3M17A

Crystal structure of human fcrn with a monomeric peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG receptor FcRn large subunit p51
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 58
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m17A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m17A01
1Z9LA 2PO6C 4ELMB 4HX1B 3MV8E 5T1LA 3SDCB 3G04B 1DUYA 5EU3B 1QRKA 2WBKA 5IFJB 4Y5VA 5D5ME 4X6CF 3CVIL 4R90L 1KLGB 1CE6B 3O6FD 4LSUL 1U8LA 1VGEH 5BZDB 1A21A 3L5XL 3RJDA 1U8IA 3GJFH 3BYTA 4Z95L 2BVOA 4KK5C 1F3DH 1L7IH 5GSVB 3NZ8A 2D7PA 4BSVA 3TN0C 1YEFH 1IQWL 1F8TL 3ZYOA 5EOTA 1UJ3A 5L8KB 3BPOC 4RBPH 1CK0L 5A3ID 1RZ8B 3MREB 1UWXK 3CC5A 4WHYH 3U79A 1LWRA 4EUPA 1E0OB 5AUMB 4XXDA 5SWSA 2UZIL 2JTDA 1A7PL 4WENB 3LKSB 5HPOA 3O9WB 5SWQA 4ZOAA 5J13C 1EGJH 3RHWK 4YAQA 4XPBH 3G5XA 2EDDA 4OAWB 1LE9B 3FFDB 3T2NL 4D0DB 4PLOB 2QSVA 4XPHH 1DBAL 4E42A 2R4RH 3BT2H 3QUZA 3RI5F 1G7JA 3L3IA 4LLYB 3VXTB 3IETB 1DQJA 3PGCB 4ENED 1RJYB 4TUJB 4WW2B 3MNVA 1F3JA 2UV3A 5KAQG 1MCIA 4WV1B 2BX5A 3EYSL 4YH6A 1UZ8A 3HE6D 2FIKA 2XRAL 1BZ7A 2OQJA 1GXEA 5F89B 3S4SB 3OXSA 2R4SL 3ZZ1A 3BPLC 4F58L 4B5EA 4MJIB 1MLBB 1JZ8A 4RFEA 4NSKA 3QHZL 2C3WA 3T0DA 4JCLA 2VLMD 1WT5A 1FN4A 3T0BA 2P24A 4JFFD 3DSFL 4U05A 2CK2A 4ONGL 3OKDA 1PY4A 2R2EB 4IHOB 4F15B 4V2CB 5DURD 3O6LH 4OLWH 1I8LA 2FHBA 3P40A 2FX9H 5M94B 2X41A 4CKVX 5CINH 4NFBA 4NRYA 1P6FA 1LEKA 4XMLH 3BZ4B 2ITCA 2YOCA 5C0GA 2IAND 5ETUA 3ARBC 3S37X 1X5IA 2AKRB 2HMID 1QP1A 5L2JB 2YPLA 3O3EA 1HSBA 1R3HB 5FKPA 2M26A 1NGWA 3FQRB 4EN3B 3PABA 4JHWH 3O8XA 4U3XA 1PEZA 3W2DH 2ZUUA 5HHMD 5LGJA 4PFEA 3CSBA 5DTFA 5BRZB 1U41A 3TN0B 1TCRB 5F7YC 3U1SL 4KI1A 4NGHH 4RMUA 4GAGH 3BPOB 5E95B 3F5WB 1DE4A 4X6CE 2W60B 1PLGH 3TIEA 4U3HA 1MY7A 1HHHA 1K3IA 1MRFL 2HLFD 4DCQA 3S3JA 3VFPB 4X6FB 5I15H 4MXWH 5E8PA 5J13B 2BSTB 4JR9H 2HVKB 1PG7H 5JLZB 2CKBL 3QUXD 4XNQB 3MRLA 3LPGA 1J0YA 2B5IB 3ARUA 5BV7C 2XTJD 5D7IF 1F6FB 3HLAB 3QEGH 3HFML 1I7TA 4CJ0A 3WFHB 5A16A 2BXYA 2GFBB 2VUOA 3GMPB 2HFFB 4Y5XB 1CDYA 1A6ZB 3OXRA 5C6WH 3T3PF 4ZO6A 4WGVB 4YNYA 2BZDA 4H25A 4RFOL 1RZFL 2G75B 5HYIA 2FEEL 4DKFL 1FZKB 5C0CA 5L2KA 3W39A 4P3CL 4E5XB 5HYSA 2HJKA 4LL9A 2P7TA 4AY0A 5J06A 3WIHA 4ZUVA 4KPHL 4N9OB 3MA7B 4CAGA 4X9FA 5I8EA 1HYSC 2E7MA 5I1AB 3LH2H 5ERWB 4WWKC 4DKDC 1MIEL 1KCKA 4HGWA 5FUOL 4PRBA 2JIXA 1IGJB 4G42A 1KC5H 2YPVL 5DFWH 1NGQL 1UZ6E 3GHBL 1S8DA 2N4IA 3TYFA 1OTUD 1T7WA 3O6MH 1OTTC 4EOWL 1A1NB 5D1XD 2WNGA 3Q6GL 4QT5A 1CGSH 1FDLL 2CUIA 3UX9B 1QLFB 1NLDL 2OTPA 1T5WA 3CFIC 1NH6A 4GW5B 4H1LG 4LCUB 2F58H 3T2OA 4RMVA 2YKLH 3QWOB 4J4PA 4CL7A 1F4XH 3CFJB 3VXQA 4FHBD 2X4UA 1OM3H 3E1F1 1BVKB 5KG9A 1LO2L 1FLRH 4ONHB 4XBPA 3GMOA 1KPUA 3HNSH 4TNVF 2FATH 4CU8A 4HKJA 1A8JH 3BX7C 4OGXH 3I3BA 4TULL 3BMVA 3QUYD 4AEEA 1MFDH 1K85A 2HP4A 5FHBH 5JHDB 3QQ3A 3PWVB 1L7TH 4GRLC 3UAJC 4AEHL 4X5WA 1T22B 2M8XA 3VJ6A 1SYVB 4KRPD 4O2CB 3NFPA 1IGMH 2LAGB 1KFAL 4PLKD 4AJ0A 2YD5A 4MCZB 5CUSH 4KJQD 1IVLA 3BD3A 2YD9A 1RZIA 4XP9H 3TO4D 5HGAA 4BELD 3CDGB 3X3GL 2Q7YA 3DHJA 3BQUD 2R2HB 4Y5VC 1MCLA 3GSWB 1HQ4B 1OD9A 3CSYB 1Z9SA 3SGDI 3DURB 2VXTH 4OSUL 4X9BA 2DF3A 1OARH 3FB5A 5D7IE 1SVZA 1KCSL 5TJWK 1KNOA 4MA7H 3BUTA 3RWEA 5LWYH 3OHXB 1PVHA 2VN7A 1HYRC 1P4BL 1UM5H 1EUTA 3DGGA 5C0RH 1UH4A 5I75C 4WWKB 1AXTL 4FQLL 2EDEA 3T3PE 1M71A 5AZ2L 5KS9B 1MEXH 4KKAD 3P77B 2FEDD 4QOKA 3Q6FA 1QO3A 4X7DC 1EHLL 4AM0B 2C9AA 3WHE1 4NN5B 2ADGB 3QPXH 3EDFA 1Z3GH 1F6AA 3EHBC 3SE9H 1MQKH 1MCOL 1KOAA 3MRNB 1YEDA 3UO1H 4YR6A 1ZV5A 3W9EB 4G7VL 2Q7NA 4G6KH 1VDGA 3HC3H 2BFVH 1C12B 3LSOB 3X13A 4KQ3L 4OD2B 3QHFH 4WFHD 3WIIH 5FECB 5EBWB 3EFDH 2OSLA 4JZJC 1TTUA 4MA1B 5JOEA 4ZXBA 5HHPA 1DN2A 3LQAH 4QRTA 4OFKA 2F5BH 1BQHA 4G9FB 4HHAA 5TQ0L 5I76B 1UB6B 1JZ6A 4RQQB 3IU4H 2V5MA 1IRAY 1XR9A 2F74B 5D1QA 5ADOH 2F53E 4F57L 3UJIL 4OGAC 4UV4L 4W68A 3K8MA 4Q0XL 3QNXB 2QSQA 3QEQD 3KJ6L 4YXKH 5T5NG 2CLVA 4WI4A 4ODVH 3KNBA 5TF1H 2ZJSH 3VXRD 4WTZA 1I8LC 2A9MH 2YUZA 3G5VB 3MRRB 4PRAB 5EU6D 5TPWL 2ED9A 4JO1H 1KB5H 3RZCA 15C8H 4X8JA 5H2BB 5K9OA 2EXWD 2Y06H 4R3SB 1G9NH 2R8SL 4DVRL 2DQEL 5C8JA 2W92A 3RTQA 5EOQH 4HS6B 4G8FA 1TMCA 5FA4B 4MQTB 5GGVL 1A7BA 3L3GA 4JZOA 4N5EA 3O8XC 2Y23A 3B3IA 5FYJU 1XGTA 4HBCL 4Z8FH 5TE7H 3NZ8B 4WJ5A 2ZKHL 3VFVB 3A6BH 3PQYB 4NHUB 4H26A 3KWWA 5I18H 1NBQA 5AZEH 4IMKA 4Z7WA 5I75B 3CC5B 3MJ8A 1GC1H 4KK8C 4LCWE 3BH8A 1BFTA 2FX7H 1P84J 1FBIL 4O4YL 5E56A 2D31B 4IRSD 5FOBA 1A1OA 3KR3H 1A3QA 2X4SA 3MO1A 3SKJL 2VDNL 5IB1B 2QHRL 4AENA 4UT6H 2Y9RT 4M6MH 3BRDA 2O26U 4MXVF 1IGIL 2IAMA 3U4EB 4XBEH 3ZYZA 4X9IA 5KZCB 4Q9BA 3KDMB 4XT1C 2PTVA 4R2GB 1I8KA 5E4IA 2F9BT 4LDLB 5JHLL 1O7VA 3TBSA 3MNVB 4NDMA 4JZJB 1QZ1A 1BP3B 2DL9A 1XGQB 3FN9A 5DMKA 1BZ7B 3MV9B 1KCVH 1E6OH 4RDQF 4KAQL 5ALBL 4NQTA 4U6YA 5FF6A 3O45A 4K7FB 3OKKB 4R4BB 1WCBB 4NSKB 4YO0B 1UXWB 3O6FA 3E0GA 5TFSL 3IDJB 4MJ2A 3GB7A 1ETZB 4GLRI 3ARWA 3UTPE 5ANME 1P9MA 3OB0K 3GNMH 5DUPL 3F7YA 1KEGH 1ND0B 1WC7A 3MRBA 1CDBA 3ZKQD 2XXCB 1NANH 5GRYA 2E7BA 5GS2H 1P7HL 1T66C 3BI9X 2VDQL 3OB8A 4U6VL 4QHNB 4XVUC 4OF6A 4NRYB 4AMKH 4O58H 5ETUB 2LE9A 3MV7A 