3M17A

Crystal structure of human fcrn with a monomeric peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
263
structure length
263
Chain Sequence
b'LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG receptor FcRn large subunit p51
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 58
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m17A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m17A01
4Y5XC 5CFHA 2GJ6B 2GT9B 2W91A 1I85A 5I1AA 3FT4A 4OF3A 4UNVA 1EJOL 3KDMB 4HIHB 3TNMA 3TNNA 3K80A 5DJ8A 4FN0A 1GVIA 4ONFL 2JB5H 2P5WE 4URTB 2F54D 3F6LA 5C6PB 3GHEH 4MZ2A 2L7JA 4CN1A 1A22B 3RUGA 2YN3A 4HK0A 3MCG1 3OJMB 2QQKL 3VWJB 1MEXL 4X9HA 3R06B 5J3HC 3W9EB 3T1WA 3BPLC 5KBNC 3AY4C 4KQ4L 1WZ1H 3MBXL 4LOUC 4PJXA 5GSVB 3RWCA 1U8QB 4HJJL 3GKWL 4WI4A 2OM5A 2LU7A 4M5ZH 1T2JA 5MP6L 2OTWB 4M48L 4HQQL 4JJ5A 1TVBA 2I9LB 2YC1B 5DEGA 1OTUD 1J88A 1QG3A 5BO1L 3GDBA 1IILE 2EKSB 2O5YL 3MJ8B 1BZ7B 3FB5A 3ARTA 3OKDA 5GXBB 3LKQA 2YN5A 2G5BB 2W92A 1R24B 3BDYL 3FT2A 4KKAD 4FQQA 3B43A 2AK1L 2ZUSA 4M6OL 2W65B 4CVZA 2NNAB 3G5XA 4ESKA 3WIIH 2PYFA 1BREA 5F89B 2G2RA 4ZXBB 1OW0C 4MNQD 1LO0L 2FIKB 1N7MH 1I4FA 1VERA 3D69A 5BV7L 4LSSH 5D2LA 5D1XD 5ERWA 4P5TD 4AENB 2MQCA 5MI0B 4M62L 4EDXA 3B9KC 1MFNA 1Y6KR 3DUHA 5E5RB 2XPGB 3S4SB 4YHYB 1HIMH 3SGDH 4HJGB 3O6MH 4P9HC 4I3SL 5J6GB 3NZHL 4X6FA 2EDOA 3MBEB 2BOBA 5BW7A 4X80H 4X4MA 1YEJH 5JW4R 2VLMD 1UKSA 1VA9A 3JTSA 3KPSB 4NQDB 3WFHA 3MLUL 2WQ8A 1PY9A 1YY9D 4YC2C 1F3JB 1UB6A 1G7QB 3CXHJ 3SJVE 3C8KA 1EEYA 5JW4Q 1QSED 4XCFL 3HE6C 4EZMA 4NOFA 4PJGE 1C12B 2YD8A 4GOSA 3L7FB 1JHLH 2YXFA 2NY4C 2UZXB 3U82B 1U8HB 4LCCA 2VXUL 5D5ME 3VXSD 1D5MA 1ZWIB 2LTQB 1CQYA 2VLLB 3IGAA 3ZZ1A 5BVJA 4GAJL 2OTUB 5MENA 1J0IA 1CT8A 1HI6B 2X4PA 3GMMA 4NJAL 5TJWK 4XX1E 3VFPA 4BUHA 5I1EL 2AEPL 3HC3L 3V6FB 1FYTE 4FQJL 4BZ2L 3OBAA 3EOTL 2IPTH 4Q58C 3H9YA 3FJTA 1YNTB 3GSRB 4XHJD 3SE3A 3TA3A 4C56D 3HTLX 3M8OL 4A6YB 3UCRA 1KIPA 2F54E 3CJJA 2X7LB 3BQUB 4K3DH 1IGCH 3GJFB 1A4KA 3K2UL 5JHLL 3ZL4H 3EO1B 2DOCA 5C0AB 3OKNB 5JDSB 1Q8MA 4L4TA 4HFUH 3WKML 4OIAA 3BFOA 4WEMB 4P3DB 3SCMC 3D6GA 1F8TL 5LBSL 4Y19A 3GZKA 3HR5A 3UTSA 2R69H 3C8HA 3TPUE 1U3HC 3EOYG 3L9RA 5L2KE 5JPNA 5DYOA 1U8NA 1J0ZA 3VE0A 4DWHA 1O5DT 5CEYA 5I8EB 5DK2A 1R3LB 1VFBA 1T1WB 4AM0A 1WIOA 1MF2H 1T7WA 3PXHA 1FFQA 3QUKB 1MPAH 4OTXH 2OMBA 5DEFA 6CGTA 3QXTA 1U93B 3E8UL 4M3KB 5EPMB 1D9KC 3U30C 2KQNA 3LKPB 2P8PA 1WEJH 3KXFA 4KKCD 3VFRB 1R3KB 5I1KH 3ETBF 4NWTL 4LNVA 5HPOA 4U1LA 1H3XA 3GBMH 4WHTB 2YKLH 5GS1B 5IF0B 4UT7H 1QO3A 3MLWL 3HZMA 3SQOH 4QHUB 3HUJF 1AXIB 1XF4A 3SGKC 3CVIL 1HN1A 5L0QC 5IP4A 2ZKHL 1A02N 1NBYA 1VEOA 2CDFA 5C08A 4XH2A 4MNQE 1UACH 3QI9D 5TQ0H 4K94C 2BXYA 4OLUL 3CFJB 4Q0XL 1RK1B 3L5WA 1IT9L 3Q3GB 4DTGH 1HKLH 2VQ1A 3HUJB 4X6EB 1INQB 1J8KA 3X3FH 4NRZA 4KTDL 4J3UA 3NCFB 4KZEL 3QPQC 43CAB 4JQVA 4ZYKB 5A2IH 1KJ3L 2D03L 2G9HA 4O2EB 3RWGA 1NCCL 2Z35A 1DL7L 5DVNA 4OF8A 1GGTA 3R0NA 3D0VB 5ISZD 2VLME 5T3ZD 3L3GA 5FKPB 3VXPB 5IBLC 3BH9B 1BJ1H 4ZS7L 3CDFA 4JFFB 3TFKC 1JGUL 4Z6AT 1OB1A 3W2DH 4PRDA 2IPKA 3KLAB 3LN4B 2R1WA 4FZEL 3ZLQC 2XZQH 3G04A 4WO4A 1MQKL 5C7XH 3HZKB 4K55A 4XPHL 3TP4A 4OV5B 1IGTB 2IQAA 3WXWL 4GMTH 3VXTA 2VDKH 1JNLL 5E2VH 3ARXA 1ZTXL 5ID1A 4QTHB 1QSEE 3N1QC 1NC2D 4APQB 2K7PA 5K59E 4C59B 2JJVA 2EXWC 1BOGA 5HJ3B 1AE6L 3BJLA 3QO1B 1MRDH 3NABL 4R7NA 2Y06L 4LLMA 4Z7QF 5DQJB 1M7DA 2IAMD 1AXSB 4MNGA 5FXCH 3LKNB 4OGXL 4QKXB 4FQIH 2AV7B 3VXSE 3EOBA 1IMHC 1ONQB 3T4AB 1KIRA 3QH3B 5DQDL 4X6DA 5F8QC 3V5HA 4KJWD 1CFVL 3CK0H 4PJCF 2NYYD 5DJZB 1GXEA 4F37F 1MJUH 4MCZA 1F2QA 4M7LL 1Z5LA 5IWLA 4CUCA 2HP4A 1N4XH 3LQZB 4TOYL 4FHBD 3K3QA 4IOIB 4LAQL 1T1YA 3FN0L 1P7QD 4KVCL 2NY0D 1EFXB 4FQXB 2MPAH 1RUQH 4K8RH 4Y4KC 2X1WL 4W81A 3I50H 3QUYC 1C5BH 1GPOH 3PL6C 4PJCB 2VYRE 5FYLD 4CMHB 4CDHA 3TYFA 2WBJA 2X4TB 4LDEB 4YHIB 3WS3A 4RAUB 2QJDA 1PDKA 4JG0L 1J10A 2CKBB 4PRBB 4NQCD 5CJQH 5EU5A 1IC1A 1A1NB 2NY1D 2KUTA 3EYVB 3HRZA 3QDMD 5FFLA 3TO4D 4IRJC 5T1KD 5T3XD 4NM8H 1S9VB 1TJIH 3OKEA 4KUCF 5IMOB 3RZCB 2XFXA 4NYLA 3T08A 3HE7B 1U3ZA 3DYMA 5FYKD 2NXZD 2VZOA 3MOBH 1V7ML 4M1GL 1DBBL 4X0KB 2D7PA 3VWKB 1YEIL 1BLNB 2EYTB 4XPAL 1CGWA 3UJTL 2PXYD 2AXHA 1LQSR 4QRRD 1HYSC 4HKZA 3ULSB 3SJVA 4OZFB 3QDJB 3I6LD 4IDLA 1D5XA 2FIRT 1A9EA 2GHWB 3VI4E 1TDQA 3SDXA 1E0OB 2GSIB 5CWSB 5IMLA 1M71A 1XIWA 3FB7A 1CXHA 4ZFGL 1Q9OB 2CSPA 1RULH 1C16B 1NCDL 4Z0BH 3V6ZA 4CJ0A 3S7GA 2X5PA 1Z3GH 2B8OT 3BZFB 3PABB 3PWNB 2BZDA 4I9WD 5I30H 3KPPA 4XXDA 2WINA 4J3SA 3RJDA 2BSSB 3FZUD 2MCG1 4MA8H 5CHNA 3DX7B 3JXAA 3KNBB 2Y1VA 1CZ8L 4Y1AE 4PGCA 5DD6A 2HT2C 4MCYA 2P5WB 1P4IH 4L8SB 1YC7A 4XBEL 5EO9A 2I24N 3UYRH 4MQ7A 1FYTA 1FE8H 1RZJL 3MV8B 1KJVA 2IALB 3LZFH 2H1PL 4C57C 2D0FA 3QIBA 3N85L 4DEPC 2H2SC 4H5SB 5GISL 3B5HA 4OZ4B 1LP9F 1WSST 4OZHA 5ISZE 1VFMA 4RRPG 3MNVA 4DN3H 4JLRB 1CLCA 1MREL 1T2QH 3RHWK 5EG6C 4HS3A 1QYGL 3Q6FB 2VZ3A 1H3GA 4I48B 4NQVB 5DEZA 1A7OL 5L2KA 4ZO7A 1TQCB 5EUKB 5JXED 1UM6H 5KZCB 3ARFB 2BVOA 4U1HB 1JGVL 2OP4H 3BP4A 5J12B 3T3MF 1LP9B 4NFCA 5L2JB 1KB5B 3OR7A 4G3YL 2A74B 4M5YL 3MO1B 1X6NA 3F7YA 1S9WA 1XGPA 