1ZSDA

Crystal structure of hla-b*3501 presenting an 11-mer ebv antigen eplpqgqltay
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CTL Recognition of a Bulged Viral Peptide Involves Biased TCR Selection.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zsdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zsdA01
1T0MB 2FJFA 2Q76A 4G9DA 1FJ1A 1ZLUK 3NCEB 4MQ7B 5DZLA 2M2DA 4NZRL 4QGYA 4MD0B 4V2BA 4R0LA 3BEWA 2G5BB 1NSNH 2B0SL 2NMSA 2EDYA 4L3EB 3RWHB 1KN2L 2JJSC 4QRTB 4WFHD 3NZHH 3FN3A 4IRJB 3O11B 5C0GA 4QY8B 4ZUTA 3ARBD 3X3GH 1LO3H 3KPMB 2EDWA 4PLKD 3CH1A 1QFHA 2NY7H 4BQ8A 5HI5C 4HXAH 5JNYB 4K94C 3FT2B 2AAVA 4N90D 4LHUG 3R06A 3DTXB 3LVEA 5DZOA 2Y9RT 5JORB 3IAQA 1U95A 2PTVA 5ANMA 1KENL 1ZANL 1HXYA 5ICYB 1XGTB 3E6FB 2DIBA 4MNGB 2P46B 4XAKE 3RVWD 2AV1A 3DI2B 4HJ0D 3LMJH 3LB6C 3KLHD 2DQHL 1IEBB 2Y25A 5E5RB 4G6AD 4TSBH 5KSAD 3GBNH 1C7TA 2BHYA 1C7SA 1T1XA 1ZEAH 2FL5A 2X4QA 2BHZA 4GRWF 1DBJH 1FH5H 4PJ9A 3V4PH 3VG0L 3GI8L 1XCTA 2BP3A 4HF5H 5GJTL 1WTGT 5JW3L 3LN5B 1YC8A 1PKQB 1YUHB 4Q97A 1PG7W 4MA1B 4W81A 3KS0H 3O41B 3P0VL 3P4NA 2XFXB 3QUZC 5CJQH 5DJ0B 2EIZB 2YHGA 1S7RA 3QXTA 4PY8I 3T1FB 3QWRD 3BPNC 4OIIL 3D85D 5FHAH 2FECI 4N90E 4XVTH 2ZCHL 5C0AD 2FJHB 2W92A 2AK4B 3CFBA 1SHMA 2PXYD 3FO0L 1MHCA 1TZIA 1J86A 3L5XL 3B2VH 4LDEB 2VDKL 2EZ0C 3FO0H 3OB0K 3RUGE 3KPQB 3OXSA 3MV8A 4FQIL 5BV7L 2Y07L 4GLRH 4JKWA 4PJGB 4E41E 2HRPL 1JMZA 2MCPH 4U6YA 4K3JL 4HCRA 4O4YL 3SKJH 4OSUH 4OZHF 2QQQA 1JTTA 3I50L 5DTFA 2F53B 4XBPB 4M7KL 1AKJB 2X4TB 2O5XH 1OAKH 3V4VH 1YYLL 3TPUA 5CEYB 4EI5B 2GITB 1CDJA 1J7VR 1MVUA 3G6JE 1QBAA 4ZQKA 3VXSA 4D0DA 1S9XA 4KDVA 1JPTH 2XZCL 5LGHH 4U6VL 2YWYA 3HG1E 3AS2A 1U8JA 1GIGH 5BVJA 4J3SA 4DEPC 2ITDB 1FN4B 2DI9A 3BN3B 3V0AC 4XT1C 4HS6B 4M1CC 4IEFB 1NGXA 2D31A 4ZSOE 5ID0A 1PW3A 5KOMC 5B38B 4X4YB 4PLJC 5T1KB 4M48L 4CDHA 2Y5TA 5A2JH 1LQSR 3CX5K 4HZLB 5CD5C 1OP3H 1I7RA 3VGAB 3BPLB 3QJFA 1EFXD 4JQXA 1JPFB 3GSWA 4EJ1C 3GB7B 1A2YB 1H3PH 3QUMA 3X11B 3GI9L 4WY7L 4OCRL 1YEJH 4PS4H 5FB8B 4KK8C 2AXGB 4JKKA 2NY7L 1B0GA 3VA6A 1FYTE 5HHXL 1KPVB 1R5VB 1WGOA 2NYYC 3HPLB 3UBXA 4P5KA 1Q94A 2Q7NA 5J1SC 4MCZB 4QHLA 1E4XH 4FFZL 5IB1A 4FNLH 4F3FB 1VFOA 3ZKQD 5JHDA 4GRMA 3GJEB 5DJ2A 4FNLL 1MI5B 3TO2A 3LEVL 1QLEL 1VGEH 4NN6C 2APTA 2MQ3A 1K8IA 2JKXA 1MQ8A 4Z7VF 4QRRA 4DJMA 2J4WH 3K2UH 1FH5L 2JTDA 3IDNA 3WSQH 5EUOB 5D70H 5FYLD 4O2EA 3WKNA 4NPYB 4PB9L 4J3UA 4N5UA 2O93L 1KCRH 3TBYB 4RMSA 4FZ8H 5EA0H 2F5AL 4Z7QE 3SDCC 5J6HA 5EZIL 4G42B 2EDNA 2KBGA 5DVLA 4LSVH 2H6PB 1HSBA 4Q58C 3I75B 4HS6A 3B4NA 1UB6B 3QQNA 4RNRA 2Q7YA 1HNGA 2QHLA 2X9WA 1MIEH 4KMQA 4KWUA 5F9WB 2J1KA 4RGNC 3LZFH 1C1EL 3F5WB 7FABL 1U8JB 1I8KA 4RCAA 4BSWA 5C0CD 2DQGH 4UT6H 2YBRB 3DBXA 3LPFA 3QUXB 1QO3A 4PD4K 3IDGA 2MQCA 2H26B 2A6KB 1ND0A 1NGYB 4ODXB 2AQ2A 1U8QA 3ELAT 1UVQA 4IS6B 2XWJA 3VDCA 2GHWB 4HGMA 5DK0A 3W0WB 1L8JA 1X5AA 1A6ZA 1Z9LA 3K0WA 4MA1C 5C3TA 1BFOB 3QZWA 3A0OA 3EYQD 1FCGA 4TVSa 3GEWB 4G8GE 4NQDA 4OZGF 2AI0H 3DYOA 4U1JB 4XI5D 4M61B 43CAB 4NYLB 4JRXB 4LQ1A 1FPTH 4FQCH 3EBAA 3V8CA 3G9AB 3VFWB 5D7SL 5EO1A 4XRCB 5FO9B 3MBEA 4P49A 4LARL 1UJ3C 3X11A 3CMGA 2CLRA 3D18B 2IH3B 1UZ6E 5C0BE 4RMUA 5B8CA 3T4YB 4Y5XA 3CFJB 2XFXA 3MLSH 3BGFB 2FHFA 3KDMB 5I30L 4HXBH 1NAKL 1TMCA 2I24N 1BQLH 1GGTA 4P46D 1A7NL 3ULUF 3LD8C 3U2SA 3CX2A 4GAGL 4NKDA 4LNRB 3EYUL 2OTWB 3N85H 1VADA 3UPCA 1AD9B 4AT6A 3QIWA 3UC0H 5LGKA 2EXYC 5H37G 1N3NB 3OV6A 4X7FC 2J12B 2CR3A 1V3LA 3HNTH 3G5VA 4GG6A 4UILL 3LY6A 1DDHA 1IEAB 4PJGA 4CKVX 5BW7A 5KJRL 4K9EC 2LABA 3JTCA 1E28B 3VH8A 1EMTL 2HFTA 2NY1C 2G75A 4TQEH 5FUCC 3V0VB 4P23C 3BQUD 2V2TA 1JNLL 3VXRD 1XF3B 1U8QB 1ZMYA 4PRIB 3WXWH 4O9HL 3SDAA 3K8LA 4JFDB 4RA0C 3DUUA 4K55A 1H15B 1P53A 1MFAL 4XP5H 1YEHH 3DV4A 4GXVL 2YPLB 1EO8L 3K2UL 4PRPD 2NXZB 3GGWA 2E6PA 5DSCB 4KK6C 3SY0A 1Q9KA 3KYAA 3LRHA 4PRHA 1KLUB 2OP4L 4XPTL 2OI9B 1U9KA 5I76B 1C5BL 1I7UB 4JQVA 4KXZI 2HA1A 4X4ZA 5HHNA 3SQOL 1U91B 1KG0B 3A6CL 4WFFD 3QEQD 5IB1B 2I5YL 4DFHA 3P9MA 3DARA 4X6BB 5L0QC 1CGXA 1MF2L 4Z6AT 3T2PA 3FB8A 1YN7A 1YMHA 1CE1H 3RVVD 2OQJA 1KELL 3O4OC 1NMAL 1OAUL 1A6PA 2HWZL 4U0RC 1SBBA 3GBML 2AGJH 1G7MB 4WEBL 3ZKXC 1PAMA 3LQAL 1WAAA 2N1KA 4MXQD 3EHBC 4P99A 3GK8H 4WFGD 5DVMA 2ARWA 4V1DA 2ICWJ 5MHSD 4PJXA 1VGKB 1TPXC 4WI3A 2ZCKH 3TCXA 3MREA 3QCVH 2IPTL 4XP4L 4YIQB 1UB5B 4XPHH 4YZFF 4XBGB 3MRKB 1MCQA 3MBXH 1DFBL 4N9GA 4G8FB 1AHWC 3GMOB 4KTYA 3OGCA 3H9HA 1C08B 3EYVA 1CDBA 4BQ6A 4JREB 5D5MB 3PXJA 5IHLB 4Y5VC 5I6XC 3FT4A 3P2TA 1XF3A 3DXAB 2M26A 3MLYL 5F7NC 1DQLH 1D9KD 1FYHB 2FJGA 4WW2A 1JPSH 1RZKH 4UIMA 5FYJU 1QRKA 5HGAB 2VSDA 4LHQB 4PJAF 5I66A 4PJCF 1I7RB 3SGJC 1CGWA 1AR2A 3STLA 2XZZA 3PP3H 3PP4L 4I3RH 2P43B 1JYWA 3GO1L 1UH4A 2NXYB 1QSFB 2NY2B 4OUUA 1NGXB 1VB9A 3RHWF 3MRQB 4JDVA 5FKAA 1A3RL 5IVZA 3H2WA 4Y2DA 3C60D 5E70A 1SY6H 1K5NB 2IADA 3VGDA 2CKBH 1B4JL 5F97E 3C5JB 4FQXD 1NFDE 4K3GA 5ITFA 5GGTA 2A6DB 1IM3B 2CLRB 4H26A 5F1NB 2OYPA 5C9JB 4ODUB 2R4SL 3GJFA 3SCMD 2F54A 5DJ0A 4HAFA 1XGUB 5K9QG 3SDDB 5FKPB 3WL9A 3RVXC 5I73C 2W0PA 4PRNA 4QRUA 5HHQA 4ORZC 2O61B 4R26L 3W2DH 2ZJSL 1D7FA 