3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
3TIDA 5EO1A 2AXGA 4O2EA 1DUYA 3M17A 2X4SA 1ED3A 3GMOA 4IIQC 4NQCA 1QR1A 3FQTA 3AM8A 3LKSA 1CD1A 3E6HA 1DE4A 1T20A 4JFFA 2X4QA 3C9NA 1X7QA 5EU6A 3VFNA 5DEFA 5GSVA 5HYJA 3RL1A 3MRGA 4L8SC 1A1MA 3CC5A 5D2NA 4JQXA 3LKOA 4IHOA 2OI9A 4QOKA 4PJCA 3B6SA 4LCWA 4NNYA 3HUJA 4ZUVA 5ENWA 1I1AA 1YDPA 3BW9A 3CH1A 2X4UA 5C07A 4N0UA 3MGOA 3VFWA 3V5DA 4X6FA 5IVXA 4HUXA 1GZQA 4U1LA 2V2WA 5EOTA 3U0PA 3MREA 3DXAA 5D7LA 1AO7A 2RFXA 4NQVA 4Y2DA 3MGTA 1S9WA 5HGHA 1ZT1A 3V5HA 1QSEA 1MWAH 4Y4HA 2F54A 5F7DA 3MRPA 2GAZA 1VGKA 3KWWA 4QRPA 1AGFA 2P5EA 3HLAA 3KPOA 1VACA 4L3EA 3OX8A 4L4VA 3RWEA 3FFCA 5EU5A 3SDAA 1QEWA 5E6IC 5C0DA 4NQDA 3WUWA 2HN7A 3KPNA 3D39A 3KXFA 2JCCA 1LEKA 5ACZA 1S7TA 3UTTA 1QQDA 3HG1A 3GMQA 1S9YA 4PJXA 2CLZA 4PREA 3DX8A 3KLAA 1ZVSA 2Q7YA 3X14A 4PG9A 4ELMA 3RTQA 5EFIA 3SJVA 1R3HA 2VLLA 1FFOA 4U1HA 1DUZA 5C08A 1S7QA 4G8GA 5IM7A 1LQVA 4JRXA 3MRIA 3TBTA 4JFEA 5FKPA 3L3IA 1A6ZA 5IB2A 1B3JA 3FRUA 4EN3C 3GSWA 5C0FA 1AKJA 5C0JA 4Y4KA 1HSAA 4PRHA 3ARBA 3E2HA 4WW2C 4XXCA 5INDA 4PJ5A 5DDHA 4NSKA 3DBXA 4V3DB 1TVHA 2FZ3A 1W0WA 1LDPH 3TA3A 4PR5A 5E00A 3TBVA 3PQYA 3GMMA 5L2JA 3KPQA 1W72A 3FOLA 3FQRA 5HHPA 4L8BA 5B38A 2UWEA 4Z78A 4QRTA 3MRMA 3DTXA 4Z77A 1HHHA 4NNXA 1YPZA 3LKNA 4PJAA 2CIKA 3ROOA 2FWOA 3P4NA 3RWFA 3VXNA 1WBXA 4CW1A 3KYOA 1EEYA 1LP9A 3QZWA 3ERYA 4X6CA 1LEGA 3TN0A 3P4MA 1VADA 1T7YA 2P5WA 3UTSA 2X4PA 1P4LA 4X6EA 1KCGC 3O3DA 1Q94A 4G8IA 5IEKA 2GUOA 3VFVA 3D25A 3QFDA 1XZ0A 4U1NA 3GMRA 3CCHA 4ZUWA 1JF1A 1IM3A 4JQVA 3RWHA 1P7QA 3W0WA 3MRNA 1A9BA 4CVXA 3GSUA 3QUYA 3LKQA 3BP4A 4JFPA 3TBSA 3GMNA 1KBGH 1I7RA 1L8JA 1QLFA 3OV6A 1T1XA 5H94A 3O8XA 4NO0A 4LCCC 3X12A 5ISZA 5IB1A 1TMCA 3P9MA 1FFNA 5BJTA 2VE6A 4HV8A 2CIIA 1B0RA 3O3AA 4MNGA 4PJFA 5EO0A 2GITA 3SDDA 4CVZA 5BS0A 2BNRA 4PJ7A 3E3QA 1QVOA 1T7VA 3TF7A 5C9JA 5J6GA 1C16A 3OXRA 5C0EA 3VFUA 4PJIA 5JHDA 3FOMA 1BZ9A 4MJ6A 4ZAKA 3B3IA 3KPRA 3SPVA 3DX7A 4L3CA 1FFPA 4G9FA 4PGCA 3QDJA 5L2KA 1RK0A 3JTSA 1MHCA 4N0FA 1UXSA 3LV3A 5C09A 1NANH 3IXAA 4Z76A 1K5NA 3HE7A 2VAAA 1HHGA 1N59A 3C8KA 1QRNA 4NT6A 1ZT7A 2FIKA 5EUOA 5IEHA 3TFKA 5C0BA 1AGDA 4K7FA 4WU5A 3QDGA 1KPVA 3HPJA 2J8UA 1XH3A 4F7MA 3H7BA 1OGTA 1A9EA 3AU1A 3TO4A 3LKRA 4QRSA 2H6PA 3CDGA 4F7CA 1ZSDA 4PRNA 3L3JA 4Y16A 5SWQA 3MRBA 5GSRA 3PWUA 4LCYA 4ZUUA 2MHAA 5BRZA 5J6HA 5MEQA 4F7EA 3QUKA 3GMLA 1HHIA 3BVNA 1ZS8A 1S7SA 2ZSVA 1JGEA 3O4LA 3WLBA 5D7IA 4PJ9A 5SWSA 4PRPA 1N3NA 2GT9A 3HAEA 3RWGA 1HYRC 1KPUA 2AXFA 2YPLA 3CPLA 2C7UA 3TO2A 4HKJA 4PJGA 3TBYA 3BXNA 3VFPA 1OSZA 2X4RA 2X4OA 4Y4FA 3ES6A 1PQZA 3MR9A 4QRUA 5D9SA 4FFEX 4NO3A 1EXUA 3VFOA 3GJFA 1E27A 1FG2A 3BH9A 2X70A 2BVOA 3FT3A 1JPFA 5HHMA 3QDMA 4L29A 5D7JC 2ZOKA 3FQNA 4PGBA 3JTTA 4G59A 3MRQA 3BP7A 2HLAA 3SCMA 1KPRA 2GJ6A 3DMMA 2ESVA 3HCVA 3MRKA 3VWJA 3P9LA 3VFTA 1T1ZA 1FZMA 3UTQA 3RWIA 5AD0A 4QRRA 1EFXA 2A83A 1XR8A 3L9RA 5C0AA 5E8PA 4N8VA 2YPKA 3MRRA 4NQXA 3VXSA 3D18A 1I1FA 1NEZA 4ZFZA 5HHQA 4ONOA 1FZOA 5IROA 3MV7A 2NW3A 1BIIA 1BQHA 1K8DA 2AV7A 2OL3H 4HS3A 2ZOLA 3VCLA 5MERA 2WY3A 1EEZA 4PGDA 3VFRA 3L3KA 3GSOA 1ZHLA 1ZT4A 3X13A 2VLJA 5E9DA 5F9JA 3KPSA 4NHUE 4U1SA 4WJ5A 4WWKC 3QULA 3WS6A 1AGCA 3MV9A 4PP8C 4U6XA 3MROA 2AKRA 1HSBA 5INCA 1CE6A 1KJVA 1A1NA 4L8DA 3VFMA 3WL9A 3L3GA 1FZJA 2VLKA 3SKMA 4U6YA 4G43A 3RZCA 4IRSA 3P77A 3MV8A 1QO3A 4MJ5A 1KJ3H 3P73A 3SDXA 1P1ZA 4WU7A 2FYYA 1LK2A 3QUXA 3NFNA 1RK1A 3O9WA 1M6OA 1YN7A 3G08A 1JE6A 1JFMA 3BEVA 4NQEA 5HGAA 4O2CA 3TJHA 4U1IA 1T80A 3H9HA 4UQ2A 1N5AA 3AREA 1IM9A 1S7RA 3H9SA 3W39A 1G7PA 2AK4A 3GSXA 3D3VA 4IRJA 1U58A 2XFXA 3ARFA 3MRCA 3SDCA 3GSQA 3RUGA 1S7VA 3KPPA 4D0CA 1INQA 1JHTA 1ZHBA 4I48A 4MVBA 4MQ7A 1A1OA 3VRIA 1WBZA 1S7UA 4PRAA 3MRDA 3QQ4A 5EU3A 1RJYA 2H26A 4EUPA 2F53A 1SYSA 2PO6A 2GTZA 1UQSA 4PRIA 4HUUA 1E28A 3ECBA 3OXSA 5B39A 3BWAA 3O3BA 5C0GA 4GKSA 2YEZA 1G6RH 3PWVA 3TVMA 5D5MA 2F74A 3RWCA 3T1FA 1KJ2H 3BHBA 1HOCA 1I4FA 1ZHNA 1B0GA 2HJLA 5E8NA 4U1KA 3TZVC 1T7WA 5FDWA 5MEOA 4L4TA 3ILPA 4NO5A 5IB4A 1S8DA 4L8CA 3JTCA 5F1NA 1T1WA 3D2UA 3VRJA 2HJKA 2BSSA 1MI5A 2BVPA 1LD9A 3KPLA 5BXFA 3E6FA 5IB5A 1T21A 3VXRA 3BEWA 1UXWA 5MENA 4HUWA 4V3EB 4PV8A 3CZFA 1FZKA 1ZHKA 4APQA 4MX7A 5SWZA 3TBWA 4EI5A 5DEGA 3BZFA 5HHNA 1T22A 4HWZA 4GUPA 4G9DA 3TPUE 4HUVA 3ROLA 3GSRA 4WUUA 4N5EA 3CVHA 3QQ3A 3KPMA 4X6DA 4PJEA 1OGAA 3PWNA 3T8XA 2ZSWA 3RWDA 1JGDA 1I7UA 1FO0H 3MRJA 4JFQA 4U1MA 1WBYA 5FA3A 1N2RA 4D0DA 4D0BA 3FT4A 1BD2A 3QFJA 2CKBH 3BUYA 4U1JA 2VABA 1T1YA 3I6LD 3VXMA 3RWJA 3SKOA 3DX6A 4PJDA 4L9LC 3BZEA 4E5XA 1KJMA 