2YPLB 3IDXH 3V0WL 4C58B 2EYRB 5GHWL 5D7LD 4QF1A 5EIVA 5TDPA 5LQBH 4OZIB 1NGWB 1U8JA 3MOAH 3PABB 1Q1JH 2ZSWA 1PZ5A 4G6JH 1N59B 1R6VA 1J8HE 1JTOA 2IPTH 2VQ1A 4FXGA 3RIAK 1KELH 3FONA 1PG7X 1RZ7L 2ZCLL 5FK9A 3TESA 4K3GA 1N4XH 1FG2A 1JMXA 1JP5A 2EIZB 4JM2D 1DE4B 1DBKL 5J6HA 3JZ7A 5F72S 2OL3B 5KOMC 5J8OA 3V79C 3IDNA 2B1HH 1N3NB 4BSWA 2I07A 4S2SA 4MNQD 3MOBH 1M7XA 2YA2A 4GKZA 4HUWA 1YJDL 2L7UA 5DD6B 3NCBB 2GSGA 3V2AR 1RPQA 2Y72A 1QFWH 3SKOB 2OI9A 2APBA 4HXAH 4I77H 1I1AB 4JFFA 3RWJB 1RIUH 5FO8B 3IAGC 3FQTA 3TP4A 4PJDF 2E6QA 1BZ9B 3U0TA 1Q72H 1QUNA 1G7LB 3ME0A 4I9WE 4ZOEA 3BJ91 3SPVA 5DXWA 3M1BB 3MA9H 3MCKA 1QSEE 4GFTB 2XWJB 5DS8A 4KZEL 3PWNA 4K3EL 1E4XH 1T1ZB 1R3JB 4MXVE 4Y16D 5J9PB 1XCQB 2IANA 4HKBB 5L2KB 3W39B 4NCC1 2A6IB 5F1IB 2IGFH 1RSFA 4M3JA 1FYHB 4NQVB 4M7KL 3GIZH 3B9VA 4GRWF 1HIML 1FZMA 5HHMA 2GW5A 2QQLL 4LKCA 4Z0XB 5MEQA 2P48B 1CTOA 3GDBA 4LCYA 1GCFA 4PRBB 2JIXB 3MLSL 2VL5B 2XZCL 1OSPH 3KPRE 3UXFA 4YBLC 3GHEL 4PG2C 3HG1A 4L4TD 1UKTA 4LQ1A 5IQ9B 2C3VA 2EIDA 1I9IH 1TXKA 2ITDB 4PJ9D 2DQUH 1Y0LA 4K55A 5IHZB 4X4YA 4OM1L 5JW5B 5F6HI 1ZHLA 1GAFH 1G1YA 1ZTXH 4CN6A 1PX4A 2HFGL 4DQOH 3VFUA 3U30B 3QUXA 5HHOD 3VXSB 3H9SA 4W4NA 5C09E 5CHNA 2ZCKL 1J88A 4O9HL 1QFOA 4YHKL 2QEJA 3GMOB 3EGSA 2O93L 4JFOA 4HF5H 4NUGH 5GPRA 2RCSL 3NACH 2GJ6B 3O6KL 2ZOLB 5IVXF 1OB1A 3VFMA 5K9KB 3QDJE 3TJEL 5CD5C 2ADJB 3PWPE 5E8DH 4M02A 1SJEB 1RUMH 4JKLA 1JF1B 2DM2A 1SY6A 1D9KD 4JFEE 4L1DA 3BIKB 4AK1A 1F5WA 2ORBL 3QAZC 2EKJA 1W72H 2H3NA 3BP5A 3MRKB 3Q3GA 5JXAL 4NKQB 3CZFB 3V7MA 3HNVL 2Q86B 5HGAB 2QADD 3RTQC 4G5ZL 3JWDC 5EZOH 4WUUD 3UJTH 1MH5A 2V17H 2Q7YB 4P9MH 4OD1L 2KQNA 5F7DA 4KMTL 1U8KA 5D1XA 4TVPE 1WF5A 4N5EC 2FYYB 4I0KA 1LO3H 2EC9T 5IMOA 5GSRA 2QKIB 2BDNH 4LNRA 4PJDE 4FZEH 1Q0YL 1MWAA 4MQ7A 5C0BE 3E6FB 2GITB 4PJ5D 2DQDL 1GSMA 4IMKC 4JY4B 1UB5A 1ODAA 4ZO9A 3OL2A 4MDJA 1C1EL 4P46B 2H2PD 1JK8B 2BVPB 2FR4B 4LPUA 2JELH 3UTOA 4YBLB 2YR3A 2HN7A 3TPUA 1AGBB 3IDIB 4RWHA 4XPFH 2RGSA 3CH1B 3QUYA 5FDWA 1A7RH 4FQCL 4M7JH 2DOCA 4YHIB 4GRWE 1F6AB 2IAMC 4X6BA 4LLDA 4OCXL 1FJ1B 3UDWC 5T1KB 4YHZL 4LSTL 4AIZB 1KTKE 2DJUA 1RY7B 3RPIB 3IFLL 2YHGA 2CDFB 4J8RB 1T2QH 4KUCF 2BHZA 3VG9C 2YS4A 3MLPA 5T3XE 3BUYB 1IFHH 1OF2A 5J7CC 1WEJH 3BQUA 1B4JH 3D18A 4JQIH 2ICEB 2OZ4H 3O6FC 2NW3A 4HDIA 2Y07H 5CBAA 4RAVB 3BVNB 4LEOA 3L3KB 4GO6B 3D48R 4JDZB 2DLGA 2BOCB 5F88B 3LHPH 4QRRD 3GGWA 5I71B 2AEQL 3L5IA 1DBBH 3QAZB 4JG1L 1CGYA 5T1DH 2NNAA 6CGTA 5A3IC 1ZWIA 4ZFGL 1QSFD 5IVXE 3K1DA 4DGYL 3JV6B 5K9OB 2AXFB 4NQXB 5LBSL 3ARTA 1XGPB 4O02L 3ERYA 1BIHA 3UYRH 4ZO8A 5BXFB 1TMCB 3RUGF 4ETQB 3BZEA 3L3GB 4HLZH 4N0UA 3VXMB 3ARED 5JZ7D 1AO7B 1OGAD 4X7TA 3SE3A 3Q1SL 3PXHA 5I1JL 1CXLA 1MREL 1U91B 3MRGB 1UT9A 2VNCA 2OTUB 4RRPG 3SDXF 2DYPD 4KI5F 1EO7A 5JW4N 4FS0A 3HRZA 4PY8I 1QFUL 3NH7L 1QQDA 4LNVA 5DDHA 1NC2B 4UUJA 4JFPB 2X4NB 1YEKH 4Q6IC 2FNBA 4LDEB 3MO1B 2HLAB 1X4YA 1GH7A 2ESVE 4JE4B 1FE8L 3QEQA 5JR1H 1SBSL 4YXLL 4G80B 3V5HB 1U8PB 4S0UC 3ALPA 4S1QH 5DD5L 4QHKJ 3GMMB 4OLYL 5GJTL 1MLCA 2I25N 2VE6A 4ZUUA 3VXRA 4IIQB 4FQHA 4RZCA 1CGTA 4XNZC 5ADPL 1EEYB 2CXGA 2E6JA 3H9YA 4NO3B 5DMKB 4OLZL 4DK6A 5DK0B 5IB5A 5CAYB 3GSNB 3G08A 3D39E 1GHFL 5KSAD 3U9UA 2HMIC 1RU9L 2NY3D 4Y1AD 1OGTB 1BBDH 3J8F7 5C6TL 5HDQL 1QNZH 3KS0J 5DYOB 5IHUL 4JVPA 4GAJL 2QSCH 2PYEE 4XPGH 3LKRA 2EDQA 1WC7B 2DLIA 2SEBB 3ZO0A 4PJBB 3RWDB 1TLKA 3VH8B 3KYKL 4DGIH 3BISA 1IAII 1P2CA 1U3HB 2VH5H 2HLFC 3BOVA 2DM4A 3MV7B 3ARFD 4KK9C 5CSZB 1ZLUH 3PWUB 2X89D 3V52L 4W6WB 5MEOB 4GQPH 4B50A 1Z9MA 4JFDB 4XRCB 1FZJA 2XTJC 1LK3L 4YHML 1J18A 1L6XA 2VLJB 5C0AB 3QNYB 4TN9A 2H9GA 5GS1A 5FHAH 3DUSB 4GXVH 1MHCA 3C6SB 2WIMA 4FFWD 5KBNC 4ZS7L 4QO1A 3TFKD 3RUGE 1P4IH 4R97C 5DHVA 2EEAA 4CVXA 4ZUSA 3OJDB 4JPVL 3C9NA 4Q6IB 3GJFK 4S2SB 2BNRE 4P4KC 4EXKA 5F1NA 5IVZA 1LD9A 4Y19B 4PREA 1HSAA 3ILPB 2VQTA 1WBZA 2W07A 4Z78A 1A6UH 2MMXA 3SDXE 5DGRA 4KI5E 2R23B 4JDVA 1BEYH 4RBPK 4XCYA 1CXIA 4M1DL 1XF4B 3CFKA 4LSRH 4KDWA 4V3EB 1DLHB 3KS0H 4P9HH 3VI3E 5J57B 3LY6A 1CF8H 2GTWA 1YEIL 1KN2L 3EOAA 4OZFA 1WWWX 4XNZB 4TVPH 4HPOH 4I0PA 5HGDA 2CXKA 5DWUL 3QBTB 5E6IB 4Z5RA 1N64H 4WEBH 5LGHL 3RVVD 4L3CB 3MMEA 2D7TH 5D7LA 1BFOA 1CTNA 1UFUA 2J7LA 4WU7A 5GRVL 1ORSA 1YMHB 2D7MA 2NX5A 4WW2F 4HWNA 4HWEH 1FZMB 3FQUB 4PLJD 4H8WC 4LKCB 4XWOD 2BY2A 3QXAA 2ARJB 2RQ8A 3T0WA 5A1AA 2NY1C 4O2EA 2P8LB 4NT6A 5F9AC 3RWCA 3RWHB 5LAXA 2VDLH 2W9DH 4KK6D 2LTQC 4JM2A 3B8YA 3HG1B 4WFGD 2IBZY 3QUYC 4JB9H 2BRQA 4GRWH 5JUEL 2C3VB 4R7DB 4F8QA 3UZEA 1PSKH 1ZANL 1T21A 2ZNWA 4L4VE 1II4E 2ZOKB 3BO8B 1KCUH 4JY5H 4KRPC 3LS5L 4PLKC 3LMJL 4HAFA 3QRGL 2P8MA 3RX7A 4P49A 3H9SB 4O5LH 3RKDC 2YN5A 4KJQC 3ZHLA 1CGWA 2WBJD 5C2BH 5F44A 4CMHC 5T3XH 4YE4H 1CE1L 3I9GH 2WSKA 3P9MB 4JFOB 3C5JB 3HZYA 3K8LA 4K7PH 4R7NA 2Z8WC 4HH9A 1S7SA 5GGTA 3FB6A 1T0PB 2J5LB 4R97B 1OB1B 2GUOB 4JN2B 5C0DA 3GJEA 4Y16A 4IRZL 4P4KB 3HC4H 1S3KH 5DF0A 4E41B 1E27B 5CWSB 5HYQA 3B9AA 2XKNA 4LPCA 2X40A 3GO1H 3BP5B 4UU9B 3T8XB 4KJYB 4L5FH 4M43H 4D94A 5JXED 2ADFH 1ZLVH 3JXAA 3DI2B 5FGSA 2FD6L 3QO0B 4JN1L 2FEDC 4NM4L 4FQJH 2B1AH 5F7DB 4L4TA 2OP4H 