3M17A

Crystal structure of human fcrn with a monomeric peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/inhibitor
molecule keywords IgG receptor FcRn large subunit p51
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m17A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m17A01
2QSVA 2AK4B 4OD1H 3X13A 5GXBB 5B21A 3L3GA 3BJLA 1D5XA 1B0WA 3FB6B 2HVKA 2J6EH 3OAYH 2YUXA 3W9EB 3DX6B 3VWJA 1F6AA 2FSEB 2CO6B 3N85L 1QLEL 5CCKL 3U46A 1CK0H 2F8XC 3FT4B 4QY8A 1JNLH 2QTEA 2JB5H 4U7KA 2VERN 4MNGB 5I6XC 2CK2A 2UZIH 4RQQA 4Z5RA 4ONHA 1QR1A 5K93A 2YA0A 3OKMB 3KJ6L 1MLCA 4U1LA 4G9FD 3U0PA 4PP1C 3RZCB 1YNTB 1TETL 4NYLA 3WDIA 2VLJB 1IGFH 3EDJA 3BYTA 4H20L 1NMAL 1NPUA 4ENED 3UYRH 3LEXB 5DI8B 1IT9H 5I1EL 4N8VB 1UYWL 3MCLL 1QSEA 4G6KH 4NZTH 5JHDE 2Z92A 1FORH 1MWAB 1YEFH 3WN5B 5E4IA 5TDNB 1HHJA 1ZHKA 2P5EB 2ZNWA 1H3PL 3QNXB 3BI9X 3GBLA 2R8SH 2IFFH 5HHMD 1NGXA 1UWXH 2NXZC 3DMMC 4M43H 5D1XD 3L7EB 1CGXA 4RA3A 3NFSH 4NPYA 5BZWB 1YPZB 3IJYB 3QXUA 3G04A 1EA9C 1EJ6A 3TA3D 3TH2T 1WFUA 2O26U 3MV11 4X4XB 3VXRE 1R3KA 3B9VA 4GOSA 2A77L 1S7SB 5DZOA 4UT9H 2WWMD 3OTTA 1FP5A 4UV4H 4X7EC 1ZVYA 2AJXL 4GRMB 4P5TC 4BQ6A 2MPAH 1P7KA 3MLWH 5CZVL 3GSOA 1WCBA 1GAFL 4OLUH 4GW5B 2BSTA 5KANI 3QWRA 3C6SA 3I75A 3F5WB 1VSCA 3EYVB 1NUDA 3IU3A 5CEXA 4DGYL 2W60A 4NNYB 1CD0A 4G80A 3MGAA 3RWGB 5GS0H 2WBJC 1BBDH 4P57A 5B39A 3RNQB 1HHKA 1NCAL 2H6PB 3LN5A 2BHZA 2XWTB 1QRND 3VXME 2OR9H 1AIFB 4NN7B 2AXJA 4K3GA 5KVDH 3MV9A 3EHBD 1KIRA 2HKHL 3IFLH 3NN8A 1F3DH 4MSWA 4U4BA 5J13B 4YH6A 1RZIB 4Z7WA 1U3HC 3MRNB 5F70A 3QUZB 3S5LA 3D9AH 5JXED 4BZ2H 1AKJB 4NO0D 1AXSB 4HUKB 4Z78A 1U8NB 4LRNH 5MEOB 5IHUL 4GBXC 3RA7L 3A6BL 4KMQA 4PV9A 4JVWA 4JFZL 1JNNH 1JRHH 1MCLA 3EZJB 5J12C 4BH8B 2UWEA 4U6YB 5FYKE 3S35L 5AAMA 1I1AC 4HEPG 4JG1H 1YUHA 5ELIA 4GSDH 4I4WA 2R29H 4PTUA 4M4PA 4ETQA 4Y2DD 4KJPD 3ARQA 5T1KA 4NBXB 2VDNL 4CU7A 3P9MB 2HFGH 4XPBL 1D5BB 1ZA6B 3S6CA 1CDCA 4Q74A 4NP4L 4FZ8L 5T33H 3GSXA 4PJ5E 4E42A 5BZDB 5IB4B 5JW5B 3ZE0E 4U1KB 3ARBB 3DOSA 4R2GC 3OF6D 3QPXL 1ED3B 4GG6B 3OG6B 1YDPB 1AXIB 3P9WB 1S5IH 2FX9H 2EO9A 5CGYD 4RAVA 1TMCA 1G7JA 4I5BA 3IDIB 2NY3D 4CMMA 3Q5YA 3DETD 4ZOCA 2W92A 2HN7B 4WWID 5A3IC 4JZOB 1H15B 5DSCB 4JFOA 1NCBL 1OD9A 2UYLB 3BAEL 4V2CB 2AGJH 5D70L 1NUFA 1UZ8A 4CL7A 1R3IL 1H3UA 1LEGB 1EHAA 4PJHF 1MHEB 5FYLL 4MJ5A 3QG6B 1KPVB 2NX5B 3FT2A 4DTGL 4ZG1A 2DQUL 2EXYC 1CIDA 5GGUA 5CKGA 3GMOB 1UYWH 4UAOC 1EERB 1R5IA 3DECA 5DYOA 4JANB 4UU9B 2VAAB 4XVJL 2ZOKA 4P59L 2N7AA 3HR5A 1HCVA 1XF3A 1T22B 3BVNA 5T1DL 4P2CG 1AC0A 4RISH 5LCVL 1L9NA 1RU9H 5DLML 1IARB 4JDZB 5DJZA 1JNHA 3Q2CA 2FDBP 2H9GA 4OBSA 4XNZB 1FO0L 1LNUA 4R7DA 5JDSB 4JPIA 4NQXB 1CGSL 1MCWM 4JFEE 4Y4HB 3S8WA 2UVFA 5CEYB 2PXYA 1IAKB 2VDOH 4YPGA 2ICCA 4OD3L 5MEPB 4YGVA 4BFIB 5D5ME 2YBRA 4L1DA 1IRAY 3BEVB 1BREA 1CR9L 4EDXB 4NHCL 4O02L 2NXZD 4A6YA 4OFIA 1YEHL 1P1ZB 1FLRL 1ZGLP 1G9EA 1KIQB 4QTIH 5HY9A 1QFOA 3VXUB 1R5VA 5A16B 2DKMA 5CJ8A 3GEWB 4NQCA 1PSKH 2AJVL 2Y06L 1KBGH 2FNBA 2DWDA 4NZDA 5I74B 1U92B 5DUML 3DRTB 1CF8L 2FJHA 4PJCB 2OXHA 4P5TD 1MUJB 3RIFK 3GUTA 1OLLA 3CVHL 3CFEA 4L9DA 4LHUD 5E2VH 3PWUB 4Z8FL 1JPST 1E4XL 1KJ2A 43CAB 5FGCB 1XR9B 5JUEH 4YFEA 2DLFH 2VC2L 3D39B 3SOBL 1F3DJ 4RZCB 4XHQA 4WUUD 1IM3A 5KSBB 1FPTH 2EE9A 3BDYL 4XT1C 2F5AH 1A4KA 3HA0A 3HNVL 4ODXB 2VZUA 1C5BH 5KAQF 3LS4H 2UY7A 3GMLA 2XXMB 3UTTE 3IXTB 2X70A 1LE5B 3S35H 1NFDF 3OWEA 2R0ZH 4ZFOA 4WJ5B 2CD0A 5ENWB 4OV5B 4M1GL 4MS8C 1JFQH 1RK0B 3M8OL 4CVXA 1U3HD 1VKXB 5IOPA 1HN1A 2YUZA 4XXDB 3K8KA 1ZLVK 2P42B 4FTVB 5DQ9A 4U1GC 2YN3A 2DDQL 4JDTH 4BSWB 4QHLA 1MCCA 4S1DC 4WRLA 5DS8B 1NKRA 4AZ8A 4JFFA 3WD5L 2AVGA 5F21B 3LV3A 4F7CA 3HMXA 5IVXA 5HHNA 2CKBA 1XZ0B 1I1AD 5GSRB 4YFDB 4V3EB 4PLJC 3FOLB 2VLME 2XFXA 3LEYL 5CZXC 4H0IA 5H2BB 3T1WA 5GS2D 2WUCL 3BYYA 5GISH 1KUMA 3SGJA 4F9PA 1GGCH 1JYWA 1HZHL 4WWKC 4XC3L 3B83A 1PFCA 1RFDL 1JHKH 1UM5L 5I1JL 4P9HC 5K9QI 2COQA 4P3DA 2LAGB 2VLKA 3ILPB 1EEZB 4Y5YC 5FM5M 3VDCA 1IZKA 1YY8A 4WDIA 2VZTA 5I15H 2O93L 4ZD3L 2VLRD 3IGAA 2OM5A 1I1CA 4IMLB 5E6YA 1YEEL 4HKJB 5DQJA 5ITFA 3OGCB 5JMOC 4LIQL 3QWQB 4JRXB 5CP7B 1AGCA 2NY0C 5A40E 1J1PL 2NTFA 1X5YA 4YX2H 3TYGL 3MMEA 1VADA 5I0ZA 3V6OE 1NFIA 1RJYA 4TNVK 3U7AA 3DX7A 5I8OH 1C08A 1KC5H 3AREB 4OLXH 1V7MH 4QHNB 1UB6B 1OP3K 2WZPD 1CFNA 3O8XD 4MCZB 4WHDA 4LLYB 5FDWB 3D0LA 4KK9C 2RFXB 5DA4A 4GMTL 4MA7L 4GKZB 4P2OA 1BVZA 2R0WH 4PB9L 1CFQA 5IB3B 3BPOB 3MRCB 4X6EB 1RHFA 4Y8AA 3QXAA 3L5WA 4L9LB 2EXYD 3HE6C 4L4TE 1FL5B 3QEGH 3EJZC 4U05A 5AD0A 2R0LL 1ZLWH 2DQEH 2Y36L 2D0FA 2J88H 1YEIL 2VDLH 5IB5A 5IBUB 4YR6A 3NPSC 5DFWH 1AQDA 1NCUA 1U58A 1NCCL 1UENA 3GMPB 1ZLSL 1Y6MR 1OAKH 1NGPH 2XWJA 5EN2A 5ERWA 3RGHA 1PX4A 1EIBA 3T0EA 2XZCL 5BO1H 1P4LA 2CMRL 3U7YL 3O6ML 4NC0B 1B6DA 4DZBA 5FYKH 1EEQA 1BJ8A 1C7TA 2EDLA 4D9LH 5KZCD 3ARGA 5JHDB 3KPRA 4UT6L 4YDLC 4MXQC 3TBTA 3IDUA 3REWA 3CK0H 3L95A 2JE8A 4OFYA 1HXYA 4PY7B 5D7KE 4ZFZB 4KRNA 5D6CA 2FWOB 1V3JA 1CVRA 3EJJX 1OTTC 3VXRB 3MXVH 4I9WE 5C08D 4N68A 2HVJB 3MX0A 4Y89A 5E70A 3FTGA 4NBZB 3IJSB 2QJDA 4YXKL 4LCYB 2J3SA 3VH8G 1M4KA 4QRSA 