5HGBA 5J1AA 1I7TA 3BH8A 1AGEA 1ZAGA 3FT2A 5EU4A 3LN5A 2NX5A 3WS3A 4E0RA 4WO4A 1DDHA 4JRYA 5MEPA 3PABA 1I1YA 2BSTA 3MA7A 3FQXA 1T7ZA 3X11A 1GZPA 4WDIA 1NAMH 3ILQC 4S0UC 4F7TA 3KYNA 2CLVA 3HE6A 2BSRA 3GSVA 3P4OA 1W0VA 4NO2A 4PJHA 1KTLA 3FQWA 5D2LA 5F1IA 3REWA 3S6CA 3V5KA 3VXOA 4F7PA 4MJIA 3RL2A 4I4WA 3FQUA 3QEQA 2PYEA 5C0IA 2BCKA 4HX1A 3VWKA 1CG9A 1JPGA 4LNRA 3UPRA 4ZUTA 1QSFA 3LKPA 3L3DA 4K71B 3GSNH 3PWJA 3MRFA 3I6KA 5C0CA 4FTVA 2V2XA 3LN4A 2X4TA 3MRHA 4MXQA 4PG2A 2BVQA 1Z5LA 1S9XA 4UQ3A 1XR9A 5E8OA 3MYJA 3FONA 2DYPA 3JVGA 4PV9A 3GIVA 4PJBA 1T7XA 1G7QA 2AV1A 5HHOA 3TIEA 1AGBA 3I6GA 3ARGA 3UBXA 3VJ6A 3BO8A 4LHUA 3PWPA 1JUFA 2GTWA 1TVBA 4PJ8A 2XPGA 3M1BA 4JFOA 4O2FA 4PRDA 3VFSA 3QUZA 1ONQA 3BGMA 3GMPA 1SYVA 4PDCE 4PRBA 1OF2A 1YN6A 5HGDA 2VLRA 4MS8A 3IT8D 4JFDA 4N0CA 3VH8A 2FO4A 3VXPA 1M05A 1T0MA 2BNQA 3MRLA 3O3EA 4QRQA 1HHKA 3FTGA 2CLRA 3ARDA 1MHEA 2D31A 3PWLA 3RGVC 3QI9A 2E7LE 1S7XA 1RJZA 2X4NA 5FA4A 4GKNA 1T0NA 3VXUA 4MNQA 1HHJA 1S7WA 3L3HA 4PGEA 5IB3A 4ZUSA 4G42A
chains in the Genus database with same CATH superfamily
3TIDA 5EO1A 2AXGA 4O2EA 1DUYA 3M17A 2X4SA 1ED3A 3GMOA 4IIQC 4NQCA 1QR1A 3FQTA 3AM8A 3LKSA 1CD1A 3E6HA 1DE4A 1T20A 4JFFA 2X4QA 3C9NA 1X7QA 4JO8A 5EU6A 3VFNA 5DEFA 5GSVA 5HYJA 3RL1A 3MRGA 4L8SC 1A1MA 3CC5A 5D2NA 4JQXA 3LKOA 4IHOA 2OI9A 4QOKA 4PJCA 3B6SA 4LCWA 4NNYA 3HUJA 4ZUVA 5ENWA 1I1AA 1YDPA 3BW9A 3CH1A 2X4UA 2IA1A 4N0UA 5C07A 3MGOA 3VFWA 3V5DA 4X6FA 5IVXA 4HUXA 1GZQA 4U1LA 2V2WA 5EOTA 3U0PA 3MREA 3DXAA 5D7LA 1AO7A 2RFXA 4NQVA 4Y2DA 3MGTA 1S9WA 5HGHA 1ZT1A 3V5HA 1QSEA 1MWAH 4Y4HA 2F54A 5F7DA 3MRPA 2GAZA 1VGKA 3KWWA 4QRPA 1AGFA 2P5EA 3HLAA 3KPOA 1VACA 4L3EA 3OX8A 4L4VA 3RWEA 3FFCA 5EU5A 3SDAA 1QEWA 5E6IC 5C0DA 4NQDA 3WUWA 2HN7A 3KPNA 3D39A 3KXFA 2JCCA 4G59C 1LEKA 5ACZA 1S7TA 3UTTA 1QQDA 3HG1A 3GMQA 1S9YA 4PJXA 2CLZA 4PREA 3DX8A 3KLAA 1ZVSA 2Q7YA 3X14A 4PG9A 4ELMA 3RTQA 5EFIA 3SJVA 1R3HA 2VLLA 1FFOA 4U1HA 1DUZA 5C08A 1S7QA 4G8GA 5IM7A 1LQVA 4JRXA 3MRIA 3TBTA 4JFEA 5FKPA 3L3IA 1A6ZA 5IB2A 1B3JA 3FRUA 4EN3C 3GSWA 5C0FA 1AKJA 5C0JA 4Y4KA 1HSAA 4PRHA 3ARBA 3E2HA 4WW2C 4XXCA 5INDA 4PJ5A 5DDHA 4NSKA 3DBXA 4V3DB 1TVHA 2FZ3A 1W0WA 1LDPH 3TA3A 4PR5A 5E00A 3TBVA 3PQYA 3GMMA 5L2JA 3KPQA 1W72A 2O5NA 3FOLA 3FQRA 5HHPA 4L8BA 5B38A 2UWEA 4Z78A 4QRTA 3MRMA 3DTXA 4Z77A 1HHHA 4NNXA 1YPZA 3LKNA 4PJAA 2CIKA 3ROOA 2FWOA 3P4NA 3RWFA 3VXNA 1WBXA 4CW1A 3KYOA 1EEYA 1LP9A 3QZWA 3ERYA 4X6CA 1LEGA 3TN0A 3P4MA 1VADA 1T7YA 2P5WA 3UTSA 2X4PA 1P4LA 4X6EA 1KCGC 3O3DA 1Q94A 4G8IA 5IEKA 2GUOA 3VFVA 3D25A 3QFDA 1XZ0A 4U1NA 3GMRA 3CCHA 4ZUWA 1JF1A 1IM3A 4JQVA 3RWHA 1P7QA 3W0WA 3MRNA 1A9BA 4CVXA 3GSUA 3QUYA 3LKQA 3BP4A 4JFPA 3TBSA 3GMNA 1KBGH 1I7RA 1L8JA 1QLFA 3OV6A 1T1XA 5H94A 3O8XA 4NO0A 4LCCC 3X12A 5ISZA 5IB1A 1TMCA 3P9MA 1FFNA 5BJTA 2VE6A 4HV8A 2CIIA 1B0RA 3O3AA 4MNGA 4PJFA 5EO0A 2GITA 3SDDA 4CVZA 5BS0A 2BNRA 4PJ7A 3E3QA 1QVOA 1T7VA 3TF7A 5C9JA 5J6GA 1C16A 3OXRA 5C0EA 3VFUA 4PJIA 5JHDA 3FOMA 1BZ9A 4MJ6A 4ZAKA 3B3IA 3KPRA 3SPVA 3DX7A 4L3CA 1FFPA 4G9FA 4PGCA 3QDJA 5L2KA 1RK0A 3JTSA 4BKWA 1MHCA 4N0FA 1UXSA 3LV3A 5C09A 1NANH 3IXAA 4Z76A 1K5NA 3HE7A 2VAAA 1HHGA 1N59A 3C8KA 1QRNA 4NT6A 1ZT7A 2FIKA 5EUOA 5IEHA 3TFKA 5C0BA 1AGDA 4K7FA 4WU5A 3QDGA 1KPVA 3HPJA 2J8UA 1XH3A 4F7MA 3H7BA 1OGTA 1A9EA 3AU1A 3TO4A 3LKRA 4QRSA 2H6PA 3CDGA 4F7CA 1ZSDA 4PRNA 3L3JA 4Y16A 5SWQA 3MRBA 5GSRA 3PWUA 4LCYA 4ZUUA 2MHAA 5BRZA 5J6HA 5MEQA 4F7EA 3QUKA 3GMLA 1HHIA 3BVNA 1ZS8A 1S7SA 2ZSVA 1JGEA 3O4LA 3WLBA 5D7IA 4PJ9A 5SWSA 4PRPA 1N3NA 2GT9A 3HAEA 3RWGA 1HYRC 1KPUA 2AXFA 2YPLA 3CPLA 2C7UA 3TO2A 4HKJA 4PJGA 3TBYA 3BXNA 3VFPA 1OSZA 2X4RA 2X4OA 4Y4FA 3ES6A 1PQZA 3MR9A 4QRUA 5D9SA 4FFEX 4NO3A 1EXUA 3VFOA 3GJFA 1E27A 1FG2A 3BH9A 2X70A 2BVOA 3FT3A 1JPFA 5HHMA 3QDMA 4L29A 5D7JC 2ZOKA 3FQNA 4PGBA 3JTTA 4G59A 3MRQA 3BP7A 2HLAA 2NYKA 3SCMA 1KPRA 2GJ6A 3DMMA 2ESVA 3HCVA 3MRKA 3VWJA 3P9LA 3VFTA 1T1ZA 1FZMA 3UTQA 3RWIA 5AD0A 4QRRA 1EFXA 2A83A 1XR8A 3L9RA 5C0AA 5E8PA 4N8VA 2YPKA 3MRRA 4NQXA 3VXSA 3D18A 1I1FA 1NEZA 4ZFZA 5HHQA 4ONOA 1FZOA 5IROA 3MV7A 2NW3A 1BIIA 1BQHA 1K8DA 2AV7A 2OL3H 4HS3A 2ZOLA 3VCLA 5MERA 2WY3A 1EEZA 4PGDA 3VFRA 3L3KA 3GSOA 1ZHLA 1ZT4A 3X13A 2VLJA 5E9DA 5F9JA 3KPSA 4NHUE 4U1SA 4WJ5A 4WWKC 3QULA 3WS6A 1AGCA 3MV9A 4PP8C 4U6XA 3MROA 2AKRA 1HSBA 5INCA 1CE6A 1KJVA 1A1NA 4L8DA 3VFMA 3WL9A 3L3GA 1FZJA 2VLKA 3SKMA 4U6YA 4G43A 3RZCA 4IRSA 3P77A 3MV8A 1QO3A 4MJ5A 1KJ3H 3P73A 3SDXA 1P1ZA 4WU7A 2FYYA 1LK2A 3QUXA 3NFNA 1RK1A 3O9WA 1M6OA 1YN7A 3G08A 1JE6A 1JFMA 3BEVA 4NQEA 