5CP3H 5EU4B 2F5AH 2D7TH 5AG8A 4KWUA 3OAZH 3VW3H 2V2WA 3PHOB 4O2FB 4EQ3A 1RVFL 4JN1L 3PIQA 4JZJB 1LEIB 1D6VH 4P99A 1AKJA 3C8DA 5JHDD 5DA4A 1KPVA 4ORGA 1OWRM 5D6CB 4DUWA 4FQCL 1E4KC 3X13A 4YFEA 3ZKNC 3QXVA 5AWNL 5J9PA 4L8CA 4QTIL 4GRWE 3ARGB 4IDJL 2UWEE 4GMSH 1D5IL 4KTEL 4AT6A 3ULUL 4LIQH 4R4FH 1HILB 3MACL 4XRCB 4DGVL 3KPOB 4LASL 2X4RA 5SX5H 3W0WD 3VI3E 1QLEH 2DI8A 3MRBB 3C08L 1WFTA 2OL3L 5E9DB 1UM4H 5FYLE 3MNWA 1NKOA 3ARBD 4WW2F 5CCKH 4Z7WE 4QHNB 2FBJL 3H0TA 3C60D 2DYPA 4MAYD 4NQCE 3ZSTA 3QCVL 3RWIB 2BVQB 2DQUL 4GRLC 3BVNB 3SKNA 2P49B 1YEEH 3QDME 5T3XE 5E8OA 3BE1L 4D8PB 2KZWA 2Z31A 1V3JA 5KSAD 1T5XA 4XZUA 5FYKE 3WSQL 2APTA 3RNQB 5B4MD 1AC0A 3TIDB 2UY6A 1ZSDA 1QFUH 4L3CB 4OCWH 3T4YB 1KGCD 1KELH 1NBZB 4QRRE 5KVFH 4PLNC 3AS0A 5GS0H 3W9DB 4F9LC 4Z5RB 2CLVB 3IDUA 1CU4L 2X89A 3I6LE 3EDJA 3EO9H 5GRWA 5J1SC 1GGCL 4JG1H 3V5DB 2J6EL 4QT5B 3MRPB 4AYFA 2XXMB 3ES6A 3VFGL 1F6AA 4X7FC 5DJ6B 1NC4D 4NN6B 3X14A 2GK0B 5I8KL 3VH8A 4I9WE 1YMHB 2PW1A 5FA3B 3MZGB 3SBWA 3QIWB 2GY7B 1G7LA 4HKBB 1PY4A 2V2XB 3STBA 3U2SB 5I8OL 3DVGB 2IC2A 2L0DA 1IKNC 4HLZH 4UB0H 1XGQB 2VISB 5IVXE 1L7IH 3RWHB 5A3ID 4HT1L 4C54A 5FF6A 4HIXH 3SGJC 5F9AC 4P2RD 3H2WA 1T66C 1IAII 4OSUH 1HXYB 2Y23A 5BZWB 5C09E 4HUVB 4Q9QL 1IAIL 1JPGB 3ERYA 1CTNA 2XQBL 4KQ3H 1IL1B 3C5ZD 2A6KA 3VFTB 1G84A 1FZKA 3L6FB 1I8LA 3IFLH 4UV4H 2ICEB 4HWUA 2ADIB 4CDGC 5HI4D 3VFWA 3ELAT 1U8PB 1IM3B 1LEGA 4HPYL 1NUDA 4CW1B 1EHAA 4AMKL 4L8BA 1JGEB 2VE6A 3O4OB 3QUZA 4KKLC 3IYLW 4HKXA 1YNKH 1FFOB 4DN4L 3MA7B 4OCMC 1I1FB 1JYVA 3GJEA 2H9GB 2OL3A 4XGZA 5CBEB 4PGDA 1G7PB 3A67L 5DUBB 1MRFH 1YEHH 3JV5A 3PWPD 4XBGB 2YD9A 5GJTL 1RZKH 3UPRB 4NPYB 1AO7B 2MWCA 5JUEH 3PGCA 1T7ZA 2D3VA 4HGWA 3BO8A 3MGTB 3ZTNH 4XVSL 1DLFH 3PQYD 3DV4B 4JFPA 2RBLA 1MOEA 4P48A 5BQ7B 1A3LL 3LV3A 4ZPVA 1H5BB 1RV6X 4QRTA 1J9CT 4BKLA 1UWXH 5I1GH 5GRVK 2OSLB 1S7SB 4HUKB 5JHDE 5HHVL 4HDIA 3CC5A 3KYNA 1X5AA 4K3GA 4Q9BA 5GJSL 1RIUL 3UTTD 4LQ1A 3QDGB 3IJSB 4K8RC 1FSKC 3L5JA 1FZMB 1M7IA 1PSKL 2J6EA 5CSZA 5EOCH 4ZFFB 3W0WE 3O2DH 3DTXA 4GKOA 2JELL 5GRYA 4Y1AA 3TJHD 2AJXL 2HRLA 3P77A 2Y36L 2Y72A 4LHUG 3C9NB 3QUXB 4JO4H 5ICZB 2CIIB 3GSXB 4G43A 2BJML 3U46A 3B2VH 3HC4L 4RFEB 1CFTA 4HF5H 2DL2A 2EXYD 4L3EB 4PJ8B 5EFIA 5L9DH 3WFEH 4WGWB 5FGRA 5DUPL 3UO1L 3BN9D 3SO3B 2QHRH 1NCAL 3CSYB 4N9GB 3O11A 3WNLA 4RISL 1KGCE 2DQIL 1MFEL 1FNSL 3IDMA 5KVGL 5EO0A 4PREA 4P23A 1B0WA 3CNKA 2FX7H 4QHMA 1OSZB 4LF3B 4O2CA 3NN8B 1SEQH 4NZDA 3ZDYF 1YYLL 4XAWH 2DWEA 4WY7H 1FPTL 4GSDL 4OLXL 1S7VB 1JYWA 1ZANH 1OSPH 3FQWA 4UV7H 1S8DB 3ARDB 2H6PB 3FQTA 4ODTH 5HYSG 1TJGL 2KZ1B 5ICYB 4TUKL 4JKPH 7FABH 3BSZL 4NN5B 5C0CB 4U1NB 5F9OL 3DO7A 4C56B 4RGOL 5DHYA 1ZHBA 3JV4A 1J18A 4QRPD 3RWDA 3IKCA 3D39B 5FECA 3A6CH 1U8JB 4P2RE 2JJWA 4O00A 3VXQB 2YK1L 4Y2DD 4PP2B 1T3FB 1C08B 3WLWD 4ZNEA 4ZUTB 1LK2A 4TNVK 5K9OA 4KK8D 5A16A 2ZSWB 1UQSA 1MHPL 4PJDF 3AS2A 1FL5B 2X2YA 4MSWA 3MV7D 5DD3H 2BXZA 2X09A 5BZDB 4PLKD 3AREA 5IBTH 5F6HI 1PYWA 2PO6C 4LVOB 4NBXB 15C8L 3QWOA 4OQTL 1KCLA 1P6AB 2ZSVA 3V52H 2GAZB 4NKDA 2CPCA 5DVKA 1DBMH 1IAIM 5CJXC 2UYLA 4GUPA 5F7UA 3BKCL 3PQYE 1KTLA 1OL0A 3HMWH 4PJDB 3OKOB 1CDJA 3HI1A 1CICA 4PFEA 2PXYA 4JFXB 5DR5L 2BNUA 4YHPA 4LCYA 3D18A 1KBGL 3P9LA 5C8JB 3O3AA 1D7FA 1UM5H 3DIFA 1VGEH 4QWWD 2KDGA 1NQBA 2HWZL 1AFVH 4W6YB 5ACLA 3P11H 2MTPA 1WAAE 4M1DL 2DTMH 1MH5B 3ARYA 3QPXL 2CLRA 4Z78A 3UTTE 4QGTA 2HKFH 4LSDA 4MWFB 2EIEA 3G6DH 4UDTA 4XVJH 1OQXA 5F7NC 1BM3H 2DLEA 5FCUL 4KFZC 1KTDB 1P1ZB 3JV6B 2WBWB 1ACYH 5DS8A 2EDHA 4RA0C 5BRZA 3WJJC 5C0DB 3UBXA 4HV8B 3TVMD 4LLWB 2DBLL 4DZBA 4PJIB 4Y4HA 4JQIL 2DKUA 1Q0YH 3F7VA 2VN7A 2FSEB 5C09A 3CU1A 2P42B 1MSPA 1A6UH 3LPFA 1S9YB 4X5XA 3BRGC 3HC0B 1ZA3B 5FGCB 4PBVC 3P9MA 3PDOA 1OD9A 1QFWI 2XYCA 4I3GA 1QFWL 2Q7YA 4P2QA 4JFED 1XCQA 4PP1D 5GS0C 1ZLVH 4GRMA 4ONGH 5IHZA 5D6DC 2J5LB 4DVBA 5ILTH 4XI5C 5IMKB 4KAQL 4N8VG 2BOCB 4Z18A 3FMGH 1EGJH 1KUMA 1YQVH 5IB4A 3PWJA 4DCQB 3ZE0E 1OP5H 3S88L 5F1SA 3CLEL 4MA7H 5EC1A 3M1BA 1FJ1B 2IAMB 1CGXA 2NXYC 3RVUD 3IS1X 4WTXA 2AK4D 4JR9L 2DWDB 3U9PH 2R4RL 2NY3B 1JWUB 3FCTB 1AD0A 1QBBA 2BC4B 4HUWB 5DMKB 1A3RH 1DP0A 5GGQH 1HXMB 4TVPL 5IW6A 3SE4A 2E9BA 3TN0D 2A2QT 4YHNB 2C3XA 5ICXA 3O3DB 3BKYL 4IHOB 4MJ6B 1E4JA 1JFQL 1U8OB 1F4AA 4NQTA 4ZUWA 1DQMH 4U1SA 5D1ZA 4QRPE 2JB6A 3AUVA 4JPVL 4NRYB 1LD9B 2FATL 3I75A 3GNMH 5SWSD 4HPOL 4ODWB 5GRUL 1X5YA 3GUTB 2W0FB 1DANU 4YXKL 1NDMA 4KI1A 4ZUUB 2BSRB 3PE9A 3TLRA 5I9QC 4A6YH 4FQLL 1E27A 1X5JA 2R4SH 3LDBB 4NQUA 4Z7WB 1IGFL 3IDGA 3DMMD 1NFDA 3GJFH 3L3IB 3MV7E 4JPKL 5TE6L 5J06A 2HVJB 4PD4J 4WI2A 5I1HL 3UJIH 4KROD 3VMNA 1RZKC 2F5BH 4MAYA 1NFKA 3QDMB 4ZD3H 3O41B 4PGJA 4ODXB 1L0XA 3DGGB 3O6FB 1KEML 2NXZB 3QG6A 2DLHA 4GLRI 4PJ7E 5I17B 1SJHB 4IOFC 4HUMB 2X1PA 4JKLA 3HCVB 4LSVL 4YDIL 1MCPH 5EU7E 4H88H 3ZKQD 1IQWL 3UX9B 3BW9B 2FR4B 2HJLA 4PJAB 3SY0B 1LO2L 4DZ8B 4KK6C 1ORQA 1GHFL 4I0PD 2VN4A 4S0SD 2DF3A 5TDPB 4I18C 3S3PA 3BP5A 2HJKB 1BFOA 1T21B 2VKXA 5D7JA 2DI7A 4V3EB 4M4PA 3Q1SL 2W60B 3VXMD 1HHIA 3FQRB 5LWYL 1QFPA 2ORBL 5IVNA 2G5RA 4WUUA 1JWMA 1S7TA 2E3VA 5TE7H 5IVXB 1ZLWK 3QNXB 4YHKH 