3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
5D2LA 1ZT4A 4O2CA 4NT6A 4WJ5A 1A9BA 4PJEA 3GSRA 4PGDA 3RTQA 2H26A 2E7LE 3VWKA 3JTTA 3KPMA 4HKJA 4ZUWA 1N2RA 1AO7A 2P5EA 2NW3A 3CCHA 3PWUA 3BEWA 2BSSA 1K8DA 1W72A 2D31A 1C16A 1KTLA 3QUXA 1FFOA 1INQA 3ILPA 3X13A 4PJIA 4LNRA 4NQDA 2C7UA 3PABA 5C08A 4Z77A 5C0BA 5EU5A 5HGAA 4ZUTA 4Y4FA 4Y16A 1RK1A 4S0UC 2YPLA 5C0IA 3HUJA 5BXFA 3QZWA 4L29A 4QRTA 2X4OA 1G6RH 1T0NA 4UQ3A 3V5HA 4JRXA 3O9WA 1R3HA 1OF2A 1ZHNA 5AD0A 3L9RA 3FOLA 5HGHA 1T7WA 3QDGA 3PWNA 3TBVA 4JQVA 3T8XA 3C9NA 4L4TA 1DUYA 3TBTA 4PRBA 5EO1A 5F9JA 1JPGA 3GSQA 4MVBA 1EXUA 3KLAA 3BH8A 1FFPA 3TZVC 3RWGA 2NX5A 2VLKA 1I1FA 3GMRA 1ZT7A 3GMNA 2VAAA 4Y4KA 5HGDA 3HPJA 4PJ9A 2ESVA 3ROOA 5HHOA 3FQWA 4LCCC 3UTTA 4HS3A 1LEGA 2BVQA 2CLRA 3BP7A 3BVNA 2BSTA 4D0CA 1S7SA 1KCGC 1S7UA 1JF1A 3KPNA 1JE6A 3HLAA 3W39A 4ELMA 1LQVA 3TN0A 4G42A 1WBZA 3DMMA 2VLRA 5FA4A 3FRUA 1B3JA 1T7ZA 3DXAA 4E5XA 3I6LD 4NO5A 4QOKA 3QQ4A 3RZCA 2GT9A 2VLJA 1AGEA 3U0PA 5D2NA 1WBYA 4NSKA 1CE6A 3FQRA 5E8NA 2GTZA 4CVZA 4EUPA 4QRSA 1EEYA 4LCWA 4G9FA 3HG1A 4WDIA 3MGOA 2AXFA 2HLAA 3BO8A 3VRIA 5JHDA 3VXRA 4G9DA 4PR5A 5EO0A 5IB5A 3M17A 5HHNA 4JFFA 1G7PA 4D0DA 3M1BA 1AKJA 3ILQC 1KJ2H 3VFOA 3BH9A 4LCYA 4ZUUA 3VFUA 3LN4A 4U1JA 5ENWA 3VH8A 3VFRA 5HYJA 1QSEA 1ZT1A 1T1XA 3HCVA 5IB2A 5B38A 3DX6A 1A1MA 3ARGA 5EFIA 5DDHA 4PRDA 3TO4A 3RL2A 3VFPA 4NNXA 1M05A 5SWQA 1ZHBA 4IHOA 3MV7A 1BQHA 1ZAGA 1QLFA 1QVOA 2AK4A 2JCCA 1XR8A 3MRMA 3G08A 1L8JA 5BRZA 3SDCA 4NO3A 5IB3A 3VFNA 1AGDA 5D7JC 1EEZA 3CPLA 1N5AA 1TVBA 4L8DA 1ZS8A 2GUOA 1FG2A 2XFXA 4EI5A 3BZEA 5C0GA 2X4SA 3CVHA 2F74A 2YEZA 2X4NA 4QRRA 1HOCA 1B0RA 1JUFA 3TPUE 2VLLA 3SKOA 1JHTA 5L2KA 1K5NA 4MNGA 3SDXA 2OI9A 1T21A 3FFCA 4PV9A 1E27A 2BNQA 1MWAH 4ONOA 1GZQA 1T1WA 5SWSA 1BZ9A 1VADA 4GUPA 1HHGA 4EN3C 2PYEA 3ARDA 3BWAA 1X7QA 4Z76A 1QO3A 3O3DA 3FQTA 3BUYA 1NANH 1KPRA 1RJYA 1S7WA 3NFNA 4HUWA 1T7YA 4I4WA 5E8PA 1N59A 3UBXA 5MERA 3L3JA 3SCMA 4N8VA 3UTSA 4L8CA 3RWDA 4PP8C 3H7BA 1ZHKA 5EOTA 4U1HA 1FO0H 5IVXA 3TBWA 5BS0A 2AV7A 1W0VA 5ISZA 4PREA 1HHHA 4JQXA 2J8UA 3QQ3A 3CH1A 4MJ6A 3SKMA 5EU6A 3OXSA 3RWHA 3KPRA 1FZOA 3IT8D 4Y4HA 3LN5A 3L3HA 3FOMA 1KPUA 1S7RA 3B6SA 1S9XA 3DTXA 4PV8A 3RWEA 3WLBA 3L3GA 3KXFA 1QEWA 4JFOA 5J1AA 4Z78A 1M6OA 3MRPA 4PDCE 3KPOA 1CG9A 3W0WA 3GSNH 1JFMA 3QDMA 3GMPA 3JTCA 3JTSA 3P73A 4PGBA 3PWPA 4MJ5A 1A9EA 4V3EB 1YPZA 5GSRA 3WL9A 4WO4A 3BXNA 4X6CA 3LKSA 3MRNA 3PWLA 3CC5A 1S7XA 1EFXA 3BZFA 3TBYA 1A1NA 4WWKC 4N0FA 1A6ZA 5GSVA 3TF7A 1OGAA 5L2JA 3QULA 1IM3A 3VFTA 1ZVSA 4L9LC 2F54A 1ZSDA 5HHPA 3VFMA 5C9JA 3DBXA 3MROA 1T7XA 5C0DA 5IB4A 1OSZA 3PQYA 1FZKA 1QSFA 5C0FA 5C0AA 1NAMH 2GITA 1I4FA 5C0EA 4G8IA 3AU1A 3FTGA 3WS3A 4PRPA 3CZFA 3VFSA 1LEKA 3T1FA 1QR1A 4L3EA 4JRYA 3UTQA 2CIIA 3OX8A 3TA3A 4NQVA 2CIKA 3P9MA 4PJHA 3MV8A 3X11A 5H94A 5HGBA 3MREA 1B0GA 2X70A 4Y2DA 1TVHA 3MA7A 4IRSA 5IB1A 5DEGA 1YN6A 5HHQA 1I7UA 5C0JA 3MYJA 4HUXA 2HJLA 5IM7A 2ZSVA 4MS8A 4PRNA 4MNQA 3DX7A 3REWA 3I6GA 4N0CA 4JFDA 2HN7A 1JPFA 3TFKA 5D7LA 4QRQA 3O3AA 4O2FA 3VJ6A 1T22A 3S6CA 4L8SC 4U1LA 3D39A 3MGTA 4PJDA 3KWWA 4F7MA 5E6IC 4WU7A 3MRGA 2X4PA 3QUYA 3D3VA 1YDPA 5F7DA 3VRJA 2GJ6A 3KPPA 1G7QA 1ONQA 3ARBA 3E6FA 3HE6A 5INCA 5D9SA 2BNRA 3OV6A 4MJIA 3BW9A 2H6PA 4PJXA 3VFWA 3X12A 2CLVA 4NQCA 1Q94A 5C0CA 5B39A 3P4MA 4WW2C 4U1IA 1XH3A 1AGCA 1S7QA 3L3DA 1RJZA 1TMCA 3KYNA 5F1IA 1E28A 2AV1A 3SPVA 2CKBH 1WBXA 3VFVA 1A1OA 1LD9A 4HUUA 2FZ3A 5C09A 5DEFA 4PRHA 4PJ8A 1KJ3H 1LDPH 5J6HA 3O3BA 3VXNA 4F7EA 3VXUA 1MI5A 3TIEA 5MEQA 3BGMA 1JGDA 3QUZA 1HSAA 4PJFA 3TIDA 4ZUSA 2AKRA 3FT4A 4PGEA 3LKPA 1MHCA 2BVPA 4X6DA 3V5KA 3FONA 2V2WA 1AGFA 3RGVC 4PJCA 4U1MA 3AREA 4ZAKA 5FKPA 1T7VA 3V5DA 4HWZA 3RL1A 1YN7A 3WS6A 3GJFA 4MQ7A 4N0UA 1UXSA 4HX1A 3TJHA 1S9WA 3GSWA 4F7CA 1P7QA 1LK2A 4NO2A 1BD2A 3QI9A 4X6EA 3P4NA 4CVXA 2ZOLA 5FDWA 3GMMA 3GMOA 3VWJA 1KJVA 3MRCA 3O4LA 4HV8A 4NHUE 4U1NA 3VXOA 1GZPA 3MRLA 3BP4A 3RUGA 3VXPA 4CW1A 1FZJA 1T1YA 3IXAA 4WU5A 2WY3A 3C8KA 4PGCA 3RWFA 3GSOA 1W0WA 3MRIA 4GKNA 1LP9A 2BSRA 3SJVA 3KPQA 4UQ2A 4NNYA 4PRIA 1DE4A 1QQDA 3MRDA 1HHKA 1NEZA 3HAEA 3D18A 1FZMA 3H9HA 3QFDA 5E9DA 1DUZA 3P4OA 3RWJA 2UWEA 4XXCA 3BEVA 2FYYA 1SYSA 2BVOA 3FQUA 1S8DA 3QUKA 3X14A 2BCKA 4NO0A 1P1ZA 5F1NA 3LKQA 1JGEA 2VABA 1VACA 2GAZA 1I1AA 1UQSA 2Q7YA 5IROA 4PJ7A 2X4TA 4L8BA 4MXQA 3BHBA 3GSXA 4PG2A 3TVMA 2OL3H 3TBSA 3P9LA 1BIIA 2X4RA 3JVGA 2ZSWA 3UPRA 1XR9A 3GMQA 4JFQA 5SWZA 2P5WA 1S7TA 1T80A 2X4UA 3VXSA 1KJMA 2FIKA 3PWVA 2F53A 3H9SA 5FA3A 1I7RA 3OXRA 5E8OA 2VE6A 2V2XA 5IEKA 4APQA 2YPKA 1N3NA 1HYRC 4G8GA 1QRNA 4WUUA 3FT3A 1HHJA 1KPVA 1RK0A 3LKOA 3QEQA 4MX7A 2FWOA 2CLZA 2GTWA 3P77A 4I48A 3ROLA 3VCLA 3AM8A 3FT2A 4K71B 3MRRA 4O2EA 3TO2A 3GIVA 4PJGA 2RFXA 3D2UA 2AXGA 3D25A 3E3QA 3PWJA 4IRJA 3RWCA 1HSBA 3VXMA 3MRHA 5E00A 4PJAA 3CDGA 3O8XA 2DYPA 3MRJA 4FTVA 1T0MA 1S7VA 4QRPA 5EUOA 5HHMA 1MHEA 5J6GA 3KPLA 1UXWA 3LKNA 4V3DB 4ZUVA 3I6KA 3MRKA 1S9YA 2MHAA 4PG9A 5MENA 4LHUA 1VGKA 1P4LA 5BJTA 5EU3A 3MRQA 4ZFZA 3SDAA 4L4VA 4E0RA 5MEOA 1IM9A 4N5EA 3O3EA 1HHIA 3ES6A 2ZOKA 4JFEA 5EU4A 1I7TA 4L3CA 4NQEA 3RWIA 3SDDA 1XZ0A 1SYVA 3GMLA 4U1SA 5D7IA 3QDJA 3ECBA 3WUWA 1AGBA 4D0BA 3QFJA 4U1KA 4F7TA 1Z5LA 1T20A 4G43A 4HUVA 3LV3A 2X4QA 2XPGA 1T1ZA 3ERYA 5C07A 3DX8A 3FQXA 4JFPA 4PJ5A 3LKRA 5D5MA 3B3IA 4F7PA 4U6YA 3E2HA 2PO6A 5IEHA 3KPSA 1ZHLA 3FQNA 1OGTA 1CD1A 4IIQC 4QRUA 4PJBA 3L3KA 4PRAA 3GSUA 5INDA 3E6HA 1FFNA 4GKSA 3ARFA 3MR9A 1ED3A 3MRFA 4K7FA 5ACZA 1U58A 2HJKA 1KBGH 4U6XA 4NQXA 1DDHA 3MRBA 4X6FA 2FO4A 3GSVA 4G59A 4FFEX 1I1YA 3L3IA 3MV9A 5MEPA 3KYOA 1PQZA 3HE7A 2A83A
