5INCA

Crystal structure of hla-b5801, a protective hla allele for hiv-1 infection
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-58 alpha chain
publication title Crystal structure of HLA-B*5801, a protective HLA allele for HIV-1 infection.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5incA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5incA01
2Q7YB 4MHHI 3SDCA 3DROA 3HPLB 3AU1A 1IGTB 5IQ7H 4R7DB 1I85A 5C0AE 2BNRE 2A6JB 3GMOB 3IFPB 3TNNA 1MHCB 4QRPD 4YXKH 3DMMD 5C0IB 3WL9B 4IEFB 2GJ6A 1FC2D 4YHZH 2PYEB 3FB6B 1JPTL 5ESAA 1V5JA 4A6YB 1XCQA 4NSKB 1JBJA 3RVUC 2MNUA 3FQXA 4JPWL 1W72H 4K7PY 4PP1C 3O2VH 5BV7B 2Z8VC 2VRAA 3FMGL 1J7VR 4ZXBB 2W91A 1JFQH 4UV4L 1NCCL 4ODTH 3RTQA 2AJZA 4G8FB 3C6LA 5D1XD 5T1KA 1C12A 5IB1B 3NCYS 2WBJA 4F9LA 1P7QD 1MUJA 3B5GA 5I1HL 1AQDA 3EGSB 5JXAH 1B90A 3GI9L 5L2JA 2CO7B 4HIJB 5EB9A 4YXLL 1IFHL 1UWEH 4OB5H 3RKDD 3F6IA 3AFLA 4K71C 3V6OE 3B8SA 3SOBH 4JKKA 2DQDH 1MEXH 3FT3A 3I6LD 4LSPL 3CVIH 4RISL 4KJPD 5FYKD 1I9IH 4ZNCD 1A14L 4F7CB 4JZJB 3BQUD 4YDJA 4TYUA 1NEZG 2HT2D 1G9NC 5IB4B 1V7NH 4MNQD 3VGAC 4PJ7B 3B3IB 4R96A 1G7JB 4G7VH 4M1DL 1KEML 3SE3A 1X5HA 7FABL 5MEND 4NFCA 4N5ED 5ACLA 1JVKA 5BS0B 4QWWD 3B4NA 3MV7E 5D1QA 1EFXB 2A1WL 4DN3L 1H5BA 2A6DA 2ICES 3QEHB 3WXVL 3LHPL 3V6BR 3QEUA 1XEDA 4NKMA 2Z8RA 4RMSA 4WUUA 4WW2B 1INQA 5D7SL 4ZUSB 5C0JA 4U0RC 1VFOA 5DQDL 3MJ9L 4EVNA 1H9VA 4GW1A 4H25A 1BZ7B 4KMLB 5I1AB 5EU5B 2QR0B 4XBPB 3B2VH 4S0SD 4J3UA 4DUXA 2SEBB 3MRNA 1Z5LA 4BELD 3OR7A 1HEZB 3FT4A 4MCZA 4MS8D 3FQUA 4C4KT 4M9PA 2D9QB 1QLRA 1T66C 1FFNB 1OCWL 2Z35B 1K5NB 3QO1B 1JGDB 2Y6SD 1ED3B 4KJYB 4R4ND 3GMMB 3WIFA 1S7SA 2CKBB 3QG6A 2VLLA 3I75A 3PQYA 5GGRY 5K9KB 4PJ5A 5DEFB 5KVGH 4JJ5B 1D5IH 3TIDA 1G7LA 5LXGL 3W9DA 4UZGA 3UEZA 3PGDB 2ADJB 3BP6B 3THMH 1VGKB 5J11B 1A7RL 2HLFD 3Q6FB 5DJ2A 4DEPB 1AD9A 2P5EA 3ELAT 1SYSA 3OAZH 3BHBA 4QT5A 4K23L 2GTWB 3MLVH 3QB7C 1H3UA 4PRNA 2EXYD 3BEWB 5D9SA 5SWQA 1SM3L 1OTUD 3CX2A 3O6MH 3VMNA 3WN5B 4QRTB 1AR2A 3T09A 1L0QA 4OD1H 3CLFL 1A7OH 5CIPB 4PRPB 4O58H 1GOHA 4L8SA 1R5IB 4UQ3B 2OI9C 2VLKA 1N4XH 2X42A 3MRFA 4YNYA 4HKZA 4I77L 3VG9C 4IOIA 4M5ZL 3GSNB 4CADB 5I74B 3ARDA 3WLBA 4CU6A 5SWSD 3U48A 4M6NL 5MEPB 4AQ1B 5KOVC 1Q94A 5MI0B 4JAMA 5HI3D 2VLJA 3QFJB 3CFCL 3IF1A 4WFFE 4OUOA 3QI9B 4WWKB 2OXHA 3E0GA 3VFSA 5ID1B 2Q8AH 3KPMA 1AC0A 2BNUB 3H9YA 3K0WA 3BP5B 5F7WC 3VDAA 4YDLB 4U1JB 3ROLB 5MEOA 4ODXA 2RFXA 3O41B 4R0LA 4TRPH 1O0VA 4OCYL 5ACZB 4G6FB 4Y1AD 4IDJH 3RWDB 1S5HB 4XI5C 1RUPH 4JANA 1IGCL 3W11D 2FEDC 1RJLB 4JN2A 1A8JH 3EYQD 2KZWA 3T8XA 5E6IB 1ZE3C 3QNZA 1KB9J 3FO0H 1S78D 2IPKA 4GKSB 4EQ2A 1QEWB 4PB0H 4YO0A 4OT1H 1QSEA 1A1NB 2AXFA 1MI5D 3P3YA 2LTQC 1Q9LA 5T1DL 4P23B 4FOMA 3CFDA 1FFRA 2J7LA 5IVXB 5HHOD 3P0GB 3ZE2E 1NBVH 4TSBL 3IXAB 1UC6A 1K8DA 3KVQA 3KS0J 1AGCB 4PJCA 1DQMH 4DUWA 2LU3A 4ZFOL 3W5MA 4MZ2A 1W0VB 2ED7A 1K3IA 1M7XA 2Y07L 4CN4A 2O5ZH 4YHPB 4HSQA 3CVHL 4JFFB 3DO3A 4HFUL 4F15B 2VABB 1MCBA 5E5RB 2DLIA 3JV0A 4U6HB 1MQKL 2P24B 4HWUA 4PJDA 5C0FA 4LCYB 1M05A 4GXVL 2J4WL 4TVPE 3VFUA 5KS9B 4GBXB 4LAQH 4X6FA 4XMPL 5IJVA 1A4KB 5JW5A 4EJ1C 4NO2A 5DC9B 7CGTA 2X4OA 4P9MH 5B8CA 3O4LE 3F8UB 3VRLE 4OZIF 4YJZL 1ONQB 3VJ6B 3DWTA 1CDHA 4Y4KA 1MY7A 4OFIA 4OM1H 1DVFD 2NY0D 2EIZA 4U05A 2O5XL 3CLEL 4ZOBA 1C7TA 5JHLL 1O5DT 2C4XA 3OTTA 1T22B 1KTDA 2DS4A 4BFEA 4CN6A 3DI3B 1WK0A 2HLAA 4MAYC 2IF7A 2J12B 5BMFH 4TULH 2E9JA 5DD0L 4AIXA 5DSCA 1WIOA 3O2DL 3SKOB 3GNML 3ARVA 3RU8H 1QACA 2CLRB 2ADIA 1IBGH 1U8NA 3KR3H 3EOAB 1ZOXA 1BBJA 2A0LD 3KYOA 1F3JA 4P46A 4LCUA 3ZE1E 4HLZH 1S7TA 3B43A 4B0MM 4HK0B 3ZHDA 3E2HA 1MH5B 3RHWF 3DV6A 5D93C 1ZHNA 2WIIA 5L8JB 3SPVB 2AEQH 3X3GH 4OZIA 5TDPB 1OTTC 1OF2A 1TNMA 3I3EA 3LH2L 4Y19B 1UXSB 3O45B 2BY2A 2Y36H 2ZCKL 4PJ8D 3RVVC 2X40A 4FQXC 4HKXA 3LKPA 2XY2A 3IDMA 4PRIE 1I8IA 3SDAA 1EJOL 4DOHE 5T1MB 1DDHB 4OF3A 1OAQH 3QP3A 1V05A 5D5ME 3VFGH 4ZOAA 3J8F7 3OAZK 1QO3A 3VFOB 2XTJE 3L6FB 3WS3B 5DXWA 4L1DA 1N8ZA 3UYRH 4JPKL 3IFPA 3WFHA 5F1KC 4DK3A 1HQRB 4MXWL 1LD9B 4H0IA 4M1CD 4FTVA 1J0JA 4TUJB 5KG9A 4PJHB 4PS4L 1JHLH 1DR9A 2HTKD 1QRNE 4R4BB 4EI5D 4K7PX 2YD3A 4OZFA 4UDTB 2VLRD 5FV2A 5L8LB 4WI2A 4N1EA 3QZWG 1W72B 1WUNT 2IALA 4MSWB 2DLFH 4FFYL 5E6YA 3T4AA 3V6ZB 3VXTB 5FO9B 2DQCL 3MO1A 5CJ5A 1T4KA 3M17A 1JNLH 2FR4B 4LCIH 2LU7A 1LO5A 1RZKC 5I1KH 1GJIA 3IFLL 3S36L 3FO9B 5CD3B 2NX5E 3ARFB 3QXAB 1ZHBA 4HMCA 5HDBF 2IGFL 4MHHG 3BYYA 5EOCL 1EGJH 3KPQB 4KH2A 3OPZH 4N0YL 3VGGA 3FQWB 2V2XA 4HIHB 3D39B 5FGSA 1NC4D 3EHBC 4P2YA 4GRWH 2BFVH 5F7NC 1G7JA 3JVGC 3BWUC 1C5BH 5C3TA 4C83B 4YUEL 5C07D 1JZ3A 1KCRH 1FZJB 1Q1JL 4Y4FD 1NDMA 1B0RB 1J1XL 1NCBL 4NQVB 1BVZA 4K8RL 4Q6IA 2GTZB 3QEHA 1DFBH 1FZOB 1JUFA 4GRLC 3MUGA 2DTSA 3ESVF 1QYGH 5C6TH 4M7ZC 5F7MC 3PWPE 4IMLB 1E4KC 5I1AA 5EU5A 3QIBA 3MXWH 1DEEB 1HHGA 1MAKA 2UYLA 1HEZA 4XBEH 5KSBF 1DQDL 2Z35A 1K5NA 4G59A 1JGDA 1KIQB 3CXHK 2FD6H 2N7AA 4KJYA 3EDEA 2G9HB 1ZLSL 4G6KL 3U83A 2PXYD 1G6RA 2NNAB 5FYJL 1F4WH 4LSRL 4FS0A 3QUYA 2IQ9H 5IEKB 1CVSC 1QA9A 5ESVA 5INDB 5I8OH 2ADJA 1MWAB 4NWUL 1AR1C 4R4FL 2QADB 4PRHD 4MQ7B 5JIIA 5JZ7D 