1BWWA 1IGJB 5DI8B 3T2QA 5CGMA 1KCVL 5AUMA 1GGIH 4OFVA 1IGYB 4WENB 3WO4B 1P69B 4FZ8L 2C7UA 1FRGL 2CR3A 3QZWB 3GSQA 3QISA 1RJLA 2C1PB 2XKSA 2GIYA 4R4NC 5FOBB 2BDNL 4EEEA 5DD0H 3FONB 4OJFL 4OI7A 4NIKB 2PKDA 2CD0A 3O3BB 4XCCL 3GIZL 1RI8A 4JFEE 1N3NB 1GGYA 2NY5H 1BJMA 3VCLB 1AQKL 5JO5A 5FGSA 1A8JH 1XFPA 4R8WL 4RIRA 4G6JL 4QCIB 1XR9A 4JRWA 5IBUB 1UJTA 5E00B 2VDMH 3KYKL 2HVKB 3LEVH 3NCJH 1EHXA 5J3HD 2FX9H 4HUUA 1MAKA 4FQ1H 3I2CH 1T83A 4FXKB 5D8JL 1T03L 2AK4E 5E2UH 3BISA 3SDYH 5T1DH 1H8SA 4TTDC 4LOUD 5E8EB 4LDOB 3I6KB 2ZCKH 5E0QA 4F58L 4UQ3A 5IQ9A 4MB5A 1QFWM 1W8NA 1QLFB 5CILH 3GGWA 1I1AC 2CKNA 1JE6A 4JY4A 1J5OL 3QQ4A 4ZAKC 5EWIH 3DPBA 4Z9KB 2Q8AH 2ICES 4O5LL 5T5FL 4LHUD 3QO0B 2ADGA 2B5IC 1JJUA 1Z9SA 1R0AL 4QRSA 1NGZA 3T2PA 1IEAB 2EZ0C 3QA3A 3KYMA 3W0WB 2J8UE 5SWSE 3CLFL 1FBIH 6FABH 5ITFA 3MRJB 5IKCA 5I71B 4RDQF 3T77B 5TH2B 2J1KA 1KC5L 3V6OC 1U91B 4DKEH 3AU1B 1T0NA 1RU9L 1FG2A 1MCFA 3C60B 1ZHNB 4LK4A 2Y7QB 1CE1H 4YPJA 4K3HA 4JFZL 2BNQD 3E2HC 1QKZL 1OTSD 3MCLH 1IGIH 2EE6A 3WXVL 4NKOA 1LK3H 5ANMA 3DI3B 1IE5A 1A6PA 1NDGB 2GITB 2NY2B 4G5ZL 4LVEA 5IHBA 4OCXL 5FKAA 2CKBH 4F33A 2J88H 1QLRA 3NA9H 4X4ZA 32C2A 2YRLA 4E41B 2JIXA 3MGOA 4WHCA 2R29L 2VAAA 4O4YH 3RPIB 1GIGH 1B90A 1T89A 4U31A 4ZOBA 1MWAL 2FJFA 1A6WL 3MCKB 3LIZL 4PRIA 5JW5B 3UTQA 4OUUA 3F58L 2FHFA 3BKMH 3STZA 4PB0L 3O2WL 1MJ8L 5BOZG 1BIIB 2CDEA 1TVHA 3KLDA 1UZ6F 1O0VA 4GW1B 2PR4H 3VXME 4MZ3A 5TE4L 4Q97A 4AEHL 5KSBF 2EEDA 3MREA 1J87A 4XNYH 1DSFL 5HDBE 2M2DA 3HE6D 4ZXBC 2C26A 1NMAL 4QRUB 1MFAL 3QUML 4I2XB 3O3EA 5L7XL 2Y07L 3P4MB 2VR5A 3S35H 4JPIB 4N68A 2NY4D 3RGVA 5MI0C 2XKNA 1KXQE 2NCMA 1BWMA 1EXUB 2ED8A 3KS0J 1AGFA 5HHNA 5KSBB 4YHYC 3V7AG 1HHJB 1RUPH 5C0JB 3DRTA 1KPUB 4TULH 3MBEC 3TBWB 1QQDB 1BHGA 2DLFL 3EIFA 4NT6A 3WIHH 1U3YA 2ZG2A 5HHQB 3PNWB 3PWPB 1CLYL 1VKXB 2W9DH 3GBLA 3RUGF 2GUOA 2VAJA 3B3IA 4LPCA 2EDXA 2QQLL 5I1AB 4CADA 3FT4B 4PJ7A 3BPNB 1L0QA 3PV6A 3SCMD 1NSNL 2R56H 3TNNB 4M7KL 5DJ8B 4NWUL 5DRNA 3MJ9H 4GBXC 1AI1L 2XZZA 4K7PL 4PJXF 1U3HD 4R26H 1UA6H 1HSAB 3GEWB 3QJHB 2R0KL 5JZ7C 1KB5H 4NHUE 2D7OA 1EAPA 5E4IA 3CCHA 2LTQC 1NGPH 1VGKA 1X44A 3VXRA 1D9KD 1TFHA 3N9GH 5FO9A 5D4QA 1A21A 4PJXB 3RWCB 5ITBL 1G7MB 3P73B 4HXAH 4YR6A 5DGQA 1A6TA 1X5ZA 4H20L 4MQSB 4BK4A 4MJ5A 3C87A 3HA0A 4Z7VB 4MS8C 5FK9A 1VEPA 2A77L 3NIDF 5B39G 3JWOC 1RMFH 4JJ5B 1CFNA 4H1LA 1TVBB 3LS4L 3IJYA 2DI9A 2H41A 1WC7A 2YA1A 1G1YA 4NQXA 3QUMA 1DLHA 4CU7A 4BH7A 2BNQE 1KENL 3ZMRA 5L8KB 5D2LF 1IZKA 3T0WA 2N7BA 3MJ6A 3OKDB 2XNAA 3LKQB 1QRND 3FT2B 4FQQB 2AERT 3IXAA 1HQ4B 4CVZB 1KB9J 4OLWL 3KG5A 4LARL 2VZ1A 1QHOA 3DYOA 2G2RB 4DW2L 1TNNA 4PJ9A 2Q1EA 1MQ8A 3EO0A 2D9CA 2W1NA 5J11B 4YHOL 4Z77A 2HT3C 2EDYA 4CN4A 2YUWA 5KW9L 1I4FB 1ZLSH 1KEGH 2D7NA 5HHXH 5F96H 5GRVL 5ERWB 4DKFL 4FP8L 5EULV 3TFKD 2KBGA 5GS1C 3T3PF 3K2MC 5GGVY 4E0RB 3SKJL 1NCWL 3CDGB 4JY6A 4DVRL 1MJJB 1MHHA 2BMKA 4U05A 3HAEA 1Z2KA 2VMFA 4L4VA 4X6FB 2BOBB 3UZEA 4N0UA 1Z9OA 5C6WH 2EXWD 1DQDL 3TBVB 3GMNA 4RBPH 1GSMA 4NUJA 3WFHB 5FEBA 5HHOA 3SN6N 1WCQA 3A6BH 1MFBL 3EFFA 1N0XL 4ODUA 5DJCA 3O6LL 1HHKA 1H3PH 2XIDA 4OD2A 4PV9A 2E7LA 3QNZA 4OZGE 2F58L 3C8KB 1J12A 3B8YA 2XT1B 4J23A 4FFWC 4NQED 3HNSH 2NY5C 4DK6A 3QCTH 1FC1A 1RUKL 1CR9L 5FV1L 4Y5VA 4KPHH 1NAMH 5LXGL 4LCCB 4HXBL 1D5MB 4OZIA 1IAKA 3IGAB 3IU4L 3IS0X 5HI3C 5SX4H 4Y4KD 4Y2OA 5MENB 3IDXL 3SE8H 4AIZA 1CT8B 2X4PB 3GMMB 3QUYD 3PL6D 3Q0HA 3VFPB 4K3EL 2COQA 4LL9A 4APQC 2CDGA 3OGCA 3WFDL 3GSOA 3KYOA 3HNVH 5EUOA 4X9IA 5CUSH 3NTCH 1VENA 1A4KB 5DURB 1PX3A 4HUXA 4DFHA 4FABL 3CFKA 4M6NH 1IKFL 3TBTA 3LD8B 2GTZA 2PN5A 1EA9C 1G9MH 4KHTH 3NOIA 4Y19B 1XT5A 5CEZL 4LSUH 1JNNL 3HR5B 5E95B 3OR6A 1PAMA 4PRPA 1UG9A 1SJEA 2B39A 4LRIA 3UYOD 4U3HA 5JPMB 1HYSD 5F97E 1XCTA 5DYOB 5JPNB 1U8NB 3VE0B 3X11A 4TSBL 1DVFA 2Y9RT 5CEYB 3EZ8A 5E2TH 4FQXC 1VFBB 4XC3H 3WEXA 4GKNB 3TVMB 3IFOA 3DVNA 3MXVH 1WJ3A 4JHWL 1JPTL 5DEFB 3CPLA 4OIIH 3VFOA 4CVWA 2Z8WC 5TDOB 3KXFB 3RBGA 4CMHC 1SBSL 1QEWA 4HLJA 4U1LB 1ZLUH 3NH7H 1F00I 4X99A 5DMIH 2IANA 2C1OB 4LCWE 3V4VH 3BT2L 1QO3B 1QRNE 4KV5F 2HT2D 3HZMB 3ZDZF 2O5ZL 4WV1B 4JFDA 3FOMA 1XF4B 4PJHA 3RZCC 2QSCH 5IT2L 1KLGB 4IIQC 4J7RA 1CFQB 4XWGH 1NBYB 2CK0L 2CDFB 4FXLA 4PG2A 3ZDXE 2H2SD 5C08B 4OCRH 4XH2B 3VWKC 4AY0A 3CDYA 4R7DA 1HNFA 4G80A 4OCLC 5L8LB 1OY3B 3L5WB 1P7KA 4M61A 3MRIA 3WHXA 1M1SA 2Y6SC 2VQ1B 1VSCA 4LVHB 2XRAL 4L8DA 2KH2B 4NGHH 1KN2H 1IM9D 4MXWL 4NRZB 2R2HA 5CD5C 1QOKA 3KPQA 4U6YB 3UC0L 3TN0B 4ZSOA 1BFSA 5T5NF 5IQ7H 3MQIA 3RWGB 2P24A 5BOPA 2Z35B 1DBJL 1ZK9A 4HK3J 2OCFD 5FYJH 1RJYA 2V2TA 4YAQA 5I74B 5TF1H 3L3GB 5CMAB 1F6LL 4ZTOL 3IAQA 3ZKXB 4D0BB 2NPLX 3TC9A 4PRDB 2IPKB 4PPTA 1V7NL 1YNLH 3G04B 3I6GA 2J8UB 4XP1H 2WM0A 3EJZC 3FRPA 1A64A 1ITBB 3IDNA 2JJSC 2Z8VC 1A1MA 2XWBA 5ID1B 4GAFB 4X6DF 4KDTA 1KJ2B 1U8IA 3RWFA 4NQEE 1IC4H 1A3QA 3H3BC 3SDCA 1BOGB 4X7TA 2E27L 2P48B 3ZKND 2JJTA 2ESVA 1MFCL 4KROB 4R7NB 4LLMB 1Y18B 1M7DB 1G7JA 4G7YL 3LOWA 4MNGB 5C0BD 3MR9A 3DWTA 4HLZG 1K8DA 3TF7C 4NZRH 3J8F7 4AH2A 1WBXA 2VLRD 3EBAA 5D70L 5CD3A 1C7TA 1R5WA 1FCGA 1ADQL 1KIRB 4X6DB 4LLUB 3V5HB 3NCMA 3SDAA 