3M17A

Crystal structure of human fcrn with a monomeric peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
molecule keywords IgG receptor FcRn large subunit p51
total genus 58
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m17A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m17A01
1NC2B 1T7XA 3HC3H 3FRPA 1CE6A 3LKRA 1PG7X 2WBJA 4XVJH 3STBA 4GW4A 4R7NA 3QIBA 3O2DH 3P73A 4RMTA 1K4CB 4O9HH 1INDH 2NNAB 1E4WH 5KN5B 1IGTB 3QJHB 4XNMB 5ACZB 1A1NA 1I7RA 1BJMA 4YZFF 4N90E 4PD4K 4OZHA 4GRLA 4F9PC 4NSKB 1U3ZA 4EDWH 5C0BB 3VA6A 4TTDC 4YPJA 4QNPF 3V8CA 3K8KA 4J6RH 1M4KA 4X6BA 2DWDB 3B2VL 4FNLH 3FZUD 4HCRA 1KJ2H 4Z5RA 3THMH 1RURH 3EYQC 1IC7L 3I9GH 2GJ6A 1WEJL 4XMKH 4TUKH 4MMXC 1U58A 3FO9A 1WBZA 3MUJA 5A2IH 1V8HA 1F3RB 3QHFL 4I13B 1SM3H 3VG0L 1XT5A 3F62A 1RJCA 3SHSA 3RWHB 5HGAB 5JPNB 3FAXA 1J8HA 5IMKB 1OD9A 5D2LA 2V17L 2HVKB 5C07E 1T4KA 2DD8H 4W81A 4Y5YC 1X4XA 5E4IA 5DEFA 1U92A 5EIIA 1ULVA 3MLXL 4MMZC 2XT1B 1PQZA 1CFSA 1YQVH 3BP7A 4FXKB 5C0FA 3O3AB 4PIRF 2O5ZL 1CD0A 1R3LA 1AHWC 2YUXA 4WHYH 3F5WB 3GMNA 2H26B 3GJEB 4WI9A 1TETL 1H8SA 1RJYA 2YC1A 4J1UB 4PRHD 1A7QL 4R0LA 2JK5B 3QFDA 1JMZA 4P5TA 2A77H 3OXSA 2EIZB 2LU3A 4I3SH 5IFHL 1AGEB 2JTDA 4PJGF 1KTDB 5HHVL 1FYTE 1HI6B 3BSZL 4HQQL 3DNKA 2ATPB 1RK1B 1HHGB 1BZ9B 3C5ZC 3A6OA 2IPUG 2LAGB 1S5HA 1SY6A 1OAYH 4HGWB 3X13B 1H3PL 3OF6D 5HSFA 2F58H 3DYMA 4P2OC 3UROR 1FFPB 4F7PA 3KR3L 2EH7H 1NGPH 1JRHL 4S0SD 4LLQB 1IGFL 3SPVA 1NEZA 5IHUL 4XHJC 3DGCR 4RQQB 1HHIB 2W91A 2J4WH 4XWGL 4TSCL 1IL1B 4PB0L 1MCPH 5ESVB 3P11H 3PWNB 3AREC 4MLIA 3STLB 3O6MH 3O4OC 1D7FA 4U6XA 4A6YA 5A16A 1I1CA 1T3FB 2AXGA 3MJ9H 4ZUUA 2R23A 1FIGH 4ZFZB 1U3YA 3GMQA 4KGLA 3K2UH 1RIHH 5I73B 3JTTA 4LLQA 3QXVA 1HOCB 1NANI 4LQFH 1IQDA 4HIXL 5BJTA 4OM1L 5IESL 5IT2L 4XNZB 2C3VB 4G9FD 2DQCL 1GAFH 3VFPB 3T0DA 1CL7I 3T0EB 4JFHE 5E4EB 1Y6KR 3LS5L 4JY6B 4QRRE 5F7KC 4U1KB 5KZCB 4NZRL 3EOYG 3LQAH 4Z0BH 3D39B 1JCKA 5EC1A 1YYMH 4KXZI 1QO3B 2VXUH 1PD6A 1UH3A 4ETYA 2W0LA 3E2HB 3CDYA 4GBXB 1OTTD 3MJ6A 1F6AB 2AK4E 3GSUB 1HEZB 1KXVC 2WUCL 2E3VA 3MRGA 3CFEB 5E5UB 2V5MA 2P8LB 2W0PA 1P7HL 3F6IA 2HT3D 3T3ME 1KLUB 3VWKD 5HPOA 2H26A 5JPMB 4PJ9A 4RNRB 4I48B 2FJFA 2GQHA 5CIPB 1AFVH 4FZ8H 4U1HA 3H9SA 5DK0B 1X4ZA 3PWUB 3D6GA 4J4PA 2NY1C 2DJ4A 1JI1A 1NCBL 1GGIH 5F9WB 1LMKA 3VXNA 4X9HA 3S3JA 2XTLA 1U92B 4XVSL 5JIIA 4TULL 1OQXA 5E8EA 5D6DC 4UIKH 3MFFB 4NO5A 5GRYA 2F5BH 4JREB 2DKSA 3OX8B 2ITDB 5D2LB 2H3NB 2W9DH 2JF1A 3H9SB 2F15A 5IEKA 2IFFH 1H3TA 3TN0C 4J4PC 1WAAA 4XMPL 1UWEH 3E3QC 4FXGA 5F89A 5IOPB 2QEJA 2CD0A 1MWAB 3Q48A 5SX5K 3MNVB 5TDNA 4LRNH 1AGCA 2A6KB 3QO1B 1BD2D 5DR5H 3CH1B 3MACH 4HS3B 2OM5A 1X5FA 4MJ4A 2P5WD 1P4IL 4IRZL 2YPKB 3MC0A 4Z95L 4QCIB 4HWZA 2ZP0T 1QO3A 3BQUB 1I7TA 4HWEL 2AK1L 3VE0B 4XB8A 5F3BB 5BV7L 4XBEH 4JY6A 1U8IA 3H6JA 1LP9E 4GRLB 4YFDB 1A6UL 1CZ8H 2W65B 4M1CC 2DQTH 2BVTA 4P46B 3VI4F 4LKCA 3BD4A 4WHCA 3O4OB 2AJSH 3WJLA 4ZO7A 5DJ6B 5FDWB 5T33L 1YUHA 5KN5A 2PF6A 4GRLD 5ALCL 3CFKA 3HNTH 1DQJA 3BP5A 4CU6A 2PR4H 1D5MB 2APWA 4Z8FH 1JGLH 3CFIC 3QIBB 2W0FA 3T77B 1VPOL 2QQLH 4Y4HD 4OLXH 4OKDA 1T2QL 5KS9E 4LEOA 3SDXF 4PLKC 2F74A 3ME0A 3KPNA 3KHQA 5EO1A 1N5YL 3L3DA 4LBEB 3CAFA 5EUOF 4P9HH 1WV7T 1ETZA 1WAAE 2XWJB 2X70A 1MIML 2VR5A 5J56B 4LLWA 5GJTL 1OT1A 2ED9A 4NRXB 4PJ7E 4DOHE 3WSQH 4FN0A 2DIBA 4MCZB 5BV7C 3BAEL 2Z92A 3M8OH 1TXKA 4YLQT 1DBKL 1T04A 3EJZC 1E6OH 3MV9A 2I60H 2A1WL 5F9AC 3RBSA 3SDCC 4BK5A 1C16A 4XAWL 3VFMA 3W5NA 1RK1A 4L5FH 4KQ3H 2Z31A 4MX7B 3LHPL 3H9SE 2MQCA 5FB8B 1NFDA 4F2MA 5D1ZD 5HI3D 4U05A 2FIRT 3TBSA 3H42H 2JKXA 5JTWA 4X6CB 2HWZH 5CD5C 5JA8B 2R2HB 4GRWH 3NFSL 2QQKH 1QSED 4QHUB 4QHNB 2EKSB 3G5XA 2VDML 1FIEA 4XNYH 4YHIA 2NY0C 3D2UA 5MENB 3F7QA 4L4TA 5GS3A 4ZFFA 3LKQA 2PW2B 4DKFL 1LDPL 4R2GD 4GG6F 2AK4B 1MAJA 1RZKL 4HWBL 1T4KB 2HVKA 1YZZA 3UBXG 1MPAL 1NL0L 2GJJA 3G9AB 1D9KD 1YEIL 2DTMH 5BOZG 3M1BA 3KPMB 1D5XA 3ZDYE 2NW2B 4GMTH 3CPLA 4U7SA 2IBBA 3GMLB 4OZFA 5DSCB 4R96B 2VXVH 4M4PA 3ELAT 3T4AA 5FKPB 3FN9A 4EUPB 5C07B 4D9LL 3NCMA 4J3SA 5C0AE 2EDYA 2MKLC 3QXUA 1EIBA 5GGRY 3MLUH 3C5ZB 3FO0H 1EK3A 1G0XA 1J0IA 1MRDH 5HDOA 2Z35B 5HHPA 3QHTC 4Z7WA 3QH3B 2XKSA 1TJGL 2R29H 5B21A 3RZCD 2ITCB 2E8YA 4L8CA 5CUSH 3MV7E 3TM6A 5HYSG 4HS6A 4YE4L 3JVGC 2HKFL 4G8FB 4ZSOE 1CT8A 3MBEB 2FDBP 4QHKI 3B3IA 3A0OA 3GMOB 5ACLA 4Y4KC 2MCPH 5DD5L 3WDHA 4NJAH 5IEHB 1I7UA 5ID1A 3N1FC 2HFFB 4JO4H 2G75B 3SO3C 3P73B 2Y36H 2AJUL 4MSWB 3CSYB 5JNYB 4ODTL 3B9KA 2P46B 1ZLUK 2YPVH 4LLYA 5FECB 4KK9C 1PKOA 2DL9A 4K3JL 1KTLA 2C3XA 2GY5A 2OL3B 2AS5M 5IQ7H 4MS8D 1FPTL 3N06B 3QQ9D 4XP4L 4HMDA 2KUTA 2NY4C 5D72H 4WY7L 5EFIA 3NAAL 1NAMB 4Y4FD 4L8BB 3AAZB 5ISZD 4FQXA 4PJ5B 1T5XB 3RWJA 1RZKC 2R0WH 4L8BA 5I66A 4OZGE 5KSBB 3OV6A 5JR1L 3EYOB 3MV7A 1MLBA 4RGNC 4U31A 3OR6B 1IM9A 4HXAH 2ATKB 4OFIA 4JPKH 1MFEH 3KPTA 2JB5H 1CXEA 4K94H 2VAAA 4RRPA 4FQPA 4XPBL 2HTLD 3QCTL 4FTVE 3MCLH 1LQVA 4QOKB 1ACYH 3SN6N 4JQXA 3GSNH 4HZAA 3ALXA 4DCQB 1BOGB 1CDGA 4FQCL 1NPUA 1K2DA 4WVRA 3EUUA 4WW2C 4ODSH 4LAQL 3T2NL 4QWWD 3VXME 4MSWA 4BQBA 1WBYA 1A3RH 1R0AH 4PGCB 5FUCC 