4KU1A 3UYOD 4KJPC 2XNAA 1C12A 1P1ZB 2G60L 4LRNH 4YDKH 1CLOH 3BUTA 5DURD 4X8JB 1PYWA 3WE6A 3D39E 4KI5E 3U7AA 3VGEA 1JE6A 1MCDA 1FL5B 3MRDA 3F7PC 1JGLH 1QZ1A 1WAAE 4I18C 4NKOA 2IQAB 3T04D 1BMGA 5SWZD 3E6HA 1WFTA 4HWNA 4OI8A 1MCCA 2BSRB 3MA9H 5E2TH 1R5WA 3P40A 2I5YH 1DBJL 2YXFA 1C16B 4AIOA 2EDEA 5EIQA 3MA9L 4V1DB 3IGAA 3MACH 4MQXC 4X5WA 5D93B 2FLRT 3OJDA 5JW3H 1RK1A 2F74A 4BFGA 1IGFL 4ZSOA 3PQYE 4ZXBB 4PREB 3RX8A 3OZ9L 4ZPTB 1KV3A 5KZCB 3GK8L 4ZNEE 4LIQL 4CU7A 1D5MA 4CU8A 4KQ4L 1IEBA 4XGZA 3H9YA 3RWHA 3MLVH 4EI6A 4NZRH 3D25A 3U36B 1J10A 2IPTH 3HG1D 3VXQB 5FF6A 1TTUA 4U2YA 4PTTA 4BUGA 5CINL 1BIIB 3TWCL 2XOTA 4PRIA 4PFEA 4AEHL 3HS0A 4UDUA 3QDGA 3H9HB 3OGCB 5FHBL 1P4BH 3QA3A 3EDFA 4RMRA 3MLYH 1RZIA 3RVTD 2Y06H 4PJHF 3TFKC 5K9KA 4HC1L 5C09D 1T21B 4LRIC 2J6EA 1P7KA 1RZKL 2P1YA 2X4SA 4M7KH 4KRLB 4P5KB 5C2UB 5T3ZL 1BFSA 3GKZA 3QPQD 4YHLH 1O5DT 4O4YH 2BY0A 3SKJL 3INUL 2I07B 4TSCL 3TBSA 3RHWK 2ED8A 2AXGA 3TJHD 3VD4A 3ARWA 1ORQB 1IC7H 1TFHA 4Y1AA 5FK9A 4ORGA 4YBLB 1BQHG 4PJ8C 1BZ9A 1T5XB 3TVMA 4Z77B 5DMGD 4H1LG 2FD6H 5E8OB 5GRZA 5HPMB 3I6LD 1DQJA 4HIEA 4U1KB 4U49A 1BQHB 4JKPL 1X5ZA 1OAXH 4YHIB 3WUWB 1D6EB 1NCDH 4P4KA 3RI5K 2VAJA 4F9PC 2AV7B 4M6NH 1MWAH 4IRSA 3TA3D 3UPRA 3MQIA 1CGYA 3L9RB 1FZKA 5F3BA 2GFBB 4UV4H 3UPAA 2DD8L 4Z78B 2GJ6E 3EO0B 1H3PL 1T1YB 1DEEB 1KPRA 1C8PA 1PX3A 4L8SA 1RHHB 1IAOA 3PHQA 4NQSA 5EBMA 2Z31A 1MCNA 2Q20A 4KI5F 4EI5A 4F7MA 5HHPA 5I71C 4JVWA 1S7UA 4AL8L 4DTGL 4JFPB 3KHQA 4K3HA 4AENB 4F15C 2J7LA 4E41A 1KIQA 2VQ1B 5IVXA 1UM4H 3VH8B 1NGYA 4GAJH 5HGGS 2MFNA 4K3JH 3CZJA 3MRKA 4KROB 4XZUA 2C3XA 1CGUA 1LK2B 5ESAA 3BZ4A 4Q2ZA 1B0WA 1KENH 4M43L 2O5XL 3KYMB 1OGAE 4NQCB 1VFBB 1YQ2A 2VABB 4LGRB 4YBQC 4WUKL 3LPWA 3KXFB 1A9EA 1PG7L 3VD7A 3RGVC 1A47A 4N8VG 1XIWD 3ILQC 3EJZD 5F7EL 5D2LE 1NAMA 1LEGB 4F7CA 3FN9A 2IAMD 1WSST 1XF4B 4KGLA 5J7CC 1K9TA 2H2PD 4J12A 4H8WH 4E5XB 1CDGA 3MYJB 1DANU 2BNRB 1JGEB 1PX4A 1AQDB 1YC7A 5JUEH 3IDUA 3HE6A 4KMTH 4N0CC 3SDCA 3EZ8A 2CJUL 4KQ4H 2PYFB 3QUZD 2UZXB 3WV0A 1S5HB 2H3NB 3UTTD 5KSBF 5TGBB 1Q9WB 5CJQL 3DIFB 4DVRL 3RWEA 2P8MA 3LKSA 2X5PA 2FWOA 5TGBA 4ODBD 4U3CA 1M7IB 4C83B 4LVHB 4JPVH 3VFWA 2X1WL 1A9EB 4MXQC 3S3SA 1YZZA 2L7JA 1GZPA 1CBVH 3GNMH 5GRVK 2D9QB 1A4JA 3D69B 3ZL4H 5HDQL 5CUSL 5CHNB 4X9FA 5M94B 1G6RB 5IB2A 1VACB 4RGMC 1JZ8A 1NFIA 5A2IH 2Z8RA 4Q0XL 1EEUA 1G9NH 4XCEB 2YXMA 4JANB 3U1SL 3VGAC 2FX7H 2V2TB 4QEGA 5T3ZH 3VXPA 1OAKL 3V4VL 5IHBA 1YYLH 2DQIH 4XZUB 2C3HA 2LVEA 1QUNA 5HYJD 1G9ML 5I16B 5CCKH 4GMTL 5IEHB 1FQ9C 3THMH 5CSZA 5IESL 3WSQL 2VC2L 1QPXA 2G5BA 1RIHH 4JR9L 3DOSA 5IMOA 3ARGA 2PNDA 1Z9SA 1Q72L 5IJVB 4R96B 1X5JA 2C1OA 1X5YA 3DGGB 4OLXL 5ERWA 4XHJD 1YMMA 4QCIA 3VE0B 4G43B 5FM5O 5DHXB 3L9RA 3QPXL 4HUXB 4I77L 1WZ1H 1CDIA 1KLFA 1NAMB 1S9WB 1SY6L 3PL6B 2NY4B 4PJEB 3VFNA 2V17L 5EOQH 2VZSA 2EH8H 2HKFL 1RJZB 1CWVA 1L4IA 4HDIA 1T04A 2GAZA 5DLMH 3W11C 3PDOB 5H94A 4YGVB 2GITA 2HTKD 1EHNA 1YEKH 3GSRA 2J5LC 2QLVB 5GGQH 2VDNL 2V5RA 1I1AD 4G9FB 1RUKH 5CZVH 3QG7H 3ZDZE 3HS0B 4MDIA 4PUBL 3UTSA 1KNOB 3CLFL 3TCLA 2FX9L 4WTXA 4IBLT 1JVKA 1J1PH 5EBMB 5CP3A 1MHEA 1CFVH 2KUTA 5ALBH 5DQDL 4IOFC 5EWIH 1MCWW 1ZLSL 5ALBL 1JZ5A 3EOAB 3IAPA 1X7QB 5HVGB 5KSBE 1JGUH 2C1OB 1WVZA 5FGBA 4ZUUB 1A6AB 3H7BB 4EUPA 4F37K 2OP4H 4XPTH 3ZSTA 2OJEA 4OB5L 3OAZH 1KXQE 3U46A 3O6FD 4QWWD 5F89B 1G7JB 1JI1A 2DKSA 1TQBB 4KAQH 3P4OA 4KROC 1ZLVK 2IQ9L 1ES0A 3DO7A 4X6CE 4OCYL 4D9LH 4LKXA 2L0DA 4YK4B 2IQ9H 4HK0A 1IAKB 4DKEH 5IBUB 1RUML 5EBGA 4DWHA 5LJYH 3PWLA 2BSRA 1KELH 1RUMH 2AXJA 1EIBA 3RGVB 1I7TA 3MLRL 4R2GC 5ANMB 1BZ7B 2VWEE 5DJ2B 1R24B 3FT2A 4JFEA 3DETD 3DUSB 5CIPA 5E2WL 4MS8C 4WHCA 3BZ4B 3NIFE 3RBGA 1JNLH 1UZ8A 2UV3A 1F6FB 5CINH 2X70A 1LD9B 4ELMB 1HXYB 4EUPH 3ULVH 4Y19A 3QAZB 4WFED 3CFIC 3D3VD 1U8KB 5L2KB 5DK2B 5HHMD 1DQDH 5FO8A 3Q3GB 5FB8A 5GZNC 1W72H 3LSOB 2X05A 4JFFE 2Y06L 1Q9WA 4H1LH 2R29L 5LG1A 3IB4A 4I0PA 4LEOB 4HKJA 4TN9A 3JWDC 1FORH 3O6FA 4U1HB 1I4FA 1MLCB 5ABDE 4X7SL 3LDBC 1FORL 5FYJE 3FZUD 1CFQB 4EIZC 4TSCH 4M6AA 3W0WE 3TC9A 1X6LA 2NYYD 1YY8B 3B6SA 3DX9B 2PW1B 2D2OA 4WDIA 1S7VB 1A7NH 4J8RB 1E4KC 3MLZH 4G59A 3MRBA 1KUMA 5C0AE 8FABB 3ZE2E 2ZG2A 2IEPA 4Z7OF 4TSAH 1OQOA 3VRIA 1TQBC 3HPJB 1UFUA 3PV6B 4XPAL 1B4JH 1L6ZA 4GKSB 4LOUD 3HNTL 3REVB 5BOPA 1U42A 5E94A 1VFAB 1A7OH 3KPOB 3TPUB 5KJRH 5ALCH 1JN6B 3KPSE 3C87A 3WHE0 5J1AB 1FFPA 3GJFK 4GQ9L 4H0HB 4OI9A 1A7OL 1FNGA 2HAZA 2HMID 4AM0A 2CDEB 4JFFD 3N1QC 1CQYA 3IJHA 2WNGA 4H0GA 5IM7A 5CJOL 1ORSB 1MRCH 3R1GH 4LGSB 4JFDE 5EZLB 3CLFH 5D9SB 3CVHH 3O6LH 2FX9H 3R1GL 2P5EE 5EZLA 1QVOB 2UWEB 2IPUG 4Z7UB 4N5ED 3QDGB 1NGZB 2BVOB 3CVHL 1MFNA 3QFJD 1F4YL 4O02H 1CCZA 3BH9A 3ZMRA 2R0KL 1Y6KR 1RUAH 4ZAKC 1URLA 2VH5H 2OTUB 2XN9E 3VWJC 3T3PE 3DX7A 1A22B 5J12B 4XMPH 3OR7B 2R69L 2XG4A 2PTTA 1JK8A 1YNKL 1KEML 4F9LC 4FFVD 3KLAB 5T3XE 2Q76B 1HXMB 2VXVH 4M43H 1WFUA 5IW1B 2IPKB 2ZSWB 4MHHG 5LCVL 2R2HA 1MCWM 5L8LB 5D2NA 5E2TL 5FIEA 4ZXBA 4X6BA 1ZXQA 4YEFA 4FQ1H 4KZDH 3DO3A 4HV8B 4X0KA 3MA7B 1INDL 5HYJA 4HV8A 3EGSB 5I8CA 2G9HB 3MUZ1 4Z7VE 5JR1L 4JZJA 4LHUB 2P7TB 2E8YA 4ZFGH 