1TQCC 2I5YH 4XBPA 4XP9L 4WI6A 4ISVB 4YEEA 5J12C 5IIEB 1K9TA 2ADJB 3B9KA 1DTUA 1F90L 4XCNB 4FFYH 1S7WA 4HIEA 1JPFA 3LH2L 4OKVA 1SM3H 4BA8A 2ZUQB 4YZFF 4F7PA 1MJ7L 4WU5A 2OJEA 3NIFE 4I0PB 4GRLD 2AJUL 4YLQT 2YA2A 1NGYA 2VQUA 3MUZ1 4Y5YB 4JZJC 1PLGH 5HYJD 1INDL 4ODSH 5I0DA 4NO0D 1AY1H 4FFEX 4ZQKB 5C0NC 2CK2A 4AEFA 4U1MA 1J0YA 1HDMB 3VXMB 1MAMH 2WBJB 1JHKL 5TFSL 3TYFB 4YQXL 2FJHA 1P7HL 3WS3B 3ZYIA 3D48R 1I8IB 2OR9H 1DBKH 1ED3A 5EU5B 3P0YL 5DQ9A 3OZ9H 1M7XA 5ADOL 3OKKA 4XAKD 3HRZB 1K4DA 3SDXF 1K6QH 3OKEB 4OGAC 4IRSD 4MA1B 4HH9A 4RQQA 2WIIA 3BHBA 4NSKB 4PD4K 1A7QH 2YWYA 3N1MC 3BPCA 1YEDB 3U7WL 1HHGA 4Z95H 1GOHA 4DAGL 1U0QA 1F4YH 1TLKA 4Y5XB 4KZDH 5J56B 4C4KO 1QPXA 4NNYA 4HKZB 4AEIH 3HR6A 1MLBA 1D5XB 2CJUH 1MCWW 5F88A 4YWGL 4HBCL 1Q9WA 1YMMD 3AM8C 5IMLB 1M71B 4I0CC 3MOQA 2OZ4H 2BCKA 3PHSA 3ME0A 2IGFL 5HDQH 1XIWB 2FD6H 3FB7B 3WUWG 4AZ8A 5GGVH 4XMLH 5IFAH 1T66D 5T3ZH 3CU7A 3V6ZB 3PDDA 3UMTA 3VDCA 2WWKO 3TYGL 4QXUL 4WW2C 4XXDB 4NP4L 2WINB 4XTRC 1JZ6A 4JO3L 2ARJA 1DUYA 1LO3L 3SPVA 1CL7I 3HG1A 4PGCB 5DD6B 5FM5M 1QSFA 2G60L 5IROC 2XN9A 4GAGL 4PRAA 5EO9B 4GAYB 1GAFH 4MQ7B 3G9VA 1BIHA 3MRRA 1G6RH 1ADQA 4XT1C 5INCA 5SWZD 3PP3H 2AJ3B 4XP5H 1LWRA 4P9ML 4NN6C 5E2JA 3UJJH 1X5GA 5I16A 3QIWC 4OZHB 2FO4A 4OAWA 3MNVB 1Y0LA 2WUCH 4HS3B 1WZKA 4KMTL 4JRYA 1BQHA 4OM1L 2NY6B 2OLDA 2F74A 3MA9H 4MDIB 3FO9A 1OVZA 4B50A 3MUGA 4OCYL 3P3YA 1BVZA 3GHEL 4FTVA 4CMMA 1YYMH 5EZOH 1W0VB 5HHMD 2N4IA 2P4AB 2Z0BA 3BP4B 4GG6E 2HN7A 1BFTA 3OR7B 4N0CC 3S98A 3MYJA 1S9WB 1XGPB 3EJJX 2HG5A 4K8RD 3HPJA 4JO1H 1A0QH 1G9NH 1GZPA 3O4OC 2O26U 2V2WB 4PS4H 1FFPA 4TQEL 3R8BB 5IJKA 1FORH 3PIQB 4GO6B 2VC2H 3SOBH 2VLRE 1NMBH 4W6XB 3H3PH 4EN3A 2C3GA 1CGYA 1KPVB 4LCWA 1RZ8A 1B4RA 3O6KH 4ORGB 4G6KH 3BDBA 1OP9A 2AJSH 4JN2A 2NX5D 3X13B 5J9PB 4L8CB 1RFDL 4MAUH 4J6RL 1YPZE 4HW6A 3RVXC 5HYSB 2HFFA 1TITA 5I8CA 2ATKA 4AT6B 4V2CB 1UH4A 2BVEA 2X4OA 3KPMA 1G9MC 5AEAA 5LGHH 2X4RB 3MXWL 2YSSB 3T2NL 5HYJE 1OPGH 4GS7B 5D1QA 4QY8A 4GQ9H 1CVRA 4KKBC 1ZS8A 3ZKMC 4P4KA 1DEDA 4S1QL 4X98A 1NL0H 3WIIL 4BSJA 3H0TB 5DWUL 3RTQA 2DYPB 2VQTA 4LRNH 3UP1A 5D7LA 3V7AE 4D9QD 5DLMH 5SWQA 2AGJH 1X5FA 1N7ML 4XPFH 4XAKE 1CDCA 3RGHA 3VMPA 3TO2B 5E8OB 4MMXC 3N1PC 1SEBA 4M8QA 2Z31B 4E42B 3WCYA 4JRXD 1T5XB 3NACH 4XZUB 4U6HA 3VRJA 4QOKD 2A1WL 3LHPL 2R1YA 1PVHA 5H37H 2Q6WA 3UDWC 1MRCH 1HIML 4PB9L 2OYPA 1CBVL 1NFIA 2CIKA 3QUXC 3L7EB 4W70A 4X6CA 1EO5A 3DX9A 4OIBA 1YMME 1KG0B 1UT9A 3CFEA 4JAMB 4EVNB 2Q76A 1PZUB 3V0WH 5GIRB 4PJ8C 4GXVH 5J1AA 1F6AB 3TH2T 4EOWH 3X14B 1M6OA 1FIGL 5I76A 3SO3C 3BGMB 2PW1B 1F97A 3IETA 1TCMA 4PRHD 1G7LB 4LLAA 2NW2A 5CAYB 3ULUF 1XH3A 2FLBT 1U3HB 2CR6A 3LSOA 1JHLL 5FF6B 5CKGA 5FA4A 4GKSA 2PO6D 5SWZE 4JHBA 1WFUA 3QIUD 5JW3H 3DSFH 1I3GH 1BZ9A 4LKCA 3Q2CA 3ARDC 4IRJA 3OB8A 4LQFH 3VFWB 4NNPH 1GC1L 5GS3A 1SVCP 1LEGB 3B9EA 3WHE0 3P30H 4NN5C 2VE6B 1Q9LA 1AXTH 4Z7UE 3QUZB 4HKXB 5IUSA 4QXGH 1TMCA 1B9ZA 5CJOH 3U4EA 1T6WA 4U7SA 1PEWA 3LVEA 2QSQA 1HZHH 3GJEB 2OL3B 3GMQA 4XGZB 4PGDB 3T0EA 5DJYB 1IGCL 5I19H 2XY2A 1AQDA 1WFOA 5DVLA 5HHME 3ZL4L 3QHFH 4R6UA 4JCMA 3PGCB 1FV1B 2DM2A 3BO8B 7CGTA 4RMSA 5IB2A 2VDQL 5E08L 1U92A 3QEQE 2IFFH 1IEBA 3QCUH 5BS0D 2R69L 3T0BA 1UB5A 3I85A 3WN5C 2WUBL 4QRTB 4BKLB 1RUAL 3WJLC 1JWSA 4LVOC 1MCSA 3FL7A 2AABH 5C0IA 2OI9A 4N8CH 1MPAL 2NX5E 3BX7C 3WL9A 3I02B 3E3QC 1WEJL 1M7IB 1Z0NA 5E5MB 1FVCA 2ZJSH 4XP4L 5FUOL 1OP5K 2FEEI 3O4LD 5ESAA 4LEOA 2FEEL 2YPLE 2YKLL 4RGMB 1T7XA 3V5KB 4JB9H 5J7CC 5GS0D 4J4PC 1P53A 3L95A 1MI5D 3S6CA 4XI5D 5C07D 1X4YA 2DQFA 1HKFA 4D9QE 1BBJA 1HH9A 4G43B 4HK3N 3U46B 1UACL 4TUJA 1A7RH 3INUL 5EOQL 1CFTB 2A9NH 3O8XD 3GMRA 4NFBA 4PGZA 2WQRA 4EUPA 5EIQA 4S1RL 5FDWA 3NCBB 5F7EL 5EFIB 3LRSA 4JRXE 1HKLL 1G7HA 2NXYD 3V0AC 5CBAA 1EAJA 3SKUD 1TZGH 2A6DB 4PJBA 4QOKE 4XNUH 5L88H 1ACZA 3O11B 5KAQF 2GW5A 4U49A 3FQUA 1CE6A 3ZO0A 3IDMB 4PREB 4F2MA 2BY0A 1S7RB 4WI5A 4QHMB 1KB9K 4GG6A 1AHWA 4AG4L 4JGUA 1J05A 4O2CB 3GJFK 1RZ7H 4G9FA 3MLXL 4RWYH 3S37H 2DWEB 3W2DL 2APBA 2ZUVA 2XZQL 5DZNA 3VFMB 4J3WA 1VB9A 3FQTB 4G8GA 2J5LC 4PRHE 3QHTC 4GMTL 1CQKA 4U0QB 3PGFL 1CXEA 4PJFA 5E2VL 4D9LH 5CS7A 3VI3F 3MLYH 3PV7A 3DO7B 1S7XA 1XGUA 2ZUTA 5T1LA 5DHYB 1ZHBB 1MHEA 3JV4B 2EH7H 3RWDB 1WWBX 5IMMA 4PJ5A 2DN7A 1FO0L 2IAMC 3L1OH 3S34H 1MCNA 1WWCA 1KCRH 3DX8B 4JM2A 4NKIL 2IQ9H 4MDJA 2NY3C 3VXUA 4K2UH 5K9OB 3DOSA 4IOFD 1WT5C 5A16B 4X7DC 3CK0L 1UQSB 2PETA 1MJUL 3K4AA 4MSWB 3WUZA 1KACB 1N4XL 4R90L 1SY6H 3AREB 4KVNH 1PYWB 5K9KA 1NJ9B 5C9KA 1OP3K 4KK6D 4W4OC 1OGAD 1FGVH 4J8RA 3QWOB 2R0LH 1W0YT 2ZSVB 4OFPA 3IT8D 3QFJD 1G9NC 4LIQE 1FNLA 1GPOL 2AAVA 4GUPB 1KTLB 5D93B 1QUNA 5GGRB 1EHLH 3LDBC 4LGRB 3HI1B 3MROB 5BS0E 1CICB 2CRIA 5BVPH 4YHPB 5JXAL 2OQJA 1IFHH 4LCYB 3D18B 3P9LB 3WNPA 3O3AB 5D7IB 1I7RA 2APWA 2LV4A 5DRZA 2OJZL 2A83A 2H3NA 1JP5A 3O6FC 2K9UA 4UQ2A 4YDLB 1S9XA 2X70A 4HS8H 4Z78B 2VLKD 5DJ0A 4LP5A 3GHBL 3ARPA 2V9RA 2GJZA 4UDTB 2YD1A 4OLYH 4K07A 4R4ND 3O4LE 3FO0H 3BEVB 2ITCB 1RZFH 5FGBC 4S11A 4HWZA 3H9SD 1RIVH 5DS8B 1OAZL 3K7UA 4YHZH 1JYXA 5BRZB 3U9UB 3UBXB 2VXSL 3O0RH 3HHRB 1MI5E 2JKXA 3E6HB 1RULL 