5HGAA 4O2CA 3TJHA 4U1IA 1T80A 3H9HA 4UQ2A 1N5AA 3AREA 1IM9A 1S7RA 3H9SA 3W39A 1G7PA 2AK4A 3GSXA 3D3VA 4IRJA 1U58A 2XFXA 3ARFA 3MRCA 3SDCA 3GSQA 3RUGA 1S7VA 3KPPA 4D0CA 1INQA 1JHTA 1ZHBA 4I48A 4MVBA 4MQ7A 1A1OA 3VRIA 1WBZA 1S7UA 4PRAA 3MRDA 3QQ4A 5EU3A 1RJYA 2H26A 4EUPA 2F53A 1SYSA 2PO6A 2GTZA 1UQSA 4PRIA 4HUUA 1E28A 3ECBA 3OXSA 5B39A 3BWAA 3O3BA 5C0GA 4GKSA 2YEZA 1G6RH 3PWVA 3TVMA 5D5MA 2F74A 3RWCA 3T1FA 1KJ2H 3BHBA 1HOCA 1I4FA 1ZHNA 1B0GA 2HJLA 5E8NA 4U1KA 3TZVC 1T7WA 5FDWA 5MEOA 4L4TA 3ILPA 4NO5A 5IB4A 1S8DA 4L8CA 3JTCA 5F1NA 1T1WA 3D2UA 3VRJA 2HJKA 2BSSA 1MI5A 2BVPA 1LD9A 3KPLA 5BXFA 3E6FA 5IB5A 1T21A 3VXRA 3BEWA 1UXWA 5MENA 4HUWA 4V3EB 4PV8A 5IB3A 3CZFA 1FZKA 1ZHKA 4APQA 4MX7A 5SWZA 3TBWA 4EI5A 5DEGA 3BZFA 5HHNA 1T22A 4HWZA 4GUPA 4G9DA 3TPUE 4HUVA 3ROLA 3GSRA 4WUUA 4N5EA 3CVHA 3QQ3A 3KPMA 4X6DA 4PJEA 1OGAA 3PWNA 3T8XA 2ZSWA 3RWDA 1JGDA 1I7UA 1FO0H 3MRJA 4JFQA 4U1MA 1WBYA 5FA3A 1N2RA 4D0DA 4D0BA 3FT4A 1BD2A 3QFJA 2CKBH 3BUYA 4U1JA 2VABA 1T1YA 3I6LD 3VXMA 3RWJA 3SKOA 3DX6A 4PJDA 4L9LC 3BZEA 4E5XA 1KJMA 5HGBA 5J1AA 1I7TA 3BH8A 1AGEA 1ZAGA 3FT2A 5EU4A 3LN5A 2NX5A 3WS3A 4E0RA 4WO4A 1DDHA 4JRYA 5MEPA 3PABA 1I1YA 2BSTA 3MA7A 3FQXA 1T7ZA 3X11A 1GZPA 4WDIA 1NAMH 3ILQC 4S0UC 4F7TA 3KYNA 2CLVA 3HE6A 2BSRA 3GSVA 3P4OA 1W0VA 4NO2A 4PJHA 1KTLA 3FQWA 5D2LA 5F1IA 3REWA 3S6CA 3V5KA 3VXOA 4F7PA 4MJIA 3RL2A 4I4WA 3FQUA 3QEQA 2PYEA 5C0IA 2BCKA 4HX1A 3VWKA 1CG9A 1JPGA 4LNRA 3UPRA 4ZUTA 1QSFA 3LKPA 3L3DA 4K71B 3GSNH 3PWJA 3MRFA 3I6KA 5C0CA 4FTVA 2V2XA 3LN4A 2X4TA 3MRHA 4MXQA 4PG2A 2BVQA 1Z5LA 1S9XA 4UQ3A 1XR9A 5E8OA 3MYJA 3FONA 2DYPA 3JVGA 4PV9A 3GIVA 4PJBA 1T7XA 1G7QA 2AV1A 5HHOA 3TIEA 1AGBA 3I6GA 3ARGA 3UBXA 3VJ6A 3BO8A 4LHUA 3PWPA 1JUFA 2GTWA 1TVBA 4PJ8A 2XPGA 3M1BA 4JFOA 4O2FA 4PRDA 3VFSA 3QUZA 1ONQA 3BGMA 3GMPA 1SYVA 4PDCE 4PRBA 1OF2A 1YN6A 5HGDA 2VLRA 4MS8A 3IT8D 4JFDA 4N0CA 3VH8A 2FO4A 3VXPA 1M05A 1T0MA 2BNQA 3MRLA 3O3EA 4QRQA 1HHKA 3FTGA 2CLRA 3ARDA 1MHEA 2D31A 3PWLA 3RGVC 3QI9A 2E7LE 1S7XA 1RJZA 2X4NA 5FA4A 4GKNA 1T0NA 3VXUA 4MNQA 1HHJA 1S7WA 3L3HA 4PGEA 3I0TA 4ZUSA 4G42A
chains in the Genus database with same CATH topology
3TIDA 5EO1A 2AXGA 4O2EA 1DUYA 3M17A 2X4SA 1ED3A 3GMOA 4IIQC 4NQCA 1QR1A 3FQTA 3AM8A 3LKSA 1CD1A 3E6HA 1DE4A 1T20A 4JFFA 2X4QA 3C9NA 1X7QA 5EU6A 3VFNA 5DEFA 5GSVA 5HYJA 3RL1A 3MRGA 4L8SC 1A1MA 3CC5A 5D2NA 4JQXA 3LKOA 4IHOA 2OI9A 4QOKA 4PJCA 3B6SA 4LCWA 4NNYA 3HUJA 4ZUVA 5ENWA 1I1AA 1YDPA 3BW9A 3CH1A 2X4UA 5C07A 4N0UA 3MGOA 3VFWA 3V5DA 4X6FA 5IVXA 4HUXA 1GZQA 4U1LA 2V2WA 5EOTA 3U0PA 3MREA 3DXAA 5D7LA 1AO7A 2RFXA 4NQVA 4Y2DA 3MGTA 1S9WA 5HGHA 1ZT1A 3V5HA 1QSEA 1MWAH 4Y4HA 2F54A 5F7DA 3MRPA 2GAZA 1VGKA 3KWWA 4QRPA 1AGFA 2P5EA 3HLAA 3KPOA 1VACA 4L3EA 3OX8A 4L4VA 3RWEA 3FFCA 5EU5A 3SDAA 1QEWA 5E6IC 5C0DA 4NQDA 3WUWA 2HN7A 3KPNA 3D39A 3KXFA 2JCCA 1LEKA 5ACZA 1S7TA 3UTTA 1QQDA 3HG1A 3GMQA 1S9YA 4PJXA 2CLZA 4PREA 3DX8A 3KLAA 1ZVSA 2Q7YA 3X14A 4PG9A 4ELMA 3RTQA 5EFIA 3SJVA 1R3HA 2VLLA 1FFOA 4U1HA 1DUZA 5C08A 1S7QA 4G8GA 5IM7A 1LQVA 4JRXA 3MRIA 3TBTA 4JFEA 5FKPA 3L3IA 1A6ZA 5IB2A 1B3JA 3FRUA 4EN3C 3GSWA 5C0FA 1AKJA 5C0JA 4Y4KA 1HSAA 4PRHA 3ARBA 3E2HA 4WW2C 4XXCA 5INDA 4PJ5A 5DDHA 4NSKA 3DBXA 4V3DB 1TVHA 2FZ3A 1W0WA 1LDPH 3TA3A 4PR5A 5E00A 3TBVA 3PQYA 3GMMA 5L2JA 3KPQA 1W72A 3FOLA 3FQRA 5HHPA 4L8BA 5B38A 2UWEA 4Z78A 4QRTA 3MRMA 3DTXA 4Z77A 1HHHA 4NNXA 1YPZA 3LKNA 4PJAA 2CIKA 3ROOA 2FWOA 3P4NA 3RWFA 3VXNA 1WBXA 4CW1A 3KYOA 1EEYA 1LP9A 3QZWA 3ERYA 4X6CA 1LEGA 3TN0A 3P4MA 1VADA 1T7YA 2P5WA 3UTSA 2X4PA 1P4LA 4X6EA 1KCGC 3O3DA 1Q94A 4G8IA 5IEKA 2GUOA 3VFVA 3D25A 3QFDA 1XZ0A 4U1NA 3GMRA 3CCHA 4ZUWA 1JF1A 1IM3A 4JQVA 3RWHA 1P7QA 3W0WA 3MRNA 1A9BA 4CVXA 3GSUA 3QUYA 3LKQA 3BP4A 4JFPA 3TBSA 3GMNA 1KBGH 1I7RA 1L8JA 1QLFA 3OV6A 1T1XA 5H94A 3O8XA 4NO0A 4LCCC 3X12A 5ISZA 5IB1A 1TMCA 3P9MA 1FFNA 5BJTA 2VE6A 4HV8A 2CIIA 1B0RA 3O3AA 4MNGA 4PJFA 5EO0A 2GITA 3SDDA 4CVZA 5BS0A 2BNRA 4PJ7A 3E3QA 1QVOA 1T7VA 3TF7A 5C9JA 5J6GA 1C16A 3OXRA 5C0EA 3VFUA 4PJIA 5JHDA 3FOMA 1BZ9A 4MJ6A 4ZAKA 3B3IA 3KPRA 3SPVA 3DX7A 4L3CA 1FFPA 4G9FA 4PGCA 3QDJA 5L2KA 1RK0A 3JTSA 1MHCA 4N0FA 1UXSA 3LV3A 5C09A 1NANH 3IXAA 4Z76A 1K5NA 3HE7A 2VAAA 1HHGA 1N59A 3C8KA 1QRNA 4NT6A 1ZT7A 2FIKA 5EUOA 5IEHA 3TFKA 5C0BA 1AGDA 4K7FA 4WU5A 3QDGA 1KPVA 3HPJA 2J8UA 1XH3A 4F7MA 3H7BA 1OGTA 1A9EA 3AU1A 3TO4A 3LKRA 4QRSA 2H6PA 3CDGA 4F7CA 1ZSDA 4PRNA 3L3JA 4Y16A 5SWQA 3MRBA 5GSRA 3PWUA 4LCYA 4ZUUA 2MHAA 5BRZA 5J6HA 5MEQA 4F7EA 3QUKA 3GMLA 1HHIA 3BVNA 1ZS8A 1S7SA 2ZSVA 1JGEA 