1N5AB 4HKBA 1EAPB 4Z7UF 5C0RH 4OF0A 1QNZH 3B9DA 1JPGA 4ONHA 3RTQB 1A0QL 3BAEH 2JELL 4JFDD 4RWYH 3K4ZA 2JELH 3IJSA 4BJLA 4WCYL 4XTRD 4UT7L 3QDMD 4KKBD 4YNYB 2YPLD 4PRPB 5DC4B 4YR6A 4PRHB 2ADJB 1CT8A 1ZHLA 3AY4A 4GQPH 1KJ2B 3VXNB 1PGRB 2XACC 1I1FB 2NY5C 4DOHB 4X9IA 1OAZL 4OAWB 1ZLUH 5J12C 4J1UB 5C07B 4HKBB 3F6IA 2FATH 4HH8A 3VRJB 4U6TA 5I18H 3HE6D 3MCLH 1REIA 3QNXA 5MI0C 1IC5L 3Q5OA 1IARB 4F7EA 4TOYH 4NHCH 4X0KB 1G7MA 4P5TC 1XGRB 5FOJA 4LBEB 4U1LA 2IAMA 3JUZA 3DVFA 4JPWL 1HZHL 4JLRA 5JO5A 4WHYH 1SJHA 2AJUL 1X5FA 2VZVA 2KDGA 2DJUA 3H42L 1QSEE 3VGBA 3OKLA 2Z91A 5IMLB 4LPYA 4M6NL 4WFGE 5DEFA 1WUNT 4R7NB 3U46B 2ADFL 2YD1A 3KPLA 2VITA 1KYOK 1OAXL 4Y4KD 5IW3A 4S2SA 4MJID 3MUJA 3SGKA 4YDVA 1Q1JH 3ARDB 4HWEH 5EU4A 3WNOA 2Y36H 3T4YA 2ATPB 3BXNB 1UZ6F 4EKXA 4HMCA 2ICCA 1MWAA 1SJEA 4ELMF 4YAQA 5GXBB 4HUVA 3ZDYE 3BGMB 4I9WE 4F33A 4AL8H 4NQVB 4QRUB 4DUVA 2Z31D 1QSZA 5DRXB 3IS1X 1J0HA 4AK1A 5I6XB 5HDLA 2IFFL 3MCKB 4PJIF 4XPGH 4RZCA 4BELD 1FNHA 3RL2A 1A6TA 1AQKH 4UDTB 1LD9A 1YEIL 3KPRA 1OP9A 1HNFA 3CMOL 3CPLA 4OGZA 3TA3A 4PJ8A 5D1XC 3O9WD 5GGUA 1IAIL 2V2XB 1HDMB 4P4KD 4ZYKA 3MRBB 8FABA 1A7QL 4OLZH 4YHPA 1NCBL 4XC1L 5I1LB 2DL2A 4NM8L 2OTWA 2NTFA 4LLVB 1J1PL 4NT6A 5DC0A 3I6LE 3MMEB 4EVNB 1NCWL 1WIUA 1GC1L 1JPTL 4M1DH 1HSBB 1KCVH 4Y1AD 2PO6C 4PJFB 1GIGL 3QYCA 3BUYA 4YXHL 5C2BL 1YPZF 3DRQA 4E0RA 1INQB 3ZE0E 5HDBE 1TITA 4M48H 3VWJB 3G5YB 4KMTL 5C08A 1J0ZA 4Z95L 1T22B 3BO8B 3BP7B 2WUCL 3BIKA 3C8DA 4RWYL 1OTSC 4I9WD 3U4EB 3CFKA 5CJXC 1TDQA 1LO3L 2P8LB 4FFWD 5EC1A 3STZA 1YN6A 4Y2OA 1WEJL 1F4AA 4LVOC 4MAYB 5ITBH 3KPNA 3L5XH 1EEYA 3VFMA 4TNWF 2C26A 5F7YC 5HJ3B 1MCOL 4QHNB 2OR8A 3U1SH 4F58H 1N6QL 5EBWB 4HC1H 3S34H 2R2BA 4RMTA 5SWZB 5DUBB 1H3TA 2UZIH 3H9SD 3S5LG 4WNQB 1UCTA 3DBXB 2RFXB 4XNQB 1UXSA 3T3ME 2ZCLL 2OL3L 4LLUA 5I19L 4GMTH 4OD2A 4U1MA 4QF1A 4ETYA 3QJFB 5BZWA 1PFCA 2YZ8A 4R7DB 4EOWH 3EO1A 3ULVE 4P23B 1NMBL 1LO5A 3JTTB 4YHNB 5DMKB 1MCSA 3E3QC 3NCCB 3ARGC 4LPTA 3D0VB 5JMOC 1ACZA 2R0WH 1T7YA 3QCUH 1N0XL 5SWZA 1GZQB 1C5DA 4M7LL 3O3EA 4X7SH 3HG1B 3PDGA 4PJDA 4I3GA 3OX8B 4BH7B 4PPTA 4XAKD 4XVJH 3ES6B 4PY8J 5K33A 3SE4C 3TYFB 2VKXA 3HZVA 5GGTH 5E00B 1QKZH 3KPRE 3FQTB 4PJHE 2WWMC 4A6YB 3QI9B 3QULB 3DI3B 3MRRB 2ZNWA 5I2IB 3S35H 4KV5E 3HFMH 3NFSL 5FAAA 4PGEA 5D1XB 1WCBA 35C8L 3BDYL 4LLDB 4R6UA 5A3IC 2GTWB 4P2OB 3SCMA 1A1OA 3NFNA 1PZUB 3LKPB 2BNQD 3RWDA 5D7IA 2IMMA 3V5DA 3BWUC 4XCYA 1JRHL 1AKJA 1YEKL 2X4TA 1KLGA 2EE9A 4LOUC 4X99B 5CJOH 3AMLA 4EUPG 1EEZA 5BQ7A 4H5SB 4OFIA 1KXVC 1RIUL 3GRWL 4IRZH 1YJDL 4R9HA 4RFOL 5KANG 1WBXB 4EI5C 1NCWH 3IRPX 3FN0L 2YD6A 5BXFB 5DQDH 4N9OB 3ET9F 5EO0B 5KG9B 1FZMB 4HIJB 1S9VA 4PJFF 1A6VL 1U93B 2R23B 4NHUB 4MDJB 3FQNA 4XMLH 2D31B 3WKML 5ID0B 5GS1C 3FONB 3C8KB 4L3CA 3LQMA 2YD5A 3N9GH 5GISH 4NN7B 4XMLL 3ETBF 1BQHA 3SDCB 3N1FC 4OB5H 4ELKA 1DCLA 2RHEA 4PJ9B 4DKEL 2B5IB 1D9KA 4JFQB 1WZ1L 1I8IB 2A83A 5H2BA 3LQAH 3BGMA 2LU7A 1AJ7H 3NMEA 4WFHE 4WJ5A 1W0YT 5EU5B 1CFTA 3L3OA 5JPNB 5JW4M 3QEHB 1U95B 3VXUE 4NQEB 3TO4C 2JJTC 5DLML 1NUGA 2VWEC 1TCRB 3F7YB 4C54A 2NLJA 4Y8DC 1ZWIA 4M1GH 3GSVB 2OTPA 1ZA3A 3HAEH 1UH3A 1V3JA 5EIVA 2H2SD 3VFVA 2UZIL 2XZAL 1QR1B 5F3HB 5C0EB 4P3CH 5F71A 1TCMA 2IC2A 2K9UA 4YFLI 5ELIA 4Q6IC 4HJGA 1GH7A 1KIUA 1MFDL 4JGUA 3I75A 3THML 4P2YA 3GMMB 4Y88A 3ZO0A 3T2OA 1N8ZB 5L8KB 5D1QC 1BLNA 4RIRB 1AC6A 1VHPA 3D85B 5C0AB 3BYTA 2WIIA 4C59B 1JZ3A 3SE8L 3LV3B 3GMPB 3V6BR 2QR0A 4LP5A 1J8HE 3FHAA 1YNTA 2QKIA 1LEKA 3M45A 5DJCB 5DHYB 1G7LB 1F11A 2GQHA 4W6XB 4J4PA 2CKBL 3TO2B 4NWTH 4S1QH 5F1SA 3GBMH 1I8LC 2VRAA 1T5XA 3TVMB 3NFSH 4N0YL 1ZGLB 1HE7A 1JWSA 4QKXB 1AKJD 1JHKH 5ALCL 3VXRA 3BQUA 4OTXL 2BCKB 1UYWL 3JWDH 2YD7A 1RJLB 2DQCL 3UX9B 5GGSY 4H0IA 3S36L 2XRAL 4GJTB 5HYJB 3WNMA 4PUBH 4AEEA 3MGOA 4PR5B 3WIFA 1WC7A 3MV8B 4UBDC 1RK0B 2OLDA 3QO0A 4HD9A 3EOYG 2G60H 4LRNL 4EXKA 5JW5A 4CAGA 5DJDB 4GXVH 3T2NH 4CBPA 2QHRH 3BN9D 5I1EL 2R2EA 4YO0B 1ETZA 1L7IL 4WI4A 4D3CL 4NO2B 5FYJD 2VIRB 4KI1A 1FG9C 1FO0A 3CMOH 4GG8B 4NO2A 1D6EA 3RRQA 1UCBH 1JF6A 1KIRB 1IT9L 4PG2A 1F2QA 2WP3O 1NCBH 1NAKH 4GXUN 3TF7C 5KVMC 3C5ZB 3L1OL 4TNVF 4X6CB 3B9EA 3EJZC 5D6CB 4WHYG 3HRZA 1RU9H 3RFZC 3UC0L 1FC1A 5IM7B 2WV3A 3CZFB 4CNIA 3PGDA 3MOQA 1RJLA 2B20A 3FCTA 4FXKB 3SGKC 1K4DA 4NP4L 3WJJA 3MJ7A 5IGXL 3H9SA 5JR1H 4RMVA 2UWEF 4HK3N 1MI5D 2MPAL 4NP4H 4Y89A 5IGXH 5GJSL 3EYSH 3FQRB 3O45B 4UOJA 2UUDH 3WXWL 3OGOE 2R4RH 1Z5LA 4OZHA 2VAAB 1MRCL 1DQQA 4P3CL 3IDIA 1P9MA 1U8LB 4XNMA 3UJTL 2VAAA 1YEHL 3EZJB 5C0CA 3D0LB 3BKMH 1D5IL 3OKMB 2WZPD 2FZ3B 3VXQA 5DUMH 4YDKL 3ROLA 3FO2A 4CMHC 1U58A 4X6CF 5F96H 5C7XH 5C08D 1ZK9A 3ERYA 3WL9B 2X4OA 5D7KD 3G5ZA 1MAMH 2FATL 5A16A 5KVDH 2O5ZL 2ZZUT 2HLFC 4MNQD 3PP4H 1J1XH 4D0BB 3QDHA 3O0RL 2WWMD 3OB0H 4JY4A 3WIHA 2I27N 1CZ8L 4JZNB 1FL6A 4KUCF 4LP4A 1U8KA 4KZDL 4RSVA 4U6XB 1HH6A 1X5KA 3OBAA 5D96B 3OR6B 5C0DA 2ADFH 1ROWA 3P4OB 3P9MB 4LLYA 4WGWB 4I0PC 1QBLL 4LLWA 4POZD 5JHDD 5E2JA 4R0LC 4JJ5B 4C56B 1A7BA 4RFEA 4G6FD 1X3DA 1UYWH 4XHQA 1KSRA 4QHKJ 1Q0XL 2R4SH 3LN4B 5J13C 4X4XA 1KPUB 2CKBA 3HKFA 3HCVB 3S36H 3T2QA 5ACZB 