2YRPA 1YN6A 2KH2B 4F80A 5DVMA 4XCNB 4PJ9A 2ZCHH 2MPAL 3VGGA 1PKQB 4X5XA 4TSAH 4I18C 1UH3A 4MQ7B 2DKSA 2KL6A 1HHKA 5HHOA 1BD2B 2X4QB 3LKPA 3B9KD 4M1CD 3H9HA 2APWA 3D0VB 4I48A 4V1DD 1G6RA 3QCTH 1MCJA 1T3FB 2BY0A 2NY1B 3P11H 1EH9A 5JA9A 3D0LA 1B2WH 1T1WA 2AABL 5K9JL 1UVQA 5JORB 3GI8H 2LTQB 5C71A 2HN7B 4TUKL 2XICA 2V5TA 5DUML 4XP4L 2OR9H 3RJQB 3H7LA 4CN1A 3WHE0 3O11B 4LLDB 3PG2A 3PP4H 5DJ2A 5E5MA 1F90L 3NN8B 1EAJA 3CMOH 3KXFB 1O5DT 2HTKC 3HUJB 5J12C 1D9KA 2W9EH 2BNQD 3FRPG 4MJ5B 1E6JH 3EYFB 4MJIE 2K9UA 4HZAA 4YDIH 1A6TA 3MFFA 4R4FL 1WTGT 2EXWC 4CMHB 2DQFA 3W0WB 5HXMA 1XIWD 4WUUA 3LQMA 1DBML 4XWGL 3S34H 4OZ4A 3SDAB 3FQNA 3TBTA 3E8UH 5FYKU 4LEXH 1IAIL 1GGBL 4HQQH 5JIKA 5C0FA 1B0RA 1JV5B 4BH7B 3S36H 3GGWB 1DDHA 3CFBB 1Q94A 4HT1H 3EDKA 4S1DD 4AL8L 2R0KL 1NDGA 3AUVA 4PJ5A 1MCSA 1S7QA 4WY7L 4MA3A 1RQ5A 2OMBA 5B38G 2HKHL 3QHTC 2H6PA 4X80H 3MJ9H 4BZ1H 2H1PH 5BRZE 5KSVB 2H32A 3QJHA 3KYMA 1OL0A 4PJAA 1MCCA 3CPLA 4N8VA 3WS3A 1NMBH 4ZQKB 1DEEA 3MCLH 3ZTJG 1HEZB 3DRTA 3MLRL 2P4AB 3UZQA 3FB7A 2AJXL 1QHPA 1TZIA 3OR7B 1HZHL 2AJZB 5IBUB 3HI5L 5CJ8A 2XZQL 5ISZB 2NYYD 4I18B 1BQLH 3L3JB 4BKLB 1OAKL 5IHBA 5GS1C 1X7QB 3PGFH 3ZL4H 5HSFA 3TIDA 4ODHL 1A2YB 2IADA 1AGFA 1IC4H 3HZKB 1NGYB 1MRCH 5DDHB 4UUJB 2OBGA 4GS7C 3I84A 1N7ML 1ZXQA 3CAFA 4WU5A 4LSVH 5FA3A 1V5JA 4X6DB 4CNIA 1RIHH 1D5XB 4ZD3H 5CIPB 3V6FA 4A6YB 1U2HA 3CVHL 3LZFH 1I1RA 2F15A 4QRRA 5KS9F 5GRUH 5EUOB 3MGOB 2IWGA 4S11A 3WIFA 3EYVA 3VFSA 2VE6B 3F62A 1K4CB 3QDGB 4FQHB 4RZCB 1TQCB 2DRUA 4I0PC 2N56A 1QSFA 4KKLD 5JPMA 1OD7A 2FZ3B 1QG3A 4HK0A 3RNKA 2JE8A 4ACPA 4KXZI 3OPZH 5GGRB 3U9UB 5J56B 4OQTL 1MVFA 1KSRA 3SE8H 2X7LB 3AREA 3CDYA 3MNWA 5DRNA 3B6SA 1EBPA 1WV7T 1OGAA 1FL5A 3WUWA 1AFVL 1EX0A 1RUKH 5IMLA 1E4KA 1Z9OA 2N7AA 3LKRB 2DYPA 2I9LA 2VZSA 4IJ3C 5GQBA 1H3WM 3LIZL 1INEL 4NUJB 5FYJE 1G7HB 3JTTA 4FABL 4OCRH 1YNLL 2W9LA 3CFDB 5T3ZL 3RWGA 2PTTB 1P2CB 1CG9B 1IAMA 1T20B 2DS4A 4KJWD 4TRPH 3BWAB 2NZ9D 4MQXD 1IAKA 1E4WL 2UZXB 4P4RA 1UC6A 1EXUB 2ATPA 1DL7L 3WKML 5CZVH 1YECH 4YUEH 4GMTH 5CZXD 3F8UB 3K74B 4P23C 5GIRA 1TNMA 3NBNA 4TSCL 1FZJB 3VGFA 1A9BB 1ZMYA 4EIZC 5A2KH 5JHDE 1QA9B 1R0AL 3U36A 1HNGA 3DARA 4XC3H 1N8ZA 4GUPA 4KVNH 4LLUA 4GS7B 1G7QB 2FCBA 4Y16C 1P5UA 1EEUA 2FHFA 3GSVA 3WSQL 5KSAA 5IVZB 1LD9B 1QLRA 2R39A 4Y1AA 1HSAB 1R3KB 4JKKA 5C0EB 5IG7A 1WBZB 2ZG1A 4OB5H 2IBGA 1CVRA 1YC7A 2DLTA 1QBAA 3IGAA 1HHIA 4CVUA 4GAGL 1DANT 3HZVA 5B3NA 4RGMB 5JTWA 1JL8A 1ZVHA 1ORQA 3C2AH 2GTWB 4HCRL 4GG6B 3OAUH 1KF9B 4I0PB 2DI9A 4MB3A 1IGTB 2R1WB 2Q1EA 1IAIM 4JO3L 5BMFL 1GJIA 1PG7L 4Y4FD 3DX7B 4PJ9C 2CRIA 4ELKA 3Q48A 3TNNB 4IRJC 3V6OA 3ARFA 1GPOH 1U8MA 5KS9E 4GXUN 4FQXC 1AGCA 5BVPL 1CD9B 2IPUG 2Z35A 4WU7B 2NX5B 1BF8A 2X89A 4U7MA 5TE6L 3WMSA 5T33H 1TVBB 4F8TA 4F37K 4JDTH 3FZUC 3R1GH 3OKLB 2BVQA 3MRFA 4XP1L 4O2EB 3UEZA 2IH1A 1LNUA 5LAXB 4LLMB 4PRID 1DTUA 4NQCD 3RI5K 2F5AL 3ZDXF 1WCQA 3TFKA 1N6VA 2C1OA 2AI0H 3VFOB 5DSCB 2XFXA 3MLXL 3TM6A 3NCYS 1FQ9C 4HFWA 4NKDB 5E4EC 4G9FE 3SQOH 4XC1H 1UG9A 1IAOA 4PBVC 1EMTH 4F7MA 3E2HA 4P23B 1KC5L 1FG9C 3INUL 2BSRA 4MNHA 5CS7A 3O4LB 8CGTA 3C5ZC 1UYWH 2QADC 2EE6A 2OTWA 4HJGA 3HZYB 4C57C 1MHHA 1JMZA 1YEHH 4U1LA 5JIIA 4OZIF 2OCFD 5JPNB 2CSPA 2YKLL 3JTCA 2IC2A 3S88H 1F4AA 5CEZE 2B0SL 5HYQB 4Q9RL 1HI6B 3QPQD 1OM3L 5I1KL 1H15A 2WLZA 2VLKD 4M7ZC 1GZQA 2D7QA 4QY8B 4H1LB 3IFNL 1FLRL 3CGTA 2PYFB 1KULA 5DMIL 2XWTB 3FO1B 4G6FD 2J6EL 2HKFH 4FNLH 4S1RL 4OGXL 5TE4H 3MGTB 1LK2B 5EO0A 1RZKL 5BS0B 3RY5A 2H2PC 5F3HA 2VZUA 2Q8BH 5I8OL 5FHBL 3D3VD 2H8PA 5B4MD 3PQYE 1K4DB 1WWCA 4OLEA 4NHUE 4HUXB 4OUUB 1P7QA 2P5EB 4OCMC 3ULUL 3DXAD 4IRJB 5KVDH 1BGXL 1CGXA 3TYGH 4MZ2A 3C6LD 2W0FB 4FQXB 2EC9U 4UT7L 4APQB 2JCCA 4X5XB 2YA0A 4WTXA 1NSNH 1JGUL 2EE2A 4BK5A 4WCYH 2WBJA 4JJ5A 5E5RB 3EDEA 5D6CB 1BJ1J 1MJJA 5BOPA 3NPZB 3HI6H 1U8OA 4U6HA 3ILQC 1OWWA 4I5BA 4U2YA 5I73B 1HOCB 5CCKH 4K3JH 1EJ6A 2GIYA 4OV5B 3NVQA 5D7SH 2DQIH 4KV5F 3VRIA 1EHNA 1KT2B 4MA8L 1M7IA 5E5MB 2WANA 3MV9E 5C08B 3PNWA 4GKSB 5KN5B 1YUHB 4YPGA 4FFVD 3GSXA 3LN5A 3QUML 1J1PL 3VFNA 3IJSA 1MEXL 5F1OB 1X5YA 3MC0A 1A6TB 3ZDXE 3BP6A 5FYLL 3S36X 5CP3H 2CKBB 5FGBC 3PDOA 3C5ZB 5JXEA 3ZKMD 3DTXA 4LOUD 3S3SA 2QADB 3EYQC 2DQFB 3RY6A 4H88H 4NCC2 1CGUA 4Y4KD 4XZUB 2ZWLT 4QRPD 4PJEA 3TBTB 4DZ8B 1G84A 4NC1C 3K46A 5HHVH 3QJFA 4GKNA 5F1KC 4L3AA 5FOJA 1Q94B 1B6DA 4M7ZB 4Y2DC 5FYJH 1BREA 4UMGA 3WHXB 3DO3A 1T83A 2YPLE 3SQBA 1BFVL 3JTSA 4GMSL 1EK3A 1S7QB 5EWIL 3B9KA 4MA3B 4OZIE 1RZGB 3MACH 4V1DA 2VL4A 2RAMA 1ZA6B 4DUWA 1JE6A 4D0BA 2FIRT 2H6PB 4L1HA 5DC9B 4IDJH 3JVGA 1NBZA 2EE9A 5TDOA 3U2SB 3QJHB 1BFSA 3KYMB 2EDRA 1GIGL 4MD4B 4PJAB 4PGBA 3WS3B 1DEEB 4JRYD 3L7EB 3DRTB 3LS4L 1CD1B 4TNVK 4BM7A 1IBGL 1SEQH 3EOBA 4KZDL 2A9ML 5D71H 3I2CH 3SOBH 2VZVA 5AAWA 2EDBA 4M5ZH 2Y6SD 4OBSA 2FJFA 5IK3A 3BZFA 4JRXD 3MLTB 2BNQA 4MAYD 2B2XL 1CU4H 5EOQL 1I3GH 2IBBA 4RGNC 1A6AA 1AGFB 4Q9CA 5LKNA 1JHLL 1ZHKA 1FORH 1AJ7L 4YHYC 1L0XA 1YEJL 4D3CL 5EORH 3QIWC 1QPXA 2OK0H 4X8XA 3RAJH 3TV3H 1W8OA 3DBXA 5TE7L 2GTZA 5I2IB 5AWNH 1N5YH 3WV0A 4PTUA 4ZTPL 4UBDC 2C26A 2AS5M 3V6FB 