3O4LA 3WLBA 5D7IA 4PJ9A 5SWSA 4PRPA 1N3NA 2GT9A 3HAEA 3RWGA 1HYRC 1KPUA 2AXFA 2YPLA 3CPLA 2C7UA 3TO2A 4HKJA 4PJGA 3TBYA 3BXNA 3VFPA 1OSZA 2X4RA 2X4OA 4Y4FA 3ES6A 1PQZA 3MR9A 4QRUA 5D9SA 4FFEX 4NO3A 1EXUA 3VFOA 3GJFA 1E27A 1FG2A 3BH9A 2X70A 2BVOA 3FT3A 1JPFA 5HHMA 3QDMA 4L29A 5D7JC 2ZOKA 3FQNA 4PGBA 3JTTA 4G59A 3MRQA 3BP7A 2HLAA 3SCMA 1KPRA 2GJ6A 3DMMA 2ESVA 3HCVA 3MRKA 3VWJA 3P9LA 3VFTA 1T1ZA 1FZMA 3UTQA 3RWIA 5AD0A 4QRRA 1EFXA 2A83A 1XR8A 3L9RA 5C0AA 5E8PA 4N8VA 2YPKA 3MRRA 4NQXA 3VXSA 3D18A 1I1FA 1NEZA 4ZFZA 5HHQA 4ONOA 1FZOA 5IROA 3MV7A 2NW3A 1BIIA 1BQHA 1K8DA 2AV7A 2OL3H 4HS3A 2ZOLA 3VCLA 5MERA 2WY3A 1EEZA 4PGDA 3VFRA 3L3KA 3GSOA 1ZHLA 1ZT4A 3X13A 2VLJA 5E9DA 5F9JA 3KPSA 4NHUE 4U1SA 4WJ5A 4WWKC 3QULA 3WS6A 1AGCA 3MV9A 4PP8C 4U6XA 3MROA 2AKRA 1HSBA 5INCA 1CE6A 1KJVA 1A1NA 4L8DA 3VFMA 3WL9A 3L3GA 1FZJA 2VLKA 3SKMA 4U6YA 4G43A 3RZCA 4IRSA 3P77A 3MV8A 1QO3A 4MJ5A 1KJ3H 3P73A 3SDXA 1P1ZA 4WU7A 2FYYA 1LK2A 3QUXA 3NFNA 1RK1A 3O9WA 1M6OA 1YN7A 3G08A 1JE6A 1JFMA 3BEVA 4NQEA 5HGAA 4O2CA 3TJHA 4U1IA 1T80A 3H9HA 4UQ2A 1N5AA 3AREA 1IM9A 1S7RA 3H9SA 3W39A 1G7PA 2AK4A 3GSXA 3D3VA 4IRJA 1U58A 2XFXA 3ARFA 3MRCA 3SDCA 3GSQA 3RUGA 1S7VA 3KPPA 4D0CA 1INQA 1JHTA 1ZHBA 4I48A 4MVBA 4MQ7A 1A1OA 3VRIA 1WBZA 1S7UA 4PRAA 3MRDA 3QQ4A 5EU3A 1RJYA 2H26A 4EUPA 2F53A 1SYSA 2PO6A 2GTZA 1UQSA 4PRIA 4HUUA 1E28A 3ECBA 3OXSA 5B39A 3BWAA 3O3BA 5C0GA 4GKSA 2YEZA 1G6RH 3PWVA 3TVMA 5D5MA 2F74A 3RWCA 3T1FA 1KJ2H 3BHBA 1HOCA 1I4FA 1ZHNA 1B0GA 2HJLA 5E8NA 4U1KA 3TZVC 1T7WA 5FDWA 5MEOA 4L4TA 3ILPA 4NO5A 5IB4A 1S8DA 4L8CA 3JTCA 5F1NA 1T1WA 3D2UA 3VRJA 2HJKA 2BSSA 1MI5A 2BVPA 1LD9A 3KPLA 5BXFA 3E6FA 5IB5A 1T21A 3VXRA 3BEWA 1UXWA 5MENA 4HUWA 4V3EB 4PV8A 3CZFA 1FZKA 1ZHKA 4APQA 4MX7A 5SWZA 3TBWA 4EI5A 5DEGA 3BZFA 5HHNA 1T22A 4HWZA 4GUPA 4G9DA 3TPUE 4HUVA 3ROLA 3GSRA 4WUUA 4N5EA 3CVHA 3QQ3A 3KPMA 4X6DA 4PJEA 1OGAA 3PWNA 3T8XA 2ZSWA 3RWDA 1JGDA 1I7UA 1FO0H 3MRJA 4JFQA 4U1MA 1WBYA 5FA3A 1N2RA 4D0DA 4D0BA 3FT4A 1BD2A 3QFJA 2CKBH 3BUYA 4U1JA 2VABA 1T1YA 3I6LD 3VXMA 3RWJA 3SKOA 3DX6A 4PJDA 4L9LC 3BZEA 4E5XA 1KJMA 5HGBA 5J1AA 1I7TA 3BH8A 1AGEA 1ZAGA 3FT2A 5EU4A 3LN5A 2NX5A 3WS3A 4E0RA 4WO4A 1DDHA 4JRYA 5MEPA 3PABA 1I1YA 2BSTA 3MA7A 3FQXA 1T7ZA 3X11A 1GZPA 4WDIA 1NAMH 3ILQC 4S0UC 4F7TA 3KYNA 2CLVA 3HE6A 2BSRA 3GSVA 3P4OA 1W0VA 4NO2A 4PJHA 1KTLA 3FQWA 5D2LA 5F1IA 3REWA 3S6CA 3V5KA 3VXOA 4F7PA 4MJIA 3RL2A 4I4WA 3FQUA 3QEQA 2PYEA 5C0IA 2BCKA 4HX1A 3VWKA 1CG9A 1JPGA 4LNRA 3UPRA 4ZUTA 1QSFA 3LKPA 3L3DA 4K71B 3GSNH 3PWJA 3MRFA 3I6KA 5C0CA 4FTVA 2V2XA 3LN4A 2X4TA 3MRHA 4MXQA 4PG2A 2BVQA 1Z5LA 1S9XA 4UQ3A 1XR9A 5E8OA 3MYJA 3FONA 2DYPA 3JVGA 4PV9A 3GIVA 4PJBA 1T7XA 1G7QA 2AV1A 5HHOA 3TIEA 1AGBA 3I6GA 3ARGA 3UBXA 3VJ6A 3BO8A 4LHUA 3PWPA 1JUFA 2GTWA 1TVBA 4PJ8A 2XPGA 3M1BA 4JFOA 4O2FA 4PRDA 3VFSA 3QUZA 1ONQA 3BGMA 3GMPA 1SYVA 4PDCE 4PRBA 1OF2A 1YN6A 5HGDA 2VLRA 4MS8A 3IT8D 4JFDA 4N0CA 3VH8A 2FO4A 3VXPA 1M05A 1T0MA 2BNQA 3MRLA 3O3EA 4QRQA 1HHKA 3FTGA 2CLRA 3ARDA 1MHEA 2D31A 3PWLA 3RGVC 3QI9A 2E7LE 1S7XA 1RJZA 2X4NA 5FA4A 4GKNA 1T0NA 3VXUA 4MNQA 1HHJA 1S7WA 3L3HA 4PGEA 5IB3A 4ZUSA 4G42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TID A;  5EO1 A;  2AXG A;  4O2E A;  1DUY A;  3M17 A;  2X4S A;  1ED3 A;  3GMO A;  4IIQ C;  4NQC A;  1QR1 A;  3FQT A;  3AM8 A;  3LKS A;  1CD1 A;  3E6H A;  1DE4 A;  1T20 A;  4JFF A;  2X4Q A;  3C9N A;  1X7Q A;  5EU6 A;  3VFN A;  5DEF A;  5GSV A;  5HYJ A;  3RL1 A;  3MRG A;  4L8S C;  1A1M A;  3CC5 A;  5D2N A;  4JQX A;  3LKO A;  4IHO A;  2OI9 A;  4QOK A;  4PJC A;  3B6S A;  4LCW A;  4NNY A;  3HUJ A;  4ZUV A;  5ENW A;  1I1A A;  1YDP A;  3BW9 A;  3CH1 A;  2X4U A;  5C07 A;  4N0U A;  3MGO A;  3VFW A;  3V5D A;  4X6F A;  5IVX A;  4HUX A;  1GZQ A;  4U1L A;  2V2W A;  5EOT A;  3U0P A;  3MRE A;  3DXA A;  5D7L A;  1AO7 A;  2RFX A;  4NQV A;  4Y2D A;  3MGT A;  1S9W A;  5HGH A;  1ZT1 A;  3V5H A;  1QSE A;  1MWA H;  4Y4H A;  2F54 A;  5F7D A;  3MRP A;  2GAZ A;  1VGK A;  3KWW A;  4QRP A;  1AGF A;  2P5E A;  3HLA A;  3KPO A;  1VAC A;  4L3E A;  3OX8 A;  4L4V A;  3RWE A;  3FFC A;  5EU5 A;  3SDA A;  1QEW A;  5E6I C;  5C0D A;  4NQD A;  3WUW A;  2HN7 A;  3KPN A;  3D39 A;  3KXF A;  2JCC A;  1LEK A;  5ACZ A;  1S7T A;  3UTT A;  1QQD A;  3HG1 A;  3GMQ A;  1S9Y A;  4PJX A;  2CLZ A;  4PRE A;  3DX8 A;  3KLA A;  1ZVS A;  2Q7Y A;  3X14 A;  4PG9 A;  4ELM A;  3RTQ A;  5EFI A;  3SJV A;  1R3H A;  2VLL A;  1FFO A;  4U1H A;  1DUZ A;  5C08 A;  1S7Q A;  4G8G A;  5IM7 A;  1LQV A;  4JRX A;  3MRI