3F7VA 4F57H 3DV6A 2BRRH 1HHIA 1A4KB 4ZUTB 5J6GB 1BIHA 2BRRL 1P4BL 3IXAB 2B2XL 4XC3H 4MD0A 4X80H 3LS5L 1R3KB 3V0VA 4YDIH 4K7PH 4XPFH 2HRPH 1S78D 4JFYB 3KLSA 3MRMB 5KTEL 3KVQA 3OKOA 4MNHA 4QXGL 5E8DL 1WT5A 4APQA 1EZVY 1QRNE 1KBGL 4QRSB 3VMNA 2EDDA 3RAJL 4MCYA 4XC1H 5DI8A 3C5JA 3WYRA 4GXUM 4K9EH 1XGYL 5DR5H 5FO7B 4KHXH 1WBXA 4JG1H 4NQXA 1WC7B 3BZEB 5DHYA 1U0QA 3CU7A 1TZGH 4M7ZB 3V9FA 5IFJA 5BVPH 2F8XC 1NBVH 3O9WA 4PJ8D 3VXSD 2XZCH 1UM6L 4H8WL 5FGCE 4UT9L 3VH8G 1IGFH 2DKUA 3FFCD 3V6OC 2DMKA 5CBAA 3GSQB 4HKXA 3AB0B 4Z7WF 3MO1B 2FYYA 4ZFGL 3BJLA 1BJ8A 1KJVB 4I0CC 4LU5L 4LIQE 4RRPG 3MLTA 4W4NA 1OGTB 4JPVL 1BBJB 3UYRH 1UQSA 4AH2A 3JV6A 4P4RB 3BAEL 5D96C 5DJZA 3VG9B 5KSVA 4PB0L 3RX7A 3QUKB 5DXWA 3GMRA 3GNML 3IDYB 2A77L 2R4RL 2NXZC 1EJOH 4JAMA 3M17A 5D6DA 1ZHKA 4OKDA 4WY7H 4JFZH 5DURB 1KJ3H 5F3HA 3BKML 1XF2B 1CLOL 3QDMA 5IR1B 3I2CL 3WHE1 2IFFH 1WBZA 4MJIA 4DK6A 4KI5D 2PW2B 2JCCA 3QWRA 1GOGA 1AQKL 3K3QA 5DF0A 4MWFB 2ARJA 1MFCH 4LSUH 4OLYL 3WFDH 4PJEF 5IT2L 3PWVA 2W9LA 2VLRB 1IC5H 1CXFA 5IB5B 4IM8A 4JFXA 3PWLB 1EO5A 4PJDF 4NDMB 3RY5A 5EO9B 1MRDL 4M5ZH 2J4WL 4JZOA 3F58H 4ZXBD 5I75B 4MJ6B 2R0LH 4JQIL 1MLBB 3VXPB 3U2SB 4AIZB 5IJKA 5C3LD 4YH6A 1QRND 2F5AH 2YEZA 1CE6B 1HQRB 4POUB 1BZQK 1N0XH 3SDXA 3O3DA 5E1AA 1R3IL 3HZKA 1Q0XH 5TFSH 2GEEA 1P6FA 3V0WL 4GW1B 3AROA 2JIXD 3FO1A 3S35L 3QQ9C 1QLFB 3VJ6B 3ALWA 3AAZA 2GW5A 2H32H 3M8OH 3PV7A 1KC5L 4OZHE 3QDJE 2B5IC 3QUKA 1KTLA 4JPKL 4HWZB 2C4XA 4JDZA 1RJYB 1R3HA 2C3VB 4ODTH 4PJGE 1A3LL 2IBZY 3DVGA 5FYJL 4Q2ZB 3SO3B 4F58L 4NM4H 5DJ6B 3IDJA 4P9HL 1T4KB 4ZFOL 2NY0D 4XB7A 4LCCA 4S11A 3F12B 4AMKH 2HKHH 1DQTA 3O3UN 2FEEI 4AMKL 3BP6B 3FMGL 1LK3L 1RIUH 5FDYA 4PP8C 3Q0HA 1A14L 5TF1L 1F00I 1G9MH 3JTSB 4ISVB 4PV8A 4CVUA 5LGHL 4MB5A 3S36X 1JPFA 3GSWB 1WTLA 4UQ3A 4TVPH 3GHBH 3VXOB 5CGTA 1I8MB 5CIPH 3GSUA 2VZOA 4JFEE 4JRWA 4PJDB 5FYKD 3WKMH 5H35A 2VN7A 1NKOA 4X4ME 2CSPA 4EEEA 4FQPA 4RFNB 3ZDYF 4L3ED 5F44A 3QFJA 5FV2A 4N5EA 4WHTA 2UVFA 2K3TA 3C08H 3HUJA 4X7DC 5GISL 4I0KA 2IBBA 5IEHA 3IFLH 5EU3B 4L4VD 4G80B 5A2FA 3WDHA 1I3UA 4YBLC 3UDWA 1UQSB 3BT2L 1RU9L 5I1DB 5HHMA 4JFFA 4MNGE 3T4AB 2OSLB 4AEFA 3FB6B 3D3VA 4BA8A 1LP9A 3TNNB 5MEPB 3EO0A 1A6ZB 1IAII 3AU1A 1BD2A 3G04A 4EN3B 1NGWB 1CE6A 4KROD 4GAJL 4DW2L 3RZCB 2ATKA 4U0QB 4KXZH 3D0VA 2WBWB 4KMLB 5DYOB 2W9EH 4TVPE 4OGAC 4N8CL 4ZG1A 2V7HB 5GGQL 1OGAD 2FX7L 4X6DE 3NPZB 1W8OA 2Z35A 4NOBA 1G6VK 2QQNH 4Z7WB 1HH6B 1ZSDB 1FAIH 1PG7H 4GSDH 5K93A 4WWKD 1BZ9B 5EUKB 5IROC 1OCWH 3STZB 1D5IH 4JREC 5D70L 1PZ5B 3V6FA 2KH2B 1M7XA 2P8MB 3LKSB 3OKOB 4UUJA 5L8JB 4XMKH 1MEXH 3GIVB 3VI4F 1VEPA 2VYRE 1JGUL 3KPSB 5FM5M 4OCSL 3RZCC 2HN7A 4EI6B 1GJIA 1TPXB 5IG7B 3S4SG 3SE8H 1NC2A 4LGPB 5T1MA 4MX7B 2GY7B 3PGCA 4JO2H 5C71A 2F19H 3V0WH 4Y19D 1RMFL 1R6VA 1Z0MA 3P9LB 3LKNA 1AXTL 4BK5A 1AJ7L 3NFPB 1OWRM 2OMBA 3EYQC 3Q6FB 2ZUSA 3GSXA 4IDJH 3RWFA 2GTZB 4Q6YA 4JFED 3VXUA 2ZOKA 5DVNA 1BD2E 5T5FL 4ZD3H 4OTXH 2CK2A 3VDBA 1A3LH 3B9KB 1D5BB 1I1AA 4NOFA 1U2HA 2APVA 2CIKB 3H9SB 1JMXA 4QTIH 2HFEA 1JF1A 1DE4B 2VLJE 5GZND 4H1LA 3VXTB 4XPHL 4KY1H 3CZFA 1IAIM 3ULVL 3QQ4A 4L4VA 1HQ4A 4Z7NF 3KJ4B 5F70A 2CD0A 4GO6B 3SBWA 1MCRA 5F1OB 4RFOH 2BMKB 3EJYC 4RBPK 1OW0A 3DETC 2F9BT 4L3EA 1EVTC 4LARH 3MR9A 4WUUE 2V6HA 1H0DB 4QXGH 4HJJH 1PVHA 4WENB 3GSNH 3RL2B 3OR7A 5DFWH 4LASL 4PJIE 5C0JB 3RWJA 3N9GL 4GRWB 4I48B 4JFHE 4A6YL 1ZS8A 1FFOB 4KAQL 1HEZA 4NQVA 2NY4D 4G5ZH 4YLQT 2EIEA 2KKQA 3B5TA 4QRPB 3UTSD 1DUYB 4YHKL 4S1QL 3LQZA 3WEXB 3MJ7B 3OAZK 4X98A 2V7NB 4NSKB 5C1MB 4UTAL 3DYMA 3W82A 1UH2A 4Y1AE 2EIBA 2EO9A 1OT1A 3SE9L 4NHUE 1KCUL 2VDNH 1CLYL 1RZIB 4XNXH 4V3DB 2DQCH 1NSNL 4FG6C 2PYEE 3BW9B 4OD1L 3EYFA 4UT7H 3TIDB 3RIAK 2XY1A 3JVGC 2XXCB 2YPKB 2XRAH 3H0TB 4PRIE 1N64H 1U8NB 2JIXA 3D9AH 4WEMB 4R26H 3W2DL 2BOCA 4WU5B 2VLLB 5CP3H 3P0GB 1CICB 1MY7A 3HZYA 1DQML 2SEBA 3UTPD 1NUFA 4F7EB 2QHRL 3BPOC 1DQMH 4ZUVB 3ME0A 4LCYB 1QRNA 3JWOC 2V5TA 1W72L 1RUAL 1HHHA 1UB5A 2CIIA 3ARGD 3O41A 1KCKA 3SQOH 1ITBB 1OWWA 5IHUH 1F4HA 4R4FL 2C3GA 3QUZA 4JRYB 3SDCD 3RL1A 4Z5RA 1F02I 2VE6B 5DJAA 4QRQB 3JV4A 3MNZA 4TSBL 1I1RA 1PG7X 3REWA 4BSVB 5IOPB 3QJHA 2HYMA 4FQ1L 2X4RB 4M6ML 1G7PB 4PJCB 2HJKA 4PJAB 3E6HB 4IDJL 4M6MH 2FGWH 3ULSB 3Q6FA 1OF2A 3RWFB 4HZAA 5T5NF 3MLVL 4U4BA 4FMFA 3T0DA 4NSKA 2D7TH 5EPMB 5TDNA 2EDHA 4ETQA 1C12B 1Z2KA 3TV3H 1JWMB 5GRWA 4CMMB 4E41D 4WRLA 1LEKB 1F13A 2NY6B 4B0MM 5IEKA 4M8QB 1VPOH 4QGTA 2PXYC 3TH4T 1J05A 1T89C 5DMGC 1G0YR 3IKCA 4NN6B 1P6AB 5DS8B 4QY8A 3MFFA 1F5WA 3C09C 1ZS8B 2VB5A 3UTTA 3I6KB 3K46A 4PGCB 4ODTL 3MLPA 2F54B 4PG9A 3RL1B 2MCPL 2SEBB 2HT4D 4K23H 1U91A 3FFCA 1FP5A 3QPQC 5H8DA 5B3JE 1IAIH 5LKNA 4JO1H 3MR9B 5AEAA 2YKLL 4J3WA 2P5WD 3OSKA 5EUKA 1EV2E 1UCBL 4M1CD 5BV7C 4TOYL 1XIWA 1Y18B 4MGXA 1WFNA 2Y72A 2BHUA 4JQXC 3OHXB 1MIMH 3IJYB 3JV0A 4KHXL 4F2MB 1I3RB 1NBVL 4GAYA 3BMWA 2WQRA 5DD6B 4P4KC 1V5JA 5DRWB 3TVMD 5BQ7B 3OKKB 5AAMA 4DUWA 1K2DA 5ESVB 3GHBL 1MJUH 4APQD 3O2DH 4ZNEA 3LOWA 3PWNA 4ZO9A 5EZOL 2JF1A 4LKCA 4JB9H 4EQ2A 5DGRA 1EPFA 3QWOA 1L7TL 3FFDB 2B8OT 2DYPB 5AYQA 1T3FB 1UJ3B 3O2VL 2B0SH 