4NGHL 5GISL 4JM2B 3QDMD 5CGYD 3Q6GL 4FQLH 4X9HA 2A73B 2F53D 2HKHL 3HZMB 5LQBH 2V2WB 3BEWA 2AJXL 4QRTA 2Y4SA 1JPFA 5H94A 4PRPA 4ODHH 1EBAA 1I1AB 2AGJH 5LKNA 5JW4R 1VDGA 4MWFB 4HUXB 3GSWB 2VIRA 1T6WA 5I1GH 1N5AA 3O6FD 1PLGH 1JP5A 1X9QA 4EN3C 5ECJE 1QLFB 5JOFB 5E8EB 1BLNA 32C2B 3T2PA 3CSPA 1TETL 2IAND 1PQZA 4ZODA 4JKMA 2WUBH 2Z91A 1WSST 5EZIL 1GH7A 5KSAB 1E6OL 4F37F 1BGXL 3T0ED 2W9EH 3RZCA 3UXFA 1YEIH 2IADA 4LSQL 3FRUA 4R7NA 1RZIB 1HQ4B 3I9GL 5I2IB 4OCSH 4CVZA 4YHYC 1CXEA 2OJZL 1J8HE 3I02B 5IP4A 1MAML 4ZFGH 1FG2B 2VKXA 2R9HC 1WV7T 5K59F 4V3DB 3N1FC 4H20L 5CJBA 4NQCD 4Z7VF 3R8QA 5FO8B 4GKSA 3CFEA 1FGNH 1AGEA 1KC5H 5L8KB 1YEHL 1LK2B 1IAIH 1A1NA 3F5WB 1XF4A 3EOBB 2HJLB 1YPZE 2J2ZA 3MBEA 1MF2H 2VXUH 1GZPA 1EX0A 3E3QE 4P23A 4PP2A 4OKVB 4FQQB 1T2XA 1HZHH 2F8VA 2JTDA 3IU3A 3IDGB 4YEEA 2BNQA 4WFED 1A6ZB 1JGEB 3BMVA 3CH8A 3QPQC 2ORBL 1RURL 4PP8C 1J0ZA 4JFFA 2MSPA 3HC4H 4U1KB 1X5KA 4U6HA 3LKOA 1CZ8L 3UTSB 2ZNWA 3M1BB 5T3ZH 1IM9D 5GRJH 4LCYA 4GQ9H 4KK5D 1TJIH 4Y2DD 5E8PB 3KWWB 5ALBL 1F58H 4WI7A 2WBWB 3H7BA 4GBXA 3R1GL 1OGAB 5M7QA 2BVQA 5FAAA 1J88A 2ATKB 3NCMA 1AD0B 1CFQB 5HHVH 1Q9KB 3MA9H 3HB3C 3WFZA 5HI4D 3QWRA 4LSSL 1G1CA 4APQD 2XPGB 4G6JH 4GMTH 3VJ6A 2G60H 1X5JA 4G6ML 2E7LC 3FB5B 2YD9A 3QNXB 2F54D 1M71B 4H1LA 4JFED 5DGQA 4KUZH 2NLJB 1NANI 1IARB 1N7ML 1ZLUH 5J57B 2ITDA 1ZLVH 1WBZB 3BT2H 5JXEC 1RU9L 4LSDA 3TBYA 5E6ZA 1BEYH 2ZG1A 3U4EB 4KTDL 4D0CB 3IXTB 5HDQL 1EEYB 3HI1B 2VXSH 5FA4B 4KROB 3VWJC 4N9GA 4LAJH 5DLMH 5TH2A 2DIAA 2BZDA 3V6FB 2FLRT 3G6AA 4HAFA 2UZIL 1JGUL 4UBDC 4XC3H 1OP9A 1BQUA 2BJMH 1AQKL 1AGBB 3CX5J 3W5NA 1MH5A 2EDJA 1INDL 4LASH 2DLGA 1CCZA 2Z4QB 5TDPA 4QRPE 5CP3H 2UWEF 4JFZH 1BIHA 3O45A 3SKNB 4X7SH 5CS7A 2AEPL 4LARL 1KPVA 1OARL 2WWMC 4MQXC 1VCAA 1KJMA 1FBIH 5I1IL 3TN0B 3D18A 3BXNA 4PTTB 2NY6C 5GZOC 4JG1L 4ZFFB 1CTOA 2AK1L 1RD6A 5B4MD 3L3IA 4YGVA 4I3SH 1PKQA 3TCXA 4X6CE 3MLRH 4UT7H 3G5VB 1XF3A 3UBXB 1P5VA 5JOEA 4WO4D 4YHML 3MFFB 2CR6A 4Z77B 1KPRB 4R4BA 3ARRA 1AO7A 3LS4L 4XPBL 1T3FB 3GJFH 1FYTB 3HZKB 4QXGL 4MSWA 1RUKL 4PG2C 1CFBA 1JWUA 1JYNA 3V6ZA 3TFKD 1U3JA 5FYKE 4LVNB 4HEME 2DYPB 4C56A 5MERB 1T03H 4DFIA 4MNQE 1C1EH 3LB6C 1NCDH 2EDFA 2NXZB 3BH8A 4L3CA 1V3KA 3N1PC 1FP5A 3VGBA 4G9FB 3I6GA 1WWBX 3EO0B 3QXAA 2APTA 4S1QH 1JI2A 5MENE 2GFBB 2MHAB 1HYSD 5D2NB 3TA3B 1ORSB 3TJHC 4YDIH 1LO3H 5CJXC 1S9WA 1JK8A 1GHFH 4X6EB 4FFZL 1F11B 3QRFM 3DRQA 3OWEA 2HKFH 5DFTA 1I9JL 3VXQB 5SWZA 1EEZA 4X4ME 3STLA 1MVFA 4BFIA 3H8NA 2VXTL 5TE4H 4UT9L 4GRWB 2DDQH 4OAWA 4NBZB 3RWHB 1JHTA 3ZKMC 3DYPA 1X5ZA 1D9KD 4U6YB 4C83A 1EO5A 4U1GC 2OL3A 2IBZX 4EOWH 1W8OA 4DQOH 3TBVB 4YEFA 3LS5L 1KIRB 4EBQH 1GC1C 2E6QA 2ZUUA 1FZOA 3AB0C 3S4SG 4OJFL 3UTPD 3I50L 1DBBL 3MROB 4CMMB 2J88L 5D2LE 1J10A 4UT6H 2E27H 1G7HB 1ITBB 3HUJF 1B4JH 1JN6B 4KKAD 1DEEA 5CSBA 5HVHC 4F7MA 3BAEH 4NNPL 4GG6E 4J3OC 5D70L 4YIQA 1XGYL 2VQ1A 4DKFL 5IMMA 3ALXA 4PGBB 3L5WB 3V52L 2OI9A 4IJ3C 3LAFA 4P2QA 4P5TD 2NNAA 4S1SL 5JMRA 5KW9H 2VLMD 1ZLUK 4KI5D 3BN9D 3NH7L 1Z0NA 1KN2L 4K3DH 1ZLVK 3DUSB 2VSDA 4NNYA 4XNZC 3VA2C 1RK1A 5C0GB 2P8MB 4OLYL 4KQ4L 1OL0A 3ZTNH 2Z8WC 4B41A 1BZ9B 4X6DB 4DGYL 2A73A 4JZNB 4W68A 4P4KC 1QNZL 3O4OB 4L5FL 3KYKL 3QDGA 2HFGH 3QRGL 4UIMB 3UC0H 4FQ1H 4ZSOA 3KJ6L 2PF6A 5D7LE 4OCRL 3KS0H 3A6BL 3JWDC 2VDLH 4Y1AE 3D0LB 5DF0A 4XP1L 2B20A 2HTLD 5FK9B 1J1OL 2X70A 4MJIB 1NAKL 3T0AA 1A6VH 2YD1A 4YHIB 3MACL 4LSTL 5DUBB 1SEQL 4G8EA 4LRNH 3FONB 2FGWL 4LGPB 1MFCH 3KPRA 3RVTD 5EIVA 4NPYB 4KVNL 25C8H 2NY4C 1Z2KA 4F7EA 1DBJH 4AMKL 5B39A 3Q1SL 1HQ4A 4K2UH 5I2IA 4YAQA 3C2SA 2X1PA 3TJEL 3I02A 3T3PE 2PO6D 1FG2A 1IILE 3BD3A 3R4DA 2OSLA 3OHXA 3WFBH 3G6DH 3NZ8B 3ARBB 4R2GB 1DSFH 4K8RD 4OV5B 4ZMAT 3ZDXE 3MLZL 5L88H 3GJFK 1R3HB 3UTTA 4JFYA 3UJJH 2P43B 1A47A 4OLWH 4Q9RL 4X9BA 1GGTA 4J8RA 1TTFA 2VZOA 3WHE1 1T1YB 3RNKB 4N8VB 1G7IA 4U49A 5C0CB 5TDNB 2BY0A 1WBXB 4PJEE 5BRZA 4X98B 1MNUL 3NPSC 1JGEA 1U93A 4DKAA 3KXFE 3L3GB 4MCYB 1JWSB 1OSPL 2Z9TA 1X7QA 4UUJB 4JFOB 4QGTA 4U1KA 1ZHKB 6CGTA 4LLQB 1QR4A 2NW3B 3FQNB 2OXGA 3SKMB 2AXHA 4MAYA 4Y4HC 5FYJD 4KRNA 4EDXA 3MLWH 1HILB 1QBAA 3KWWA 4LLVA 3KLHD 3B5HA 3E6HA 5GS1C 5JW4Q 2VDNL 3O3BB 1NMBL 2FL5A 1BD2D 3RBGA 2F5BL 5CZXD 1P4LB 3K1KC 2A9MH 5L6YH 3C09C 3D2UB 3BMWA 1INEH 4WHCA 2WMPA 1L0XA 1A6TA 3ARPA 4W4OC 1U8HA 2X2YA 1F6AA 4EEEA 1AI1L 5GS2H 4WUKL 1BPVA 4FQXA 2NXYB 4KZEL 3OAYH 5L2KD 2DQEL 5AZ2H 1ZS8B 1EHLL 4NRZA 1I7ZA 1UB6B 5H2BB 1PSKH 4K7FB 4MMXC 3SDDC 5FM5O 1SMAA 4KQ3H 3CD4A 3HE7C 3M45A 1SJHB 3UJIL 1DLFH 1ES0B 1HCFX 1HNGA 1KLFA 1KB5A 2J8UB 4P3DA 4Z7NF 1H8NA 2X89D 5ILTH 5ITBL 3GIZL 1JNNL 3E1F1 2D7TL 4BM7A 3RUGF 2C5DC 2DM7A 3LPFA 2WWKT 3QUKB 2AJ3A 3VD3A 4HHAB 5DMIL 1J11A 4JLRA 3U9UA 1GZQB 4U6VL 3O6KL 3S37L 5FB8A 3CMGA 1QFWI 5FYKU 1DQLH 1E4XL 2P5WE 4BZ2H 4L4TD 1QFUL 3ULVC 3ULSA 3EJYC 2E9WA 4P4RB 2XNAA 5CEXA 4GKNB 3IDIB 1KEGH 1G6RL 1KB9K 5JPMB 3BE1L 3MRRA 3HRPA 3MGAA 3HFMH 3LN5B 5E9DB 4PRBB 4NCDA 5CD5C 1WZ1H 2VDMH 4OGXH 4L9LB 1LEIB 4PJXB 3K7UA 1BQHB 5F8RC 2A2QT 2CDGB 4ZFFA 3ET9F 3MA7A 4PJFF 1CF8H 5T5NG 3P77A 4P3WA 1F13A 1UH3A 4RFNB 1QOKA 1SMOA 4ZTPL 