1S7WA 3REWA 4FHBD 3OKLA 3SKMA 3P0VH 4Z78B 5ID1B 2CLRA 2VLRD 1JNJA 2FR4A 5AZEL 1G6RH 4YXKL 2A9NH 3U7WH 4H26B 4W6XB 2IGFH 2QQNL 2Z93B 3BMVA 3L3IA 4WWKB 2AI0L 4XNUH 2A83B 2RHEA 3LIZH 4PJGA 4PJHE 1N64L 4PRDA 4RSVA 1IM3B 1BEYL 2X4QB 3L3HA 4XPAH 2EDHA 1T7VA 2IJ0C 2LQRA 3RUGF 5HI4C 4RGNB 5HGHA 1NQBA 1U6AL 4U1SA 4OF7A 5T1MA 4POYA 4HUVA 3W82A 3OKDB 1O5DT 3HB3C 1DANU 5D7JD 3CZJA 5FV1L 3RP1A 3O2VL 1I3GH 3RIFK 1WITA 3LKOB 1Q72L 2WV3A 4OCSH 1GOFA 1I8IB 2R0LH 2NPLX 2CKNA 4NM4L 3P4LA 4NZTL 3PIQB 4PRHA 5FHAH 3RI5K 3PP3H 3NPSC 1I1YA 5FXCH 3MNWB 5D6CA 1MCSA 1JBJA 1CLYH 4RAHA 4YEEA 4YK4B 4YHZL 2IANA 5GS2H 2YZ8A 4FP8L 3I02A 4PJ5D 2DQIH 2PW2A 4AYFA 1TCRA 4IHOB 2HFTA 2YMXL 1FP5A 3RTQA 4M7LH 2CUMA 4JB9L 5ERWA 1S9WA 2BJMH 5CBEA 4APQB 5B39G 3MODH 1MCBA 3FRPG 4QY8B 2X44D 4PGEB 4Y4KB 3ZTJG 2OI9A 3ZHLA 2ED7A 3ARED 4UINH 4K8RL 3F7RA 5BV7B 1ZVSA 3WFCL 1YMHB 5IB5A 1KJ2A 2WQRA 3ZTJH 3BRGC 4UQ3A 4FQHA 2YPLD 1N8ZA 1U0QA 4OCMC 5EN2B 1NJ9A 3VFMB 2AABH 4DZBA 4JN2B 1JV5A 1MI5E 3C6LA 3HE7A 3BKML 3GJFA 3HB3D 4B53A 4CW1A 1AQKL 1CD1B 4X4XA 1S7QA 1S7UB 2OQJB 4GAJH 4NKOB 1FO0B 1BM3H 1JFMA 3WFEL 1ZHLB 5E1HB 1NGQH 4HC1H 2ADFH 4NC2B 4D0DA 4YUEL 1LO2L 1BAFL 3D25A 4ONHA 2EDRA 4N0UB 1DQQA 4LF3A 1ADQL 3NCYP 3ROOA 4AH2B 1BBDL 4U33A 1JNNH 4XT1C 2V2WA 3LN5B 4UTBL 4M6OH 4PP1C 3I50L 2PYFB 2C4XA 3HMXA 1G9NC 1DVFD 3V0VA 4O02H 5CFHA 3ZDZE 4MVBD 1Y6MR 2VDLH 4EI5C 4JM2F 1KENL 3EO9H 4G5ZH 1QBLH 3BFOA 4YJZL 2FO4A 3JV4B 3OR7A 4GG6B 4JFDE 4FG6C 4HKXB 3LN4B 2OSLB 5BXFA 2A74B 3QG6A 5I18L 1IM9D 4PJIE 3Q1SL 3FB8A 4LFHG 3T0XA 3U79A 4PJ8D 1KCSL 3QEHB 1QNZL 3TVMA 3BKYH 4XCCL 1QSEB 2DM7A 2EDNA 2ZNWA 1VFMA 1NGXB 3QIWC 4FFEX 5JIHA 4M62H 4G7YH 5ETUB 1T2JA 3KXFD 3FQXB 1PLGL 3HFMH 2XQBH 1U41A 5A2KH 3LN5A 5FO7B 1DQLH 4CJ0A 4LF3B 4BH7B 5C2BH 1AR2A 2CDEB 3W2DH 4ONHB 1Z0MA 4JREC 4NHUB 1CFQA 1L6ZA 5FGBA 5L2KA 1GZPB 1AY1L 1ZHLA 1RQ5A 4NUGH 1A7NH 1U8JB 4BZ2H 1RSFA 4ZTOL 4DVBA 4D8PA 5JHLH 3HN3A 4NRZB 4PJ9B 3QNXA 3QQ4A 5E56A 1UM4H 1P2CA 3BUYB 3HLAB 4WO4D 3ULVE 3IDGB 2K9UA 1K3IA 1NFIA 3DXAA 1VB9A 3QDGE 4ZD3H 1V7ML 2NY0D 4BFBD 2ZCKH 1OF2B 1J9CT 4S10A 3VW3H 5DMJB 4D9QE 4U1IA 4YHYC 4X98B 4APQC 4Y88A 1R3JB 4L8SB 4MQ7B 1F11A 4M8QB 1F58L 2DM2A 1ZLVK 4ETQB 3MRNA 1FJ1A 3U2SB 5EO9B 2PXYC 4Y4FB 4GKSA 4K8RC 4K55A 4BQ6A 4X4ME 2AEWA 1L7TH 2PW1A 1YEHH 3R06A 4U6YA 1NC4D 1KYOK 4RGNE 3V4UL 4OF5A 2Z8WC 2ADJA 2NY3C 4AZ8A 3MLWH 1T03L 4MA7L 4EBQL 1YY8A 3C9NA 4OQ1A 2R2EB 5F9WC 3LKOA 5HHMA 5I9QC 4MD0A 1MJ8H 1F6LL 3GSOA 4UMGA 1DVFA 5TQ0H 1ITCA 5GRWA 4I3RH 1U2CA 4KRPD 3PGCB 4YBLB 5FF6B 2ENSA 1A47A 2NYYC 4QRQA 2R39A 4NKIH 4MB4A 3GI8H 3B9EA 1ZLSH 5JW3H 2AXJA 2DJSA 2X4QA 4CMMA 4PV9B 4FQXC 2GSIA 1BIHA 3UX9B 2DQFB 1KTDA 3L95B 4KJQC 1G7PA 2R4SH 4O5LH 2VISB 4U2ZA 2EZ0C 5DMGC 4WUUE 4NNPL 1ZANH 3MA7A 2DM3A 5IMMB 1KXQE 1T5WB 3GNMH 3PHOB 4WFHE 5IW3A 2R1YB 1RV6X 2B1HH 3KYKH 2FX7L 3F12A 3QWQB 4J1UA 4JFQA 3TV3H 4CVZB 3PP4L 4XC1L 1OLLA 1EEYB 3MYJA 4Y1AA 4BQCA 3S9DB 4UQ2A 1E28A 5J12B 1K2DB 4Y16C 35C8L 1QFPA 3QNZB 1R6VA 4C56E 1UM5H 5C0FB 1IC1A 1PW3A 4WWKD 5EZIL 3MLYL 3UTPD 5E6IC 4PJHB 5D9SA 2VDNL 3QA3B 4OLUL 4F8TA 4ZG1A 5LKNA 4UNUA 2EO9A 3BKCH 5ITBH 4H8WL 2X7LA 2VKXA 4G8EA 5D2NB 5TE6L 3EYFB 5CZKA 4G9FB 3N1GC 4HKJB 1CFNA 1A4KA 4PS4H 5I16B 4YHML 3DUSB 3PJSB 4YGVB 1FORH 4Y2OA 1LK2A 4GW5B 4F58L 3MCKB 1N0LA 4M7KL 1Q1JL 2CK2A 2HH0L 5DHVB 3PWLB 4OLWH 4PJ5A 5D7KE 2YEZB 4X83A 3W9EA 1RUMH 5C6WH 1IGJA 2FECI 1NC4B 4G43B 1A8JH 2EE2A 1PY4A 2V6HA 2X4SB 4NGHL 9CGTA 4N1HB 3T65B 5EOQH 2V5RA 5CP3A 4M1DL 1IEAB 3VXMB 1FNSL 2KPNA 4P46D 3MREA 1NBVL 4IOIB 4RA0C 2AEPH 4TUJA 1CU4L 1XGYH 4MJIB 4GQ9H 4Q0XH 5D7JA 2FLRT 3NFPA 1JFQL 3MRPA 3HKFA 3D85B 3O11B 4QTHA 3QG7L 1KPUB 2VC2L 5DD0L 4HIJB 2LABA 3DARA 3ULVL 1BD2E 2G75A 5IBLC 1JPTH 1QSFD 4GW4B 5GQBA 5C1MB 1W0WB 4GSDH 4JVPA 3C08H 2CJUH 2CK0H 3ARGD 4X6FB 4GW1A 1OQOA 4ERSH 2AEIT 3L1OH 5HJ3B 3SDCA 4G42B 1WT5C 5HHPB 1X5AA 3VMOA 5IG7B 3T65A 3VXUA 2ARJB 4GG8A 5BW7C 2Y07L 4WFFD 4KTEL 3HPLB 3I85A 5F9OL 1IGJB 5C0RL 1MREL 4MJ2A 4M93C 4WI5A 3RVUD 1WZ1H 3LEYH 4Z7VF 3DMMA 2R56H 4LPVA 25C8L 2R0ZH 4WCYL 2DOCA 3CPLB 1ORSA 2XG4A 5F9OH 2VKWA 2YSSB 3PABA 4N0FA 4DGIL 3NBNA 4PJAA 4G9FA 2X7LB 1VESA 4JQVC 4LARH 5CZVH 5FKAA 3V0AC 3WIIH 2VL5A 3MGOB 2BXYA 3L5XL 4PG2C 4U6HA 1DUZB 3U4BL 1RZGB 1OW0C 3NZ8A 1MCFA 3DVGA 4GFTB 3TFKD 5GGVL 2O93L 2CJUL 4RAVB 4OM0L 1E27B 1T89C 4GSDL 1RZIB 1JPTL 4B0MM 5E2UH 4LU5H 5FKAB 3SDCD 1QKZL 2MKWA 1NBYB 4JDTH 3O2WL 5DD0H 2VC2H 5DVMA 1G9EA 2Q7NA 1NFDB 4O51B 3D3VE 3GGWB 5EZJB 1K6QL 3VRJA 3FO2B 3KPRE 4MCYB 2V9TA 5JXED 1Z9OA 3IAGC 2C4FT 3TBYB 2LU7A 3FOLB 5DURB 5KOVC 2AXFB 3S37H 3U0WL 5H94B 1BQSA 1FNSH 4CVXA 4GAGH 4L8DB 2B4CH 1U8QB 2C3HA 2JCCE 2XPGA 1TZGL 3H0TB 3SKJL 1HKLH 2OZ4H 2EYTA 1XGTA 1FFOB 3OJVC 2X70B 1N5AB 1ACZA 3IDJA 1GCFA 5LCVH 3WE6A 3WFHA 2G60H 3ULSA 3TA3C 4OCRL 2Y23A 1FC1A 4M7KH 4W68A 1JGEA 4LPXA 5BS0A 2XRAH 3BGFB 5F1IB 5F72S 3T8XB 3DOSA 4JQXC 2NZ9C 3WNNA 3S5LG 1IKNA 4HUWB 1JGVL 1IAOA 1XCQA 3BKCL 3SKOB 4PP2A 5H35B 5I17A 2BVOA 5EZIH 3G6DL 3BOVA 3QDME 5J6GA 2WBKA 3HI5H 5BRZB 3F8UB 1INEH 