1Q1JL 3FB7A 4K3EL 2WUCH 3LN9A 3MNWB 5ETUA 3WNLA 4PRDA 4GBXC 1RJZA 1ZLWK 2AABL 3FQXA 4K3EH 2Z93B 1M6OA 2JB6B 4YBQD 2E8ZA 3ARPA 3B2UC 2WBJA 2DIJA 5EOCL 1Y6NR 1QLFA 3QDGD 3RUGA 4PS4L 3PWPB 5EULV 4KK5D 4NQUA 1U3JA 5ECJE 4NO3A 4HXAL 4EDWH 4YIQA 3NVQA 1G6RL 1B6DA 1N59A 3WHXB 4IRSD 1CD8A 4NJAL 1VERA 4HBQA 5DO2C 5TQ0L 3QEQB 4ZUSB 5BXFA 4MB4A 4MLSA 1KEMH 1KCGC 2AJYH 1YEIH 5E8DH 3PHOA 3R4DA 4PJBA 1P69B 5I1AB 4W4OA 3CIQA 1MAML 3EDEA 3U79A 2ZCLH 2HFGH 3IFOA 2W65B 1G7IA 3KAAA 4XVUC 4JHBA 4U1NA 4WV1B 4DK3A 1PEWA 1G7HA 4JG1L 1RZGB 5FECA 5E03A 1NMBH 2R39A 4MNQA 4U1MB 1INDH 3QG6A 3HE6C 3TZVB 3LKOB 1M7DB 1S7TB 3MV8E 3QUMH 2WINB 4HGKC 1XF5B 4JG0H 2ERJC 5C09A 5CEXB 3LB6D 4KJWD 3V5HA 1X5GA 3O6MH 4NQEA 3P0YH 1X5IA 3WBDA 1QYGL 2XIDA 4KUZL 2J2ZA 1II4E 3UYRL 4OZGB 2VDRH 2Y36L 4RAVB 3EUUA 3TYFA 4FQXC 1KGCD 1BREA 3E2HC 3TT3L 2APWA 2DI7A 1G9EA 3TCLB 2CUMA 3DO7B 1KACB 1DBAL 1PSKH 3HG1A 4Z0BL 4GKNB 1KNOA 5EORL 2ICWA 2OXHA 5KSUA 1MI5A 1A9BA 3M8OL 5EORH 2ERJB 43C9A 1LNUB 5IMMA 1MCOH 4XC3L 3RY4A 3HI6L 2FEDC 4L4TA 5IP4A 4M9OA 1Z3GL 2N4IA 1QQDA 3KWWA 5HBBA 2FNBA 1PLGL 4O2FB 1MFCL 1R5VA 3O2WH 3IVKA 3EW3B 3UTZA 2ADGB 1PLGH 3SE4A 1J11A 3MGTA 2FR4A 3B2UD 5TF1H 3U9UA 3LKRB 5HYFA 1NEZB 1TENA 4PRHE 5GHWL 2YWZA 1RSFA 3L95B 4MD5A 5ADOH 2Z92A 3C60A 1T1ZA 2MHAA 2AQ3A 4FFVC 4YXLH 1KCVL 4UT9H 5IB4B 2DJ4A 5DI8B 5TJWK 3PG2A 4OLVL 4RX4D 1JNNH 5IJVA 3S96A 5EUOF 1MHPL 2UUDK 3E3QE 5BW7C 4MJ2A 3MOAL 2NW2B 3WDJA 4JDZB 4PTUA 3MLSL 4LFHD 4OF8A 3BRDA 2R1YA 1GXEA 3EDJA 4UZGA 1CGVA 4JPIA 5HTSA 4FABH 5J6GA 3T77A 3MNWA 3QO1B 1KB5H 2EKSB 3GMNB 4HHAB 2FGZA 4WGVB 5EOCH 1F6AA 4GAGH 4NNYA 2EKSA 1H3UA 3RVVC 1CD1B 5I17B 5CFHA 1E6JH 4UTAH 15C8L 3VXMB 3N0PB 4M1GL 5BJTA 3MPCA 2YUVA 5GGSA 2W9EL 2Q1EA 3BIAX 1FZOA 1CGSH 1CLZH 3ARYA 4FQXA 3UZEA 5ILTH 1NFIB 5GS1A 1EX0A 5D1QB 5BS0B 1DL7H 1R3JA 4JCLA 4QHKI 5DD6A 4V1DD 1D6VL 3RWIA 5IT2H 3DRTA 5KSBB 5IHZB 3T0AA 4GSDL 4U1KA 4J4PD 4Y2DD 5DRNB 4NM8H 1YPZB 1MFEH 2C1PB 5HYQB 3NCYS 4E42B 4LSDA 4O2FA 2XKNB 2Q3ZA 3FTGB 1BFVL 4CADB 4ZFFA 4LSPH 4P59L 2LE9A 3F58L 1GGYA 3BP6A 1G1YA 2D0GA 1IJ9A 4JQIH 4LSPL 1FIGL 3CC5B 4P59H 5FYLE 3IVKB 3S6CA 2GSIB 4PJ7F 3QEQA 4ZUSA 1KJMA 3P4NB 2BZDA 1AGCB 2EDJA 3UDWC 3SKOA 3P0YL 1BHGA 3VFMB 3IXTA 4QTHA 4PRHD 4U7KA 4G8IB 2GCYB 1CBVL 2LU4A 1WEJH 3U0TA 4MA8H 4PJIB 4GS7C 4PRBB 2F19L 4IIQA 4FFEX 3G6AB 3FB5A 4P2RE 4OZHB 1DBAH 4Z0BH 3VXSE 3CJJA 3JV6B 3FRPA 2VITB 3G9VA 4F7TA 3SDAD 5LVEA 4F8TA 1F90H 2XA8H 2ICES 2J8UF 2ZWLT 3RIAF 4L8CA 4L9LC 4B41A 3HE6B 3TZVC 5MI0B 35C8H 3BDYH 3MZGB 2XA8L 2IALA 5IVXE 3HNVL 2Q8AL 1OLZA 3GSQA 5IF0A 4JO4H 2WBKA 2ESVD 4NM4L 1F3DJ 1PQZA 1DUZA 1F58L 5D72H 1G7HB 3CXHJ 3CVIL 1AC0A 3ZDXE 5D7IE 1E4WL 2DDQH 4JFOA 1J9CT 5JHLH 3L6FA 1GYAA 1M4KA 4MJ6A 4OM1L 4U1GB 3X17A 5F7KC 4HLZG 3T2NL 1NDGA 5GHWH 5FECB 3I6GA 1AO7E 5A40E 2Z8VC 4KVNH 1RIHL 4OCNC 5TQ2L 1EZVX 4TULL 3P4MA 4Y4KB 1ED3B 4YXLL 5BV7B 5I9QB 4DUXA 2V5YA 1WF5A 5FUCE 5JZ7C 5BS0A 3OPZL 2JB5H 1JBJA 3EIFA 2W0FA 4QOKA 2YKLH 3M17B 4OLXH 3AXLA 5D7JB 4HJJL 3I6KA 4PGCA 1U8IA 4GH7B 1TVHB 1EEQA 3HZMA 4MJIE 4YX2L 4F33B 1UG9A 2QBWA 1OOAA 3UAJC 4DGIH 2X4PA 3WIIH 5EN2A 5GGRB 2BC4B 1ZGLM 4RAUB 2EH8L 2HKFH 5HD8D 1QHPA 2NY6C 3WFHB 2GI7A 5C0GB 1DBKH 2FECL 1A7PH 1NBZA 2BNQA 4NQDD 2X44D 2YZ1A 4S1DC 1YDPB 4XPAH 5D71L 4DKAA 3PWUB 5TDOB 3FB7B 1CLYH 3H3PH 2NY0B 1JCKA 4KK6D 3ZSSA 2OMNA 3EJYD 1GOFA 5SWSB 3T8XB 4EBQH 1CFBA 4O9HH 4NRYA 1G7QB 5LQBH 1ORQA 1TVBA 4JHZA 1J18A 5DUML 1ZLSH 3IFPA 2NY1D 1P7HL 1G6RH 4OUUB 4ACPA 1FE8L 1BEYL 5FF6B 4MXWH 3IF1B 3BISA 4GAFB 4KDWA 3WLBB 3QCTL 1H5BC 4LPVA 3O3AB 3ARSA 1A8JH 3HRPA 4J1UA 2EXYD 3ULUH 4L4JA 3CH8A 5IHUL 2ZOLB 4JY5H 4NFCA 3RJDA 4IOFD 4Z0XA 3QRFM 3SKMB 3UBXI 1TJIH 2VERN 2QSCH 3RQ3A 4Y4FC 1X44A 1Z5LB 1RUPL 1S7SB 2QSCL 1NBQA 3KPOA 1X4XA 4QXTA 2MTPA 4RAVA 3CFCL 3S88H 2XPGA 4JKLA 4JE4B 1XH3B 5TDNB 3BEVB 5GGVL 3C09B 5IKCA 4RQQB 2NLJB 4KZEH 2IFGA 5B4MC 5IKCB 4BSVA 5IOPA 1A0QH 3JWDL 4X8JA 4OT1L 1VPOL 1KTDB 2GIYA 3NN8A 3DJ9A 1O7SA 3W39A 5BZDA 1H8NA 4WWKC 3TT3H 3FT3A 3ARUA 5FA4A 1DLFH 1FGVH 4NKQB 2PETA 2ZPKL 1FL6B 2CRIA 1KJMB 4XHJC 4ODWA 4K7PL 2C7UB 1L0XA 4TULH 1IKNA 4DGYH 3KPPA 3BPNB 3CK0H 1NCCH 1GGIL 2JB5L 3Q5TA 2DBLL 1WQVT 4GLRI 5T1LB 2VJXA 1IT9H 4LCUB 4QRRD 4XNZC 5F6HI 1J1XL 3VGGA 5E2UL 1UM6H 4NCC2 4DGIL 4FS0A 4MA3B 1MJUL 2VLKB 4ZFZA 1DQQB 2GSIA 3JZ7A 1DBKL 3KPRD 5D5MF 4ONGL 5CGMA 3BWAB 2KZWA 1JHKL 1QBLH 1QD0A 3HAEA 3WEXA 5JQHC 1MHPH 5EZOH 1CD1A 4P57A 4HSQA 3JUYA 3B9KC 3RKDD 1SMOA 4RGMB 1JF5A 2B1AH 5J89A 4OJFL 4UV4L 5TDOA 3GSXB 4KHTH 2ZG1A 2B1AL 5F7LB 4FABL 1Q9OB 3MV8D 5MP6H 1IZJA 2EEAA 3Q2CA 4PJCE 4JFZL 3L3GB 2BSSB 1T7WA 3O6LL 5MP6L 4RGNB 4GG8A 1VCAA 3KJ4C 2BC4A 1DUYA 1FV1B 1P7QB 2KPNA 4KGJA 4NRZB 1V3MA 5HYSA 1XR9A 5E08L 1U93A 2CDGB 3UROR 3KNBB 1E4XI 2X4NA 3OB8A 4Y4KA 2K7PA 4XMPL 3VXME 2LFGA 1LE5B 3D85A 3O6FB 5T3XL 4J7RA 4LLMA 3QIBC 2E9IA 4NJAH 2H2PC 1B88A 3LMJL 2BXYA 5BRZD 4CJ1A 3GBNL 1K6QL 4NFBA 4HMDA 3GUTB 2AEPH 1UKSA 2WLZA 5IK3A 2CIKA 3PABA 4M8QA 5F7EH 4XBEH 2FO4A 4LRIA 4PJ5E 4Q9CA 5DT1L 4GRLC 4L4VE 1QBBA 4JB9L 4KC3B 4PYHA 