A;  3TBT A;  4JFE A;  5FKP A;  3L3I A;  1A6Z A;  5IB2 A;  1B3J A;  3FRU A;  4EN3 C;  3GSW A;  5C0F A;  1AKJ A;  5C0J A;  4Y4K A;  1HSA A;  4PRH A;  3ARB A;  3E2H A;  4WW2 C;  4XXC A;  5IND A;  4PJ5 A;  5DDH A;  4NSK A;  3DBX A;  4V3D B;  1TVH A;  2FZ3 A;  1W0W A;  1LDP H;  3TA3 A;  4PR5 A;  5E00 A;  3TBV A;  3PQY A;  3GMM A;  5L2J A;  3KPQ A;  1W72 A;  3FOL A;  3FQR A;  5HHP A;  4L8B A;  5B38 A;  2UWE A;  4Z78 A;  4QRT A;  3MRM A;  3DTX A;  4Z77 A;  1HHH A;  4NNX A;  1YPZ A;  3LKN A;  4PJA A;  2CIK A;  3ROO A;  2FWO A;  3P4N A;  3RWF A;  3VXN A;  1WBX A;  4CW1 A;  3KYO A;  1EEY A;  1LP9 A;  3QZW A;  3ERY A;  4X6C A;  1LEG A;  3TN0 A;  3P4M A;  1VAD A;  1T7Y A;  2P5W A;  3UTS A;  2X4P A;  1P4L A;  4X6E A;  1KCG C;  3O3D A;  1Q94 A;  4G8I A;  5IEK A;  2GUO A;  3VFV A;  3D25 A;  3QFD A;  1XZ0 A;  4U1N A;  3GMR A;  3CCH A;  4ZUW A;  1JF1 A;  1IM3 A;  4JQV A;  3RWH A;  1P7Q A;  3W0W A;  3MRN A;  1A9B A;  4CVX A;  3GSU A;  3QUY A;  3LKQ A;  3BP4 A;  4JFP A;  3TBS A;  3GMN A;  1KBG H;  1I7R A;  1L8J A;  1QLF A;  3OV6 A;  1T1X A;  5H94 A;  3O8X A;  4NO0 A;  4LCC C;  3X12 A;  5ISZ A;  5IB1 A;  1TMC A;  3P9M A;  1FFN A;  5BJT A;  2VE6 A;  4HV8 A;  2CII A;  1B0R A;  3O3A A;  4MNG A;  4PJF A;  5EO0 A;  2GIT A;  3SDD A;  4CVZ A;  5BS0 A;  2BNR A;  4PJ7 A;  3E3Q A;  1QVO A;  1T7V A;  3TF7 A;  5C9J A;  5J6G A;  1C16 A;  3OXR A;  5C0E A;  3VFU A;  4PJI A;  5JHD A;  3FOM A;  1BZ9 A;  4MJ6 A;  4ZAK A;  3B3I A;  3KPR A;  3SPV A;  3DX7 A;  4L3C A;  1FFP A;  4G9F A;  4PGC A;  3QDJ A;  5L2K A;  1RK0 A;  3JTS A;  1MHC A;  4N0F A;  1UXS A;  3LV3 A;  5C09 A;  1NAN H;  3IXA A;  4Z76 A;  1K5N A;  3HE7 A;  2VAA A;  1HHG A;  1N59 A;  3C8K A;  1QRN A;  4NT6 A;  1ZT7 A;  2FIK A;  5EUO A;  5IEH A;  3TFK A;  5C0B A;  1AGD A;  4K7F A;  4WU5 A;  3QDG A;  1KPV A;  3HPJ A;  2J8U A;  1XH3 A;  4F7M A;  3H7B A;  1OGT A;  1A9E A;  3AU1 A;  3TO4 A;  3LKR A;  4QRS A;  2H6P A;  3CDG A;  4F7C A;  1ZSD A;  4PRN A;  3L3J A;  4Y16 A;  5SWQ A;  3MRB A;  5GSR A;  3PWU A;  4LCY A;  4ZUU A;  2MHA A;  5BRZ A;  5J6H A;  5MEQ A;  4F7E A;  3QUK A;  3GML A;  1HHI A;  3BVN A;  1ZS8 A;  1S7S A;  2ZSV A;  1JGE A;  3O4L A;  3WLB A;  5D7I A;  4PJ9 A;  5SWS A;  4PRP A;  1N3N A;  2GT9 A;  3HAE A;  3RWG A;  1HYR C;  1KPU A;  2AXF A;  2YPL A;  3CPL A;  2C7U A;  3TO2 A;  4HKJ A;  4PJG A;  3TBY A;  3BXN A;  3VFP A;  1OSZ A;  2X4R A;  2X4O A;  4Y4F A;  3ES6 A;  1PQZ A;  3MR9 A;  4QRU A;  5D9S A;  4FFE X;  4NO3 A;  1EXU A;  3VFO A;  3GJF A;  1E27 A;  1FG2 A;  3BH9 A;  2X70 A;  2BVO A;  3FT3 A;  1JPF A;  5HHM A;  3QDM A;  4L29 A;  5D7J C;  2ZOK A;  3FQN A;  4PGB A;  3JTT A;  4G59 A;  3MRQ A;  3BP7 A;  2HLA A;  3SCM A;  1KPR A;  2GJ6 A;  3DMM A;  2ESV A;  3HCV A;  3MRK A;  3VWJ A;  3P9L A;  3VFT A;  1T1Z A;  1FZM A;  3UTQ A;  3RWI A;  5AD0 A;  4QRR A;  1EFX A;  2A83 A;  1XR8 A;  3L9R A;  5C0A A;  5E8P A;  4N8V A;  2YPK A;  3MRR A;  4NQX A;  3VXS A;  3D18 A;  1I1F A;  1NEZ A;  4ZFZ A;  5HHQ A;  4ONO A;  1FZO A;  5IRO A;  3MV7 A;  2NW3 A;  1BII A;  1BQH A;  1K8D A;  2AV7 A;  2OL3 H;  4HS3 A;  2ZOL A;  3VCL A;  5MER A;  2WY3 A;  1EEZ A;  4PGD A;  3VFR A;  3L3K A;  3GSO A;  1ZHL A;  1ZT4 A;  3X13 A;  2VLJ A;  5E9D A;  5F9J A;  3KPS A;  4NHU E;  4U1S A;  4WJ5 A;  4WWK C;  3QUL A;  3WS6 A;  1AGC A;  3MV9 A;  4PP8 C;  4U6X A;  3MRO A;  2AKR A;  1HSB A;  5INC A;  1CE6 A;  1KJV A;  1A1N A;  4L8D A;  3VFM A;  3WL9 A;  3L3G A;  1FZJ A;  2VLK A;  3SKM A;  4U6Y A;  4G43 A;  3RZC A;  4IRS A;  3P77 A;  3MV8 A;  1QO3 A;  4MJ5 A;  1KJ3 H;  3P73 A;  3SDX A;  1P1Z A;  4WU7 A;  2FYY A;  1LK2 A;  3QUX A;  3NFN A;  1RK1 A;  3O9W A;  1M6O A;  1YN7 A;  3G08 A;  1JE6 A;  1JFM A;  3BEV A;  4NQE A;  5HGA A;  4O2C A;  3TJH A;  4U1I A;  1T80 A;  3H9H A;  4UQ2 A;  1N5A A;  3ARE A;  1IM9 A;  1S7R A;  3H9S A;  3W39 A;  1G7P A;  2AK4 A;  3GSX A;  3D3V A;  4IRJ A;  1U58 A;  2XFX A;  3ARF A;  3MRC A;  3SDC A;  3GSQ A;  3RUG A;  1S7V A;  3KPP A;  4D0C A;  1INQ A;  1JHT A;  1ZHB A;  4I48 A;  4MVB A;  4MQ7 A;  1A1O A;  3VRI A;  1WBZ A;  1S7U A;  4PRA A;  3MRD A;  3QQ4 A;  5EU3 A;  1RJY A;  2H26 A;  4EUP A;  2F53 A;  1SYS A;  2PO6 A;  2GTZ A;  1UQS A;  4PRI A;  4HUU A;  1E28 A;  3ECB A;  3OXS A;  5B39 A;  3BWA A;  3O3B A;  5C0G A;  4GKS A;  2YEZ A;  1G6R H;  3PWV A;  3TVM A;  5D5M A;  2F74 A;  3RWC A;  3T1F A;  1KJ2 H;  3BHB A;  1HOC A;  1I4F A;  1ZHN A;  1B0G A;  2HJL A;  5E8N A;  4U1K A;  3TZV C;  1T7W A;  5FDW A;  