chains in the Genus database with same CATH superfamily
5D2LA 1ZT4A 4O2CA 4NT6A 4WJ5A 1A9BA 4PJEA 3GSRA 4PGDA 3RTQA 2H26A 2E7LE 3VWKA 3JTTA 3KPMA 4HKJA 4ZUWA 1N2RA 1AO7A 2P5EA 2NW3A 3CCHA 3PWUA 3BEWA 2BSSA 1K8DA 1W72A 2D31A 1C16A 1KTLA 3QUXA 1FFOA 1INQA 3ILPA 3X13A 4PJIA 4LNRA 4NQDA 2C7UA 3PABA 5C08A 4Z77A 5C0BA 5EU5A 5HGAA 4ZUTA 4Y4FA 4Y16A 1RK1A 4S0UC 2YPLA 5C0IA 3HUJA 5BXFA 3QZWA 4L29A 4QRTA 2X4OA 1G6RH 1T0NA 4UQ3A 3V5HA 4JRXA 3O9WA 1R3HA 1OF2A 1ZHNA 5AD0A 3L9RA 3FOLA 5HGHA 1T7WA 3QDGA 3PWNA 3TBVA 4JQVA 3T8XA 3C9NA 4L4TA 1DUYA 3TBTA 4PRBA 5EO1A 5F9JA 1JPGA 3GSQA 4MVBA 1EXUA 3KLAA 3BH8A 1FFPA 3TZVC 3RWGA 2NX5A 2VLKA 1I1FA 3GMRA 1ZT7A 3GMNA 2VAAA 4Y4KA 5HGDA 3HPJA 4PJ9A 2ESVA 3ROOA 5HHOA 3FQWA 4LCCC 3UTTA 4HS3A 1LEGA 2BVQA 2CLRA 3BP7A 3BVNA 2BSTA 4D0CA 1S7SA 1KCGC 1S7UA 1JF1A 3KPNA 1JE6A 3HLAA 3W39A 4ELMA 1LQVA 3TN0A 4G42A 1WBZA 3DMMA 2VLRA 5FA4A 3FRUA 1B3JA 1T7ZA 3DXAA 4E5XA 3I6LD 4NO5A 4QOKA 3QQ4A 3RZCA 2GT9A 2VLJA 1AGEA 3U0PA 5D2NA 1WBYA 4NSKA 1CE6A 3FQRA 5E8NA 2GTZA 4CVZA 4EUPA 4QRSA 1EEYA 4LCWA 4G9FA 3HG1A 4WDIA 3MGOA 2AXFA 2HLAA 3BO8A 3VRIA 5JHDA 3VXRA 4G9DA 4PR5A 5EO0A 5IB5A 3M17A 5HHNA 4JFFA 1G7PA 4D0DA 3M1BA 1AKJA 3ILQC 1KJ2H 3VFOA 3BH9A 4LCYA 4ZUUA 3VFUA 3LN4A 4U1JA 5ENWA 3VH8A 3VFRA 5HYJA 1QSEA 1ZT1A 1T1XA 3HCVA 5IB2A 5B38A 3DX6A 1A1MA 3ARGA 5EFIA 5DDHA 4PRDA 3TO4A 3RL2A 3VFPA 4NNXA 1M05A 5SWQA 1ZHBA 4IHOA 3MV7A 1BQHA 1ZAGA 1QLFA 1QVOA 2AK4A 2JCCA 1XR8A 3MRMA 3G08A 1L8JA 5BRZA 3SDCA 4NO3A 5IB3A 3VFNA 1AGDA 5D7JC 1EEZA 3CPLA 1N5AA 1TVBA 4L8DA 1ZS8A 2GUOA 1FG2A 2XFXA 4EI5A 3BZEA 5C0GA 2X4SA 3CVHA 2F74A 2YEZA 2X4NA 4JO8A 1HOCA 1B0RA 1JUFA 3TPUE 4QRRA 2VLLA 3SKOA 1JHTA 5L2KA 1K5NA 4MNGA 3SDXA 2OI9A 1T21A 3FFCA 4PV9A 1E27A 2BNQA 1MWAH 4ONOA 1GZQA 1T1WA 5SWSA 1BZ9A 1VADA 4GUPA 1HHGA 4EN3C 2PYEA 3ARDA 3BWAA 1X7QA 4Z76A 1QO3A 3O3DA 3FQTA 3BUYA 1NANH 1KPRA 1RJYA 1S7WA 3NFNA 4HUWA 1T7YA 4I4WA 5E8PA 1N59A 3UBXA 5MERA 3L3JA 3SCMA 4N8VA 3UTSA 4L8CA 3RWDA 4PP8C 3H7BA 1ZHKA 5EOTA 4U1HA 1FO0H 5IVXA 3TBWA 5BS0A 2AV7A 1W0VA 5ISZA 4PREA 1HHHA 4JQXA 2J8UA 3QQ3A 3CH1A 4MJ6A 3SKMA 5EU6A 3OXSA 3RWHA 3KPRA 1FZOA 3IT8D 4Y4HA 3LN5A 3L3HA 3FOMA 1KPUA 1S7RA 3B6SA 1S9XA 3DTXA 4PV8A 3RWEA 3WLBA 3L3GA 3KXFA 1QEWA 4JFOA 5J1AA 4Z78A 1M6OA 3MRPA 4PDCE 3KPOA 1CG9A 3W0WA 3GSNH 1JFMA 3QDMA 3GMPA 3JTCA 3JTSA 3P73A 4PGBA 3PWPA 4MJ5A 1A9EA 4V3EB 1YPZA 5GSRA 3WL9A 4WO4A 3BXNA 4X6CA 3LKSA 3MRNA 3PWLA 3CC5A 1S7XA 1EFXA 3BZFA 3TBYA 1A1NA 4WWKC 4N0FA 1A6ZA 5GSVA 3TF7A 1OGAA 5L2JA 3QULA 1IM3A 3VFTA 1ZVSA 4L9LC 2F54A 1ZSDA 5HHPA 3VFMA 5C9JA 3DBXA 3MROA 1T7XA 2O5NA 5C0DA 5IB4A 1OSZA 3PQYA 1FZKA 1QSFA 5C0FA 5C0AA 1NAMH 2GITA 1I4FA 5C0EA 4G8IA 3AU1A 3FTGA 3WS3A 4PRPA 3CZFA 3VFSA 1LEKA 3T1FA 1QR1A 4L3EA 4JRYA 3UTQA 2CIIA 3OX8A 3TA3A 4NQVA 2CIKA 3P9MA 4PJHA 3MV8A 3X11A 5H94A 5HGBA 3MREA 1B0GA 2X70A 4Y2DA 1TVHA 3MA7A 4IRSA 5IB1A 5DEGA 1YN6A 5HHQA 1I7UA 5C0JA 3MYJA 4HUXA 2HJLA 5IM7A 2ZSVA 4MS8A 4PRNA 4MNQA 3DX7A 3REWA 3I6GA 4N0CA 4JFDA 2HN7A 1JPFA 3TFKA 5D7LA 4QRQA 3O3AA 4O2FA 3VJ6A 1T22A 3S6CA 4L8SC 4U1LA 3D39A 3MGTA 4PJDA 3KWWA 4F7MA 5E6IC 4WU7A 3MRGA 2X4PA 3QUYA 3D3VA 1YDPA 5F7DA 3VRJA 2GJ6A 3KPPA 1G7QA 1ONQA 3ARBA 3E6FA 3HE6A 5INCA 5D9SA 2BNRA 3OV6A 4MJIA 3BW9A 2H6PA 4PJXA 3VFWA 3X12A 2CLVA 4NQCA 1Q94A 5C0CA 5B39A 3P4MA 4WW2C 4U1IA 1XH3A 2IA1A 1AGCA 1S7QA 3L3DA 1RJZA 1TMCA 3KYNA 5F1IA 1E28A 2AV1A 3SPVA 2CKBH 1WBXA 3VFVA 1A1OA 1LD9A 4HUUA 2FZ3A 5C09A 5DEFA 4PRHA 4PJ8A 1KJ3H 1LDPH 5J6HA 3O3BA 3VXNA 4F7EA 3VXUA 1MI5A 3TIEA 5MEQA 3BGMA 1JGDA 3QUZA 1HSAA 4PJFA 3TIDA 4ZUSA 2AKRA 3FT4A 4PGEA 3LKPA 1MHCA 2BVPA 4X6DA 3V5KA 3FONA 2V2WA 1AGFA 3RGVC 4PJCA 4U1MA 3AREA 4ZAKA 5FKPA 1T7VA 3V5DA 4HWZA 3RL1A 1YN7A 3WS6A 3GJFA 4MQ7A 4N0UA 1UXSA 4HX1A 3TJHA 1S9WA 3GSWA 4F7CA 1P7QA 1LK2A 4NO2A 1BD2A 3QI9A 4X6EA 3P4NA 4CVXA 2ZOLA 5FDWA 3GMMA 3GMOA 3VWJA 1KJVA 3MRCA 3O4LA 4HV8A 4NHUE 4U1NA 3VXOA 1GZPA 3MRLA 3BP4A 3RUGA 3VXPA 4CW1A 1FZJA 1T1YA 3IXAA 4WU5A 2WY3A 3C8KA 4PGCA 3RWFA 3GSOA 1W0WA 3MRIA 4GKNA 1LP9A 2BSRA 3SJVA 3KPQA 4UQ2A 4NNYA 4PRIA 1DE4A 1QQDA 3MRDA 1HHKA 1NEZA 3HAEA 3D18A 1FZMA 3H9HA 3QFDA 5E9DA 1DUZA 3P4OA 3RWJA 2UWEA 4XXCA 3BEVA 2FYYA 1SYSA 2BVOA 3FQUA 1S8DA 3QUKA 3X14A 2BCKA 4NO0A 1P1ZA 5F1NA 3LKQA 1JGEA 2VABA 1VACA 2GAZA 1I1AA 1UQSA 3I0TA 2Q7YA 5IROA 4PJ7A 2X4TA 4L8BA 4MXQA 3BHBA 3GSXA 4PG2A 3TVMA 2OL3H 3TBSA 3P9LA 1BIIA 2X4RA 3JVGA 2ZSWA 3UPRA 1XR9A 3GMQA 4JFQA 5SWZA 2P5WA 1S7TA 1T80A 2X4UA 3VXSA 1KJMA 2FIKA 3PWVA 2F53A 3H9SA 5FA3A 1I7RA 3OXRA 5E8OA 2VE6A 2V2XA 5IEKA 4APQA 2YPKA 1N3NA 1HYRC 4G8GA 1QRNA 4WUUA 3FT3A 1HHJA 1KPVA 1RK0A 3LKOA 3QEQA 4MX7A 2FWOA 2CLZA 2GTWA 3P77A 4I48A 3ROLA 3VCLA 3AM8A 3FT2A 4K71B 3MRRA 4O2EA 3TO2A 3GIVA 4PJGA 2RFXA 3D2UA 2AXGA 3D25A 3E3QA 3PWJA 4IRJA 3RWCA 1HSBA 3VXMA 3MRHA 5E00A 4PJAA 3CDGA 3O8XA 2DYPA 3MRJA 4FTVA 1T0MA 1S7VA 4QRPA 5EUOA 5HHMA 1MHEA 5J6GA 3KPLA 1UXWA 3LKNA 4V3DB 4ZUVA 3I6KA 3MRKA 1S9YA 2MHAA 4PG9A 5MENA 4LHUA 1VGKA 1P4LA 5BJTA 5EU3A 3MRQA 4ZFZA 3SDAA 4L4VA 4E0RA 5MEOA 1IM9A 4N5EA 3O3EA 1HHIA 3ES6A 2ZOKA 4JFEA 5EU4A 1I7TA 4L3CA 4NQEA 3RWIA 3SDDA 1XZ0A 1SYVA 3GMLA 4U1SA 5D7IA 3QDJA 3ECBA 3WUWA 1AGBA 4D0BA 3QFJA 4U1KA 4F7TA 1Z5LA 1T20A 4G43A 4HUVA 3LV3A 2X4QA 2XPGA 1T1ZA 3ERYA 5C07A 3DX8A 3FQXA 4JFPA 4PJ5A 3LKRA 4BKWA 4G59C 5D5MA 3B3IA 4F7PA 4U6YA 3E2HA 2PO6A 5IEHA 3KPSA 1ZHLA 3FQNA 1OGTA 1CD1A 4IIQC 4QRUA 4PJBA 3L3KA 4PRAA 3GSUA 5INDA 3E6HA 1FFNA 4GKSA 3ARFA 3MR9A 1ED3A 3MRFA 4K7FA 5ACZA 1U58A 2HJKA 1KBGH 4U6XA 4NQXA 1DDHA 3MRBA 4X6FA 2FO4A 3GSVA 4G59A 4FFEX 1I1YA 3L3IA 3MV9A 5MEPA 3KYOA 1PQZA 3HE7A 2A83A 2NYKA