3TWCL 4OCWL 3V0VA 4HAGA 4NM8H 2X9XA 1FL3B 4TOYH 2DQHH 4GXUM 1JGDB 1INQA 1GC1L 1RURH 2P5WB 1YN7A 2VXSH 3SGEI 2IMMA 5L2KE 4GAYA 1TJIH 3FTGB 1WLHA 4LAQL 4RRPA 2NTFA 4GJTB 4QHUA 1H5BB 6FABL 1GVIA 1ADQA 4HMDA 5JPMB 4KV5E 1Y18A 4M6ML 4M5YH 2YK1H 4XP5L 3QIUD 3F7QA 1T04A 4XBEL 3DJ9A 1YEGH 1N0LA 1CQYA 5DRNB 3B6SB 5SWZD 2X4TB 3MRQB 1C5CH 2EDJA 2OXHA 3GBLA 3RQ3A 12E8H 4KGLA 4K07A 5IMLB 3GZKA 2W59A 2DIAA 3FO9A 1T2XA 1CDUA 2R1XA 4JO2H 3MBED 1KCVL 2NQCA 4Y2DB 3VD5A 4BQCA 3BRFA 4FFWC 2GSIB 1R5WA 3ZTNL 1QRNA 1VENA 4AYFA 3VXSE 4OF8A 4DAGH 1R5IB 3QRFM 1QPPA 4P4RB 5J89A 1U8HB 5D70H 2X4RA 2WW8A 1NFDB 1MVUA 3Q5YA 1N5AA 1IEBA 2K7QA 1HXYB 3E2HC 3MLYH 2GJ6E 3AB0C 3G9AB 2XWBB 4M61B 1EA9C 4UTAL 1CICA 1LE5A 1KJ2L 2HT4C 1CZ8H 3JWOC 1YYML 5BV7L 1RHHB 1D6EA 4RGNB 3I3DA 3G9VA 1NMAL 3FO2B 3UTTD 1RIVH 4M8QB 2X5PA 5EDXA 5E2UL 4YHYB 3U7YL 3GBNL 4QXUH 5ESQB 5CEZH 3MOAL 1GRWA 3QIWB 5MHSD 3HMWH 3RVVC 1J05A 1QLRB 4JFZL 4K2UL 4G6JL 3SDYL 1A47A 5EG6C 1G7IB 3L6FB 1VFBA 2Z31D 1NBYA 3O2DL 1OT1A 1JGVH 3HZVB 5EOCL 4PRNB 1HQRA 3GMLA 4HPYL 3PJSB 3HNTH 5DQJB 4PG9A 5IJVA 2O5XL 4G8GD 3HCVB 4P2RB 1MJ7H 5C9JA 3KYAA 5GRZA 1CFSB 5I66A 4KK6C 3OKEA 4M1GL 1S9VA 1MJUH 2VWEC 1TJHH 2YBRB 4UILL 4CMMA 1RUPL 2R0ZL 4EDWL 5HDLA 3ULSA 2V7NA 4EBQH 3KPSD 1LO4H 4XPAL 4XPTH 1JWMB 2W0LA 5L88L 1IEAA 3K2UH 4HXBH 1NJ9A 3PWLB 1AGCB 3F12A 4LCIL 2Z35B 3T1FA 3TA3D 4DTGH 1AE6H 3O41A 4BJLA 2R29H 4I3SH 1B90A 1G7MB 3FQXA 4GAFB 2WBJC 4BZ2L 3BDXA 5HDBF 2HFEB 3MRFB 5GGSY 4JRWA 2PXYA 5FCUH 5D4QA 3EJYD 3VRJB 1LGVA 4P59H 2VLRD 5DJYB 3S5LG 3U4BH 3UTSD 1U8NA 1AD9A 2V5RA 3CXHJ 4LQFL 4LGPB 2XFXB 1CFTA 1C5DA 3LPWA 4OBRA 3DIFA 4WNQA 2ID5A 1XZ0B 1BJMA 4FZ8H 5DJ6A 4WGWB 1IAOB 1AY1L 1QTYT 2FBJL 4R26H 2GJJA 2C3XA 1I1YB 1P4LB 2QQKH 3AB0B 1JRHI 4PJBF 4XMPH 5EO9B 2BSRB 4KHTH 3WD5H 3U46A 4Z77B 5JQ6H 3KPLA 5JXEC 2KUTA 1FIEA 4ZYKA 1T7VA 4W81A 4XTRC 4LLWB 5KTEL 4UIMB 2OTWB 3RY6C 3P0VH 2K7PA 4WFFD 2X2YA 3GSUA 1S7UB 1UACH 4QTIH 1ZLUK 4LSPH 3KG5A 1DFBH 3EO9H 4FP8L 3DV4A 4L8CB 4Y4FA 1RFDH 3VW3L 1CDGA 5I0DA 1R3IH 1INDL 1WK0A 2YEZA 5D1ZC 3G6JB 1GZQB 5KVGL 1JFQL 4HJJL 1T83C 4U1MA 3TVMD 3PHQA 3UBXG 3SDDB 5DA4A 4HS8L 1NAMA 3GM0A 3MRHA 5DO2D 1TFHA 2VDOL 3VXME 2DM7A 5DD0L 1E28A 1JJUA 2C1PB 4K94C 4PJFB 1AD0B 1AO7E 2R2BB 3KJ4B 5DR5H 4JY6B 1BM3H 1JHTB 5EBMA 2MCPH 4NQCA 1CT8A 2GCYA 3FOMA 5E8DL 5DZOA 4QHKI 1P7QB 1YMME 3FFCB 5E94B 2OL3H 1F6LL 2JCCB 4HWZB 1DQDH 5IBTH 3PUCA 5ALCL 1LDPL 4HUUB 1MHEA 3U0PA 2FL5B 3I50L 1KIRB 5LG1A 3WDHA 2V17L 2ADIB 5F8RC 3KPTA 4BFBD 1FL6A 1KJVB 1K6QH 5DUBB 3CFEB 2XIDA 1U8OB 4AQ1B 5GISL 3MPCA 4HC1H 4U6HB 4I5BB 1W0WA 1UEMA 5L7XL 4HS3B 3QULA 3MRMA 5DHYA 4FZEL 5KVEH 3NABL 4F3FA 2V9QA 1GOHA 1LO5A 1M7IB 1KIPA 1X5GA 3D6GA 4HGMA 1J0ZA 4YPGB 4JO4L 1FVEA 4Z7UA 4KTDL 25C8L 2VLKA 2FGZA 3IJSB 3QCUH 4S1DC 3G5ZA 4PJCA 3DX8B 3WIHH 4D9RE 32C2A 3ULVF 3DYPA 2O5ZL 2XY1A 4HV8A 2P8PA 3BP6B 1TITA 2A6KA 1UWEH 5B39G 2FX8H 1VGKA 4XPFL 4ZOBA 3TT3L 4L29A 1KTDB 1OT2A 4ZFFA 5I1EH 3CU7A 4CDHA 1CR9H 2AQ1A 3D3VA 3CFCH 2CK0H 4PJEB 5GS0L 3DVGA 4MVBD 3HC0B 3AY4A 5I1CL 5D2LA 4F7CB 3HS0B 3WXWH 4PJBE 3DXAA 3FT4B 3FN0H 5D1ZB 3C6LA 1ERNA 4AT6A 2VXQH 2NYYC 3MYZA 5EIQA 1D3CA 1GGTA 3A6CH 3RX8A 2AERT 3C60B 3H3KA 4PRHB 2A38A 1D5MA 4FA8A 3SJVD 2UVFA 4TPRH 5GJSL 1K8DB 4JFDE 1R3LB 2EE3A 4W6XB 3P30L 5TDOB 2YMXL 2J88L 2VLJE 5C0AE 1A5FL 3RL2B 1RZJL 3KPNA 4XXCC 3QA3A 1IC7H 3MSPA 4HIXH 1J1OH 3EOBB 2BVTA 1LMKA 1A7NL 3EO0A 4K23H 4M93C 4PBWD 3F6LA 4HIHA 4C54A 1CICC 2FJFB 5E2TH 3BZFB 1ZLVK 3L95B 1NCDH 2BSSB 3AU1A 4Y19E 3GBML 2VIRA 1NGXA 3MV8D 1S9WB 2FGWL 2HH0L 5DFVD 4KKLC 5SV4A 1EEQA 4H5SB 2Q6WA 1ZHKB 4FFYH 3M17B 4UB0L 3MRJB 1DJSA 4P3DB 3BEWA 3HA0A 1I7RB 2FB4L 4Y4KA 4QRPA 4EUPG 5BQ7A 1YNKH 1GOFA 1F4YH 2NY2D 3THML 3V0VB 1U42A 1AP2B 4WEUD 5EA0H 5FYKE 5H35A 4U1SB 4LARL 4TVSa 2HRPL 5FDYA 4GAYB 1MCFA 1FC2D 4PJHF 5EC2A 5E00A 2MSPA 5GGQL 4NQUA 3VWJD 4WTWA 5HI3C 4QHUB 5BJTA 1K2DB 1ZT4B 3MRDB 3TBWA 3KLSA 1Y18B 4KJWC 2YC1A 5DVNA 4MQXC 5IR1A 4Z9KB 1OP9A 5JDJA 5I8KL 1T04B 3HUJF 1TZGL 2JB5H 1QEWB 2GKIA 3UP1A 5CZXC 4N5UA 4K3HA 4R8WL 3HG1E 5HJ3B 3O2VH 3QQ4B 3ULVE 3STZB 3FOLB 4JLRA 2CDGB 4R4ND 5J1TC 2Y5TB 4JRXA 2PXYC 3EO1B 4XI5D 5INCA 4BFIA 5H94A 5DEGA 3A0OA 2AJUL 3BE1H 3TBYB 3ECBB 4TUOA 1JRHL 4NKIH 3VCLA 2QL1A 2FBOJ 1R5WB 4K9EL 5E2VL 4ZSOA 1QRNB 3ROLA 1QVOA 1NC4D 2YPKB 3WFBH 3H9SE 3WE6A 2DQTH 2R9HD 4FTVA 3IF1B 3DMMC 4OCNC 1Q9LB 4QYOA 5ICXA 1ZLSH 3BSZH 4YZFE 3HMXH 2PF6A 3MR9B 1IT9H 4N8CH 2J8UA 1B0GA 4KY1H 2VR5A 5DMGC 5EPMB 3ES6A 4FQ1L 2Q20A 3QFJA 4M93B 1CICB 5IW3A 3GIVB 5CJOH 3T0EB 4DGIL 5I19L 5IB3B 1KGCE 4QTHB 4MWFA 4E41E 3EYOA 3GK8H 2XQYK 4MNGE 1XCTA 1VKXA 4JHBA 5HHXH 1M7DB 4DN4H 1RMFL 2ZSVA 1KIQA 4Y4FC 2LVCA 1CFVH 5GRJH 5IESL 3IXTA 4NZRH 4OLXL 4PR5A 1V7NL 2NR6D 4DKEL 2Q8AL 3CCHA 3HR6A 4G6ML 3LRHA 5B21A 4PS4H 1VA9A 1VFBB 2E9JA 3HE7A 3UCRA 3BGMB 4HG4J 4Z0BH 3DNKA 1U6AH 5JW4Q 5B8CA 5FHAL 1HQRB 4OGYL 1HE7A 2ZUQC 2HJLB 3PHOB 1MCRA 5EB9A 2CPCA 4YBHA 3KPMA 4AH2A 3DVNB 4OIAA 3UPRB 3B5GA 5AYUL 1REIA 5GGSB 3QI9D 3IFOB 2RFXB 4WO4D 1PKQE 4MSWB 3LEYH 2V5YA 4X6DF 1DQQB 