5MEO A;  4L4T A;  3ILP A;  4NO5 A;  5IB4 A;  1S8D A;  4L8C A;  3JTC A;  5F1N A;  1T1W A;  3D2U A;  3VRJ A;  2HJK A;  2BSS A;  1MI5 A;  2BVP A;  1LD9 A;  3KPL A;  5BXF A;  3E6F A;  5IB5 A;  1T21 A;  3VXR A;  3BEW A;  1UXW A;  5MEN A;  4HUW A;  4V3E B;  4PV8 A;  3CZF A;  1FZK A;  1ZHK A;  4APQ A;  4MX7 A;  5SWZ A;  3TBW A;  4EI5 A;  5DEG A;  3BZF A;  5HHN A;  1T22 A;  4HWZ A;  4GUP A;  4G9D A;  3TPU E;  4HUV A;  3ROL A;  3GSR A;  4WUU A;  4N5E A;  3CVH A;  3QQ3 A;  3KPM A;  4X6D A;  4PJE A;  1OGA A;  3PWN A;  3T8X A;  2ZSW A;  3RWD A;  1JGD A;  1I7U A;  1FO0 H;  3MRJ A;  4JFQ A;  4U1M A;  1WBY A;  5FA3 A;  1N2R A;  4D0D A;  4D0B A;  3FT4 A;  1BD2 A;  3QFJ A;  2CKB H;  3BUY A;  4U1J A;  2VAB A;  1T1Y A;  3I6L D;  3VXM A;  3RWJ A;  3SKO A;  3DX6 A;  4PJD A;  4L9L C;  3BZE A;  4E5X A;  1KJM A;  5HGB A;  5J1A A;  1I7T A;  3BH8 A;  1AGE A;  1ZAG A;  3FT2 A;  5EU4 A;  3LN5 A;  2NX5 A;  3WS3 A;  4E0R A;  4WO4 A;  1DDH A;  4JRY A;  5MEP A;  3PAB A;  1I1Y A;  2BST A;  3MA7 A;  3FQX A;  1T7Z A;  3X11 A;  1GZP A;  4WDI A;  1NAM H;  3ILQ C;  4S0U C;  4F7T A;  3KYN A;  2CLV A;  3HE6 A;  2BSR A;  3GSV A;  3P4O A;  1W0V A;  4NO2 A;  4PJH A;  1KTL A;  3FQW A;  5D2L A;  5F1I A;  3REW A;  3S6C A;  3V5K A;  3VXO A;  4F7P A;  4MJI A;  3RL2 A;  4I4W A;  3FQU A;  3QEQ A;  2PYE A;  5C0I A;  2BCK A;  4HX1 A;  3VWK A;  1CG9 A;  1JPG A;  4LNR A;  3UPR A;  4ZUT A;  1QSF A;  3LKP A;  3L3D A;  4K71 B;  3GSN H;  3PWJ A;  3MRF A;  3I6K A;  5C0C A;  4FTV A;  2V2X A;  3LN4 A;  2X4T A;  3MRH A;  4MXQ A;  4PG2 A;  2BVQ A;  1Z5L A;  1S9X A;  4UQ3 A;  1XR9 A;  5E8O A;  3MYJ A;  3FON A;  2DYP A;  3JVG A;  4PV9 A;  3GIV A;  4PJB A;  1T7X A;  1G7Q A;  2AV1 A;  5HHO A;  3TIE A;  1AGB A;  3I6G A;  3ARG A;  3UBX A;  3VJ6 A;  3BO8 A;  4LHU A;  3PWP A;  1JUF A;  2GTW A;  1TVB A;  4PJ8 A;  2XPG A;  3M1B A;  4JFO A;  4O2F A;  4PRD A;  3VFS A;  3QUZ A;  1ONQ A;  3BGM A;  3GMP A;  1SYV A;  4PDC E;  4PRB A;  1OF2 A;  1YN6 A;  5HGD A;  2VLR A;  4MS8 A;  3IT8 D;  4JFD A;  4N0C A;  3VH8 A;  2FO4 A;  3VXP A;  1M05 A;  1T0M A;  2BNQ A;  3MRL A;  3O3E A;  4QRQ A;  1HHK A;  3FTG A;  2CLR A;  3ARD A;  1MHE A;  2D31 A;  3PWL A;  3RGV C;  3QI9 A;  2E7L E;  1S7X A;  1RJZ A;  2X4N A;  5FA4 A;  4GKN A;  1T0N A;  3VXU A;  4MNQ A;  1HHJ A;  1S7W A;  3L3H A;  4PGE A;  5IB3 A;  4ZUS A;  4G42 A; 
#chains in the Genus database with same CATH topology
 3TID A;  5EO1 A;  2AXG A;  4O2E A;  1DUY A;  3M17 A;  2X4S A;  1ED3 A;  3GMO A;  4IIQ C;  4NQC A;  1QR1 A;  3FQT A;  3AM8 A;  3LKS A;  1CD1 A;  3E6H A;  1DE4 A;  1T20 A;  4JFF A;  2X4Q A;  3C9N A;  1X7Q A;  4JO8 A;  5EU6 A;  3VFN A;  5DEF A;  5GSV A;  5HYJ A;  3RL1 A;  3MRG A;  4L8S C;  1A1M A;  3CC5 A;  5D2N A;  4JQX A;  3LKO A;  4IHO A;  2OI9 A;  4QOK A;  4PJC A;  3B6S A;  4LCW A;  4NNY A;  3HUJ A;  4ZUV A;  5ENW A;  1I1A A;  1YDP A;  3BW9 A;  3CH1 A;  2X4U A;  2IA1 A;  4N0U A;  5C07 A;  3MGO A;  3VFW A;  3V5D A;  4X6F A;  5IVX A;  4HUX A;  1GZQ A;  4U1L A;  2V2W A;  5EOT A;  3U0P A;  3MRE A;  3DXA A;  5D7L A;  1AO7 A;  2RFX A;  4NQV A;  4Y2D A;  3MGT A;  1S9W A;  5HGH A;  1ZT1 A;  3V5H A;  1QSE A;  1MWA H;  4Y4H A;  2F54 A;  5F7D A;  3MRP A;  2GAZ A;  1VGK A;  3KWW A;  4QRP A;  1AGF A;  2P5E A;  3HLA A;  3KPO A;  1VAC A;  4L3E A;  3OX8 A;  4L4V A;  3RWE A;  3FFC A;  5EU5 A;  3SDA A;  1QEW A;  5E6I C;  5C0D A;  4NQD A;  3WUW A;  2HN7 A;  3KPN A;  3D39 A;  3KXF A;  2JCC A;  4G59 C;  1LEK A;  5ACZ A;  1S7T A;  3UTT A;  1QQD A;  3HG1 A;  3GMQ A;  1S9Y A;  4PJX A;  2CLZ A;  4PRE A;  3DX8 A;  3KLA A;  1ZVS A;  2Q7Y A;  3X14 A;  4PG9 A;  4ELM A;  3RTQ A;  5EFI A;  3SJV A;  1R3H A;  2VLL A;  1FFO A;  4U1H A;  1DUZ A;  5C08 A;  1S7Q A;  4G8G A;  5IM7 A;  1LQV A;  4JRX A;  3MRI A;  3TBT A;  4JFE A;  5FKP A;  3L3I A;  1A6Z A;  5IB2 A;  1B3J A;  3FRU A;  4EN3 C;  3GSW A;  5C0F A;  1AKJ A;  5C0J A;  4Y4K A;  1HSA A;  4PRH A;  3ARB A;  3E2H A;  4WW2 C;  4XXC A;  5IND A;  4PJ5 A;  5DDH A;  4NSK A;  3DBX A;  4V3D B;  1TVH A;  2FZ3 A;  1W0W A;  1LDP H;  3TA3 A;  4PR5 A;  5E00 A;  3TBV A;  3PQY A;  3GMM A;  5L2J A;  3KPQ A;  1W72 A;  2O5N A;  3FOL A;  3FQR A;  5HHP A;  4L8B A;  5B38 A;  2UWE A;  4Z78 A;  4QRT A;  3MRM A;  3DTX A;  4Z77 A;  1HHH A;  4NNX A;  1YPZ A;  3LKN A;  4PJA A;  2CIK A;  3ROO A;  2FWO A;  3P4N A;  3RWF A;  3VXN A;  1WBX A;  4CW1 A;  3KYO A;  1EEY A;  1LP9 A;  3QZW A;  3ERY A;  4X6C A;  1LEG A;  3TN0 A;  3P4M A;  1VAD A;  1T7Y