4RGND 4JHAL 1R24B 3LZFH 4NYLA 4Y8DC 4WWID 3RUGA 2Q86B 4NC1E 1T3FA 1WC7B 2R1WA 3RTQD 3ILQC 4YHKH 3ARTA 1XGRB 3IFNL 5T1KD 1CL7I 4KRPC 3OSKA 3TT1H 2DAVA 4HWZB 5IT2L 4MD0A 3JVGA 1SYVB 1UQSB 5JDJA 1U58B 2X1WL 2DQHH 5FGRA 1MJJA 3HI5L 3L7EB 1PEWA 4FQIL 4PJAB 4H26B 1P4IH 3TGXA 5D7IB 1L7TL 4HD9A 1NL0H 3BO8A 3LKQA 4WFHD 5F1NB 4FQ2H 3EO0A 2F19L 3BSZL 2MHAA 5D2NA 5C07E 3T77A 1IGJA 2XRAH 3KPPB 2QBWA 5JO5B 3QIUD 5CGMA 5J12B 1HE7A 4N1HB 2X4SB 3BPCB 5EUOB 1A6AB 1G84A 4PJFA 4QTIL 1FNEB 4XWGL 3UZVB 3UROR 3MXVH 3RWFB 4ZDHA 3VXQA 4I5BA 3WUWG 1KTKE 4WHYG 4QEGA 3UZEA 4FXKB 1F2XK 3MRPB 3RVXD 3S5LB 5C0RL 2VWEC 5D1QD 3WEXB 3JWOL 4MD5B 4OD3H 4RGOL 2KBGA 3MV9B 3HKFA 4WUUD 5K9OB 5J6HB 1WZKA 1B88A 2VB5A 3NA4A 3FFDA 1YMMA 4HKBB 4P59H 5GRUH 1P6AB 2VITB 1NPUA 4WEUD 2I9TB 1T1WA 1EHNA 2P42B 2GI7A 4L8DB 3MRIA 1A7NH 5JLZB 3P0VH 1K8IA 5F9AC 5CWSA 1G7HA 1VACB 4RNRB 4TNWK 2HVJA 4HF5H 1FJ1B 4FMFA 1JN6A 4PRHE 4N0CC 4XMLL 4NKIH 4MJ4A 2X41A 3FN0L 3QDME 3DO7A 4RA0C 4ZUVB 4GMSH 5EBMA 5GRVK 2R4RL 3PQYD 3U1SH 4PJ5D 2FEEL 2F53E 1OB1A 3SBWC 3LEVH 4WI5A 1MOEA 1TQBB 1ZANL 4HLJA 3EFFB 1MY5A 4UV7H 3CK0L 3DHMA 2V7HA 3RA7L 1A7PL 4OZHF 4AEIL 4U0QB 4I0CC 4LKXB 4FP8L 1T7YA 3EOTL 3FFCE 1RY7B 1ORQB 4NQSA 1NFDE 1MHEB 4EN3A 2P5ED 4LLYB 3NABH 4FRWA 1AE6H 3BDYL 3OAYK 4HXBL 5DA0B 3JUYA 3WV0A 1CR9H 5EA0L 2E3VA 4LQFH 3ES6B 4EUPH 2IANE 2OTWA 4KI1A 5BZWA 1BZ9A 4X6DA 4MJ6B 4O9HH 4X4XB 1DP0A 4KVCH 1E27A 2VLKD 1F02I 5DVNA 4OV6F 5GGSY 3NFPA 5GGSA 4NNXB 5IB2B 3T0EE 2E7HA 4MB5A 2D9CA 2DQFB 5T33L 1E0OB 3P0YL 1QP1A 2VLJD 4KY1H 4ONGH 2ERJB 2VXQL 4XCEB 3RZWA 5BO1L 1D5BA 5FYKH 5KVEL 3HE6C 4MJIA 2WQ8A 4JKPL 4Z0BL 1A6PA 1CXIA 3P4NB 1S9YA 4HJJH 3MR9B 4XPGH 1MCOL 3CDGA 4C58B 4Z76B 1CE1L 4LEOA 4D9LL 1K2DA 1FSKC 3LPGA 1ZVHA 4GQPH 4F2MA 4NM4H 3SDXE 4Z6AT 2VDPL 1TVHB 5IHZA 5LBSH 1FVDB 3N85L 1T2JA 1MRDL 2VH5L 5HHPB 4XBGB 4WFEE 4G80B 1II4E 4AT6A 1AXTH 2GY5A 3SCMD 4HPYH 5IVZB 4O2FA 5E94A 1RJZA 4L4VA 4XNMB 3VXPA 1JWMB 4FFWD 4I18C 4M9OA 4YPGA 5GSRB 2XFXA 3WE6B 3STZB 3EW3B 2D0HA 1E4XI 2E7LA 2PR4H 3K2MC 4BKLB 2YA0A 4P99A 3ARGB 3PHSA 3PP4H 4KUCD 5J6GB 3S96B 4RDQF 4MCYA 4YE4H 3GHBL 4JFOA 4JFEE 4JFDD 5JXEA 4WGWB 3VI4F 5D72L 1OQXA 3VWJA 2H2PC 5FYLE 4RQQB 2HRPL 4YH6A 1RZ7L 4K3JL 4LHUA 5T5FL 2DICA 3EYFB 4JREC 4PV9B 2OR7A 2ILLA 4KK8C 4MNGB 4AL8H 3CU7A 3G04A 1TVBA 3MRJB 4YDVB 2BVOA 5FKPB 4M8QA 3BN3B 3D2UA 5DMKB 5ADOL 5I71B 4ZAKB 1SEBB 2MQ0A 2MWCA 4K3HA 1JHKL 4XPTL 1LO0H 2CMRL 3NIFE 3LKNA 4YDKL 4QYOB 1A64A 2GT9B 4LQ1A 3T2OA 3JV6B 1ZEAH 2VDQH 2ZKHL 4WU5B 5IK3B 3TBWA 2VNCA 2OL3L 3U7WL 4OLUH 5F7FA 1FRGL 4MQTB 4HQQH 4PJ9C 3U9PH 2DQJH 4F33B 2Q8BH 1AIFB 3WS6C 4PJIF 3QULB 3OR6A 1P1ZB 3LQZB 4MA3B 3VCLB 4FQJH 3QG7L 5I1EH 3PWVB 4JRXB 1I7UB 1HSBB 2LFGA 4YFLF 4HK3N 1VERA 3KLDA 4D0DA 4ETQA 4U3CA 5TPWH 4JFXA 1F3RB 3QUKA 4WEBL 5EPMA 1CYGA 4HUWB 3WLWC 4XP5L 4PY7B 3MGOB 3TCLB 2BSSA 5FOBB 1ZA6B 3G6JF 1T0MA 1UZ8B 4PG2A 5D8JL 4HBCL 5I75C 1U3HC 4PJGE 1JTPA 3IDIA 3TO4B 2V2TA 1PY9A 2B0SH 3BUYB 3VFMB 4ZD3H 1Y6NR 2H3NB 2Y5TA 3MV8B 5DJXA 4NHCL 2NY1C 1YC7A 4WY7L 3LN5A 4PRBA 3MRDA 3E6FB 4HIXL 3OJMB 3HAEG 4L9DA 1UXWB 2QHLA 1YNKL 5DJYB 1FDLL 3TJHA 1AXIB 5CJXA 4LDLB 5EOCJ 5C0ND 3QA3A 1MFBH 2AP2A 2H45A 3HUJE 5DD3L 4ZXBD 2W92A 4U1MA 3PUCA 2NYYC 5MHSE 4DTGH 3L3DB 4OLXL 1FL5A 2X4QA 1YN6B 1MVUB 2J5LB 3W9EA 3MLYH 4LF3B 2OMBA 4ZTOH 1P4BL 5JHDB 1UH4A 3GMQA 3G6JA 3NIDF 3RX8A 4DGVL 1H15A 2O61B 4X80H 5CBEA 1FFQA 4A2LA 1FFPA 5EBWB 1MHHB 4H26A 1P53A 4HUUB 1A3LL 5I1LA 2J6EH 1BIIB 2D3VA 5F1NA 1AGDB 3H0TA 5JO5A 3MJGX 4OF5A 5J7CC 1S7UA 4Y5VB 2ZCLL 5CEZL 1IEAA 1ND0A 2AQ1A 5ICZA 4YX2L 2GYSA 2BDNH 4NQXB 1YEEL 4YXHL 3WKML 1WLHA 5AD0A 1WBYB 3K81A 1KPUB 1G7PB 1FNHA 1EFXD 2YHGA 4V2BA 3RL1A 4OTXL 3MV9A 5TQ0L 1OPGH 1JGLL 2FJGA 1NJ9A 2V7NA 4NUGL 3DHJA 4HKBA 1J0HA 2ZUYA 4JDZA 2IQAA 4B50A 2VITA 4JRYA 5DJAA 1PX4A 4LVHC 3NFNA 3CX5K 4L8DA 5DUMH 4GRMB 1KENL 1A3QA 2R2BA 1UA6L 2VLME 4KI5E 3VA6A 1ITCA 1FE8H 4OZ4A 3HR5B 2HH0H 5J3HC 8FABB 3DVNA 4NFDA 1FJ1A 4F9PA 2B2XL 4M7KL 4P4KA 1AJ7H 1F90H 1HXYA 3FO1B 4J1UB 4O51A 3RJQB 1ADQH 1PVHA 1IQWL 4PJ7F 4RAUB 5TFSH 2YBRB 1GIGH 2JELH 3QUYD 1L6XA 1GGCH 5I1JH 4M62H 1H0DB 3SE4C 2B5IB 1Y0LA 3IAQA 4QRPB 3DMMB 3MRCB 1FYHB 3D0VA 3V0AC 3ZE0F 3AS2A 3BPNB 5SV3A 4F3FB 5HSFA 4D9QD 2YUVA 4RMVA 3MLSL 1TJHL 2WK2A 3SJVB 5HYSA 4NQEB 4KGJA 1GGIL 5DHVA 1MSPA 4PBXA 4NHUE 2AQ2A 4RMRA 3UPRB 4EUPB 4PRPD 3BRFA 3PWJA 4PV8A 3CSGA 4MJ6A 4ELMB 2MPAL 2OQJB 4ZYKA 5D1XB 4NQDB 2IFFL 2D4DA 2HFFB 2WBKA 1BREA 1KGCD 1WISA 2IAMC 2LAAA 3CUPB 3QT2A 4YWGL 4KZDL 3H7LA 1UM5L 3LD8B 3T08A 4NN6B 4RAVA 1JTOA 1HN1A 3QFJD 3BP7B 3V4UL 1BOYA 1LE5A 3KYAA 2JK5B 3NMEA 4NM8L 1KB5L 4WV1C 2OJEA 5DJZB 5DWUH 5IMKA 1HIML 3PL6B 5J56B 4RIRB 3H3PL 5FF6B 4XMKL 5CSGA 3RZCD 4JN1L 4JVWA 15C8L 2YC1A 4AENA 1OP5H 2DQIL 4KMQA 1SVCP 4GUPB 4G6FD 1CGSH 4XAKD 4W70A 2Q6WB 5CFHA 4KHTL 3VFTB 2CRMA 4HDIA 2HT4C 1LDSA 4D94A 3U4AA 1FVDA 1D5ZB 3QUZC 5ICYB 1QR1A 3RGVC 3MBXH 2BXYA 4I2XA 1LP9E 2EDBA 4TSAH 1LE9A 3FHQA 1NAMH 5I8CA 3FQRB 1RZKL 1MIEH 3D87B 1Z9OA 2IG2H 4Y4HA 1FQ9C 1JJUA 5DFVD 4P23D 2ZOKB 2RQ8A 