3X12B 5BQ7B 4K3EL 4JN1L 5E08H 2HJFA 1FGVH 5F44A 1HNFA 3GRWH 3C5SB 1J05B 3U46B 3FQTA 2F15A 3W39A 2B2XL 5HHQB 4M7LH 5L2KA 2NZ9C 4RQQB 1X44A 4ONHB 4MLIA 3UEZA 4L3EE 3RZCC 2ZCHL 4X5LA 5I0DA 4HC1L 4M5YL 4ZPTA 1X5KA 3INUL 2ZOLA 1WZKA 4MJIE 3BGMA 3WN5C 3VXMB 2DBJA 4PJXF 1QSEB 5IWLC 4NKQB 1DQQB 4ORGA 1CN4A 5D7JA 2HJKA 2ZSWB 4NUGH 4X83A 3MNWB 4F7EB 2RB8A 1C5DB 1CE1L 3Q6FB 3KLHC 5HGHB 4KQ3L 4AEEA 1NGQL 1EEUA 1UM5H 5ADPH 3O45A 4S1DD 2LVEA 1OAXH 2D9QB 5ITBL 3BRDA 2IGFH 1CG9A 1X9QA 1KN4L 1FNLA 2PETA 1BLNB 5C0EB 5IV2A 1NCNA 4H88H 1MHCA 3DHMA 3HC0A 5HVWA 2BOBB 3OL2A 3WIIH 2AI0L 4KTDL 1BECA 4Z7OE 5FUOH 4B50A 3O41A 1YEEH 4PLJD 3BN9D 5IEKB 5LJYH 1Q72L 1J87A 2FHFA 1OOAA 5CZXD 5TH2A 4AH2B 1B3JA 3F12A 2XN9A 3I2CH 2WM0A 4WWKD 4PJ8B 1FFQA 4DOHE 3DSNA 4MAYA 4AL8L 3WKML 3OKLA 3PDDA 1I1YA 1K6QH 4U6HA 3TWCL 4HQQH 3VI4F 1Q1JL 4PJ5B 3W2DH 1NFKA 1F4XL 3L7FB 4P57B 2W1NA 35C8L 3Q1SL 2E5EA 3NIDF 1L7IH 4UIKL 4NN7C 4OSUL 3T3ME 1UCBL 1OQXA 1JPTL 4G6JL 3QFJA 5J13C 1T1XA 1KIRB 3ISWA 1S7UA 3NN8B 4TNWF 4MA7H 4MSWB 3QUZC 1PGRB 4HT1L 5F9JB 4L8BA 1ULVA 2I26N 3PQYD 3S5LB 1RZFH 4TVPE 2BNRD 1URLA 4JO1L 1A9BA 4OAWB 4KDTA 4JFDD 4F33B 3CZJA 4PP2A 3F7YA 5I17B 3P11L 4XCNA 1YEIH 1T1WA 3WFHA 5C09A 4HWBH 3A0OA 3DURB 4CADB 5I18H 1NLBH 1N3NA 3B9EA 4J3OC 3D3VD 1NCCH 3VGDA 1J5OL 4BSVB 3DVNA 3PF2A 2H8PB 4KK9D 4F57L 5C0RL 3MNZB 1FYTD 1Q38A 2XZCH 5HPMB 4OGAC 5H37H 3M1BB 4RAUA 3KYKH 3MYJB 1N5YL 1IBGH 2X5PA 1CD1A 3V8CA 5CSZA 1UWXK 5T1KB 1CLZL 2D7TH 3CFIC 5DJDB 1VHPA 4RWYH 2LQRA 1SBSH 4UMGA 3VFWB 3LHPH 3FRPG 2AXFA 4WNQB 5EZLB 3MFFA 5DJYA 1WFTA 1JI2A 4OJFH 4HJ0C 1NC4A 4YHMH 4NJAL 1RZGA 2FZ3A 2IBBA 4JFEB 4TVSa 2JB6B 2I9LB 1DBAL 3IDMA 4OZGA 4GRWH 4RAVB 1HDMA 4HUWB 5D5MB 2VDKL 3I6LE 4TULH 3AB0B 3SKUD 2F74A 4I5BB 1IAOB 4P9HL 4MXQD 4MXWL 5DVLA 1DLFH 3QI9B 4KZEL 3EW3B 1FQ9C 4MQ7A 1QO3A 2BP3A 4H1LB 3KNBB 3KDMA 4IRJD 2G60L 1TCRA 2BFVL 1IZJA 1TVBB 3QFDA 2IH1A 1MI5A 1I8KB 2AK4D 4RMSA 4PGBA 5KVEL 1HHIA 2YMXH 5DRZB 3W81A 1UKQA 3MJ9H 3KPMA 1MNUH 3MXWH 4JZNA 4MJ5B 3EDFA 2PKDA 4HC1H 1G6RH 1DEDA 3MV8E 4Y16A 4Z0XA 2CSPA 1MCFA 1B4JL 3NA4A 5GGUB 4N5UA 5BVPL 3SE8L 4FFZH 4WI2A 5HGBA 5DYOB 4U7SA 1FNAA 5ETUA 1XF3B 4PJDE 1MFDL 3ZYOA 1ND0A 3HCVA 1ZEAL 4FXKB 4XNZC 4AEFA 4TUOA 5I1IH 4OFKA 1F58H 4Y4HC 3TFKC 5KJRH 1XH3A 5KS9E 3FL7A 4YBHA 4YQXL 1HINL 3EO0B 3PGDA 3U82B 5KW9L 1I8LC 4L8SA 4JJ5A 5HDLA 2PXYB 3GSRA 5LG1A 3SDDD 5IGXH 1U95A 3DO7A 3UTTB 2Z35B 3QIWA 1J0HA 1GRWA 2DF3A 1WBXB 2ZJSH 1A7OH 1MLBB 4KTDH 2K7PA 4QNPE 4QT5A 3ZDZE 5EU4A 4DCQA 1JF1B 3KLHD 4UQ3A 4NJ9L 1OGAE 3TBSA 3WO4B 3EOTH 3MRGA 3HAEG 5DK0B 1EH9A 1NCDH 5E8EB 4WI7A 4WHTB 2IC2A 1BZQK 1KTRL 4YHPA 1M7DA 1DBBH 4LVHB 1QOKA 1F90H 5KVGL 3TPUA 4U1IA 5DJ0B 3QUKA 5C0NC 3LB6C 2IBZY 4AY0A 1KJ3H 2AJYL 3W0WE 5ANME 2VXUL 3O3EA 4DEPB 4HLZH 1BEYH 5JOFB 1OVZA 1KB5H 1WWBX 3FFCA 5F8RC 4NKDA 1C16A 4L4JA 1RULH 2JJUA 3WS6A 3I02A 2ESVE 5F3BA 2OTUA 2PR4H 5HYIA 2ZCKH 5CINL 1AGFB 5HYSG 4JO1H 2IPUK 4MVBC 4MA8L 4E41E 1L6XA 1A4KB 4QEGA 2GEEA 5LAXA 4OM1H 3WNKA 3WHXA 5DJ8A 4EN3A 4JVUA 4LLQB 5EBLA 3ESUF 2FATH 1T7YA 2DM7A 3ECBA 3SJVA 3GM0A 5IOPB 1L0QA 3B2UC 3RJDA 4UTAL 3NVQA 3LIZL 3ZL4H 4BFEA 1JGUL 4YXHL 4QHLB 5C07A 4QRPD 1CLYH 2E27H 3MC0A 3UTSD 1QP1A 2O5YL 1EZVX 2A9NH 4F7CB 3MLVL 3TPUE 4NC1C 1MH5A 3WSQL 1JP5A 1AFVL 1WJ3A 5ESQB 2X05A 4X7TA 5FOBA 2DTSA 4LOUC 4M6ML 2XACC 1BFVH 1KT2B 4L4TB 2JIXB 1N7MH 1BGXH 5SWZD 4HCRA 2FO4A 4NO5B 4PUBL 2KBGA 2V5RA 3JSSA 4N90D 4X8XA 3VCLA 2ZKHH 4P4KB 4L8CA 3ARBD 2FJGA 3GM8A 1Z2KA 4F58H 4PRIE 5KAQG 3L3IA 5EO9A 4ZUVB 4DGIL 4HS8H 5I1CL 1EVUA 1GGYA 1ZS8B 2E9BA 3ZKQD 1DN0A 2VQ1A 4PRHA 5B3JE 5J1AB 3E3QC 1KB5B 1F2QA 4IOIA 3D18A 2V9QA 1ZT4A 5GS0D 4S0SD 4NZRL 1GZPB 4B0MM 3SJVE 3NZHL 1RJYB 2NQCA 3MRMA 4JM4H 5DMGD 1JYXA 1ZV5A 3AREC 5TE4H 3DX7B 4XNXH 4XPTL 4O2CB 1CZ8L 5GS3A 3QHZL 4NM8H 5ADOH 2V7HB 1U8JA 1ZEAH 1UM4L 4GLRH 1XGQA 5FUZH 3TYFB 4X6FA 1D9KA 1W0VB 1BHGA 5SWSE 5EOQH 1WAAF 3BPOC 4F8QA 1WZMA 2R1XB 4LAJH 4L9LC 4YQXH 3L5XH 5EWIH 3MRHA 3QXAB 4LAQL 4M93B 5A43C 4Q2ZB 1RPQA 2HLAB 1FZMB 5GRWA 1FH5L 5ID1B 4FABH 4XP4H 5L2JA 4PRDB 3RIFF 1CFSA 2G75A 4YR6B 4XBGA 4TVPH 4L3EB 4LARH 3J7HA 3P4OB 4HXBL 1G9MH 4Y4HD 3GDBA 2XWJB 5ERWB 1B2WH 1P4LB 5HI3C 4I18A 3PWLB 4HBCL 1LDPH 4MJIB 2WLZA 5E6IA 3ZHLA 2PO6A 1HNGA 4N8CH 5CD3A 3ZE1E 2L7JA 1T66D 3DSFL 4FFYL 4G7VL 5FKPA 3S35X 3TBTB 2VXUH 1G7IA 5E94A 3O11A 1YC8A 4XBEL 4KTYA 1HXYB 2EDFA 3VXUD 2C4FU 3VGHA 5DURB 3QDJD 4GO6B 4HPOL 1OB1A 5IIEB 3HMWL 5IFHH 5E24E 3GJEA 3GSQA 2JCCF 3GBMH 3KPLA 4I77L 3JVGC 4PJ9A 3L3KA 1V5JA 3BQUD 4QHMA 4KHXH 2VR5A 5EFIA 3O6FD 3MACH 3FTGB 1FZOA 1KTKE 2A83B 1QRKA 4R9HA 3OPZH 2XNAA 4YHZH 4EVNA 1T5XA 5IMMB 2ATKA 4MB5A 1HI6B 4HGWB 2Q7YA 1RIVL 2RIKA 3CXDL 3W39B 4JO3H 3BWAA 1RUQH 4DOHB 5FECA 1P69B 3V52H 2APBA 4WW2B 1XF4B 4GRLA 4KRPB 1DQTA 3OKOA 2XY1A 3NMEA 4K8RH 4JPWL 3ZKNC 3RVXC 4J3WA 3QRGL 5F3HB 3MNVA 1Q9KA 4CVZB 3BXNA 2ZOLB 3GKWL 4K7FB 3AVEA 4LSSL 4M1CD 4ODWA 5C0JB 1KLGB 5EU6A 3DGCR 4YDIH 1ZLWK 2HJKB 4FTVD 4LGSB 4NDMA 4Y5XA 3QNYB 2Z4QB 4E5XA 1ZHBA 4Z7VE 4JGJA 3QEHA 2BC4A 2YEZA 4PTTA 