A;  2P5W A;  3UTS A;  2X4P A;  1P4L A;  4X6E A;  1KCG C;  3O3D A;  1Q94 A;  4G8I A;  5IEK A;  2GUO A;  3VFV A;  3D25 A;  3QFD A;  1XZ0 A;  4U1N A;  3GMR A;  3CCH A;  4ZUW A;  1JF1 A;  1IM3 A;  4JQV A;  3RWH A;  1P7Q A;  3W0W A;  3MRN A;  1A9B A;  4CVX A;  3GSU A;  3QUY A;  3LKQ A;  3BP4 A;  4JFP A;  3TBS A;  3GMN A;  1KBG H;  1I7R A;  1L8J A;  1QLF A;  3OV6 A;  1T1X A;  5H94 A;  3O8X A;  4NO0 A;  4LCC C;  3X12 A;  5ISZ A;  5IB1 A;  1TMC A;  3P9M A;  1FFN A;  5BJT A;  2VE6 A;  4HV8 A;  2CII A;  1B0R A;  3O3A A;  4MNG A;  4PJF A;  5EO0 A;  2GIT A;  3SDD A;  4CVZ A;  5BS0 A;  2BNR A;  4PJ7 A;  3E3Q A;  1QVO A;  1T7V A;  3TF7 A;  5C9J A;  5J6G A;  1C16 A;  3OXR A;  5C0E A;  3VFU A;  4PJI A;  5JHD A;  3FOM A;  1BZ9 A;  4MJ6 A;  4ZAK A;  3B3I A;  3KPR A;  3SPV A;  3DX7 A;  4L3C A;  1FFP A;  4G9F A;  4PGC A;  3QDJ A;  5L2K A;  1RK0 A;  3JTS A;  4BKW A;  1MHC A;  4N0F A;  1UXS A;  3LV3 A;  5C09 A;  1NAN H;  3IXA A;  4Z76 A;  1K5N A;  3HE7 A;  2VAA A;  1HHG A;  1N59 A;  3C8K A;  1QRN A;  4NT6 A;  1ZT7 A;  2FIK A;  5EUO A;  5IEH A;  3TFK A;  5C0B A;  1AGD A;  4K7F A;  4WU5 A;  3QDG A;  1KPV A;  3HPJ A;  2J8U A;  1XH3 A;  4F7M A;  3H7B A;  1OGT A;  1A9E A;  3AU1 A;  3TO4 A;  3LKR A;  4QRS A;  2H6P A;  3CDG A;  4F7C A;  1ZSD A;  4PRN A;  3L3J A;  4Y16 A;  5SWQ A;  3MRB A;  5GSR A;  3PWU A;  4LCY A;  4ZUU A;  2MHA A;  5BRZ A;  5J6H A;  5MEQ A;  4F7E A;  3QUK A;  3GML A;  1HHI A;  3BVN A;  1ZS8 A;  1S7S A;  2ZSV A;  1JGE A;  3O4L A;  3WLB A;  5D7I A;  4PJ9 A;  5SWS A;  4PRP A;  1N3N A;  2GT9 A;  3HAE A;  3RWG A;  1HYR C;  1KPU A;  2AXF A;  2YPL A;  3CPL A;  2C7U A;  3TO2 A;  4HKJ A;  4PJG A;  3TBY A;  3BXN A;  3VFP A;  1OSZ A;  2X4R A;  2X4O A;  4Y4F A;  3ES6 A;  1PQZ A;  3MR9 A;  4QRU A;  5D9S A;  4FFE X;  4NO3 A;  1EXU A;  3VFO A;  3GJF A;  1E27 A;  1FG2 A;  3BH9 A;  2X70 A;  2BVO A;  3FT3 A;  1JPF A;  5HHM A;  3QDM A;  4L29 A;  5D7J C;  2ZOK A;  3FQN A;  4PGB A;  3JTT A;  4G59 A;  3MRQ A;  3BP7 A;  2HLA A;  2NYK A;  3SCM A;  1KPR A;  2GJ6 A;  3DMM A;  2ESV A;  3HCV A;  3MRK A;  3VWJ A;  3P9L A;  3VFT A;  1T1Z A;  1FZM A;  3UTQ A;  3RWI A;  5AD0 A;  4QRR A;  1EFX A;  2A83 A;  1XR8 A;  3L9R A;  5C0A A;  5E8P A;  4N8V A;  2YPK A;  3MRR A;  4NQX A;  3VXS A;  3D18 A;  1I1F A;  1NEZ A;  4ZFZ A;  5HHQ A;  4ONO A;  1FZO A;  5IRO A;  3MV7 A;  2NW3 A;  1BII A;  1BQH A;  1K8D A;  2AV7 A;  2OL3 H;  4HS3 A;  2ZOL A;  3VCL A;  5MER A;  2WY3 A;  1EEZ A;  4PGD A;  3VFR A;  3L3K A;  3GSO A;  1ZHL A;  1ZT4 A;  3X13 A;  2VLJ A;  5E9D A;  5F9J A;  3KPS A;  4NHU E;  4U1S A;  4WJ5 A;  4WWK C;  3QUL A;  3WS6 A;  1AGC A;  3MV9 A;  4PP8 C;  4U6X A;  3MRO A;  2AKR A;  1HSB A;  5INC A;  1CE6 A;  1KJV A;  1A1N A;  4L8D A;  3VFM A;  3WL9 A;  3L3G A;  1FZJ A;  2VLK A;  3SKM A;  4U6Y A;  4G43 A;  3RZC A;  4IRS A;  3P77 A;  3MV8 A;  1QO3 A;  4MJ5 A;  1KJ3 H;  3P73 A;  3SDX A;  1P1Z A;  4WU7 A;  2FYY A;  1LK2 A;  3QUX A;  3NFN A;  1RK1 A;  3O9W A;  1M6O A;  1YN7 A;  3G08 A;  1JE6 A;  1JFM A;  3BEV A;  4NQE A;  5HGA A;  4O2C A;  3TJH A;  4U1I A;  1T80 A;  3H9H A;  4UQ2 A;  1N5A A;  3ARE A;  1IM9 A;  1S7R A;  3H9S A;  3W39 A;  1G7P A;  2AK4 A;  3GSX A;  3D3V A;  4IRJ A;  1U58 A;  2XFX A;  3ARF A;  3MRC A;  3SDC A;  3GSQ A;  3RUG A;  1S7V A;  3KPP A;  4D0C A;  1INQ A;  1JHT A;  1ZHB A;  4I48 A;  4MVB A;  4MQ7 A;  1A1O A;  3VRI A;  1WBZ A;  1S7U A;  4PRA A;  3MRD A;  3QQ4 A;  5EU3 A;  1RJY A;  2H26 A;  4EUP A;  2F53 A;  1SYS A;  2PO6 A;  2GTZ A;  1UQS A;  4PRI A;  4HUU A;  1E28 A;  3ECB A;  3OXS A;  5B39 A;  3BWA A;  3O3B A;  5C0G A;  4GKS A;  2YEZ A;  1G6R H;  3PWV A;  3TVM A;  5D5M A;  2F74 A;  3RWC A;  3T1F A;  1KJ2 H;  3BHB A;  1HOC A;  1I4F A;  1ZHN A;  1B0G A;  2HJL A;  5E8N A;  4U1K A;  3TZV C;  1T7W A;  5FDW A;  5MEO A;  4L4T A;  3ILP A;  4NO5 A;  5IB4 A;  1S8D A;  4L8C A;  3JTC A;  5F1N A;  1T1W A;  3D2U A;  3VRJ A;  2HJK A;  2BSS A;  1MI5 A;  2BVP A;  1LD9 A;  3KPL A;  5BXF A;  3E6F A;  5IB5 A;  1T21 A;  3VXR A;  3BEW A;  1UXW A;  5MEN A;  4HUW A;  4V3E B;  4PV8 A;  5IB3 A;  3CZF A;  1FZK A;  1ZHK A;  4APQ A;  4MX7 A;  5SWZ A;  3TBW A;  4EI5 A;  5DEG A;  3BZF A;  5HHN A;  1T22 A;  4HWZ A;  4GUP A;  4G9D A;  3TPU E;  4HUV A;  3ROL A;  3GSR A;  4WUU A;  4N5E A;  3CVH A;  3QQ3 A;  3KPM A;  4X6D A;  4PJE A;  1OGA A;  3PWN A;  3T8X A;  2ZSW A;  3RWD A;  1JGD A;  1I7U A;  1FO0 H;  3MRJ A;  4JFQ A;  4U1M A;  1WBY A;  5FA3 A;  1N2R A;  4D0D A;  4D0B A;  3FT4 