1T83C 1QYGH 4KUZH 5I76A 3MRNB 3UTQA 4MXVF 4JG0L 5TFSL 5CJXA 5DJCA 3EYSL 2PXYA 4XVTL 5EN2B 5GGRA 4UAOC 2YPLA 4WCYH 1CLCA 4PJHA 3PL6C 1LO0L 1XF1A 5HHMB 4G43A 3UJTH 2EDKA 1NKRA 4WU7A 4JFDA 3SGEH 5FHBH 3ZL4L 4WI9A 3MOBL 5F8QC 1CDHA 4RNRB 3ZYJA 5C0IA 1AY1H 2NY3B 2CH8A 5CJ8A 1NGQH 1SBSH 3ARGB 3MOBH 1E28A 5AZ2H 2A6JA 3V6FB 1A6AA 3O2WL 2OI9A 2EYSB 4TUJB 1FZJA 3PNWA 4JGMA 3MJGX 4Z7WA 4DQOH 1E4WH 4ZUVA 3TT1L 3MJ8A 5HHME 3UAJD 3GMMA 1PY4A 2VKWA 2WIMA 2VLJD 3ILPA 3KYOA 3K74B 5D5ME 2BVTA 5C0CE 5I1AA 1MRDH 2BOCB 1EGJA 4KVNL 5TQ2H 3HB3C 4EOWL 5BVPL 3C6LC 1CFNB 3TN0C 4BK4A 2XA3A 3A67H 2IH1B 5GS3A 2I9LA 1AFVH 2E6QA 4LMQE 4C56D 2D7QA 5TH2B 5IHZA 2PCPA 2E7BA 3CLEL 4P2OA 4WJ5B 5EU5A 2IH3A 3FOLB 1P2CB 2IF7A 1HOCB 2FO4B 3IDMB 2PN5A 5C08E 4U7MA 1ADQH 3O6ML 2Y5EA 4FTVB 3AREC 4KJPD 5EO1B 1YDPA 2HLAB 2IWGA 4OLEA 3GUTA 5F9JA 5E4EC 1BD2B 1FFNB 1HHJA 3ROOA 3LEXB 2VDLL 5F9JB 2BVEA 2LV4A 4XP1L 5IQ9A 4G8IA 1BF2A 1PKOA 5EU7C 3UJJH 2OJZH 4KFZC 5ETUB 4L8DB 2MKWA 4D9RD 4N0UB 5DMYA 1IGIL 1RY7B 5E5MB 1PSKL 5D1ZD 1FCCA 2C9AA 1DVFA 1KJ3L 4I13B 2L4OA 3N1MC 4ZUWB 3ES6A 3RA7L 4L9LA 4UQ3B 2JJTA 1MH5B 1UC6A 1VESA 5FOBB 5KTEH 3BOVA 5HYSB 1DL7L 5TQ0H 3QSKB 1CFSB 4HKZA 5CGYC 5T3XH 3SDAC 1TZHB 3WCYA 4U3XA 3WO4B 2BVPA 4AZ8A 4P9HH 3CVHA 4S1DD 4F7PA 1NEZA 1CGSL 1CLZL 4Y5YB 2XKNA 4P23A 1HYSC 1IGYA 1TLKA 1RZJH 1T1ZB 4OZFA 1TZGL 3MV9E 3Q1SL 4LK4A 1UXSB 3CSGA 4APQB 3CGTA 2BVQB 1NCUA 3ZTNL 1W2KT 3W0WA 2XTJD 3CAFA 3EDKA 3L7FA 5EU6D 5FOBA 3IDXH 5KSUB 2W1NA 3IXAA 4OLVH 3T09A 3ZTNH 4I0PD 2GJZA 1MCKA 2D7MA 2VDML 2YK1H 3LQAC 3MOAH 2DM3A 1NFDB 3T0EC 3IKCB 3OKNB 3E2HA 3UTOA 2J8UA 4NPYA 3X13B 3VXUB 4N0UA 3ARFC 5JLZB 1TJIL 4R8WH 5CZXC 1A1NB 3AM8A 2YN5A 1JTPA 4XNYH 1Z6JT 2PYED 3DUHA 3EAKA 3FQTA 3S88L 3U9PH 3MUHL 4AH2B 3RWCB 3SCMC 1HOCA 4ZS6C 2H3NA 3HNVH 4WO4A 1L9MA 3T1WA 4YXKL 3UP1A 4HWBH 3P11H 1Z3GH 4RGNE 1CFNA 3NCBB 1R3LA 2VLRD 4JZJB 1IQDB 4OFYA 1RZKC 4IOSD 4Y4HD 3LN5A 2XZAH 4AIZA 1CXKA 1ODAA 3QXWA 1FNLA 3G6DH 5JMRA 1M7DA 2P45B 4PGBB 1A7RH 4D9RE 4ETQB 5DVKA 2EYTA 1MQKH 4TUOA 1FPTL 1A7RL 5EO9A 5E8EB 3O4LD 3W5MA 4HS3A 5D7SH 3ULSA 1ZVHA 4DGYL 3OPZH 4UMGA 1EGJH 3DMMD 4TVPL 3EOBB 4UQ2B 1P4LB 1Q72H 3CVHB 4F7PB 2DWDB 3ARDD 2FZ3A 1RAMA 2L7UA 5EFIA 5CJ5A 2YD3A 2XWTA 4LLQA 2CLZB 1T20B 2XWBA 4G5ZL 3WUZA 3BH9B 3JVGA 2W0KA 1HHIB 3DHJA 2BDNH 2AK4D 4PJHB 4BH8A 1NCTA 5DWUH 2V17H 3E2HB 3BT2H 5HYIA 4OI7A 1IGIH 5D93C 5IQ9B 3BPCA 3DMMC 4U05A 4PTUB 1T22A 1SEQH 2FEDD 2DJSA 1OGTA 3UEZA 1FC2D 4G7VL 3BSZH 5E2VH 3J8F7 1LILA 5DHVH 3AFLA 5IK3B 1D6VH 4J23A 1OM3H 4X6CA 4U6XA 3EYFB 4OCWL 1QHOA 5GGUB 1HH9A 2QQNL 1K2DB 2XQYG 3LH2H 3K80A 4CGTA 4B50A 3I85A 1YMMD 3MV7E 2BSTB 1TTFA 4MNHB 1BFVH 4IHOB 1I3RA 3GBLA 4D8PA 4O02L 1NH6A 3P3YA 2QQKH 4XMKL 1T1WA 3ZHLA 4D3CH 4X7TA 3WS3B 4U6YB 4S0UC 2VDMH 3D87B 4BSJA 3MRLA 2QSVA 3MJ9L 3VXNA 3V7AE 4X5XA 1EFXB 5LCVH 3VFOA 3MJ9H 4JO2L 4JY5L 1CDCA 3BDXA 2LQRA 5KS9E 5DDHA 3OWEA 2EDQA 2HRLA 5SV3A 3BHBA 1QEWA 1ZAGA 3T65B 3PQYD 4PTTB 5ACZA 1H0DA 2DWDA 1JGDB 3QIBB 1JWMA 4M4PA 3QWOB 4OCMC 4P2QA 5INCA 4ODWB 1QFPA 4ZD3L 3SDXB 5HVHC 5LWYL 3P4MB 5D1QD 4XCNB 4ESKA 3H3PL 1SJXA 1SJHB 3OJMB 4XP4H 4QTIL 1CXIA 3TV3L 3W9DB 2CRYA 2X9XA 2BNUA 1QSFA 2WM0A 5IBUG 1MCFA 4C58B 3UO1L 3SE3A 1CG9A 4P46C 5AUMB 1Q38A 4HGWB 3TFKA 5CJBA 1YMHB 5F72S 1MFDH 5E99H 4NC0B 3D3VE 1DQLL 5I8KL 1Q9LB 1U8PA 4P2QB 2M8XA 3NZ8B 3QCTH 5D1ZC 4BM7A 5T3ZE 5L2JA 1XFPA 5ID1B 1U8OA 4KVCL 3GM0A 4Y4FA 1N2RA 3ZT5A 1AE6L 3WLBA 5DRZB 3G08A 1CD9B 5GSRB 3D2UD 5K9OB 2FX8H 3HMXL 3O0RH 4OKVA 5ICZB 3DURA 2J8UE 2K7QA 4YX2H 1O7VA 3MRLB 4Z8FL 1DEDA 2W60B 4MQSB 2BSSA 4OZFH 1JV5B 1QSED 5DJXB 3O2DL 3WIIL 5K59E 1G7QA 1F4WL 1T1WB 1JUFB 3KR3L 4HUMB 5JPMB 1ZE3C 4CW1B 3ZHDA 3ZDXF 4JHAL 3S4SA 3TBWA 2DI8A 4LPUA 3FOMB 5GGVH 3QDJD 3O2VH 2FJFB 1CTOA 2A73A 5HGDB 4LMQI 4I2XB 2X4PB 1WZKA 4EI5D 4PGZA 1N3NA 1J1OH 2B4CL 1HHKA 1J0KA 2YOCA 4KK5C 2HJFA 3S37L 5EB9A 1M05B 3PGDB 3BP5A 3OAUH 1N64L 8CGTA 2APFA 1KCSL 4JDVB 4LDOB 3A6BL 5FKAB 1T03L 2HVKB 2X7LB 1KT2B 4R97C 4CDGC 1HEZB 3O8XB 2JCCE 5ERWB 2CO6B 2QQKL 4FQQB 4X80L 2V9QA 2BSED 4P9MH 2Q6WB 1AI1L 5K9JH 3RY6C 5JLZA 3MODL 1QBMH 2GSGA 3V79C 2DBLH 2ESVE 2AXHA 4KKAD 1Z9MA 2K1MA 1T89A 2OL3B 1XGPA 1U92B 1OPGH 1RURL 2WUBL 4XH2B 4NO0B 5FUOL 1NFKA 4HWUA 4XCYB 4OF3A 5F21B 3TJHA 4QOKB 3AREB 4MJ5B 3MCG1 2E7LC 5IF0B 4ZTPL 5HYEA 5KW9H 5CS7A 4YPJA 4G8GA 4NQDE 4ZAKB 4L3EE 5I1CL 3OZ9H 2ED7A 5E56A 6CGTA 3I3BA 3GIZL 1K3ZA 2BOBB 4KZEL 5L88L 1VACA 1FNEB 2IAND 4TPRL 5JA8B 3TBTB 1UEYA 4PRID 3T3PF 2A6IB 3CSPA 2EXWD 1N2RB 4J8RA 2E3VA 3RU8L 3OXRA 2EKJA 1HHGA 1DZBA 5CD5D 1K8DB 2BY3A 3B43A 5E08H 2CDFB 5E4IA 2LAGB 4EXPX 5ICXA 1ZHNB 3DVIA 3DSFH 3GMPA 5KN5B 4GRWE 5IVOA 4WEUD 3LEXA 1I85C 4UV7H 2R23A 4NHUA 5CSZB 5DA4A 4FQJL 4YHLL 4ZO6A 2EE3A 4UV7L 3P30L 4FTVA 1YPZA 4R2GB 1H8OA 2X70B 4J6RH 3QUXC 4IHOA 5C0ND 4WHDA 5I0ZA 5J56B 1W0WB 2NTSP 3D0LA 4Z7UE 2AJUH 4OZGE 3T0EB 1F3JA 4M5ZL 1IM9A 4NRXB 3VFSB 2R0ZL 3RVWC 4WWID 4NRXA 3VFSA 5CEZE 1IKNC 2FGWL 1ZVYA 1LWRA 3QXAB 3TNNA 1CK0L 1D5XA 3U0PB 4DZBB 4OIBA 3G5VB 1WITA 3H9SE 4M7LH 3GSVA 5GIRA 2C4FU 