4XNMA 3GIVB 4PGEB 2ZPKH 3RRQA 1F3DJ 5GS1A 1WFUA 2AV1A 5FYJE 2QJDA 4X9FA 4KK9D 4Z7NE 3OF6D 5DJCB 1Q0XH 4NO3B 4TPRL 1IC4H 3SDYL 3ARZA 3EDDA 5HHXL 4HWEL 3B6SB 1A1OB 1T21B 1BD2E 4JFFD 1ZHLA 4EQ3A 3OXRB 3ULVF 3FB8A 3U46B 2P8PB 3FO2A 4OUUA 2WP3O 4JPVL 2G5BB 4NZRH 1IM3B 1J1PL 2I07A 4GBXD 5J0BA 4JEGB 1DN2A 1JPTH 1CS6A 3WO4B 5FGCB 2B4CC 5BVJA 4X7EC 3QWRD 3TIEB 5TQ2L 3HE7A 5FCSH 1HHKA 5E4EB 3QUXB 2EIDA 4RQQA 3S34L 3FMGH 2ZSWB 3DURA 1WFTA 3EYFA 4PV9A 1NCCH 4ZPTA 5IHBA 2VSCA 3AXLB 4FG6D 1N5YL 5DMKA 1CICC 4OCXL 3MRKA 1OAYL 3DRTB 3I3DA 4Q74A 1CDYA 3JV6A 5SWSB 1JPSL 5I1HH 3GI9H 2I9LA 3QDJE 4YXLH 1IFHH 1Z9SA 1XF2A 3RWEA 3MZTA 4HFWB 4DFHA 3O2WL 5JPNA 3PWUB 5DI8B 2FJFB 4F33A 4L4TE 4CGTA 4X9GA 4O02L 4U6XB 4QOKA 1DQQB 3QULA 1A14H 2FYYB 1C16A 3C08L 3BZEA 1QLEH 3LQZA 3QQ4B 2CIIA 2C3GA 3DUHA 1NEUA 2XXCB 4RFEB 3DX8B 3LIZL 3RVUD 1FV1B 1HH6B 4M1DH 3IT8D 4LP4A 4PJBB 5DZNA 1I3RA 2MCPL 5FHAL 1XGPB 3PABB 1T04B 2NY2C 4I9WD 1N2RA 3MLTA 3RX5A 1DBKL 4IHOB 4DN3H 1TZHB 3HS0A 3LHPH 3DBXB 1NMCB 3BKMH 2GK2A 1MI5B 3GB7A 5DRZB 4QHNB 3V6OC 4PGCB 3BUYA 3LKSB 3QQ9C 3VFMA 3BGFB 1FNSL 2JJTC 2H3NA 3QCVH 2PTTB 3MV8A 4Q0XH 5HHOB 3OL2A 3TT3L 3E6FA 4LHJB 1WIPA 3UO1L 2APFA 4LP5A 2BSTB 3PV7A 4ZPVB 3IFOB 1OCWH 1YY9C 3VFPB 3VXUB 1AO7D 3QIWB 5HHME 5E03A 1BWMA 1UM4H 4WFHE 1LEGB 2FZ3B 4MVBD 5FV1L 1SBSL 5IQ9A 1LEKB 3V79C 3PXHA 1QBML 3V0WL 2XOTA 3VH8A 4P57A 1S7WA 4HCRH 5LXGH 4KHXL 1A7BA 4FQHA 1Q8MA 3ARSA 2EE2A 4PLOB 5EFIA 1Y6KR 2HT3C 4HIEB 4K23H 5CKGA 2H9GA 2DI7A 5FXCH 5D96C 3QJHA 1V7ML 2EZ0C 4TSCL 2AK4A 1NCAL 4M61B 5C0BA 3CLFH 5D7JC 4ENED 1AGDA 5I30H 4W81A 2YPLB 5SWZD 3D39D 3MCKB 1HH9A 2NR6D 2E7BA 1NGZA 4I77H 1OAUL 4JHZA 4M5ZH 2XA8L 4M4PA 4NN5B 1RVFL 1T66D 3VE0A 1FCGA 3C5SB 3CDFA 4QHLA 4XNXH 3DARA 2ADFH 1IGIH 4NQXA 4N0CA 4XVUC 1KCKA 4EXPX 1WBYA 4D2NA 1ZA3A 3NCJL 1FVEB 3SBWA 4GW4B 2C3WA 5HGDB 4JB9L 4BQ6A 5KJRL 2ARWA 4N90D 5C8JA 4NRXB 3PQYE 2F58L 1ZXQA 5D6DC 4ZUWB 1IL1A 1LO4L 4IRSC 4OCYH 5B38G 2CPCA 1CXHA 3BZ4B 4XPAH 4JR9H 5KSUA 2JIXB 2LE9A 2R2EB 2JB6B 3E8UL 5ERWA 1CGXA 5KSVB 1BFVL 2X4NA 4M03A 1I1FA 3J7HA 4JY5L 3N1GC 3FZUC 3MQIA 2EE9A 1KG0B 2ATPA 4TOYL 1NGYA 3GDBA 2H26A 2D31B 4P2QD 4NO0B 2OZ4H 4Y89A 1RMFL 2D0GA 2BK8A 2NZ9D 2ARJA 5EZJA 3O3EB 1PY4A 2UUDH 4GKZB 1RZFL 4TSBH 4IIQC 3RVWC 3MRCA 5I1CL 3BVNB 1CFNA 3FOLA 3UBXI 3V2AR 2VLJE 3TVMC 4F3FA 2R0ZL 2JCCB 4HULB 2VLRB 4YHLH 2X7LB 4HFUH 2W9DL 3ZSSA 4Z7UB 5E2VL 2J4WH 1L9MA 2PCPA 3AAZB 4XI5D 1I1AD 5AWNL 4XMPH 4DW2L 1S9XB 1OM3L 4JZOB 3MLUL 1D5MA 4PD4J 3O11B 3TF7C 3OKEB 3D85B 2I25N 1J5OL 3D5OF 5JUEL 2OLDA 5GJTL 1X4ZA 5C09E 2FBJL 5KVDL 3KPOB 3F7YB 1MHPL 2O5XH 4J23A 1AKJB 5FYJU 2XN9A 1K4DB 3CLEH 3GSRA 3DPBA 3Q3GA 1EVTC 1I7TA 5JHLH 3W0WA 2R0LH 2X05A 3O8XB 4I18A 1XCTA 3VXMB 3BFOA 3U0PB 4D8PA 1EHXA 2ESVA 4GUPA 4E5XA 5DD0H 3AGVA 4PJCE 3IJSB 4R26L 3NOIA 2VAAA 2DBJA 1S7XB 4TUOA 1RAMA 3HZYA 1EJ6A 5ICYA 5HGHB 1CLCA 4Y4FB 3H9HB 1ZGLA 5ENWB 1FGVL 4L3EE 4YZFF 4OI7A 4RRPA 3LN4A 3RDTB 1CQYA 4PJDE 4DZBB 3N9GL 4PJIE 1NC2B 4QHUB 3T3ME 4JFDE 4Z9KB 5IW6B 1KELH 2ZCKH 1AHWB 3O9WB 5ITFB 1OAXL 4G8GE 5LGKA 3MFGB 1NGPL 3CJJA 4PYHA 5DJCA 1EJOH 4NO3A 2APWA 4H88L 5BRZD 1I75A 1WITA 4NKDB 1WCQA 1TXKA 1T21A 5GZND 1CDIA 1CQKA 2AEWA 5EU4A 4JPKH 2PXYB 4MAYD 1D6EA 2OTUB 3LOWA 4MXWH 2GAZA 4H8WL 3GBNH 1L9NA 1KJVA 5J13C 1MCFA 3W39A 3PDOB 2YSSA 4MAUL 4PS4H 2MOVA 3ZDYF 4PJ9A 4Y16B 3WS6A 4PRHB 1AY1L 4L29B 1YECL 1NUNB 1GC1L 4PYGA 2EH8L 5F6HI 5F7LB 1FL6B 3QUXA 4JGUA 3P9MA 3GUTB 3IDYC 1B2WL 1G9MC 4JHBA 3DETC 2DQCH 3GSQB 5A2JH 2X4RB 5E2WL 2CDFA 2A74B 3SE8L 3AXLA 2JJSA 5HHNB 3RVVD 2XTJC 1H8OA 2W59A 4FQXD 4AG4L 3IFLH 3S36H 3OKNB 3TM6A 4J6RL 2PKDA 4X9IA 1I9EA 2IGFH 1YEJL 5EOCH 4UAOC 1VENA 5F3BA 4QHMB 2EC9U 1U3HA 1EUUA 3KPSB 1RUAL 3MRHA 2APBA 4N0YH 4UTAH 3EOYG 1GGBL 4U31A 1BFOA 2Q7NA 3QQ4A 3R06A 1C5DB 2JF1A 2Z93B 3V95A 2C3VB 3QHTC 1MJUL 1T80A 1HH6A 4U33A 2PYEE 2UUDK 4Q97A 3H9SA 2I24N 5GS3A 4EKXA 3U30B 3OX8A 4NQCB 2C1PB 1J1XH 1NCBH 4K8RH 3SQOH 3DX7B 3DBXA 3C9NA 4L8BA 2AABH 5DMJB 5DO2C 3JWDL 4JCMA 1XGUB 1I1CA 3GGWB 3PHOB 2Y7QB 3LKSA 1Y6MR 2A6IB 4HBQA 3D3VB 3KYMA 2IH3A 3ZDZE 2B1AH 1DLHB 4WHYH 2EYRB 4MDJA 3KPNB 4R8WL 1CK0L 2CKNA 5I19H 1NQBA 2XWJB 3C60B 4Z5RB 1ZLSH 4G6KH 5GQBA 5EG6C 3P2TA 1J12A 4F7PA 1MFNA 1KNOB 5FYJH 5HGAA 3HI6L 4LSRH 1MCEA 2DYPD 3RL2B 1VADB 4YK4C 3JWNC 2W1NA 4Y2DB 4B7IA 3IAGC 1OT2A 2H32B 3HZVA 4BZ1H 1QVOB 2FECI 4PJ7E 1FC1A 2NXZD 3ZHKA 4NWUH 4HS8L 2QV2A 2GCYB 4G9FD 4OGYL 4NGHH 5GISH 1OAZL 3Q6GH 4MXQC 5BS0E 1F4YL 2HKHH 3RJDA 1DUZA 5GHWL 2AJXH 4HZLB 3HCVB 1U8OB 4OM0L 2CIKB 2F54B 3OAUL 3N1MC 2XWBB 3VXRA 3SKUD 3ISWA 1U6AH 5C08B 2VDKL 4LLAA 4NJAH 1CT8A 5BVPH 4NUJB 5DJDA 4GAFB 3RP1A 3C5SA 4MA1B 3BOVA 2R0WL 5F9WB 4UIKL 1TETH 2GQHA 4ODVL 1B3JA 1G7QB 1YMMD 4GW4A 1W2KT 1NUDA 5EZIH 1MLBB 2DI9A 3SE4A 1E6OH 1A5FL 4PLJC 2A38A 3DJ9A 4MYWB 4POZD 1XR8B 5HHQA 4XB7A 1AR1D 4DAGL 3QWOB 4LSQH 4U1NA 5CCKH 1S7QA 4LCWA 3MNVA 4OZGB 1A02N 3GM8A 3I9GH 2K1MA 3OZ9H 2OP4H 1MAMH 4IS6A 2JIXA 4LPVA 2XIDA 2BRRL 2JB6A 3NTCL 4KJQD 4H20H 4OF0A 3WFCH 1DQJA 1UYWH 5KSVA 5EN2A 4Y5YC 5GS0D 2AJSL 