1HHHA 4Y4HB 3F7VB 2FYYA 1EO8L 3EKCA 5H35A 1XF2A 2EE2A 2RFXA 3N0PB 3TWCL 4L9DA 43C9B 5I30L 2EIZA 2GJJA 5E1AB 4X5XB 4MA8L 3WNKA 1FO0A 2IADA 3P9MB 3PDOB 2ZUYA 1RD6A 3NZ8A 4PTUA 2Q7YB 3HZYA 4P2QB 4Y8AA 1FL6A 4TTDD 4Z7UA 2E6JA 2VRAA 5IHZB 1MELA 4ONFH 1ZGLM 3LZFL 3BH8B 1SHMA 3WO4C 4NZTH 2X05A 5GZOC 3KPRD 4ZODA 1I1AD 1CD1B 5A1AA 1XR8B 3PWJB 4IM8A 4MJID 1F3RB 4QHKI 4Y8DC 4ZAKD 2HJFA 2GJ6D 1HQRA 4OZFG 5EC1B 3GMLA 4DN3L 4KJQC 1JHTA 3TCLA 3M1BB 3ROLA 3BI9X 5C0BB 3QEQA 1UVQA 1U9KA 1A6VH 4JDTL 4MJ4A 1U6AH 5DJDA 2EZ0D 3U0PA 1T6VN 4HULB 4KQ4H 3QJFA 1P5VA 3MBXH 3MRNA 3S3SA 5IW6B 2XZAL 4HJJH 1CD8A 1UCBH 2N56A 2ZWLT 4RAVA 1UM6L 5DMJB 2FL5A 4DFIA 2OP4L 4X83A 4PLOB 2R8SH 4P2OC 5GGUB 1RZIA 4QXTA 5HGAB 1NFDF 1KLFA 2NX5A 4U1SB 4YBLC 5CP7A 2ICWI 5D1ZB 3MPCA 4M48H 5MP6H 2F5AL 2D7TL 4MNHA 2APVA 5F3HA 3VW3L 2JB6B 3EW3B 4L5FH 3THMH 4F9PC 3I75B 5BO1H 4NO0B 5JOFA 1OCWL 1H0DA 2H8PA 5JDJA 2YPLA 2ENSA 1NDMB 4JKMA 2DQTH 1E27B 1UCTA 1PKOA 3D85A 4ODBD 3BDYH 3IDGB 1MNUH 1JZ4A 2AK1H 3MMEB 2AQ1A 4N5UA 4PV8A 3UAJC 1MHCA 1M4KA 4GMSL 5F6HJ 3L3KA 4LIQL 4R4FL 3TJEH 2NTSP 1S3KL 1OGAE 4ZO9A 4IRSB 1LO0H 1A47A 4PJEE 5JQ6L 3QG6B 5I71C 3QFJE 3CD4A 2F53A 2F8VA 3FT3A 3CZFA 2CUIA 4TSCH 4OF6A 3SDDA 5CCKL 3AGVA 2PTTA 3KJ6H 3C60C 2XWTA 5LQBL 2HJLB 3G6JE 4BQ9A 1WUNT 2HKHL 1MCLA 3ROOA 3IXTB 1XZ0A 1ORQB 4ZXBD 2C3HA 3NZHH 3GMOA 4RNRA 3G5ZA 1BD2A 4R96A 1T7YA 3LEXA 3S5LA 5FHBL 4OGYH 4OQ1A 2NY2C 1YDPA 4JQXC 1AD9B 2VLKE 4PG9A 5LVEA 5D96B 1QVOB 1HHIB 2BERA 4ELME 1QFUL 5JTWA 1KELL 1BF2A 2VH5H 4WUUB 2V6HA 5KVFL 1JWMB 2R15A 1S7TB 5K9JL 2IG2H 1HOCA 3MBED 3H9SE 4JG1L 4XPGL 3OG6B 2DQJH 2DKSA 5AUMB 5E6IA 3KPSD 4NQDD 5F9WB 4WEBL 3MNZA 4OFYA 4EI5A 3GSQB 4NZUL 3NIGF 5DD1L 1JZ2A 2H26B 3BZ4B 4I1NB 4B41A 2VXUH 4X4XA 5CP3A 1ODAA 2ICWA 4UB0L 3MLSL 4GAJH 1YN6B 2QV2A 2X44D 1L7IL 4NJAH 2EO1A 5ENWB 1HEZA 1KV3A 4GBXD 4BZ2H 4FQJH 3EOTH 3ARZA 5JO5B 3IVKA 5ACMA 2CXKA 3M8OH 1Z0MA 2DLTA 5JZ7D 5HHMB 3OPZH 1AH1A 4RIRB 4V1DE 2EYSA 3IFLL 1JRHI 3JUZA 5EBMA 5JHLH 2GJ6E 2Z91A 4CNIB 2EKJA 4WWKA 1MY7A 4M3JA 1GGUA 5ECJE 4S1SL 5JIPA 5DFWH 4Q6IC 1Q94A 3GI9H 5LBSH 3MLTA 4O58L 4HH8A 3KR3L 1YA5A 1KJ2H 2P8LA 2AV1B 2P44B 4UQ3B 5IQ9B 3IAPA 3EYUH 3P0VL 3GGWB 3V6OE 2XXCB 4MS8D 2FEDC 4KH2A 3VGDA 4QEGA 1W2KT 3GMPA 1RZKL 3KYAA 3H6JA 4X5WB 1I85C 3ZTNL 1E4XL 2P7TA 3RBSA 3EGSA 2F15A 3BPNC 2ADGB 2IPUK 1ZVSB 5DRXA 3E8UH 4QRSB 1NGZB 4H8WH 3TM6A 3DGCR 2ARJQ 2ARWA 3QA3B 4Y7MA 3KYMB 4NWTH 4PP8C 2IMMA 5I1GL 5IKCB 3OTTA 1TQBB 4Z7OE 1IC5H 5DJ2A 2Z92A 4JO2H 3WLBA 3MLWH 1A5FL 1T0NB 2GFBA 3H8NA 2SEBA 1MI5A 2XWJB 3CVIH 1N2RA 2ED9A 3S36X 2BY1A 2HT3D 2JJUA 4W6WB 3MC0A 3PJSA 4JRXB 5ANMB 5KS9A 3G6AB 3IDIB 3O2DL 4EBQL 4I13B 4QOKB 1CWVA 5FKAB 1QLRB 1FZOA 4F7EA 2MQ0A 32C2B 2JIXB 3MGOB 1Q1JH 2VAAB 1VFAA 4MA3A 1Q9KA 4WW1A 4JO4L 2XACC 3QG7L 1R3IL 3F7PC 4DGIL 2FJFB 2D03H 1OQOA 3OGOE 2WK2A 1NCCH 1OAQL 4PRIB 3BAEH 1L6ZA 3VFVA 4HGKC 1DL7H 3UTQB 4OUUB 4WFFD 3D2UA 3LRHA 1WCBA 3WFEL 1L9NA 2CDEB 2HAZA 4WFHE 3BN9C 1S5HA 1TVHB 2QHRL 1BECA 1FNEA 3OV6A 3CAFA 1T4KA 1MQKH 5B38G 4XPHH 5HVHC 1BX2A 3MRKA 1C8PA 1K8IA 1A1OA 3AVEA 4U33A 4FFWD 5J11C 2JCCA 4WI9A 1CDUA 1Z6JT 3O3EB 2NW3A 1SEQL 5CLWA 3KPSE 2PO6B 4XAWL 4NQDE 3RGVB 4JFFD 2XKNB 3NABH 4OT1H 1XGRA 2Y06H 3QIUB 2X4UB 1ZANL 4I8DA 1AGFB 1N5AB 1F02I 3MRQB 5HI3D 2YRPA 1WFNA 1G9EA 3DRTB 4MVBD 5CZVH 4KRPB 3RHWF 7FABL 4PJ7F 5M7QA 5DQDH 4APQD 5BW7C 5EU6A 4LSTH 4NT6B 4M7LH 1ZT7A 5J13B 3A6CL 3QSKB 1RHFA 5HTSA 5DT1L 1NEZG 4LAQH 3FN0H 1AGEA 1KN4L 4KVCH 5TDNB 2GUOB 3R4DA 4CADB 4KHXL 2FX8L 4KK8C 2VLJA 4I18A 5JQHC 3QDHA 4G6AC 4CBPA 3L5HA 5DRNB 2BNRA 1WWAX 1T80A 1MUJA 1ZVYA 3CFIC 3O2DA 4JG0H 1MVFA 2CGRH 3KPLA 1A7PL 1EAPB 2E6QA 4TSAH 1EFXD 4FQXD 4NO2A 4LCCC 5LGJA 2J4WH 3DURA 3D0LB 5C0AE 1VGKB 3SEPA 1XEDA 1DBML 2M26A 1ETZA 4U1IA 3HMWL 5FO9B 1CIDA 5FUZH 1RK0B 1V7MH 4NOBA 4ELMA 3SE3C 1QBLL 4XPAH 4YR6B 1FL3A 2X9YA 1A6TB 2EC9T 5GGRY 2C4FT 4ETYA 4MJ5B 1VGEL 5FK9B 4LEXH 3BWAA 3P4OA 3CMOH 2B2XH 3TV3H 2YA0A 5IB5A 1AFVL 3P11L 3LD8C 3RZCD 1CFNB 4H1LB 5C07B 1X7QA 1WC7B 4NQXB 4WCYL 4BM7A 2YBRB 1NCDH 3VWKD 1IAOA 5BV7C 2HFGL 3O8XB 3OAYK 4BH7B 3RY6A 1BM3L 1P5UA 2XNAB 3QDJD 1ACYL 2ZUXA 1I9RL 2Y6SD 3IXAB 4POZC 4UUJA 1LO4L 1INEH 1CZ8H 4NC0B 4KUCD 2VITA 1VPOL 4L9LA 3V0VA 4RZCA 5CD5D 2R23A 4PJ9B 2VABA 2BVPA 1G6VK 3EO0B 1Q0YL 1B0GA 2IF7A 4Y4FA 5EO1A 4BQCA 2P5EA 4Z77B 2H1PH 3N85H 4V1DA 1A6UL 2EICA 3WNMA 5GISH 1XGTA 3W39A 2B1AL 2GT9A 4WFFE 1DN0A 4HWEH 2FECI 4ZNCD 1MREH 4WV1C 5CGTA 4HIHA 2FECL 1FQ9C 3HUJE 4PUBH 3EJZD 4LCUA 1QYGH 3U4BL 3NCCB 4JY6B 3MV8D 1RHHA 4KI5F 3HAEB 2VZVA 3FMGL 1EGJL 4L4VB 5DHVA 2OK0L 4GW4A 3VXNB 3K8LA 2ENYA 2PW2A 1KJMA 1UYWH 1JGVH 4MA7L 3KWWA 4ZUVA 3GMNB 2R2EB 3KHQA 4NUJB 3VJ6A 2A9MH 4G3YH 1I3VA 3RL2A 3NFSL 1L4IA 3VWJA 5HHOB 4JFFE 1AGDB 1LE9A 4LPYA 3U9PL 5J6HB 4LVHC 4ODUB 5DJCB 2QLVB 2HLAA 3SKMB 1HHKB 5AYUH 3BIAX 4OD2B 4OZIF 1A3RL 1JPST 1JVKA 3QNZB 1RVFH 4JQVC 2R9HC 1A6ZA 1I8KA 1U8QA 1IQDA 12E8H 5KZCD 1DE4A 3RDTA 4M00A 4R0LA 2K7QA 2HH0L 1OAKL 5I74C 3JUYA 1DQML 2D7QA 2OTWA 5EUOF 4K3JH 2YD7A 4P5KB 3ZKXC 4KK5C 4Y5VB 5IESH 