4QXUH 3KLAA 3TIDB 5KOMC 3T0XA 4ZTOH 1EGJA 4NQVA 1DQDL 4OF0A 4TRPH 1ZK9A 4G8EA 3G9AB 3BGAA 3GSVA 1LK3H 1DE4A 4GAGH 4LPUA 4JKLA 1CDYA 1A8JH 4ZFGL 4KDWA 4LOUD 2W9EL 4PJ8C 5TH2B 3IFPB 7FABL 1CGWA 3FRUB 1ADQL 3C2AL 1OPGH 2AK1H 1RJLA 4QCIB 4XNUH 2DIJA 2Y07L 4HDIA 1I1YB 5IUSA 1KYOJ 3HUJF 1X6NA 1FGNL 1AE6H 2V17H 5L8JB 3TJEH 2YD7A 4R26L 1J18A 1YQVH 3VG0L 4L5FL 3D2UD 1YMMA 1AJ7L 4JRXD 1QSFA 1CVSC 1EBPA 4XP5H 3DUUA 1S7UB 1X5LA 1Q0XH 2YC1B 1ES0B 5F6HI 4D8PA 5DD6B 4P46B 2GUOA 4R4FH 5CJOL 3VGFA 4OZFG 1JGEA 5E03A 5DMIL 5T3ZE 1P6FA 3ZTNH 2VDPL 2P8PB 2I9TB 5BMFH 4DUVA 3F7YB 4JKMA 3VWKB 3VXQA 1PZ5A 2R2HA 1KCUL 1P5UA 1WZ1L 1N3NB 4XCYB 5ACZA 2QSCH 1CIUA 2RQ8A 1PY9A 5E0QA 2OL3B 2Z8SA 5BV7H 1OT2A 3BIKB 3PHQA 3MV8B 1YNKL 3P4NB 4KY1H 5GRZA 1I7ZB 4XTRC 5D9SA 4CAGA 1T5WB 2P49B 1VFUA 1KTDA 3MGOA 1M6OA 5GIRA 3PJSA 4EI5A 1P4IL 4PJDB 3MJ7B 1BFTA 4GKSB 3QP3A 4ZPVB 3IDJA 1QKZL 3V7AG 2NW2B 4MDJA 5E8OB 4N1CA 3BE1H 5KS9B 1RZGB 1T1ZA 1NGWB 5HI3D 3K4ZA 1QSFE 3TN0D 4YHNA 4BH7B 4PFEA 3T4AA 3ZE2F 2A0LC 2GJ6D 2DQGH 4ISVB 3ARWA 1EO8L 5IK3B 1ACYL 3QI9C 4I0CC 2X4UA 1MREH 1R0AL 2BRRL 4GW4A 3K74B 4MXVE 1UG9A 5I2IB 4OIIL 5LXGL 4MB4A 3BP5B 3VXRD 1OGAB 2EIDA 4P3CH 4KKAC 1E6JH 4UBDC 2RCSL 4ZUWA 2KKQA 3DYPA 4CN6A 1WIOA 4EJ1C 4IOSD 4N0CA 3QA3A 2G9HB 5E2JA 3QNZA 3W0WB 5ANMB 4OLZL 4MNQE 1UC6A 1G0YR 5ACLA 1Z5LA 5E5RB 3S88H 2FECL 4QRUB 2X40A 3RDTA 5I1DA 1HSBA 5IBLC 3IDNA 5ETUB 2OJZL 4F15B 3EYQC 1NJ9B 3AROA 3S37L 5TDPB 4O51B 3T77B 2ESVB 4UOJA 4J3UA 4DGVH 3QXVA 4XPFL 1BIHA 1QQDB 2C1PB 5D7SL 1GGIH 4YZFF 2EIEA 2PXYC 3LRHA 2EDXA 3DXAE 3RVXD 4E41B 2MCPL 4WUKH 3VXMD 3TCLA 5BV7B 3SE3C 1VEOA 4OLYL 1Q0YH 3MUGB 4YHOH 3ULUL 1FBIH 1OAQL 4G8GA 1U8PA 5BJTA 5CLWA 4DUXA 3RUGA 1W72A 2NXYC 5BOZG 1VENA 2HG5A 2W9EH 5JLZB 5F1OB 3WO4C 1E4WH 3FZUC 5EU4B 1YEJH 2BNQE 3OJDA 1NDGB 3UXFA 3RNKA 1UH4A 3QO0A 1FNEB 5JTWA 4GFTB 4LVHC 4QOKD 4Q9QH 3KGRA 1MCRA 4XP9H 5FYKD 1QUNA 1A6WL 5DK2B 1K9TA 2VRAA 4M6OL 5INCB 3TPUB 1AGBB 3QUKB 1ZTXH 2XRAL 3A67L 2BY0A 2AAVA 3RHWK 4DEPC 5FK9B 1WWCA 3PP4L 3QIBA 3R0NA 4NCC2 3NAAH 1G7MA 2JJTA 1VGKA 3V5KB 2OSLB 2NTSP 4PJ8D 4UT7L 1T6WA 4W68A 5CBAA 2YD4A 1JPSH 5IEHA 1MJ8H 3HZYB 5FYKU 3GSWB 1QPPA 3WKNA 1C16B 5KSUA 3MUJA 5EUOF 4ONOA 4PJ5D 3U0TB 1F4WL 2OTUB 3SCMB 2X7LB 2WQ8A 5IM7A 3OZ9L 1HKLL 2OZ4H 2YD3A 1AO7E 4PRIB 1RZ7L 4NZUL 4KTEH 5EPMB 1GOGA 2DQCL 3FO9A 4I3RH 5LAXB 1QBBA 1YJDL 3QUMA 3LPFA 3MOBH 5JPMA 2FR4B 1CQYA 1OSPH 1D5MB 3V6OC 1II4E 4UB0L 4BELD 4PLKD 3TVMA 5IB1B 4EDWL 1HSAB 3QUYB 2A6IB 4TSBH 4GG6F 3CUPB 3SJVB 5DRXB 9CGTA 2Y25A 1HXMB 4K3JL 3HNSL 4AG4L 5INDB 1KEGL 4N0FA 5DD3H 4OCWL 2EC8A 4X7FC 5DXWA 5T1MA 2BXZA 3SKNA 1T89A 1V3MA 2L4OA 3DYMA 2FYYB 5DHXB 4NHUE 1XCTA 2R56L 2R1WB 5SWSB 1AI1L 5A2KH 2AW2A 3KR3L 2PYEE 2H26A 5FOBB 1FC1A 2DQHH 4F9PC 4XVSH 3OB0H 2P1YA 4EOWH 3N9GH 1N64L 1LO2H 4OB5L 3SEPA 3DI2B 3MV7D 4P4KC 2FO4B 1NMCB 4PGJA 2WINB 2G2RA 5JW4M 1R3HB 3ZKMD 1QFHA 1SYVB 3PIQB 5DEFB 1JTPA 2FJGB 5CEZL 1CDBA 3LEVL 1FDLH 4QHKI 4JFED 4LCCA 2OQJA 5EO9B 2V9RA 5DHYA 1BM3H 4BZYA 4JKPH 3DPBA 4OUUB 5JO5A 1CDIA 1U91A 3ALXA 4TPRL 5CILH 3BKCL 4WCYL 2XKSA 4P99A 4CDGC 5GGRB 1HHHA 1LO4H 1UXSA 1YEGH 3V6ZA 2PTTA 5BXFA 2BVQA 3QQ4B 3MRMB 5LQBL 1G7QB 3LKOB 1CXFA 4PJHE 2R4SL 1FV1B 4ZYKB 3R8BB 3U2SB 2FB4L 1G7LB 2WY3A 2VDQL 1U8JB 4RGOH 3WIHA 4KKAD 4HGKC 4DVBA 1MQ8A 1MRFH 2HMID 4I3SL 5AUMB 5I1GL 1QFUH 1GJIA 4Y4KB 3FO1A 4C56A 2C1OA 4YIQA 5JIKA 1TZGH 5KVFL 4S2SB 4M93C 4DKEL 5A2IH 1OQOA 2GAZB 2DKUA 4C59B 1JN6A 4LHJB 1MAKA 3ULUH 5E56A 3WEXB 5EOCL 4WGWB 2Q6WA 4K55A 5GRVL 2IALA 4PJCF 4NUJB 3GSNA 3ARZA 4XBGB 1A3RH 1NLDH 5GJTH 3GHBH 1A4JB 2AQ1A 1INQA 4I13B 3UJTH 1NEZA 2YK1L 2F54A 4OGXH 4XX1G 5TFSH 3UTTD 3DROA 4QXWA 1CU4H 2EYSA 4XMKL 1JGDB 3CFKA 1RAMA 1X5IA 2IADA 1WICA 3TO4A 3VRLF 1BBJB 3ARFB 3BKML 5KSBF 1SJHA 2XRAH 5CD3B 3V8OA 3TNMA 2B8OT 3T0AA 1MAML 3VXSA 3G5YB 4JFHD 1ONQB 4QYOA 5E94B 1IE5A 1YEDA 3S34H 2KH2B 4WFGD 1RIUH 1U6AL 1KG0A 4Z7VB 3EYUH 2JTDA 3MR9A 5GRXG 3CU1A 3WDHA 3TIEA 1F4WH 3KPLB 1FZKB 2Q8AL 5MHSE 4PJ9B 4BSJA 3BIAX 4QHUA 4OZIF 2IPKA 2ADFL 4HKBA 1JGLH 5EFIB 2FIKA 3NFPA 2VXVH 3UP1A 2E7BA 2VOTA 4PV8A 2VLMD 4ZUTB 1KYOK 2XNAB 3FO2B 4EVNB 3Q3GA 1ZXQA 3P4MB 4LCIL 1KCVL 5DRNB 2D7OA 1HHGB 4ELKB 2EH7L 4F3FA 4GG8A 1NBYA 4MD0A 4ODSH 2YXFA 3VMPA 2DLEA 1A6AB 4KRPC 1A5FL 1NFDE 4KKLD 5DMKA 2BERA 3MODH 5FDYA 4KV5E 4OQ1A 4XHJD 1FSKB 4LPWA 2H2SD 1FVCA 2EDQA 5DJXB 4ZS7L 2QR0A 3Q48A 2F54E 4JHBA 4MHHG 4XAWH 4JGMA 4ZAKD 4P2QE 1XGYL 1WC7B 3OR6A 5FCUL 4HS3B 3UAJC 1CGYA 2XOTA 1R5WB 5E9DD 3IDYB 4H25B 3FQUA 3H42H 1JWUB 4ODWB 2YPLA 4HKXA 3QUXA 3DLQR 1AXTL 4OF5A 4ZS6D 4NDMB 1S3KL 3D87B 3RIAK 3L3JB 5EO1A 3FMGH 5IG7B 4OB5H 5JXAH 2OJEA 3MA9H 4TOYL 5TF1H 1Y0LB 2XA3A 2OI9B 3LS5H 1H0DA 3HE7B 5K59F 3VH8B 2YD1A 3H2WA 2EC9T 1KXQE 4ZTPL 1KCRL 1F97A 4G8EB 4RMWA 4A6YL 1DE4B 1RUAL 1RZKL 4L4TD 5F7YC 2JIXD 1C1EH 1C8PA 3KPSD 4X4YB 4G6MH 3E1F1 1LE9A 2Q3ZA 2ED7A 1AC6A 1M05A 5EUKA 4P4KD 1NAKH 4BQBA 1NC2D 3O9WB 3TV3L 5DJCB 2WBKA 1S9VA 4P2RE 1SQ2N 2XZQH 3GFUA 3BD3A 2R4SH 5GGVH 3V5HA 4EXPX 2O5XH 2DI8A 4S11A 1Q8MA 1JWSB 