4GS7B 4V1DA 1WWAX 1YEHH 3A67H 1HXMB 1HHIA 3AREC 1YEGH 2BOCB 1HINL 2D31A 3L5HA 3GK8L 4PRPE 5IF0B 4OLZL 5KVMC 1QD0A 2IAMA 4NDMB 4Z7OE 1BX2B 5EC2A 3O3EA 1A9BB 1ACYH 1KGCE 3VW3L 1VFUA 4JDVA 5HI5D 2O5YL 4XPHL 3INUL 5LGJB 3F65A 3QFJE 1UB5A 3QAZC 3GMNB 3QXDB 4HLZG 2ORBH 1RURH 5EDXA 4I0PC 3CVHB 1YJDH 4G6AC 4U2ZA 1CZ8H 3PXJA 3QR2A 3OXSA 1MLCB 5C70A 2X4PB 4AYFA 4F80A 3CSYA 1EGJA 1F3DH 1XF5A 3R1GH 4DGIH 4G42B 4P3CH 2R9HD 5DQJB 1QSFB 1JV5A 4IRJC 3RGVA 3D85A 4LSSH 4S2SB 3IKCA 3E3QC 1AGFB 1F8TL 1ZAGA 4MJID 4G6MH 3CPLB 5IROA 1H3GA 2D03L 4ZUTB 2GK0B 1GPOL 2BXZA 2FATH 1MFAL 1N7MH 3N50A 3O8XA 1FO0B 4XTRC 4RCAA 1UT9A 5H35B 4Z7WA 3UBXG 1RU9H 5IVXE 3MRLA 4YR6B 5HGGS 4K94C 4HX1B 4KTDH 1FORL 3TPUB 4Y5XC 5JDSB 3TESA 1KLUB 4PG9B 2VJXA 1FN4B 3LQAC 4S1RL 3HNSL 3ZO0A 5IFJA 1JGUH 3V5HB 4R2GD 1T7VA 1U8QB 4JFFE 5F88A 3EDKA 4JDTL 2Q20A 2DKUA 4L4VD 1SJEA 1AQKH 3QXUA 2Q3AA 3LRHA 1INDH 4HH9A 5HYIA 1GAFL 5KS9E 5ESQA 2QQQA 1UFUA 4GXUN 3EYOB 2AEPH 1AHWA 4LARH 3IDYB 2W60B 3VFVB 2EDXA 4OFVA 3O3DB 1AFVH 2HRLA 3DX6B 5I1IH 4NKDA 4I4WB 1E28A 5DEGA 4MNHB 3PF2A 1CICA 1U8LB 2X4UB 2R69L 3ZKSD 1NBYA 3QFDA 4JG1H 4YBLB 5C0AA 1J05B 2OTUA 3VWJD 5E99L 3ZMRA 5DDHA 5F7DA 2COQA 1XZ0B 2F5AL 1NBQA 2UVFA 3BWAA 3LS4H 4UBDD 3VMOA 2WP3T 4TTGA 3UZQA 5I18L 4QXGH 1FL6A 3P73A 1RUKH 1RIHL 4IRZL 5IMLB 3D2UD 3LDBB 4ODSL 1T1ZA 4EI6A 5KOMC 1IAOA 1A6WL 1FHGA 1CIDA 1YEDB 2NXYD 3RPIB 3FTGA 3G08A 2WWMD 4Y19E 1C5CL 3V8OA 4NQTA 3HAEH 1T5WA 3HNTL 5F7EL 3QJFB 4I9WE 4LPTA 1NBZB 5TF1H 1YDPA 4P2OC 4QKXB 2NY6D 1KYOJ 3G5XB 4BH7B 5B3JE 2F8XC 1W0WA 4FFZH 3GO1H 3V6OA 5GZOD 3OKMB 2CQVA 1UADC 2JJTA 4JO3L 5F7HA 3RKDC 1I9JH 4X8JA 4EIGB 2NTSP 5IQ7L 1CG9A 1C5DA 3R0NA 5TE7H 1PDKA 2VXTH 2ZSVA 2EKJA 4UT9H 3OB8A 4KJPC 3FRPG 1N3NB 3BQUC 4P49A 3FQTA 3RIAK 4PJHE 1U9KA 3HPJB 2HT2C 5I1DB 4HGWB 3WXWL 2XKNB 4ONFL 3CFIC 3ZYIA 2CK2A 2EYSB 4ZS6C 3MV7A 3DX7A 3I6KB 2MJWA 5FDWB 1CFSB 5IW1A 5E08H 4I48B 3I50H 1DBBH 3LB6D 3TWCH 4QWWC 4ELKA 2R4SH 3RNQA 2J88H 3PHOA 4ODTL 4EXKA 4WJ5A 1VKXA 1JF1A 4GW5B 3VXOA 1KCGC 4O2CA 3TJHD 4OI8A 4XGZB 2UVEA 3DXAB 3T0WA 4HV8A 4NNPH 1CFVH 2Z8SA 1PX3A 1CLZL 1XGYH 4DKFH 1KJ2B 4OB5L 5F6IC 4MS8C 1JNJA 2GW5A 4AH2A 1CL7H 3QEQB 3JBG7 4E42B 2HYMA 3EO1B 2DQDL 2YWZA 1MEXL 3NVQA 2Y6SC 3CVIL 3D39E 3RL2A 1IQDB 2Z31C 1VADA 4S11A 4R4NC 4JRWA 3V4VL 3HG1B 2H32A 3NH7H 4WTWA 2X4TB 1V7NL 1KN2H 1JMXA 4OLYH 4KQ4H 5F96L 1MJ8L 5I66B 1G0DA 5I15L 5INCB 4BSJA 4DUVA 4MD4B 3SGJC 3O0RH 1OVZA 1JPGA 4P9HL 4F58L 2WQRA 3QRGH 2EDTA 4IRSA 4N90E 4N8VG 2XWBA 2XZCL 2VISA 5LAXB 4OCRH 2WZPD 4OBRA 3A6BH 5L2KB 1NLDL 1T5XB 1X5XA 1M7IB 1J1OH 5DTFB 4BSVB 1NAKH 5AZEL 3MNWB 5CP3A 3MV9D 1DANU 4PGDA 3HHRB 2FB4L 3ZE2F 1HOCA 4LSTH 1SEQH 3MRMB 5JNYA 4LPXA 4QRRB 4XRCB 2AKRA 2FGWH 4IIQA 3MUZ1 1P7HL 4KVNH 3QWOA 3H3KA 4NZUL 3Q1SH 2ZJSL 3TVMA 4PR5A 3VRIB 5AG9A 1GXEA 1RUQH 3MRBA 3C5JB 3BZFB 4XPFL 4V3EB 3JTTB 2BCKB 4M48L 4WW1A 2DIJA 3SDCB 3DNKA 4Q58C 3DROB 3W11C 3TNNB 3MLZH 2PNDA 4KK6D 2DQUL 5HDLA 1REIA 3O6ML 1CFTA 1DBMH 2GJ6B 3VRLF 4Q9RH 1A7OL 4A6YH 5ESAB 4O58L 3SKJL 1XCQB 1P2CA 3CCHA 4S0UC 3VGHA 5BZDB 1EERB 3FQXB 1R5VB 4X6BA 5BV7H 3T1FA 3N06B 1BZQK 1TQCB 1L7IH 4RGNB 4TUKL 1MNUH 5LGJA 5EU3A 5DRNA 2E9BA 3RTQB 5EO1A 3EUUA 5E1AB 2GJZA 4JO4L 3C6LB 5T1KB 1C12B 4V2CB 1EFQA 2WBJB 3S7GA 4QLRA 3HNVL 4D0BB 1MUJB 2YRLA 2YXMA 1ZT4A 5L2JB 1KOAA 5JMOC 1EXUB 2VDNH 2M8XA 3ZE1F 1QSFA 1NMBH 3EFDH 3C5ZC 3MLXH 1MREL 1R5WB 2F5BH 3FT3B 3O4LA 3CPLA 3DTXB 4ZO9A 4YDJB 2PUQT 1HDMB 4I1NB 5IBLC 3FO0L 3HC0B 5IB5A 2VL5A 3RY4A 1BQHG 3MRGA 4PB0L 3KGRA 2CXKA 1AI1H 4WUKH 5F1IA 5I6XC 5LJYH 1DVFC 1FO0A 2NY0C 4KXZI 3ILPA 5GSVA 1TLKA 5D5MF 2DQEH 2VAJA 1EHLH 5DVMA 2LABA 1H5BB 2A6DB 3QEUB 1X5IA 4NKMB 2QQLH 4WUUB 4MDIA 2Q76A 1INQB 5TE6L 3V5HA 3X14B 4EVNB 3P11H 4GSDH 4GW1B 4H25B 3SQBA 3GIZH 3WDJA 5ITBH 1JNNH 3UTSE 2A0LC 4LVOC 3TZVB 3A6CL 4P5KA 1CLYL 4I8DA 2D0FA 2AS5M 5DMIH 3MRNB 1Z5LB 1P69B 3OR7B 2CUMA 3EO9L 3FT4B 4MCZB 5EIIA 4U6VH 3FQUB 3O6KH 3S37H 4LAQL 1OGAE 1QLRB 2ZWLT 1E4XH 1OTSC 3RKPA 1BAFL 1QFUH 4JFHD 4PB9L 2CKBH 1TFHA 2CO6B 2X1OA 5CUSH 2QL1A 3WIFB 3D69B 3ARGD 1YUHA 4PRIA 1CTNA 1TITA 3I75B 3RAJL 4PJ8C 5GGRB 4PJ5B 5D5MA 3BE1H 3TIDB 5C71A 5F1SA 4OM1L 2GJJA 3QYCA 1YN7A 3LEXA 4CDHA 1G7LB 5CBAA 5DVLA 5EU7E 3W9DB 4KPHH 4KTYA 2Y1VA 2R8SL 3S5LG 2MTPA 4J12A 2BOBA 4XCFL 2ED8A 3JV4B 2P5EB 4CVUA 5A3IC 3BRGC 3BHBB 4QT5B 3HE7D 1CD8A 4ONHA 2DL9A 3OKDA 2CUIA 1LO2L 4PRNB 5BMFL 1XZ0A 5D9SB 5SWQB 5E8DL 1QRNA 1MCWM 4K9EH 3RU8L 2P7TA 3KR3L 1FCCA 4M6OH 2ICEA 4N68A 2J8HA 5IM7B 2VLKB 3D48R 4EI5C 3MRFB 4ZAKD 4YNYB 1NGWA 5IT2H 1Z6JT 1WEJH 3ZKXB 3ARDB 3WLBB 4BH8A 2R2HA 3ARYA 4S0TD 4G5ZL 2CXGA 1D3CA 4JAMB 5B22A 5GJSH 3VRJA 3RPIA 1KSRA 3EJYD 4FQIH 3IF1B 2KH2B 2NY3C 1L7TH 4J3WA 4NP4H 3PWNA 4DZ8B 4GO6B 5HGBA 4RA3A 3X13A 2F19H 3MRQA 2OR9L 4QOKD 2QSQA 5E5MA 2W65A 2E8ZA 3KPMB 5CD5D 4HEPG 5MEOB 4OFDA 4ODXB 3EDJA 3OKMA 5FO7A 4R0LB 4WVRA 4XWGH 1ZTXH 2YK1L 1R3JA 4NC1C 4TNWF 5TJWK 4JANB 5HJ3A 3OJDA 4JN2B 2IFGA 3GEWB 3IVKB 1RZGB 1N3NA 3T8XB 3SO3C 3QNZB 2ZCHH 4GG8B 5E2UL 2IPKB 3JWOH 4AM0A 4RGOH 4YO0B 5I1DA 