3LB6D 2YD1A 2AV7B 4LVNB 3ULSB 2FWOA 2V7NB 2DD8L 1TTGA 1BD2E 5FO9B 5HGBB 5IBLC 4E9LA 1FRGL 4YDLC 1FP5A 4XX1E 5EUOF 2BY1A 3RFZC 5IFAH 2JK5B 3F12B 1I1FA 2YXMA 5ACMA 3P73A 4UINL 5F9JA 5ID0A 1A6VL 4OI7A 1E4JA 35C8L 1IARB 5IV2B 3SGKA 5HYSG 2ZUXA 4ERSL 5A2LH 1CLYH 4BFEA 2PR4H 2PXYB 3LV3B 1N64L 3VMOA 5CEXA 4K8RH 1MUJB 3KXFE 3OAZH 3HUJE 3BW9A 3UTTA 1AD9B 3BFOA 3TO2A 5DK2B 2AJVH 3DMMB 3GSNH 5IHLB 2M1KA 5CEYA 2HT3C 1A1MB 3GJFA 3W0WE 1KLUA 4YHNB 3RWIA 4X7SH 1VFAB 2JJUA 2Z31A 1W8NA 3VXOB 1TETL 4ZS6D 1JPGB 5KAQF 3RVXD 2I24N 5J6GB 2IALA 3VGBA 3CVHA 5D9SA 2ENSA 1XGYH 4G8GA 1T0MA 5GS2D 4UQ2B 4L8SB 4MB5A 1KTLB 3H7BB 1CFQA 2OR7A 1DLFH 3GSUB 5B4MC 4JY5L 4XNUH 4XP6H 3NA9L 3JWDL 5ITBH 3KPSA 2WP3T 1WZ1L 1AC6A 3QYCA 3H0TB 4MJ6A 4Y5YB 1JUFA 5TDNA 3TA3A 4FMKA 2EYSA 4YE4L 5DC0A 3I9GL 8FABB 3OKMA 5EU4B 1HHGA 1JNHB 4K7PL 4MD5B 2OS7A 2ZUQB 4PD4J 5F71A 1KBGH 4CW1B 5EBMB 1BBJB 5HPMB 1BOGB 2XKSA 4NQEB 5ISZE 2VLRA 3NTCH 4KQ4L 1CT8B 3UTSA 5I16A 5I74B 3H42L 5IB4A 5HY9B 4NJAH 1FSKC 2X9YA 3QH3A 1FH5L 4FFVC 3GFUA 3RGVB 3FO0H 4GG6F 1LEIA 2ADFL 2IPKA 4JG0L 1I7ZA 1MHEB 1V7MH 3LN4A 2IH3A 1A0QL 1WJ3A 4LSQL 1S5HB 4IOIA 4X6DE 1XFPA 5CMAB 1QBLH 4QRSB 2MKLC 5BO1L 3M8OL 3I6GB 4FQ2L 5EUOE 1PKOA 4Y4KC 5DRXB 3X3FL 2VAAA 3FCTB 5DHYB 3QDGE 3GMRA 4NC2B 5CGYD 4F3FB 4YDVA 3PDGA 2WWKO 5ENWA 1S7VA 4LGRB 5ICYA 5FYKH 3T0AA 3FQWA 3P4OB 1FVEB 1HINH 2VDPL 2XN9B 3QDMB 5M95B 3LOWA 3P11L 3TCLB 3ZYJA 2QQNH 3TVMA 3VFGL 3TBVB 3BKYH 32C2B 5IM7B 2P8PB 4YC2C 1VGKB 1UM6L 2EDKA 1X3DA 2OR9L 4ZFFB 4RGOH 3KYNA 1R24A 2A6DB 3WL9B 4Y8DC 2NMSA 3GMNA 1ZSDA 4JEGB 2APFA 2GK0A 4MDIA 5CJXA 1BQHG 4LBEA 1K3ZA 1EJOL 2AJYL 4LKXA 1WIPA 3ULVH 4YEEA 5EZLB 5KJRH 1U8QA 3GUTA 4FQQB 5FM5M 2JJVA 5HYJB 4GRMB 2AK1H 3FAWA 4NWUL 1EBAA 2EKSB 1Z5LA 3I02B 4OZHB 1KPRB 5IROA 5JDSA 3REVA 4NJ9H 1KACB 4G8IA 2ICCA 3DV6B 3D1MC 1OAYL 2ERJB 2WWMC 2YD6A 3H3PH 4FXKA 1FNGA 3E8UL 4PGEB 4WTZG 2OLDA 4N8PA 2F53D 1JYWA 2MKWA 1MFCL 2AP2A 3OKNA 3MNZA 1LP9A 1JWSA 4ODTH 1OTSD 2IFGA 2XQBH 4ZUTB 2W91A 4OGZA 3MTRA 2KBGA 4EVNB 4YQXH 1VFOA 2IFFH 5IF0A 1PQZB 1FSKB 3EO0B 2DQJL 4JHAL 4QCIB 1FFOB 3LRSA 4QHLA 5EZIH 1MF2H 1AXSB 2VXVH 4JRYE 5SX4I 1MCEA 4PV9A 2AK4E 4OIBA 3D25A 1IGFL 4UQ3A 5B38B 3T65B 1NFIB 2VXUH 3H8NA 2EECA 4ZNEA 4MVBA 4PJ8D 4GG6E 2B39A 4OD3H 1L6ZA 3SKNA 3P0YL 3HE7C 1MFEH 1S7XA 2G5RA 5B8CC 3AS1A 2E7LA 5I1GL 1ZHNA 2A74B 3ARDD 3QG7H 4OV6F 5H35B 2AAVA 1QLEH 1AHWC 5EC2B 1A4KA 4LCWD 4F7PA 2UWEF 3NIGE 5LVEA 2ATKA 3BKJL 1T03H 3RZWA 1EFXD 2C7UB 3HB3C 2NX5E 5T1MB 3SJVA 3T04D 5CILH 4YC2B 2WINB 3OJVC 3CK0L 4FQIH 3Q0HA 3TBWB 3BYYA 1F13A 2YC1B 4FFZH 4PTTA 4EI6A 4ZD3L 5IW1A 3T0XA 1UXSA 3AXLA 1F4WH 1H3PL 2DQGL 3GSRB 5GRUL 2VB5A 4U1KB 3GRWH 3FB8B 4NNYB 5EU7C 2VZOA 1CLCA 3RA7L 3NFNB 2R0LH 1KN4H 3SGKC 3TZVC 4ISVA 4MCYB 4JLRB 1KLFA 2NY4D 1Z2KA 4GQ9L 4NQDB 3DRQA 4MX7B 3VFRB 2EXYD 5DJAB 1HCVA 4BFIB 4YGAB 5DEGB 4D2NA 4YDKL 3EAKA 3K2MC 2QLVB 3MV8A 1FIGL 1X6LA 1VADA 3RWFB 3ROLB 1N26A 1T2JA 3G6AB 5ILTL 5D5MA 4FTVB 4BQBA 3O4LE 4XBGA 5E08H 2NXZD 3UTPD 3D2UB 3WBDA 4OZGB 1NAKH 1RUAL 1EO8H 1EHXA 3B43A 2Z31C 4UV7H 5D7KE 1SM3H 3QFJB 5E2WH 4OCRL 1ZA3A 3WDIA 4Z7OF 3KLHD 4N0FB 1G0DA 4MWFB 4RISL 1ES0A 2F54B 3SGJA 3VWJA 3HI1A 3I3EA 1HKLL 4P5KB 4FMFA 3BIAX 4S10A 2VDMH 4XHJC 2ZSVB 1XT5A 1KXTB 1YECL 2BMKB 5I1LA 3GKZA 5T5NF 5BS0E 3CCHB 3TA3C 1J8HD 4YWGL 1OAQL 5IGXL 2FSEA 2XA8L 1TIUA 3HE7B 3NCJH 2EDXA 2NY7L 2W0PA 3MODH 1MWAL 2DDQL 2Z92A 4BUHA 5CJ5A 2P5EE 1LHZA 1AHWB 1I8IA 3N1QC 4QHMA 1Y6NR 4H8WL 2XZAH 2A77L 3WXVL 3BPCB 2O5YH 1JTPA 4NIKB 5I1DA 2VITB 1NC4A 4KROD 1F97A 4XMKH 5C0JA 1R5VA 1KCGC 2VDRH 5D6DA 5F9OL 5F6IC 4NKOA 1CCZA 1ZEAL 3BPNB 5HHQB 3VA2C 3DO7B 3F58L 1FYTB 4PGDA 5F9JB 3C08L 1KPVA 4DUVA 5IWLC 5C92A 5HI5D 3TZVB 1J5OH 4ZAKA 5CIPH 4A6YH 4I9WD 4UTBL 3R4DA 4RFNB 5ESVB 1NKOA 3IDMA 4Y89A 3SY0A 1QSED 1NUDA 5C08E 1KB5A 5D8JL 5ABDE 4NWTH 2A83B 1GPOL 5E99L 4NO0B 4JFQA 3TO2B 3VI4F 3VWKD 1G9ML 4PP2B 2B8OT 4DW2H 1S78D 1FVDB 1DUZB 4JDTL 1H3GA 4L8DB 3NA4A 3EZ8A 3PIQA 5DD1H 1NL0L 3TVMC 1MAKA 3O0RL 5F9DC 4C55A 1F58L 5I1IL 4PJ7B 3KPRD 2CGRH 5HHNB 3WFZA 5TQ2L 3CVHB 4YHLL 4P2QB 1IC5H 4X6CA 2ZZUT 1N0XH 3QI9A 1DVFD 3OAYH 5F7KC 4S0TD 3ESUF 4WO4A 1NFDF 1WFNA 1JPSL 5CJXC 4L8BB 5E9DE 4C4KO 3ZKXB 3GKWL 4O51B 4AQOA 3S5LA 3BP7A 2R56L 1Q9WA 4NN6C 5ICZA 5CD3B 2X4PA 3O3AB 1JUFB 5TDNB 4XB8A 4OKVA 5C09D 4Z7OE 1FAKT 4PJXB 5IJKC 2R69H 3GMQA 4F7TB 1IQDA 1KEML 2VC2H 1QKZL 5A2IH 1HH9A 4HUVB 4LASL 3NCEB 3X11A 5CP7B 1N6UA 4MQSB 2EEBA 2X9WA 4K3DH 1C16A 1OLLA 3HPLB 4KJPC 3QDJD 3TT1L 4S1SL 2EH8H 4XCFL 4OCLC 5F7HA 1A14L 4P5TC 5DEFB 3PWPD 2FO4B 3WCYA 4NPYB 2B4CL 2CIKB 4JPKH 4P5MB 4JFED 1Q0XL 5F6IB 1HDMB 2AGJL 3QUKB 5CGTA 1K8IB 5TE4L 4Y4HB 3BDYH 3CUPA 4OJFH 1I7ZB 1N6QL 3DETD 1I1CA 1H3VA 2IH3B 4IOIB 5DQDH 3JUYA 2V9TA 3QEHB 1U95B 1A7OH 4QXWA 4TVPD 4ZFOA 4U1NA 1I7UB 5E1AB 4ZPVA 2WV3A 5KVDL 3IDYB 2P5WE 2HYMA 3K4DA 3RRQA 1CL7I 2CJUH 3GMRB 2A1WL 5ENWB 3ZT5A 2C4XA 5C0BD 4PGJA 4ODUB 4OI8A 3QZWA 3QXDA 3PWJB 5FM4A 3PV6A 1XH3A 1L0YA 3HI6L 3L7FB 5ITFA 3K81A 3P9LA 3QWQB 4Q97A 2GT9B 3CVIH 4R90H 2GY7B 