4G9FA 3G6JF 1KN2L 4M3KB 4HD9A 2OS7A 5E2UH 1KJ2L 1QSFB 4CJ0A 5DD1L 1AY1H 1MIML 3A6CL 4J4PC 4HXAL 4H26A 5C6TL 3KWWB 1NAMH 4ODTH 4P46C 4MX7B 3WUWG 2LU4A 5GRUL 5I66B 5D7KD 4M6NL 4PR5B 5EZIL 4KDTC 4K8RC 5TE7H 5HHMA 1IQDB 2OCFD 1NGZB 3KLSA 2YXMA 4UIMB 2HTLD 1A6TA 4H8WC 5D1XA 3BKJH 1LP9E 4X5WA 3U1SL 2PW1B 1ZT1A 4HUMB 3TA3A 2R2HB 4I9WD 4PJGF 4ZFOL 3RVTD 1MFAH 3QEQD 5IVNA 3SKOB 1T0NA 3GB7A 3SDAB 2QSTA 1KNOB 1I1FA 1C7SA 3MLSH 4M5ZH 4MWFA 2ZUXA 2EDNA 3GSUA 4MNQB 3ZDYE 3LKSA 3IDGB 1T83A 5CHNA 15C8L 4QTHA 1ZHLA 5F9AC 2V7NA 4V1DA 4L3ED 3PJSB 3T4YB 1XCQA 3X11A 3HMXL 4PJXA 2CKBL 2DQDH 4OF6A 2Z8RA 3IDJB 3LQAL 2DQJH 3WNMA 1OGTA 1ZLUH 3KXFA 5HGAA 5DVMA 5FF6A 1RUKL 1G1YA 3TPKA 2EDRA 3DXAB 4MJID 4MJ4A 3GMNA 1DP0A 1FVDA 3ULVL 4E0RB 3IAPA 1O0VA 2IPTL 1DQLL 3MROA 1QRNA 3IDXL 1MCBA 3DIFA 4ZFFA 2C7UB 4KXZH 3U83A 5LKNA 4OZHF 5CJBA 2DM3A 5HYJE 4ZODA 1DQMH 3WDJA 4GAYB 1E4KA 5DFTA 5HHME 3O6LH 4XNQB 4GW4B 1N4XH 4CVUA 3P0VH 3RWJB 1KLUB 2BNQB 4NO0A 4PIRF 2W07A 3JUZA 4D0CA 2MCG1 5HSFA 3BH8B 4JPKL 1CI5A 5D93B 5F7EH 3TC9A 4O5LL 1MJUL 1UJ3B 2ITCA 2OBGA 1E6OL 1NAMB 5LGHL 4F2MA 3B8SA 3CDGA 2VE6B 3KPQB 3UTZA 4HIXH 1HOCB 4JY4B 3MGTA 1VGEL 5D7IA 4F15C 4Y2DA 4PJ7E 1MRCL 4PRPD 3M07A 1HSBB 3HAEH 4LPXA 2NLJA 3C9NA 5DJ6B 3ARTA 3MLZL 5HHPA 3MREB 4RNRA 5CP3H 3QPQC 1YECH 3SPVB 1DVFB 4PGEB 5BV7C 1AO7B 2W0LA 1QA9A 3OF6A 3PWPD 3NCCB 4UILH 1T03H 3TBWA 1QRNE 4LF3B 2R0KL 1BVLB 1H8OA 3BP4B 4NQSB 2KPNA 3ZE0F 3BUYA 1W72B 1RVFL 1D6VH 2CRIA 3EJYD 4J12A 3UPCA 4TVPD 1MELA 5EIIA 3CSYA 2HG5B 32C2B 1IILE 2P5WE 4XP6H 2NMSA 1RHHB 3ZT7A 3IKCB 4M9OA 3VD7A 3H8NA 3FB7B 4IIQA 4LLDB 4K9EH 3CGTA 2N1KA 2ORBH 4UDUB 4NHUB 3BZ4A 5DJ2B 5GZND 3IAQA 1GHFH 1JBJA 3DJ9A 1FFOB 2KDGA 4QF1A 1BQHG 4KVCH 3OHXB 1KN2H 2PYEB 3PL6B 4HS6A 1KJ2H 5IMKB 2YPKA 2VN4A 3ARYA 3L1OH 3NIDE 3BW9A 1QACA 1K3IA 3C8HA 3V7AE 5FM5O 2YD9A 3F7RA 3RTQD 4AK1A 1M7XA 3FO0H 1HE7A 1A3LH 3SCMC 4CKVX 3GJFK 4POUB 5C0GA 4CW1A 3SDCB 1AP2B 1TJGH 1RMFL 4G6FD 2ERJB 4EUPG 3T1FB 1NGYB 4LLUB 4NFCA 5CWSB 4JVPA 3JV0A 1FFRA 3HB3C 5EOCJ 4X99B 4FXGB 3IU4L 1VFAA 1F3JA 3V0VA 4HJJL 4J4PD 5C9JA 3DUSA 1N8ZA 5E8DL 3QUYC 5J11B 4NZJA 1DTUA 4P46D 5F1NA 4HMCA 1RIHH 4X9BA 1I4FA 2P8LB 1MCDA 3HAEB 4LSUH 3TVMB 2DQTH 3ME0A 3KVQA 4K8RD 2Z8WC 2VZ3A 3VWKD 4PJHB 1JV5A 2Z8VC 5M95B 1KXVC 1I9IH 2Y7QB 1F6FB 3ARSA 4N0FB 5TDOB 2G5RA 1IGJA 4AIXA 1CYGA 4XWOD 3QCUL 1MCHA 3SKNB 4M8QB 1FAIL 4MQXC 2CKBH 2CGRL 3BP7B 1KELH 3LSOA 1GGBL 1WT5A 4APQD 3MLUL 1RJZA 1QHPA 4P5TA 3C8KA 1N0XH 1D5IL 3DX8A 1NMCC 3N1FC 2F5BH 2MKLC 3PWJB 5HYSB 1L8JA 4Q9RL 4LHUA 5E2WH 4YLQT 2DLHA 1MSPA 5MENE 3PHOB 4G9DA 4QKXB 4XXCC 1QLRB 5CJQL 3DYOA 4MA1C 2GI7A 4WUUA 4JY6B 2EH8L 1IGCL 1S8DA 1MCOL 3RWDB 5FO8B 1FG2B 2J4WL 3VFOB 5H35A 4TTGA 5FM8A 4KUZL 4JO4H 2JELL 5HHVL 5C0BD 3UTQA 1WF5A 3FONB 4F7TA 4UINH 1A6ZA 1E6OH 4XPHH 5B4MC 2P7TB 5EBWB 3FN3A 3HLAA 1INDH 2PTTB 2VZ1A 1ODAA 2XQYK 2Z91A 3G08A 5FB8B 3VFPA 1U3HA 1HWGB 1NANI 4GUPB 1KENH 1OGAD 1VDGA 2BVYA 4HEME 2FBJH 3OB8A 4Y4KC 2W38A 4DVBB 4YEEA 3CH1A 3PV6A 4YEFA 1TJHH 1XAUA 1MQKH 4LVNB 2ENSA 3DV6A 4DN4L 3FO1B 4YIQB 5FO9B 2IQAA 1I1AA 1VPOL 4RRPG 5ICYB 2FX8H 4AEIL 1JN6B 5FM4A 5C3TA 1TNMA 2ITDA 2R1YB 4MAUL 2NNAA 4P9MH 4LCWE 1FZJB 4H8WL 5F89B 5HHOD 1BOGA 3RHWF 4GRWF 2IALB 2ESVD 3OGOE 2BVUA 2EXWC 3B8YA 3QQNA 1NFDB 3JTTA 2EYTA 2GIYA 4M7JL 5F88A 2VDMH 1JI1A 5I8CA 2NR6D 1RV6X 1INQB 3SQOH 5IR1A 3EFDH 2VDRH 4I18C 1HIMH 3RJQB 1LEKA 2F54B 5DJAA 2PO6C 4P2QB 3W11D 4LLWA 3ARFC 1K4CA 4PRBA 4OIAA 4CBPA 4M1DL 2BSRA 3OB0K 4HIJA 4WU7A 1CD8A 1EXUB 2K7QA 3AXLA 3B4NA 1GL4B 1SJHB 4I3GA 3GIZH 4UUJB 1HH9A 4QYOB 1CBVL 4TTDD 4I48B 4IRZL 3QHFH 2I07A 4LSQH 4RFOH 4P23B 1PX3A 4KROD 3GGWA 4PJ9C 1MCJA 5FHAH 1XGTB 3ULSA 3MR9B 5CIPA 1YYLH 1L7TH 2GY7B 2WP3O 4X6DF 1RMFH 4QHUB 4LEXH 2AEQH 2IPKB 3HC3H 4R8WH 3RWIB 2DMCA 3UROR 4HKBB 4XH2A 2FIKB 4M48L 3LOWA 1I9RL 5C0CE 5F9DC 1Z3GH 3VXNB 5DD0L 1PKQA 4U1NB 2BDNH 1AD9A 3Q3GB 4NO3B 4CU8A 2B4CL 1EMTL 1BVKA 3QG7H 4L8DB 3PNWA 3MRQB 3SCMD 1FSKC 1IMHC 2FX7L 4KGJA 5DMKB 2XQBH 4JPVL 4PRID 4P2RB 3VFUA 5IT2L 1NL0L 2DIAA 2GY5A 2VLRE 3H9YA 3VW3H 4U6XA 1BZ9A 2SEBA 3IDYC 3W82A 3STLA 4JQIH 2IPUG 2MWCA 2GK0A 1GGTA 5E1HB 1MVUA 1HEZB 2BXYA 2APTA 2V5YA 1RUML 1WZLA 3FQUB 2EDKA 1OL0A 4M7KH 4ELMA 5TPWH 2H1PH 1S7XA 4RIRA 1FHGA 4D9RD 4FQ1L 4MZ2A 2FGZA 1WAAA 2OI9C 4TQEL 5IJVB 4NM4H 2APFA 2NY6B 2OJEB 3HE7C 3BKYH 2E9JA 3AM8C 1LP9B 2YSSB 3HPJA 2H32H 2ZG2A 5D72H 2PW2A 1YZZA 2DQIL 2W0PA 5SWSD 1DR9A 3MJ8B 5DTFA 1SVCP 1S7RA 1S9WA 3S37X 4NKOA 4UV7L 2P43B 2E7LA 1B0GB 3WFBL 1LQSR 5FYJE 5I19L 1I8IA 2BVPA 3ZMRA 2GFBB 1E27B 4M62L 3T2OA 3O9WC 1WGOA 5FA3A 5IVZB 3MRIA 3BPCB 1EHLL 2VL5A 1HILB 4LLMA 4XX1E 2BMKA 4IS6B 4HW6A 4OCRL 3TLRA 2BOCB 2VUYA 4NQDE 1XF5A 4Y4FD 4Z0BL 1U8LB 1JWMB 2ATPA 3QQ3A 5E99L 4KMLB 4TUKL 1C12B 1G9NH 5C2BL 3RU8L 1N59B 3BPLB 5BRZE 3GMRA 5C7XH 1RK1A 4H26B 1CD9B 3MRBB 3H3KA 5B4MD 4F80A 2QQNL 5HYJB 4WEMB 4LPCA 1UWGH 1A7QL 3OAUL 4LU5L 4MAUH 5HHMB 2QSQA 3CFCH 1XGPB 4JO2L 1ZGLA 1T4KA 4XCFH 5JPNA 2Q76A 1MFCL 3SGDI 3TZVB 1PG7L 3O4LD 3TA3B 4XPGH 3CFDA 3SDAC 