chains in the Genus database with same CATH topology
5D2LA 1ZT4A 4O2CA 4NT6A 4WJ5A 1A9BA 4PJEA 3GSRA 4PGDA 3RTQA 2H26A 2E7LE 3VWKA 3JTTA 3KPMA 4HKJA 4ZUWA 1N2RA 1AO7A 2P5EA 2NW3A 3CCHA 3PWUA 3BEWA 2BSSA 1K8DA 1W72A 2D31A 1C16A 1KTLA 3QUXA 1FFOA 1INQA 3ILPA 3X13A 4PJIA 4LNRA 4NQDA 2C7UA 3PABA 5C08A 4Z77A 5C0BA 5EU5A 5HGAA 4ZUTA 4Y4FA 4Y16A 1RK1A 4S0UC 2YPLA 5C0IA 3HUJA 5BXFA 3QZWA 4L29A 4QRTA 2X4OA 1G6RH 1T0NA 4UQ3A 3V5HA 4JRXA 3O9WA 1R3HA 1OF2A 1ZHNA 5AD0A 3L9RA 3FOLA 5HGHA 1T7WA 3QDGA 3PWNA 3TBVA 4JQVA 3T8XA 3C9NA 4L4TA 1DUYA 3TBTA 4PRBA 5EO1A 5F9JA 1JPGA 3GSQA 4MVBA 1EXUA 3KLAA 3BH8A 1FFPA 3TZVC 3RWGA 2NX5A 2VLKA 1I1FA 3GMRA 1ZT7A 3GMNA 2VAAA 4Y4KA 5HGDA 3HPJA 4PJ9A 2ESVA 3ROOA 5HHOA 3FQWA 4LCCC 3UTTA 4HS3A 1LEGA 2BVQA 2CLRA 3BP7A 3BVNA 2BSTA 4D0CA 1S7SA 1KCGC 1S7UA 1JF1A 3KPNA 1JE6A 3HLAA 3W39A 4ELMA 1LQVA 3TN0A 4G42A 1WBZA 3DMMA 2VLRA 5FA4A 3FRUA 1B3JA 1T7ZA 3DXAA 4E5XA 3I6LD 4NO5A 4QOKA 3QQ4A 3RZCA 2GT9A 2VLJA 1AGEA 3U0PA 5D2NA 1WBYA 4NSKA 1CE6A 3FQRA 5E8NA 2GTZA 4CVZA 4EUPA 4QRSA 1EEYA 4LCWA 4G9FA 3HG1A 4WDIA 3MGOA 2AXFA 2HLAA 3BO8A 3VRIA 5JHDA 3VXRA 4G9DA 4PR5A 5EO0A 5IB5A 3M17A 5HHNA 4JFFA 1G7PA 4D0DA 3M1BA 1AKJA 3ILQC 1KJ2H 3VFOA 3BH9A 4LCYA 4ZUUA 3VFUA 3LN4A 4U1JA 5ENWA 3VH8A 3VFRA 5HYJA 1QSEA 1ZT1A 1T1XA 3HCVA 5IB2A 5B38A 3DX6A 1A1MA 3ARGA 5EFIA 5DDHA 4PRDA 3TO4A 3RL2A 3VFPA 4NNXA 1M05A 5SWQA 1ZHBA 4IHOA 3MV7A 1BQHA 1ZAGA 1QLFA 1QVOA 2AK4A 2JCCA 1XR8A 3MRMA 3G08A 1L8JA 5BRZA 3SDCA 4NO3A 5IB3A 3VFNA 1AGDA 5D7JC 1EEZA 3CPLA 1N5AA 1TVBA 4L8DA 1ZS8A 2GUOA 1FG2A 2XFXA 4EI5A 3BZEA 5C0GA 2X4SA 3CVHA 2F74A 2YEZA 2X4NA 4QRRA 1HOCA 1B0RA 1JUFA 3TPUE 2VLLA 3SKOA 1JHTA 5L2KA 1K5NA 4MNGA 3SDXA 2OI9A 1T21A 3FFCA 4PV9A 1E27A 2BNQA 1MWAH 4ONOA 1GZQA 1T1WA 5SWSA 1BZ9A 1VADA 4GUPA 1HHGA 4EN3C 2PYEA 3ARDA 3BWAA 1X7QA 4Z76A 1QO3A 3O3DA 3FQTA 3BUYA 1NANH 1KPRA 1RJYA 1S7WA 3NFNA 4HUWA 1T7YA 4I4WA 5E8PA 1N59A 3UBXA 5MERA 3L3JA 3SCMA 4N8VA 3UTSA 4L8CA 3RWDA 4PP8C 3H7BA 1ZHKA 5EOTA 4U1HA 1FO0H 5IVXA 3TBWA 5BS0A 2AV7A 1W0VA 5ISZA 4PREA 1HHHA 4JQXA 2J8UA 3QQ3A 3CH1A 4MJ6A 3SKMA 5EU6A 3OXSA 3RWHA 3KPRA 1FZOA 3IT8D 4Y4HA 3LN5A 3L3HA 3FOMA 1KPUA 1S7RA 3B6SA 1S9XA 3DTXA 4PV8A 3RWEA 3WLBA 3L3GA 3KXFA 1QEWA 4JFOA 5J1AA 4Z78A 1M6OA 3MRPA 4PDCE 3KPOA 1CG9A 3W0WA 3GSNH 1JFMA 3QDMA 3GMPA 3JTCA 3JTSA 3P73A 4PGBA 3PWPA 4MJ5A 1A9EA 4V3EB 1YPZA 5GSRA 3WL9A 4WO4A 3BXNA 4X6CA 3LKSA 3MRNA 3PWLA 3CC5A 1S7XA 1EFXA 3BZFA 3TBYA 1A1NA 4WWKC 4N0FA 1A6ZA 5GSVA 3TF7A 1OGAA 5L2JA 3QULA 1IM3A 3VFTA 1ZVSA 4L9LC 2F54A 1ZSDA 5HHPA 3VFMA 5C9JA 3DBXA 3MROA 1T7XA 5C0DA 5IB4A 1OSZA 3PQYA 1FZKA 1QSFA 5C0FA 5C0AA 1NAMH 2GITA 1I4FA 5C0EA 4G8IA 3AU1A 3FTGA 3WS3A 4PRPA 3CZFA 3VFSA 1LEKA 3T1FA 1QR1A 4L3EA 4JRYA 3UTQA 2CIIA 3OX8A 3TA3A 4NQVA 2CIKA 3P9MA 4PJHA 3MV8A 3X11A 5H94A 5HGBA 3MREA 1B0GA 2X70A 4Y2DA 1TVHA 3MA7A 4IRSA 5IB1A 5DEGA 1YN6A 5HHQA 1I7UA 5C0JA 3MYJA 4HUXA 2HJLA 5IM7A 2ZSVA 4MS8A 4PRNA 4MNQA 3DX7A 3REWA 3I6GA 4N0CA 4JFDA 2HN7A 1JPFA 3TFKA 5D7LA 4QRQA 3O3AA 4O2FA 3VJ6A 1T22A 3S6CA 4L8SC 4U1LA 3D39A 3MGTA 4PJDA 3KWWA 4F7MA 5E6IC 4WU7A 3MRGA 2X4PA 3QUYA 3D3VA 1YDPA 5F7DA 3VRJA 2GJ6A 3KPPA 1G7QA 1ONQA 3ARBA 3E6FA 3HE6A 5INCA 5D9SA 2BNRA 3OV6A 4MJIA 3BW9A 2H6PA 4PJXA 3VFWA 3X12A 2CLVA 4NQCA 1Q94A 5C0CA 5B39A 3P4MA 4WW2C 4U1IA 1XH3A 1AGCA 1S7QA 3L3DA 1RJZA 1TMCA 3KYNA 5F1IA 1E28A 2AV1A 3SPVA 2CKBH 1WBXA 3VFVA 1A1OA 1LD9A 4HUUA 2FZ3A 5C09A 5DEFA 4PRHA 4PJ8A 1KJ3H 1LDPH 5J6HA 3O3BA 3VXNA 4F7EA 3VXUA 1MI5A 3TIEA 5MEQA 3BGMA 1JGDA 3QUZA 1HSAA 4PJFA 3TIDA 4ZUSA 2AKRA 3FT4A 4PGEA 3LKPA 1MHCA 2BVPA 4X6DA 3V5KA 3FONA 2V2WA 1AGFA 3RGVC 4PJCA 4U1MA 3AREA 4ZAKA 5FKPA 1T7VA 3V5DA 4HWZA 3RL1A 1YN7A 3WS6A 3GJFA 4MQ7A 4N0UA 1UXSA 4HX1A 3TJHA 1S9WA 3GSWA 4F7CA 1P7QA 1LK2A 4NO2A 1BD2A 3QI9A 4X6EA 3P4NA 4CVXA 2ZOLA 5FDWA 3GMMA 3GMOA 3VWJA 1KJVA 3MRCA 3O4LA 4HV8A 4NHUE 4U1NA 3VXOA 1GZPA 3MRLA 3BP4A 3RUGA 3VXPA 4CW1A 1FZJA 1T1YA 3IXAA 4WU5A 2WY3A 3C8KA 4PGCA 3RWFA 3GSOA 1W0WA 3MRIA 4GKNA 1LP9A 2BSRA 3SJVA 3KPQA 4UQ2A 4NNYA 4PRIA 1DE4A 1QQDA 3MRDA 1HHKA 1NEZA 3HAEA 3D18A 1FZMA 3H9HA 3QFDA 5E9DA 1DUZA 3P4OA 3RWJA 2UWEA 4XXCA 3BEVA 2FYYA 1SYSA 2BVOA 3FQUA 1S8DA 3QUKA 3X14A 2BCKA 4NO0A 1P1ZA 5F1NA 3LKQA 1JGEA 2VABA 1VACA 2GAZA 1I1AA 1UQSA 2Q7YA 5IROA 4PJ7A 2X4TA 4L8BA 4MXQA 3BHBA 3GSXA 4PG2A 3TVMA 2OL3H 3TBSA 3P9LA 1BIIA 2X4RA 3JVGA 2ZSWA 3UPRA 1XR9A 3GMQA 4JFQA 5SWZA 2P5WA 1S7TA 1T80A 2X4UA 3VXSA 1KJMA 2FIKA 3PWVA 2F53A 3H9SA 5FA3A 1I7RA 3OXRA 5E8OA 2VE6A 