3BWUC 3GKWH 3D85A 3CXHK 4LKCB 3E0GA 2EC8A 3OJDB 1F11B 4M8QA 5JUEL 3O6KH 2BSSB 5FM4A 5GXBB 4MQ7A 3PP4H 5EU3B 2CO7B 1WC7A 2NY5C 5B4MD 3FQWA 3L9RA 3HZYB 3KYKL 5HDLA 1ZS8B 2V2TB 4GRWE 5CZXC 3U9UA 1I1FB 4HWZB 3GNML 1WK0A 3HZMA 3JSSA 4QCIA 1IEAA 3CUPA 1PX4A 4MB5A 4Y1AD 1OAKL 3PV6A 4G43A 4HS3A 2R4SL 3CH1A 4WU5A 3NIGE 2JLLA 4H1LB 2H6PB 2EICA 4DW2H 1BF8A 4HKZA 4YPGA 1ZT1B 3QNXB 3BP6A 3WLWD 2B7DT 3LAFA 4OCWL 4AEHH 1DN2A 1LK2B 3OG6B 4GW5A 12E8H 1HQRA 4XPGH 3AS3A 2OTUB 4MJ6B 1NSNH 1SJXA 3IXAA 4I3RL 3PDOB 1FRGL 5L2KB 3D18A 1LP9A 3AREB 1FFQA 1AR1C 2PNDA 4XNQB 3L3GB 1A2YA 2IC2A 3MLWL 1KBGL 3X14A 1UJTA 4HF5L 5D7SL 1BECA 5DJDA 1FYTB 1QQDB 3RVTD 2OR7A 4R7DB 1IEHA 4JFQB 1U36A 4P2CG 1YEDB 4JHWL 3SKUD 3TBWA 3TPUB 1P69B 4KKCD 3LCYA 3REVA 4F33A 3E2HA 2VISA 4MDIA 5DDHB 1FL6B 1LK3H 4QNPE 2GSIB 4M5YL 3RVXC 1FDLL 1WZLA 2P7TA 4KMLB 1G7JA 1V7NL 3QUYA 4X6EB 2VQUA 3BMWA 5J9PA 4I3GA 5A3ID 2ZCKL 5F7DA 1BOYA 1V7MH 2VH5L 1OAUH 1DVFB 4JO3H 1XR9A 3V0VB 2DN7A 1D5BB 4OF0A 1Q8MA 4Q9RL 5ISZA 2G9HB 3GMQB 4PREB 3HPJA 4WHTA 3VFTB 1CDHA 2R23B 4ZFZA 5DVNA 1WWAX 3VGBA 4M7LT 4TQEL 3FFCB 4WV1B 1A02N 1YQ2A 1KT2B 4XZUA 5JHLL 4GG6E 5C9JA 1CE1H 4X8JB 1C7TA 1QRKA 3G6JF 4MS8A 5I1HL 1JUFB 1A7NL 3R06B 4U6YB 1Q9KB 4Q6IA 1EZVX 1S7TB 5BVJA 1PG7L 3O6FB 2BOCA 5ITFB 2D9QB 5GSVB 4MNQD 3B9KD 1BWMA 3U4EB 1QSEE 1OLZA 1B0WA 1H5BC 5BQ7B 5L6YH 1FH5H 2EE3A 4JZJC 4NO0A 5JDJA 1KXTB 1CGWA 3QQ3B 2XQBL 3RX8A 1D9KB 3WS6C 5KG9B 5C09D 2A6DB 5EN2A 3SJVB 3KWWB 1L4IA 1EEZB 4FQ1H 1R5IB 4JE4B 4RZCB 5FYKL 2V5YA 3H9SD 3P9WB 1ZVSB 3MOBH 1JGUL 5IWLC 5FK9B 1RUAH 1MQ8A 3N50A 3WFDL 2D2OA 32C2A 4W6YB 3BUYA 3ZE0E 2VSCA 3TLRA 2MJWA 4Z76A 4HFUH 1C08B 1LO3H 1ADQA 3SDYH 1EH9A 3GUTB 1QR4A 3RWCA 3QUXC 1RIUH 3I02B 4BUGA 3PWPB 4YHYB 1F3JA 1YYLL 5D93B 4HJGB 4NPYB 1PQZB 1GZPA 5ICZB 3H2WA 3MNWA 1JF1B 4LSSH 1T0MB 3KNBB 2NY0B 4M6OL 1KLGB 1Q9WA 3T4YA 3UCRA 2Y7QB 2A0LD 3QIWD 2I25N 1AO7B 1EO8L 3CLEL 4KUZL 1BAFH 4HHAB 4YUEH 3O3DB 5DLMH 2ADFL 4PRPE 1XF5A 2MNUA 3FQXA 3I84A 4L9LA 1WBXA 4N0YH 3S5LA 4R26H 43C9B 2BMKB 3ZYOA 4C56D 3UPRA 3UDWC 3I3BA 3GKZA 4OZGF 4U1GB 3TVMB 4KMTL 5HHNA 5DJXA 4MQTB 4LP5A 5D8JH 4KRNA 4MVBC 1FG2A 3LN4A 4MXVF 1JHKL 3B8YA 2EDQA 2H9GA 4N8VA 4XXDA 5GS0D 3MPCA 4XP9H 3AVEA 3KYOA 2VDOL 5SWSD 4F80A 4HX1A 4MNQB 2W9EH 4AIXA 1HILA 4M7JL 4ZFGH 3WFCH 5I1GH 1MCHA 5GRUH 2Y6SD 3VDBA 4HMEA 4GRMB 4JFEB 1MOEA 4I9WE 5DUBA 5E2JA 3VJ6B 2Z91A 3EOBB 2CLZB 2YPLA 3X3GH 4GBXC 5IMLB 4OAWA 1QEWB 2ZG2A 1HXYB 3WHE1 1REIA 2P44B 4M7LL 2NY4D 4X5WB 2YMXH 3AREA 4IIQB 4M8VA 4WENB 5HGBB 3RWEB 3BDYL 3VWJC 4PBXA 5FGSA 3GSNA 5SX5H 4M5ZH 4NO3A 3SE3C 4D0BB 3SDDB 1CD1A 1S8DA 3IDIA 4HWUA 4NM4H 5I71C 3NABL 5KSBA 4K7FA 4Y4HA 1UQSA 2QL1A 5I6XC 2W60A 1Q94A 4WTXA 3ZKQD 4OI7A 2DQDL 1CL7H 1QFOA 3NFNB 3RL2B 1OT2A 4EIGB 2EDFA 4N0CD 3GMRA 3C8KA 2HMID 1JHLL 2IQAA 5GJSH 3C6SA 3G5YB 3IKKA 1HSAA 1K5NB 2QHRH 3DUUB 4WTWA 5D7LA 1MCCA 1U6AH 3DJ9A 3RJDA 3LY6A 4JG0L 2FH8A 2OL3A 3KPOA 1ES0A 4X7SL 5CLTA 3HZYA 1JYNA 3OKNB 1KJ3L 2AERT 2E9JA 1XF3A 4OFKA 1LP9F 2BSSA 4JFFD 4Y1AE 3RAJH 1FZOA 4BFGA 2NTFA 4XNUL 3Q2CA 2P5WA 5DMIL 3RWGA 4FFWC 1AI1L 3BEVB 5B39B 3HHRB 3QQ9C 4NNYB 3U7WL 2A9NL 2H32H 4YXKH 4IBLT 3EDFA 4GRWB 2YBRB 2E6JA 4LSUL 4R4NC 3KAAA 5E6IA 3T2NH 1M71A 4N8CL 3TCLB 5K9OA 4PRHB 1FLRH 2E7MA 5D6DA 2D0GA 4FQJL 1VGKB 1FL3B 5CIPH 1FAKT 3NIDF 3LKPB 2LTQC 4YXLH 5C0EA 3I2CL 2JB5L 4K71B 1MFEL 4NRYB 4L8DA 2G2RB 4HXAL 3MJ7A 2BFVL 3P4OB 4I77H 1MEXL 1KB9J 1NMBH 1K8DB 4GAYB 1G7LA 2HRLA 2R0WL 3QI9D 3BPOB 1IM3A 3L3HB 4JR9L 4LCWE 2BNRD 3BEWB 3VH8A 2AJ3A 4IRSB 1BD2B 4OJFH 4D9QD 4ELKB 3DX7A 2GUOB 1OL0A 3C5SB 3NAAH 2BDNH 2VXSH 1BFVH 4K3EH 2XA3A 1S7XA 3MXVL 3QHZL 3QCUL 1LEIA 1EFQA 4K9EL 5GISH 2R69H 2VZ1A 3OKLB 3GMPB 3BP4B 4KKBC 1GRWA 3DVGB 2O5YH 2F54B 2C26A 4ZUSB 3TPKA 1RAMA 2VXQH 1AE6H 4OF8A 3OHXB 1KIPA 4F9LA 1DUZA 2D31A 2GY7B 3U0PB 5ANME 5KTEH 2Q8BL 2X4UA 3BE1L 2ICWI 4NJAL 2HN7A 4NQCA 5DVOA 4QRPB 4KVNL 1MCEA 2MCPL 2VAAB 3GIVA 2BOBB 2OR8A 3DUHA 1KPVB 2W1NA 3ZE1E 3V5KA 3OR6A 5ENWB 4WU7B 3QUMB 3DMMB 4GBXD 1T5XA 4TRPL 3QPQD 4P3DA 3HS0A 4Y5VA 4BSVB 1BMGA 2OK0L 4GLRH 3CFBB 4H8WC 4OGAC 2IADA 4X7CC 5C71A 3QPXH 3RU8L 3S35H 3OF6A 4KDWA 1G7HA 3EO0B 1P9MC 3OKKA 3FTGA 3MRRA 1YC7A 3NCFB 5CJXC 3SDCB 4LBEA 1EBAA 1OM3H 2LV4A 5GGUA 4H0IA 5I19L 1AC6A 4GMTL 3V4PH 3ROLB 1XF2A 3VI3F 1MFAH 2DTML 2NY5H 1G0YR 3KPNB 1JK8B 1OW0A 2H45A 3NIFF 4DZ8A 3FOMB 4PJ9C 1F4XL 4R4ND 4RBPH 4L29A 3BISA 1CR9L 3EJYD 1SJVA 3H3PH 3TA3B 5E5RB 3CVHL 1MRCH 2DBJA 4HCRL 2CDGA 2OL3L 2B1AH 4XNYL 2GK0B 4X5XB 3JWDL 1B6DA 2Q6WB 5F6HI 5IB1A 4L8CB 2QQKL 2ITCA 2D03H 4LK4A 1YEGL 3RIFF 1U8MB 3GRWL 5HHOE 5BZWA 5C92A 4Y8DC 3H42L 4KDTC 3ZMRA 4OTXL 5ID0B 1AGDB 1WIOA 3D2UD 3MRMB 2RJMA 3DXAE 1NEUA 1EPFA 1P7QA 3VGAB 3W9EB 5J1AB 3PWPE 4Z9KB 1RZ7L 4L5FL 5CBAA 5HHOA 3SY0A 3TCXA 4ESKA 3PWPD 3PWLA 4RMWA 2AJVL 3O45B 4DEPC 5CWSA 3TO4A 1I4FB 4I5BB 3HI1B 2A0LC 5JW4Q 4WUKH 1D5XB 1I4FA 1MFDL 3BAEH 3OX8A 3SKNA 4EI5D 2W92A 5TE4H 3EYFA 1MHHA 1MIMH 1MWAL 1IGCH 5HI5C 4WW2B 5EBMB 2M2DA 2X41A 4RISL 1YN6B 3MJ8A 4MD5B 1UVQB 3VFNB 1AGBB 1JF5A 3FT4A 