4K3JL 4LSUH 3VI4E 3L5XH 4JHZA 4Z95H 5E8NA 3IXAA 1RZKC 1IGCL 4RSVA 4OM0L 1JI1A 1ZT7B 3E3QE 5DVLA 1IQWH 1F8TH 3UMTA 2L0DA 3N0PB 2VABA 4JFHE 4YHPB 1CK0H 2C3GA 2ED8A 3GUTB 2NXYC 3F7RA 4LPWA 4PIRF 2YD4A 4F7EA 1PYWB 3X14A 2UZIH 2X70B 4G6AC 1A7PH 3MCG1 1NFDE 1T6VN 5T3XD 5MENB 5DFVC 1KG0A 1OCWL 1NFKA 3BKMH 4PV8A 2LFGA 1HWGB 4I4WA 3T2NH 3J7HA 1J86A 4XB7A 1DBAH 3NPSC 3G6JF 4YHOL 5DRZB 5L9DL 3OKNB 3LKQA 1CLOL 1H8OA 5GS3A 1S7TA 5D7IA 4N0CC 4P5TB 3QFDB 2NY2C 4RGNE 3SKMA 4OTXL 4BUGA 3EYSH 2XRAH 4PJFF 3SCMA 4PGZA 4YX2L 2R4SH 1D7FA 4F58H 4OLVL 4C56B 1AKJD 3SGJC 5ACZB 4H1LH 4QLRA 2WMPA 2PW2B 4QRQA 3QHZH 1NCAL 4JZNA 4I3RL 5JMOC 2XPGA 3DSFH 5CBEA 3CXHK 4PRPB 4LIQE 4RIRB 5D71L 4P2RE 1FCGA 4ONFL 4BH8A 5I8CB 1VACA 4XAWL 5IOPB 4LMQI 2NY6B 2X4OA 4R4NC 3KYOA 1I3GL 5E24E 4G43B 4LHUD 1KENL 3MBXL 2VSDA 1W2KT 1VEPA 5EORL 3LQAC 3SJVB 3QNZB 3MUY1 4QRUA 4E0RB 2I9TB 1A9EA 1OWRM 2CLRA 2F53A 1KXVC 3IVKA 1ZHBB 2ESVD 5CKGA 5GZOD 2A73A 5IW1B 2BCKB 3ARGB 1DN0B 2RB8A 5C07B 3T0VA 4NN7C 2ZNXA 3U1SH 1MPAL 3T4YB 1FGNL 5DJ0B 3FRUB 2DLFL 1XGRA 5DJDB 5INDB 5E8EB 3EDDA 2A6JA 5HTSA 2NXYB 4ZAKC 5JO5A 2NLJA 5MEPA 3DRQB 1ZGLA 4F37F 1JN6B 4HKXB 1MRFH 4P57A 2NY0D 4Q2ZB 4H20L 4PJEF 3D39D 1G9NC 3RL1B 1NQBA 4QXTA 1J0KA 1WBYA 4NO5A 4PYGA 5HI4D 2CKBH 3S8WA 5FO7B 5GGTL 3O3BA 2BRRL 1VEMA 3HFMH 4PJ8A 1XF2A 2CMRH 1ZVSB 2MHAB 2DWDB 2FJHB 4CVZB 4KUCD 4PLNC 1WZKA 1JGLL 1MRDL 3F7PC 2PYED 5BZWB 4ZPTB 1OPGL 1UZ6F 3D85B 5IUSA 3ARDA 4LFHD 3KPPB 3HRPA 4RFOH 1RZFH 1GGCL 4LF3A 7FABL 4DKFH 4LCWA 3FT3B 3PGDB 3QI9C 3DX9A 4UAOC 1GC1C 3G6JE 3QUMB 4P3CH 4WO4C 4DGVL 1EFXA 1H0DB 1UENA 3BHBA 5IEHB 4KPHH 4OQ1A 3AS3A 3MLZL 4CU7A 1BPVA 1GOGA 3W5MA 4Z76A 1MIEH 2OXGA 4KVCL 3SO5A 5FUOH 4B41A 1IKNA 4PJFE 4PRDA 2YPVH 5EFIB 1HHJB 1NGQH 3GHBH 1AGEA 2PO6B 4GOSA 3F6IA 2OJEA 1EEZB 4LSSL 4G8EA 4EOWH 3SO3C 3Q6GH 3FFCE 2ICWJ 2DICA 1FDLH 3V95A 3FJTA 1NLDH 2Z91A 5CZKA 2GJZA 3WEXB 1G6RL 3TJHD 4HKZB 2BNRD 4OZFG 5C0JB 1R5VB 3I75A 5HGHB 2G5BB 4U1IB 4KI5D 4NRZA 2JB6A 1JGVL 2OZ4A 4OT1L 1LO2H 1I8MA 1NGZB 1OAUL 4NN7B 5ANMA 4PGDB 1CL7L 5DJCB 3C8KA 2VN4A 4XVTL 4MAUL 4P0DA 2F8OA 2FRGP 4ZAKB 4TULH 2ENYA 3F7VB 3T2PA 4YPJA 4HEPG 5DQ9A 1TZHB 5EUKA 4AEHH 1MCPH 4PJIB 2YSSA 3WJLA 4NO2B 3LKOB 1KFAH 4JFQB 3AS0A 4ZOCA 2IEPA 3LAFA 1W0VA 4ZDHB 3D9AH 1J8HA 1NBVL 3IJYB 3PIQB 5FKAA 1JGEA 3DUUA 5FCUL 3X3GH 3BPLB 4PJEE 4RAUB 1ZT1A 2FH8A 4P59L 1BF2A 4D0CA 1I9EA 1GGIL 3IAPA 4R6UA 3HPJA 2OJZL 4OSUH 4UAOB 4KUZL 3UJJH 3WLWD 3N1GC 1KCSH 4PJGB 1BIIA 3CLEL 3IJHA 4L4VD 3MYJA 2CLZA 1U3YA 2GYSA 3ARSA 3S5LB 3BP7B 5GRWA 3EOTL 4PRHE 4NP4L 2DTML 2LU7A 4GBXC 1VFUA 2X4PB 1AXTH 4L3EA 5AZ2H 4NQSA 43C9A 1A4JA 1EHLH 3ARBB 3P4NB 3SO3B 4XHQA 4HMEA 1SJHA 1DQML 3MJ7A 1CLZL 2O61A 1DFBL 3GI9L 3VXUB 1QSEA 5I17A 1IM9D 1MCOH 1X5AA 2ARWA 3U6RA 2UY7A 1MI5D 2ILLA 2UYLB 1HXMA 5SV3A 3VWKA 5CGYC 4KQ3H 5LCVL 1YPZB 2MJWA 3SDCD 4HUNB 3DGCR 4UT9L 1WZMA 2PCPB 1QYGH 3SCMC 3RVUC 5TQ0H 4MJ4A 4KWUA 4Z7VB 1BM3L 3BZDA 2IBZX 3KPRA 4F57H 3UJIH 3IFPB 4OF5A 2VERN 3MLUL 5D7JD 3UBXB 4UV4H 4ZFZB 5C0ND 4HZLA 4ZNCD 4Q0XH 2J12B 2VR9A 3HAEG 4G3YL 5EBLB 3KJ6H 3BH9B 4LIQH 4U1NB 1DVFA 1KJ2B 3OQ3B 5EU5A 4R0LA 5BV7B 3HZMA 3MZGB 4M62L 3U7WL 3KVQA 1N2RB 1I4FB 4X4XB 5TPWH 5BVJA 2BOBB 4WHTB 3EDJA 3O9WD 4BA8A 1U93B 2VLLB 2OMNA 4X0KB 5C09A 2R8SH 4DVRH 2DQEH 1XR8A 3DWTA 3FHQA 2BNUB 5DRWA 3V5DB 4N9GA 5DJZA 1JYNA 4NBZB 2V2TA 1OSZB 5GGVH 3OAZK 4I8DA 5JOFA 5TF0A 3QIBA 5FB8A 4HBCH 4XH2B 1UJ3C 5KVMC 3LEVL 3QDJA 3TNMB 4ORZC 4HLJA 1C5BL 1NUFA 3PWPA 43CAB 1FGVL 4TSBL 3QCUL 1IZKA 4GBXB 1QRNE 4JFEA 4D9LL 1TQBC 4MJID 1FO0B 5E8OA 4HG4K 4UI2A 5DJ8A 1VFMA 4JPWL 4NNXA 3X14B 1FBIH 4O4YH 1T5XA 5AAMA 3OJ2C 2IMNA 3SKJH 1F00I 2VDNH 3RDTA 3QUZC 1YA5A 4PV8B 1FNHA 3BEVA 1IGIH 5B39B 3LQZA 2AJSL 3T0EE 2ZUWA 1FVCA 3BD4A 3LDBC 4Y2OA 1X5FA 1A3LL 4ZTOL 4JFYB 4PJDA 5JHLH 2BC4A 4LLVB 1KJMB 3SKMB 4N8VG 1HH6B 1DZBA 4JJHA 5C0BA 4M7LH 5DC4B 3ARDC 3SCMB 4KAQH 5JIHA 4F9LA 5ALBH 1ED3A 2OR8A 4I1NB 4EN3D 1WT5C 2PW1A 4QRQB 4GRLB 2Y5EA 4QNPF 5BRZD 1QBML 2AXJA 5TFSH 1MFNA 4M9PA 3TN0D 1M6OB 3ZE1E 3MLWL 5F93C 3VG0L 4ZODA 5CBEB 4WUKL 4KC3B 5IMKA 5DUPH 3O4OC 1IKNC 1T1YB 1UWGL 3VE0A 1WGOA 1T1XB 4BH8B 3EZJB 1RJLA 4X6EA 5GS0C 1VACB 4HWUA 5T1LB 4OCYL 1DUYB 2WUCL 4MLIA 1BVLA 4U6VH 2X4OB 2NY4C 4PUBL 4HWBL 4Y5VB 2G2RA 2EXYC 4XCEA 1U8LB 1U8IB 3TCXA 5GHWH 1T7XA 2BVOB 4N1EA 4BSVB 1A6WL 5EOTB 1UJ3B 1JBJA 5J1AA 2HVJA 1MAJA 2Y7QA 1FNLA 5D93C 4OCSH 1RZ7H 2ZCLH 4DN3L 1RZJC 4EUPB 2EDLA 4XXDB 5SWSB 2EO1A 3WYRA 2A6JB 4EI5D 1DBKH 1YNTA 5SWQB 2I60L 2XTLA 3VGHA 3KLHC 4YAQB 4PD4K 5IVXA 3G5XB 1AKJA 1A3RH 2JJWA 4FG6D 3WUWG 4AIOA 4ODWA 3WJLC 4K7PY 1YJDH 1JYXA 4OF0A 1XMWA 4E42B 3JWOL 3QUZB 1G7JB 3L3IB 3ZDZF 1CXKA 3SGDH 1DQJB 2ZUTA 3AMKA 4G9DA 3NGBC 1IM3A 3V6ZA 1F3JB 1AIFA 3GSOA 3U0WL 1IKFL 4EEEA 1BX2A 4OZHF 4KHXL 1AR1D 1UZ8B 2FIKB 4F2MA 5KVFL 1ZS8A 1RV6X 2OQJB 3OR6A 4HFUL 3WN5A 3OXSB 1ONQA 4OFIA 3BE1L 4KTEL 5FYJD 3B5HA 3N85L 4NKIL 1I75A 4RFEB 4KZEH 4LLAA 4LHUA 4MGXA 3WFBL 1P7KA 4XNXL 1FN4B 2P24B 5T5FL 4JGUA 3OKDB 1J7VR 3HMXL 2RR3A 1MJ8L 2ESVA 1HIMH 1S9YA 2BJML 