1QSEB 4HGWA 2XKNA 2AXFB 4FABL 4KRPD 1JCKA 1FYTE 1MCIA 1OSZA 4HPOL 2EYSA 3NA9L 2V17L 5CP7B 1Q9LB 5BJTA 4LNVA 3CFDB 3MV8D 5I8EA 4LLWA 1CFSA 2W0KA 1YMHB 4GFTB 2WY3A 35C8L 1K8DB 3EJJX 1R3LA 3PWPA 1I4FA 1CU4H 1KFAH 1N6QL 1U91B 4MXQA 3UMTA 5B21A 4G9FE 4XMLH 5JQHC 1M1SA 1MQ8A 3FN0H 3DXAA 3BGMA 5D2NE 2R4RH 3L1OL 5ETUA 1KJ2A 2CH8A 4W6YB 1M05B 4R97C 1EGJL 3VFUB 3CK0H 3RA7H 1A7PH 4AEIH 5IJVB 5J1AA 5JW5B 1TZIA 3EOTH 4NO2B 1IQDA 5JHDD 1B4RA 4WFGD 3RWGB 2X4OB 4HS3B 1OD9A 4QRUA 1P84J 5B8CB 2V9QA 3GRWA 3TO2A 1I8KA 4OI9A 4ZOCA 4GRWE 4HXBH 2YKLL 1IAKB 4UQ2A 4Y4KB 2AK4D 1VESA 2EIZB 1EIBA 4LEXL 4XXDB 3FN9A 5GRZA 4CRPA 4UI2A 5CGYC 2FO1A 5DT1H 1U41A 3EDFA 2IH1B 4BUHA 4LLMA 5DSCB 5T33H 3KNBA 1MCNA 3RWCA 2ADIB 1B6DA 5FDYA 1U8NB 4Y5YA 1BBJB 2VXQH 3KYOB 1F3JB 5IESL 2EH7H 5JIKA 4P46B 4LCUB 4JJHA 1WFNA 1YPZF 5GGVL 5KVEH 5I8KL 3AREA 4JKPH 1S7TB 4XBEL 4Z0BH 1OWWA 2DI8A 3E2HB 1MCOH 5FUCE 1ZHNB 3R8BB 3O6FC 2QQKH 4OZIB 3MRMA 1OF2B 2B4CL 4D9LH 1RUML 2BVYA 4XRCA 1XGQB 3RWIA 3WNNA 4HKJA 2AXGA 2VDPH 3GKWH 4HKXB 4X5XA 3IDMB 3SDAB 1I8IB 1OLZA 3N85H 4XZUA 3T0EC 1MRDH 3D25B 2VH5H 1N0XL 1PEZA 4RMTA 1HHHA 2MFNA 4KDTC 4I0PA 4JG0L 5DJ8B 3H3BC 1NEZA 2BCKA 2AV7A 4CL7A 1N8ZB 4QHKJ 4X6DE 1JRHI 1TZGL 3MUJA 1T6VN 3WFHB 3L3JA 1YEFL 2VUOA 1EH9A 4FTVB 2ZZUT 5IBTL 1M4KA 1TDQA 1YPZA 2EDDA 3VFWA 1FNAA 4IRJA 5KG9B 4ODHL 1HYRC 2AGJL 3NACL 3E3QA 4OZFB 5BZDA 1R5VA 3SJVD 1PZ5A 4NQED 2IALB 4XCNA 3T4AB 4MJIE 3AS0A 3MO1B 1T4KB 3M17B 3K4AA 5IWLA 3GHBH 1NUFA 5DMGD 3B9KC 5E1AA 2I5YL 1LO5B 4NQDD 4ERSL 4D0BA 4E0RA 4Y5XA 3F12A 1ZHBB 3CC5A 1YEIL 3BPLB 1EXUA 2HRPH 1RZ7H 4K3JH 3DVIA 4ZS7H 3S9DB 3V7MA 1R5WA 2XN9D 4C57C 4L3AA 4ZFGL 3PL6D 3PWLA 5EO0A 1U8MB 3GBLA 3W0WD 2V2XB 4U1HA 3DTXA 1MCWW 1HDMA 2YUXA 5ADOH 1JZ4A 3HC0A 5HI4C 5KZCB 1FGNL 4APQC 2CMRH 1NCWL 4YDKH 2ESVD 1IAIL 4LU5H 1VPOH 3QISA 3MCLL 4YPJA 2ZKHH 2GSIA 2VDOL 5C2BL 2OL3H 1FRGH 4J2XA 3BKYL 4X7CC 2RCSL 1NDMB 4Q6IB 1VEOA 1MRFH 5C0CE 4NKOA 1JUFB 3GMLA 3MUGB 3V9FA 3QG7H 2VC2L 4DVRL 3X14A 3S35L 3LPWA 4X6CF 4LMQI 2H2PD 5FFLA 1NCUA 3TZVA 2WANA 3QIBB 4WEBH 5T3ZE 5GRJL 1HHGB 3L7FA 5I16A 2UYLB 4PTUA 1EK3A 4XP5H 3KYNB 1VFBA 2AJUL 2APVA 5AUMB 1F4HA 1TMCA 5D8JH 4HBCH 5ICXA 1ZT1B 3D69A 3MA9L 4N8PA 3FAWA 4G6JL 5GGRA 1G6RB 3QUYB 4LK4A 4NHCH 4WY7H 1QA9B 5ESVB 2UY6A 1ROWA 2VZVA 1MWAH 3MJ7A 3WJLC 4PJ9D 3WIIL 5E7FA 1FDLH 5I73C 3JV4A 3Q48A 4XX1G 4M1GL 3BT2L 3CDYA 4P2OA 1P7QA 3QUXD 1BEYL 5E56A 1JZ8A 5IR1A 1A1MB 2V5YA 4J4PC 3ULUD 4HXAL 4OIAA 1JYXA 3WNOA 2HJFA 1F2QA 1JPFB 5H94B 1O7VA 2YD7A 2J8UE 4WO4C 5KSBB 3BKCH 2P47B 3VWKC 5IM7A 3AROA 2AJVH 2VIRB 5KN5A 1P4BH 1RZJH 2BJML 3BQUA 4HJ0D 3WLWD 3KJ4C 3U4BL 2HFEA 3IAPA 1N5AB 5JORA 3TFKC 3WHXA 1S7VA 4LASL 4KTEL 4MNQA 1BLNB 4FZEL 1U3HD 1A3LH 1PQZB 2QKIA 4X7SL 2FIKA 3L9RA 4AEFA 2EC8A 4DZ8A 4KWUA 5MENA 1JZ2A 2Z91B 4QXUL 1HKFA 5D2LF 3IDXL 3RZCB 1FNFA 1FBIL 1HYSC 2IADB 5E9DE 3FRUB 2ZUQB 4R7NB 4JQXC 4CVZB 4GG6F 4PJXE 3H9SD 3MOBL 1P7KA 1YEEH 4X4MA 3WKMH 4YXHH 4ZG1A 3K8LA 3BEVA 3OKLB 3IVKA 1RZGA 4AJ0A 1A0QL 1JE6A 1TPXC 4GG8A 4EUPG 4H0GA 2NYYD 3CFEB 4FHBD 5HPOA 1AGEB 4MS8A 4NN7B 4OTXH 5IIEA 1DTUA 1NKOA 5D4QA 2PTVA 2DQGL 5TQ0H 2FGZA 5HYEA 1JGLH 1XF4B 1H3PL 3U2SB 4NUGH 3MBEB 2Z31A 4WI8A 1D9KC 5CP7A 1GZPB 4PP2B 2RAMA 2JLLA 1YMHA 2XZZA 5EOTB 1KENH 2NY5C 3IU3B 3MMEA 5DZLA 3ZKNC 1UA6H 2BNQB 4UNTA 4YC2C 1T03L 3VD9A 1WCBA 1H3VA 5D2LA 1C1EL 3S3SA 2X9XA 3VXUD 4PJAE 1U91A 3U0TB 3KLAA 3QIWD 5D7IE 2VQTA 4M7KH 1A6UL 3SGJA 1I7RA 3EJZD 1JZ7A 1IQWH 1FNGB 2Z92A 3LKOB 4YDIL 1LO3L 1VFAA 4GG6A 3X11A 2V5MA 1U92A 4KKAC 5EUOE 3L3HA 4TVPL 4GAYB 3H7BB 2XT1B 4Z7VB 1NLBL 2BVQB 4LL9A 3RWGA 4HS3A 6FABL 2IPUK 5F72S 4P5TC 3MLSH 1TJHH 1J87A 1YC8A 4Z95L 1IAKA 1GGIH 4IMKC 3GSUB 1YEKH 4RWYL 4KI5C 4XXDA 3MV9E 4H1LB 43CAA 3GSVB 5EWIL 2YPLD 1KJ3L 1FO0L 2MPAH 2HAZA 4WTZG 4EOWL 3AMLA 4ZFZB 2ITDB 4M5YL 1U42A 4EBQL 3T3PF 5DRWA 3GKZA 3TBYB 4PGJA 1UACH 3QZWA 4YWGH 1D5XA 5J3HD 2IH1A 4RAHA 4KZDH 3QCTL 1UM5H 3MOAH 5MEQA 5D7LA 4N9GB 5TH2B 3DX9A 4LLDA 3ZDXF 3T04D 4Y1AA 2WWKO 2E27L 4UT6L 3G6AB 3V4UH 2EXWC 4NM8H 1KB5H 2ARJQ 1CGUA 1XIWC 3QQ3A 2FX8L 1YYMH 3KAAA 3H3PH 2WNGA 3B8YA 4RX4A 4XMKH 3V0VA 1IRAY 1KYOK 1UENA 5CMAA 3O6LH 2HN7A 4LCWD 4OD2B 4Z8FL 2G75B 3BZDA 1XGQA 5J9PA 4KHTH 2JIXD 4PJEF 1KXVC 1KPVB 1G9ML 2CD0A 3VGEA 3D25A 1NFKA 1KJMB 4K3DL 4V1DD 5DJ8A 5J8OA 5I17A 3UPAA 1QSVA 3D18B 3BXNB 4M93C 3F62A 4NO0D 2FRGP 2PO6C 5CGTA 3D6GA 2BY1A 2HFGL 3L3IB 3QCUL 4YGVB 1PKQB 4FQ1L 4K8RC 4K71B 4PRAB 1XF3B 3C5ZA 3QHFH 5HHXH 1AO7B 1WGOA 4K55A 1IJ9A 3OGCA 3VFRA 1S9VA 2UWEB 1HSAA 1JWUB 4RZCA 2C4FT 1X5LA 3GM0A 3PGCA 4PJEA 3VGAB 3AM8C 3KXFA 4JPVH 4C56B 1B0GA 1J1PH 2J6EA 3HMXA 4PUBH 2HT4D 1FFOB 3BH8B 2P48B 4L3CB 4LCCC 1UG9A 3RGVD 3HRZA 3I6GB 5EZLA 3D85D 5TQ2H 4GAGH 1EO7A 3WIHA 2EE6A 3DYOA 1RIVH 3O81A 2Y23A 1PW3A 1KCUL 2YD2A 1S9WB 1DBJL 1JK8B 2EDYA 3GJEA 4U0RB 3EYUH 3DRQB 1AKJD 1YY8A 2PW2A 4D9RD 1U8MA 4RBPH 5J1TC 4GKOA 3O8XD 5SWZB 1SY6L 1EEZB 3VXMD 3STLB 1DSFL 4BFIB 4OCXH 1OAYH 2CK0H 5CZXC 5L88L 4JKLA 4M6MH 4OAWB 2LAGB 1JPSH 1JHTB 3VGFA 1HNFA 3MZGB 4F7TA 4BQ9A 3N1QC 5AAWA 