1T0NB 4I48A 1NCDL 3P30H 1UZ8A 3LPGA 1QSFE 2BCKB 4G6JH 2YXFA 4Q9BA 3W0WA 5CLWA 1VPOH 2R4RH 3I6LD 4HZLA 2Q6WA 3CFEA 3IFNH 3MRGB 1JGLL 3RA7L 4ZNCD 2DQUL 3HNTL 5I1DA 1ORQB 3S3PA 5JA9A 2DMCA 2HTKD 1MJUL 4P23C 5CEZL 1LQSR 2N4IA 2GT9A 1QRNA 3TT3L 3TZVA 4U1KA 2XFXB 4NWTH 1W0VB 4CJ1A 1QR1B 1VERA 3OKMB 5BV7H 1EFXB 2AK1H 4FTVD 3T0EA 1BPVA 1K3ZA 1RK0B 1T83A 3OKOB 4F3FB 4Q2ZA 5CHNB 3RKDC 4JJ5A 3ZKXB 5JHDB 5I1IH 2D7NA 1B2WH 4ZFOA 1WTGT 1A21A 4LCWD 2GTWB 1JZ4A 5DR5L 2WLYA 2IH3B 1G7HB 4LRNL 2DDQL 2WK2A 5EBLA 3MTRA 4IRJA 5FA4A 1AIFB 4YBQD 2KDGA 2AKRB 3C9NB 3T0EC 3HS0B 5A16B 3LD8B 1FE8L 5BMFL 2LVEA 3CXDL 5DD1L 2OLDA 3QWRA 4UT7L 3IAPA 2QTEA 1UEYA 1Q9LB 4FZEL 3KLAA 3WLBB 1AGFA 5MI0C 4KZEH 4GJTB 3ZKSD 3P77B 2X2YA 3ZT7A 1BQHG 4LOUD 1WFNA 4XP6H 4Y19B 3VXSA 5EUOA 2NTSP 3HUJB 1AFVL 1S5HB 1DBML 5EU5A 1UCTA 4L3CB 3N85L 4ZNEE 5F7FA 5DVLA 2X4OA 4U1IB 5E2VH 3CSBA 5D70H 2Q20A 3QO0A 4Y2DC 3BQUA 1HHKB 1XF1A 5KSVB 4LCCB 2C7UB 15C8L 1D5ZB 4PLNC 2DQGL 1N7ML 1LD9A 2XTJB 5EU6D 3KLHC 1KJVA 1LO0H 3OB0K 5EU6E 3QUYC 1T6VN 4U1JA 1S7XB 3BH8B 4EEEA 3BRDA 1I8MB 1D9KC 1MWAA 5DRWA 5ISZE 4ZSOA 4JY5H 3WKNA 4A6YL 4HMCA 3KYMA 4NBZB 1Y18B 1FCCA 1SYSB 3F58H 1H5BB 5IT2H 5JIKA 4O58H 3BJ91 3FONA 1AQDB 3DBXB 1K8DA 5ADPL 2J12B 3HMXL 2ZOLA 4LIQL 5ADOL 3FHQA 4OQTL 3K2UL 3VD4A 3QDGB 2EC9U 1MCLA 2UY7A 4NQED 43CAA 1KELH 4X7FC 2E9BA 4UILH 4MA8L 4UBDC 1NMAL 5JPNA 3P11L 3RWHA 2GFBB 1MCPL 4P5TC 4F37F 1OTUD 1UCBL 5HVWA 3C5JA 5FGCB 3TJHC 4JKKA 1IGFH 1P84K 1WBZB 3V6ZA 5E6IB 3ZT6A 1JRHH 1R3HB 2EECA 3LB6C 4DTGL 1NGPL 4O4YL 3V52H 5KVMC 1QSEA 4NT6A 4I9WD 3I75B 2F58L 5J7CC 3IXTA 1OAYL 3WNMA 5KSUB 2ARWA 4UOW1 4O00A 3FB8B 1L0XA 4DUXA 4ZMAT 3PNWA 4QHMA 3TJHA 3PE9A 4RMVA 1QA9B 2MHAA 2YD4A 3P4MB 5F1KC 2D9CA 3BWAB 4GQPH 4JDVA 4KVCL 4X80H 5C0AD 4M61B 2PYEA 3AU1A 1LWRA 1JHTA 5GRVL 4KV5F 5A2LH 1U93A 4EI5B 3KJ4C 1QPXA 3EDJA 1NFDE 1HHJB 1TETH 4U7MA 3D87B 2VABA 1SYVB 1J8KA 3UMTA 3OPZH 5EZOL 4J8RB 2PO6D 4EVNB 1T1YA 4UT9L 4DVRL 4I8DA 2NY2C 3WS6A 5C0BE 1W72L 3QUKA 2UVFA 3V2AR 1I1RA 2OQJA 3AROA 1O0VA 5CKGA 1DTUA 1CFTA 5HGBA 4E41B 2H2SC 1I1AA 2VDQL 3UTZB 1PYWA 1LEGB 3SGKC 3ARTA 2F53E 2ATPA 2GTZB 1SM3L 5CKAA 5F6IB 1NJ9B 5SWSE 3VJ6A 2YD3A 1BLNB 3LRSB 3MRLA 4Y4FC 1U93B 4JFYA 1Q38A 1RURL 1J8HD 3B2VH 3THML 3QFDB 2PYEB 3HE6D 1ZLWK 1DQML 4EOWL 4QY8A 5GS1C 3FQNB 2D4FA 3NPSB 4J6RL 5MEND 4QHMB 1T21B 3O9WD 1GZQB 2HT4C 3ARDA 1L6XA 4X4MA 4QHLB 4KKAC 2VDQH 4JVWA 1CDIA 2VWEE 2RIKA 5GZOC 2VITA 1E4WL 3O9WB 3VXQA 3S4SB 4O9HL 2P24B 4YBLC 3RQ3A 4OGAD 5ABDE 4YIQB 1W72H 3S5LB 4LIQE 5A2JH 1CXKA 5MEPA 5I9QB 1I8IA 1NGWB 5ESAA 4M03A 4GRWF 2X5PA 5EZOH 3ARFC 5BRZD 1I9RL 5IFAL 1GH7A 2AGJL 4YNYB 2Y7QA 4AENB 5T1KB 3FFDA 4CN1A 3RNKA 1T0MA 4X7DC 3WN5A 3QEGH 5C0IB 1MI5D 2Y4SA 3IT8D 4CADB 1DLFL 1N59A 3SDDC 3U46B 2DWDA 1J12A 5FA3B 1ED3B 3FB7B 5C08A 4KVCH 1Y18A 1KCRH 1RULH 5KVGL 4QT5A 1GZQA 2A83A 4L3EB 1TJHH 2APTA 1UADC 1A5FH 4OZFH 3SO3B 1K4DA 1H3UA 2P5WE 3VFGH 3WN5C 3MLZH 4BZYA 4MA1C 1TFHA 3WS3B 5F96H 1CVRA 1MFCH 3Q6GH 2H1PL 1P4LB 4N1CA 1P1ZA 2AJXH 2CLRB 5EPMA 4Z78A 4G6FB 1T6WA 4KKLC 4LCCA 2BY3A 2HFEB 2APVA 1EEZA 3T3PF 1I7ZA 4LLMA 4K07A 1EVTC 1NMAH 4HPOH 1MRFH 2HT4D 1BQHB 1W2KT 5D1ZB 4NDMB 5GSVA 5HYEA 3QUMH 5CS7A 4Z7UF 1YDPA 3ARFD 4BZ1H 3G6AA 2X89D 1J7VR 4LSRH 4Q74A 4P23A 3EYOA 4ODVL 3SDXB 3VMPA 1TNMA 5CGMA 3MA9L 3NA4A 3F58L 4KK8D 2R8SL 4JRXA 5D2NC 4YHPA 1QLFA 5IB2A 4DK3A 5FA4B 4C58B 4ZXBA 2AK4D 3S34L 4BKLA 4PYGA 1JPFB 2O61B 5L7XH 1KIRA 3H9HA 1QACA 1N7MH 1VACB 3V9FA 1X3DA 4OD3H 4LPYA 3U9PH 2VZOA 1RK0A 5T1KD 1NUDA 3DV6A 4G9FE 1QR1A 3ET9F 4JFPA 4AEEA 3MV8D 1DBMH 1EEUA 4P3WA 4D2NA 4YAQA 5KSUA 3ILQC 5C9KA 5C3TA 1W72B 4UIMB 3ZTNL 2ZG1A 5T3XE 1UXSA 3I75A 1UWXK 1ZVHA 5IEHA 3TPUA 4LHUB 4U1LB 1IQWH 4OD2B 2DYPD 3UO1H 1QFWH 3BIBX 1AC0A 3DRTA 5IJKC 4H0HB 1N0XL 5EU6B 2BCKA 1YNKL 1MCWW 4G6AC 1MCNA 2FATL 3T2OA 1AGBA 3CXDH 2DBLH 2FJGB 3P0GB 4ZUWA 3L3GA 4NN7B 5LJYH 5MP6L 4U3XA 4PJIA 4EZMA 2YS4A 4LPTA 3IF1B 3MGTA 7FABH 2DDQH 3D18B 3S4SG 3FFCE 3DWTA 1A9BB 3BKJH 3LEVL 1ZT7A 4IS6B 4NHUE 1CK0L 3O6FC 3SKNB 4OZFB 4CU7A 2ORBL 2NLJB 2J2ZA 1U2HA 1U3HD 3BT2H 1CGXA 5D1QA 3BIAX 4L4JA 4P2OD 4Z7WE 5CBAB 4Y89A 1I9EA 2N7AA 3F7YA 5HHXL 2H6PA 2O5XH 3I3DA 1LGVA 2VR4A 5CEZH 5IKCB 4IIQC 5FDYA 4ZFFB 3NZHH 4Q9QL 2C7UA 3TH3T 4AIOA 1PSKH 5D1XB 2R4RL 4NQXB 5A2FA 3KGRA 5EIVA 1NCDH 2IBGA 4U4BA 3OJDA 2HT3C 4HIEA 2CDGB 3X12B 2V5SA 5C0CA 2XA8L 2JE8A 1MHEB 4IMKC 1J0HA 1U3HA 1VKXB 1MLCA 4Z7UE 5HYSA 1RZFL 3QIUD 1UM6L 4U2YA 1IGCL 1WT5A 3HE6A 3KLAB 4CU8A 2JELH 3IFLL 2XZCL 1NH6A 1GC1L 4PRPA 3TJEL 1YECL 5JLZA 4FRWA 5F1IA 1I8KB 3Q0HA 5BS0B 5SWZA 1G9NH 3WYRA 4FMKA 3S96A 3GBML 2JCCF 4G8IB 3LSOB 1KCKA 3GBLA 2VLKA 3FTGB 1B90A 3BZDA 3K46A 3OL2A 1NLBH 1FFOA 4HD9A 5HDQH 1I1AD 4ODXA 2IADB 3CFBA 3LSOA 4QYOA 3KPRD 2XPGB 5C6PB 1U8QA 3T0AA 4OTXH 1Z5LB 5J3HD 4YFLI 3NGBC 4OFVA 2AXFA 1EFXA 4JKMA 1GSMA 3G6JB 5GGSB 2AJZB 3MOAH 4HPYH 3MV8A 1YN7A 2XFXA 2GT9B 3GSXB 4LDLB 4HBQA 2FEDD 1UXWA 1WWBX 5E94A 1MLCB 1HSBA 4NQCB 4JAMB 5D5ME 2E7LC 1ORQA 4ENEC 4JPWH 1JJUA 2COQA 4PJ8B 4HT1H 4ZPTA 1KIPB 