4KY1L 4WHDA 3V4UL 2QQLH 3O4OB 4NZUL 3MLSH 1JZ4A 2WWKT 5IKCA 2EEDA 2XZCH 3EOYG 1LEKB 5JHDD 4NQEE 1FNEA 2ITCB 5C0GB 3GHEH 5DT1L 1BLNA 4DZBA 3VD9A 4QNPE 3O3EB 5EIIA 1HSBB 5CGMA 4DN4L 1YY8A 4AIXA 5FKPB 4BQ6A 1U58A 3L5WA 4D9QE 1YYLL 3O8XB 4J4PC 4OM1H 5LGJB 4AZ8A 5DTFB 3V5KA 1WZLA 2HFGH 2Y25A 4XNMA 4K9EC 4J7RA 3RIFF 1S78C 1U6AL 2DBLL 2ZCKH 3VFWA 4IEFB 4O9HH 5D93B 4YHKH 3RNQA 5CLWA 1JZ5A 3HE6A 3C8KB 3TIEB 4NZTL 5FUZL 4CJ1A 2RCSH 2PYEA 1QD0A 1XGUA 1F02I 2FH6A 1HHHB 3O6KH 3WJJA 4I13B 4DCQB 5ID1A 2VDKL 1SHMA 2RBLA 5E8PB 1UA6L 3BXNA 4N0YH 5H37G 1WIOA 4X99A 3TH4T 1DVFC 2AW2A 1XF1A 3OJMB 1FFQA 3V4VL 2YSSB 3MRLB 3N1FC 2XN9E 3QDME 3QQ9C 4WWKD 3ZE2F 4OIIL 4JKWA 3MJ9A 1I7TB 1UADC 1AQKL 5A16B 4UNVA 5JXAH 1S9KC 3P4MA 3JWNC 3OXRB 3HNVH 1CXHA 2Z4QA 2CQVA 4G5ZH 2AEPL 4YNYB 1JHKL 4H25B 1MOEA 3CDFA 2HT2C 4OD1H 2NY5L 5CFHA 1ZT1B 5C0CB 5IIEA 4KMTH 5HYSB 2HJKB 2P7TB 3RUGA 5JQHC 3ZDZE 4ZUVB 3QIBC 5EO1A 3O3DA 3REWA 5HYJE 5I8EB 3B2VL 1HCFX 1UEYA 3EKCA 3TJHA 3LEXA 4OZGF 1Q0YH 4K94L 3VGEA 2BNRA 3CXDL 4OZHE 5JA8B 2WBWB 5M7QA 4HGWB 4TQEL 1YDPA 1FFNA 4G9FD 5E2JA 2DQDH 2DM3A 4G42B 3SDXA 1S8DB 2NW2A 3IYLW 1NEZG 4L3EB 5MERA 3TYFB 3N9GL 3QO1A 1C1EH 4JANA 4H0GA 1I9JL 4QT5B 5ESAA 4HIIA 5IVOA 3UAJD 5CJQL 3N50A 3RDTC 1T5WB 3MRCA 2BXZA 4M6NL 2VISA 2Q76A 3WFCL 1Q9KA 4OCXH 3FAXA 4YHZH 3VXQB 4Q9QL 2PTUA 2X4UB 4YBQC 5DI8A 1HXMB 4B53A 5CEZD 5KG9B 5I6XC 3C5SA 4ZXBC 5EULV 3IFLH 4GLRH 1L8JA 3QG6A 4XBPB 4M8VA 4DVBA 1ZOXA 1KPUB 1LO0H 2E9BA 1FZOA 4HKJB 5D1QC 4HIEA 1GGYA 3P9WB 4F9LC 3L9RA 5AEAA 1X5LA 1WAAF 1P1ZA 3QQ3B 1A64A 1YY9C 1MNUL 4X5WB 3VJ6B 3ROOA 1UCBL 4HULB 4X4ME 5DD3L 3BD5A 3NFPB 3PQYD 4N90E 4G7YH 5K33A 2CO7B 4R9HA 4ZUWA 4CUCA 1H3XA 1ADQL 4CADA 2GY5A 4OKDA 2I5YL 3NOIA 5D96C 2AEQH 4L4VA 3RZCC 2WQRA 2J2ZA 1RZIB 3EW3B 4JG1H 3T4AA 3JUZA 4S0SD 5AYQA 1V7ML 1P69B 4ZFGH 4U1JA 4DGYH 4NZDA 3I6LE 2YWYA 1SEBA 1XR8B 5LBSH 4O02H 4MD0A 3SN6N 5JNYA 4P3WA 1UQSA 5KZCD 3FB5B 3ZE2E 3OG6B 3AROA 3BP4A 4R2GD 1KNOB 2W65A 3QIBB 5FB8B 3RWEB 3Q1SH 1IM9A 4WHCA 2VZ3A 3MLVL 5I1JH 4NQDE 1NMCC 3DGGB 4POZC 3MV9D 2V2XA 3V7AE 1M71B 4HX1A 3G04A 4PJ7F 3W11C 3VXNA 4QOKB 3Q6FB 5EU3A 5IFJA 1QFUH 1QO3B 2EC8A 1KLGA 4FTVE 1CE6A 5AG8A 1SBBA 3T2QA 1JCKA 4ZO7A 3OAYK 1QFPA 4OZGE 3RDTB 5D7JA 1YEDB 1FE8H 4YR6B 1U92A 2CIIA 1SBSH 4YXLH 3QFJE 4M4RA 3X13B 3ORJA 3MRIA 4OFVA 3LQZB 1NCWH 5KJRL 5DD5H 1FVCB 3MREA 2OSLB 4OLYH 4PJXF 5GJTH 3AAZA 3BGAA 4ZXBB 2F54E 5AUMA 5HHPB 2JKXA 4W6YB 4L9LA 4QRTB 3TO4A 3RU8L 1BQHB 4HHAB 1D5IL 3CX2A 3LKSA 1X5HA 3O9WA 2YPLD 4LRIA 1XR9B 5D1QB 5C7XL 2HTLD 1GHFH 4OAWA 1LE9A 2BK8A 2C4FU 1RU9H 4D0DA 1OQOA 2ZUYA 2CLVB 1P9MC 2D03L 1MFBL 5C6TH 3KNBB 4LLYA 3ARZA 5HDQH 3IETA 3VXTA 5GZOC 3PGCA 1LDSA 4TUJA 4WW2A 4WV1A 5IHUH 2WLYA 4GAJH 3RZCB 4KK8D 4X8JB 3IT8D 4X6EB 5F89A 3S4SA 1WAAE 2NPLX 3NZHL 5C8JB 3RTQB 4KRMB 3A6OA 3BKCL 4GSDL 3AC0A 4G8FB 2MCG1 1FAIL 1A02N 3KYKH 4K71C 1MLBA 4LDOB 1A7QL 1AQDA 4JZOB 4XCEB 4NHCL 2NY0C 1I1AD 4KRNA 3B3IB 1XGTB 2V5SA 5IT2L 1FYTE 2R2EA 2GAZA 1B88A 2XXMB 4IHOA 4WJ5B 5EU7E 3V52H 2EZ0D 4OD3L 4H26B 3KWWB 4ENEC 1LK3H 1MFEL 3S35L 1NMCB 4C4KT 4Z7WB 3MJ8B 1CXEA 3KHQA 2ZUVA 3HE6C 3QG7L 3ZT7A 2HFTA 2PN5A 3BH8B 3BDBA 3VI3F 4ZS7H 3FMGL 5L2KD 5FOBB 5L2JA 1A1OB 5I1HL 2X4SB 3T08A 2VKWA 5CILL 4AENB 1J1XH 3QQNA 1R3HA 3FQRA 1VPOL 4JPVH 4EN3A 5C86A 1YC8A 2OI9C 2EH7L 2XYCA 4JGMA 1RK0A 2IAMB 1QHOA 2C5DC 4L4JA 5BRZA 5IEKA 5KSUA 2JIXD 3TN0A 1TCRA 1BMGA 1I8KB 1MCHA 2IQ9L 4PJ7E 4M1DH 1IM3B 3TBSB 4NDMB 4P2QE 5EU6A 4AG4L 4IOSD 4JM4L 2W60A 1YEIH 1KN2H 2ED7A 4PB9L 1ONQB 4U6YB 3VG9B 5FF6B 4RMRA 4J3XA 3O45B 5DWUH 5F70A 4GG8A 5D72L 2BSTA 2HVKA 3G6DH 3O6FB 1NAML 3GB7B 5LGHH 4DEPC 2QR0A 3VXSD 2E9IA 1HWHB 1UM4L 2HWZL 4BQ8A 4PJXE 1DBJH 3HLAA 3F7YB 2AQ3A 2DQCL 1TENA 4ZMAT 3WFHA 5KW9L 2GFBA 4HJ0D 1S9YB 3GMPA 3MRBB 2HFFA 4KI5C 4Y5XA 4PP8C 1A6ZA 1MIML 2GJ6D 3SHSA 2F19L 4I0CC 3UC0H 4Y88A 1HN1A 1RUQL 2G75A 4EI5A 1NCUA 4IRSA 1BLNB 4K71B 4E5XA 3PL6D 1YQVL 2WUBL 5JUEH 5T3ZE 4QF1B 5TDPB 1SJXA 1XEDA 5GZND 3MA7A 1ZANH 1U8JB 5CP3A 5I1AA 2ZSWB 3QUXC 2I26N 2D0HA 5ERWA 4CRPA 1PZ5B 3LS5H 3L1OL 5IMMA 5DVOA 3WNLA 2VQ1B 3LMJH 4YEFA 4FXGB 3QRGH 4XNMB 1IGJA 4ELMF 3HKFA 3FONB 1XAUA 1CYGA 5FK9B 5FGRA 2EIEA 3KHOA 5DVKA 5I30H 1J12A 1FG2B 3MODL 1A1NA 1JNLL 1I9RL 1CE1H 4UOW1 4PB0L 5J6HB 3HE6B 4YXHL 3IDNB 5DLML 5F7EL 3CIQA 2IQAA 4BSWB 5ID1B 2I07B 1RULL 3ZTJH 2COQA 1H8NA 4GW5A 3CJJA 4GKZB 2EIBA 4LCUA 3W82A 4QXGH 4HUWB 5JMRA 2B7DT 1KYOJ 2GSGB 4IRZH 3MXVL 2OI9B 1EZVX 3QWOA 3IKKA 4JFFB 2X42A 1BAFL 3S37L 3FQTB 1BVKA 1CBVL 4P46D 4WI2A 4ONHA 3U0TB 5DURB 3ULUF 4J23A 2DWEA 1FNSL 3P4MB 2D2OA 2A9NH 1MAML 3SPVB 1OTUC 2Z4QB 3MCKB 5DS8B 5D1XC 2FD6H 4JN1H 3PWNB 5JHDA 4NM4H 3PWVA 3WFDL 1V8HA 2IANB 3ARYA 1FPTL 5F7UA 1SYVA 4NWTL 4IM8A 5T1KD 4O2CA 5HYEA 1Z6JT 1NKRA 3VGAC 5L6YH 1TDQA 4OI9A 2X1PA 4MCZA 4X5LA 4X4ZA 3LEXB 5HHMB 2MPAH 5MEQB 1S5IH 2AQ2A 4LCYB 4UIKL 1AI1L 5MENE 5J0BA 3CDGA 3QO1B 3NAAL 4JANB 2AABH 3GSWA 1HQ4A 5K9JH 3CSYA 1CIUA 2JLLA 2YD7A 1JNNL 1JPTL 3EJZD 3DURA 1H3TA 5CD5D 3BAEL 1Y0LB 3MFGB 4TUKH 2YUXA 4MNQA 5DUMH 