2V2XA 5IEKA 4APQA 2YPKA 1N3NA 1HYRC 4G8GA 1QRNA 4WUUA 3FT3A 1HHJA 1KPVA 1RK0A 3LKOA 3QEQA 4MX7A 2FWOA 2CLZA 2GTWA 3P77A 4I48A 3ROLA 3VCLA 3AM8A 3FT2A 4K71B 3MRRA 4O2EA 3TO2A 3GIVA 4PJGA 2RFXA 3D2UA 2AXGA 3D25A 3E3QA 3PWJA 4IRJA 3RWCA 1HSBA 3VXMA 3MRHA 5E00A 4PJAA 3CDGA 3O8XA 2DYPA 3MRJA 4FTVA 1T0MA 1S7VA 4QRPA 5EUOA 5HHMA 1MHEA 5J6GA 3KPLA 1UXWA 3LKNA 4V3DB 4ZUVA 3I6KA 3MRKA 1S9YA 2MHAA 4PG9A 5MENA 4LHUA 1VGKA 1P4LA 5BJTA 5EU3A 3MRQA 4ZFZA 3SDAA 4L4VA 4E0RA 5MEOA 1IM9A 4N5EA 3O3EA 1HHIA 3ES6A 2ZOKA 4JFEA 5EU4A 1I7TA 4L3CA 4NQEA 3RWIA 3SDDA 1XZ0A 1SYVA 3GMLA 4U1SA 5D7IA 3QDJA 3ECBA 3WUWA 1AGBA 4D0BA 3QFJA 4U1KA 4F7TA 1Z5LA 1T20A 4G43A 4HUVA 3LV3A 2X4QA 2XPGA 1T1ZA 3ERYA 5C07A 3DX8A 3FQXA 4JFPA 4PJ5A 3LKRA 5D5MA 3B3IA 4F7PA 4U6YA 3E2HA 2PO6A 5IEHA 3KPSA 1ZHLA 3FQNA 1OGTA 1CD1A 4IIQC 4QRUA 4PJBA 3L3KA 4PRAA 3GSUA 5INDA 3E6HA 1FFNA 4GKSA 3ARFA 3MR9A 1ED3A 3MRFA 4K7FA 5ACZA 1U58A 2HJKA 1KBGH 4U6XA 4NQXA 1DDHA 3MRBA 4X6FA 2FO4A 3GSVA 4G59A 4FFEX 1I1YA 3L3IA 3MV9A 5MEPA 3KYOA 1PQZA 3HE7A 2A83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2L A;  1ZT4 A;  4O2C A;  4NT6 A;  4WJ5 A;  1A9B A;  4PJE A;  3GSR A;  4PGD A;  3RTQ A;  2H26 A;  2E7L E;  3VWK A;  3JTT A;  3KPM A;  4HKJ A;  4ZUW A;  1N2R A;  1AO7 A;  2P5E A;  2NW3 A;  3CCH A;  3PWU A;  3BEW A;  2BSS A;  1K8D A;  1W72 A;  2D31 A;  1C16 A;  1KTL A;  3QUX A;  1FFO A;  1INQ A;  3ILP A;  3X13 A;  4PJI A;  4LNR A;  4NQD A;  2C7U A;  3PAB A;  5C08 A;  4Z77 A;  5C0B A;  5EU5 A;  5HGA A;  4ZUT A;  4Y4F A;  4Y16 A;  1RK1 A;  4S0U C;  2YPL A;  5C0I A;  3HUJ A;  5BXF A;  3QZW A;  4L29 A;  4QRT A;  2X4O A;  1G6R H;  1T0N A;  4UQ3 A;  3V5H A;  4JRX A;  3O9W A;  1R3H A;  1OF2 A;  1ZHN A;  5AD0 A;  3L9R A;  3FOL A;  5HGH A;  1T7W A;  3QDG A;  3PWN A;  3TBV A;  4JQV A;  3T8X A;  3C9N A;  4L4T A;  1DUY A;  3TBT A;  4PRB A;  5EO1 A;  5F9J A;  1JPG A;  3GSQ A;  4MVB A;  1EXU A;  3KLA A;  3BH8 A;  1FFP A;  3TZV C;  3RWG A;  2NX5 A;  2VLK A;  1I1F A;  3GMR A;  1ZT7 A;  3GMN A;  2VAA A;  4Y4K A;  5HGD A;  3HPJ A;  4PJ9 A;  2ESV A;  3ROO A;  5HHO A;  3FQW A;  4LCC C;  3UTT A;  4HS3 A;  1LEG A;  2BVQ A;  2CLR A;  3BP7 A;  3BVN A;  2BST A;  4D0C A;  1S7S A;  1KCG C;  1S7U A;  1JF1 A;  3KPN A;  1JE6 A;  3HLA A;  3W39 A;  4ELM A;  1LQV A;  3TN0 A;  4G42 A;  1WBZ A;  3DMM A;  2VLR A;  5FA4 A;  3FRU A;  1B3J A;  1T7Z A;  3DXA A;  4E5X A;  3I6L D;  4NO5 A;  4QOK A;  3QQ4 A;  3RZC A;  2GT9 A;  2VLJ A;  1AGE A;  3U0P A;  5D2N A;  1WBY A;  4NSK A;  1CE6 A;  3FQR A;  5E8N A;  2GTZ A;  4CVZ A;  4EUP A;  4QRS A;  1EEY A;  4LCW A;  4G9F A;  3HG1 A;  4WDI A;  3MGO A;  2AXF A;  2HLA A;  3BO8 A;  3VRI A;  5JHD A;  3VXR A;  4G9D A;  4PR5 A;  5EO0 A;  5IB5 A;  3M17 A;  5HHN A;  4JFF A;  1G7P A;  4D0D A;  3M1B A;  1AKJ A;  3ILQ C;  1KJ2 H;  3VFO A;  3BH9 A;  4LCY A;  4ZUU A;  3VFU A;  3LN4 A;  4U1J A;  5ENW A;  3VH8 A;  3VFR A;  5HYJ A;  1QSE A;  1ZT1 A;  1T1X A;  3HCV A;  5IB2 A;  5B38 A;  3DX6 A;  1A1M A;  3ARG A;  5EFI A;  5DDH A;  4PRD A;  3TO4 A;  3RL2 A;  3VFP A;  4NNX A;  1M05 A;  5SWQ A;  1ZHB A;  4IHO A;  3MV7 A;  1BQH A;  1ZAG A;  1QLF A;  1QVO A;  2AK4 A;  2JCC A;  1XR8 A;  3MRM A;  3G08 A;  1L8J A;  5BRZ A;  3SDC A;  4NO3 A;  5IB3 A;  3VFN A;  1AGD A;  5D7J C;  1EEZ A;  3CPL A;  1N5A A;  1TVB A;  4L8D A;  1ZS8 A;  2GUO A;  1FG2 A;  2XFX A;  4EI5 A;  3BZE A;  5C0G A;  2X4S A;  3CVH A;  2F74 A;  2YEZ A;  2X4N A;  4QRR A;  1HOC A;  1B0R A;  1JUF A;  3TPU E;  2VLL A;  3SKO A;  1JHT A;  5L2K A;  1K5N A;  4MNG A;  3SDX A;  2OI9 A;  1T21 A;  3FFC A;  4PV9 A;  1E27 A;  2BNQ A;  1MWA H;  4ONO A;  1GZQ A;  1T1W A;  5SWS A;  1BZ9 A;  1VAD A;  4GUP A;  1HHG A;  4EN3 C;  2PYE A;  3ARD A;  3BWA A;  1X7Q A;  4Z76 A;  1QO3 A;  3O3D A;  3FQT A;  3BUY A;  1NAN H;  1KPR A;  1RJY A;  1S7W A;  3NFN A;  4HUW A;  1T7Y A;  4I4W A;  5E8P A;  1N59 A;  3UBX A;  5MER A;  3L3J A;  3SCM A;  4N8V A;  3UTS A;  4L8C A;  3RWD A;  4PP8 C;  3H7B A;  1ZHK A;  5EOT A;  4U1H A;  1FO0 H;  5IVX A;  3TBW A;  5BS0 A;  2AV7 A;  1W0V A;  5ISZ A;  4PRE A;  1HHH A;  4JQX A;  2J8U A;  3QQ3 A;  3CH1 A;  4MJ6 A;  3SKM A;  5EU6 A;  3OXS A;  3RWH A;  3KPR A;  1FZO A;  3IT8 D;  4Y4H A;  3LN5 A;  3L3H A;  3FOM A;  1KPU A;  1S7R A;  3B6S A;  1S9X A;  3DTX A;  4PV8 A;  3RWE A;  3WLB A;  3L3G A;  3KXF A;  1QEW A;  4JFO A;  5J1A A;  4Z78 A;  1M6O A;  3MRP A;  4PDC E;  3KPO A;  1CG9 A;  3W0W A;  3GSN H;  1JFM A;  3QDM A;  3GMP A;  3JTC A;  3JTS A;  3P73 A;  4PGB A;  3PWP A;  4MJ5 A;  1A9E A;  4V3E B;  1YPZ A;  5GSR A;  3WL9 A;  4WO4 A;  3BXN A;  4X6C A;  3LKS A;  3MRN A;  3PWL A;  3CC5 A;  1S7X A;  1EFX A;  3BZF A;  3TBY A;  1A1N A;  4WWK C;  4N0F A;  1A6Z A;  5GSV A;  3TF7 A;  1OGA A;  5L2J A;  3QUL A;  1IM3 A;  3VFT A;  1ZVS A;  4L9L C;  2F54 A;  1ZSD A;  5HHP A;  3VFM A;  5C9J A;  3DBX A;  3MRO A;  1T7X A;  5C0D A;  5IB4 A;  1OSZ A;  3PQY A;  1FZK A;  1QSF A;  5C0F A;  5C0A A;  1NAM H;  2GIT A;  1I4F A;  5C0E A;  4G8I A;  3AU1 A;  3FTG A;  3WS3 A;  4PRP A;  3CZF A;  3VFS A;  1LEK A;  3T1F A;  1QR1 A;  4L3E A;  4JRY A;  3UTQ A;  2CII A;  3OX8 A;  3TA3 A;  4NQV A;  2CIK A;  3P9M A;  4PJH