5INCA

Crystal structure of hla-b5801, a protective hla allele for hiv-1 infection
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-58 alpha chain
publication title Crystal structure of HLA-B*5801, a protective HLA allele for HIV-1 infection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5incA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5incA01
1AXTL 4KXZH 5CJ8A 3MX0A 3BP7A 3L6FB 4J8RA 3RHWK 2IQ9L 1NANH 4PJ7E 1M05B 3ARTA 3KPQB 1QRNB 3C60B 3DUUA 1FBIH 4PJDB 2FCBA 1RHHB 1BQHA 1DR9A 4JFYA 3VFMA 4XCCH 4MAUL 4WFHD 3QB7C 4W6XB 4D0DB 4U3CA 1IMHC 2E9IA 4QRPB 3W11C 4KKCD 2OXGA 3MOBL 3T3MF 1KGCD 1DLHA 3M45A 4FZ8L 3AS0A 3VWKD 3RZCB 1UH2A 1A47A 1PVHA 3E6FB 4QXUL 3CLFL 4HXAH 3JTSA 3HZMB 1UKSA 4OZIE 4LLYA 3H9SA 4I48B 3C6LD 1JF6A 1WT5A 2OMBA 1IZKA 4CVZB 2N1KA 5ABDE 3C5ZB 1JMZA 4Z6AT 5EO9A 5AZ2L 2BNRA 3NOIA 2YD6A 4OF0A 2CRMA 1UACH 4PFEA 2X7LB 3O6KL 1OF2B 4RFOL 1UC6A 2BVPA 4L8SC 1NGQL 4Z0XA 1F58H 4QXGH 3GSUB 3HN3A 2HVKB 3S88H 4YEEA 2CD0A 3UPAA 1SMOA 3W11D 4N68A 4MD0B 4GRWB 4PR5B 5HXMA 4I18A 3AVEA 4YHPA 1ETZA 3MV11 5L2KA 1U58A 2ZJSL 1FCGA 3SY0B 2QHRH 3MRDB 2NX5B 3E3QC 4D0CA 3V8OA 4BKLA 4KJYA 2I07B 3CZFA 4X5XA 3RDTD 2OI9C 3MZTA 5DJZA 3G9AB 5GISL 5FA3B 3GMQB 3LB6C 1JTPA 4OZGA 4J2XA 4I77H 4IIQB 3PNWA 4LAJH 3BKMH 4XCNB 3L5WA 5KVFH 2EE2A 5DJAB 2EH7H 2XTJB 4LU5L 5LCVH 1GJIA 3ARBC 3T65B 3U46B 4C56B 4G6ML 2VDQH 3K1DA 3RL2B 3O6MH 5INDB 5D72H 4MSWA 5E5UB 4D3CH 2VZVA 4KVCL 5CJBA 4YR6A 4F9PA 4XAKD 3QXUA 2V17H 4DCQB 3C87A 2AERT 2P8MA 3LQAH 4OJFL 5SV4A 3TF7C 3C09B 4JKMA 5IHBA 1QSFB 1CL7L 1OGAA 1TCRA 4HFWB 1ORQB 4XCYA 4TUOA 5GGSA 3LB6D 12E8H 1FZJB 4QHUA 4QXTB 5CEZH 1XR9A 3RJDA 5L0QC 3IDGA 4YBLC 1VADA 3HRZB 3EYSH 4R0LA 5C0DA 1U3HD 2H2SC 2CXKA 2GT9B 4FQPA 3QDAA 1D5ZA 3ARBD 2BY2A 4K94H 3UTTB 3MC0A 3PHOA 2GHWB 1BVKB 4AENA 3ULUC 1XCTB 1T3FA 1FORH 2IADA 3EDKA 4ZDHA 1FO0B 3HUJA 1MEXH 4HUUA 5F3HA 1C16A 1OQXA 5F1KC 3BFOA 4S1DC 3AC0A 4KPHH 1ZT1A 2AEPL 4V1DB 1K4CB 1TCMA 4UQ2A 4UDUA 4ZAKB 1VA9A 3OTTA 2MTPA 2XZZA 2X9WA 4XCEB 5INCB 4N9OB 1H3VA 3BEVB 4MCZA 1ZA3A 4KRPB 3ZT5A 1DUYA 2I60L 2H2SD 4ETQB 1JUFB 3VXQB 3JSSA 4JZJC 3GSNA 1WT5C 2D7NA 4HGWB 1VACA 3CD4A 4QRSA 4ZUVA 1XFPA 5DD5H 1AO7B 1BWMA 1RULH 2I26N 3KPPB 3QI9A 4KJQC 1Y6MR 1AGBB 4OSUL 4X7EC 5GRJH 5BZWA 4XH2A 2BCKB 1FN4B 4QO1A 1NEUA 3Q3GB 5KVEL 2W91A 2YUVA 4ODSL 4S1DD 4BSVA 5CP3A 3LS5H 3K4ZA 1NBQA 3T2QA 4W81A 3LN9A 3U0PB 4MGXA 3NIGE 4U1KA 1QYGH 4X7CC 4EJ1C 2YR3A 5HYSG 3S97C 3DV4A 2I9LB 1PZ5A 3GJFH 3PWPA 4RBPK 4BZYA 3H9SD 4ODBD 1EUTA 2MQ3A 4R4NC 3O6LL 2MCPL 1DQJA 1O5DT 3BHBA 4GAGH 4WGWB 1NGWB 2BNRD 4KJQD 3PXJA 1MAMH 4PJFE 2X4OB 5I8OL 3PJSA 3NFSH 4HJJL 1GGBL 4L1HA 1CFQA 2GYSA 3CK0L 2ENSA 3FB5B 1KCRL 3GKWH 4GXUM 4PRAA 4YLQT 5FDWB 3UPRA 1ZLSL 4M5ZL 3HFML 2ADJB 5HSFA 2WM0A 4QHNB 5I1JL 4OIIL 5E0QA 1U3YA 4GJTB 2OTUA 3TVMA 2W9EL 4P4KB 1ZT4B 2KBGA 1GL4B 1C12A 1SBSH 3QWOB 4EBQH 2VLKE 2X1QA 3WO4C 3NFPA 4GKZA 2MWCA 5HD8C 4H0HB 2G5BB 1YY8B 2F5AL 3JZ7A 1UB6B 5I1IL 4LQFH 5GRUH 1W72B 3N85L 1N0XL 3IETB 1QUNA 4G9DA 2P47B 2KKQA 3OX8B 4R4ND 3NIFE 5IB5B 4NWUH 2ZCKL 2IBGA 4PJCF 2X4TB 3CCHB 4JVWA 1NFIA 1MH5B 2V9QA 4AH2B 4DN3L 2DDQL 2GY7B 3VRIB 3FN3A 3O2DL 4KDWA 4J6RH 2NW2B 5JXEA 3VXOA 5I75B 1BD2E 4M7KL 3L9RA 3PV7A 3L3OA 5HHVH 4OAWB 3CJJA 4PJ5A 1K4DA 4PRHA 4W6WB 4OCNC 1DN2A 4K3EL 2EEDA 1G7LB 1KCKA 5HD8D 3AU1B 3QFJB 3QT2A 3IAQA 4F33A 2BVYA 2VAJA 4X6DA 4NCC1 1E0OB 4OM1H 2XT1B 3AS1A 4BQ8A 3O3BA 4JRWA 4X6EA 5EU4B 5J57B 2CIIA 2OM5A 1F3JB 3LZFL 1GOFA 2DIAA 1OGAD 4PP2B 3HZYA 1NBVH 4XPFL 4Y4HA 3UYPA 4YXHL 2M2DA 4FABL 1LGVA 3PGFL 4OGXL 1D6EA 2VE6B 2AK4A 2GTWA 4YHNA 5ISZA 1MREL 3REWB 4XPHL 3SEPA 2K1MA 5IVXB 4QHMB 3IFPA 1V3LA 2HN7A 3ZTNL 2Y1VA 3O45A 2LABA 3KJ4B 4PRIB 3IF1A 4PJEA 3NA9H 3QI9C 4NO5A 4TULH 1PQZB 4HZLA 3QISA 4XP9L 4F37K 1U8OB 2BVQA 3W0WD 5EUOE 1F5WA 3NVQA 1HQRA 5E08H 4KMTL 5DR5H 1E4KC 4XMKL 3GJEA 4JQIL 5F8QC 3V4UL 4WTZA 5H94A 4HBCH 2NW3A 4FTVD 3F58L 3CX2A 4HIJA 2H3NB 4X4XA 4Y7MA 5TQ2L 3PWLB 1I1AA 1OTUC 5C71A 5CZKA 2FATH 5AWNL 4ZUSA 1LNUA 1R3HA 2CDGB 3PGCB 4RGNE 3I50L 5BVPH 1VHPA 1WZ1L 4PP1C 4XP5L 3UMTA 3KYNB 1OQOA 1OT1A 2B2XH 3ZDYE 3PG2A 3UTQB 4EI5B 4XNXH 1JZ5A 1FNEA 4G8GE 4PJBA 3R4DA 1GC1L 2DN7A 4YHYB 5IFJB 4X4MA 5CHNA 1BQLH 3ZE2F 2DQTH 3QI9D 1WCQA 3F7YA 2P44B 2YK1H 4JR9H 4PJXF 1RSFA 1CGUA 3VXUD 2BDNL 4ONHB 2XQYG 2QHLA 1UYWH 1EHNA 4FQ2H 3DSFH 3QDGE 4WFGE 4JRXD 4OFIA 4PJGA 1QBLH 1R3KA 1H3TA 2I5YH 2ZCLH 1S7TB 4Y4FD 5F1IB 2ATPA 4HX1B 2PUQT 5DS8A 1DZBA 3O8XB 1MHCB 1T2QH 2GITA 1VGEL 2MHAB 1Z2KA 1XF4B 1OTUD 3SKJL 3WJLA 1JNLH 3JUYA 2DD8L 2R69L 4NOBA 1QLEL 3MRFA 4M1DH 3D39E 2VAAB 4WI7A 3BW9B 5E6IA 5GGQL 3N9GL 1N3NB 2CLZB 2X4RA 4KY1H 5TH2A 4RA3A 4PP1D 4TVPL 3PWUB 2HJFB 1FFQA 3E1F1 1T1XB 3K2UL 3Q6GL 5HYJA 3SPVA 1F3DH 4Y19A 3QNYB 1OARH 4CADA 5HDBF 3ARYA 1J1PH 3BMVA 4RIRA 5D5MA 3MUY1 2QLVB 1G7IB 3REVA 3QEQD 5ACLA 1JZ3A 1P4BH 2ESVE 1FFOB 1MFNA 5KTEL 4LCWE 4YWGH 1LHZA 3NCJL 4KVNH 2C3WA 4Y0GA 3HB3C 1KJ3L 4F7EA 3DLQR 5E8PA 1R5VB 3ARDA 4NFDA 3F6LA 3QYCA 3QIUC 3GB7A 3TM6A 2E7LE 2ZKHH 3EKCA 3OPZL 2X70B 1LO4H 2QKIB 