5CBEB 1A2YB 2DYPD 4NNPL 5DR5H 3TT3L 4F7PA 2B39A 4PGCA 5C08E 4XNMA 4JDVB 1E4JA 5DUPH 4BFGA 1T0NB 2JKXA 1KPUA 1B9ZA 2L7UA 2E7LE 1M71A 3CPLB 3G6DH 1U93A 4ZO6A 4G6AC 4OLVH 5CUSL 1A6VH 1MRDH 4PJ7B 4QTHB 2Q8BH 4FQHB 2R2BA 4WWKA 4I0PD 5TQ0H 2X9WA 5TF0A 3X11B 4Z7OF 3NACH 2H32B 3FQXB 4HPYL 4Y5YA 4U6TA 3B9KD 2W91A 4KKCC 1FCGA 3GMNB 1I85C 4WW2F 3WHE1 3FQRB 4S1QL 3H9SD 2NYYC 4HCRL 4YUEL 3ARFD 5DEGA 4PBWD 1QRNB 2AJZA 1MCEA 4OZFB 1A7RL 4YWGH 1GIGH 5FO7B 5ISZA 4ZFFB 3X14A 2JCCE 2A6DA 5ILTL 2VSCA 4LKCB 1QBLL 3KPOA 4KK5D 3UZQA 3T3MF 3SE9L 2P5WB 3PQYA 3CVIH 2OTPA 4Z95L 2GCYB 2BNRA 3ES6B 3P77B 4OGYL 2OP4L 5D93C 4JFDA 1T21A 4D0CB 5AG8A 3WL9A 1UJ3C 1FFPA 2HRPH 1OAZH 4PG9A 4QRTA 4XMLL 4V3DB 4ORZC 3D3VA 5I8KH 1E0OB 4G8IA 5JW3L 5I8EB 2X4TA 5C0FB 2Z31B 4I2XA 3RX7A 1FYTA 4F2MB 2LTQB 1UXWA 4Y19E 3PDGA 1FVEA 2GSGB 3CDGB 3OJVC 3ZYZA 5EZJB 3MFGB 3UTZB 1LVEA 1JPGB 1KFAH 4Y2DB 1YNLL 5C70A 1UM6L 3ARXA 4LGRB 5GRVK 3C9NB 3G5ZA 1DVFC 1R24B 4RDQF 3LKQB 5F6HJ 1J0YA 1VACB 3QXWA 3FB8B 5GGRY 2C3HA 1BMGA 4JCLA 1T7VA 3PGFL 3FFDA 1TZIA 4YXLH 2R39A 1JF6A 3DO3A 3RKDD 3ULUD 4BK5A 3NCJH 3TBWB 1XFPA 5D2LE 3OX8B 4CDHA 4GMSL 2BNUB 2JJSC 1BX2A 4MXQA 8FABB 2NY3B 4YBLB 3EYFA 3PQYE 3EOYG 3TJHD 2ICWB 2HLFD 4LNVA 1ZLUK 4JFDE 1JNJA 1RZJH 3TF7A 1JTOA 4IRJA 3RL1B 1X5JA 5F96L 4MDIA 2GTWA 2D7MA 3TNNA 4FXLA 4XP1L 2AK4A 2EZ0C 5EORH 3PL6C 2JJTC 3MRLB 1U42A 2B0SL 2E8YA 3HUJE 3W9EA 2LAAA 4LSDA 2FSEA 3REVB 1XGRB 3VXTB 4HIIB 2YA2A 3FT4A 5EU3A 3O9WD 5AYQA 4U7MA 4MNGA 3SDCC 3B3IB 5D96B 4M7LT 2ERJC 2CH8A 3K2MC 3O3AB 4CW1B 4GAJL 5MENB 3OKMA 4HFWB 4F8TA 3RL2B 3RZCA 1YNTA 5D4QA 2VLJA 4EBQH 1Z9MA 1KEML 3LEXA 1NMBH 1I9JH 4PJDF 3VE0B 5DF0A 3VD5A 2QQKH 4PB0L 4U6VH 3KAAA 5J11C 2YZ8A 4BJLA 1IC4L 1MF2H 4TSCL 3SDDA 3WN5A 1MWAA 3V4PH 5GGSB 5TDNA 3TVMC 5J6GB 2P5EA 2XXCB 3QNXA 4KJYB 5B22A 3SDYL 5KS9F 5IWLA 1IFHH 3WIFB 2BHYA 4X5XB 1QBMH 3OKEB 3WJLC 3N1PC 5A2JH 5E7BA 3SO5A 5K9JL 1FNFA 2HAZA 1OTUC 1MCKA 5DC0A 3B2VH 3BDXA 1E4XI 3TH4T 2V2TA 4X4XA 3MOAL 1S7SA 1ZE3C 1Y6KR 4QNPF 1WV7T 1WWAX 1U36A 4DW2L 1S7QB 1WWWX 1A7NL 4GRMA 2UV3A 4YHKL 1ZT7B 5HVGB 4S1RL 4KHTL 3EUUA 4CNIB 4MNQD 3IXAB 5T3ZL 4GW5A 3P0YL 3HG1E 4ZO8A 1JZ2A 3G6AB 2X09A 1K85A 4LCWB 3F5WA 5EU5A 3CMOH 3EYVA 4UQ2B 2VL4A 4FMKA 4K9EC 5JIIA 3IF1B 3O3BB 1JMZA 2VXSL 3IS1X 4K23L 5C0DB 5J56B 3UJJH 2D0GA 3R06A 3RNQA 2FCBA 2H6PA 1AQKL 3DXAD 4MQSB 4JFXB 2XWTA 4G3YL 4KKCD 1AIFA 2P4AB 2ZUSA 2J6EA 2NYYD 2EICA 3L6FB 3MBEB 4C55A 5IHBA 5IW3A 3UTQB 2GJZB 3HI5L 2VXTL 3QR2A 2B1HH 3MRNA 1MVFA 2X89A 3QUZA 5FYJH 3LH2H 1SY6H 3MRJB 1NDMB 3WHE0 1AKJA 2BNQD 1DBML 2IFGA 3EZ8A 4LRIA 1AXSA 2I60H 5EBGA 1U8NA 1V3KA 5MEOA 5F7DB 4JM2B 2IWGA 4FP8L 4LVNC 4U6YA 3CH1B 3PV6B 3WMSA 1Z0NA 2XIDA 3EFFA 1S7VB 4FZEL 2QQLL 5C0CB 3SO3B 1M1SA 1S7TB 5LBSH 3WFEH 1N6QH 1MFBH 4LGPB 3UTPD 3IJHB 2NNAB 4YZFE 1I3GL 3KJ4B 3P9MA 1D5BA 2WMPA 4KK6C 1D5ZB 1C5CL 1XR8A 1ZA6A 4NKIL 4NRZA 4W81A 5IVOA 3HI6L 4NGHH 5BZDA 5IB4A 5JW5A 2W0FB 1BF2A 4LMQI 1AO7D 4WTWA 4BQ9A 3ZO0A 3ARBA 3CZFB 4FQXD 4IDJL 3S97C 2VLRB 8CGTA 1ED3A 4X9IA 4GG6A 1YDPA 4QRRD 1IC5L 5IQ9B 2AABH 2M2DA 3AXLB 2EDYA 1T2QH 1YEKH 2E7MA 3IDIA 2D03L 4XMPH 5GGTH 4ODVL 2AS5M 4ZUSB 2UVEA 3NIGF 4P23C 2HN7A 1XMWA 3ZSSA 4JZOA 1H15A 1B0RA 5GGQL 5B3JF 2UYLA 2W65B 2ZSVA 1YA5A 4RRPA 12E8L 3RX8A 1V3LA 2IANE 4GAJH 4QRPE 2YRLA 3UTSE 1LEGA 4AMKL 3K4AA 3O8XB 4XVTL 2AJUH 1MHEA 2Z93A 4XH2B 3QG6A 5EUOE 1KPVA 4TSAL 2PYED 5IF0B 4KJWD 2NX5A 1DL7H 3C8DA 4KQ4L 4HIHB 4QHKJ 3G5VA 3WFDL 4NQED 4GKOA 1VESA 4XWGL 4UDTB 3WNLA 2X9YA 4JANA 2VAAA 4XPAL 4B7LA 1T22A 4K94L 1J88A 3BEWB 5SWZE 3PNWB 3SDYH 3SDCD 1JZ5A 4OI8A 5IHLB 4JDZA 2AJSL 4N90E 3W5NA 3U4BH 1FE8L 3CFJB 4NQDB 5HHXL 4LSTL 4LSVL 5JDSA 4NQXA 2DL9A 3DI3B 3MRDA 4Y4HA 25C8L 4OKVB 5DQDH 5CEYA 3TFKA 4NO2B 1IAKA 1UH3A 4W4OC 5L0QB 5GGVY 3BD5A 5MEPA 1DBKL 4HBQA 3QUXC 3WXWL 5BRZB 1DLHB 4OF3A 5J0BA 5KZCB 3GI8L 1S7XB 4EDXA 4PS4L 4J8RB 2R4RL 2NY6C 1P1ZA 1OTUD 4R96B 1KIQA 4PLOB 4WHCA 1UGNA 3VXUA 5A16A 1F3RB 4HGMA 3ZE1F 4Y5VB 5SX4I 1EGJH 3HPJB 4OLWH 4ZNEA 1SEBB 5JOPD 5JHLH 1W72L 1EHNA 4K3HA 1U92A 3FJTA 3DRTA 5C08B 4PJCA 5GHWL 1PZUB 1MUJA 4NKOB 5MP6H 3T0BA 1BJMA 2FD6L 2RR3A 4JHWL 1U8IB 5EIVA 3PWUA 2A9MH 3GI9L 4WW1B 3X3FL 2DTMH 43CAA 1XR9A 3K46A 2XKNB 2YKLL 3D39A 4RZCA 4WV1A 5AZ2L 2I27N 5KSAB 3DX9A 4ODUA 5A2LH 1DBMH 1U8QB 3E8UH 5KSBA 3WFCL 4Q0XH 2XYCA 2Q86A 1OP3H 2A38A 4JB9H 3AS0A 4ENEC 4ODXA 3LZFL 3BPLC 1FRGL 3BH9A 2DBLL 3H9HB 4O9HH 1LE5A 1M7IB 5FOJA 2DRUA 3LKPA 4WJ5A 3RAJH 4OV5A 1KIPB 4JFYB 2JCCB 1RK0A 1VKXA 1J1OH 4XXDA 4HLZG 4K7PL 2KUTA 5T5NG 4FTVA 1I3GH 1MIEL 2X4OB 3UBXG 2JLLA 1IGIH 3TZVC 3TA3C 5I30L 4BSWA 3S36L 1T4KB 3QUML 4QRQB 4NKIH 3QDJE 1INEH 4ZNEE 5T3XH 3QH3B 5MHSD 3HI6H 5CMAA 3K2UL 3MO1B 4LFHD 2WWMC 3CFDB 3RWCB 3NABH 3C6LB 3RI5K 1K3ZA 1XZ0A 2L0DA 4XNMB 4PYGA 4IDJH 3U7WL 5F97E 4Z7VF 1GOFA 4NC2B 5FA4B 4EEEA 3SGKC 1OAYL 1OM3H 3FOLA 3W5MA 1M71B 2YD5A 2EEAA 4Y19B 5H2BA 3ZZ1A 2EE3A 2VH5H 4NWTH 1IAMA 3STZB 1EEZA 1O7VA 5IBTL 3UC0L 1CT8B 5H8DA 4ALAH 5DFVC 3VD4A 5IFAH 4R4NC 3VRJB 3U9PL 4J3SA 1OWRM 4FQQB 4IMLA 5I1HL 