1PGRB 5D7JC 4X4YB 4XP4H 1ZHLB 1WFUA 3VGDA 3QCVL 3VFUB 3OHXA 3QUXB 4YJZL 2XTJB 3B9DA 5CHNB 4C56E 3TO4C 3ALXA 4L9LC 3P77A 3EGSB 4DVBB 4HEME 1EAPA 1QR4A 4R4FH 1G9MC 3O9WC 4LRIC 1TJGL 3BQUC 5C6PB 3MRPA 3VXMD 3VFMB 3L9RB 4PRPE 1DBMH 4XWGH 1NCBL 1AO7D 1MI5E 1C8PA 3MRNA 1OAXL 5F7WC 3W9EA 4ELME 1IAIH 1GGBH 2VZ1A 2VMFA 1C12A 4OD2A 3U9PL 4WW2C 2H3NB 1YMMD 4XVSL 4CADB 5FECA 4WV1C 3Q3GB 4P2YA 3ARRA 2X1OA 4AL8H 2R0KH 1NC2D 3S96A 4G9FA 3BDYL 5I76A 1UB6A 4KKAC 1ZKAA 4WY7H 4RNRA 4ODBD 1MH5B 2F74A 2HKHH 5JW4M 5DQDL 1SEBB 1U8KB 5D1XB 3QNXA 4M48L 4PJIF 1ZK9A 5C07E 1ITCA 5IMOB 5GSRB 3SE3C 1UQSB 1ACZA 3U82B 1JPFA 1XF3A 1BVZA 3MLRH 4LNRB 5BOZG 1MWAB 4K8RD 2CJUL 2AJXH 3VGAB 2VRAA 3ULUE 3MOQA 1HZHH 3CLFL 3G5VA 4AEIL 3HAEA 1UKQA 3HI5H 2J1KA 3Q5TA 2XZQH 1UB5B 3MXWL 5H2BA 1SMAA 1OAKH 4DFHA 4MDJB 4TTDD 4HS6A 2P45B 4KMQA 3VXNB 4ODHH 1F11A 1KJ3L 4WFEE 5FA4A 5FM8A 3TPUB 4D9RD 2R0WH 2B4CC 1T7ZA 4XGZA 3QUYB 4EN3C 5FDWB 1N7MH 4PJGF 2IG2L 1GL4B 4X6BB 5D7JB 2Y36L 4KRPB 1U92B 2CIIB 3VFVA 3PQYA 3ZT6A 5LXGL 4NHUA 3CVHH 3A67L 3MRIB 4LRNL 2DI8A 3WFEL 5J3HD 4KGJA 4IBLT 3AAZB 3DOSA 1NPUA 2VJXA 3TO4B 4L9LB 2ICWI 1EDQA 1U3HD 2D31A 5F96L 3MV7D 1OF2B 1MFAL 1P5VA 1DQLL 3BQUB 5FYLE 3D18B 2G60L 5IB1A 1JF5A 1DSFL 2ZG2A 3BKML 2NW3B 4HDIB 2Z8RA 5CBAB 4OQTH 3U4EA 4LEOB 2HJFA 4JFDD 2B5IC 2LABA 4JFXA 4FFEX 3KDMA 1YPZF 2VLJD 5C0AD 3WNOA 3O2WL 4RWYH 4Z18A 2ZPKL 4Y5XC 2APVA 1AFVH 2NNAB 4JZJA 4A2MA 1HILA 4KTYA 1ZWIB 5DJXA 2FECI 1XGQA 4Z7VF 3MV9A 3LIZH 1INEH 1IC1A 4FABH 1RVFL 1YNLH 4EI5C 4IRSC 4K7FA 4OLUL 5T3ZH 3OKKA 2D0GA 4Y19D 4R4BA 1WCBA 4YO0A 1UXWA 5FV2A 1AQDB 3BZEB 3IDJA 4N0UB 1ETZA 1E4WH 3K8KA 1U3ZA 4FG6C 4LLQA 1B0WA 4NBYB 2IF7A 1DL7H 4X7TB 3WKMH 3DVIA 3BMWA 3HR5A 2GAZB 2EDNA 1NCCL 1ND0A 4TSCH 2DAVA 4P99A 3HRZB 2WQ8A 4QHNA 4U7KA 1AR1C 1CD8A 1QQDB 5E6ID 4LU5H 1R0AH 4PJIE 5FYKD 5SX5H 5EZJA 1VGEL 4BFGA 5HVHC 1WTLA 2EYRA 2WP3O 4M7LT 1L7IL 4OZIA 5J1SC 3WSQH 1YEFL 3QEQB 1RK0B 3C2SA 1N59A 4UNTA 5IEKB 5KSUB 2EO9A 1MLCB 5J12B 4ZUUB 3VXRB 2EIZA 5EU6B 3HG1D 3OKOA 3ULVD 1KB9K 1W0YT 3DI3B 3P4LA 4HCRH 5KANI 2V2WA 2OL3A 3Q2CA 5IB5B 1EGJL 3G08B 1N3NA 4XPBL 2HA1A 4PJGE 2E8YA 3LPFA 4KK9D 2YA1A 4GG8B 2KQMA 4XPHL 4JO3H 5BMFH 5DD6A 4GH7B 1DQTA 2R4RL 3BT2L 3SKOA 4PGCA 2QR0B 1I1AA 3H9SD 3RWJA 4FRWA 5BVPH 5FO8A 3MZTA 4HC1A 1BZ9A 2CMRL 4XAKE 5TE6H 1G7LA 4RMWA 3M1BA 4JM2C 3VXUE 4XP1H 2XWJA 3S6CA 1T1ZA 5J9PA 1R3JA 1XCQA 4HKBA 2F5AH 4EI5B 1KGCD 4P4KD 2FHCA 4IRSB 4E41D 1PG7W 1YPZE 2A6IA 5F1IA 2YWZA 4NQVA 1VEOA 1IGYA 3MLXH 3S7GA 3CZJA 3O6LL 4OLWL 5IMMB 1EO5A 4LP5A 4Z0XA 3U4AA 4Z7VE 2M2DA 3EJJX 2FX9L 4FQPA 2VL5A 2P49B 1BZQK 1JF6A 3INUH 5CINL 2H9GB 5GS1B 4XMLL 1MHCB 5A43C 5DHVB 5IQ9A 1HNFA 4NN5C 3B8SA 4CVXB 2W0KA 4ZUSB 2ITDA 5E6YA 1IMHC 2IQAB 3C9NB 5IHZA 4JHWL 5HVHB 1G7PA 5F1NB 1U0QA 3W2DL 2EICA 4PREB 5JW5A 1VHPA 4QGTA 4Z78B 1RJZA 2H2SD 4N0RA 4JDVB 3BN9D 3VXSA 3DX6A 2B0SH 4NGHL 1BD2D 4NC0B 4Q9RH 4XCYB 5I1KH 3CFKB 4MA1C 3IFNH 2NY1D 1PLGL 4OZFB 3EOAB 2DWEB 1L0QA 5DMIH 1OP5H 2J6EH 2BVUA 4S1RH 2GJ6A 2ZOLA 5HGDB 1RZKH 5I15L 4MXWL 5I8OH 5K9KA 4Z5RB 4JR9L 3EBAA 2Z8VC 1CQKA 1MCPL 4C59B 2ADJA 3MMEB 3PL6A 1SJEA 3KXFD 1BFOB 5D7LB 3WO4C 3ULUH 1JF1A 4HK3J 3QEGL 1ORSB 3BIKA 4HWBA 1BGXH 3RKDD 3MRKA 4Q74A 5DMYA 4UT7H 4U1GC 3CZFA 3V8CA 3QXAB 3D9AL 2N1KA 2Q86A 1J9CT 2FLBT 3MGAA 4IJ3B 4WHYG 1JGUH 4NT6B 3RWCB 4OFYD 3W0WD 1WWAX 3NCFB 4JM2B 3SDAD 1KCRH 3VA6A 2FYYA 3T1WA 2RIKA 1T21B 4MNQB 2QKIA 3UJJL 3LH2L 4EDXB 3FT2A 1K5NA 2JJSA 4MA8H 1D9KC 4KXZH 3E6FA 2P8MB 2GITA 4JY4A 4KKNA 1PJ9A 2AV1A 1J1PH 3QUMH 5C70A 4HD9A 3O6ML 4P46A 1JK8A 2BVPA 2FR4A 1OAZH 1CGSL 1EAPB 5FYLH 4R7NB 4HH9B 1JWUA 1S7SB 2HAZA 4PG2A 1AGBA 3IDIA 3FB6B 3CH1A 2FECL 1NEZA 3MRPB 5C0DB 3PP3H 2F58L 3D5OF 3GJEB 2XG4A 3QR2A 4Y16B 4YHIA 3N1PC 1J0JA 1NANI 1FJ1A 1O0VA 5T1KA 1F4XL 4AIZA 2XKNB 4R2GC 5ISZD 3RPIA 2CDFA 3HNSL 4J8RA 2FATL 1QYGL 1KUMA 1JZ7A 3S96B 1UKSA 2ZUSA 1BFVH 4GMSH 1MFDL 3HMXA 5EWIH 2DJ4A 1CD0A 4RNRB 3BUYA 1L7TL 2ICEA 4L4TB 1YN6B 2DN7A 1T7YA 1ZLWH 1IGML 4NRXA 4RAVA 3BVNA 4LIQL 4PJ9B 1GIGH 3L3KA 2NZIA 3UPCA 4JDZA 2BOCA 5F88A 1JPFB 1XF3B 5CUSL 3LS4H 2EYTA 3WO4B 5SWSE 1IBGH 2HTKD 3OKYA 2GK2A 4KZDH 2E3VA 4XP9L 1VSCA 3QDGD 1HHKB 3HAEB 5HHOB 3RBGA 3P2TA 4M4PA 4WEMB 3V0AC 3LKPB 4U1GB 3H9HB 3L5JA 3JV6A 4I48B 1G6RB 2AXFA 4NQXA 1JFMA 2AXGA 2B2XH 3D0LB 1QFWI 1T1WB 1XGPA 2VSCA 1ITBB 1UVQB 4U49A 1F11B 5BXFA 5A2FA 2AEIT 2VXTL 4MLSA 1JHLH 4XGZB 1AJ7H 2HTLC 1OVZA 1OARL 4ETQA 1YEJH 4D3CH 2VKXA 3VXMA 5EC1A 3TF7A 2AVGA 1AO7A 4MA7L 1F45A 5LWYL 2PETA 5DJ2B 3IU3A 1U91A 1UM5L 5E4EB 3MRGA 4ZTPH 5C0RL 2OTUA 2CH8A 3GEWB 1D9KB 3TWCH 1E4XI 4OCWH 1YMMA 3MFFB 1NC2A 4LAQH 4JFPA 2X4NA 3QPXL 4WUUB 6FABH 2HLAA 1Z3GL 4OZ4B 3SE9L 1CDIA 1MQKL 1CI5A 3FQNB 2JF1A 2XNAA 3UO1L 5F7FA 3EUUA 3RBSA 3AREC 4XP5H 4G6KL 5IW6A 1I1AC 4G80A 3HC3L 2BFVL 3V5HA 5F97E 1B0RB 1U8PA 2HJFB 5C0FB 3QHFL 5JZ7C 4JFXB 3UDWA 3WIIL 1QSZA 3GMMA 1DDHB 2ICES 3EFDL 2CRMA 2CR3A 4KU1A 1E4KC 5EOCJ 2EZ0C 3LQAL 1NDGB 4IIQA 5F7LB 2F5BL 4PJ5B 1EEYA 3STBA 1HILB 3IU4L 3QISA 5DJXB 4NO3A 4M7LL 4LCCA 5DK0A 5ADOL