1U91B 4JGJA 4JZOA 3IDYB 4LHUD 5E8DL 4AL8H 3CZJA 5BS0B 1EO5A 2VB5A 5K59E 1JGDB 4M7ZC 4ERSH 5C7XL 4WIQA 3E0GA 3C8HA 4OLWH 5HVWA 1ZSDB 2C3GA 5GPRA 2D03H 3WXWL 3LVEA 4ZS7H 4HKXB 1J12A 2WP3O 4Y4HC 4F7PB 2NNAA 4F7TB 1RU9L 3UO1L 4S10A 3MRJA 1NUGA 1R5WA 3G5YB 2X4PA 3GO1L 4WI4A 1U8NA 3EZJB 4JFZH 1REIA 2RHEA 4NQXB 3PV6A 1JZ6A 3BZFB 1HDMA 3GSQA 3HAEB 3HB3D 4GG8A 4LRNL 1SJHB 1YYML 2C3VB 3ZKNC 1KSRA 3QIUD 4XCFH 4NQEA 1I3UA 4GRWE 2XXCB 3P4LA 1ND0B 4GG6B 4KQ4H 5EFIB 2VIRB 4LCCB 3B3IA 4KQ3L 3RPKA 5DZLA 4XZUB 1IC5L 5LXGH 1XIWA 5DURD 2DJUA 1I1AC 1UM6H 3EAKA 5F96H 3GI9L 5ALBH 1RZFH 4LLDB 2O26U 2AK4D 1MCWM 2JIXA 2QSCH 4OLUH 4MNGB 1DP0A 2PO6A 3H7BA 5BRZA 3H42L 5CZVL 1EAJA 1JYXA 5TJWK 3RWDA 2OZ4L 5MEQB 3FHAA 2BNQB 2GJZA 4QOKA 1V5JA 2Q8AL 4FQHB 3UJIL 3S35X 3UTSE 1DBKL 4CMHC 4LDOB 5DJ6A 4OLXH 2WY3A 4IRZL 3ARVA 3ZKND 2IANB 5CIPH 5EOQL 5L8JB 4WWKB 2D7TH 3QZWA 4JFDA 5CJOH 1OAQH 3RGVB 4YDIL 4K7PX 5IK3B 5D1QB 1WAAA 3RHWF 2AABH 2FJHA 2WLYA 3CFJA 1LO2H 2J6EL 4HLJA 3DYOA 3FQUB 3WIHH 2BFVL 3MFFA 4ZPTA 2YA1A 5DF0A 1DDHB 1KUMA 2R0ZH 1I1AD 4PB0L 3WJLC 2IMMA 4G5ZL 2IBZX 1T2JA 2B4CC 1FC2D 2WINB 4IMLA 5E6IC 3T1WA 1RUKL 4R96B 43C9A 1T1ZB 1S9YA 2OL3B 2V5MA 4BA8A 5J11B 2A77L 4PLKC 2DOCA 5F88A 3QULB 4PLNC 3FFCA 4ZQKA 5DVMA 4Y4KA 3S37L 2VSCA 1FG9C 5IT2H 4HIIA 4NUJA 3EW3B 5DJCA 3RA7H 3W39A 2C9AA 3UTTE 3MRBA 4DKFL 3WKML 1MLBA 3KG5A 5EWIH 1RFDH 4UTBH 3WS6A 4JQXA 4PV8A 1NKOA 5CILH 3DX7B 3RJQB 3EGSA 2AEQL 2HRPL 1HILB 3VFVA 1P5VA 4Z7UA 3SDDB 2W59A 1ZGLB 4JJHA 5C8JB 3TT3H 1YMHA 5GS3A 3IRZA 4WU5B 3MBEB 1JNHB 5E6ID 3KPNA 3QXTA 3IAPA 1DFBH 4UBDC 3BZEA 1ZT7B 5IROC 3EFDL 3RPIB 1NBYA 1WISA 3RWEA 5ECJE 1DTUA 1J86A 1R24B 5KOVC 4M00A 5HYJD 4W6YB 4ELKB 4LSDA 3QQ4B 3FO9B 4BZ2L 5T5FH 5MEOB 3ARWA 5IMOA 1BQHG 5C92A 1BBJA 1CFTA 3DMMB 1AO7E 3BUYB 3TPKA 2D4DA 1FP5A 3T0XA 4GMTL 3MRQB 1UEYA 3IU3B 3QIBB 4K9EC 4LAQH 4P49A 3MMEA 2EDOA 4L4VE 5C0EB 2K7QA 2FX7L 3ES6B 5ESVA 5KOMC 5TDPA 1IEBA 5MI0B 1YNKL 3QXWA 4HS8H 2DL9A 2F58L 3B6SA 3WEXA 2AK1L 3VRJB 4IDJH 5C07E 4XAWL 1KCLA 4UBDD 2EO9A 5I9QB 4LP4A 2YPLA 5C0CE 1I7UB 1FFNB 3WS3A 2CUIA 2OR9H 1QBBA 2FHCA 4DFHA 1XIWC 4PJXB 1U42A 5EC1B 1ZA6A 4DEPC 4YQXL 3DVIA 5IB4A 5FYLE 4YO0A 4M6MH 3UTPE 1CLOH 4WEMB 4UT9H 4MYWB 2O5ZH 3TNMB 3MRCA 2ITCB 4P59L 4Z5RB 1Q0YH 4DGIL 4TSBL 4BQ9A 3MCLH 5EOCH 5GRWA 1KEML 3OKOB 3MRIB 5JHDE 3IDNA 3E6HB 5GHWH 2VABB 1X7QB 3NMEA 4R90L 2XYCA 4HIEB 5SWSA 3MLPA 2DICA 2V2XA 4BZ1L 3WL9B 3W9EA 3LKPA 2GK2A 4GKSA 1NMCC 1NH6A 4PGDA 1CDHA 2IPTH 5HGAB 4HUWB 4MJIE 5D7IB 5F9JA 3NACH 3ULVD 5ANMA 2XQBL 1K8IB 3Q5YA 4FQXC 5L9DH 2PW2A 2FLRT 4ZTPH 3TFKA 1L9MA 1A0QH 3PQYB 3TYFB 3KR3L 4U6HA 5J6GB 1VFUA 4LBEB 5E99H 4QRRA 1XIWD 3OKNB 5K33A 3ARGA 1QZ1A 3ZHLA 2X09A 2ENYA 3BIKA 5I1LA 3R1GL 4YPJA 1L9NA 1CN4A 3FT2B 2EDBA 1GHFL 1S7QA 4UT7H 2IBBA 4LVOC 1U95A 4D9QE 2ZSVB 2VKXA 3MXWL 3V6OE 4QF1A 3EYFA 4E0RA 3ARZA 2RJMA 2XA8H 1XGRB 1OSPH 4QOKD 2WBJA 1S78C 1I8KB 1MJUL 3SO5A 3MPCA 4MA3A 3U9PH 2YWYA 2BP3A 1KCGC 1CVSC 4FNLL 5EZOL 5IBTH 4JFDD 1XF3A 3WS6C 4Y5VB 4Z7VB 1BZ9B 4FQXD 5CD3B 3QCUL 1I1RA 1P7QD 3GSOB 2UWEA 5DMYA 4GAJL 1R3LB 2FWOB 3LMJL 4QRUB 5HTSA 2F74B 3S36X 4JG0H 4Z7QE 3SKNB 3FB8B 2V9TA 1I9JL 2IFFH 4OQTA 3FN0L 1ZANH 3U83A 3IDJA 3I6GA 4LEXH 2V2TB 5MENA 3E2HB 2HLFC 2EO1A 5DQJA 4Z78B 4N0CD 4X5WB 4GAFB 2GCYB 5HGGS 5DTFB 4JO4H 3P77B 4UDTA 1DBAH 5IVXE 1V3JA 2JF1A 4ZO9A 3GM8A 5FO7B 1YQVL 1SVZA 3WFDH 4HUXA 1T5XB 1LDSA 4PRIE 4Q97A 1WZLA 3UEZA 4XPBL 2MSPA 4BH7A 3ROLB 1DVFA 4D3CL 3VXSA 3MJ8A 4K3GA 1UFUA 3KAAA 2ADIA 4PRPA 2X1OA 4YDLB 4P99A 3INUL 3KYMB 3STZB 1MRCL 4U31A 2NXZB 3T4AA 3DXAD 3ZE1E 4MJ5A 4EZMA 12E8L 3UDWA 2XWJB 4JM2C 3OR6B 4NKMA 3D0LA 5DJYA 3VD4A 1P5UA 4NZTH 3VE0A 3CDCA 3L1OH 4IRJC 3TO4A 4RAUA 1A02N 2PYEB 3UJJH 1IEHA 4U1SA 1MSPA 4K94L 3QUKB 4AEIL 4KWUA 2ITDB 4KK9C 3MO1A 2FO4A 2P45B 1S7XA 3LN5A 4XWGH 1FORL 4OKVA 3UPCA 1MCHA 1PFCA 5DK2B 4CU6A 3VXPB 1YDPB 1FNLA 1U8JB 3U7WH 4JCMA 4GW5A 2WSKA 4L29A 4M48H 4Y1AB 5HHMB 5JA8B 1I3RB 1MI5B 4K9EH 43CAB 2XWBB 3VD5A 3WUWB 4E41B 4WDIB 1J0ZA 4U33A 1A6WH 3I84A 3IGAA 4JM2D 4U6VH 5I16A 1P4LA 4HPOH 3ULVH 1KBGL 5CMAB 4A6YB 3TFKC 5HGHA 4ORGA 4ZUWB 2BMKA 2YPLD 3QPXL 4B0MM 1KTLA 3MLXH 2J88H 4IRJD 8CGTA 2R8SH 1FZKA 2BVOB 4M61A 3ARGC 4MA1C 4KK9D 4M03A 3A6CL 5DD5L 1RULL 4ZYKB 1AJ7L 4X9GA 1MF2L 1NBZB 5K9OB 3FOMB 4PV9B 5J9PB 5CSBA 1X5ZA 1LO3H 3MNWA 4G7VL 1GGYA 4Z9KB 1DBBL 4L4TE 1GZQA 5F6HI 4JFOA 5LJYH 3QH3B 4OZIA 3V6ZB 3S96A 5T1KB 4M62H 5GS1A 4P4RB 3KPRE 2HJKB 3C5SB 5TE4H 5GGTL 1HI6A 3N1PC 1AHWC 2H41A 3TZVB 3TA3B 3CH1B 5T3XL 5JMOC 2FJGA 4GXVH 4HH8A 5AG9A 8FABB 4C59B 4JKPH 4P9HH 5D93B 5I17A 2FEDC 4RZCB 3TFKD 1L7TL 4DW2H 4WTXA 1A3RL 1BJ8A 5B3NA 1XH3A 1AR1C 1MFAL 4TNWK 4F37F 3UJTL 3GMLA 1QD0A 3PHQB 1I75A 1TQCC 4OLEA 3BKYH 3BRFA 1ED3B 1LEKA 1A6ZA 1U36A 5D2LB 2GJ6E 3VI4E 4HUMB 4PGJA 2Q6WA 5J1TC 2JCCE 3L7FA 4J3UA 5DLMH 2QSTA 1BZ7B 1CE1H 4PBVC 1QFPA 3U6RA 3IFNH 4HQQL 3WSQH 1FYTB 2O5YH 4RFEB 4DAGH 5F6IC 4DZBA 3P40A 4LMQI 1NMAL 4UIKH 3QDHA 1MHHB 3Q1SL 1DBJH 4GSDH 3U9UA 4PJ8B 2FEDD 5EUKB 2VDLH 3B2VL 5CJQL 4Z7WA 2MQCA 1AR1D 