1C7SA 4PJCB 5IF0A 2VIRA 1R5VA 2NY5L 3X3FH 2FJHA 4GXVL 3GMPA 4PJGE 2QJDA 1CN4A 1N6UA 3MJ8B 4R4FL 3MGOA 3GSVB 2XG5A 4GMSH 5IKCA 2IWGA 4JHBA 5IM7B 1B3JA 4LRIC 3WIHH 4PY8I 1NUFA 4WW1B 5DQ9A 4ZO6A 4TTDD 1RHHB 3AC0A 4AM0A 5DQJB 1GL4B 1FVCA 1FN4A 2DAVA 3MSPA 4ORZC 1FGVH 5BRZE 1N4XH 3WDJA 3TH4T 3HUJE 4TUOB 2EXYD 4BELD 1P7QB 5T3ZH 2NY7H 3JUZA 3HPLA 1WZKA 3WO4C 3HZKA 1RZJC 3BZEB 4YDLB 1ZHKB 1MVUA 2FYYB 4PJBB 2Q8BH 2Q7YA 1T1ZA 3SGDH 4KJPC 3MRKB 1KEML 3TZVC 1S9VB 4XVTH 3OGCB 3QULB 5HJ3A 3QT2A 2VXQL 3TCLA 5E7FA 3K1DA 3KYNA 4RX4D 4P3CH 4UDUA 1EERB 4KPHH 2P8PA 3CXHJ 5F71A 4LHUA 2BHUA 1F6AA 4HLZH 1MJJA 2R69L 4P4KC 3MLRL 1NCAL 4K9EH 3TEUA 3STZB 2N7BA 1EX0A 3KPSA 3B6SB 2DWEB 4KHTH 5FOBA 2VXSL 4OGXH 4LLVB 3NFPB 2GW5A 1F4YL 3JWNC 4TVPH 2QSTA 1CTOA 1YEKH 5C09E 4AK1A 4OGYH 4C56B 3BESR 5F97E 5EOCJ 1KCVL 3MREB 1MEXH 2W59A 2BFVH 1ZA6A 1C12A 1BVLA 1EHAA 2QV2A 3VXSD 3I2CH 2WIIB 4ODWB 4ZXBB 1IILE 3MNZA 4BSWB 4YXLL 5F8QC 1VFUA 4PRBB 1CBVL 3N1QC 1RU9H 1ZHNB 1I9IL 1J1PH 3KHOA 5HYFA 3QUMA 1A64A 5CJQH 5E9DA 5D1XD 1S8DB 3IDIB 1QYGH 3JWOC 2BRRL 2SEBB 4N8CH 2QSQA 2A9ML 3NCYS 3ZE1F 3BI9X 2WZPD 1DBBH 3EYSL 5D5MF 1TPXB 5HYJB 2X4UB 2ZUWA 5HGDB 4X5WA 2XNAB 5I6XB 1KNOA 3JVGA 5JOFA 2A6IA 3BRFA 5E8DH 1I7ZB 2XWBB 2GJZA 1C5DB 5JW4R 5CMAB 1QPPA 3T0ED 1YY9D 1B4JL 1Z2KA 4I0PC 3RGVD 1TQBB 4X7SH 4EIZC 2FGWL 4AL8L 1JTTA 3V7MA 2ZCHL 2R0KL 2VQ1A 5GGTL 3WS3A 4HX1B 4RMRA 4JFHD 3QR2A 3MA7B 3SE9H 1K4DB 3CC5A 3BPNB 4XXDB 4W4OA 5D2NE 5KVDH 4FFZH 4BFIA 2GUOA 4JZOA 5EWIH 2WWKO 2JJTA 3F5WA 4MAYD 4Z7UB 4DKDC 5C08B 3KPRB 4FQLL 4TVSa 3QDGD 4FXKA 3W11D 3OJMB 3QCVL 3KPPA 2WANA 3WKML 3BYYA 3ARGC 3HUJF 3NACL 5EIIB 1RVFL 1L0QA 5IV2A 4TSBL 1CICD 5TF0A 1QBML 3GSOB 4RGND 2BVQA 5C0JA 1S7SB 3TA3D 4YFEA 1DR9A 1ZV5A 5SWSA 3X3GL 5MEPB 4BFEA 1ONQA 2V9QA 5GZND 1RUKL 5DWUH 1WF5A 5CILH 4LPCA 5J6HA 3QFJD 2VDKL 3PWPA 2F5AL 5GRUL 3FFCD 1C12B 1DN0B 1FHGA 1D5IL 4S0TD 1BVKB 5HPMB 4NHCH 5I75B 1SY6L 4MNGA 3TNMA 3V5HA 1XGRB 2BNQD 4J3OC 1JHKH 4OCXH 3GZKA 3HNVL 3D0VB 1FZOB 2LFGA 1CI5A 5E8PB 3L3JA 1MAML 1UKTA 2RBLA 4KMTH 4X0KA 3ARRA 1AP2B 4PRHE 3N1PC 1SEQL 4ZOBA 3IS1X 1V3MA 5DO2D 1V05A 3QEUA 1IZKA 2CPCA 4E5XB 3ZLQC 3ARVA 5EB9A 1ZTXH 4N90D 2VDRL 3C8KB 4R26L 4X6DF 4QRPE 4NQTA 1KB9K 3D9AH 3WEXA 5BS0E 5KG9A 3EZ8A 1IGMH 5C8JB 3QQ3A 3L6FB 3WIFB 3KYNB 2DLTA 4KROC 3CLEH 1I1AB 1D3CA 3OGCA 3QULA 4OLYH 5I74C 3MBXL 3ULVC 3LPWA 1S9XA 3ECBA 3BZEA 1MCIA 3BHBB 4Q6IB 1M6OA 1P5VA 5TJWK 3UP1A 4WUUB 1RIUL 4JG1L 4ZAKD 3ULUL 2XQYG 4ODBD 4U1MB 5TDOB 2YK1H 3ETBF 4S1RH 1A1OB 2APFA 4OAWB 4OI8A 3QXTA 5DD6A 3VXPB 4POUB 4L4VA 1MHCA 3DYPA 3IYLW 1MCWM 3ARDC 1CDJA 1G9MH 4OFYA 1CG9A 4MYWB 1S3KH 4NO0D 2BP3A 1A6ZA 1JHTB 4XNXH 5ETUA 5TPWH 1LE5B 2YD6A 5EULV 3D3VD 3DI3B 2B5IB 2OP4H 3BGAA 4Y19E 1ZKAA 4JM2C 3GI9H 5A40E 4FFVC 4NOBA 1L7IH 4JKPH 3D3VB 4PLKD 1I8LC 3ARFA 2ZKHL 4AG4L 4OBRA 3VCLA 4L9DA 4N5UA 2XXCB 4H5SB 3SCMB 5DQDL 4D0CB 1MCKA 2BMKA 4K9EC 4LNVA 2XTJE 4WHDA 5GGSY 2DQEH 3HG1A 4PTUA 1GGYA 3HMWL 5DJDB 5IK3A 1OP5K 2UUDH 4PD4J 3O3DA 1CE1L 4PJ5E 1G7IB 3AMLA 2ZUQB 4EKXA 1A7PH 4RFNB 2OTPA 43CAB 3BH9A 1A14H 4Q9RH 5AWNL 1JF1A 3RVTC 4JO3L 3HR5B 1OAUL 2VH5H 4OKVA 3DTXA 1MNUH 4OCNC 4EN3A 1A0QH 2QSCL 2ED8A 2OTWB 3HZVB 2WBJC 2VLMD 2UWEF 3NCCB 1QHOA 4HWBA 4G8IA 3KJ4B 1G1YA 4Z76B 3MGAA 4GAFB 4HKZB 4YPGB 1FDLH 1FNFA 1PAMA 2DQHH 4BH8A 2VWEC 1I8KA 3QFJA 3RL1B 5I8CB 1CTNA 1LK3L 5JLZB 3PV6B 4DK6A 4WI6A 3BPCA 3A6CH 2PCPA 3U36A 2EDBA 4KKNA 1I1FA 4H0GA 5SV3A 2KQMA 2CKBA 3DX6A 3L3KB 5IHZB 1A3LL 4JPIB 3PQYA 2YD2A 3CMGA 4L3CA 4V3EB 4M48H 5D7SH 4NQDD 3RZWA 1NAKL 4NQEB 3GHEH 3WXWH 3ZO0A 3HUJA 4UT6L 3VXSB 1JN6A 3LQAC 3SDAA 3CLFL 4KROB 1MCOH 4F7EB 5E1AB 3TO4D 4LNRA 2ZSWA 1NCCL 3GO1L 5DO2C 3WJJA 3LRGA 2E7HA 3PXJA 1F97A 4Y5YB 1OY3B 2WWMD 4MNHA 4RWYH 4X8JA 4XPGL 1DCLA 1I1YB 2ZPKL 2CDFA 1E6JH 4BH8B 1H8OA 3FRUB 3QEQB 4AEHL 1OSZA 1UT9A 2J88H 1HINH 1FCGA 2DLGA 3VWKC 1TZIB 3U7AA 5EBLB 4OF6A 3T08A 4Z7OE 2J6EH 1JWUB 1XR9B 4HS8L 4EQ3A 3EGSA 1OAKH 4HIIA 1KPRA 1CVSC 4ZO9A 4DGVH 5D7IE 1DQTA 3OKOA 3VI3E 4R8WL 3ZKND 3UTTB 1G7JB 1J87A 4PJDF 4EJ1C 1KB5H 4RWHA 5J0BA 4PPTA 2VLRE 5JUEH 2CUIA 2NW3B 4WO4C 1FL6A 3FN0H 1J1XL 5INCB 2P4AB 1WCBB 3HG1B 4PTUB 5IK3B 3TN0D 3GKWL 1INEL 5BS0D 3REVB 3HI5L 3G6DH 1G6RB 4LLAA 4LMQE 3CFDA 3OKEA 5E9DD 1DZBA 4F9LC 5FO8A 5KSAC 4DKAA 7CGTA 1BP3B 4PLOB 2YWZA 3GEWB 1ODAA 1JGVH 3AUVA 3EIFA 3OG4B 3WUZA 5DJ0A 3NVQA 5IB4B 4UI2A 3MR9B 1YMMB 4P2QB 4WUUD 2W07A 2NY1D 1A6AA 4MZ3A 3KDMA 5I73C 3IVKA 5SX4I 1IAMA 5DJ2A 1JWMA 5GRJH 3QYCA 2DJUA 1LP9B 1NBQA 5GGQL 1X5LA 2WW8A 4RFOL 4Y5XC 4HIIB 1OGAA 3DURA 4ZFOL 1DFBH 3SKJH 4MJ6A 1BZ7B 5IGXH 4MDJA 4BKLB 2I9TB 4QOKE 5FYJH 4OZIF 1JVKA 3U0WH 3CSPA 1QLFB 5IB2B 4L8SC 5I66B 4JRXB 4S1DC 3RWJB 3E6HB 4PJEE 2AEQL 5HD8D 3ERYA 4M3JA 3QWOA 4UBDD 3OWEA 3RX7A 1FO0L 3PV7A 3GSWB 4M4RA 4L1HA 1BREA 3RY6A 1Q0YH 1MH5A 1U3HC 4JO1H 1OHQA 2E6QA 3FHAA 5EBWB 3RUGA 4CN4A 5GSRA 3R0MA 3I6GA 3KPLB 4NDMA 2CGRH 3FQWB 3VFSA 1QFUH 3CDFA 4JFOB 3MRCB 4WW2F 1MCDA 2J8UA 4NQEA 4XC3L 1F4WH 1LO4L 1I9JH 1O7VA 5A1AA 3U48A 2UY6A 3WEXB 3U4BH 3IU4H 