4HKJA 3MV01 3WUWB 5ECJE 3OGCA 4S10A 3V4VL 5L7XL 1A1OB 3UO1H 4JRXA 5DEGB 1CLOL 5CP7A 2VLKD 2AJZB 1T1YB 5D2LB 4FQLL 3C5ZB 1LQVA 1E4KC 2Q7NA 1OWWA 4OCXL 3E3QA 4KQ4H 4KI5E 1IAIM 1RUPL 3VFGL 2WQRA 4BZ1L 4OZIE 4WFFD 1MJ7H 5JXEC 1IQWH 5LGKA 4B41A 4XWGH 5FFLA 1WK0A 3A6OA 3PQYB 3TT1H 2ZUQB 3H3PL 1RURL 4K94H 3V6FB 4KAQL 1ZVHA 1G9NC 4GXVH 4JFDB 3EAKA 5DT1H 1QFWM 4MCZA 4ACPA 1TTGA 4LLYA 4QRTB 5FDWA 3U79A 2AKRA 2Z31C 2RFXA 4AEHH 2LTQC 1DSFL 1NBVH 2BJMH 4G8IB 2A1WL 2D2OA 2R69L 2X4TB 1ZSDB 1KIUA 3MLYL 3MRCA 4X6EA 4ZDHB 1X4ZA 4L9LA 3HUJB 1FVEB 1FL5A 4NWUL 4KJPC 4Y2DC 4FFWD 1P7QB 3R1GH 2XY2A 5E8NB 5HTSA 3WIHL 4YGAB 1CDJA 4KC3B 4OM0L 3EDDA 1WQVT 3G5ZB 3OKNB 4OF7A 3TBYB 1IC7H 4X80H 5FKAA 5IESL 3EOBB 2GSIB 1A14H 3GMPA 1MHPH 3T0WA 5EIQA 4HK0B 5C2UB 3QIUD 4M03A 2V5SA 3IFNH 5CGYC 2JJVA 3MPCA 3GSNL 4PJGA 1IGYB 2NY3C 2YR3A 4YBLC 3MCKA 1UACH 5DD5H 1JK8B 3DETC 4PY7A 4ZFZA 4X7SL 3T0ED 3EYFB 4EUPH 3X3FH 4N0UE 2FWOA 1MCPH 3HZKB 1UA6H 3VXRA 5JOEA 3KPRD 4RMVA 5DZLA 2GTWB 2HVJA 3JVGA 2UZYB 3IJSA 4MXVF 1IL1B 2EE6A 3HFML 1F4YL 4LCYA 4OFYD 1RZ8B 5LWYH 3X12A 4J6RH 5BQ7A 3DTXB 3NH7L 3HG1B 1MPAL 4KU1A 3C5SA 1J05A 3N06B 4KZDL 4B5EA 3LMJL 4WEUD 3G6JE 5D96C 5EU3B 2HT2D 5AWNH 5HHQA 4RDQG 3B6SB 5IQ7H 5IB2A 4TUJB 4FQJL 3SY0B 4K7PH 4R90L 4HV8B 2ZG3A 4ZQKB 4U1MB 3JWDL 1FNGA 4GXUM 1ZGLM 1XGUB 2FRGP 3VXMA 4YBQD 3SDDB 3NCMA 4K2UH 2GJ6E 5L2KD 5HYJD 2NY7L 1DQQA 2MTPA 4PJGE 4GH7B 1LGVA 2ZSWA 1QG3A 5KANG 3E2HB 4QWWD 2KZ1B 5IHZB 3MNWA 4MD4B 4F7EA 4WENB 1C5DA 3O6KL 1BZ7B 3Q6FA 1AD0B 5HGHA 2WSKA 3CNKA 3TZVD 3OJ2C 3I9GL 2V2TB 2F58L 1X3DA 1BQHB 1K2DA 4QOKA 1BLNA 5C0EA 1WT5C 3V0WH 2C3VA 2VB5A 2ZUUA 2BOBA 1WTLA 1D6EA 5J7CC 2CUHA 5FCSH 5B3NA 5IEKA 4OTXL 5D71L 3QWOA 4AH2A 3MYZA 4B7IA 1FJ1B 5D1QB 3FCTB 4PJ8A 1X4YA 5EU5B 2VKXA 4EUPB 4Z7WF 3NZ8B 4I0KA 4YO0B 4EXKA 1QNZH 1T04B 4PJ5A 4X6CE 2NW3B 1OCWH 3L7FA 3R06B 1F02I 4ZUUA 4OZHE 1OP9A 1A6UL 3HZVB 5DFVD 5TQ2H 4R4ND 3O0RH 4WVRA 1TZHA 3MBEC 5T5FH 1TDQA 4HWEL 4MAYD 4PGDB 4OCYL 3T08A 2OMNA 2LU3A 1RD6A 5F1KC 5F9JA 3X3GH 3MLYH 2P5WD 4O4YL 3VFVA 4FQIL 3CC5B 4OAWA 4JM2C 4F33A 5TE6L 2HWZL 1TJIL 2AV1B 5I17A 3RPKA 1GC1L 3DRQB 3DURA 4FQCH 4CADA 2VISB 3QCTH 2OK0L 1OW0C 5GS1B 3VFTB 2D4FA 1QTYT 4QOKE 1V8HA 2A74A 2IANB 4QRPB 3THML 2W9DL 3UTSB 4BSVA 2H8PA 2HFEB 3OXSB 4KVNL 2Z31D 5HI5D 1DFBL 4LSRH 3MNZA 3SO3C 2CDGB 3EFFB 5EUOB 1IEBB 3L9RB 4NT6B 5HPMA 1SM3L 2DL2A 4HZAA 4PJFE 4PJAE 2NY5C 3M1BA 1LILA 3UJIL 3KJ4C 3MYJA 1BWWA 2X2YA 4IEFB 1U8KB 4YE4H 5DJDA 3K1KC 3CLFL 3C08L 3JWOH 4FMFA 4G7YL 2IQ9H 4WGVB 3VFWA 4MMZC 4MA3B 1XR8B 2YPVL 5SWZB 4NRZB 4BQ8A 4WNQA 2F53E 5EZLA 3BN3B 1QVOB 2WUBL 3O2DH 2V2WB 4HF5L 1H5BB 4ETYA 4K3DL 4DFHA 4WFED 3MSPA 4ONGL 4JFEA 4KK8D 2JB6A 2VXQL 4YC2B 5GJSH 4LK4A 2I9LA 2M8XA 4HUWA 5D5MA 1PG7X 3BT2L 4XZUB 1IAOA 4GQPH 3HFMH 1OSZA 3QI9A 1X7QA 4LQFL 4X7CC 2ZPKL 3N85H 1QLEH 3PG2A 3KNBA 4H1LA 5CCKH 6FABL 5HDQL 3IFOB 4ONFL 1B0RB 1TVBA 2P24B 2ZSVB 3O8XC 4NCDA 1I8KA 3BHBB 5CD5D 2XTJD 2J5LB 5DRZA 3KJ6H 3SBWA 1XT5A 4JLRB 5I71B 4LASL 2Z93B 1TETH 2VZOA 4H20H 1NMAH 4OF8A 4UNUA 5I1EH 3G5VB 3K8MA 1L4IA 3MCLH 5JZ7D 1OHQA 1H3PH 3MV7E 5MEND 4FXKA 4HWBA 3MUZ1 4Y16D 3EO0A 1JTTA 3U30B 4DZ8A 3H0TB 2VKWA 5L0QC 3MRDB 5DGRA 1LEIA 5DRWB 3F7PC 2A77H 3WNNA 3UTTA 2Z35A 2LV4A 3SE3A 1EUUA 2MQ3A 1WBXA 4LIQE 2AJXH 2HKFL 3J8F7 1MLBA 2C5DC 5CZVH 1BQSA 3NGBB 2AEPL 1GAFH 5D71H 2CDFB 2CLRB 4KJQC 4NQUA 4PJIF 1JF1A 4Y5VC 3RWHB 1KCKA 5DK0A 3QIWD 4DGYH 5ABDE 5E8EA 4WHTA 3QDJB 3B5HA 5ACMA 5DJ0A 1U8MA 1NCAH 4L3CB 2E7LC 4FNLL 3BQUB 1VA9A 3KG5A 4LSPL 5D6DC 3JV6A 3O6FB 3BISA 4LCWD 3FB5B 3ROOB 3PXJA 5JOFA 2X1WL 2CUMA 2HKHH 3FKUS 4HIEB 5JW4R 5KSAC 4PREA 2EDJA 1CL7L 1JRHI 4WV1B 1AGFA 1G1CA 3DX9B 4ODUB 1YC7A 2RGSA 3HKFA 5TE6H 4U1SB 5FGRA 2Q86B 3MJ9A 5IHUH 1FIGL 4LDLB 2R9HD 3RA7H 3MBED 1G6RA 3A6BH 3FFCD 4PBVC 3BH9B 4JFZH 3EYOB 1PLGL 1N5AB 5D1ZB 4ZAKA 2W9DH 5IVXF 1S9YB 1UH2A 1DBJL 3LKPB 4G5ZL 4JG0L 4KV5F 2J8OA 4LLQA 5E9DA 3U0WL 4DVRL 2X4QB 2OX5A 4C83B 3UYPA 2X9XA 1IKNA 1TXKA 3SKJL 3V6OA 4X6DA 4AENA 1Z9SA 1PEZA 4OZIB 1WBYA 1CQKA 4JFHE 4EQ2A 4JM2D 5K9QG 2VDNH 4JCMA 3WFZA 4WFGE 4XPBH 4XCCL 4M9PA 1I9EA 2XQYG 5FUCC 3C6LC 1KULA 4NP4H 3RVUD 5CMAB 5LGJA 4FZ8H 3EO9L 2I24N 1BAFL 4GRWE 5C0CD 1UFUA 5ESQA 5CGTA 3QPXH 4XGZB 1WSST 4ONGH 1IKFL 3BN9C 4Y88A 1E28B 5F7FA 4NOBA 3AGVA 3ARUA 1KT2A 5BS0E 4L4TA 2JIXA 4XVUD 5AZEL 3KPSA 4D0DA 2WIIB 4NO5A 4U1HA 2ZG1A 1UZ6F 1CFBA 4IOFD 4M3JA 5I1AB 4P4KA 5GGSY 2WP3T 1NC2A 1F6LL 3V6BR 3QDGD 4ONFH 3FHQA 1J8HE 4ZUVA 2I5YL 1NCBH 3BAEH 1B4RA 4NBYB 2DWEB 5D70H 4ODHL 1LO0L 5F71A 1ZS8A 1R3IH 3C5ZC 3D2UB 4X7DC 5J1AA 1KSRA 5E9DE 1KB5A 5FYLH 5C0AE 3OKKB 3IAGC 2PTVA 1CFVL 3DV4B 4X9HA 1GZPA 1LK2B 3GIVB 4DTGH 3RWFB 3C5JB 2DQUH 4X6DE 2FO1A 5DHVH 2CK0L 1EDQA 2ZUQC 2VITA 3ZLQC 5EO0B 3FQWB 2X4NA 3EGSA 4O2CA 4XVJH 4P59H 4N0UB 2NY4B 2V7HA 5T1DH 5LCVH 2F19L 4IJ3B 5DLMH 2AXGB 2H3NB 5F9OL 3TYFA 4D3CL 1W0VA 4ERSL 1FO0H 3QEQA 2AKRB 2R1XA 5FHBL 1T0PB 4DN3L 2CRYA 1CGSH 5FYJD 1LP9F 3BPNB 1AGEB 1CDHA 1X5FA 4Q2ZA 2HT4D 1J0JA 3BZDA 4JN2A 2HLAA 1FZMA 2BSSB 4OD3H 3KPSE 