1T21B 2LFGA 4GG6E 4RX4A 2NXYB 5C0GB 3BGMA 3FB7B 4X6CE 3T77B 3B9KB 1QSZA 1QVOA 2QSQA 2HAZA 2B1HL 1CBVL 1I1FA 1EX0A 1CFNB 3QDMD 3T8XB 2E6PA 3VGAC 4K07A 4J6RL 3QEUB 4KUZH 4MNGE 1AH1A 1KYOK 5HHVL 2DQFA 1CGSH 1UCBL 4B50A 1BEYL 4Y2DA 5H2BB 1R0AL 4R2GB 5KSBA 5IKCB 4P46A 5JIHA 3RNKA 4WTZG 1CE6A 2DYPB 5C08B 3A6OA 3VXSD 3ULSB 1OL0A 3VRLE 4G6FD 3K4DA 3I02B 1Q8MA 3KPMA 4OD1L 5C09A 4HH9B 4WI9A 5HHNB 3HE6A 2P48B 3RWHA 3CDGB 2W07A 1UM5H 3O4LE 4F7CA 4NYLA 3KNBA 5SWZB 3S5LB 1P53A 1R3IH 5CUSL 4JRYE 5FO8B 5DMIH 2J5LB 3MLUL 3L3DA 1IARB 3BRDA 2IPKA 5D1XC 2N4IA 5JW4M 4LSUH 1IKFH 1C7SA 4RGOH 2EDJA 1EHXA 4POYA 4AIZA 3QNZA 3CUPB 4LKXA 4EOWH 3C2SA 3TV3L 3ULUL 4DQOH 4C83B 1YEEL 3WE6B 2JB5H 2VERN 2PKDA 3HC0A 5ILTH 4FXGB 1W0YT 4OD3L 1SYSB 2ZCHH 1LD9A 5FGCB 1Z9LA 1XGQB 3VFNB 1S7VA 4FQCL 2XNAA 5E8EB 3P9MB 1ZHBB 4HUKB 1JGEA 1NFDF 3V0AC 1AXIB 4MQ7B 1G7HB 3DVFA 1U8LA 3SKOA 2VDMH 4QTIH 2QR0A 4JFEE 5I1HH 1RV6X 2ZOLA 5GJSH 1OM3H 3JWNC 3NCYS 3QUMH 3GHBH 3BIAX 3ARUA 3BEWB 3HC3H 3IFOB 3EJJX 3MLYL 5D1XD 1KENL 1JWMA 4CW1A 5TDNA 3LEYL 3OXRA 1MQKH 3PIQA 4U7SA 1HOCB 5EC2A 3RVUD 5GRXG 2F53E 4EDWL 5E5MA 5I1CH 4KZDH 2OR7A 2NY2C 4KV5F 2O61A 4ISVB 3QXVA 3WXVH 2ZCLL 2ADGA 4L9LC 5AD0A 3ARSA 2P5ED 5F7WC 4PLJC 3I75B 4HGKC 4TSCL 4OCXL 3LEXB 2HTLC 1ZKAA 4TN9A 5E8NA 3O4OB 2VISA 3S35H 3HI5L 3O2VL 4K23L 1NAKL 1PYWA 4PJFA 4E42B 4RDQG 4KC3B 3RTQC 1H9VA 2ICEA 3VXMD 1S7WB 4EKXA 4U2ZA 4EXPX 1ZXQA 2E3VA 4W4OA 3ZE1F 4CJ0A 2L4OA 4K7PH 1T20A 3QJFB 3G5XB 4OF8A 1RY7B 4NJAH 2WQRA 2YXMA 2ZOKA 4U1MB 4KJPC 4RNRA 2XZCH 5EU6E 4ETYA 3I3DA 4ZD3H 1G7QB 2UVEA 4PUBL 3MUZ1 2NY2D 2CKBA 2P5WD 4YPGA 2EYTA 3AAZA 1Q38A 2DBLL 3QFDB 3NCFB 3C6LB 4XC3H 4MAYA 3GBLA 1SEBB 2FB4H 2NY1D 4ODXB 5C2BH 2HTLD 2IALA 2X4SB 1KPRB 2XG4A 5HHOE 1I3VA 32C2A 4P46C 5FB8A 2YZ8A 5JXAH 4O2CB 3KXFE 1PX4A 4E5XB 1A3LH 3CLEL 4O2FB 2AJXH 3MV9E 4AIXA 3RTQD 5EBWA 3L5IA 3N1FC 4AL8L 2DJSA 3WNOA 3ZKXB 5I1GL 1BD2A 4DZ8A 1U8IA 1CXEA 4S0TD 3TPUB 5A2IH 4OLWL 1TPXC 5IMMA 4LSRH 3LAFA 1S9XB 4L8BB 3HE6C 4KJPD 1UB5A 1YEFH 4N9GA 1UM4H 4NHCL 4X80H 4YX2L 4MVBC 4G8EA 4XWOC 3P3YA 1S7RA 3G9VA 1F2QA 5JHLH 3T0EB 3GJFB 5BZDB 5I30H 2VR9A 5FM4A 4ZO6A 3MUGA 4NM8H 4JN1H 3VMPA 4GMSL 4HC1H 5EBLA 1T0MA 3QZWG 5GZOC 2LU3A 3KDMA 3FMGL 4JQVC 5TDOA 3RDTB 1YECL 3JBG7 5DRNA 4WO4C 4K71C 4HKZB 4I0KA 4X7SH 3TBSB 1JPFA 1RZ7L 4ZFFB 5IIEA 1CIDA 4FQQA 5ICXA 3N1MC 1NGYA 3B43A 4J3WA 4O2EB 4TUKL 3D3VE 3CMOH 4X9IA 1UWGH 4OZHF 2VLRD 2V2WB 2DM2A 1F11A 4JFFB 4I3SL 3TBTA 4P5KA 5GGVL 3SKMB 5F9AC 4L8SB 5LXGL 1CG9A 5C09D 4BJLA 3EOAB 3HE6D 2A6KA 3BN3B 1H8SA 5HPOA 3VJ6B 4L8DB 1HH6A 4MVBD 2Y6SC 5JORA 4TSAL 3MRGB 1EEZB 4XWOD 4OLVL 3HC4H 4YDKL 3DECA 4XPTL 5BJTA 2X10A 1C08B 4TPRH 3FT4A 4K7PY 5A2FA 1MHEA 3GSNL 1N4XH 3G6AA 4U0RC 4HF5H 1ZLUH 4Y5XC 5DJ2A 2KPNA 4ZSOA 3BD4A 2DIBA 4WO4D 5DVKA 4S0SD 5DDHB 1JFQH 2C4FU 5KBNC 2IBZY 4Q2ZB 3IFLL 3UTOA 1VFBA 3TH3T 1U3HB 4GBXA 2Z35A 5IGXL 1FNSL 1UJ3A 4ZUUA 3PWJA 1RJZA 3O0RL 4N8CH 3H2WA 5DJDB 3WIHL 4CDGC 3D6GA 3NN8B 5EU7C 2XQYK 5KSAB 4HLZH 3TP4A 3MRNB 3B5HA 1EK3A 4YHIB 2Y6SD 1VENA 1UENA 4S1RH 2D9CA 2E6JA 1JGUH 3MOQA 4DK3A 2VO5A 5KVDL 5TGBB 4XVTL 3OKMB 3MUJA 4GLRI 4JVUA 3WMSA 3QO0A 4LEOB 4BK5A 2Z8RA 3MGAA 5J3HC 3FT3B 4WJ5A 3HA0A 4P2QB 3P11H 4H1LA 3SO3C 2YN5A 3D69A 1TZGL 3VFRB 1RFDL 2G2RB 3D39A 1TJIL 3BP5A 4OUUB 1VSCA 1KPVA 3ILPA 4P48A 4YC2C 5HYQA 3D0VB 1YQ2A 2NY7H 2CDFA 4FFZH 2R9HC 1BBDH 5HHME 3P0VL 4I5BA 3WUZA 1MCPL 3NPSC 3PF2A 5DUBB 3L6FA 3QEHB 3F8UB 2MPAL 5CCKH 3NIDF 4LQ1A 5AZEH 3KPQA 1G6RH 4DGYH 3C60A 4KI5C 5TFSH 3OQ3B 4PJAE 4PJDA 4X7TB 3MV8D 5J3HD 4D0DA 1MRDH 3U30B 4X83A 4QRPA 3S36H 2B1AH 2V5YA 2E7LA 4KDTA 9CGTA 1MJ7H 3STLB 3H3PH 1T7XA 4OFKA 4KRMB 2YPVH 3RZCA 5GS0D 1U93A 2F54D 1DL7H 3E6FA 4GH7B 1CGXA 3HZMA 1NFDB 2VITB 3L3IA 5HHQB 1T83A 1XGYH 4LASH 3ZHKA 3T3PE 4CVZA 3C5ZA 4NM4H 1YMMB 5E2UH 5FM5M 4U1GB 1H8OA 5D1ZA 5FYJL 1QP1A 4GRMA 4KI5D 4FMFA 5I1KH 2X7LA 1OF2A 2JJUA 1GVIA 3DUSB 3WFZA 1IM9D 4NZDA 4KKLC 3GSUA 1F4WL 4POUB 2HVKA 4BK4A 1FL6B 1TQBC 2LAGB 2QADB 4JO2L 2JJSA 5M7QA 2HMIC 1PDKA 4QLRA 4OIAA 3QHTC 1J8HE 2IQAA 1F4YL 1IFHL 1LO0L 5D2LE 5DD6B 1YNLH 3SY0A 3RWJB 1CF8L 4RWYL 5ETUB 3MODL 2NX5A 5MHSE 1T4KB 4XRCB 1ITCA 2I07A 4MB3A 4XNUH 1UEMA 3CXHJ 4WHTA 1YEKH 1MNUL 5FA3A 5D2NE 4YIQB 4NRXB 3MLZH 3SDXE 2ADFH 3VGHA 4GBXC 4LPTA 4F3FB 1RIVL 1IBGL 5IMLB 2AJVL 5FV2A 4LSTL 4IIQA 1FFRA 2OJEA 4XCNA 1CU4H 5DJAA 2OP4H 4PBWD 2Q76B 4NT6B 1CD8A 3T65A 3I3EA 3UC0L 2P8LB 1FGNL 3U46A 3BESR 5JOEA 5IMKB 5GJTL 1F2XK 2HMID 3PXHA 3QUYC 4ZXBB 3RL2A 3LQMA 5INDA 1DN0B 3JV4B 3BQUB 1FAKT 3O9WD 4NQVB 5D96C 2FHBA 1NCCL 1JGVL 1QSFA 5DZOA 2DWDB 4WU7A 1JCKA 4HFWA 1ORQA 2J7LA 1T89C 5BXFB 2P49B 4OLYH 2EIZB 1FZJA 1VB9A 2HVJB 3L5XH 2Y07H 4U1HA 4QXTA 2WP3T 5E8OB 4GBXD 2C4FT 3F7PC 1ZTXH 5DJXB 3MGTA 2AJZB 3BX7C 4L9DA 1AI1H 1RUQH 4URTB 2GT9A 5I8EA 2WQ8A 2X5PA 1HH9A 1Q1JH 4G9FE 3UTTA 1NGPH 2B4CL 3W0WB 3H3BC 1BVKA 2QBWA 1ZLVK 1P6AB 2WWMC 3QUYD 4LEXL 1JNNH 4WUKL 5DFTA 1FO0A 1FH5H 2JE8A 1Q72H 4LHJB 1HIMH 1HHJA 3SJVB 2AJSH 4JO4L 4XC1H 1Z9SA 4FTVB 3TIEB 4V1DA 3B83A 4ODHH 3CSYB 5IF0A 4IEFB 