5F7EH 3L5XH 1UC6A 2CKBB 5I17B 3TIEA 5H35A 5DJCA 4XMLL 2YA0A 1YJDH 3ARXA 3UTSB 4E5XA 1HYRC 4UV7L 4PJ7A 3EFFA 4J23A 1CT8B 3Q5TA 1PKQB 1OPGH 4ONGH 5SX4H 3PL6C 5DT1H 1SJHA 4XBGB 1OOAA 1JPSH 3W5MA 3L7FA 2VXTH 2R0ZL 1SBSH 2MWCA 3WE6B 2R56L 3UC0H 3BW9B 3MRRB 1WZ1L 3LEYL 3JTCA 4K2UL 2Y72A 3EFDH 2LU4A 4W6WB 5I15H 1M7IB 4P2QD 3LV3A 4RGMB 1EJOL 4EUPA 5E99L 1TPXC 1UA6H 5D7IF 4CVXB 1ZEAH 5EORH 5I1LB 5IR1B 1Z0NA 5IVNA 4PLJC 3FOLA 4CMHB 4OB5L 3L1OL 1EBPA 4KK5C 3ALWA 4KY1L 2XKUA 2D0FA 1EO5A 4PUBL 4OUUA 2L0DA 4QRPA 4OCYH 1H3GA 4XP5H 1U8KA 4M6ML 4M00A 1IBGL 5HI5D 3ULVH 2WLZA 1U91A 4NP4H 5LGHH 3DHJA 5CCKH 3LKQB 1RZJL 4Y2DB 1JNLL 3OHXA 3RVWD 3KPRA 4AT6B 1E28B 3HNSH 3NZ8B 1YPZE 3D3VA 3ARDB 4LGRB 4JPVH 4MHHI 2XKNB 1KC5L 4OZ4B 1J11A 2IG2H 1XGYL 1IAKB 4ZO8A 1QBBA 5K9JH 3FQNA 1NBVH 2X1OA 3U0TA 3GMMA 4RDQF 4X4YB 5HTSA 4AIZB 1B4RA 4LSTH 4M1DH 4IJ3B 1JPST 5AD0A 2YPLE 4Q6YA 4F2MB 1DBJH 4OQTA 2HT2D 4FTVA 5DURD 2J6EA 3WXVL 3MRLB 4NN5C 1BLNA 3R1GH 4JHAH 3LH2L 4G8GA 4OLWL 3EYVA 3SEPA 5DUPH 3VH8B 1IRAY 3X11B 4CMMB 4ZAKA 4OT1H 1L8JA 3K1KC 4X4ZA 4J3WA 4XCNA 1Q1JH 4H1LG 1OSPH 1VENA 4PJFE 3C2SA 1GGBL 4F58H 1WWWX 4HSQA 4JRYA 3PGCA 4ZTPL 1ZVYA 4RFEA 5TE6H 1S9XB 3G5ZB 1S7RB 3QUKB 5ITBL 2SEBA 1RUQL 5I30L 5DD3L 4F57H 2FL5B 4G42A 4XP1H 3L5WB 3D1MC 4IOSD 1UKSA 35C8H 2ADJB 2WMPA 1NDMA 3WIFA 1ZSDA 4XC1H 3V5DA 3W9DA 5JDSB 4POZD 4R9HA 3C6LD 3HE7D 4G6KL 2FX7H 5I75C 4PG2A 4EI5A 1D5MA 3ZDXF 4AEIH 4U0RC 3UAJD 3QEUB 3IDNB 4CMHC 4YDJB 5DJ6A 4YHLH 5FDWA 1KPUA 1AP2A 4JFEE 3SGJA 2BNQA 1FBIH 4I18A 5DK2A 4C56A 1FJ1B 1GIGH 4QWWC 4I0CC 1J05B 5HHOD 4KI5C 2CRIA 4XP1L 2W65A 8CGTA 4LCIL 3UYOD 1IC5H 5E70A 4OZFG 3WFBH 5DK2B 3OKNA 1A6TB 4MNGB 4LLDB 3RHWK 3LS4H 1C5CH 5H37G 4ZTPH 1ROWA 1IGIH 3O8XA 4HIHB 4NT6B 1FNLA 1T1WB 3SGEH 1OSPL 3CD4A 1A7OL 2A6KA 1AGCB 2YEZA 2W60B 1P2CB 3HLAA 4YDIL 5DUPL 1UQSB 3UJIL 4NO2A 4K71C 3QQNA 3R1GL 3VXMD 5F7UA 3BO8A 2GFBA 1KB5B 5FV2A 4E42B 1XCTB 1T1ZB 2AV7A 1DBJL 4HK3N 3V4UH 3PJSA 4LSTL 1D6VL 1YEHL 3NCJL 4RFEB 4WI8A 1OWWA 2R1XB 4G8EB 5K9JL 3WUWA 3DO7A 5AG9A 2CDEA 2I24N 3KPPB 5TE7L 1QD0A 1FZKB 4JPVL 1XFPA 1HH9A 5DRZB 2QKIA 3EYVB 1BJ1H 4Z7UA 1RZJH 4R90L 4RNRA 1NGZB 3HCVA 2NX5D 2V7NB 4KJYA 1QSVA 1A3QA 4PY7A 3BH8A 3P0YL 4LSPL 4OLVH 2YD5A 3VW3L 4MNQA 2YXMA 1NGXA 1T83C 5IIEA 1YEJL 1FYTD 2MTPA 2NY1B 2H8PA 1U3JA 3ARYA 4GBXA 2ESVA 4KY1H 1IFHL 5EOCH 1DEEA 2DTSA 3WL9A 5KS9F 2QADD 4ALAL 2X4OB 5D2LE 1UM4L 4M6AA 5JOFB 3CJJA 2VZSA 4NN6B 1FL5B 1KNOB 4PJFF 5I15L 1PKQE 1R24B 2RGSA 4ZTOH 4BZ2L 2FO1A 4NUGL 1AY1H 1XF5B 1UXWB 3UC0L 2QLVB 3FMGH 5C0AB 1Q9LA 4I0PD 3IJHB 3MV8B 2ERJC 3UJTL 3QISA 2R2EA 3G08B 5DT1L 1DQLL 1OGTB 1OPGL 4K7PY 3S88H 3UPAA 4JVUA 1Q9WB 1YPZA 3T4YB 3RY5A 3BGMA 2HLAB 5IHLB 3TVMD 3Q3GA 1IAIH 1KIUA 4JO2H 3VI4E 3HFML 2VN7A 1PLGH 3DMMD 1DE4A 2LE9A 4NUJA 2FX8H 3SPVB 1FFNA 3K2MC 3MRQA 3IB4A 3IU4L 4G7YL 5F7EL 3WD5H 1N6QH 1T7YA 4X4XB 4CW1B 4Y4FA 4ZFOB 4YC2B 2YD1A 1F4WL 4XC3H 5DHVH 5D5MB 1KCSH 2CGRL 4F7CA 1DDHA 4L8SA 4J7RA 3MUHL 4HG4J 1F4AA 5FUZL 2D7TH 1QRNB 3TZVB 4YO0A 3MRFB 2Q3ZA 3BDXA 1HH6A 1QBLL 5DJCB 1KENH 3OXSB 5T3XD 5D4QA 3UBXI 3EW3B 4PGEA 5IFJA 1A7RH 1MELA 4ENED 5J13C 1NFIB 3DXAB 4KJPD 4HZLB 3MRCA 3QDJD 3FKUS 5INDB 3B2UD 5FYJL 3UXFA 3GMNB 4YZFE 4K7PH 4OSUL 3FB6B 1WCQA 4R4BA 3UYRH 3V95A 5I1AB 1MVUB 1UYWH 1LO2H 4MD5A 5GGQH 4HC1L 1PGRB 3FQRA 3RZCA 1Q9KA 4U6VL 3QI9C 4LP4A 5IW1A 1BM3L 4NHUA 4HKBB 1YNTB 4QXUH 4HUUA 2CIIB 1AQKH 2D0HA 1MIEH 4PREA 2MCG1 4OV6F 4I5BA 5CWSB 2FGZA 5D7LD 2BZDA 3O4LD 1MUJA 4IS6A 2BNUA 3DURB 2JJSC 3KJ6H 3FO9B 2BHYA 4EUPH 4L4TE 5DJ2B 3N1MC 2YRPA 4RMSA 2RCSL 1J88A 2VZ3A 2ZG3A 4K8RH 5ID0A 5I1KL 4Z5RB 4UINL 3RFZC 1KB5L 4YX2H 5TH2A 4V1DE 2VIRB 2YWYA 3CIQA 5DMYA 3NCEB 5DJ0B 2YN3A 2E27H 3ZDYF 4WWKA 2BJML 4LOUC 4JCMA 4F33B 2VE6A 4XCYA 4OZHB 2GK0A 4X5XA 4QRRA 2EDTA 4Z7VA 1LHZA 1EVUA 2N1KA 4JRWA 4UB0H 3OKEB 4HS8H 4OV5B 4JZJB 4LL9A 3QJHA 2W38A 2XY2A 4RIRB 4YHZH 4UIMA 3K4ZA 4EN3C 4PJAF 2J88L 2XTJC 1E6JL 5CSGA 3DV6B 2EYSB 2ZPKH 2R0LL 4ELMF 2KH2B 5E8NA 2VYRE 4AH2A 1GVIA 3WHXB 4DQOH 4LMQI 1PG7W 2PYED 2CMRL 4KMQA 2KBGA 4AMKL 4JANA 4HEPG 1MCOL 2AP2A 3CLFH 1ZE3C 3PL6D 2YUVA 3WXWL 4PRPD 4ZPVB 1I3RB 3FT2A 4M48L 1QVOB 2UYLB 3O3BB 5CP7B 5D7KD 2HTLC 3FRUA 1A4JA 1ZHBA 1N64H 1A3LH 4DZBB 3AGVA 5GS1A 4CRPA 5F70A 3EJJX 2QQNH 4FQIL 5IBTH 2XIDA 5FGBC 5GRZA 5GS0C 1XF4B 4F7EA 2V2TA 3G04A 4PJEA 4WNQB 1KSRA 1TQCC 3P0VL 1JN6B 2DQHL 5EU3A 1SMAA 4R3SB 4XAKD 3V6BR 3DVNB 2PETA 2R2CA 2PXYD 2C4FU 5FIEA 2VTFA 5DZNA 1A0QL 2QSCH 3ARPA 1U95B 4AY0A 2AXHA 3HTLX 2A6JA 1OD7A 4P48A 5B8CB 4KJQD 1J5OL 3IRZA 3MCLL 4MJ5B 5AWNH 1UB5B 3BPCB 4HUWA 3TIDB 3GMOA 2A2QT 4K94L 2GKIA 5D6CB 4JPKL 1DQDH 2ADGA 3F7YB 1JGEB 4EN3D 4O2FA 4D94A 4I18C 4L3EA 4Y5XA 4HUXB 5JR1H 3O6FD 2Q8AH 1BD2A 3HMWH 2YRLA 2ZUSA 2DQEL 1N5AA 4S2SB 1ED3A 2EH8L 5T1DH 5FA3A 2NLJA 3QUZA 1G7LB 4WO4A 5T5NG 4DN4L 5T1MB 4PJXF 5ANMB 1FPTH 2ZKHH 3ABZA 4NZUH 1HDMB 2GAZB 3RJQB 1A6PA 4JKPL 3L7EA 1CXIA 4WI3A 4KRMB 3UTPE 1BIIA 3VFOB 4PRNA 4O51A 2DMKA 4ODTH 2JB6B 1M71B 1EDQA 2XN9B 4KRLB 4D0CA 3S4SA 3NA9H 4P2OB 2VZVA 5IVZB 