3PP4H 2I9LA 4JHZA 5EU3A 4IDJH 5F7HA 1D5IH 4OZIB 1DQLL 5M94B 1IAKB 3GNML 4PJEB 2I26N 2BX5A 4EXPX 3QFJB 4DGVH 3WUWB 3JVGA 4LASH 4CKVX 5HVFB 5FV2A 5C0ND 4BFBD 4WJ5A 4V2BA 2NR6C 2R4SL 3C08H 2CDGB 2D4FA 2OL3H 2G5BA 5KTEL 3GSOB 1FNAA 2EH8L 5EUOB 1YEKH 2W65A 2NNAA 2OMNA 2V5YA 4KROC 3UJIL 3CH1A 4HEME 4HWBH 4JGJA 4Z7QE 5F89A 2F5BL 2FBJH 5HDBF 1NLDL 4HUXB 4OGAD 2FIKA 3TBTB 3B8SA 4YX2H 4KJPC 4K94H 3BE1H 4Y16A 2VLKB 4UMGA 4H8WC 4MXQA 5E9DD 1S7QA 4N90D 4PJCE 5FAAA 3DBXA 3OR6B 1MCPL 3WSQH 3QAZC 5IWLC 4PRPB 1SJEB 3AS3A 1XCTB 3D3VD 3S4SA 3X11B 1E6OL 1DVFB 2ZCHH 4P57B 2A0LD 1E28A 3IFOB 4E5XA 1GGCH 3CPLB 5F93C 2J6EH 4PJHF 1J11A 1EGJA 3VFOB 3PP3K 3VFGH 3EAKA 2WBJC 3N1GC 4HKJB 1QEWB 3K4ZA 1BF8A 4X99B 1R6VA 3F62A 5TE7L 2IANB 4OFDA 1TPXB 3QDJE 1PG7X 5I8OH 1CL7H 2Z8RA 4JFDB 4WDIA 3FOMB 4PJHB 1GGIL 4X7SH 4MA1C 1YC8A 3L7FA 3KPRB 3MRHA 1L7TH 1SMOA 4MJIB 3K46A 4Q9QH 4KTYA 4R7DB 3OF6D 4ZAKB 4G80B 3QIWD 1ZWIA 4M61B 3MRIB 2WZPD 2B5IB 2OTUA 1NPUA 2VR9A 4F57H 5HYEA 2YUXA 4WTZG 4NKMA 4HPYH 1DDHB 4L8DB 4LHQB 4AMKH 2NY5L 2R2HB 1XIWC 1T1XB 3GSRA 3D5OF 2AJZA 3MV8E 2CXGA 2X1XR 4TUOB 4HBQA 2X7LA 5IB1A 3A67H 2XG5A 3BQUA 3BGFC 1RJYB 2EIDA 3GJFA 2V2TB 4YAQB 4N1HB 3EO1A 5C0AA 4N0CD 2NY7H 5GJTH 5IW1A 3LEVL 5H37G 4YNYA 1NAKH 4FQ1L 4XVSH 3SDYL 5T1DL 3E2HB 3I6GB 3QXWA 2EDWA 2ZCKL 4UT9L 4TNVF 2GCYB 1A3LH 2BSED 3QZWG 3IDNB 3QIBC 5CILL 3FHAA 3HZVA 3F12A 1U8IB 3RWFB 4HZAA 3FQXA 1KFAL 3F65A 5HHVH 4X7TB 3CSPA 5I8EA 1K2DA 1AO7D 1LP9E 2Q8AL 1T1WA 3FFCD 4LPVA 3ZE1F 5C9JA 1X3DA 5GJSH 3RVXD 2DBJA 1G0YR 2XZCL 4MQXD 4BQ8A 5EPMA 3MR9B 3LKPA 1K8DB 1KF9B 4AH2B 1WBXB 5F1IB 2NY6C 1Q0XL 1R5IB 1R5WB 4ALAH 5DFVC 4P46A 3SDAB 4HGMA 4KKBD 1U42A 3ZKMD 3QXUA 4WHTA 3UXFA 5IBUG 2JELH 1TIUA 5KSVB 2IBZY 2AXFA 2VUYA 4HWNA 1S7WB 4HIEB 1JPFB 4OKVB 4OB5L 1CE1L 3QDGD 4F7PB 4WU5B 1X6LA 4LLQA 3BZEB 1OOAA 1OTSC 3ULVH 1NGYB 1IGMH 1IGIL 5IHUH 3FO2B 2W9EL 1EEZA 3CFJA 25C8L 3HC4H 3T65A 1RK1A 4XPTL 4C4KT 1MIMH 4U1MB 1EO7A 2CKBL 5E9DE 4N90E 3MV9D 3C6LA 2FJHB 2J88L 5D71H 1BQUA 3NA9L 5AAWA 4UTBH 1I75A 4Q9CA 1U8MB 4RMQA 4O4YL 1CK0L 1ED3B 5F1KC 1GIGL 3D3VE 4IS6A 2YZ1A 4RISH 1UEYA 5DQ9B 3QUXD 1I1YA 43CAA 2DQIH 3GIVA 1IEHA 1GOFA 1MFEH 2VIRA 1FNSH 5KVGH 1NCNA 4DGYL 2BY3A 5E99L 3NFNB 4GS7C 1QR4A 2WWKT 3D0VA 4L3ED 1FLTX 3BKML 4PJ8D 3BPCB 4XNQB 1J1XH 1NMCB 2DQHH 3FO1A 1YYLH 4M4RA 1FPTH 5CKAA 2UZYB 4GSDH 2PYEA 3KLAA 3O9WA 4OLXH 2DLIA 4NNYB 3FRUA 4OV5A 2GTWA 4XNYL 1MLBB 2LE9A 4EXKA 4QRQB 4UDUA 4F80A 5KVMC 5GGTH 3D1MC 4LLDA 3DXAA 4RDQG 4GBXB 5DC0A 1RZJC 2BCKB 5BXFA 3LMJL 5F9OH 2Z31C 1JZ3A 5BMFH 5FYJD 3KJ4C 5DQJA 5KN5B 3QXDA 1KCSL 2BHUA 2YK1H 2CQVA 1OT2A 3ARDD 3BGAA 4S10A 1C7SA 1EFQA 2ARJB 1DUYB 4HHAA 3HG1B 3MOAH 3QH3A 5C0CD 2XN9B 4PRAB 4NM4L 2C3VA 3SE9H 4UU9A 1MHPH 3MRLA 3ECBA 3MRRB 1NCUA 2RQ8A 3Q5OA 2O5XH 4M6AA 2BVUA 5ALCH 5INCB 3D39D 2V5SA 3BPOB 2JK5A 1U8LA 1I7TB 2XY1A 3RA7H 3L3HA 4AL8L 5I16B 3OXRA 3B2UD 3SBWC 3SKOA 4OAWB 1Y0LB 3REVA 4ZTPL 1Z9MA 5AG9A 1DJSA 5IM7A 3K81A 3BKCH 4JRYB 4N8PA 3AS1A 5F6IB 4N9OB 4YHIA 2F74B 1UA6L 3E6FA 3FO9B 3MYZA 2J12B 3MUGB 2YS4A 4NHCH 3TBSA 4FTVB 3ISWA 4CMMB 4YFLF 1A1NA 1I8LC 3EYVA 5DVMA 1OM3L 2EDLA 1AO7E 1GOGA 1PG7W 3FFCE 3MYJB 5IMOA 2E5EA 4N5EA 3N9GL 3ULUC 3HE7A 5GPRA 2X6MA 1JIBA 3ZDXF 3QUZC 1V3MA 2HTKC 4OF5A 2EYTA 4HXAL 1FAKT 5C92A 4EN3B 1FNFA 1CFBA 4QLRA 3OJDB 3ULSA 4DK3A 2VXTH 4TNWK 4JN2B 5JOEA 4RX4A 3TBYA 4J4PD 2GSIA 5CWSA 5K33A 2HFFB 5E94A 1EVTC 5I8CB 5BJTA 2ATKB 1CS6A 3QDGE 2X4OB 1AGBA 4JJHA 1CDYA 3KPMB 1J0JA 4JZNA 2EO9A 4K9EH 3PABA 3T0AA 2WANA 5EBWB 1F4XH 5D1QB 3TZVA 3HI6L 1H15B 3BEWA 2B7DT 4ERSH 1JI1A 1ZS8B 4P4KB 4X98B 3MV9E 3NPZB 2P5WA 3LKSB 1RUMH 4L8SA 1PEZA 4OLVL 3AFLA 3OAUL 3RTQB 1KCGC 1W0WA 4U0RB 1EZVX 5D7LB 2EDQA 2VJXA 5MEPB 3HI5L 4RMVA 5HHXL 4PTTA 4XP6H 4X6CF 2MQ3A 1SEBB 5F96L 1O7VA 4NCDA 2E7BA 4L3EE 4U6HB 4UINH 2J2ZA 4RGMC 4JLRA 4WUKL 1KYOK 5F8RC 4JFQA 3TT1L 4WTWA 4O51B 2AJYH 1CTOA 2CIKB 4TVPH 1F58L 1RSFA 1DCLA 3UEZA 5DZLA 5EUKA 4X6CB 3ARFA 3DX9B 4U1HA 1U41A 3BKYH 3CFEB 1N0LA 3MODH 5J1AB 3DRQA 1S7UA 2A74A 3MO1A 4QNPF 5FYJE 3OHXB 1M6OB 3QXAA 5I76B 5EU4A 2VXQL 2NY3D 3IETB 1KXTB 5I1IH 4JPVH 2FATH 1BFVL 3PHOA 3MLRL 2OS7A 3AXLA 3WFBH 4JZJA 1P84J 1KCUH 1YN7A 3FAXA 4HPOH 5GRUH 1GGBH 4TRPH 3QULA 2JTDA 4P23C 5GSRA 4M03A 5C0CE 4FQLH 4L29A 4C56E 5D6CA 3LSOB 4P0DA 3QCTL 5FA4B 3ZDYE 3D39E 1NAML 3ARGA 2Q3ZA 1ZHKA 5SX4I 1E4WH 1HILA 2EDBA 1BZ9B 2WSKA 4XRCA 2RHEA 4R3SA 4LSQH 3FB6A 4P3CL 3TIEB 4HC1H 4X6BA 1ZA6A 3NPSC 1KEMH 5EBGA 3MRBA 1Q9LB 1U95B 1HSBA 3CFBA 4N1EA 3RKDC 1TMCB 3GBNH 5DHXB 2HLFC 3GSWA 3U4EB 4U6XA 3GMQB 3NTCL 3T0EB 4QHNA 1AQDB 4QF1B 4OI9A 2I07A 2VDPL 3Q6GH 5H8DA 2HMIC 4P49A 5ALBH 3RWIA 3PHQB 1GHFH 4M6NL 3AM8A 5I66A 3O6FD 4IIQB 4JY5H 1G9ML 1C5DA 3QWRD 4KHTL 4D8PA 1BVLA 1PKQB 3VFSB 1BEYL 1U92B 1IEBB 4HX1B 3UTPD 3E3QE 1TXKA 4PJDE 3IAGC 4FFVC 4NQSA 3RNQA 1UB5B 3Q1SH 2V9QA 1RZGA 1L0YA 3L5XH 4KKNA 1FAIH 1XGYH 3AREC 1JN6B 4JHAH 5F7KC 3T4YA 5I75B 1VADB 3JSSA 4Z0XB 1NBZA 5DSCB 4QHLB 4LFHG 5SV4A 4ELKB 4W68A 5C0IB 3WFCH 4XC3L 1KOAA 4PJGA 2C9AA 3S35X 4QT5A 4OIIL 3DARA 3WL9B 