4JR9L 5ID1A 1A7PL 3G6JB 1JHLL 2IF7A 3K0WA 4PRDA 2CIKB 4NQDD 1CR9H 4NHCH 4O02H 4L3EA 3PGCB 5FKAB 1PBYA 1QYGL 3P4OA 3L3DB 1GXEA 1YEHH 1FLRH 3ZT5A 5FYJU 5L9DL 3ZDYF 5K9OA 1UWEL 4HH9B 2AJVH 3PWLA 3OSKA 5BRZD 4MJIA 2Y06H 2ZWLT 3OAZH 3S96B 3AY4C 3TN0B 5C3LD 2GJ6B 1KACB 5DUMH 1CF8H 2WWKO 3VG9B 3ARDB 1N26A 3T0DA 4PJGB 3QDME 3E6FB 3MCKB 2VUOA 3CX5J 3CVHH 3KS0H 4KJQD 2APVA 1TVHB 1MFNA 4Z8FH 3TF7C 1E4XH 4IRJC 4L3AA 5IIEA 2FECI 4L4VD 2AP2A 2VC2H 2J8UE 3L3OB 3SOBH 2ICEB 3JV5A 3VFMA 2Y5TB 5SV3A 4WI6A 3QEQE 5J9PB 2NY1B 3BDYH 2A83A 1CXIA 3V95A 3GHEL 1CFTB 3BO8B 3HNVH 4BKLB 1JCKA 4NSKB 2ARJQ 5IMMA 2H2PD 1HI6A 5DHVB 4HGWA 1PDKA 1VFBB 4JG0H 5JMRA 1KCSL 3U0WH 1HQRB 1OTSD 2V5TA 2YN5A 4M1GH 1MCQA 4WW2A 5KSAD 4BM7A 3M8OH 5IB2B 4CMHB 1XF4A 3ZT6A 5L8LB 4P48A 4WTXA 4J1UB 3NTCL 2YUVA 1IAIL 1IGML 3F7VA 4X6CB 4NCC1 4OZHB 2DDQH 5F3HA 4O2EB 1FO0B 2CR3A 1X5GA 2K9UA 4PJ7F 1FNGB 4CVZA 3QULA 3SDDC 2XICA 5J1SC 3WD5H 1HH6A 2CLZB 4K7FA 2HH0L 1QFWL 3DVGB 3LD8B 3PWPA 3AS2A 1BAFH 4X6BB 5C0JA 3E2HC 1KLGA 4P5MB 3M17B 2MSPA 3LEYH 2CQVA 2K3TA 2NCMA 3QNYA 4JHAL 2Z4QA 1H3GA 3JWNC 2WUCH 1HZHH 5F7WC 4D94A 3BOVA 2XA8L 2QHRL 4XC3H 4XNYL 1RFDH 3G5XB 5I1JH 5ICZB 3TIDA 3C6LD 1Q9LB 1K2DB 4QOKB 3LKRB 5IROC 1HYSD 2XZAL 4WEBL 4ZD3H 2C3VB 5HDBE 3F58L 4JRYE 1ETZB 1MCWW 3D0VB 2I5YH 3ALPA 1PD6A 4Y19D 1D6EB 4PJFB 4PJAB 5D1QC 5C6WH 3WBDA 3QWOB 3IFPA 5EC1B 4LIQH 4U33A 3CVHB 4PLNC 3FRUA 1J1PH 3RVWD 2OR8A 3K3QA 3IYLW 4FQ2L 4PRPE 4QCIA 3TYGH 3WNOA 2F53B 4ZUUB 1VEPA 2VSDA 1TZHB 3H7LA 1AR1D 3QEUA 3PWPE 3V79C 2YRPA 3C5ZD 5IP4A 1WEJL 4PRAB 4ERSH 4GMTH 5B8CB 2EC9U 5EA0L 2YC1A 1ES0A 1BD2E 1TVDA 4J4PA 4PB9H 4DN3H 4LRIC 5DD6A 4P46A 5I6XB 1ZAGA 4AM0B 3VFVB 1P4BL 3VMNA 2MNUA 2XPGB 4HFUL 4LPVA 1YMMD 2P8PA 2I9TA 2R0LH 5GS1C 2R23B 2Y36H 3VWKA 2WANA 4HHAB 4H5SB 1MCNA 3O2VL 5B39G 5IW6B 2QBWA 4XCYA 1YY9D 2A74B 2OL3A 1ZLSH 3BIKA 1UWEH 1SYSB 2CMRH 3U7YH 3MV8A 3VGAB 1ORQB 1P7QD 3GZKA 3O6MH 3P4NA 4APQA 1I7ZA 3HRPA 5I75B 4UTBL 1T5WA 2GK2A 3H3BC 2APWA 4UT6H 4YAQB 5T3XD 4PJDA 3MJ7A 3MV7B 1H5BC 4GKSA 4DKFL 5JR1L 4ZPVA 2GYSA 1J1XL 3ARBC 4LVOB 2O5ZL 2NW2A 5ESVB 2DLTA 4RBPH 3EO1B 5E8OA 3ETBF 5KS9A 3HRZA 4YC2C 4K7PX 3C2SA 4N0YL 1NGWA 3KS0J 4U0RB 4BFBD 4BH7A 5D8JL 4ISVA 1K5NA 2Z0BA 5IK3A 4IHOB 3P2TA 5DC4B 3CFBB 4KI1A 4YXKH 1OSZB 5GS0C 4KKNA 3U4AA 1X7QB 5DMGC 2VR9A 4K3EH 4Q9BA 4JN1H 2Q87A 1U8OB 5E00A 2P47B 5JW4N 1DCLA 5I2IA 3V0AC 1ROWA 5SX4H 2B2XH 3BP5A 1OGAA 2J5LC 1PW3A 5ID0B 5I71C 2R2CA 2ZCHH 5DEZA 4R4BA 5E8PB 2G9HA 4M5YH 3AAZB 3W0WA 3HG1D 5ANMA 3INUH 4KUCD 4BUHA 4WO4D 5I16B 1QFPA 1V7NL 3RY6A 4PJBE 2EIBA 4QRUA 3IRZA 4TYUA 1FNHA 1QEWA 3TBVA 5C86A 4C57C 1NJ9A 5HHOA 2BHUA 5TDPA 4O51A 3T77A 4YHLL 2ESVA 4GBXB 5L88L 3GK8L 3U30C 1UB5B 1QQDA 3GNML 4MD5B 5B38B 2C1PA 1CE1H 4YDVA 4KQ3H 4XNYH 1W0WB 3WLBB 1NGQH 4E41A 4DZ8B 1AHWB 2FGWL 3D85B 2ZZUT 5ITBH 4NKMB 1LEIB 3MUGA 3SGEH 1LD9B 2P48B 1KN4H 5DGQA 3F58H 3NGBC 5C0BE 1T66C 4HJGA 1BWMA 4UNTA 2AI0H 1R3LB 4OI9A 3ARPA 4GW1B 2LVCA 4HUXB 5JLZA 1WLHA 1Q72H 3JTSB 4OCMC 3T09A 1NDGA 4KKBD 1FNEA 1BFOB 2VIRA 4O58L 4AL8H 3WKMH 2GITB 3JBG7 4G8GD 4FQ2H 4ZMAT 1U2CA 3TWCH 5I74C 1Q1JH 5DK2A 3DGGB 4OFPA 3BQUC 1F4XH 5DO2D 5INCA 1GVIA 1UVQB 5DDHB 3O6FC 1AGBA 1NSNL 1U8MB 35C8H 3Q1SH 1YN7A 3K8LA 4XBPA 2PF6A 4GRWB 4UIKH 3FAWA 1XIWB 5DUBB 4OSUH 5FK9A 5JIPA 2Z9TA 4JM2F 1Q9WB 3JV6B 1UCBH 1JPTH 4EI6A 4G6JH 5D1QD 3V5KA 2OSLA 5BS0B 3V4UL 5J3HC 3SQBA 3HZYA 2AV7B 3GSWA 4HT1H 4WV1C 1PQZB 4J7RA 5HHOE 3S4SG 3MBXL 4PREB 1A1NB 3HI1B 3U0TA 5I76B 3SCMA 2X7LA 4AYFA 4HWZB 3OG4B 3FT3B 4DAGL 2BCKB 4HFUH 3MLRL 4PRIA 5EPMA 4IRSD 3P11H 5D1ZC 1J8HB 4WY7L 3HNTL 3DBXB 4U1JB 1G6RB 2AJ3B 5AYUL 3RY4A 3K80A 4ZAKB 2EEBA 4M1CC 1J5OH 4J3XA 3MLPA 2FR4A 1D5MA 4F57H 5C0RH 3NA9L 4KI5C 5E9DB 1W0YT 5C0AB 4YFLF 5IB1A 1HSAA 3D69B 1YN6B 1EJOL 2A6IA 2CLVB 3QUYA 3CUPA 3HS0A 2VLLB 1N5YH 4X6DB 5DRXA 4AENB 1WBYB 2X44D 1HXMA 4UTBH 5INDA 1CLZH 5E2TL 2GT9A 4P5KB 2C4XA 1TFHA 3NFNB 3PP3H 2IAND 2ADJB 1YYML 2B7DT 1MWAL 2E9WA 2FYYA 5LGJB 1CGVA 3OR7B 2O5ZH 5IMOA 2R1WA 5SWSA 5E5MB 5HYQB 4NJAH 1BFSA 5GZOD 1DUYB 1FNSL 1F00I 1A64A 4LFHG 2BVTA 1FYHB 1DBAH 1QLFA 1GPOL 1GSMA 1W2KT 2VDKH 3EOAA 3I50L 3KPSB 4D0DB 4U1HB 2WINA 4P9HH 1ITBB 4GQ9L 4MXWH 1R3HA 4S1SL 4KZEH 1SYVA 3PIQA 5DEFA 1B90A 2YZ1A 1NC2B 2AERT 3FOMB 4G8FA 1LO3L 1NCWL 4XAKE 4JQXC 4XXCA 4YHIB 2G60H 2BFVH 3CX5K 5EOTB 2NY2D 4OUUA 3SDXE 3NIGE 2HFFB 5KSVB 5KVEH 5KOVC 3UBXB 5GGRA 4XI5D 4ZOEA 3QDMB 1B4JH 1KXTB 2D9CA 3Q5TA 5BVPH 3QQ4A 4N8PA 2VITB 1G7QA 3LKOA 4OD1L 4D9RE 2NY4C 3SE8H 4X9GA 2X4NB 3CDFA 1ZA3A 3EGSB 1FV1A 4ZYKA 2D3VA 3U2SA 2NZIA 4HKZB 1G7LA 2J6EL 1MFDH 4OUOA 2J8UB 5AUMA 1CK0L 2ZUTA 4BQCA 4Y4KA 1JNLL 1NBZB 2JB5L 3BIBX 3QEQB 3BPNC 4IDLA 4S2SA 1HINH 2X4PB 5KW9H 3GBNL 2GAZA 3MA7A 5CFHA 4I8DA 2X4SA 3WEXA 4JN2B 1DQJB 3P73A 4H0GA 1IGFL 3ZKXB 2VAJA 3MRFB 3UYRL 1OT1A 1IT9L 4NUJA 4NZTL 1A4JA 5E5UB 1AGDB 1FORL 1YEFL 4MJ2A 5C0IB 3STBA 4HK3N 4NJ9H 5K9OB 4AQOA 2IFFL 4OD2B 1T3FB 4K7PY 3B9KA 4NIKB 3TN0C 1K4DB 3ARRA 3NFSL 1JGDA 3FQNA 3VG9C 2MKWA 3ARDC 5KVGH 1ZMYA 5F7HA 1BBJA 3ARFA 