2D4DA 3KXFA 3EOAB 3VCLB 4RAVA 5MHSD 4Z18A 3FQTB 4YAQB 4IRJD 2EE9A 3BEVA 4X8XA 5DJ8A 5B39A 5CUSL 4OZGB 2YK1L 5KSBE 2NTFB 2X4PB 2Q8AL 4JG1H 3WNOA 5C08E 1XGPB 3KPSE 4YK4C 4HJ0C 1DQDL 4LDOB 3U6RB 4OZIA 5F8RC 4PJAB 3CDGA 3OAUL 1L0YA 4OLYL 3C6SB 3G5YA 3B9AA 2IH1B 2RFXA 2CIKA 1J5OH 4Z6AT 5KZCD 2GTZA 3VXPA 3RDTB 3PQYE 4FFVD 4P9ML 4XRCA 1ZHBB 3SDXE 3BN9C 4P5KB 1KN4H 3BXNB 4Y4HB 2VDRH 3SDXA 5BO1H 1XIWC 4HWBH 3IDMB 4D0BA 1CLZL 5DZOA 1YDPB 4PJBF 2XWJA 1Y6NR 1TITA 1L9NA 5F6IC 1MAMH 1T1YB 4N9GB 4HG4K 4FQIH 5IBTL 4OCXL 4J8RA 4KKCC 4Y16B 3BQUC 3DYOA 2IAMA 4NNXA 5T5NF 4L4VE 4LLYB 1QEWA 4LVEA 3DROB 5C8JA 3H7LA 2VB5A 3RWIB 4N1EA 5CILL 5DWUL 2ID5A 4IOFC 4CGTA 2ZSVA 4E0RB 4G8FA 4AMKH 4BQ9A 3LHPH 2HJFA 2IBZX 2XN9E 1NGYA 4I2XA 4RA3A 3QH3A 2A1WH 2I60L 2G5BB 1E6OL 5M7QA 4Z7NF 1FNGB 3QDMD 3M8OL 1S5IH 3NACH 4ZAKC 2X4RA 3WKMH 1NC4A 2YA2A 4MA3B 4JFZH 3ZT5A 3QCVH 1KG0A 5GJTH 5FKPA 2FHFA 3RTQD 3T4AB 1WBXB 4FQLH 1ONQB 2HJLA 3P2TA 5GIRA 4NWUH 3TYGH 5FUOL 4P9HL 3D85D 5MI0B 5TGBA 4X6DB 1S7SA 1N5YH 2E27L 5F21B 1TLKA 5DUMH 1GGCH 5C07D 5L8JB 4WEBH 3SE9L 1PJ9A 4MS8C 1A4KB 2NY6C 1T2QH 2QBWA 1CFNB 4HUUB 3QDGA 5DEZA 1DANT 4G9DB 5TF1H 1XZ0A 2D7PA 2FGWH 3DGGA 4AL8H 3ZSTA 3QUXB 4DJMA 3LMJL 4O2CB 2PR4L 3TF7C 4HK3J 5ICZA 4N5EC 1L9MA 3IKCA 3ARDD 4RCAA 4NC1C 1O7SA 4RGOL 4RFNC 3O9WA 3VRLE 3FB5B 5T33H 3RWCB 1AXIB 4W70A 3C60C 4L4TB 3QNZA 4X5LA 2HVJB 2L7JA 4KQ4L 4R4BB 4Y1AB 4P4KA 1R3KB 2CR6A 1CZ8L 5F93C 1Q0XL 4QHUA 1FZJB 5J89A 4QGYA 5J57B 1TIUA 5DRWB 1J0JA 4XBEL 2X6MA 1MIEL 2FD6L 4X6CA 3IS0X 3V6FA 1UH4A 2VQ1B 4QXUL 1Y0LA 3NGBB 2A38A 1P4IH 4IM8A 4IRZH 4XI5D 4U6VH 2EC9T 1LO5B 1QYGL 1K9TA 2BSTA 4KFZC 3UJJL 4XX1G 2Q86A 4HFWB 4Y8AA 2GJZB 1RU9L 4PV9A 4XCEB 2A6IB 1UWEL 2B0SH 1BWWA 4NO0B 1NCTA 2IFFL 3ULUC 5D5MA 4MHHG 2W9DL 3U4EA 2WBJD 2K3TA 2F5BL 1JYWA 1NLDL 2MPAH 4HJJL 1A6WL 1HOCA 1S7TA 4RRPG 1KCVH 4TULH 4DWHA 4LLWB 3O41A 3R8QA 2I9LB 3T1FA 4NQVA 1NCBH 1YEKL 3FN3A 1JUFA 2EIDA 2D7TL 2V2XB 3K7UA 3BGMB 2Q3AA 4JZNA 3PDGA 5E6YA 1ERNA 1SYVA 4L3EE 4BSWA 4IRJB 5E6ZA 1NCAH 5ISZB 1CICC 2WUCH 4DEPB 4N0CC 3ESUF 4GKSB 1YUHB 3WD5L 2BNRA 2AAVA 4I0PA 4JJ5B 3VFVA 5JHDA 1MAKA 2APXA 2VXUL 4OUOA 4WTZG 3LQAL 1H15B 2A73A 4POZC 2VAJA 2P7TB 4LLVA 1R3JA 1K85A 2DMBA 3LS5H 4F7MA 1TQBC 5CZXD 3VFRB 5DF0A 1IMHC 1GAFL 2DQCH 4M02A 3STZA 3WL9B 5F1OB 2ESVB 5T3ZL 3FMGL 1RI8A 3AM8A 5TQ2H 2P8PB 1N4XL 3QO1A 2XY1A 3LKNA 3DSNA 5T1LD 1RIHL 2Y5TB 1BGXL 2ICES 3ARGA 2RB8A 5D1ZC 2MFNA 2DYPB 2FIKB 4KRPC 5IEKB 3CSGA 4TSAH 3MRKA 4NRZA 1X7QB 5AUMA 3W11C 2FYYA 4PJBA 2NZ9D 2ITDA 1VFBA 3WIHL 4PB0H 4TSCH 4TN9A 4WFGD 4QTIH 4GMSL 5IHUH 1HIML 4R4FH 1JZ6A 1YEJH 3EZJB 4HDIA 4Q7DA 4XXCA 4OLVL 4LSPH 3P0YH 5DMGD 1FVCB 1YEEL 5DQJA 2FJFB 3KYMB 4FG6D 1JGDB 3BP6B 4HT1L 1KLUA 5JPMA 3ARQA 3SY0B 3UBXA 4HQQH 2H2PC 5DQ9B 1NFKA 4ODUA 4HH9A 1MJ7L 4KHXH 3W39B 4D3CH 3JZ7A 4K3GA 2FX9L 5I8OL 1T1WA 3B5HA 5IM7A 4YR6A 3GSVA 4MD4B 1D5ZA 3CUPB 2PTTB 3C8HA 3NCJH 3MOAL 5I2IB 1B0GB 1TVBA 3F6LA 2VNCA 4PP1D 1A6TA 2A74A 4F7MB 4IRJC 4HKXA 3S36L 4LVHB 1NGYB 3VFPA 5DRXB 4E0RA 2FO4B 3OR7B 4GG6A 5L0QC 1IEBA 2O5ZH 1IQDB 4FABH 3OGOE 1H8NA 5J6GB 5DXWA 1TTGA 1YQVL 3RDTD 2VLJE 4G3YH 3DX9B 3HRPA 1H3VA 2FRGP 3WLBA 1YPZF 2ADIB 1IGIL 5DJZA 4HC1A 1CFBA 5JDSA 1G9NL 2V2WB 2XZQL 3V79C 1XF2B 4JZNB 2EYRA 2BNRE 3WFBL 2XZCH 1W8OA 1IC5L 1Z5LA 2Z31D 4LCIH 1B9ZA 1RUPH 1WUNT 3OAZK 3VG0H 2I9LA 3T1FB 4ODXB 1FBIL 3QHFH 4U3CA 1XGTB 2GCYB 4YHLL 2IH3A 1P84J 2EDDA 2Z8RA 4F7PB 4Z7QE 1FFPA 1KJ2L 1TVHA 4XVUD 1FQ9C 3QXDA 3RWFA 3ALPA 3QIUA 4JJHA 1HHGA 3TBYA 4PLJD 4JRYD 1OTTC 3X11A 3V5KB 2CIKB 1CICB 4HWNA 4G6MH 1AO7E 3C2AL 4X9GA 5DD3H 3GIVB 2P1YA 2BY1A 1YMHA 5IB5B 3GJFK 2O5XL 1MFBH 4F15B 4P5TB 4HIEB 2FSEA 3O2DL 1PDKA 1IT9L 5I76B 3MOQA 1RZIA 3CH8A 1EHLH 3BT2L 4ZUSA 1KJMB 2BVPB 2BVYA 1RZ8A 1T0NA 5ICYB 3VG9B 4JFFE 3MV7D 4LLUB 4OT1L 4BK4A 4C55A 3GBNH 5F7LB 2HVJA 3LH2H 1UVQA 3EOAA 4JHAL 4WJ5A 4PJCF 1RHFA 3WXVH 4ZNEA 4NJ9H 2OXGA 4P2OA 3CMOH 4XCFL 5I8EA 3C60A 5IB3B 3ARBB 2JB6A 3C5SA 3K3QA 3LKSB 4KK5D 1BIIB 5L9DH 3A67H 5GS2D 2AJ3B 1N0XH 4M7ZB 1JNHB 1KC5H 3L7EB 2UZXB 4KK6D 2GAZA 3HNSL 3I6KA 3UO1L 5ACMA 1IQWL 4D9RD 1LEKA 1XR8B 5CCKL 1GC1C 3MGTB 5LGHL 4P2YA 3ZTNH 3HAEB 2X4RB 3VXRD 1NMCC 4HBCH 5IG7A 1U8NA 4M6MH 4XP5L 5IW6B 3O0RH 1R3IL 4PUBH 4RDQG 4S0UC 1U8MA 3QXAA 2P8MA 3IETA 4LCUB 2J5LB 3DV4B 4I2XB 3DRTB 3L7FB 2Z93A 4OD3L 4X6FA 1X9QA 4OB5H 1SJEB 5LG1A 3VWKB 2ZSVB 4UV4L 3QXWA 3SBWA 3SE4C 5EORL 2IPTL 1UA6L 4XNMA 5ACZA 1EJOH 2NCMA 1OAXL 4N9OB 3UDWA 4N5EA 1U8LB 2BSRB 1U95A 2VRAA 1VADA 3RWIA 3O4LB 4KC3B 4R2GC 1NC2A 1SBSL 3M17A 4X9BA 4ZUVB 2GEEA 2VXTL 1VFAB 2P49B 1JPSL 1UZ6E 4IOIA 4PV8B 4TUJB 3NOIA 5EBWA 3IFOB 3QDAA 4YHKL 1HSAB 1K5NA 1F3DJ 1X6NA 3ILPA 1YJDC 3T1WA 1F2XK 1FG9C 1YJDL 4XMLH 3BVNA 4BSVA 4L1DA 1INQB 4OFPA 4Y5VB 4Z7QF 5GS1B 2YD9A 2DI8A 3IU3A 1VEPA 2DLFL 4XRCB 1LO4H 5DHVA 4WU7A 1IC4H 2F19L 3BVNB 3EYQD 1QFUL 1UG9A 4B41A 1X5JA 1DP0A 3AM8C 5CD3B 2IANE 4K23L 3QZWB 3CDGB 3SJVE 2C1OA 5JIPA 1C8PA 4CNIB 1Q0YL 1PZ5A 5D1ZA 1FAIL 1JWMB 1BQHA 3BPNC 4ZUTB 3D39D 2VDPH 1TJHL 1FO0H 4CAGA 1HNFA 