3EDFA 3ULVC 1XF3A 4WNQB 5D93C 1FFRA 3S36H 3DX6A 1FVCB 5D5MA 1CICC 5IOPA 5HD8C 3VGAB 4LEOB 3U1SH 3BMVA 4JPWH 1YJDL 4WIQA 5DJXB 4MB4A 4OJFH 4PJBF 1N6QL 3RWHA 3RU8H 3NBNA 3GIZH 2F54A 4YDLC 2HYMA 2DQFB 1JGLH 3V8CA 5GZOD 4PJIE 1RIHH 1BBJB 4RA3A 1HXYA 1HH9B 2V17L 1JPGA 1BOYA 4U1GB 3STLA 3T1FB 1VFUA 2CUHA 3L6FA 4GG6F 5T3ZE 1PJ9A 4EUPB 2ICEA 4KJQD 1NAMA 5FGCE 1G7HB 1YZZA 4FQHB 5HXMA 3SGEH 4YDKL 4PJBB 1KN2L 4K7FB 5D8JH 3TPUA 3X12A 2ICCA 4J3OC 3FQUB 1CE6B 3MA7A 4ODHH 4Y4HC 2H32A 4IMKA 4PJFF 4EI6B 1G7PA 4RMRA 5FM4A 4P2OD 5TF1L 1AHWB 4XBGA 1J5OH 1CIUA 1J05B 4TN9A 5HGDA 5I18L 4G9FB 3FB8A 3UPRA 3WFZA 2VR4A 3RJQB 3LPWA 3CVHL 4O5LH 2Y4SA 1YNLL 3IFNH 5T5FH 2AVGA 2P46B 4JM2F 3DV4A 1CGSL 2ZZUT 4G8GB 1H5BA 4PJFB 1HYRC 2X1QA 2YUZA 3PUCA 1IC4L 1KC5H 1S7XB 1XGUB 1CN4A 1NGQL 5T1LB 4DQOH 3CDCA 3UAJD 2FHCA 2OR7A 4JDZA 1QPPA 2WBKA 3U7YL 3U6RA 1JMZA 1RQ5A 3ILPA 4FFZH 4JM2B 3IJSA 4MNQA 3VXUB 1DBAL 3LKRB 1QKZH 2WLYA 5D1XA 4NZJA 3SE4C 1HINH 3WXVH 4P5TA 2O61A 1AGCB 3PXJA 1P4BH 4G5ZH 1RJZA 5JNYB 2DRUA 3KGRA 2QADD 3D3VB 2IH1A 5D1ZC 4I4WB 5K9KB 3ZHDA 1SM3L 4LVNC 2R29H 4J8RB 3W81A 1A6AA 4KC3B 5C71A 1PLGL 4ODSL 5T5NG 2CMRL 2NY2D 5DD5H 5INDB 5KJRL 3F58H 4WW2B 3A0OA 4PB0H 3EYOA 3UTPE 3M07A 4NNXA 3GI8H 4AIXA 1PX4A 3MRDB 1VFOA 1WBYA 3CSYA 4E41D 2OR9L 1DBKL 5JORB 4BFIA 5TE4H 1FLRL 3X3GH 1HNGA 4PJAE 4BFGA 1QSEA 4H1LH 4OLEA 1W72L 1G0XA 3EYQC 3VU2A 2RIKA 1K6QL 2A83B 4IRSC 2H3NB 4CAGA 1MFAH 4UQ2B 2X70B 2Y07H 3RY5A 3BKJH 5HGGS 4K9EC 3VD9A 2GJZB 4PLJC 5IB3A 3VXSA 2BRQA 3BP6A 1S8DA 3CVHA 4YE4H 1NGXA 2DQCH 5DRWB 4HWZB 2CJUL 4WVRA 3ILQD 3ZE2F 4Z7UF 1JNJA 4C56A 4XMLL 2DLFH 2AXJA 2DJ4A 5T3ZL 2GYSA 1AJ7L 1NCTA 5D7JC 2FYYB 1U8JA 5H35B 1XF2B 1FGNH 5D96C 3TT3H 4M7ZB 3VXQA 3RIAK 4Z7NF 1LVEA 2EIZB 1CLYH 1JRHH 4DOHB 4L4JA 4UIKH 1FO0B 2IADB 3EZJB 4WHYH 3VGFA 3NZ8B 4QGYA 1JF1A 3HZYB 3TH4T 3HAEH 1FL6B 1NSNH 1EH9A 4WRLA 4YGAB 5JW4M 4M7KH 1G6RL 1FL5A 4NWUH 1AI1H 1UWGL 5F9WC 1LO5A 4XP5L 3UJJL 2R0KH 2AI0H 2FEDD 3SHSA 3UYPA 5MHSD 2HT4C 3FFCB 3GMLB 1BJ1J 2EDNA 4G9DB 1JHTB 4P4RA 3ROLB 1HCFX 2GAZA 1UKTA 1SYVB 3AAZB 5E8DL 4RMUA 1UVQB 4FXGA 3U0WH 3V4PL 3DUSA 2CH8A 3U0PB 2D31A 3VXOA 2LVCA 4M6MH 4ZFOL 1UH2A 5ITBH 2F9BT 4RAVB 4IRZH 1PQZB 5C8JA 1TTGA 5E2WH 4M43H 4U7MA 1CI5A 1NUGA 4QXTB 3EUUA 5CP7B 2Z93B 1KT2A 5B38B 4XX1G 1WBZA 1W72A 1MH5A 1T83C 3LS4H 5CEXB 2W38A 3WDHA 3KPTA 5FYLL 1FFNB 3QI9A 3CZJA 1NMBL 5JOFB 3H3PL 1H0DB 2H8PB 1KENH 5DFTA 3IDJA 3O6KL 3MV9B 4E9LA 3D85B 3JV6A 1EVUA 4HSQA 1MHCB 5T3XL 1TENA 4LLWA 1YEFL 3L3KB 4DW2H 4XNZC 5FYKL 4PJIA 5HY9A 1Q72L 2FSEA 4K71B 4YHOH 1OAXL 5KW9H 5LGHL 3HNTH 1OPGL 5ISZA 3IU3A 2BFVH 1S9YA 1TQBC 5IGXL 2R1XB 2F53B 3CZFB 4DKFH 3D25A 2MKWA 5DC4B 5DTFA 5F7WC 1NEZB 3SDDB 3NCYS 1NL0L 3QEGH 1FDLH 2B4CL 2PTTB 1T2XA 5C70A 4E41E 4MLSA 4LP4A 4UTAH 4LRNL 2IH3A 3ROOB 5DLML 4PGEA 2AGJL 2BOCA 2E7CA 3GMOB 4XPFL 5E70A 1NC2A 1DEEB 1YY8A 1LMKA 3B5TA 1BD2B 1FC2D 3G5ZB 4R96B 4RNRB 3PF2A 1G6RA 3LKOA 1FZJA 2AKRB 4OLZH 3LQAH 5AD0A 4LLYA 3GFUA 3BIBX 1W8OA 3P40A 1YDPB 2E9WA 2IAMA 5EA0H 3VG0H 1MFBH 5LJYH 2DWDA 1EZVY 4J3VA 4GKZB 5F21B 1JWUA 3FCTA 2F19H 5IK3A 1JZ5A 1T89C 2F58H 1HOCB 4BSVA 1JNHA 1PG7H 1WT5A 2QHLA 3WD5L 5KSUA 2W0KA 4I2XE 5E6IB 4QYOA 3BOVA 4ZFOA 3V0WL 4GXVL 2V5TA 2ZG1A 3MNZB 2UWEA 4EI5B 1P7QA 1RUKH 1CR9H 1UZ6E 4YXHL 3WBDA 5LXGH 4X4XB 3O45A 5KSBE 1UFUA 5GQBA 2X40A 3IDXH 3S97C 2OX5A 2W0FA 3GUTA 2Q87A 4G6AD 4K3EH 3DI2B 3IJHA 1VDGA 1XF1A 3WN5B 4Z7WA 3WFDH 3IVKB 5E8NA 3OX8B 4NQCA 3RGVC 4BH8B 3HS0A 3ALPA 1BAFH 3R0MA 3QIUC 4LFHD 3DSFL 3K4DA 3PWPE 2EYSB 5D2NB 5A2FA 5IR1A 3QDMA 4OFIA 1BMGA 1S78C 2Q3AA 4QHKJ 5EBMB 5T1KA 3TO4A 5MHSE 5MEND 4FABH 1QACA 4WWKB 4KRPC 1SJHA 4OD3L 1AXTL 4QXGL 3MLTB 4RMTA 2PCPA 1JNNH 4NN7B 5CJOL 4ACPA 3TA3D 1HZHL 2FGZA 4R2GD 5CSBA 4QRRA 5J13C 3VH8G 5I73B 4XPBL 4PJAA 4KRMB 4LPTA 1U2CA 5DURD 4TSBH 3GMPB 1JI2A 4CGTA 3WS6A 1IBGH 3WNNA 4BJLA 4F7CB 4BZ1H 4L4TD 3ET9F 2H2PC 4BSWA 1JPTH 2P7TB 2ICWJ 3EGSB 2IFFL 4Y19D 1FNHA 3QCUL 1UXSB 2LU4A 3UTSD 4G8EB 3DJ9A 3D9AL 1SBSH 1OARL 4PJXE 4CN6A 5KS9F 1RURH 2BK8A 3TCXA 5IVXA 4POZD 3T09A 2EYRA 3BUYB 3WLBB 4Z7VE 2X4QA 2YWZA 2O5ZH 4UILH 3MLZH 2AEIT 1CGVA 4B7IA 5IT2H 1N2RB 1ZT4B 3KXFD 3LCYA 3QNYA 1YEGL 2AXGB 2V7HA 4JM4L 4XC1H 4X7CC 1U36A 3L3JB 3WIFA 1J1PL 5KS9B 1A7NH 1IC7L 4HJ0C 5E7FA 3W5NA 2HFEB 1FNGB 3NIDE 2XRAH 3F8UB 4MXWH 4MA3B 1VFAB 3ZYOA 1Q9KB 2MCPH 4WW1B 4J1UA 3VGGA 5JXEA 5C08D 2JCCF 3CUPB 1B2WH 8CGTA 3O8XC 3VFVB 2XQYK 5DGRA 2DB8A 4P5MB 2YMXH 5E00A 1SYSA 1FVDB 2EDEA 3SQBA 4OQTA 1MCIA 1S5HB 3BMWA 1WK0A 1FNEB 4U1JB 1V7NH 4GG8A 5L88L 4I5BA 1OAYL 3OG4B 1BX2B 4PJ9C 3MRKB 2R9HD 3U4AA 1K8IB 1PGRB 3I3EA 1A1OB 4U1KA 5JHDA 2AEQL 4XVTL 2V5RA 4X4ME 2NW3B 1RZ7L 1WICA 4MX7B 5HHPB 5DJAA 4KK5D 5GHWH 4FQ2H 3T3PE 4G7YH 4WO4D 1N6VA 5JA9A 3SO5A 1ITCA 2RCSL 3REWA 3W0WA 2BY2A 2YPVH 3MRJA 3P2TA 1ADQH 5TH2A 2NR6D 1MVUA 3CFCL 5EU6B 3ARBA 4XP9H 1U91A 3KPNB 3OXSA 2JF1A 2EH7L 5EZLA 4HAGA 3AU1A 5F9JA 1F90H 3H3KA 3JWOH 3S34L 1LHZA 3C60A 3U0TA 1KCRL 4YUEL 1MAJA 5EZJB 2NZ9C 1NLBL 1AGEB 1MJ7H 3W11C 1CVSC 1P2CA 2E7LC 4KI5C 3X17A 4KJPD 