A;  3MV8 A;  3X11 A;  5H94 A;  5HGB A;  3MRE A;  1B0G A;  2X70 A;  4Y2D A;  1TVH A;  3MA7 A;  4IRS A;  5IB1 A;  5DEG A;  1YN6 A;  5HHQ A;  1I7U A;  5C0J A;  3MYJ A;  4HUX A;  2HJL A;  5IM7 A;  2ZSV A;  4MS8 A;  4PRN A;  4MNQ A;  3DX7 A;  3REW A;  3I6G A;  4N0C A;  4JFD A;  2HN7 A;  1JPF A;  3TFK A;  5D7L A;  4QRQ A;  3O3A A;  4O2F A;  3VJ6 A;  1T22 A;  3S6C A;  4L8S C;  4U1L A;  3D39 A;  3MGT A;  4PJD A;  3KWW A;  4F7M A;  5E6I C;  4WU7 A;  3MRG A;  2X4P A;  3QUY A;  3D3V A;  1YDP A;  5F7D A;  3VRJ A;  2GJ6 A;  3KPP A;  1G7Q A;  1ONQ A;  3ARB A;  3E6F A;  3HE6 A;  5INC A;  5D9S A;  2BNR A;  3OV6 A;  4MJI A;  3BW9 A;  2H6P A;  4PJX A;  3VFW A;  3X12 A;  2CLV A;  4NQC A;  1Q94 A;  5C0C A;  5B39 A;  3P4M A;  4WW2 C;  4U1I A;  1XH3 A;  1AGC A;  1S7Q A;  3L3D A;  1RJZ A;  1TMC A;  3KYN A;  5F1I A;  1E28 A;  2AV1 A;  3SPV A;  2CKB H;  1WBX A;  3VFV A;  1A1O A;  1LD9 A;  4HUU A;  2FZ3 A;  5C09 A;  5DEF A;  4PRH A;  4PJ8 A;  1KJ3 H;  1LDP H;  5J6H A;  3O3B A;  3VXN A;  4F7E A;  3VXU A;  1MI5 A;  3TIE A;  5MEQ A;  3BGM A;  1JGD A;  3QUZ A;  1HSA A;  4PJF A;  3TID A;  4ZUS A;  2AKR A;  3FT4 A;  4PGE A;  3LKP A;  1MHC A;  2BVP A;  4X6D A;  3V5K A;  3FON A;  2V2W A;  1AGF A;  3RGV C;  4PJC A;  4U1M A;  3ARE A;  4ZAK A;  5FKP A;  1T7V A;  3V5D A;  4HWZ A;  3RL1 A;  1YN7 A;  3WS6 A;  3GJF A;  4MQ7 A;  4N0U A;  1UXS A;  4HX1 A;  3TJH A;  1S9W A;  3GSW A;  4F7C A;  1P7Q A;  1LK2 A;  4NO2 A;  1BD2 A;  3QI9 A;  4X6E A;  3P4N A;  4CVX A;  2ZOL A;  5FDW A;  3GMM A;  3GMO A;  3VWJ A;  1KJV A;  3MRC A;  3O4L A;  4HV8 A;  4NHU E;  4U1N A;  3VXO A;  1GZP A;  3MRL A;  3BP4 A;  3RUG A;  3VXP A;  4CW1 A;  1FZJ A;  1T1Y A;  3IXA A;  4WU5 A;  2WY3 A;  3C8K A;  4PGC A;  3RWF A;  3GSO A;  1W0W A;  3MRI A;  4GKN A;  1LP9 A;  2BSR A;  3SJV A;  3KPQ A;  4UQ2 A;  4NNY A;  4PRI A;  1DE4 A;  1QQD A;  3MRD A;  1HHK A;  1NEZ A;  3HAE A;  3D18 A;  1FZM A;  3H9H A;  3QFD A;  5E9D A;  1DUZ A;  3P4O A;  3RWJ A;  2UWE A;  4XXC A;  3BEV A;  2FYY A;  1SYS A;  2BVO A;  3FQU A;  1S8D A;  3QUK A;  3X14 A;  2BCK A;  4NO0 A;  1P1Z A;  5F1N A;  3LKQ A;  1JGE A;  2VAB A;  1VAC A;  2GAZ A;  1I1A A;  1UQS A;  2Q7Y A;  5IRO A;  4PJ7 A;  2X4T A;  4L8B A;  4MXQ A;  3BHB A;  3GSX A;  4PG2 A;  3TVM A;  2OL3 H;  3TBS A;  3P9L A;  1BII A;  2X4R A;  3JVG A;  2ZSW A;  3UPR A;  1XR9 A;  3GMQ A;  4JFQ A;  5SWZ A;  2P5W A;  1S7T A;  1T80 A;  2X4U A;  3VXS A;  1KJM A;  2FIK A;  3PWV A;  2F53 A;  3H9S A;  5FA3 A;  1I7R A;  3OXR A;  5E8O A;  2VE6 A;  2V2X A;  5IEK A;  4APQ A;  2YPK A;  1N3N A;  1HYR C;  4G8G A;  1QRN A;  4WUU A;  3FT3 A;  1HHJ A;  1KPV A;  1RK0 A;  3LKO A;  3QEQ A;  4MX7 A;  2FWO A;  2CLZ A;  2GTW A;  3P77 A;  4I48 A;  3ROL A;  3VCL A;  3AM8 A;  3FT2 A;  4K71 B;  3MRR A;  4O2E A;  3TO2 A;  3GIV A;  4PJG A;  2RFX A;  3D2U A;  2AXG A;  3D25 A;  3E3Q A;  3PWJ A;  4IRJ A;  3RWC A;  1HSB A;  3VXM A;  3MRH A;  5E00 A;  4PJA A;  3CDG A;  3O8X A;  2DYP A;  3MRJ A;  4FTV A;  1T0M A;  1S7V A;  4QRP A;  5EUO A;  5HHM A;  1MHE A;  5J6G A;  3KPL A;  1UXW A;  3LKN A;  4V3D B;  4ZUV A;  3I6K A;  3MRK A;  1S9Y A;  2MHA A;  4PG9 A;  5MEN A;  4LHU A;  1VGK A;  1P4L A;  5BJT A;  5EU3 A;  3MRQ A;  4ZFZ A;  3SDA A;  4L4V A;  4E0R A;  5MEO A;  1IM9 A;  4N5E A;  3O3E A;  1HHI A;  3ES6 A;  2ZOK A;  4JFE A;  5EU4 A;  1I7T A;  4L3C A;  4NQE A;  3RWI A;  3SDD A;  1XZ0 A;  1SYV A;  3GML A;  4U1S A;  5D7I A;  3QDJ A;  3ECB A;  3WUW A;  1AGB A;  4D0B A;  3QFJ A;  4U1K A;  4F7T A;  1Z5L A;  1T20 A;  4G43 A;  4HUV A;  3LV3 A;  2X4Q A;  2XPG A;  1T1Z A;  3ERY A;  5C07 A;  3DX8 A;  3FQX A;  4JFP A;  4PJ5 A;  3LKR A;  5D5M A;  3B3I A;  4F7P A;  4U6Y A;  3E2H A;  2PO6 A;  5IEH A;  3KPS A;  1ZHL A;  3FQN A;  1OGT A;  1CD1 A;  4IIQ C;  4QRU A;  4PJB A;  3L3K A;  4PRA A;  3GSU A;  5IND A;  3E6H A;  1FFN A;  4GKS A;  3ARF A;  3MR9 A;  1ED3 A;  3MRF A;  4K7F A;  5ACZ A;  1U58 A;  2HJK A;  1KBG H;  4U6X A;  4NQX A;  1DDH A;  3MRB A;  4X6F A;  2FO4 A;  3GSV A;  4G59 A;  4FFE X;  1I1Y A;  3L3I A;  3MV9 A;  5MEP A;  3KYO A;  1PQZ A;  3HE7 A;  2A83 A; 
#chains in the Genus database with same CATH topology
 5D2L A;  1ZT4 A;  4O2C A;  4NT6 A;  4WJ5 A;  1A9B A;  4PJE A;  3GSR A;  4PGD A;  3RTQ A;  2H26 A;  2E7L E;  3VWK A;  3JTT A;  3KPM A;  4HKJ A;  4ZUW A;  1N2R A;  1AO7 A;  2P5E A;  2NW3 A;  3CCH A;  3PWU A;  3BEW A;  2BSS A;  1K8D A;  1W72 A;  2D31 A;  1C16 A;  1KTL A;  3QUX A;  1FFO A;  1INQ A;  3ILP A;  3X13 A;  4PJI A;  4LNR A;  4NQD A;  2C7U A;  3PAB A;  5C08 A;  4Z77 A;  5C0B A;  5EU5 A;  5HGA A;  4ZUT A;  4Y4F A;  4Y16 A;  1RK1 A;  4S0U C;  2YPL A;  5C0I A;  3HUJ A;  5BXF A;  3QZW A;  4L29 A;  4QRT A;  2X4O A;  1G6R H;  1T0N A;  4UQ3 A;  3V5H A;  4JRX A;  3O9W A;  1R3H A;  1OF2 A;  1ZHN A;  5AD0 A;  3L9R A;  3FOL A;  5HGH A;  1T7W A;  3QDG A;  3PWN A;  3TBV A;  4JQV A;  3T8X A;  3C9N A;  4L4T A;  1DUY A;  3TBT A;  4PRB A;  5EO1 A;  5F9J A;  1JPG A;  3GSQ A;  4MVB A;  1EXU A;  3KLA A;  3BH8 A;  1FFP A;  3TZV C;  3RWG A;  2NX5 A;  2VLK A;  1I1F A;  3GMR A;  1ZT7 A;  3GMN A;  2VAA A;  4Y4K A;  5HGD A;  3HPJ A;  4PJ9 A;  2ESV A;  3ROO A;  5HHO A;  3FQW