5CBEA 4HDIB 1L0YA 4XP1H 3UZVB 3BE1L 3NCFB 1KB5L 1TJHH 2BDNL 1EXUB 3A6OA 5IB3B 1A5FH 4JRXD 2AABH 1IGTB 3PL6A 5L2KD 5IIEA 1E6JL 1I8IA 3SHSA 1WICA 2F54D 4FG6D 1ZVSA 5C07E 5FA3A 4YHOH 4UOW0 3OQ3B 4HUUB 4EDWL 1GSMA 4CN4A 5CKGA 4LCWD 5GSVB 5D7JA 5J06A 3NIDF 5IV2B 1XR9B 4UUJB 2QJDA 2J88L 1EA9C 2CMRH 2I9TB 3MV01 4ZFFB 4AG4H 4NT6B 5DMKA 3ULVC 4ZUUA 3AUVA 4FXGB 4QRPD 4L1HA 5DFTA 4AG4L 5DJDA 1A02N 3B8YA 3GJEA 4ZYKB 4GKZA 3L3DA 1K6QH 3UXFA 5KSAC 4PV8B 3S5LA 2VXQH 2EECA 5ESAB 3SN6N 1R3JB 3U0PA 1WIPA 3S5LB 4Z7VB 1EHAA 1GVIA 3AREA 4K7PX 1R3KA 1AFVL 4X6DB 1VFUA 5I1CH 3HE7D 3PWNB 2DYPD 4XBPA 5I15L 3L5IA 1JNNL 1NBZB 1U3HA 3HHRB 3BQUB 4QLRA 1RZJC 4OLWL 1A4KA 1U6AH 5MERB 4Z95H 2YK1L 4R4NC 3OXSB 5DEGA 3C08L 2WY3A 1JTOA 1N7ML 1QOKA 2CKBB 2D9CA 4PLKC 5I74B 1GC1C 2VDLH 4G80A 4UDUB 1MHCB 3SPVA 1EJOL 4LVOB 2YR3A 2X4NB 3CFKB 1NEUA 2HLAA 2HT2C 3FL7A 4X7CC 4DZ8A 1Y6MR 5E00A 5E9DD 5MENB 2AJVH 1BAFH 4M02A 4YHIA 1K8DA 5CSGA 2I9LB 3HI6H 2AJYL 3DGCR 5IB4A 1YNLL 2HJFB 4ZO7A 1DR9A 4MNQB 4MXQA 5EOTB 1GZQA 3AB0C 1J0IA 3HC3L 1KTRL 4OD2B 3U30C 2R8SH 4N8CH 4TUOB 4FP8H 4F7CB 3LAFA 1MQKL 2NW3A 4BFEA 5J11B 3TT1H 1NLDH 4LEXH 4GG6E 2GJ6B 4Z7QF 3NCJL 5AZEH 5HYQA 4B7IA 3X14A 1IGYB 3RPKA 5ADOL 1UACL 4TNVK 3T0EA 2XQYK 5F8RC 4LCWE 4OZIE 1G7IB 4G8GB 4N1HB 4HCRL 2AXFB 3FQWA 3ARFA 5KN5A 4UDTA 5AD0B 3CLEH 3SO3C 3ZYZA 1AHWA 2CUIA 1ZHKB 3G08B 5JORA 1R3IH 1ADQL 3MV7D 4XXDA 3IDYC 4PRPA 3ZTJH 3X3FL 4X83A 2FX8L 3O3BA 4I77H 4WFEE 1G6RA 1RD6A 5JOEA 1HYRC 5T1DL 4Y16C 2CXGA 2GK0A 4NNYB 4PJGF 2XN9A 2OJZL 5DK3A 4XNYL 1A7PL 2C7UA 1A1MA 3NIDE 1D9KB 4JFQA 1QR4A 4OQTA 1FYTA 3U82B 3WHXA 2XTLA 1OAYL 4P3DA 5FCSH 5T5FH 5TDPB 4LCYA 4YPGA 1YY9C 1ZHNA 1XF5A 3KPLB 1FJ1B 4I18B 3NOIA 1T2XA 3BZEA 3HRZB 3P73B 3QIWD 3OHXA 3GZKA 3RVUD 3BSZL 2C1PA 2BNRE 4U1NB 4KY1L 4WV1A 4P46A 3FQRA 3TIDA 4MCYB 2Z4QB 1R5WB 2EDFA 3CFDA 4Y5YA 4ZAKA 1ZA6B 2OL3A 1WWBX 1BEYH 1FO0B 3TO4A 5A2LH 4M6OL 2ADGA 2NZIA 4NNPH 1BVLA 2OTUA 2BX5A 3MUGA 1Z0NA 4KRPB 1A6VH 3SO5A 4H8WC 2R1XA 5I15H 3MBED 1XGPB 1CVSC 3SDDD 4GAYB 1QFWH 1NUDA 2C5DC 1WAAF 3AM8C 4IRJD 4ZOCA 5E24E 1QP1A 3MJ9A 4CL7A 3DX8B 5J8OA 2D7PA 1N7MH 2IGFL 3L1OH 2AJXH 1U8IB 3UJIH 2OR7A 3RDTA 5KSVB 4JZJC 3QEUA 1T6VN 5C09E 3S8WA 3IRZA 4DKFL 15C8H 1EERB 4D9QE 4ZOAA 1WBYB 4M62L 1DEEA 1N0LA 4DKFH 5ISZD 1J0JA 1BAFL 4NC1C 5D71H 4KI5C 3ULUD 1IGMH 4HFWB 4M7JH 5LWYH 1HI6B 4PJ5B 4PRAA 2VXUH 1N4XL 2CR6A 3WFBL 1BX2A 4XNXL 5D72L 4EBQL 5DJXA 1MVFA 4HK3J 32C2A 4W70A 1S7WB 1ZV5A 4YFLF 2QKIB 3VI4E 4PGDB 1GAFH 3QQ9D 2AEWA 1IKFH 4H1LB 1LGVA 3PGFL 1NLDL 3VG9C 1W72B 2CQVA 3RPIB 2OK0L 1RFDL 1IQWL 3PGFH 4Y1AB 3O2DA 1JV5A 3VI3E 5HPOA 1MEXL 3SGDI 1VFMA 1ACYH 4RAUA 5CGYD 1QRNB 4C4KO 3CCHA 3M07A 1AO7A 5E99L 4MXWL 3VMPA 5DJAB 4OCSH 4Z9KB 3QIUD 2Z8SA 1N8ZA 3N1PC 3TBWB 2V5MA 5DRZA 3BZFB 2GYSA 3I02A 1J12A 1HHGB 3R06B 5DK2A 3BRFA 3GSNB 4PBXA 3HMXH 4OCLC 2FRGP 1QFOA 4ZXBC 1T0NB 4JHWL 1AHWB 3QHZL 4O51B 1RV6X 2DLGA 4JY6B 2QR0B 4XBGA 2PXYB 1U8PB 3EOBA 4WI7A 1CT8B 1ZHLB 1NFDA 4JN2B 4KJYA 1HWHB 2IG2L 1X5XA 1LE9B 2J8HA 4YHYB 2XZQH 1U8OB 3B5HA 2GJJA 1CK0H 5J1AA 4X5LA 1MCJA 2EDXA 4X7EC 3VWJA 1I9IL 2IJ0C 4GRLB 2F53D 2NW3B 5JIKA 1QFWM 2DLFL 4C56E 4YHZL 1RZGA 2D7TL 4FXKA 1Z9OA 2DDQL 3CSYA 4R4ND 2DLFH 3O4OB 1N6VA 1A5FL 1ZHBB 1J1OL 4PJAE 3RWJB 3QFDB 4F57L 2KL6A 5DRWA 1EFXA 3S37H 1DTUA 2D0HA 5JOPE 1B9ZA 5ENWA 1TMCB 1F4YH 3HA0A 3CDYA 5T3ZD 2VH5L 4M6OH 1AI1H 5K9JL 2ED9A 1YNKH 4X6FA 4PP1C 4JM2C 2WW8A 3D18A 1XR8B 5DJ8B 1J8HB 4HEME 4JO1L 3R8BB 4BH8B 5D7LB 1RZ8A 3BPOB 3RAJH 3T77B 1UWGH 2FDBP 1PJ9A 2AEPL 1WISA 2P48B 1OB1A 4PRPE 2AK4E 5E6ZA 3EOTL 4Q74A 4NUJB 4XBEL 1U8MB 3QNYA 5E2UH 4KJWC 3ZZ1A 5DT1H 5IMKB 4Q7DA 4M61A 3VCLA 1T3FA 3EFDH 1NANH 1RUPH 3EYOB 4XP6L 4X4XB 3PV6A 3CFCH 1BJ1H 4LKCB 5KG9A 1M71A 3LEYH 1RZ7H 2F15A 3LDBB 2XWJB 1ZT7A 2LTQC 1AIFA 4LLWB 4YDLC 2VL5A 2VZTA 2Y6SD 4M00A 1YNTB 5I73B 2AW2A 1FVDB 1UKTA 3O81A 3X12B 3GRWA 5SWQA 5LQBL 4LCUA 4GRWH 5C0AA 1WWWX 1OTTC 5KS9B 1OARL 2I60H 3T0XA 1YMME 4ZUWA 1AY1L 2RCSL 1RFDH 3MNZB 2XWTB 2A9NL 3HMWH 4IRSC 3I2CH 4GRLA 4I18A 3MRQA 4HHAA 2A9NH 4FQJH 4XVSL 3DSNA 3CK0L 4K7FA 1Q9LA 4JPIB 2XICA 3V95A 4BFIA 5FCUH 3VFUB 3ZKNC 1T80A 5EU6E 2O5ZH 4HGWA 4J6RL 2E7LA 4KRNA 4U2ZA 5GIRB 4JDTH 4Y19B 2XN9B 4GBXD 2HFGL 4NHCL 4PJ9D 1X6NA 3L7EB 5AWNL 4EZMA 1JNJA 3P30H 4KKBC 5D4QA 2NNAB 4PR5A 2V7HA 5KSAA 3QXAA 4XAWL 4JFEB 1T66C 3SDAB 3NABH 3MLWH 4IS6A 3H42H 4K7PY 4HFWA 1JF1B 4XCNA 3B9KD 3RKDC 4CVZA 7CGTA 1WT5C 4APQC 12E8H 5MEPA 3HUJE 2FIKB 2F8VA 3E3QA 1CTNA 2ENYA 1FVEA 5L7XH 4ONFH 4R7DA 1LDPH 4F80A 5JOFA 5J3HD 4J3VA 3FQUB 4ODSL 2IAMC 2ATKB 4PJXB 3RNKB 4OJFH 4NBXB 4TUJA 4AT6B 2WAHA 3U6RA 2OCFD 4FXGA 4XNQA 3ARBA 1FGVL 4X5XB 3VFOB 4GW5B 5C70A 4QTHB 1EO7A 2H32B 1IAKA 5IV2A 2X09A 3LS5H 1YEGL 4XWGL 4Y7MA 3AXLB 2A9MH 3PXHA 4XWGH 5I1DA 1INEH 5T1LD 3IKKA 4HPYH 5DJYB 4FTVE 1IGTA 1I9JH 1LO2L 2FBOJ 1NCAL 2OX5A 4WI6A 3RDTB 2Y1VA 4QRRE 4HIJA 3KJ6L 1MRFL 5F6HJ 2P49B 4M3KB 5BVJB 1P84K 3QEGH 2JK5A 1YQVH 5CBEB 5D7IB 5JA9A 5JXED 3QZWB 4KTEL 4I4WB 2A0LC 4S0TD 3QQ4B 2FYYB 2OI9C 3S37X 2O5YL 4MJ5A 3OAYH 