3RFZC 4OM0L 3QB7C 5MENE 2PTUA 2VLJB 3NA4A 5D72L 5KSAA 4G6ML 4POUB 1JHKH 1BZQK 2AQ2A 4N0FA 1SY6L 5TFSH 4ELMF 1EUTA 2BNRB 2Q8BL 1MUJB 3QQ9C 1P84K 1UWEH 4Y5VC 5ESQA 3KPLB 3LN5A 3RPIA 1X5IA 5KAQG 1JPSH 2R0LL 3P0YH 5ETUA 5LGJB 5ADOH 4S2SB 3DURB 1CLZH 5IV2B 2R0ZH 4BUGA 4JKWA 5JW5A 5A2LH 1NC4A 1EHLL 4Y19E 4IEFB 2WBJD 1BIIA 3LPGA 3UTSE 4GW1A 1MCKA 1FL3B 5D7SL 5BVPL 1IFHL 4O02H 1OTTD 4X8XA 4LKXB 4R4BB 5IB5B 1AC6A 4YWGH 4HBCH 2VDLH 5JMOC 4NO5A 4HS8L 2IGFH 4P2RA 1WZLA 1X7QB 4UAOB 2WIMA 2XKUA 3KXFE 1I9IL 3G5VA 4OLYL 3C5ZA 4NO3A 4LRIC 4QXUH 2DAVA 1EXUA 1A4JB 3FO0L 5DF0A 2DD8H 1UADC 4JO3H 5HGBB 3SJVD 4XNXH 1DVFC 4I3RL 4PY8I 1RIVL 1LO3H 3NVQA 4JDVB 4LSPH 4YHZL 1ES0B 4UUJB 2VITB 2XA8H 3V0VB 3O0RL 4GAGH 3DROB 3TBWA 1QQDA 2R23B 5C6TH 1XIWD 2VABB 2MFNA 5IEHA 2BVPB 1F4WL 5EO1B 2DMKA 4Y4FB 2P5EB 5KVEL 1CFSB 1FIEA 3LQAC 4P2OB 5HHQA 5C08E 3PNWA 3PWPA 3GSUB 1VKXA 5FYKU 4YBLB 1XGTB 4LLVA 1KNOB 3W39B 4ONHA 5JLZB 1ZLWH 2I25N 1DN0B 3PQYA 1TPXC 4KV5E 2J3SA 4Q2ZA 3ZDZE 4UNUA 3IF1B 4HIIA 1PZ5A 5CZKA 4MD5B 4Q9RH 1FYTD 1WIPA 1B0RA 4LCUB 4KMTH 1RHHB 4OM1H 3F7RA 4NZTL 2UUDH 4FNLL 4QO1A 3QIBD 1HSAA 5DHVB 1EV2E 4PG2C 4GW4B 3QJHA 4OCYH 1NGWA 3OKMA 5I1JH 3LAFA 1WQVT 2PW2B 1SY6A 4Z7OF 4HCRL 1KJMB 3RAJH 3KWWB 3MFFA 4ZUVB 5I15L 3VJ6B 1WAAA 3T0XA 4LCIH 3RL2B 5L8JB 3UTTA 1LE9B 2QQQA 3UBXG 1T1ZA 1A6VL 2EE3A 2HLAB 3PWVA 3H7BA 1U6AL 1ND0B 1H3WM 5MEOA 2D4DA 4TQEH 2NY6D 5EN2B 3VD4A 3E1F1 2DTSA 1A6ZB 1G7MA 1I8KB 4LBEB 1UCBL 1S5IH 3P73A 1LNUA 1IQDB 5DFVD 5L2KD 3RIFK 1DE4B 3RDTB 4LNRA 2R8SL 3V95A 4R0LB 3TJHA 2CRMA 2QADB 4Z7VA 3DETC 1TJHL 3WMSA 5EIIB 4X8JA 2R2BB 4NUGH 1RFDH 4J6RH 4L5FL 5EU3B 3THML 2E8ZA 4MNGE 2VZTA 5KG9A 3BD5A 4ZG1A 3RVWC 3GB7A 4FRWA 1UGNA 3WHE1 1SQ2N 1AKJD 3MXWH 3K8MA 3T2NH 4WJ5B 2DQTL 4X6DE 4KDTC 2HRPH 5ESVA 4LPXA 2I9TB 5FM8A 3BRFA 1MNUL 3SDCC 1F3DJ 2JJTC 4S1QH 1HQ4A 3CH1B 3QWQB 4LPWA 5DWUH 3UTOA 3TJEL 1I7ZB 3EYFA 3VA2C 4WU7B 3CFDB 2HA1A 5I1CL 1MY5A 3ZSSA 5E4EB 3V6BR 4Y16B 5A43C 1QNZH 3SDAC 1S7QB 2D0HA 3DBXB 4TSCL 4OZFH 1H9VA 1UXWA 4PBWD 2A1WH 3LHPH 4E0RA 1F2XK 3KJ6L 3GSNL 4PB9H 1U58A 2DYPD 3BRDA 3N06B 3CDGA 3VRIA 4YZFE 1MJJA 1SMAA 5FIEA 1CBVH 1E28B 2VOTA 4E5XB 5HDOA 3S37X 4OGYL 3RNKA 1OF2A 3C6SA 2Z31D 4QRPA 1DFBH 2EEBA 3TBVA 5H94A 1JGDA 4Y2DA 4HCRA 1FIGH 5J89A 2VH5L 1J8HB 4P59L 5A2JH 2D9QB 2NTFB 2IG2L 4ODVH 4Q6IB 3IKKA 2X89D 1YQ2A 4YBQC 3VFNA 4WDIB 3SDXE 2DQJL 1OGTB 3MV7A 2YOCA 4AQ1B 2CLZA 4OV6F 3MRHB 4XXCA 3QRGH 4D9RD 5IG7A 1NMCC 4EUPH 1B4JL 1DZBA 2GQHA 1QBAA 2CO7B 3ZT6A 4PY7A 3S9DB 3FHQA 4PGBA 3U36A 3TNMB 1NBQA 3JTCA 1GC1H 2YRZA 2MHAA 3HMXL 3OJ2C 2ZP0T 4NKMB 1HH6A 3F7QA 5E5UB 1G7IA 3DECA 1OAUL 2AJZB 1QA9A 3OPZL 4Z8FL 5IB1B 5FM5O 3RUGB 4YPGA 4HK0B 1I8MA 3JV0A 1E6JL 1EX0A 3MLVL 5ID0A 4MXVF 5T33H 5IW1B 4OZHE 1V3LA 2VDRH 4F3FA 3JWDL 4YNYB 3ULUD 1VHPA 1MWAA 1WIUA 2QQNH 3W82A 3GI9L 2VDQH 5E08H 2AJVH 3QUZD 2HTKD 2F8XC 3GRWH 1KJ2L 2WUBH 3EYUL 5JPMA 3BPOC 3HZVB 1RUAH 3F12B 4RRPA 1WISA 2Z4QA 3FQXB 4PR5A 1QZ1A 2QTEA 1K2DB 5C9JB 1UZ8A 3GSNA 4GKNA 1SJXA 3TVMA 1XAUA 5DEGB 4B5EA 2ED7A 1T20A 1ZMYA 1ORSA 2VDNH 5TDOA 4H8WL 3LEYH 4YDVA 5F6IC 1HCVA 5DUMH 3IDYC 4XP4H 5FUOH 3FB5B 4P46B 1SBBA 5L6YL 3QDAA 1J1OL 4KK9C 4DJMA 2C1OA 1IC5L 1QP1A 4JO2L 1WV7T 5AZEH 3G5XB 1EMTH 2AXFB 2L4OA 4JFEA 2VDOL 2PYFB 4WV1A 5HVHB 3CIQA 1GRWA 3LY6A 1KLGA 5KANG 1CFQA 5FO7A 4LLQB 4AIOA 4U6VH 3RX5A 5IJKC 3D69B 5D2LB 5B8CA 1EEZB 4EN3C 3INUH 5EOQH 2V7NA 2EDFA 4M7LT 3T65B 3I3DA 4S1RH 4EDXB 2UVEA 1TNMA 5F7EH 4Y1AD 2AK4A 3C6LB 1MCWM 2VERN 1Q1JL 4WFED 2IMNA 1YECH 4IS6B 3HMXA 1I1YB 4U6YA 1BQSA 2WWMC 3GIVB 3TN0A 2VIRB 1P9MA 3JTSB 3BAEL 5GGSA 3C09C 5D1QC 2R0WH 5B3JF 4AG4H 5CMAA 1R5VA 3MLXH 3FO1B 3LB6C 5IFHH 4D0BA 1UB6B 1ZT1A 2PYEB 3O9WB 4P4KC 1U3JA 4GW5A 3BIKA 3HPLA 3FRUB 2J8UA 5SWSA 2GTWB 3RTQC 1EEYB 3EDDA 4F8TA 4U0RC 4ZO8A 4UDUB 3PGFH 2GKIA 1I3RA 4P23D 4LLDB 1KJ2A 3DXAB 4POYA 3G08A 3DMMA 5BXFB 3HFMH 5JIIA 1UJ3A 3CSBA 4C55A 4OT1L 1Y18A 1QBML 3RVVD 4D9RE 1D5ZA 1FO0H 3QXDB 3VFUA 5BVJB 4NKIH 1TETL 2YEZA 4ZS6C 4HHAB 1B6DA 1CXLA 4MVBC 5KVDL 2GSGA 5CZVL 5C0GA 1KULA 3OL2A 2I60L 4LLUA 2C3VB 2YPKA 2DQEH 3TA3B 4O9HH 4UU9B 3CX2A 4LSTL 3RKDD 4ISVA 3MRLB 3ECBB 1KIPB 2HLFD 4PIRF 4R2GB 5C2BL 5IIEA 2ADJA 4R90H 3QHZH 4XCNA 2JK5B 1U8LB 2NLJA 3RRQA 3L3HB 3MZTA 4BQ6A 4M1CC 2HMID 3OXRB 4L4TB 3SKOB 4I0PA 3VRLE 4XMKL 1DQQA 1TCRA 2NMSA 2VZSA 3L3OA 3MSPA 4Y5YA 3VGBA 3REVB 5JR1H 2FO1A 3ULUE 5CINH 5IM7B 3UTSB 4ZQKA 5BV7B 4HD9A 4FFVD 1HDMA 3VXMA 1MFDH 3ARED 3E6FB 3L9RB 1I8IA 3EYSH 3TBSB 2CGRL 2UZIH 4TSAL 5JXAH 5DK2B 1FVEA 4AM0B 3U7AA 2J4WL 2ZPKL 4LSRL 4RFNB 2OJZH 2GI7A 2Y5TA 2P8PB 1N5YL 3ULVD 4NSKA 3NMEA 5I2IA 4RMWA 3EHBC 1YEDA 1CF8H 5FUZL 3UTZA 3A6OA 1I9EA 3GHBH 1CICD 4Y5XA 5HD8D 1P4LA 3C2AH 3V4UH 3B5GA 5EZIL 3DHMA 3T0EC 5C0RL 3D87B 4P9HL 3IFPA 4LEXL 3CMOL 2B2XL 3TBYB 3TV3L 1OAZH 2APFA 1KSRA 4I77L 1YUHA 2D0GA 2VXSH 4G8FA 5E94B 5BJTB 1AGBB 1ULVA 4JZNB 1BPVA 3GSVA 1EO8H 4H26A 5HYFA 3TWCH 3TZVB 5I75C 3BEWB 4ETQA 1LDPH 3S3JA 3KVQA 1CLOL 1I7UA 4YHLL 4XCEA 3GO1H 3OAZK 2OI9C 2DQDH 1INEL 5F1NA 2AEWA 5BRZD 3AY4A 2WMPA 2YUV