3R0MA 4OZHB 1OTTC 4OQ1A 3V95A 4ZAKA 5B38B 1RUML 2YPKB 4KDTC 2EKJA 4LPXA 5KN5A 25C8H 4NKQB 1WZKA 4NJ9L 3P9LB 3RZCC 4XCEA 3QCVL 4Z95H 5INCA 1IGJA 1BGXH 3BEVA 4JY5H 4WI8A 3WFCH 5GS0H 5I0ZA 1CR9H 4JGUA 5IEHB 4ETQA 3SE9L 4GLRH 1JUFA 4J1UA 3BISA 5EBMB 2EIBA 1T83C 5KVGH 3VFOB 5ACMA 1EHAA 2BSRB 5CIPB 3VXUB 3V79C 3C5ZC 4IDLA 2VL5B 4DUXA 1AO7A 3KPPA 1AGBA 2WWMD 3EFFB 4LIQH 4JRXB 1QRND 1WK0A 1FN4A 3GBML 2WWKO 1TMCB 4Y4FB 1DUZB 3QG7H 5AYUH 4YHZH 5F89B 2VZSA 4L4VA 3ZTJH 2DJ4A 4XPGL 5DEFA 3OHXB 3BO8A 2IWGA 1ES0B 4MB5A 1SM3L 4QRPD 6FABL 4N0UB 5B21A 3U0PA 5HHXL 1EXUB 1A7RL 4FQIL 4OCMC 4HDIA 5C07A 5F9OL 5C0CA 3DUHA 2A73B 5IOPA 3ULVF 3Q5OA 2Y5TA 2H9GB 3NPZB 2D31A 1INDL 1HYRC 1IL1B 1AD0B 3BVNB 1QA9B 5T3ZL 2IPUG 2H1PH 3C5ZD 4XMPH 1NGWA 2FIRT 4K3JL 2X4OA 4NKIL 2AQ2A 3W9DA 1MCBA 3D5OF 1A9EB 3FB5A 4AMKH 5FDWA 1IC1A 2XTJC 3VFSA 2ADJA 3JVGA 2XG5A 1MFDH 4QHNA 4WFHE 1A14L 5TF1H 1BJ1J 2APFA 3NCBB 4P2YA 3L5JA 4P4KA 1ZT4A 4MJIA 1NUNB 3QWOA 3RY5A 2G5BA 1YY8A 1KGCE 4PJ9C 3V52H 1UB6A 2A1WH 2FBJL 2BVEA 2J3SA 1W72A 1J8KA 3K4AA 3H7LA 3IETA 2NX5D 3MRKB 1N6VA 3I85A 3OX8A 3C09C 4QHLB 5IB5A 4WY7H 4JPIB 4NC0B 2X4TA 4ZTOH 3K46A 3A6BH 1JIBA 3DO3A 2X9YA 1LDPH 1MH5A 2AGJH 2JK5B 1HXYB 4AH2A 1QO3B 1CFSB 3FQRB 2HJLA 3FO2B 2ZUSA 1P2CB 1OP3K 4MDJB 2NW2A 4ZO8A 5E2VL 2XTJD 3V4PH 4PGBB 4OAWA 4GFTB 5BV7H 1AIFB 1JZ8A 3QIUB 4NQCB 4C56D 1G7LA 3B5TA 3AU1A 3MNVA 3QFJA 4ZNEE 4PJAF 4PJ9D 5EG6C 4IOIA 5GGSY 4PDCE 3PGDB 1EGJH 3QG6B 1JZ4A 2XZQL 4GKOA 4Z77B 1F90L 2VQUA 5EU4A 4Q9BA 5DLML 1CGYA 1F3JA 3WSQL 5DURB 4EIGB 1HHGB 1LEIB 1QSFD 1KJVB 2OJZH 4OT1H 4PP2A 4NQSA 4G3YH 4ZAKC 4NO3B 2HT2C 4UIKL 4LVNB 5KJRL 3GMPA 1XF5B 4LDEB 5EN2B 2VDLL 2DS4A 4KRPC 4ELME 1QFHA 4Y16D 1F6AB 3LOWA 4HWBA 3GUTA 3REWA 4G8IB 5M94B 4G59A 4WNQB 3MCKB 3WHXB 1LILA 5IVXA 1PX3A 2FYYB 4QHMA 5JW5B 5BOZG 3F5WB 4PRIA 5MP6H 5GGVY 5J1SC 5IFAH 1KLFA 2VUOA 5CEYB 1DQDH 4I9WD 4R4BA 1GGUA 4PJHE 5E7BA 2R23A 1NUFA 1WC7B 5K93A 4XAKE 1VKXB 3MLVL 5F7YC 1PG7W 4AY0A 3E3QE 2VJXA 1NKRA 4I8DA 4XBPB 2VXTH 3VDCA 4ZAKD 2H3NA 2Y7QB 2HT2D 3PWLA 1OCWL 4M4RA 4XNQB 4YGVA 3QAZC 5FGBA 1FAIL 4YHLL 2VXUH 2VUYA 1HHIB 2CDGA 3PGCA 2VZTA 4OD2A 2C3HA 5CWSB 4L3CB 2XFXB 3KYNA 4XP1H 1RK1A 1N64L 4KI1A 5B8CB 3UTQA 3VGBA 1UWXK 2Y25A 2YBRB 1G9MC 3RQ3A 4EI5A 1UH3A 1UM5L 1DBMH 2Z4QB 5IFJA 1FZMB 3I2CH 4X98B 4ODTH 4G6JL 5JO5B 3ISWA 1BVLB 3IU4H 4ONHA 1BHGA 1IGCH 4L5FH 3TYGL 4OFDA 3G6JE 1H3PL 1QKZH 4G6KL 2FDBP 5EU3B 1YNTB 5F1NB 4WFFD 1IKFL 1S7TA 4P9MH 3JVGC 5FYKD 5F1IA 4HX1A 3HMXA 3O8XA 1MHCA 4FQ1H 5SX5H 1FGVL 4P4KC 1TTUA 1XF4A 2R1WB 5CP7B 3O6FB 4JPWL 1ZEAH 1XAUA 2AJUH 1INEH 2BERA 5DI8A 2VAAA 3BW9A 2ZCHL 1A22B 3RFZC 4LNRB 3CXDL 4XBGB 4Z7NF 1BP3B 5CGTA 3PWUA 4F57L 4LCIL 1T1XA 3EYVB 1FDLL 1URLA 3EZ8A 4LPCA 4M9OA 4TQEH 4D9LL 2VSDA 3QNYA 1ZLWH 3ULUE 3QUML 4KHXH 4TRPL 5CZXC 1KCVH 1V7NL 1G7IA 1KIRB 1UJTA 1UWEH 2EDNA 5I75C 3ARFC 4BH8B 1FFOA 1G1CA 3H0TB 3MTRA 1I7TB 3BYTA 2HG5B 5BQ7B 2D7OA 4PGCB 3GHEH 4P4KD 2XXMB 3RKDC 3QJHA 1SY6H 1R5VA 1K5NB 1U8HB 1WBYB 5ESAB 4GO6B 3BKJH 4C58B 3BZ4A 4WV1C 1MIEL 2QKIA 1U91A 5IBLC 4MQTB 4LSQH 4BFEA 1L7IL 5BS0A 1HINH 1JGDA 3H9SE 3KHQA 4HWZB 2FGZA 4UTAH 2OR8A 4JAMA 3RY4A 1ZSDA 5C0BB 4YK4C 4UINH 5J1AA 4HKXA 1EZVX 1KXVC 3MRLB 4F7TA 4F7PA 1XMWA 2BNRE 1F13A 1NLBL 5CZXD 7FABL 4RFNC 1RURH 3G5YA 1C5CL 1X4YA 2AXGA 5KW9H 3ARFD 4OCRL 2WBWB 3QHFH 1YEDB 2BVUA 1A1OA 4NJAL 2R4SH 2NY6B 1A6AB 4NQXA 1MAJA 2XZCL 3HAEA 1N5YL 3RKDD 4OQTL 1SJHA 2C3VA 2CK0H 1FVCB 7CGTA 2OTWA 1PD6A 4GRLA 2X89A 3F62A 4K3DH 5IBLD 4P0DA 1ND0A 4GG6A 5EFIA 1KIUA 2VIRA 4LCCA 4DEPB 2DQEH 1R6VA 4FFEX 4XZUA 3U36B 4LPVA 1KLUA 4HPYH 5JXAL 1AFVL 1S8DB 2ICWB 4PYGA 2CR3A 2F8VA 3D48R 2VWEC 5FGBC 4ZFOA 5ITBH 4ESKA 2B8OT 4MNGA 5IR1A 2A9ML 3VXRD 1P6FA 4OGAC 3IAGC 1D7FA 3DVNB 5MEQA 1Y18A 4EI5C 1CXKA 4U4BA 5F7KC 1ZLWK 4FQHA 4X80L 4YHYC 1JWSB 3HS0B 1F02I 3SGJC 1M7XA 2HKFH 4X9HA 3BT2L 1I3GL 1MJ8H 5IHUH 5FYKU 2IANA 4FQXB 4HKJB 4WWKA 1P7QB 4YXKL 2EXYC 4OTXL 3RGVA 5FUCC 5IK3A 5IV2B 5D1QA 3MA9L 1BFVL 4LPUA 2XWTA 4KH2A 5ENWA 2DM3A 3GMOB 5DSCB 5FYKH 2FD6H 3O8XC 2Z31B 2PNDA 1V8HA 3FQUA 1OGAE 1E4WL 4J3SA 1JF5A 3M8OL 1DDHA 3GRWA 1L0XA 1A7NL 1CXLA 4PRDB 4YUEL 3B9AA 2LE9A 3LRHA 3M1BB 4LVOB 2WINA 2YN3A 1ZVYA 2DQIL 4R96A 1T1ZA 5E24E 3WN5B 2OL3A 2FSEA 4X0KB 1IAII 3V5HB 1OAXL 1IT9L 1A1NB 4EI5D 2IGFL 1G9MH 4LL9A 2AJYL 3U4EB 4NDMB 4OF5A 1HSAB 1CXHA 4RAVB 4OV6F 1WSST 1Z5LB 1NSNH 4R4FL 4AM0B 5T33H 3VFWB 2EXYD 3HUJE 5IW6B 2UZIL 3HE7D 3DX7A 1CFVH 1I9IH 2ZUYA 4AEEA 3VU2A 3DXAB 3O8XD 5GRVL 1HILA 2YRPA 4FTVE 1ZGLA 3SOBL 5C8JA 3EHBC 1K2DB 1V7ML 5LAXB 1G6VK 4U1IB 1OAUL 4WU5A 3BDBA 3MBEA 3VI3E 3PWVB 3IDYC 1BX2A 5HPMB 1JPGB 1ZT7A 3RPIA 1R24A 5C70A 2WV3A 2V5RA 3QQ4A 3FO9A 5MEOA 4IMKA 1AGFB 4S1RL 1OPGH 1JHLH 3VXUE 3CPLB 4DOHB 3JXAA 3DMMA 4CN6A 4LLWB 3BUYA 3TO2B 4EN3B 4QRTB 4N0RA 3MRQA 3IU3A 3QIBA 4P5TA 2XI9A 4HCRH 5IP4A 1H5BB 1KCUH 5C0EA 4HXBH 1MY5A 4I3RL 3VA2C 1JWUA 3ES6A 4JFPB 3MQIA 1H15B 3EHBD 2CO7B 3LPWA 3W2DL 1EJOL 2HFFA 4IHOA 1N7ML 3HG1B 5DK3A 2X4UB 2HFEB 2RFXB 5BS0D 3T04D 5D70H 5DVOA 1I7UA 1FFNA 2NR6C 