2BHZA 2D31B 5E8NB 5KSAA 1X5XA 4X7TB 1IKFH 1MSPA 2BVEA 2F54A 4X7EC 1U8LA 2YZ1A 4ONOA 3C5ZD 2HFEA 1DLFH 3E1F1 4GRMA 4JFEA 1NMCB 2EEBA 3F12B 3QEGL 3PL6B 5IGXL 4K7PX 4OV5A 4DUVA 3WJLC 2Z4QA 1P4LA 3P9LA 1DFBL 1SVZA 5FO8B 1CCZA 1A9EA 2NZIA 4AQ1B 3MBEA 1CGSH 5FUCE 5E95B 2VE6B 2AGJH 4XCYB 4N8VB 4PRNB 1CFVH 2WP3T 5INCA 3QXAB 2DQFA 2FECL 3RVUC 4IRSA 5TH2B 5E24E 1CXHA 4O2EA 4QRRD 1GXEA 4YDKH 1U8NB 1GHFH 3PWVB 4KKBD 3SQOL 5F7MC 3MV01 3SE8L 4H88L 1CD9B 5GRXG 4JM2D 3UYPA 4EI6B 1LE9B 5FF6A 4LVNB 1SQ2N 2BERA 4NQDB 3INUL 3FFDB 1DL7H 1D6EB 3LZFL 3LKPA 5CJ8A 5DJAA 1J1XH 2IBZY 1E4XL 2WP3O 1YY8B 4M6NH 2F53B 4RAUB 1RJLB 3ARBA 5DK3A 5IW1B 3C60B 4R8WH 3TIDA 4JFDA 5M94B 1F3JB 1UB5A 2PW1B 4DGVL 4WJ5B 5MENA 5BVPH 1CXFA 5E1AA 3D2UB 4Q58C 4QHLA 2B20A 2BVPA 4LASH 3V0WH 5GS0H 5CJ5A 5IBUG 3SDAB 1CF8H 1EA9C 3D48R 2RAMA 2FSEB 2P5ED 4ISVB 3K8LA 5FK9A 5J1TC 1ZWIA 3FL7A 1ES0B 2ICWA 3QDJA 5FB8A 1XF4A 4GS7B 3PWJA 1OCWL 4JFYB 1HYSD 4UT9H 4DVRH 4U1NB 4YO0B 1OF2A 3MLSL 2IQAB 2AJYH 4NIKB 5E4EC 2NY2B 3ZHDA 5JXEA 3MLTA 4HGKC 3OPZL 5I1JH 3QIUB 4F7CB 3ES6B 5F3HB 1PYWB 3WO4B 4HW6A 3N0PB 1NAKH 5EBGA 4NM8L 2GCYA 3GSNB 3MRQB 3JBG7 1U8JA 4OKVB 1TENA 5JXEC 4X80L 2OJZH 3MBED 3Q3GB 2JJWA 1H3XA 4QF1A 3L3DB 2NXYC 2WY3A 2UVEA 3G08A 5LAXB 4NKMA 5JW5A 3CFCH 4PBVC 4BQ8A 3HPJB 5KANG 1HHJA 1G7IA 2FNBA 5IMOB 5C0AA 5FYJE 3DX9A 1OB1A 3GSQA 4O4YH 3V52L 5IUSA 2IAMD 2B2XL 3RRQA 1MNUL 3AU1B 1FGNH 5H37H 4V2BA 3IJYB 4JGJA 1A14L 2ZUQC 3PNWB 5DFWH 1FG2B 4UILL 3QJFA 1JF6A 3RI5F 4NBYB 4Z77B 2PTTA 4OQTH 4JKLA 5ADOH 3EHBD 4MD4A 4NKDB 3VH8G 2DKUA 2AQ3A 4LIQH 3TYFB 5ADPH 4ODUB 1X4YA 4KTDL 1KACB 4V1DA 1MUJB 3K8MA 1FYTA 3LN9A 1JGDA 4JY5L 1MHCB 2HLFD 4LKXA 4AG4H 2Z8SA 1YEFL 2VO5A 2VJXA 1L7IL 4HDIB 4R97C 4PRIB 1LO0L 2CIIA 3GI9L 4NO5B 4LDEB 2ICEA 1YNTA 1EO7A 3VXUE 2DQGH 2R1XA 4D0DB 5DRNB 3QAZC 5KJRL 1CIUA 4S1SL 4XWOD 4DFHA 3IXAB 5TPWL 2R9HD 5E2VL 1S7UA 4NKOA 2EIEA 4XNXL 3QZWG 1H5BA 1S3KL 3CX5J 1SYSA 1XH3B 2J1KA 3HE6C 3K4AA 4NO2B 3C6LB 3HE7B 4M3KB 5A3IC 5K9QG 2P8LA 2CXKA 5F3HA 4UNVA 5EO0A 5JXAH 4S1RL 4PJXE 3WMSA 4DN3H 3BDBA 1HEZA 2VL4A 3MRHB 1LD9B 4GOSA 1EMTH 2L7UA 2FBOJ 1RIVH 1ZGLP 4MB3A 4FZEH 1N8ZB 3VD3A 5L2JA 5JZ7D 3PWJB 3MRFA 1S9KC 3SJVA 2UWEB 4LEXH 5LGJA 4X0KB 4P57B 1WC7B 3MBXH 5D2LF 1MQKL 3WDIA 5T3XH 5K9KB 1JZ2A 5EU5B 5E7BA 4V1DD 4NFCA 3SCMC 4F7TA 2C3VA 4MXWL 4I1NB 2HAZA 3GDBA 4YHOH 4MQSB 5FYKE 3MYZA 2AQ2A 4FQ2H 4PJ8C 2VLJA 2UUDK 2ERJB 5KVEL 3D9AL 3P77A 4JGUA 4L4TD 3HR6A 5DS8A 4K3DH 4EDXB 1ZTXL 1B2WL 1EAJA 4G80B 3SGKA 5I1IL 5J6HB 4JFDB 3D69A 3C60D 4HV8A 5DI8A 1ZSDB 5E00A 1JWSA 4G7VH 4F8QA 5C9JB 5KW9L 5LWYH 3STLA 5DVKA 4NWTL 1KGCE 5C7XH 3TT3H 3VGAC 1MY5A 3HNVH 2NXYB 3LD8C 1H0DB 2BSED 1S7RA 1SY6H 5DGRA 1KCLA 4WFFE 1D6EA 4HLJA 2GTWA 1D5IH 3RWDA 1OAQL 4YQXH 4F37K 3IFNL 2FBJL 3CVIH 2F5AH 1R24A 5FYKD 4ELMA 1EGJH 4F3FA 4G6JL 3X13A 2CQVA 3MV9D 1I8LA 4P0DA 3J7HA 4P2RB 1RUKH 4V2CB 3QIBD 3EHBC 1AD0A 2VLLB 3S7GA 2Q86B 3MRJA 1XEDA 1MF2L 5EU4B 4BFIB 1Z3GL 5EZJA 3VRJB 5IJVB 2DIJA 3MJGX 1MWAH 5HHQA 5HHMD 5HVFB 3KLHD 3W0WD 5AD0B 4H26A 3KVQA 1P7KA 1TQCB 5IIEB 3WIHA 5TE4L 1A9EB 4MAYA 1FVDB 2Z4QB 3P9LB 4TSBH 3V6FB 4QXGH 1JYVA 2HT2C 1AXTH 5CEYA 3TP4A 4WUKL 3W0WB 2XKNA 4LVHC 1NBZB 1OP9A 2P43B 2AJVH 4P4KB 1C5DA 2QKIB 1AXSA 4YXHL 1HH9B 2EXWC 5DRZA 5J1SC 1RZ7H 1X44A 3CNKA 4Y2DA 1N2RB 4DCQA 4LHQB 5EC2B 1KUMA 5IROA 4JDZB 5EBMA 1RMFL 1CFSB 3KS0H 1FNHA 1CLOL 2WINB 5KVDL 1VCAA 5HGDA 5CEXB 1WJ3A 4PGDA 1XZ0B 1U8KB 3B4NA 5GGTH 2ZCHH 4IOFD 2OTUA 3GRWH 1B4JH 2D03L 4JM2B 1J8HB 5DFVD 5J13B 1HZHH 3MMEA 5TGBB 4Z7NE 5C86A 2B1AL 5DZLA 1LNUA 4X6DE 1ZHNA 1PEWA 1FFRA 4HCRH 5TFSH 3MRIB 1F5WA 1MRCL 3CVHH 5E08H 2NYYD 4LCCC 5E8DL 5FYLD 1KN2H 1KG0B 5D71H 1CR9H 3MNZB 2VLJD 4OIAA 1AJ7H 2ARJA 3CFJB 4GG8B 3MRMA 2WIIA 3NTCH 4ODWA 4XH2B 1F4XH 4GUPB 4GKZB 4APQD 3U1SL 1M1SA 1JTOA 5AZ2L 1DBBL 3SCMD 2G5BA 4PJFA 1OTSC 2YRZA 1AKJA 1MFAL 1WISA 5C0BA 2I07A 4EXKA 2BRRH 2MQ0A 1MFNA 5I19H 1GGTA 4GW1B 4XBGA 4MXQD 5BZDB 5FECA 2EDXA 5AEAA 4JY4B 4HJ0D 1I9IH 1J1PL 3O4LA 5L2KD 3BIKA 1AHWA 4M1GL 3AXLB 3K80A 4NC1E 3BZ4A 3CSYA 2BVOB 4B7IA 2AVGA 4PP2B 3RU8H 3S35L 4OI9A 1K4CA 4ONFH 4WFHD 4J4PD 4MNGE 4L29B 3FO1A 1XCQB 3TIEB 5BCAA 1ZGLB 3QPQC 1I7UB 2H2PD 4PJAE 3O11A 1CE6B 3LKRB 3MRPB 3V5DB 4HUKB 3VWKA 4ELME 4HS6B 2Y06L 4NNXB 2ZUTA 5GGUB 3VFSB 1NAMH 1F4YH 2E7BA 4TVPL 4NCC1 4NYLA 3IDJB 2CKBH 3EO1A 3ZE0F 4OGXL 4JCLA 2E5EA 3B5TA 3OKKB 4KVNH 4KHTL 5FAAA 3C5ZA 2Q87A 4GUPA 3HZKB 5KTEL 2WUBL 5FCSH 4X6CE 4KI5E 3TESA 3MLRH 5DHYA 1Z9MA 2FZ3A 3T09A 3BXNA 5KSAD 4UNTA 4DAGL 3HI6H 4KPHL 4XCNB 3OTTA 4U7KA 2BVUA 4NQCD 4XPHL 5C6TH 4ZAKB 1JNHA 4W4OC 2CH8A 4DAGH 1EV2E 2IH1A 2RFXB 4XVTL 4MDJB 2JJTC 5GISL 3S37X 2I9TA 3CVHA 4ZDHA 1KEMH 2BOBA 4OIIH 1WAAF 2WUBH 3QCUH 1RJZB 3QHZH 1OGAB 3V7AG 4YDVB 3GK8L 5LVEA 5CEXA 1BFVL 2NR6D 2DLEA 3GMMB 1WTLA 2CKBL 4PJIF 3G9VA 2H32B 4JDZA 1NAML 2X4PA 4OJFL 5C0GA 3ZKMD 1E27A 1A6AB 4P9HC 1FGVL 4JR9H 4OZ4A 1S78C 4LLUA 5DJ8B 2Y06H 4GT7A 2JIXB 4XTRC 4QHNA 1FNEA 5LBSH 4CVZA 4I77L 1CD8A 5IF0B 5H8DA 2D7QA 3KXFB 2GJ6E 3P4NB 4JRXE 4MXVE 3PHOA