1P2CB 1P6AB 5MI0B 2AJYH 1ZHNB 2CO7B 2CXKA 3G5YA 1ONQA 4UT9L 2P8MB 4UV4L 5JDJA 4OLEA 1D7FA 3L5JA 4Z7VA 3CCHB 2MPAL 3MLWL 4OLUL 1I3RB 4RMQA 3MBXH 1J0IA 1FZKA 5HBBA 2NY1C 3O4LE 4C4KO 1FL3B 4NNXB 5CINH 3VFMB 4DAGH 4JAMB 3VXSD 1QSZA 3MLRH 4MA8H 4JRYB 5JQ6L 3LN4A 5GS0L 2JK5B 4ZUTA 1BBDL 3FO2A 3P4MA 5F7LB 5DRNA 4ELKA 1HHGA 2ADIB 3LRSA 5DK3A 5J3HD 3HTLX 4MMXC 3U4EB 2HP4A 1A6AA 2OR9L 2HJLB 5D7LE 4PRPB 5KVDL 1S9XB 3IFLL 3F7VB 4UTAH 4NC1E 5IKCB 1JPFA 5DJXA 3B9AA 3LIZH 3I6KA 4I1NB 5D1ZD 1BQLL 4RMTA 3H9ZA 4RFEB 1JGUH 3D9AL 4YXHH 1YYMH 1WC7A 3LD8C 2O5YH 4BZ2L 3QULB 4HS3A 4JKWA 1R5WA 3HE6B 3MLVH 1HH6B 4H25A 1JF5A 3H9SE 3PWPB 4LRNL 3WSQH 1JWUA 1O5DT 3GMQB 1AFVH 4KI5D 5TGBB 2DQFB 3VJ6A 1BD2B 1JNNL 1JRHL 3DHJA 4V2BA 4M6MH 3RPIA 1U3YA 1I7RA 1T7ZA 3L3JA 4JG1L 4TNWK 2FLRT 5IG7A 5JA9A 4GSDL 1Y0LA 4PUBH 5D2LF 2R29L 3PWNA 2OI9A 5I1LB 2G5BB 3HE7A 3VH8A 3AM8A 5DC9B 4TNVF 1SHMA 2HFGL 1LO3H 5GSVA 4Z76B 1U8HB 1A02N 3OAZK 2HFTA 3K4DA 4YJZL 4HUUB 4AT6B 5AG9A 2O61B 4DGIH 2WV3A 2EO1A 3WE6B 5I1CH 5T33L 3VXOA 4X4YA 5MEQB 4FS0A 3TO2B 4HG4J 4RX4D 3LRGA 3C60B 3O9WA 5DJCA 4NZRH 1S5IL 2FX9L 3RTQB 4MQTB 3NZHH 3CSBA 3V5DB 4LLVB 4XPTH 2F8OA 1CZ8H 1JWSA 4G6FB 4X0KA 3QHZH 3PXHA 2FEDC 3BDBA 5TJWK 3JV4A 1UM4H 2EDTA 5B8CC 3QEUB 1JGVL 4AIZB 3ULUE 3MRRB 1KJMB 1IM9B 3KWWA 2AGJL 4MX7A 3GBNH 3AMLA 1CS6A 1JUFB 4PLKC 5I66A 4Y1AE 4LAQH 4PR5A 3V7MA 3NBNA 1J9CT 3MOQA 1IQDA 1NGZA 3CD4A 4UIMA 2NY4D 2HYMA 2EDHA 4WI3A 1FH5H 2UY6A 2PW1A 4R3SA 5F72S 2QHLA 3TCXA 1S7WB 4GJTB 1EZVY 2VZVA 4HXBH 3SKOA 3BP6A 3SDAA 3VGAC 4RISL 1KNOA 1RU9L 5I75C 1F5WA 5HYFA 4J23A 1A1MA 4APQB 4MNQA 4HBCH 2BVOB 3UTOA 1DANT 3IDGA 4PJBB 3TESA 4NFBA 3DSFH 4G7VH 4FFYH 4MGXA 4LVOC 3T4YA 2VDOL 3ZKMC 1EVTC 1F2XK 4XBEH 4GT7A 3PWVB 4L29B 5ICXB 4KUCF 4U0RC 5KG9B 4HPOH 4L1HA 5I73B 3HMWH 3DXAA 3HRZB 4OQTA 2ARJB 4I77H 3RWEB 4E0RA 3AB0C 2EECA 2V9TA 4V1DD 1I85A 1K5NB 4QTIL 3ARDD 2GTZB 2PCPB 3QO1A 2C7UA 1WIPA 5JQ6H 1U0QA 5C0BB 1PSKL 3KXFD 1KBGL 4GAYA 3QXDA 1B6UA 4XNQA 4LCUB 4JY5L 5E00B 3RWJA 1KLUA 1RIVH 2BNQA 3CXDH 1Z9LA 2FH8A 3GJFH 3W9DB 3OXRA 3BH8A 1ZWIB 1WCQA 1QSEE 4Z7NF 3SBWC 5E2VL 2NY1D 2HMIC 1UJ3A 4JPWH 4X98B 4ZXBB 5FYLD 1TPXB 1CLCA 4R4BB 2GQHA 3QRGH 5JUEL 2DLFL 1BQLH 1NAMA 3FRPA 2VE6A 3KPQA 1HOCA 4JY4A 1FPTL 3GKWH 1T80A 4LSSH 1ZVSB 2F5AL 3RUGF 2EDOA 1QEWB 3TBVB 5EU7E 1C5BL 3LPGA 5DJ6A 3LS4L 5HHOB 1FL6A 2X1OA 3MREA 3NCYP 2R0ZL 3SPVA 3KYNB 1SJXA 1DVFA 1AHWC 4PGEA 5CEZE 2X42A 5AEAA 1X5XA 1AO7A 1JFQL 4YDVB 4FQXA 5J6HA 1OY3B 3RGVB 4N9GB 4Q9CA 4JZJB 4LF3A 1BVLA 2W59A 1CE6B 3BP4A 4JDTL 4NQSA 4QRRA 1DQDH 1N0LA 4HJGB 5GQBA 1IGTA 1Q94B 4ZFGH 5F6IB 32C2A 5T1LD 4U3CA 2JJSA 2WBWB 1RHHA 3IKCA 1S5HB 5CZKA 7FABH 3LKNB 2MJWA 3SKMB 3OKDB 1ADQH 3FB7A 2VIRB 3C2AH 3EDKA 4LLDA 3VFSB 1PVHA 4RBPK 2Y07H 3MV9E 4KROB 5GISL 4UDUA 4NHUA 1GGCL 5DJ2A 1BF8A 5JQHC 1XIWC 3OJMB 1FGNH 4P4RB 1JHKL 2WLYA 1T20B 4XBPB 1YN7B 1FFOA 4R26H 4Z7WE 5HGGS 1CICD 3VG0H 5CS7A 2IAMD 3OHXA 3PL6A 2PYEA 4L5FH 2DJUA 1AJ7H 5I15L 5IMKA 5AAWA 4EI6B 2DN7A 1JGVH 3I84A 4NQEA 3UTPE 1A47A 3CX2A 2HT3D 2F53D 4LBEA 2H45A 3U9UB 3ABZA 3GJFB 2UWEE 4KKLC 5CJOH 2QV2A 3IETB 3SDCA 1AP2A 4XHJC 2H2SC 3BUTA 5DMIH 2VDPH 2P46B 3T1FA 4YX2L 1J0ZA 1NGYA 4LLUA 5CWSA 5MERA 4ZAKC 1KCUH 2FEDD 1WZ1H 1TITA 1JHTB 4X99A 3SDXB 4FXGA 2X4RB 4WFHE 5I8OL 4QRRE 1KC5L 3HPLB 3PDOA 4OLXL 3UDWC 1V7ML 3NIFF 1IKNC 2DLIA 1Q9OB 4IM8A 2P8LA 2QKIB 3HAEA 1YNKH 4ZS6C 3HS0B 4PP1D 1GZQB 5CP3A 5F1IB 4PJHA 3WJLA 5EC2B 2R0WL 2Y7QA 4WI8A 5TDOA 3MUHL 2GT9B 1G7HB 4PJEF 1P4IH 1QD0A 4M8QA 5FV2A 3QEGL 5FV1L 3BP7A 1A9EB 1QKZH 2DQEL 5JORA 5IMOB 2J88L 2VDLL 4MCYB 2X1PA 3S3SA 3DMMD 1VB9A 3S4SA 1OAKL 2GHWB 1NGPL 3PWJA 4NQEE 5SWQB 2D31B 1QLFB 1F4AA 5HYSA 5IFJA 4N9OB 3EOAB 5BO1L 1EO8H 1ACYH 5JNYB 5FYKL 1JZ4A 3PHOA 1R0AH 4D9LL 2BRRH 4U3HA 3FN9A 1QLRA 4G8FB 2X1XR 4JY5H 4G42B 3DNKA 4JY6A 4OIIH 3CK0L 4Y4FB 5LXGH 1KPRB 3RWDA 5FO8A 1ZKAA 3FN0L 1FG2A 2DB8A 3VFOA 4JREB 4NN6B 2DM2A 2RCSH 4PJIA 3FONA 1IEAB 1OF2B 5ESAB 3TGXA 3VFNA 4PD4J 3P3YA 2P7TA 5DZNA 2WBJD 3ARVA 4X4MA 5EBWA 3MXVL 4OLZH 5FB8A 4GUPA 4IBLT 3SE4A 2HTLC 1HQ4B 1HK6A 1ZA3B 4RCAA 1Z0MA 2OJZH 2N56A 3RVTC 3MRPB 3S37H 5E08L 4HSQA 1FGVL 3GRWL 5EBMB 3O4LB 5JOPE 4XPFH 3U48A 4HX1B 5D7SH 2DI7A 3ZKSD 2DYPB 4M7LL 2B5IB 1WTGT 5FO9A 2MCPH 5ICYA 2OYPA 1LO5B 4OLYH 3MA7B 2R1YA 3VFRB 2X4SB 3ZKXC 4KWUA 1OAQH 1FZJA 5F89A 3P73B 1SVZA 4NQCE 4GBXD 4NFDA 4IMKC 4Z6AT 1O7SA 5D7LB 2R2EB 1NFDA 3PP3K 3G9VA 3T8XA 1NCTA 4I0PB 4JQVC 3D85D 1PKOA 3ROLB 3MLTB 3QISA 4NUGL 4P2QA 3X17A 3B9KB 3ZHDA 4PJIE 1A6WH 5HGDB 5MI0C 3FQNB 4M6OH 1EXUA 1JYNA 3H9SB 3AFLA 5ADPL 3A67H 1OAXL 2IGFL 3PP4H 3AS3A 4UUJA 4X4ME 2D7QA 2OTWB 1UT9A 1WBZB 4H88L 4UT7H 2ADGB 4R2GD 4I48A 1LMKA 3WIIL 1EAPB 4C58B 4P23A 5FUOL 4PPTA 1XGTA 4MNHB 3M45A 4KDVA 4KI5F 3WJJC 3I2CL 3L3HB 3MQIA 3OZ9H 3RWIA 4HG4K 1XIWD 1HKLH 3GMMB 1NEUA 4D0BA 3MZGB 1RZ7H 4NZUH 3UPRA 4JKKA 3LN4B 2DQCH 1K6QL 4HQQL 3VXNA 4JEGB 5BS0D 4U1NA 1YJDH 4NO3A 3W2DL 1FFNA 1TNNA 1ZOXA 5A3ID 1A6PA 3LRSB 1L7IL 2A73B 4WW2C 4L8DA 3MRQA 4YNYA 2FBOJ 4JFFE 4UB0H 3H7BA 5E1AB