3GKZA 4HSQA 2CGRL 4N8VG 3CVHH 1QLFB 3LEVL 4NQTA 1EVTC 3QNXA 3TNMA 1QPPA 1NCWH 3QBTB 2ITCA 1GIGH 4XXDB 5AZEL 4Z5RA 5C2UB 4NN5B 3QEQE 3OKOA 3MRIA 3PDOA 2AV7B 1JHTB 3QA3B 3E6HA 2VABA 1X7QA 4JZNB 2GI7A 3CAFA 1IE5A 5JQ6H 4TUJB 3MRHA 4HIEA 3GBNH 3WL9A 4WI2A 3TN0A 4IRSC 2JJTA 3CFDB 3T0VA 5HY9B 4K2UH 4XPAH 1JNJA 5I15H 3MV9A 1U3JA 3EYUL 1C5DB 4HUWA 4H25B 4WWKC 1MLCB 1NCBL 2YD4A 5D7IA 2YPVL 4KJWC 4ZUTB 4KMQA 1K8IA 4F15B 1NMBH 4FP8L 5D1QC 4MS8A 1E4XH 5HDLA 4F9LA 5I1DB 3OKLB 2BRRL 3PQYA 1A7BA 3TYFA 3UZEA 2NR6D 1QHOA 5GS2H 2HKHL 2CIKB 4LBEA 2DAVA 4JHBA 3OKNA 5E2UL 4PS4H 2V5TA 4JHZA 4LNVA 4JDVB 2VH5H 4JKLA 3LHPL 2ZSVA 4OBSA 3TT1L 3DJ9A 1HZHL 2VDKH 2YRLA 5J11C 2GFBB 2BNQD 1EO8L 2E27L 2YKLL 4PJ5E 4AEHH 1EBPA 1I8KA 4HK3N 3DI2B 1RHFA 2DWEB 4IRSD 4K55A 3HZVB 3BUTA 1OSZB 4WWKD 4KJWD 4OI9A 2R15A 4Y5VA 1A6VH 4Z7VA 1BZ9A 5AYQA 5CD3A 5D1QD 5FYJE 1EO7A 2GY5A 1EIBA 1SEQL 3GSOA 1D6VL 3L5HA 4OI7A 3IS0X 3CC5A 5CLWA 4X7FC 4GQ9H 1AC6A 1AQKL 1CTNA 4QRUA 2FWOA 2HH0H 2DM4A 2JJWA 3MOAH 3SDDC 3E8UL 1U8KB 4DTGH 3QO1A 1EDQA 2F74A 3LSOA 1B0WA 4MWFB 3FB8A 4YZFE 1WZMA 4ONOA 3MBEC 2W0FB 1MPAL 2AK4E 4JM4L 5FECB 3A67H 4FQLH 5ISZE 2V2TA 2F9BT 3AFLA 3L3KA 3E2HA 5JPNB 2YOCA 4X5WA 3MNZB 1F4HA 1XGUB 2GCYA 3VA6A 5DTFA 4I0PA 1MWAH 3P77A 2H6PA 3F7QA 4IMKC 2ID5A 4PJEE 3FN9A 5FO7A 3VMNA 1T5XA 4JDTH 1CI5A 3DMMC 2IEPA 4HMDA 5GSVA 5JOFB 3EO9L 4R7DB 2NPLX 1ACYH 2VXQH 3ZMRA 1G0YR 3D25B 1YEJL 2K3TA 3FQXB 1QFUL 4WCYL 2W9LA 3H3KA 1A7PL 3QIBC 5K9JL 5DYOB 1YN7B 1BM3L 4Q6IB 1KJMB 1TNMA 2MKLC 3KYMA 5IQ9B 3STZA 4RCAA 3SDDD 4H88H 4UT6L 1X4XA 2ICCA 5MI0C 3WV0A 4Z7OE 1IM3B 5DT1H 3CVIH 3MYJB 1F4AA 2FX8L 4OCYH 1N26A 3CFKB 1AI1L 5I9QC 4M3KB 5JTWA 2QQLL 4FFYH 1L6XA 4Q9RL 3O3AA 2KZWA 4D9RD 1KN4H 2C3XA 2PYEA 3FQWB 4PJBE 4OZGF 3H6JA 3MROB 4X4ME 1NGPL 1DQLH 1IAIM 2V7HB 3QUKA 2ITDA 1PAMA 2OSLA 2XY2A 3DHJA 1GAFH 3PL6B 4JHWH 5EZJA 2Q8BL 5HGBB 1MOEA 5TE7L 3MLRH 3KYKH 1FH5L 2VLJB 3GSWB 2F19H 3HPJB 4JO3H 5DK2A 4PJGE 2NY4C 1KN2L 3MLWL 3VXPA 1A4KB 1BFTA 1U8JA 1LP9B 2W9DH 4NGHH 3QIBD 4MA8L 4Y1AA 3ZDZE 5HHMA 1JF1B 1I3RA 5L7XL 1EFXB 4JPKH 1WWBX 3NZ8B 1JFMA 1HHHB 3I9GL 1YYLL 2JJTC 3WUWA 4XTRC 4E41A 4WDIA 5CFHA 5I8KH 2J8UF 25C8L 1RIUH 2CKBL 1Q0XH 4TVSa 3F6IA 3WD5H 2VC2H 3KYAA 1Q9LB 4MS8C 5CMAA 1JPTL 1QFOA 3HI1B 3DETD 5KVGL 4KKNA 2BVOA 1OP9A 4NBYB 5HYJE 2VXSH 5HDOA 1B2WH 3FQNA 3WFHB 3BPLC 2LU7A 4ZYKA 3NH7L 1X5IA 5K9OA 2YZ1A 3FOMA 4PV9A 5D5ME 5J9PA 3AM8A 3S98A 1T6WA 2CRYA 2NY4D 1I9EA 3T2NH 4MLSA 3V6ZA 5T1KA 2AV1B 4HIXH 4XNZB 3TWCL 2OK0H 5KG9B 1RMFL 3I6KA 1KIPB 2HJKA 3RWCA 2WIIB 4XTRD 2E9WA 3UYOD 1R5IB 3TZVA 3VXMB 3CH1A 4Y5VC 3CIQA 1Q9OA 4I2XE 5KS9E 2EYRB 3AY4C 8FABA 3ZO0A 2FGWL 3ESUF 4RZCA 2Y9RT 1NGXA 1MELA 5HYEA 3PQYD 2EECA 4Q58C 1F4XL 2PCPB 2YA0A 1A9BB 3CFEB 3PHQA 3X3GL 4XMPL 1W0VB 3CFBB 1DEEA 4R9HA 1C1EH 2NY2B 1E6OL 1NCNA 1JVKA 2D0HA 3BRGC 2P5WB 1EHLH 4XVSL 2X4NB 4L9LB 4OCWL 5D2LA 5IQ7L 1KB5H 3E2HC 3I6LE 2NY1B 5F7EH 3U0TB 1K6QL 5TF1L 3OXSB 4P57B 3SGEI 1YEHL 1UA6H 1BZ7A 3RWIB 2XZAH 1FYTA 4RFEA 4HAFA 5D2NA 5CKAA 4YDJB 4HHAB 3O3DB 1G6RB 3H9YA 2APBA 1D5XB 1MHHA 3WFBL 2Y36H 1DLFH 4PJ8A 1RIHH 1FZOB 1JV5A 5EUKA 4PJIF 1T21A 2P4AB 4JG1L 1CLYL 3C08L 5C0GA 3DBXB 3FB7A 5E94B 3T0BA 1OAYL 3A6BL 4M7LL 3SN6N 3B9KA 3T77A 1HCVA 1S7SB 2AGJL 1N6QL 1OD7A 2OMNA 3QUXA 1CFNA 1LMKA 3QEUA 4P3CH 1NJ9B 1XCQA 2EE6A 5FOJA 3VFGL 5TPWH 4BFIA 4ALAL 1I8MB 4HWEH 1LK2B 4QOKE 3SQOH 2CRIA 5E1AB 2KUTA 3ZE0E 1W0WB 5H2BA 1UXSB 4NQDD 1TIUA 3LH2L 4P2OA 2ED9A 5IKCA 1ZGLM 4V2BA 3GGWA 3HI6H 4JFDE 5C08A 1NCAH 5DRWB 4JHAH 5F7DB 2DQGH 3ULSA 5DWUH 3WO3B 4PG2A 4YHMH 1YN6B 1WAAE 3GIVB 4JO1H 1TPXB 2QV2A 3NABH 5ICYB 3I02A 2VLLB 3NA4A 2YRZA 1T5WB 1PKQB 4HH9A 4M43L 4G9FA 5JIKA 3WHE0 3ZZ1A 3CDGA 3V5KB 1S3KL 2D7QA 4J8RB 1S7UA 3VW3H 3OAZK 3S5LA 3GFUA 4FQJH 5FO8A 2BK8A 1I7RB 3P30H 1MCOH 2PYED 3FFCE 2X42A 4MA7H 5LGJB 2ZPKH 1PG7L 5LGHL 2DKMA 1BQHB 4JFYB 1XEDA 3WYRA 3VFMB 3CUPA 1AGEB 4LGSB 4CVXA 1BAFH 4JE4B 1FLRH 1K9TA 3P0YL 3ZYIA 2FNBA 2VLKD 3DPBA 5FGSA 2Y06L 4FXGA 3RU8L 1SYSA 2IH3B 4O4YL 1GYAA 5D6DA 4Y1AD 1MFCL 1JJUA 1MI5D 1OP5H 1XGQA 4X6DF 4KGJA 4Z7UE 5E8EA 4E41D 3P9MA 1ZHBA 1N8ZB 1XGPA 3JWDH 4OCSH 5GRVK 1WICA 1H0DB 1T0NB 2JELL 3TZVC 3THML 5DRXA 3TA3C 3C2AL 3CH8A 3LKRB 4HK0B 1G7HA 1I8IB 2EDTA 5HI3C 1HQ4B 5E56A 1MVUB 4Q0XL 5IVOA 1YEGL 1FPTH 4NCDA 4OB5L 1M6OB 5D8JH 3MLSH 4FZEL 4S1SL 1NANI 5D6CA 2HWZH 5CD5C 1W8OA 1J5OH 1HOCA 3BAEH 3MBXL 5F9DC 2XY1A 1Z9MA 5AAWA 3DX9B 4BSWA 1BMGA 3TJHA 3ARXA 4ISVA 1Z9OA 4I18B 4MCYB 1Z6JT 5DMKB 1KB9J 4ONGH 3FAWA 5T1KD 3I75A 1MCFA 3NZHL 1YPZF 1U58B 3LEXA 5H37H 2R1XB 1PLGH 5GGUA 3EIFA 3GMRB 3TZVD 3B2UC 3TA3D 2VQ1B 4O9HH 2P1YA 5DJZB 1G9NH 6CGTA 5HI3D 4FFWC 4NBZB 2R39A 1IGMH 1S7WA 4PJ8C 3WIIH 2VDOH 4NKOB 2YPLE 4OZGB 4R97B 2Z0BA 5BMFH 1GOHA 2NXYC 3DRTA 2ZSWB 3QJFA 3G5XA 3TBVB 1A7OL 3B9KC 3DYPA 4U1MA 5DHYA 4QGYA 1N5AB 5CD5D 5I66B 3S4SG 5E00B 35C8H 4APQD 3VWKA 3HAEG 5DJ0B 3GSXB 2BJML 4M6OH 3SCMB 4J3VA 2F54B 1QBAA 1T1WB 1E28B 2XN9D 2ZUQB 4U6XB 4MSWB 15C8H 3QFDA 3C6LA 2J8UB 3ERYA 5DFVC 1SEBA 3GHEL 4ODXA 2R0WH 5GIRB 2X4SA 1KPRA 