A;  4LCC C;  3UTT A;  4HS3 A;  1LEG A;  2BVQ A;  2CLR A;  3BP7 A;  3BVN A;  2BST A;  4D0C A;  1S7S A;  1KCG C;  1S7U A;  1JF1 A;  3KPN A;  1JE6 A;  3HLA A;  3W39 A;  4ELM A;  1LQV A;  3TN0 A;  4G42 A;  1WBZ A;  3DMM A;  2VLR A;  5FA4 A;  3FRU A;  1B3J A;  1T7Z A;  3DXA A;  4E5X A;  3I6L D;  4NO5 A;  4QOK A;  3QQ4 A;  3RZC A;  2GT9 A;  2VLJ A;  1AGE A;  3U0P A;  5D2N A;  1WBY A;  4NSK A;  1CE6 A;  3FQR A;  5E8N A;  2GTZ A;  4CVZ A;  4EUP A;  4QRS A;  1EEY A;  4LCW A;  4G9F A;  3HG1 A;  4WDI A;  3MGO A;  2AXF A;  2HLA A;  3BO8 A;  3VRI A;  5JHD A;  3VXR A;  4G9D A;  4PR5 A;  5EO0 A;  5IB5 A;  3M17 A;  5HHN A;  4JFF A;  1G7P A;  4D0D A;  3M1B A;  1AKJ A;  3ILQ C;  1KJ2 H;  3VFO A;  3BH9 A;  4LCY A;  4ZUU A;  3VFU A;  3LN4 A;  4U1J A;  5ENW A;  3VH8 A;  3VFR A;  5HYJ A;  1QSE A;  1ZT1 A;  1T1X A;  3HCV A;  5IB2 A;  5B38 A;  3DX6 A;  1A1M A;  3ARG A;  5EFI A;  5DDH A;  4PRD A;  3TO4 A;  3RL2 A;  3VFP A;  4NNX A;  1M05 A;  5SWQ A;  1ZHB A;  4IHO A;  3MV7 A;  1BQH A;  1ZAG A;  1QLF A;  1QVO A;  2AK4 A;  2JCC A;  1XR8 A;  3MRM A;  3G08 A;  1L8J A;  5BRZ A;  3SDC A;  4NO3 A;  5IB3 A;  3VFN A;  1AGD A;  5D7J C;  1EEZ A;  3CPL A;  1N5A A;  1TVB A;  4L8D A;  1ZS8 A;  2GUO A;  1FG2 A;  2XFX A;  4EI5 A;  3BZE A;  5C0G A;  2X4S A;  3CVH A;  2F74 A;  2YEZ A;  2X4N A;  4JO8 A;  1HOC A;  1B0R A;  1JUF A;  3TPU E;  4QRR A;  2VLL A;  3SKO A;  1JHT A;  5L2K A;  1K5N A;  4MNG A;  3SDX A;  2OI9 A;  1T21 A;  3FFC A;  4PV9 A;  1E27 A;  2BNQ A;  1MWA H;  4ONO A;  1GZQ A;  1T1W A;  5SWS A;  1BZ9 A;  1VAD A;  4GUP A;  1HHG A;  4EN3 C;  2PYE A;  3ARD A;  3BWA A;  1X7Q A;  4Z76 A;  1QO3 A;  3O3D A;  3FQT A;  3BUY A;  1NAN H;  1KPR A;  1RJY A;  1S7W A;  3NFN A;  4HUW A;  1T7Y A;  4I4W A;  5E8P A;  1N59 A;  3UBX A;  5MER A;  3L3J A;  3SCM A;  4N8V A;  3UTS A;  4L8C A;  3RWD A;  4PP8 C;  3H7B A;  1ZHK A;  5EOT A;  4U1H A;  1FO0 H;  5IVX A;  3TBW A;  5BS0 A;  2AV7 A;  1W0V A;  5ISZ A;  4PRE A;  1HHH A;  4JQX A;  2J8U A;  3QQ3 A;  3CH1 A;  4MJ6 A;  3SKM A;  5EU6 A;  3OXS A;  3RWH A;  3KPR A;  1FZO A;  3IT8 D;  4Y4H A;  3LN5 A;  3L3H A;  3FOM A;  1KPU A;  1S7R A;  3B6S A;  1S9X A;  3DTX A;  4PV8 A;  3RWE A;  3WLB A;  3L3G A;  3KXF A;  1QEW A;  4JFO A;  5J1A A;  4Z78 A;  1M6O A;  3MRP A;  4PDC E;  3KPO A;  1CG9 A;  3W0W A;  3GSN H;  1JFM A;  3QDM A;  3GMP A;  3JTC A;  3JTS A;  3P73 A;  4PGB A;  3PWP A;  4MJ5 A;  1A9E A;  4V3E B;  1YPZ A;  5GSR A;  3WL9 A;  4WO4 A;  3BXN A;  4X6C A;  3LKS A;  3MRN A;  3PWL A;  3CC5 A;  1S7X A;  1EFX A;  3BZF A;  3TBY A;  1A1N A;  4WWK C;  4N0F A;  1A6Z A;  5GSV A;  3TF7 A;  1OGA A;  5L2J A;  3QUL A;  1IM3 A;  3VFT A;  1ZVS A;  4L9L C;  2F54 A;  1ZSD A;  5HHP A;  3VFM A;  5C9J A;  3DBX A;  3MRO A;  1T7X A;  2O5N A;  5C0D A;  5IB4 A;  1OSZ A;  3PQY A;  1FZK A;  1QSF A;  5C0F A;  5C0A A;  1NAM H;  2GIT A;  1I4F A;  5C0E A;  4G8I A;  3AU1 A;  3FTG A;  3WS3 A;  4PRP A;  3CZF A;  3VFS A;  1LEK A;  3T1F A;  1QR1 A;  4L3E A;  4JRY A;  3UTQ A;  2CII A;  3OX8 A;  3TA3 A;  4NQV A;  2CIK A;  3P9M A;  4PJH A;  3MV8 A;  3X11 A;  5H94 A;  5HGB A;  3MRE A;  1B0G A;  2X70 A;  4Y2D A;  1TVH A;  3MA7 A;  4IRS A;  5IB1 A;  5DEG A;  1YN6 A;  5HHQ A;  1I7U A;  5C0J A;  3MYJ A;  4HUX A;  2HJL A;  5IM7 A;  2ZSV A;  4MS8 A;  4PRN A;  4MNQ A;  3DX7 A;  3REW A;  3I6G A;  4N0C A;  4JFD A;  2HN7 A;  1JPF A;  3TFK A;  5D7L A;  4QRQ A;  3O3A A;  4O2F A;  3VJ6 A;  1T22 A;  3S6C A;  4L8S C;  4U1L A;  3D39 A;  3MGT A;  4PJD A;  3KWW A;  4F7M A;  5E6I C;  4WU7 A;  3MRG A;  2X4P A;  3QUY A;  3D3V A;  1YDP A;  5F7D A;  3VRJ A;  2GJ6 A;  3KPP A;  1G7Q A;  1ONQ A;  3ARB A;  3E6F A;  3HE6 A;  5INC A;  5D9S A;  2BNR A;  3OV6 A;  4MJI A;  3BW9 A;  2H6P A;  4PJX A;  3VFW A;  3X12 A;  2CLV A;  4NQC A;  1Q94 A;  5C0C A;  5B39 A;  3P4M A;  4WW2 C;  4U1I A;  1XH3 A;  2IA1 A;  1AGC A;  1S7Q A;  3L3D A;  1RJZ A;  1TMC A;  3KYN A;  5F1I A;  1E28 A;  2AV1 A;  3SPV A;  2CKB H;  1WBX A;  3VFV A;  1A1O A;  1LD9 A;  4HUU A;  2FZ3 A;  5C09 A;  5DEF A;  4PRH A;  4PJ8 A;  1KJ3 H;  1LDP H;  5J6H A;  3O3B A;  3VXN A;  4F7E A;  3VXU A;  1MI5 A;  3TIE A;  5MEQ A;  3BGM A;  1JGD A;  3QUZ A;  1HSA A;  4PJF A;  3TID A;  4ZUS A;  2AKR A;  3FT4 A;  4PGE A;  3LKP A;  1MHC A;  2BVP A;  4X6D A;  3V5K A;  3FON A;  2V2W A;  1AGF A;  3RGV C;  4PJC A;  4U1M A;  3ARE A;  4ZAK A;  5FKP A;  1T7V A;  3V5D A;  4HWZ A;  3RL1 A;  1YN7 A;  3WS6 A;  3GJF A;  4MQ7 A;  4N0U A;  1UXS A;  4HX1 A;  3TJH A;  1S9W A;  3GSW A;  4F7C A;  1P7Q A;  1LK2 A;  4NO2 A;  1BD2 A;  3QI9 A;  4X6E A;  3P4N A;  4CVX A;  2ZOL A;  5FDW A;  3GMM A;  3GMO A;  3VWJ A;  1KJV A;  3MRC A;  3O4L A;  4HV8 A;  4NHU E;  4U1N A;  3VXO A;  1GZP A;  3MRL A;  3BP4 A;  3RUG A;  3VXP A;  4CW1 A;  1FZJ A;  1T1Y A;  3IXA A;  4WU5 A;  2WY3 A;  3C8K A;  4PGC A;  3RWF A;  3GSO A;  1W0W A;  3MRI A;  4GKN A;  1LP9 A;  2BSR A;  3SJV A;  3KPQ A;  4UQ2 A;  4NNY A;  4PRI A;  1DE4 A;  1QQD A;  3MRD A;  1HHK A;  1NEZ A;  3HAE A;  3D18 A;  1FZM A;  3H9H A;  3QFD A;  5E9D A;  1DUZ A;  3P4O A;  3RWJ A;  2UWE A;  4XXC A;  3BEV A;  2FYY A;  1SYS A;  2BVO A;  3FQU A;  1S8D A;  3QUK A;  3X14 A;  