1WCBB 4YXHH 5C2BH 3ZKMD 2Y23A 4N1CA 5KVGL 1IM9B 2EXWC 2EDLA 2EE2A 1OSZB 3TO4B 2IALB 4MVBC 4NKMA 3WXVH 4P2RB 3RP1A 4KHTL 5D7LA 3D48R 5MENE 1CS6A 4Q6IB 4PB0H 1R3HB 1U6AL 4Y16A 2P47B 1B0RA 1HDMA 4HT1H 2OM5A 1FFNA 5FA3B 5D7JC 5ITBL 2CRMA 3BD3A 5CD3A 1H3GA 1L9NA 4MB3A 2RCSH 2W0FB 2A6JB 4M62H 5ENWB 3RWEB 1IFHL 3PGCB 4NZJA 1MLBA 4XWOC 1S7QB 3CX5J 3HI1B 5AZ2L 3BP4A 3S34L 2BNRA 1YYMH 1JHTB 5CMAB 5E8EA 5ILTL 3VWKD 5BRZB 1YNLH 4Q6IA 2D7OA 4I2XA 2Q3AA 3NCYP 4U1LB 3EO9L 3NIFF 1KPUA 1MWAB 3O3BB 4FP8L 2BERA 1MFEL 4WUUA 1RZFL 3HUJF 5DUBA 1EGJL 4WIQA 1MHHB 3SGJA 5AD0A 3QR2A 2WWKO 1F3JB 1I75A 3BEVA 4NZTH 4F3FA 5C07A 1YEDA 2ITCA 3FOLA 3A67L 4LLAA 3AMKA 4AYFA 12E8L 3DUSA 3IDXL 5CIPB 1MOEA 2XY2A 3KXFD 1CI5A 2QV2A 3PHSA 3V6ZA 1PBYA 1T0NA 2IMNA 2P4AB 4HEPG 3RNQB 4ONFL 4XVJL 3F7QA 3HMXA 3MXWL 2NY6D 2GJ6A 2QSTA 1I7TB 3AAZB 3QRGL 1CF8L 4RWHA 3BH8A 5EIIB 1U92A 4ONOA 3WDIA 2NNAA 2C4FT 4IMLA 1SM3L 2B1HH 4PGJA 1S3KH 3U36A 2MQ0A 4MX7A 4PLNC 1GGBH 4ONHB 3HFML 4ZOBA 2B1HL 4BH7A 1AXTH 3B5GA 2EC9T 1JGEA 2GJZB 1NGQL 1SBSL 1N59B 2H32A 3RA7H 3IF1A 5K59F 1BGXL 4AY0A 1G0DA 4Q9BA 4Z7VA 2BVQA 2R9HC 3AS0A 4OBSA 4KUCD 2WBJB 1MJ7H 4P2CG 3WUWA 2HFFA 2NXYD 5BZWB 2DQUL 1VDGA 5KS9A 3MZTA 3EOAA 1V7MH 1U8NA 3BDBA 1LK3H 4BQCA 4B7LA 4LLUB 4ODVH 3BW9A 1JFQL 3VWKC 4Y5YC 4ZTOH 1V7NH 1H8SA 3T0BA 5CAYB 2VXQL 4P5TB 1UXWA 3PHOB 2NR6D 2F58L 5F9AC 3NA4A 4DVBA 1UACH 4X99A 2CUHA 2HT3C 2PW2A 4HUUA 4NNPL 3QXDB 1QQDB 1FSKC 4G6FB 4QT5B 5K9KB 5KVGH 3EYOA 1BECA 5E5MA 3QDME 2BJMH 5FYKH 4AIXA 2AJXL 1X4ZA 2DQJL 1U8MA 3QNYB 5DD1L 3TP4A 3K4DA 5I1KH 2X6MA 3VFNB 3MRRA 5DD1H 1BVLB 1FFPB 2C3WA 3GJFB 3S3PA 4DOHE 2Z31B 4JFYA 2CLVA 5TPWH 1OAYH 3DRQB 1RZ7L 4YO0A 1IGML 5I8OL 1O0VA 3DGGA 1Q9OA 4L5FH 5JXEC 4QYOA 4Z7UA 1MCLA 1A64A 1FVDA 4S2SB 5E2VL 5SWSA 3T8XA 5GS0C 3O6KH 2NX5A 4GW5A 1FGNH 2ZUWA 4K3DL 1RZJL 3HNSH 4GOSA 5IMLA 5JW4N 4FFWC 3C9NA 1ZT7B 2VSCA 1PY9A 3MRPB 2IANE 4IIQC 4NDMA 5EG6C 3KYKL 5I8KH 2FLBT 1LHZA 2FH6A 2UZYB 3CPLB 5C0BA 2VLKA 4JN2A 4KJYB 1I8LA 2XTJB 1LE9A 4OD3L 2QL1A 2DKMA 1C5CL 3ZTJG 2C3VA 4OKVB 4FZEL 4KVCH 4M93C 5ICZA 2EEDA 4JM2A 1ACYL 5AAWA 1NEZG 2CDFA 3KPPB 3MGAA 1NC4A 2QADD 3VD5A 3AGVA 2CLZA 1AE6H 2XWBB 2PO6D 3FO9A 4B53A 2B7DT 3WMSA 4Z0XB 4IOIB 3QDMB 5IR1A 4UI2A 5K9OA 3UJIL 5E0QA 5I1GH 3G5ZB 3B3IA 5JIHA 5DWUL 4MAYD 1BJ1J 5C0BB 2VR9A 3MREB 1GGBL 1JGVH 1WCQA 3K2MC 3LS4L 3I02B 4N0CD 4PV9B 3BFOA 3MLTB 5BZDB 3X3GL 4ZSOB 4HWBL 1CICA 4ODSH 4JEGB 1HKFA 2ZUVA 2EO1A 1F58H 2V9RA 4FQLH 2HJKB 3OR6A 3QH3B 2VNCA 3FRUB 3K1DA 1OP5H 3SJVE 2Z31C 3DPBA 1DE4A 5F1IB 3V7AG 4JLRB 4PJFA 3EGSA 4OT1H 3RGVD 4OZIF 2X1OA 2NY0C 1GGCL 1U8HA 2V5SA 3AS3A 1VENA 2OK0H 3QNXB 1GGCH 3ARDC 5D6CA 3NGBC 2XTJC 3GDBA 4N1EA 3G6JB 4FOMA 2P24B 4G8EB 3QEUB 4R90H 2IPUK 1FVCA 4QYOB 4NQCA 5FGRA 2R2HB 1NGWA 4Y4KC 3O8XA 2HT2D 2F54E 5DSCA 3OKDA 3QIBA 5JDJA 4G6JL 3GI8H 4NKIL 1B6UA 5D2NE 3GMNA 3BD4A 4UU9B 3CD4A 5FUOH 3U4BH 4PRNB 3DXAA 5DDHB 2R2EB 1S7UB 2DIAA 1T20A 2DTSA 4BUHA 3ZT7A 1GHFH 4U31A 3EFDL 5I1KL 5SX5H 5IFAL 5EFIB 1V3KA 4NCC1 2BCKA 5F1NA 1ERNA 2IG2H 3TLRA 1DBBL 2APBA 3D39A 3MRHB 3KR3H 5D1XD 4GG6B 2CGRL 1GRWA 1GCFA 2JLLA 2OZ4H 2WLYA 3MUGB 4CW1A 4DCQA 1SYVB 1JN6A 4MA7H 3WXVL 2Q8BH 4Y2DB 1NBYA 1R5IB 1I9RL 4OD1H 1CR9L 4FQXB 4PP2A 1MI5E 2Y07H 3ULVD 3D9AL 4L3AA 2FR4B 4XTRC 4I3SH 3NH7H 3C5ZA 1X5LA 4PP1D 5EU6B 3L3KA 4LSTH 4U33A 5B8CB 3MRHA 4JRYE 1JRHI 1EHLL 3DSFL 4HKJB 3TN0D 2A74A 5A16B 43C9B 4FZEH 5TDPA 5JPMA 4R4FH 2XKSA 3UTTB 3ROOB 3SJVD 5CSBA 2NXZD 1TQCB 1FNSL 3GMOA 1MELA 3ARZA 3MV9D 5FCUL 1BLNB 1UWGL 4N0RA 4RA3A 4RIRA 1HYSD 3B8SA 2DMCA 2OBGA 2MKLC 3QDGE 4QHMB 5HGBB 1G84A 3HC0B 2E9JA 2JJSA 1X4YA 3IDIB 4LPWA 4R96A 3MRFB 1PQZB 1C08A 4MD5B 4M5YL 1AGDA 3HR5A 1F4WH 2XZQL 4EN3D 5IMOB 3V4UH 1U8HB 3CCHB 5INCB 4JFOB 2WP3T 3CFDB 4HJGB 5CLWA 3MXWH 5C0NC 5I16A 1FNAA 3MRPA 3TVMC 3G6AA 5DZNA 2ZSVB 1IZKA 1DN0A 3GM8A 1F11B 1T7ZA 3TIEB 2YD8A 3MA7A 1AXIB 1XAUA 3PE9A 3ZKSD 2DM7A 2AEQL 5DD3H 4BYHA 2MSPA 2X4OB 3RTQD 3HMWL 1B90A 1FFOA 2B2XH 5DD3L 3VXMA 3U0TB 1NCCL 4JCMA 5JPNA 4V2CB 1VGEL 1S7QA 3HI1A 4K23L 1GGIH 1HXMA 4Y16B 5IFHL 1OVZA 2UYLA 1XT5A 2GKIA 4IOIA 5FYKU 2A83B 1H15A 5J9PB 1MJ8L 4JAMB 4PB9H 4K71B 1K8IB 4P0DA 5E1AB 3D2UB 3U30B 1YQVL 3C6LA 5AWNH 2YA0A 3QI9D 3R8QA 2WUBH 1WZMA 5I74C 25C8L 2YD4A 3PUCA 1FSKB 1MHEB 3IDMA 1RUQL 1CVRA 2QTEA 4RFNC 3QDAA 1BQSA 3FTGA 3MO1A 5C0FA 1Q94B 1MJJB 2BY1A 1MCEA 3WNNA 1OSZA 3SEPA 3I3EA 1FDLH 1I8MA 3MYJA 4QXUH 2VQ1A 1UADC 4GFTB 5IVXB 5FM4A 1MNUL 7FABH 4X6DA 3L7FB 2BNQB 1XMWA 1VA9A 4JFXB 4YUEH 5B22A 1CD0A 1RHFA 1D5BA 1FL3A 1I1AB 4G9FD 4ZDHA 5IFJB 4H25B 5CP7B 4CADA 2Q8BL 1DP0A 4PJBB 1EFQA 3HZVB 3V5KB 4N5EC 1T04B 2VABA 2HLFD 3OAUL 2A77H 4LKXB 4HFUL 4LLQB 3A6BH 1JZ4A 3RWDB 3RX5A 3N06B 1KEGH 1MAJA 4NN7C 2Q7YB 4N8PA 4OV6F 5JIIA 4LSQH 3WD5H 4LSTL 5GS1B 5IIEB 3SDYH 2PR4H 2X89D 4DZ8B 1WK0A 4YPGB 3FQNB 4RZCB 3CSBA 5B8CC 3GHEL 4P9ML 5SX4H 2PR4L 1HHJB 3BP5B 5C86A 3D5OF 1I4FB 4Y5XB 3WS6C 4FQCL 1MFBL 4LSUL 4OLYH 2J88H 3WFDL 3BIBX 3FO1B 2EZ0D 3PWJA 3U7WL 3V5KA 1EBAA 3IU4H 4NO0D 3KJ6H 3L6FB 5SX5K 4CMMA 1NGPL