4R2GC 1NQBA 1FYTD 3EJYD 1BZQK 1AQDB 2A9NL 1EERB 3B2UD 1UG9A 1EFQA 3X11A 5D9SB 2H45A 1D5MA 4E5XA 3KJ6H 4LLUB 4O2FA 5C6TH 3T0DA 5FUZL 5GGSB 4FFWD 3S34H 1VADB 1C5BL 4KZEH 1IM9B 4R0LB 4RGND 3TPUA 5C0DB 2HTKC 2W38A 2WWKT 3BP6B 4QRRE 4TNVK 3QQ3B 3VH8B 3SGEH 3QQ9D 1S9XA 3BSZH 4L8BA 5HVFB 4UQ3A 1RZJH 1D5ZB 1IAMA 4G8GD 1BECA 3T0EA 3GJFA 1J1XH 4N0YH 5FCUL 4X9BA 5B3JF 2J5LC 3PP3H 5BZDA 4DKDC 3BDYL 4NHUB 5F3HB 2UUDH 3O41B 5DFVD 5ADPL 5JIIA 5D5MF 4UIMB 1CT8A 4OZFH 3RDTA 4R2GD 5I1EH 3Q48A 5DD0H 4HKZA 5KANI 3TBSA 4UQ2B 3WFEH 4O2EA 2DYPD 1FO0L 5EZIH 2G60H 1NAMH 4RMQA 3MXVH 2V2WA 2C7UB 5D6DC 3WJJA 4JFFA 3SKMA 3N1QC 4L8SA 5I0DA 2HTKD 3C8DA 3BPCA 2H26B 3EOAA 5IB2B 4ZOCA 2BHZA 3EDFA 2YUXA 1D9KB 4PTUB 4NCC2 4L8DA 1KJ2H 1ODAA 5BVJA 4QRSB 3QDME 5SWZD 4RDQF 3V7MA 4A6YH 5BZWB 1Q9WB 3TC9A 1C08A 3O9WB 4MZ3A 5ID0B 5C0NC 1GH7A 1MY7A 3GIZL 4LCWD 2YMXH 3VDBA 3I3BA 3KPLA 2A38A 1PSKH 1MJ8L 1U2HA 5KAQG 5DDHA 4PJIB 4Q2ZA 3TJHC 1TVBA 2R4RH 3VXSE 1B4JH 4KHTH 3U4BL 1U3HA 4XNYL 4OF7A 4PRPE 3EOTH 3UCRA 3DV4B 4AT6B 2VNCA 5IESL 1PZ5B 2PYFB 3PWPB 5BV7B 4O02H 4UOW0 3NN8A 1BREA 3GK8L 2BVTA 5LQBL 2B0SL 1NC2B 5DD1H 3MRNA 3QUYB 1B6DA 1GGCH 3B9VA 2AVGA 3AB0B 4LMQE 5DD3H 1RAMA 4MXWL 3V0WH 5TGBA 3VFTA 4NC2B 5C0ND 3LPFA 1EUUA 4WEBH 4LEOA 1G9ML 3JWOL 1WFNA 1N0LA 3UPRB 4NNPH 1TJGH 3FT3A 3RI5F 4P2QA 1WJ3A 1KLGB 1MIMH 1WIOA 2OTUB 3CFCH 3OKKB 5TE6H 3TVMB 5CEZD 3PP3K 1WBZB 3VFRA 3TJHD 3B8YA 4LVEA 3U1SH 1X9QA 4KRLB 2OQJA 1ZHLB 2QEJA 4OUUA 2X1XR 4R8WL 4F58H 1I9IL 1QFWH 2UZXB 5FK9B 3D0VA 4KAQL 1OAKH 3MRPB 1LP9E 2H32H 4UMGA 5DEGB 3SGDH 4JPVH 1DE4B 1CLCA 4Y5YB 3MRMA 2NY3B 5CSZB 5DUBA 1JRHH 1I8LC 3RVXC 1O0VA 1W72L 3FOLA 3BZDA 1T04B 4XMLL 1NLDL 2YWZA 3ZKXC 4UB0H 2OLDA 1S5IH 4P2CG 5T5NG 1WGOA 3VXOB 4X7TA 3MV7B 1NCDL 5FKPB 3L3OB 1N59B 3SDYL 3TGXA 4PRHB 3PABB 3HRPA 4KDVA 3T0EC 1OLLA 3WDIA 3DVGB 4LP5A 4X6DB 5F3BA 3LY6A 5JOPD 1DSFL 2P5EE 3LV3A 2DKUA 3O3BB 4JZJA 4R3SA 3MJ9H 5E2TH 4KMLB 1NFDA 3QRGL 4X6EB 3EYOA 2VITA 5DA4A 3RDTC 1HKFA 1ZHKA 4OM0H 2GTZB 2YEZB 5HHQA 5IFHH 1TJHL 3OAUL 3HZYB 4YE4H 1U92B 2BHUA 3RVXD 1YMMA 3DX6B 5LWYL 3L3GB 2R56L 4Z7UF 3P0GB 3WJJC 4PTTB 1RJLA 1WBXB 5D7SH 3SGKC 1A6PA 2O5XL 3BP4B 3DUSA 1G1YA 5CINH 4HFUL 1Y6KR 5JR1H 4DUVA 2HN7B 3BPNB 1FL6A 5H8DA 2NY0D 1KC5H 1WEJL 4N5UA 1KG0B 2IFGA 3T0ED 1YPZB 1UZ6F 1C7TA 4HWBL 2RQ8A 4M7JL 4EUPH 1K85A 1MCEA 5JQ6L 2UY7A 5DD6A 1L0QA 3GJEB 4AG4H 5ETUA 4RSVA 1T4KA 4K2UL 1BQSA 4XRCA 3TEUA 5H94B 3ZLQC 1TFHA 3RIFF 3CSGA 1H3GA 4HIJB 4X4XB 1KTDB 4NRXA 5A16B 1WFTA 1U3HC 4LVHC 4F3FA 4ZUSB 4JFFD 2CSPA 3IDXH 3T08A 1RVFH 2DLGA 5IMLA 4Z7WE 1X5YA 5ALCH 2FHFA 5KSAC 1JYVA 4GUPA 4NT6A 2W60B 5HDQH 4O5LH 1OW0C 2P8LA 3V4VL 5IMKA 4PJ9B 4PB9L 3LS4L 1AGDA 3VCLB 5EA0L 4ZXBA 1FNFA 4ORZC 1J05B 4WHYG 1DN0A 3DARA 3JV4A 3BQUA 2BNUA 4RA0C 4RBPH 4NQVA 4H20L 1R3KB 5DHVH 2C26A 3FO0H 4RISH 4DKAA 4QCIB 1EBAA 1I85A 3B4NA 1BOGB 4G42B 5KSBE 3RP1A 2DWDA 2A0LC 4ONFH 5BXFA 5A1AA 1QNZL 2EIZA 3NAAL 4QEGA 2FO1A 2HVJA 1A6VL 5E8OA 4M6AA 2VLRE 4Y16B 1AE6L 5DJXA 4XX1E 1HEZB 1HKLL 2JTDA 1GZPB 3HMXL 1FG2B 1IGFH 5TH2B 2EDKA 5C09E 2DQJH 2VDRL 4PYHA 5KSAD 5A2KH 3F7VA 3PWNB 3PP4L 3W0WA 2VDNH 4HS6B 4Y19B 1FIGL 4YHKH 3UTPD 4CADB 4MX7B 5JUEH 1ADQH 1DQML 1VFAA 4RIRB 3SJVA 2DMBA 3QCTH 3V6OC 4FTVA 4LARH 3TIEA 4JB9H 3ZL4L 4P2QD 3U30C 4OZHA 1E6JH 2A0LD 3CDYA 2UV3A 5B38A 5DUMH 1TZHB 2YPKA 5E8PB 2VLMD 5I73B 4LLMA 1IQDA 3WUWG 1JHKH 3P9LA 4RMUA 2KDGA 5C0JB 4CAGA 4JKKA 1QSED 4JEGB 1XZ0B 4DVRH 1IAIL 3X13A 1MFEH 5IEHA 3KWWB 5J0BA 1HXMB 1QBML 2ATKB 4ZMAT 4EDXB 3VFOA 2EH8L 1WTLA 4NIKB 1MUJA 2W0KA 3LIZH 3SDCB 5CIPA 3VXUA 2UWEF 1XR8A 4M7LT 3OJ2C 4U1GC 1E4KA 3EFFA 3HNVL 4JRXA 3QRFM 4MNHA 1CLZH 3X3FH 2ZUUA 1OAZH 4NFBA 4Y4FA 4ZPVB 1E27B 1VPOL 1JMXA 1DUZA 1OGTA 5E2JA 3WIHA 2NY5H 4NRZA 5F89A 1G7JA 1U8NB 4NSKB 3PV6B 2R2BB 4JHWL 1HDMB 3GSQB 1ES0A 2QADC 3QAZB 5L6YH 1EXUA 2DQCH 4ODWB 2DTSA 2F19L 3GI8H 5C9JB 3RBSA 4NQEB 4IM8A 4JY4A 4UV7H 4W4NA 3DRQA 1L4IA 4EIZC 1WUNT 5EU7E 1IL1A 1AD0A 3BVNA 1QA9A 1NC4D 4XB7A 5EO0A 2F8OA 4NZUH 1IILE 3EO1B 3WD5L 1YMMD 3EBAA 4MMZC 3RUGF 3QEQA 2I27N 2R2CA 4X99A 3FFDB 4FS0A 2MJWA 2X1PA 2ERJC 3HMWL 1QQDA 1A9EA 2XRAH 2VXVH 3DIFA 3MV8E 4J3XA 1JPSL 2X44D 2IAMC 2E7HA 2DMCA 4ZFOL 1GGIL 2QADD 5EOCJ 4M5YH 1D5IL 1KEGH 2EDEA 1KFAH 3K1KC 1OWRM 1R3JA 3OZ9H 4O58L 4ZXBC 4LHUA 5F8RC 4J7RA 3T2NL 1OB1B 3BQUC 1U8PB 4HIXL 4UU9B 1I85C 3CFJB 4LRIC 1A7QL 4JPIA 1VEPA 3EDEA 2JK5A 1HXYA 3BKCH 3ARFB 3FQRA 4IMLB 3FO2A 1P2CA 4KI5E 3W5NA 1RUAL 4PJ7F 1NEZA 1U8MA 3GRWL 5I19L 2PR4H 2IAMD 5AUMB 1OHQA 2DQHH 4KTEH 4PGBA 2M8XA 5BO1L 3LRGA 1AIFA 3OGCB 4Y4KB 1AD9A 2QQQA 3QIUA 4NQCA 1IGYB 5C0FA 4NUJB 4ZXBD 5DJCB 4WV1B 5FO9B 5FYLH 4S11A 1X4ZA 2C1PB 3PGDA 3QG6A 2OL3L 1MLBB 4Z77A 5HJ3B 1KCSH 3BQUD 2A6IB 4JANA 2RBLA 5A3IC 3IJHA 2IG2L 4UNVA 1ACZA 4YK4B 1P7KB 3CVHB 1LEIA 1RJYA 1QOKA 1IC4H 1TZIB 3VFVB 3U0WH 5FUOH 5J13C 1LE9A 5E5RB 4OZIF 4LLVA 1AXTH 2EDLA 3VFUB 4H8WL 2X05A 3CXHK 3VXRB 4RFNB 1YMHB 1XF5A 3MGOB 1BIIB 1CZ8L 2IQ9H 3SDAC 1RPQA 3HNTL 2NYYC 1F6AA 4G8IA 4WNQA 4BFGA 3FTGB 3IKCB 3MCKA 3WHXA 3S5LG 3RWEB 