2BCK A;  4NO0 A;  1P1Z A;  5F1N A;  3LKQ A;  1JGE A;  2VAB A;  1VAC A;  2GAZ A;  1I1A A;  1UQS A;  3I0T A;  2Q7Y A;  5IRO A;  4PJ7 A;  2X4T A;  4L8B A;  4MXQ A;  3BHB A;  3GSX A;  4PG2 A;  3TVM A;  2OL3 H;  3TBS A;  3P9L A;  1BII A;  2X4R A;  3JVG A;  2ZSW A;  3UPR A;  1XR9 A;  3GMQ A;  4JFQ A;  5SWZ A;  2P5W A;  1S7T A;  1T80 A;  2X4U A;  3VXS A;  1KJM A;  2FIK A;  3PWV A;  2F53 A;  3H9S A;  5FA3 A;  1I7R A;  3OXR A;  5E8O A;  2VE6 A;  2V2X A;  5IEK A;  4APQ A;  2YPK A;  1N3N A;  1HYR C;  4G8G A;  1QRN A;  4WUU A;  3FT3 A;  1HHJ A;  1KPV A;  1RK0 A;  3LKO A;  3QEQ A;  4MX7 A;  2FWO A;  2CLZ A;  2GTW A;  3P77 A;  4I48 A;  3ROL A;  3VCL A;  3AM8 A;  3FT2 A;  4K71 B;  3MRR A;  4O2E A;  3TO2 A;  3GIV A;  4PJG A;  2RFX A;  3D2U A;  2AXG A;  3D25 A;  3E3Q A;  3PWJ A;  4IRJ A;  3RWC A;  1HSB A;  3VXM A;  3MRH A;  5E00 A;  4PJA A;  3CDG A;  3O8X A;  2DYP A;  3MRJ A;  4FTV A;  1T0M A;  1S7V A;  4QRP A;  5EUO A;  5HHM A;  1MHE A;  5J6G A;  3KPL A;  1UXW A;  3LKN A;  4V3D B;  4ZUV A;  3I6K A;  3MRK A;  1S9Y A;  2MHA A;  4PG9 A;  5MEN A;  4LHU A;  1VGK A;  1P4L A;  5BJT A;  5EU3 A;  3MRQ A;  4ZFZ A;  3SDA A;  4L4V A;  4E0R A;  5MEO A;  1IM9 A;  4N5E A;  3O3E A;  1HHI A;  3ES6 A;  2ZOK A;  4JFE A;  5EU4 A;  1I7T A;  4L3C A;  4NQE A;  3RWI A;  3SDD A;  1XZ0 A;  1SYV A;  3GML A;  4U1S A;  5D7I A;  3QDJ A;  3ECB A;  3WUW A;  1AGB A;  4D0B A;  3QFJ A;  4U1K A;  4F7T A;  1Z5L A;  1T20 A;  4G43 A;  4HUV A;  3LV3 A;  2X4Q A;  2XPG A;  1T1Z A;  3ERY A;  5C07 A;  3DX8 A;  3FQX A;  4JFP A;  4PJ5 A;  3LKR A;  4BKW A;  4G59 C;  5D5M A;  3B3I A;  4F7P A;  4U6Y A;  3E2H A;  2PO6 A;  5IEH A;  3KPS A;  1ZHL A;  3FQN A;  1OGT A;  1CD1 A;  4IIQ C;  4QRU A;  4PJB A;  3L3K A;  4PRA A;  3GSU A;  5IND A;  3E6H A;  1FFN A;  4GKS A;  3ARF A;  3MR9 A;  1ED3 A;  3MRF A;  4K7F A;  5ACZ A;  1U58 A;  2HJK A;  1KBG H;  4U6X A;  4NQX A;  1DDH A;  3MRB A;  4X6F A;  2FO4 A;  3GSV A;  4G59 A;  4FFE X;  1I1Y A;  3L3I A;  3MV9 A;  5MEP A;  3KYO A;  1PQZ A;  3HE7 A;  2A83 A;  2NYK A; 
#chains in the Genus database with same CATH homology
 5D2L A;  1ZT4 A;  4O2C A;  4NT6 A;  4WJ5 A;  1A9B A;  4PJE A;  3GSR A;  4PGD A;  3RTQ A;  2H26 A;  2E7L E;  3VWK A;  3JTT A;  3KPM A;  4HKJ A;  4ZUW A;  1N2R A;  1AO7 A;  2P5E A;  2NW3 A;  3CCH A;  3PWU A;  3BEW A;  2BSS A;  1K8D A;  1W72 A;  2D31 A;  1C16 A;  1KTL A;  3QUX A;  1FFO A;  1INQ A;  3ILP A;  3X13 A;  4PJI A;  4LNR A;  4NQD A;  2C7U A;  3PAB A;  5C08 A;  4Z77 A;  5C0B A;  5EU5 A;  5HGA A;  4ZUT A;  4Y4F A;  4Y16 A;  1RK1 A;  4S0U C;  2YPL A;  5C0I A;  3HUJ A;  5BXF A;  3QZW A;  4L29 A;  4QRT A;  2X4O A;  1G6R H;  1T0N A;  4UQ3 A;  3V5H A;  4JRX A;  3O9W A;  1R3H A;  1OF2 A;  1ZHN A;  5AD0 A;  3L9R A;  3FOL A;  5HGH A;  1T7W A;  3QDG A;  3PWN A;  3TBV A;  4JQV A;  3T8X A;  3C9N A;  4L4T A;  1DUY A;  3TBT A;  4PRB A;  5EO1 A;  5F9J A;  1JPG A;  3GSQ A;  4MVB A;  1EXU A;  3KLA A;  3BH8 A;  1FFP A;  3TZV C;  3RWG A;  2NX5 A;  2VLK A;  1I1F A;  3GMR A;  1ZT7 A;  3GMN A;  2VAA A;  4Y4K A;  5HGD A;  3HPJ A;  4PJ9 A;  2ESV A;  3ROO A;  5HHO A;  3FQW A;  4LCC C;  3UTT A;  4HS3 A;  1LEG A;  2BVQ A;  2CLR A;  3BP7 A;  3BVN A;  2BST A;  4D0C A;  1S7S A;  1KCG C;  1S7U A;  1JF1 A;  3KPN A;  1JE6 A;  3HLA A;  3W39 A;  4ELM A;  1LQV A;  3TN0 A;  4G42 A;  1WBZ A;  3DMM A;  2VLR A;  5FA4 A;  3FRU A;  1B3J A;  1T7Z A;  3DXA A;  4E5X A;  3I6L D;  4NO5 A;  4QOK A;  3QQ4 A;  3RZC A;  2GT9 A;  2VLJ A;  1AGE A;  3U0P A;  5D2N A;  1WBY A;  4NSK A;  1CE6 A;  3FQR A;  5E8N A;  2GTZ A;  4CVZ A;  4EUP A;  4QRS A;  1EEY A;  4LCW A;  4G9F A;  3HG1 A;  4WDI A;  3MGO A;  2AXF A;  2HLA A;  3BO8 A;  3VRI A;  5JHD A;  3VXR A;  4G9D A;  4PR5 A;  5EO0 A;  5IB5 A;  3M17 A;  5HHN A;  4JFF A;  1G7P A;  4D0D A;  3M1B A;  1AKJ A;  3ILQ C;  1KJ2 H;  3VFO A;  3BH9 A;  4LCY A;  4ZUU A;  3VFU A;  3LN4 A;  4U1J A;  5ENW A;  3VH8 A;  3VFR A;  5HYJ A;  1QSE A;  1ZT1 A;  1T1X A;  3HCV A;  5IB2 A;  5B38 A;  3DX6 A;  1A1M A;  3ARG A;  5EFI A;  5DDH A;  4PRD A;  3TO4 A;  3RL2 A;  3VFP A;  4NNX A;  1M05 A;  5SWQ A;  1ZHB A;  4IHO A;  3MV7 A;  1BQH A;  1ZAG A;  1QLF A;  1QVO A;  2AK4 A;  2JCC A;  1XR8 A;  3MRM A;  3G08 A;  1L8J A;  5BRZ A;  3SDC A;  4NO3 A;  5IB3 A;  3VFN A;  1AGD A;  5D7J C;  1EEZ A;  3CPL A;  1N5A A;  1TVB A;  4L8D A;  1ZS8 A;  2GUO A;  1FG2 A;  2XFX A;  4EI5 A;  3BZE A;  5C0G A;  2X4S A;  3CVH A;  2F74 A;  2YEZ A;  2X4N A;  4QRR A;  1HOC A;  1B0R A;  1JUF A;  3TPU E;  2VLL A;  3SKO A;  1JHT A;  5L2K A;  1K5N A;  4MNG A;  3SDX A;  2OI9 A;  1T21 A;  3FFC A;  4PV9 A;  1E27 A;  2BNQ A;  1MWA H;  4ONO A;  1GZQ A;  1T1W A;  5SWS A;  1BZ9 A;  1VAD A;  4GUP A;  1HHG A;  4EN3 C;  2PYE A;  3ARD A;  3BWA A;  1X7Q A;  4Z76 A;  1QO3 A;  3O3D A;  3FQT A;  3BUY A;  1NAN H;  1KPR A;  1RJY A;  1S7W A;  3NFN A;  4HUW A;  1T7Y A;  4I4W A;  5E8P A;  1N59 A;  3UBX A;  5MER A;  3L3J A;  3SCM A;  4N8V A;  3UTS A;  4L8C A;  3RWD A;  4PP8 C;  3H7B A;  1ZHK A;  5EOT A;  4U1H A;  1FO0 H;  5IVX A;  3TBW A;  5BS0 A;  2AV7 A;  1W0V A;  5ISZ A;  4PRE A;  1HHH A;  4JQX A;  2J8U A;  3QQ3 A;  3CH1 A;  4MJ6 A;  3SKM A;  5EU6 A;  