2C1OA 2OL3B 3O2WH 4JO2H 3LY6A 4PJ8A 2BHUA 5IV2A 2IBZY 4O02H 4R90L 2E5EA 2DWDB 3C08H 3RDTD 3WFDL 1ZLWH 2B8OT 4WIQA 5DYOA 3SGKC 3IGAA 5I0ZA 3M8OL 5KAQF 3LIZH 4FFVD 4AEEA 5FEBA 1NC2D 2YZ8A 3QDHA 4K3EH 5GIRA 2DLEA 4LKCA 4DKEH 3ESUF 3REVB 3O9WD 2MCPH 1J8KA 5FHAH 4LIQL 2YN5A 2PYFA 3SO5A 5GS0H 3IRPX 4F7MB 4PIRF 1DBKH 3KYNA 1G7MA 3VXSB 1KJ2L 1WQVT 4YIQB 2ITCA 2VQ1B 5AUMA 2P5WA 5IMMB 5GRVL 5MP6L 5L7XL 3VWKB 2OI9B 4EI5A 1CICD 1ZT1A 2A9NL 4P2QB 4MNGE 4RGMC 3VG9B 1AXSA 2X44D 1U3YA 2A9ML 3L5IA 3GRWL 4XC1H 1INEL 4NWTH 4XXCC 3TT3H 3V8CA 4NKQB 1I85C 3RQ3A 3UO1H 3QUMA 2M1KA 4NNYB 4Y16D 4WI3A 1OW0C 1RK1B 1I9RL 3MSPA 4EDWL 2RB8A 4ESKA 4AIOA 3WNPA 2BERA 5K9JL 5BW7C 2MKWA 5D1ZC 1SBSH 1A1MA 3QDGB 3REWA 1QBMH 3V0WH 1NH6A 4TNVK 4TTDD 1I8MB 1NMAL 2G2RB 4ZSOB 4JRXE 3T0DA 1Q72L 5KSBA 4KHXH 5DHYA 2CSPA 2NY2D 2GSGA 1RULH 2YA2A 1KLGB 1D6VH 1YJDC 2X9YA 2X70B 3WYRA 1K9TA 1V7MH 5KANI 1RZ8A 3KPSD 2Q87A 1NCAH 1DQLL 2LTQB 3CFBA 4NZTL 1QBLL 1VFMA 4G8EB 2FSEB 1KEGL 3KPRB 5CINL 2YPVL 1OAUH 2H2SD 2Q3ZA 3MV8E 4Z78A 2XA8H 1RHFA 4F7EB 3HFML 5B39B 3QIUC 4YAQB 4Q2ZB 1I8LC 4U1IB 4OGXL 1GVIA 3TBSB 4LBEA 2OSLB 3OHXB 3OKLA 3NCJH 4MLSA 5ABDE 2YRPA 5E8NA 1A9EA 4QXTA 3MV7D 2VR4A 2YD5A 4R3SA 3UTTB 3RVXC 1NFDF 4JFYB 1KN4H 4C55A 5D1QC 1LO4H 3U2SA 5M95B 5KAQG 3CU1A 1I1RA 4J8RB 4YHKL 2HT3D 3D3VD 3P4OA 1T2QL 3PG2A 3NGBC 5JHDE 5EOTA 4WFGE 4K7PL 1O7SA 3E8UH 4IBLT 1G7IB 2EDQA 2H8PB 1C8PA 5BRZB 4JY5H 1U93B 2DQHL 3U0TA 1ZK9A 2XQYG 4U7SA 1ACZA 1ZSDA 1OAKH 3C60D 1KCVL 1X7QB 3QWQB 1NL0L 1UWXH 4FQ2L 3WFEL 3NIGE 1UEYA 3QNYA 1FNGA 2AI0H 4K94L 2XRAL 4MAYB 1OD7A 4EDXB 4GAYA 4LLVB 3VFNA 4LPUA 2E7MA 1SJXA 3E6HB 4Z7VA 3LQAL 5I1CH 4XVUD 4CW1B 5EO9A 4CDGC 4OCLC 4CU7A 3WHE0 3FFCA 2FL5B 2R0ZH 4U1LA 1NFDA 2ICWB 1OY3B 2KPNA 3HC3L 3PNWA 2YD6A 4J3TA 2W9DH 3GSUA 5D93B 2YD4A 1BVKA 1FL3A 5EUKA 5E2VH 4XX1E 1A6TB 5IGXL 1U8HB 3GSOA 1F6AB 3SDXF 2IANA 3GSVA 4PPTA 4E41B 2BMKA 5AWNH 5C08D 4JQIL 4ZFZA 1ZLWK 1DZBA 4FQXB 3MLUH 3RY5A 4CMHC 3OGOE 3T0EA 4NRZB 1I7ZB 4L8SC 4DVBA 3FZUD 1J5OH 4KDTA 4G8IA 2R1XA 5JUEH 5GJTH 5FM5M 2FBJH 1FAKT 3P30H 1MHPH 2P44B 1KACB 3TYFA 2ZUVA 4PREA 4P3DB 5AYUL 5JW4M 4Z18A 1KB5B 2BC4A 5FHBL 5TDOB 3RVWD 1EHAA 1HHJA 3PV6A 4UINH 4AQOA 2AJ3B 4RMWA 5F9OL 4HIIA 4JLRB 4OD2A 3U9UB 2G75A 4YBQC 4R26H 5FB8B 3AUVA 4ODWA 2C3HA 3SDXA 3ULSB 4XP9H 1S3KL 2NQCA 2XNAB 5CEXB 3SJVE 5GPRA 4NQEE 3SE9L 4PLNC 1FGVH 3WMSA 1UJ3C 2VZ1A 3MRRB 2FDBP 5F7UA 1FZKA 3B9KA 2P8LA 1CR9L 5IHLB 3N9GH 2E6JA 3GMRA 4ELME 2HFTA 5L0QC 5CEYA 4O9HL 4F57L 4KVCL 4NQDE 3MA7B 5JQ6L 5C6WH 4ALAL 1NGPH 3P77B 2I60H 3SCMC 1IKFL 4X5WA 4PRAA 4HCRA 3OB0H 3IDUA 4NYLB 2QQNL 3RUGB 3S4SA 4KY1L 4BSWA 2YXFA 2MQ3A 5HY9A 2R1WB 4OCMC 3NIFF 2BY3A 1HWGB 3L5XL 4WHTA 2UWEA 3I6LE 4APQA 3I84A 4OZGF 3ZYJA 4MD0B 3SHSA 1S8DA 4HJJL 1EAPA 4H8WH 4XPGL 4TVPD 3WNMA 2PN5A 2IC2A 3BPOC 1VB9A 1MJJB 4MAUH 1K4CA 1FFOA 1QSFD 5CKAA 2A83A 1G1YA 1RPQA 3F7VA 1AY1H 3BO8B 3LKQB 2EH8H 5IMOA 3T77B 1IGJB 5DVOA 4G43A 4GRLB 5LBSL 2K3TA 1B2WH 3OG6B 3V4PH 2K7QA 4PJFB 3AMKA 5E2WH 4M7ZB 3SE8H 4ZDHB 4I5BB 3ZT7A 4MXVE 4NOBA 4AG4H 2EYTA 1HI6B 4YBHA 1MCPL 5DR5L 1U8IA 5FUZL 1YNTA 4X99B 4PJGF 1RIUH 1YEJH 2GEEA 3UTQA 2C7UA 1RUAH 3CXHJ 3FFDB 1YMMB 4OBSA 3WNKA 3RIFK 2DWDA 4XWOC 1T1WB 4Y7MA 1UWXK 3MRIB 3WJLA 1Q38A 1MJUH 1K8IB 2VL4A 5CWSB 3REVA 1MFDL 1AP2A 2HVJB 2OZ4A 5FGCE 5GGQL 4N9OB 3DETD 4J4PA 3DO7B 4WI9A 3EAKA 5EBMB 5LCVH 1PD6A 1OB1B 3VXSA 3DGGA 3ULUE 5DA4A 4N8CL 4ZFOA 4WO4A 2H1PL 4XH2B 1Q9WA 3MREA 3VWKA 2V7HB 4PJGA 2X1QA 3ROOA 4LFHD 4NQSB 5CJ8A 5K33A 4MX7A 4EN3B 2VR5A 3Q5YA 5SWSE 3UDWC 3ERYA 1ZWIA 4R8WH 1QRND 3DYMA 2OTWB 5BZWB 4AZ8A 3IDNA 5J1SC 1MIML 4HQQL 2J1KA 2Q8BL 1E27B 4UDUB 2OMNA 3BX7C 3NFPB 5GGSB 3T65A 3HUJA 2AXJA 5DVKA 3C2AH 5C0NC 4JQXA 1I8MA 4YHYB 2G2RA 1XR9A 5BV7C 3BH9B 1LDPH 4FQJL 3P9LA 4ZXBC 3NCBB 1QQDB 2J8OA 4HS8H 4M43H 1CGWA 1RK0A 4OGYH 4PJBE 4XVJH 1KLGA 5IOPA 4Q9QL 1ZT7A 3C6SA 1D5BB 2JJWA 4OZHB 4P2RA 4W4NA 4UOW1 5DO2D 1F4YH 1MPAL 1S9YB 5GHWH 2YOCA 1DN0A 2CLZA 3CDGB 4OM0H 5DS8A 3OAUH 4LEOB 1MI5E 3TC9A 43C9A 4KV5E 4KI5F 4X5LA 4LNRB 1K2DB 1XT5A 2VDKH 2FSEA 4FXGB 4XNYH 2B0SL 4F2MB 4ZD3L 2ZG3A 5HHOE 5IHZB 4JZJC 1LHZA 1XH3A 4Q2ZA 2R0WH 3SGEI 1UZ6E 4O5LH 4U1IA 3X3FH 3TBSA 4YQXH 1A2YA 5A16B 1OGTA 4ODVH 3VXUE 5FECA 4AT6B 1VGEL 2V6HA 5GGTA 2HVKB 1IGYA 3OB0K 3L3OA 4O2FB 5E94B 1PZUB 2XZQH 1RJZB 4L4VB 3VXPB 1A5FH 5HYQA 1WVZA 2BVTA 4QTHA 3VXNA 4YPGB 4ACPA 4DTGL 2XFXB 2R1YB 3PWPD 5ANMB 4U1SB 3BW9A 4WW2C 4P5TA 1KCLA 4NT6A 5KANG 4M3KB 5T5NF 1SBBA 3NTCH 3FHAA 2DN7A 3DXAD 4JM4H 1Q9OA 2AJSH 2H8PA 4X80L 3DSFL 4PLKD 3PE9A 3OV6A 4LOUC 2D7NA 3QO0B 1HINH 2J6EL 3IU4H 3HMXL 3QEQD 4NC0B 5C86A 4XNQA 3GK8H 1T0PB 2YPLE 4OLZH 5HTSA 4NCC1 4PDCE 2DOCA 5CILH 3HG1D 3VWJB 3WIHL 3KPLA 1FPTH 4XVTL 4CW1A 3DSNA 4CBPA 1UCTA 3ZLQC 2O5YH 4LHUB 3INUH 1WAAE 2O26U 1XIWA 2BDNL 1MCJA 4FN0A 2ICWA 1NFIB 1BJMA 3G04B 1TVBB 4JPIB 5J11C 2BVOB 3ABZA 2CLVB 4M8QB 4DEPC 4NHUA 3LKNB 5DC4B 4E41A 1OPGL 4QY8B 4KKNA 4UOJA 3WN5C 3WSQH 4B53A 4LMQE 4K9EC 3CFKA 1LP9F 3TBWB 1NGQH 5DD6A 2NY6B 3OR6B 5DRXB 2FO4B 2D03H 4LLUA 