3O2WL 2FYYA 1G0XA 1BF2A 5JW5A 3FL7A 2WUCH 4NKDA 4MAUH 3LD8C 2KL6A 5IMOB 4OFVA 4Y4FC 2GUOA 1WC7A 3MOBH 3SJVD 4L4TD 1MFBL 1VKXA 4X6BB 5I76B 2VN7A 2XV6B 5A3ID 4LLQB 4FZ8H 5EU5B 5JPMA 4WTWA 4Z8FL 4N5EA 4ZSOE 2DQUL 1A6TB 1JYWA 2CJUL 4QHKI 1WTGT 3CLFH 4K7FB 4XBPA 3MMEB 3KPRD 3S37X 2Y7QA 4XNQA 1ZHNB 2LV4A 4DKEL 1X5HA 4R26L 1YC8A 1HHIA 3T0WA 3DWTA 3SDAD 5LBSL 5E6YA 5AZ2H 4L3ED 5CWSA 2NYYD 4L3CA 5I18L 4LFHD 1A6UL 2XFXA 3ZSTA 2PW1B 4MNQB 4WHDA 3VG0L 5B8CA 5F7FA 2YBRA 3O6KH 4RFOH 1FZMA 2HFGL 4X98A 1NGQH 1ZGLP 5C0RL 1BVLA 5T1DL 3ECBB 3HE7B 3UP1A 5CBEB 2Q7YA 3S3SA 5F1NA 2CLVB 5EU3A 4WEUD 2ZPKL 2GJ6D 4WUUD 3MA7B 2ZJSH 5SWSB 2V2XB 2MQ0A 2CLRB 4C57C 4UOJA 2R1WA 5CP7A 1TDQA 3LKPB 3MJGX 3L3JA 3P4OB 4GKSB 4A2LA 4TNVF 1IGIL 4U1LA 5GISH 1BIHA 3UROR 4LNRA 2PW2B 4XBGA 3BPOB 1MWAB 4U05A 2BY3A 1DJSA 2WW8A 3EYVA 3RVVC 1W2KT 3RX5A 4LU5H 1TXKA 1AY1L 4P3DA 2F5BL 1GPOH 1EPFA 4HV8B 1QRNE 5D71L 1S7QB 2HT3C 2DLFH 1KIRA 2H8PB 5GGRA 4XGZB 4HT1L 4PJDE 4BH8A 3M07A 4G6MH 1VEOA 3H0TA 3EYFB 1I7TA 2HG5A 5BQ7A 4MXVE 3D9AH 4PGCA 3BAEL 1RZ8B 4JFXB 4GQPH 4QRPE 5B22A 4MA3B 1U0QA 5K9QI 4I2XA 5KS9A 1M1SA 1U8HA 5ESAA 3U7YL 5ADOL 3QDJB 4MHHG 2KQMA 5IROA 1XF3B 4HG4J 3HCVA 2VZOA 3D87B 3VG9B 2WLZA 2R0LL 1S9VB 1JTTA 1JBJA 1NCUA 3RVVD 5C0BA 1TLKA 3V6FB 4LVNC 3MRLA 4JFHD 4OI8A 5C0AD 3BOVA 3JV0A 4JY6A 1YC7A 2L7JA 3O4LD 2HT3D 3QIWC 2GSGB 3IDJB 1YEDA 3WBDA 1FL5B 5MENB 1A6AA 4NUGH 4XVJL 4G43B 4NQCD 5KSVB 2AEPH 1F00I 3UBXB 4NO0D 1FVCA 5J89A 3M17B 1IQWL 4JKWA 3GEWB 2CQVA 1NL0L 3NIGF 4NC1C 2PN5A 2NX5E 2YC1A 1MCWW 2R0WL 2PETA 4N5EC 5D7KD 3S6CA 1B90A 2B5IC 4O00A 3U36A 4QNPE 2I60H 3RUGB 5IHZA 1S8DA 5KSUB 3KJ6L 3FKUS 4MJ5B 4OCLC 3IJSA 4XP4L 1GC1C 4X7DC 3GNMH 3B8SA 4PREB 3QIWD 4OSUH 3PDDA 3DVNA 4PJFF 3EUUA 4EEEA 5L8LB 1LWRA 2XTJE 5B8CC 1LQVA 4IRSB 4U1NB 3BD3A 5KVEH 4TTGA 3MFGB 5I8CA 4U1SB 1JWSA 3HS0A 5EIIB 3NCYP 1RZIB 4C56E 1RZGB 1NUDA 1SQ2N 3KGRA 2F53D 3NTCL 4FQXA 4N0YL 4HKJA 1P7QA 4PJCB 3HPLB 2VDPL 1T7VA 4P23B 4OKVB 5L88L 4DN4L 1LK3L 2G9HB 4OGYL 4RMTA 3RAJL 5IV2A 5EPMB 3VFPB 1T6VN 3QUZB 4N5ED 1KT2A 5DSCA 1SYVB 2Z31A 4GW5B 4L29B 5JW3L 4LSPL 1QSFE 3MACL 5EDXA 2CPCA 4HD9A 5DJ8B 5EZIL 3O6LH 2MCPH 4PRDA 3O6FC 3NIFF 3MXVL 4GT7A 3M1BA 4PJ7B 4CN1A 1KB5B 2J4WL 1A64A 2DLIA 4N0CA 3WN5A 4CMMA 5I8OH 4X0KA 4HJJH 1GGBH 4NP4L 1FZKB 3LKQA 4M61B 1FIEA 3CK0H 4RRPA 1KCRH 4UV4H 1ZLSH 4M5ZH 4NDMA 1HSAA 4RAVA 4N90D 5I1JH 4OIIH 4A6YL 4KTYA 4I9WE 1Z5LA 2W9EH 5EU6D 1KACB 5FGRA 4AM0A 4AIOA 3VFWA 2XTLA 1P84J 1AC0A 4HEME 3G08A 4FRWA 3X17A 1UCTA 2F5AH 5I1IH 4U1JB 1N0XH 3DXAA 4V1DE 1FE8L 5GS1B 4TVPD 3K7UA 3ZDXE 5HHOD 1J1OL 2AI0L 1IJ9A 3IDIB 3O6FD 2ZCKH 5LAXA 4WHCA 4U1IA 4S1QL 3KXFD 2QQNL 3PWVA 1MJJA 3WDJA 1PBYA 1JPGA 2Z8SA 5I17B 2OYPA 4DN3H 2DDQH 2DQDL 1U6AH 1F8TL 4HMCA 3O2DH 4J23A 5EB9A 4M7KH 2UVFA 1AGFA 4X8JA 3OKEB 4QY8B 4YAQB 4LLWA 4TOYL 4K3EH 4KTDH 2VOTA 1LEKB 4LSSL 1YEIL 4EN3A 4QRTA 4WFFE 4WW1B 2NY6C 4CVUA 3NCMA 3V7AE 4P5MB 5EUOF 5FYKE 3S3JA 1TVHA 2AW2A 4KKBC 1I9RL 1IC7L 2RCSL 2ICWI 1MIML 5TQ0L 4JM2A 5CSGA 3T09A 1H5BA 1C8PA 3RBGA 3U6RB 3ULVC 3LZFH 4JFPA 1H15A 4YXLL 2CDEB 4MD4B 4XP6L 4XPFH 2YXFA 2X4UA 2HFEA 3G5ZB 4YXHH 2RFXA 4IRJA 4FABH 3PGFH 4UUJB 1K3IA 5C0BD 1MREH 4W68A 3MRRB 1QLFA 2HFTA 3ZDYF 5F6HJ 1FBIL 2QSVA 3ZTNH 4XXDA 2NY4B 5I6XB 1S5IL 4I4WA 4XCCL 4XP9H 2AV7A 1JHTA 3QA3A 2NY6D 5B39B 4JZNA 3VGEA 3U7AA 4KMTH 3QXDA 4TUJA 4B7LA 4KKBD 4XMKH 4G7YH 4CGTA 5E4EB 2X4QB 3CFDA 4YJZL 3W81A 4Y2DB 3V4UH 4P9HC 1MLCA 4HXAL 3F58H 3QUMA 4ZUTA 5TQ2H 4J4PA 2EDQA 5EULV 5E2TL 3OKLA 5AWNH 1MCQA 2Z31C 3C9NB 3OKDB 2SEBB 3BGAA 4OM0L 4X4YB 2CIKA 3BPLB 3I50H 5C0IB 1WZ1H 3B5GA 3R8BB 4XP5H 2EICA 3KPMB 3VMOA 2BC4B 1UACL 3RWHB 3IVKB 4XXCC 4JDVA 1GC1H 5FKAB 4NYLB 5B4MC 3MREB 1F58L 1XF1A 4QXGL 4N0CC 4QYOB 3WN5C 3S88L 2BDNH 4OFYD 4WFED 2Z8WC 4S2SB 2GFBA 3TIDB 1ZAGA 2Q7NA 4NNYA 3T3ME 1M7DA 1AHWA 2DWEA 5IJKA 3KS0H 4XHJC 3QFJE 3HZVA 3QNZB 4AIZB 1FSKB 1HHKB 1OSZA 1VGEH 1A2YB 4EI6A 2QHRL 3VD9A 3BE1H 4HIHA 3WLBB 5DMGC 3SKJH 2DD8H 2R69H 3HZKB 4FXLA 2N7AA 4MQXC 5C6PB 1ROWA 2Z31D 4M3JA 1LD9B 2EE9A 3N9GH 5GZNC 4TVPH 5IEKB 3NBNA 1U8KA 3N1GC 3UX9B 5K59F 1PGRB 3QDMA 4M4PA 4MWFA 3K2UH 3Q6GH 1JGEB 4I77L 2VR5A 3IDUA 3BKML 4JN2B 5KVFL 5B4MD 4M1GH 2QR0B 3TNNB 2EH7L 5LCVL 4GXUN 2EDFA 1QLRA 2MOVA 5D7LD 5JPNA 4JDZB 1BFOA 3MNZA 1XGUA 1FVDB 2VMFA 4O5LL 4NQDB 4XB8A 5D7JC 5JNYB 5KTEH 1JWMB 2VDQL 3O6ML 4K8RC 5D72L 5JLZB 4XHJD 2J2ZA 3H9ZA 4R6UA 1KJ3H 3OG6B 2NCMA 5JOFA 2V17L 4R7DA 4LCUB 3D25A 4NNXB 3LQAL 3ARPA 5DMGD 4EN3C 5B38G 2O61B 4MQXD 3OPZH 5AD0B 1YN7A 4Q6IA 4H5SB 5E8DH 1KJMA 4GRWF 5FOBB 5IQ9A 1H5BC 1RZKC 5CEZL 4MDIB 5GZND 5C7XH 2NZ9D 5MEPA 3EYSL 3VGDA 2Z8VC 4ZOAA 2G75B 3FONB 1PYWB 3WXWH 2FIKA 3MYJA 5DMJB 1J0JA 2ICEB 1RU9H 3UO1H 3CFKA 4Y2OA 4HC1A 1Z0MA 4BQBA 1DQQB 4X6FB 4QGTA 5DHXB 4OZFB 5FXCH 3GO1H 5D7JD 1WFOA 3MROA 2V7HA 1XT5A 4K8RD 4RNRB 3FJTA 3K3QA 1WV7T 2VLKB 1MEXL 1NAMB 5HGBA 2GK0A 2FZ3B 4NN5C 3GSWA 1CK0H 2VLJA 1YYMH 2WANA 4KPHL 2X9XA 4OF3A 4EN3D 5FUCE 4Z76B 4YPGB 1LP9A 5HYFA 4YBQC 3KPSD 5IJVB 1JF1A 1EFXA 4MAYB 3NZ8A 1HHHA 3ETBF 1Y6NR 