3OXS A;  3RWH A;  3KPR A;  1FZO A;  3IT8 D;  4Y4H A;  3LN5 A;  3L3H A;  3FOM A;  1KPU A;  1S7R A;  3B6S A;  1S9X A;  3DTX A;  4PV8 A;  3RWE A;  3WLB A;  3L3G A;  3KXF A;  1QEW A;  4JFO A;  5J1A A;  4Z78 A;  1M6O A;  3MRP A;  4PDC E;  3KPO A;  1CG9 A;  3W0W A;  3GSN H;  1JFM A;  3QDM A;  3GMP A;  3JTC A;  3JTS A;  3P73 A;  4PGB A;  3PWP A;  4MJ5 A;  1A9E A;  4V3E B;  1YPZ A;  5GSR A;  3WL9 A;  4WO4 A;  3BXN A;  4X6C A;  3LKS A;  3MRN A;  3PWL A;  3CC5 A;  1S7X A;  1EFX A;  3BZF A;  3TBY A;  1A1N A;  4WWK C;  4N0F A;  1A6Z A;  5GSV A;  3TF7 A;  1OGA A;  5L2J A;  3QUL A;  1IM3 A;  3VFT A;  1ZVS A;  4L9L C;  2F54 A;  1ZSD A;  5HHP A;  3VFM A;  5C9J A;  3DBX A;  3MRO A;  1T7X A;  5C0D A;  5IB4 A;  1OSZ A;  3PQY A;  1FZK A;  1QSF A;  5C0F A;  5C0A A;  1NAM H;  2GIT A;  1I4F A;  5C0E A;  4G8I A;  3AU1 A;  3FTG A;  3WS3 A;  4PRP A;  3CZF A;  3VFS A;  1LEK A;  3T1F A;  1QR1 A;  4L3E A;  4JRY A;  3UTQ A;  2CII A;  3OX8 A;  3TA3 A;  4NQV A;  2CIK A;  3P9M A;  4PJH A;  3MV8 A;  3X11 A;  5H94 A;  5HGB A;  3MRE A;  1B0G A;  2X70 A;  4Y2D A;  1TVH A;  3MA7 A;  4IRS A;  5IB1 A;  5DEG A;  1YN6 A;  5HHQ A;  1I7U A;  5C0J A;  3MYJ A;  4HUX A;  2HJL A;  5IM7 A;  2ZSV A;  4MS8 A;  4PRN A;  4MNQ A;  3DX7 A;  3REW A;  3I6G A;  4N0C A;  4JFD A;  2HN7 A;  1JPF A;  3TFK A;  5D7L A;  4QRQ A;  3O3A A;  4O2F A;  3VJ6 A;  1T22 A;  3S6C A;  4L8S C;  4U1L A;  3D39 A;  3MGT A;  4PJD A;  3KWW A;  4F7M A;  5E6I C;  4WU7 A;  3MRG A;  2X4P A;  3QUY A;  3D3V A;  1YDP A;  5F7D A;  3VRJ A;  2GJ6 A;  3KPP A;  1G7Q A;  1ONQ A;  3ARB A;  3E6F A;  3HE6 A;  5INC A;  5D9S A;  2BNR A;  3OV6 A;  4MJI A;  3BW9 A;  2H6P A;  4PJX A;  3VFW A;  3X12 A;  2CLV A;  4NQC A;  1Q94 A;  5C0C A;  5B39 A;  3P4M A;  4WW2 C;  4U1I A;  1XH3 A;  1AGC A;  1S7Q A;  3L3D A;  1RJZ A;  1TMC A;  3KYN A;  5F1I A;  1E28 A;  2AV1 A;  3SPV A;  2CKB H;  1WBX A;  3VFV A;  1A1O A;  1LD9 A;  4HUU A;  2FZ3 A;  5C09 A;  5DEF A;  4PRH A;  4PJ8 A;  1KJ3 H;  1LDP H;  5J6H A;  3O3B A;  3VXN A;  4F7E A;  3VXU A;  1MI5 A;  3TIE A;  5MEQ A;  3BGM A;  1JGD A;  3QUZ A;  1HSA A;  4PJF A;  3TID A;  4ZUS A;  2AKR A;  3FT4 A;  4PGE A;  3LKP A;  1MHC A;  2BVP A;  4X6D A;  3V5K A;  3FON A;  2V2W A;  1AGF A;  3RGV C;  4PJC A;  4U1M A;  3ARE A;  4ZAK A;  5FKP A;  1T7V A;  3V5D A;  4HWZ A;  3RL1 A;  1YN7 A;  3WS6 A;  3GJF A;  4MQ7 A;  4N0U A;  1UXS A;  4HX1 A;  3TJH A;  1S9W A;  3GSW A;  4F7C A;  1P7Q A;  1LK2 A;  4NO2 A;  1BD2 A;  3QI9 A;  4X6E A;  3P4N A;  4CVX A;  2ZOL A;  5FDW A;  3GMM A;  3GMO A;  3VWJ A;  1KJV A;  3MRC A;  3O4L A;  4HV8 A;  4NHU E;  4U1N A;  3VXO A;  1GZP A;  3MRL A;  3BP4 A;  3RUG A;  3VXP A;  4CW1 A;  1FZJ A;  1T1Y A;  3IXA A;  4WU5 A;  2WY3 A;  3C8K A;  4PGC A;  3RWF A;  3GSO A;  1W0W A;  3MRI A;  4GKN A;  1LP9 A;  2BSR A;  3SJV A;  3KPQ A;  4UQ2 A;  4NNY A;  4PRI A;  1DE4 A;  1QQD A;  3MRD A;  1HHK A;  1NEZ A;  3HAE A;  3D18 A;  1FZM A;  3H9H A;  3QFD A;  5E9D A;  1DUZ A;  3P4O A;  3RWJ A;  2UWE A;  4XXC A;  3BEV A;  2FYY A;  1SYS A;  2BVO A;  3FQU A;  1S8D A;  3QUK A;  3X14 A;  2BCK A;  4NO0 A;  1P1Z A;  5F1N A;  3LKQ A;  1JGE A;  2VAB A;  1VAC A;  2GAZ A;  1I1A A;  1UQS A;  2Q7Y A;  5IRO A;  4PJ7 A;  2X4T A;  4L8B A;  4MXQ A;  3BHB A;  3GSX A;  4PG2 A;  3TVM A;  2OL3 H;  3TBS A;  3P9L A;  1BII A;  2X4R A;  3JVG A;  2ZSW A;  3UPR A;  1XR9 A;  3GMQ A;  4JFQ A;  5SWZ A;  2P5W A;  1S7T A;  1T80 A;  2X4U A;  3VXS A;  1KJM A;  2FIK A;  3PWV A;  2F53 A;  3H9S A;  5FA3 A;  1I7R A;  3OXR A;  5E8O A;  2VE6 A;  2V2X A;  5IEK A;  4APQ A;  2YPK A;  1N3N A;  1HYR C;  4G8G A;  1QRN A;  4WUU A;  3FT3 A;  1HHJ A;  1KPV A;  1RK0 A;  3LKO A;  3QEQ A;  4MX7 A;  2FWO A;  2CLZ A;  2GTW A;  3P77 A;  4I48 A;  3ROL A;  3VCL A;  3AM8 A;  3FT2 A;  4K71 B;  3MRR A;  4O2E A;  3TO2 A;  3GIV A;  4PJG A;  2RFX A;  3D2U A;  2AXG A;  3D25 A;  3E3Q A;  3PWJ A;  4IRJ A;  3RWC A;  1HSB A;  3VXM A;  3MRH A;  5E00 A;  4PJA A;  3CDG A;  3O8X A;  2DYP A;  3MRJ A;  4FTV A;  1T0M A;  1S7V A;  4QRP A;  5EUO A;  5HHM A;  1MHE A;  5J6G A;  3KPL A;  1UXW A;  3LKN A;  4V3D B;  4ZUV A;  3I6K A;  3MRK A;  1S9Y A;  2MHA A;  4PG9 A;  5MEN A;  4LHU A;  1VGK A;  1P4L A;  5BJT A;  5EU3 A;  3MRQ A;  4ZFZ A;  3SDA A;  4L4V A;  4E0R A;  5MEO A;  1IM9 A;  4N5E A;  3O3E A;  1HHI A;  3ES6 A;  2ZOK A;  4JFE A;  5EU4 A;  1I7T A;  4L3C A;  4NQE A;  3RWI A;  3SDD A;  1XZ0 A;  1SYV A;  3GML A;  4U1S A;  5D7I A;  3QDJ A;  3ECB A;  3WUW A;  1AGB A;  4D0B A;  3QFJ A;  4U1K A;  4F7T A;  1Z5L A;  1T20 A;  4G43 A;  4HUV A;  3LV3 A;  2X4Q A;  2XPG A;  1T1Z A;  3ERY A;  5C07 A;  3DX8 A;  3FQX A;  4JFP A;  4PJ5 A;  3LKR A;  5D5M A;  3B3I A;  4F7P A;  4U6Y A;  3E2H A;  2PO6 A;  5IEH A;  3KPS A;  1ZHL A;  3FQN A;  1OGT A;  1CD1 A;  4IIQ C;  4QRU A;  4PJB A;  3L3K A;  4PRA A;  3GSU A;  5IND A;  3E6H A;  1FFN A;  4GKS A;  3ARF A;  3MR9 A;  1ED3 A;  3MRF A;  4K7F A;  5ACZ A;  1U58 A;  2HJK A;  1KBG H;  4U6X A;  4NQX A;  1DDH A;  3MRB A;  4X6F A;  2FO4 A;  3GSV A;  4G59 A;  4FFE X;  1I1Y A;  3L3I A;  3MV9 A;  5MEP A;  3KYO A;  1PQZ A;  3HE7 A;  2A83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...