5I74C 1GPOH 2HH0L 1MFAH 2PO6A 4NC2B 5MI0C 4ORGA 2KQNA 5ACMA 1F90L 4LSVL 4QRRD 3ARUA 4M7JH 5TDOA 4D0DB 4ETQB 3QI9C 4WWKC 3QXTA 1IZKA 4JFXB 5EPMB 4ZNEA 1GGCL 1U3ZA 4M6AA 1U95B 2BSSB 4OFPA 4YDLC 4I0PD 3V7AG 1T0MB 2WIMA 3HNSH 2JCCE 2WUCH 4G6AD 2VLRE 1FIGL 3SDCD 2V2TB 3WUWA 3AM8A 3BKJL 5GGUA 1UCBH 1LNUB 1LP9A 2Y5TB 5DJXB 4Z7UE 5EOQL 3W2DL 4M8VA 5E6IC 2BRQA 3MRDB 2GJ6D 1GAFH 3QUML 4IRJD 4LCCA 2YUZA 3A0OA 2NW2A 3S98A 1MELA 4UU9B 3QEGL 2DBLH 3QA3B 5JA8B 3I2CL 2NZIA 1I3GL 4P23C 1RFDL 4G9DA 1F4XH 4U1MB 4BQ8A 4KK9C 3IDJA 1KIUA 2PTUA 4JKWA 1FL5B 4D9RE 3C6LD 2X4QB 1RSFA 3JTCA 3W9EB 2WBJD 3OKOB 3VXME 3GMQB 3G6JB 4F15C 1H15B 4HC1A 5E99H 4I13B 1IGML 4U1GB 1KTLA 5CBEB 1CXFA 3PHQA 5C9JA 1FFPB 2F5AH 1CGSL 5I1LB 2YA1A 1ZVYA 4GBXC 3TPKA 1EEUA 3H0TB 1PJ9A 3B2UC 4GRLA 5JR1H 3AB0B 1RIHH 3SGKA 2BVUA 3EYVA 3MBXL 1S7UB 3A6OA 3AC0A 1E4KA 1IEAB 2DWEA 4KXZH 5D6CA 3RIAF 1ND0B 3JTSB 5ICZB 2OX5A 4NBYB 3CXDL 1C5CH 1HI6A 5AD0B 1BJ8A 2X89A 4XVSL 5HVHB 2WINB 3DVFA 2ZPKL 3HNTH 3LV3A 3H42H 2EO9A 5F7EH 4X99A 3QDJA 3L3KA 1Q0XL 3PDGA 4XAWL 2PW1A 1IC4L 3RL1B 1N64L 4GAJL 4IJ3B 5CZVH 2NMSA 3CFJB 2FJGB 1NJ9B 2DD8L 2V7NB 4OCWL 1J86A 4JO3H 4JDZB 1DUYB 2IQAB 4BYHA 4JRYB 5DJAB 2GITA 4XXCA 5D71H 3TZVD 3NFNB 2V9RA 1YQ2A 2R2BB 4KJWC 1A3RL 4XNZB 1CGVA 1OW0A 4NZRL 4OZ4B 1GYAA 3DVNB 1BF8A 3EZJB 3WXWH 5BW7A 4P4KB 1Q0YL 5D1ZA 1HXYB 1NKRA 4ONFH 4O51B 2YPKA 4OQTH 1ZVSB 4JE4B 1BHGA 2FBOJ 5DD1L 4PGZA 5E8OA 4GOSA 2RJMA 1Y0LB 1JTTA 4XH2A 4YLQT 4ORZC 3D0VB 3X17A 3WKNA 4HG4J 1BBDH 5DK0A 1OQOA 4P2OD 5HYSB 4XB8A 4N0UB 2CDEA 1SQ2N 5DHVB 1CLOH 1CLZH 1ETZA 4FNLL 3KPSE 5HHMA 3PWJB 4HWBA 4PV8B 3U82B 2Y5EA 4ZYKB 5HVGB 5EBGA 1CD1A 4FQCH 4UDUA 4KKBC 2NY4B 1CBVL 3UAJD 1DL7L 3QIUA 3V4VH 1QLEL 3ARDD 4MVBC 3BH9A 1I8LA 4RAVB 1QQDA 3H2WA 2W0FA 4CVXA 1LE5B 5F96H 4ZS6D 2OJEB 1MJ8H 5IMKB 5F9JB 3T4YA 5I15H 4OZHA 4NQCE 4P9HH 4F58H 3ARFC 3ORJA 2KL6A 2YC1B 3F58L 3WO3B 4AENB 4L1HA 3BKML 4CNIA 2XZCH 4LNRA 1FAIL 4FXGA 1IGFL 3D3VE 4HDIB 3TNMB 4ENEC 3QCVL 1NLDH 4Q0XL 1MCSA 2VZ3A 3T0VA 2NR6C 3NPSB 1QR1B 5FCUL 4I2XB 1LE9B 5AZEH 2DMBA 1QSED 4OSUL 5A16A 5I8CB 2FB4H 5BQ7B 4POYA 3UTZB 2HVKA 5JA9A 3FKUS 4HJGA 2Z31D 4Y4HB 1NSNL 1UM4L 3U36A 2QSCH 3WBDA 3KDMB 5GS1B 2AV1B 4J3XA 3JZ7A 4NZUH 4OGZA 2ZJSH 4HCRL 2R1YA 4AEHH 1WJ3A 5ANMA 4U1SA 4XPFH 3FOMA 3CDCA 1GGYA 4M48H 3NAAL 2ZUWA 3C09B 4KFZC 4ZQKA 3O3AB 1ZHLB 1G9NL 3FB8B 1RJYB 2DQUH 3FO2B 4OUUB 2LU4A 3QO0A 3Q0HA 2A6KA 2I07B 1RHHA 1OLLA 1YQVH 2F54E 3CAFA 3BIBX 4HT1H 4XNUL 5I30L 3SKJH 5C08E 5BVJB 3SDDB 3OBAA 5FYLL 3HE7B 1DQTA 5DD5L 1HHKB 1JYWA 3GHEL 2VYRE 2EDLA 4Y4KD 2NZ9C 3DURB 5EORH 5DURB 1U8PB 2ZUXA 3ULUH 4XNXL 4TUKH 1LMKA 4JY4A 3S36X 1CDGA 1CXLA 1IGIL 2ADFL 4PRDA 5KVFL 3PGFL 2ICCA 1NFIA 4ZPTB 2EKSA 3U0WL 3HAEA 4HUMB 4U6TA 4JPIA 4JO4H 1WT5C 2QADC 4PJCF 2CLVA 3PJSB 4JO1L 3MRKB 4JM2C 2YUWA 1R3IL 3HNVH 2X1XR 4QY8A 4HS6A 2I9LB 5D7LD 3N0PB 4OZGE 1UVQA 1XF2B 3RWEB 3ECBB 4KUCF 4XPAL 1BECA 1PG7L 4JR9L 1I1AC 5JPNB 1MREH 4PJDF 1UJ3A 4P46D 4QOKB 3U7YL 4S1DC 4RX4D 1C16B 5DRXA 1RZJC 3BZEB 3T3MF 2CIIB 2FO4A 5C09A 1BFTA 3UP1A 4AK1A 3QPXL 5KBNC 4H0HB 2NTFA 1BM3L 5KTEL 1JNHB 5DUPL 1PYWA 3SCMA 2OZ4L 1QPXA 1I3RB 1T0NB 4U3XA 3SDAD 1BQLL 1N2RB 4MA8L 5KSAC 5ALCL 3MLTB 1U95A 5E5UB 5JW3H 3HS0B 5TE6H 3GB7B 4KRPB 1JRHH 1XF1A 5F7YC 5M94B 3FT2A 2NY7L 4U2YA 4YHLL 1G0YR 4QCIA 2GY7B 4I3GA 3ZYOA 5DK3A 1LNUA 4L3EA 2XXMB 4XT1C 3A6CH 1CLYH 4FTVD 3FAXA 4IM8A 1K6QL 4WNQA 3DVGA 2ADGB 3QH3A 3EO9H 5TF0A 1WZLA 4PJIA 3C5ZD 5IW3A 3ALWA 2AJYL 4MMZC 4JFDA 2VDRL 1QSFE 4LRIC 4UU9A 1BAFH 4G8GA 4PB9H 2WM0A 5IBLD 5B38B 5LGHL 3RAJH 4NJ9L 5IQ9B 5CAYB 4DJMA 1ERNA 2FEEI 1TCRA 2F74A 3VH8B 3KXFD 4G7YL 4P57B 1S7WB 2DTMH 1MCRA 12E8L 4X7TB 2R8SH 1IKNC 4FQHB 4QF1B 2R0LL 3V5KA 5GZNC 4QRSA 1IEBA 3OKOA 1NDGA 3CH1A 4XCFH 5EFIB 4WI6A 2H9GB 3TPUE 4P2CG 1LO2H 3QJHB 2AK4B 1MCKA 3TP4A 1ZGLP 5E8DH 5C0BB 1EDQA 2A77L 4X7FC 3VD7A 4X0KB 2NY5L 5EU6B 1HH9B 5IB3A 1T1XA 1NGZB 1DE4B 2HP4A 5KZCD 3TBTA 3UTPE 4LVEA 3VE0B 4G5ZH 2LVEA 3JTSA 4QHLB 1OTSD 4M7LH 1JPST 5EU7C 3U6RA 2WINA 1ZA3B 1E4WH 2HG5A 2EO1A 1KELL 1CD9B 5GGTL 2N1KA 4I0KA 3B5TA 2OR9H 1DBAL 4B5EA 2JKXA 2WSKA 4G3YH 1QSZA 5C8JB 3C8KB 1EEQA 2VZSA 3DUUB 2WV3A 3CFJA 1KBGL 1IL1B 3ZDZF 4KROC 4MJ5A 3P40A 2JE8A 4OGAC 5ELIA 5FKAA 4ODUA 2Q7YA 2X5PA 4WEMB 1DUYA 4Z7QE 2YK1H 5A3ID 3HPLA 1IGTA 5KSUB 2FX7H 4R7DA 3QIBD 2A6JA 3GMOA 3UDWA 5ERWB 1MHCA 2OK0L 4UTBL 2X4NB 5C0IA 3GBNL 3WL9A 5E2UH 1I1FB 2P1YA 2PYEA 3FB6A 5AYQA 3B9VA 2ATPB 4A6YA 2P5WD 1NGYB 4NSKA 2H26B 4FABH 4HPOH 4IOFC 4TVSa 3NA9H 1ZVSA 2V17H 4DN4L 4K3GA 3STBA 3V7AE 2ARJB 5EZJB 35C8H 2CRIA 4ZXBA 3BJ91 2QEJA 2NY3D 1CFNB 3FOLB 3TN0C 4G8FA 5IB1A 3MODL 5F44A 5DFWH 1N6QH 3HE6B 2VTFA 4N0UA 4WW2F 1EO8H 5JIPA 4UNUA 3EGSA 3L1OH 3AY4C 4HIJA 3PIQB 3DV4B 1CDCA 2PCPB 1FNLA 1FSKB 2DB8A 4UTAL 1D5MB 1QPPA 4BQCA 4F7CA 4JZJA 2ED9A 4N5UA 5IB4A 5ADPH 4LVNC 2YKLH 2QSTA 4PJ7A 1JZ6A 3B3IA 4LEXH 2XN9B 3GSRB 1F00I 3Q3GB 5F9JA 1I7TB 4GLRH 3G5YB 2NXZC 3W0WB 2QHRL 1IAMA 5BS0A 1Z3GL 4I18B 1XCTB 3U7AA 1EFXA 4HAGA 3GI8L 3SQOL 4D8PB 5D2NC 3TA3C 2AABL 2ESVB 2R29L