1KJ2B 3G5VB 1Y0LB 1B3JA 3B9DA 4KQ3H 1IC5H 3O3EB 1HWHB 3HG1D 4J4PC 4UZGA 4F15C 2EDDA 1Q9LA 4DVRL 3GI9H 4D0BB 5D1XA 2ARJA 3HI1A 3ZSSA 5CZVH 1U8IB 1PEZA 3BI9X 5GRJL 2OZ4H 3V8CA 3WFHA 2P8PA 4ZFZB 2Q8AH 3UJIH 4M9PA 1DBKH 1A4JB 4WWID 4IRZH 2ZWLT 2P5EA 2HT4C 3LS5L 3DGCR 5EOQH 1BOYA 4YBQD 3KLAB 4LHUG 4YDIH 2A2QT 2AV1A 4CRPA 4ACPA 1QYGL 4HJ0C 4KUCF 5KG9A 2FR4B 1KIPA 2HYMA 1EMTH 2WIIA 5IJKC 3AXLB 2J6EH 4DWHA 1R5IA 3VXMA 2BFVH 3T4YB 1JPFB 4J4PD 4YFDB 2EYRA 4PRNB 4KK5C 5FV1L 3BIBX 2ORBH 5BS0E 5IM7B 4GAGL 3TBTB 1JE6A 1RUKH 2RB8A 5FF6A 5I71C 4J12A 1MAML 4APQB 1A9BA 3QQNA 4YDVB 3NFSL 1W0VA 2A77H 3CFBA 1FVEB 1NEZG 3S37H 3BXNB 3OF6A 3GKWL 1JGLH 2P5WA 2Z92B 1J88A 2XN9B 5EUOB 3TJEH 4L9LA 2HT4D 3ME0A 4DKFH 4D94A 2DLEA 2M26A 3WKMH 2AEWA 2H32B 3U0TA 1SBSL 2V6HA 3OXSA 4EBQL 2DB8A 4HJ0D 3CU1A 1EA9C 5DJ2B 3RWIA 3BH9B 4B7IA 2AEQH 4LQFL 2HRPH 5GRUL 5DRZB 4YDJA 3RTQA 4HHAA 2HLAA 1H3XA 3O3DA 1G6RA 5IB1B 1D5XA 4KK5D 2KQNA 3Q6FB 1IVLA 2WMPA 1VFBB 4NWUL 4RGNB 2D9QB 2Z35B 4Q6IC 5ACZA 3LDBB 4ZUUB 1JK8A 1TTGA 3DBXA 5E9DD 1CQKA 4G8GB 1MCRA 1S7SA 2J8OA 4PY8I 2YS4A 3BKCL 3RIAK 1VEMA 4BZ2H 4C4KO 3BJLA 2W1NA 1VGKA 2ZUTA 1NJ9A 2NTSP 3QDGB 1I8MA 1G7PB 4HJGA 1LK2A 2BNQE 2V5SA 4KTEL 5E1AA 1S9KC 3QO0B 4GMTH 2HA1A 5IUSA 1KPUB 4OM1L 4K8RH 2I9TB 3PL6C 4PPTA 2IANE 1UADC 2VLRA 5DRWA 3C5JA 2FX7H 5F7DA 2C1OB 3D39B 2COQA 1INQA 1KXQE 1YNKH 4PJCE 3BP5B 3GIVA 3P4NB 1B88A 1SJXA 2F58H 1NBVL 2VLLA 2Q1EA 1T5WA 4XAWH 3UZQA 1GXEA 3BH8B 1RZKH 4MVBA 5L8KB 4I5BB 3BWUC 3V5KA 5LGKA 3U2SA 3IJYB 2ZG3A 4G8FB 3BWAA 4YQXH 1I1CA 4EUPB 3SBWA 4RMWA 1ORSA 3TH4T 2ESVB 4P59H 4LCWB 4DGIH 1I7RA 4TSBH 4JQVA 3NA9L 5LGJA 1KEMH 2WUCL 4TULL 3RVUC 4WO4A 2JJVA 4R90H 5E08L 5DR5L 3PL6D 1AGEA 2DIJA 4BZ1H 1MVFA 5F7UA 3RNQA 2VLJD 4HBCL 4AQ1B 2ED8A 5ICZA 2GSIA 2IH3A 2XKNB 3W5MA 1WWWX 1U93B 2XQBH 1EFXD 4XNZC 4UNUA 2FATL 4L4JA 1N8ZA 3KR3H 3VXNA 4G6AC 4IS6B 3L3IB 1H0DA 1T0NA 4HUNB 3LKRA 5MERB 1NDGB 3FZUC 4HK0A 5BVPL 1I8IA 1HQ4A 2B2XL 1MVUA 3R1GH 4MXQC 4Z7QF 5D1ZB 4XNXL 5FHBH 1GHFH 4GRMB 2BSTA 4N8VB 5DHVB 5J56B 4GS7B 1M6OA 4D9RE 1BQLL 4Y5XA 2DQTL 3TBWB 3ALPA 5JA9A 3MXWH 2YK1L 4JR9L 2JB6B 1Z3GH 1ZE3C 3K8KA 1UYWL 4FQ2L 3DSFL 5J12C 3Q5TA 4P2RD 3EOBB 3DROB 1MJUH 1QBLL 2I5YL 3DX9A 3GDBA 5IVXF 4F2MB 5H35B 1U8QB 3PDGA 3LN4A 4FNLH 2IQAB 5EZOH 1T2QL 2NY1C 5T3XD 4MCYA 1G84A 5DMKA 1AKJD 2WIMA 3QCUH 3AMKA 1IGTB 1JNLL 4DGVH 1J0IA 2R1XA 4R7NB 5JW4Q 4G6AD 4M1DL 2CH8A 4CJ1A 3GMRA 4GAJH 4KY1L 3LMJH 2VQ1A 4JCLA 3MR9B 3FZUD 1I7ZB 4WHTB 1MCSA 2Q87A 3OJDA 4MQSB 4RMVA 4MXQD 1I9JH 4NKOA 3RL1B 3FN0H 4M8QA 3ZE2E 3MV8A 4WI5A 1OARL 2ZSWA 4PJXE 2OJEB 1J1PL 3TBVA 3UTSB 1IAKA 2ICES 1S9WB 1N5AA 5I66A 1U41A 4NQUA 5E00A 2Z93B 1P4BL 1GPOL 3OF6D 4YWGL 1H8NA 2DLFL 1YQVH 3EO0A 5DJ0A 3GSXA 3SCMA 2CK2A 3WNKA 2F54A 4KVNL 1FL3B 5CEXB 1T1WA 1E28A 2HP4A 4U6XA 4XPBH 5AEAA 4Z0BH 4JJ5A 1CDIA 5GRYA 3D9AL 2J8UA 2K9UA 1B0GA 5GIRA 1TENA 2ZKHL 3GSVB 1AQDA 1LO4L 3INUH 4WU7B 5D9SA 5D7IE 1MRCH 4LLUA 4ERSL 2ZUXA 4O51B 4U1HB 5FEBA 5C3TA 5FA4A 3PQYE 2D03L 3OR7B 4H0IA 4ZS7L 5T1LD 3MGTB 1IM9A 3BP6A 5HDBE 3VH8A 1AR2A 3QQ3A 2EDXA 2FBOJ 1OOAA 3HR5A 5I8EB 2NY0B 3MUHL 1HH9B 4S0UC 1JN6B 1EEUA 4AEIH 4D8PB 3SBWC 1BFSA 3DX8B 4JFZL 1NDMB 4QWWC 1SJEB 4NUGL 4NHUA 3O41A 1ZWIB 1HHJB 5FHAH 4UIMA 3LQZA 4XCFL 3D85B 3EDJA 5IF0B 4Q9QH 4HS3B 1MAKA 4KQ4L 4Z7VE 4DUWA 5KN5B 3RWFA 2C7UA 2WNGA 2ZG2A 1IGJB 1UM6L 5F96L 1KBGH 1TETH 5ALBL 1RZFL 3QPXH 2H26A 3MZGB 4J1UB 5IB2A 4QT5B 4F7MB 2QSCL 4OLUL 1D9KA 4PTUA 1CXIA 3GNML 1BQUA 4V2CB 3JUZA 3A6CH 4RRPG 3ULUD 1AJ7H 2GAZB 4FOMA 1MF2H 4FXKB 1Q9WA 2BSSA 3O9WA 1B9ZA 4QWWD 5ID0A 4G7VH 4OLXL 1N2RB 1DBBH 1MCNA 4LSVH 2D7TL 4RQQB 4L4VB 3VI4F 2BRQA 4NQDE 5CJOL 1OAQL 5DEFB 1CGTA 3BO8B 2JCCF 2AABL 2DM7A 4LVHB 4PJIA 2BHYA 1B4RA 3V2AR 1LO2L 5GGTH 4HDIB 4I18C 5ESQA 5C07B 5T3XH 5C0CB 2R0ZL 5IOPB 4AT6A 3HLAB 2EC8A 2DI8A 2PYFA 2Y5TB 1L7TH 2D31B 1MCKA 1A3RH 4JREB 3O11A 1FC1A 1NC2A 1MRFH 4WW2F 1MFAH 4GG6F 3UJTH 1K8DB 2VR4A 3MJ7B 2ZNWA 3QUYA 2GJJA 5DK0A 4X6CF 1EGJA 4GW4A 3SE8H 2XKUA 4R97C 1KF9B 5JHDB 4PD4J 1J7VR 3W9DB 5IT2L 1T03H 2PYEE 5EOTB 3P4MB 4B5EA 4YFLF 3RA7L 4UV4L 1VCAA 1YUHA 3VFSB 1T89A 5EWIL 4UTBL 1KLGA 3OKKA 2FJFA 1OTSC 1FJ1B 1WBZA 4MJIB 3PE9A 5CILL 5GS0C 4HQQH 3DV6B 3SCMC 1QSEB 1ZHLA 4HUVB 2ZUQC 4HULB 1NMAH 4Y1AE 5L2KD 5FK9A 3GMNA 4LKCB 4OV5B 1MI5E 2QL1A 4YH6A 4F9PC 3Q1SH 3MRPA 5DEGA 3TT3L 4JFQB 1DE4A 3VRLF 4Y5YA 4E41E 3B2VH 4H0GA 5CJQH 4H26B 5ID1B 5CSZA 1DFBL 1M05A 1QRNA 1T04A 2B1HH 1CBVH 1RHHA 1U6AL 2HJLB 1HSBB 4R0LC 4Y89A 5T5FL 4CL7A 4HAGA 3MV7A 5F72S 5FKPA 2FECI 1UCBH 1N59A 3VXTB 3MSPA 1OTSD 2ARJQ 4HKBB 1BEYH 3PABA 4ZOBA 5AG8A 4D2NA 1R0AH 1CICB 3SCMD 3DO7B 4KTDL 3MNVB 5JDJA 3DVGA 4IOIB 4LAQL 4I48A 5HHPB 1AGCB 1YY9C 5J8OA 2Q3AA 4HS8L 1NC4B 1KB9K 2GTZA 2YEZA 1MCLA 4IDJL 4PBXA 4NQSB 4QTHB 1U92A 4OD1H 5KAQF 4IBLT 2OR9L 5HYIA 3DX6A 2EDYA 3GJFK 1ZLVH 3L3GA 3GMPB 1DQTA 3DSNA 4PTTA 3KYOB 1WBXA 1JP5A 4M6ML 3BP4A 5CUSH 1CLOL 3GUTB 4UT9L 4DK6A 2O5ZL 3MLUH 4V3EB 1Q0YL 1D9KC 2BY1A 3MCLL 5EOCL 3DGGB 4MD0A 4PR5A 1HNFA 2E5EA 5GHWL 1H3UA 5EORH 1KG0A <