A;  1BD2 A;  3QFJ A;  2CKB H;  3BUY A;  4U1J A;  2VAB A;  1T1Y A;  3I6L D;  3VXM A;  3RWJ A;  3SKO A;  3DX6 A;  4PJD A;  4L9L C;  3BZE A;  4E5X A;  1KJM A;  5HGB A;  5J1A A;  1I7T A;  3BH8 A;  1AGE A;  1ZAG A;  3FT2 A;  5EU4 A;  3LN5 A;  2NX5 A;  3WS3 A;  4E0R A;  4WO4 A;  1DDH A;  4JRY A;  5MEP A;  3PAB A;  1I1Y A;  2BST A;  3MA7 A;  3FQX A;  1T7Z A;  3X11 A;  1GZP A;  4WDI A;  1NAM H;  3ILQ C;  4S0U C;  4F7T A;  3KYN A;  2CLV A;  3HE6 A;  2BSR A;  3GSV A;  3P4O A;  1W0V A;  4NO2 A;  4PJH A;  1KTL A;  3FQW A;  5D2L A;  5F1I A;  3REW A;  3S6C A;  3V5K A;  3VXO A;  4F7P A;  4MJI A;  3RL2 A;  4I4W A;  3FQU A;  3QEQ A;  2PYE A;  5C0I A;  2BCK A;  4HX1 A;  3VWK A;  1CG9 A;  1JPG A;  4LNR A;  3UPR A;  4ZUT A;  1QSF A;  3LKP A;  3L3D A;  4K71 B;  3GSN H;  3PWJ A;  3MRF A;  3I6K A;  5C0C A;  4FTV A;  2V2X A;  3LN4 A;  2X4T A;  3MRH A;  4MXQ A;  4PG2 A;  2BVQ A;  1Z5L A;  1S9X A;  4UQ3 A;  1XR9 A;  5E8O A;  3MYJ A;  3FON A;  2DYP A;  3JVG A;  4PV9 A;  3GIV A;  4PJB A;  1T7X A;  1G7Q A;  2AV1 A;  5HHO A;  3TIE A;  1AGB A;  3I6G A;  3ARG A;  3UBX A;  3VJ6 A;  3BO8 A;  4LHU A;  3PWP A;  1JUF A;  2GTW A;  1TVB A;  4PJ8 A;  2XPG A;  3M1B A;  4JFO A;  4O2F A;  4PRD A;  3VFS A;  3QUZ A;  1ONQ A;  3BGM A;  3GMP A;  1SYV A;  4PDC E;  4PRB A;  1OF2 A;  1YN6 A;  5HGD A;  2VLR A;  4MS8 A;  3IT8 D;  4JFD A;  4N0C A;  3VH8 A;  2FO4 A;  3VXP A;  1M05 A;  1T0M A;  2BNQ A;  3MRL A;  3O3E A;  4QRQ A;  1HHK A;  3FTG A;  2CLR A;  3ARD A;  1MHE A;  2D31 A;  3PWL A;  3RGV C;  3QI9 A;  2E7L E;  1S7X A;  1RJZ A;  2X4N A;  5FA4 A;  4GKN A;  1T0N A;  3VXU A;  4MNQ A;  1HHJ A;  1S7W A;  3L3H A;  4PGE A;  3I0T A;  4ZUS A;  4G42 A; 
#chains in the Genus database with same CATH homology
 3TID A;  5EO1 A;  2AXG A;  4O2E A;  1DUY A;  3M17 A;  2X4S A;  1ED3 A;  3GMO A;  4IIQ C;  4NQC A;  1QR1 A;  3FQT A;  3AM8 A;  3LKS A;  1CD1 A;  3E6H A;  1DE4 A;  1T20 A;  4JFF A;  2X4Q A;  3C9N A;  1X7Q A;  5EU6 A;  3VFN A;  5DEF A;  5GSV A;  5HYJ A;  3RL1 A;  3MRG A;  4L8S C;  1A1M A;  3CC5 A;  5D2N A;  4JQX A;  3LKO A;  4IHO A;  2OI9 A;  4QOK A;  4PJC A;  3B6S A;  4LCW A;  4NNY A;  3HUJ A;  4ZUV A;  5ENW A;  1I1A A;  1YDP A;  3BW9 A;  3CH1 A;  2X4U A;  5C07 A;  4N0U A;  3MGO A;  3VFW A;  3V5D A;  4X6F A;  5IVX A;  4HUX A;  1GZQ A;  4U1L A;  2V2W A;  5EOT A;  3U0P A;  3MRE A;  3DXA A;  5D7L A;  1AO7 A;  2RFX A;  4NQV A;  4Y2D A;  3MGT A;  1S9W A;  5HGH A;  1ZT1 A;  3V5H A;  1QSE A;  1MWA H;  4Y4H A;  2F54 A;  5F7D A;  3MRP A;  2GAZ A;  1VGK A;  3KWW A;  4QRP A;  1AGF A;  2P5E A;  3HLA A;  3KPO A;  1VAC A;  4L3E A;  3OX8 A;  4L4V A;  3RWE A;  3FFC A;  5EU5 A;  3SDA A;  1QEW A;  5E6I C;  5C0D A;  4NQD A;  3WUW A;  2HN7 A;  3KPN A;  3D39 A;  3KXF A;  2JCC A;  1LEK A;  5ACZ A;  1S7T A;  3UTT A;  1QQD A;  3HG1 A;  3GMQ A;  1S9Y A;  4PJX A;  2CLZ A;  4PRE A;  3DX8 A;  3KLA A;  1ZVS A;  2Q7Y A;  3X14 A;  4PG9 A;  4ELM A;  3RTQ A;  5EFI A;  3SJV A;  1R3H A;  2VLL A;  1FFO A;  4U1H A;  1DUZ A;  5C08 A;  1S7Q A;  4G8G A;  5IM7 A;  1LQV A;  4JRX A;  3MRI A;  3TBT A;  4JFE A;  5FKP A;  3L3I A;  1A6Z A;  5IB2 A;  1B3J A;  3FRU A;  4EN3 C;  3GSW A;  5C0F A;  1AKJ A;  5C0J A;  4Y4K A;  1HSA A;  4PRH A;  3ARB A;  3E2H A;  4WW2 C;  4XXC A;  5IND A;  4PJ5 A;  5DDH A;  4NSK A;  3DBX A;  4V3D B;  1TVH A;  2FZ3 A;  1W0W A;  1LDP H;  3TA3 A;  4PR5 A;  5E00 A;  3TBV A;  3PQY A;  3GMM A;  5L2J A;  3KPQ A;  1W72 A;  3FOL A;  3FQR A;  5HHP A;  4L8B A;  5B38 A;  2UWE A;  4Z78 A;  4QRT A;  3MRM A;  3DTX A;  4Z77 A;  1HHH A;  4NNX A;  1YPZ A;  3LKN A;  4PJA A;  2CIK A;  3ROO A;  2FWO A;  3P4N A;  3RWF A;  3VXN A;  1WBX A;  4CW1 A;  3KYO A;  1EEY A;  1LP9 A;  3QZW A;  3ERY A;  4X6C A;  1LEG A;  3TN0 A;  3P4M A;  1VAD A;  1T7Y A;  2P5W A;  3UTS A;  2X4P A;  1P4L A;  4X6E A;  1KCG C;  3O3D A;  1Q94 A;  4G8I A;  5IEK A;  2GUO A;  3VFV A;  3D25 A;  3QFD A;  1XZ0 A;  4U1N A;  3GMR A;  3CCH A;  4ZUW A;  1JF1 A;  1IM3 A;  4JQV A;  3RWH A;  1P7Q A;  3W0W A;  3MRN A;  1A9B A;  4CVX A;  3GSU A;  3QUY A;  3LKQ A;  3BP4 A;  4JFP A;  3TBS A;  3GMN A;  1KBG H;  1I7R A;  1L8J A;  1QLF A;  3OV6 A;  1T1X A;  5H94 A;  3O8X A;  4NO0 A;  4LCC C;  3X12 A;  5ISZ A;  5IB1 A;  1TMC A;  3P9M A;  1FFN A;  5BJT A;  2VE6 A;  4HV8 A;  2CII A;  1B0R A;  3O3A A;  4MNG A;  4PJF A;  5EO0 A;  2GIT A;  3SDD A;  4CVZ A;  5BS0 A;  2BNR A;  4PJ7 A;  3E3Q A;  1QVO A;  1T7V A;  3TF7 A;  5C9J A;  5J6G A;  1C16 A;  3OXR A;  5C0E A;  3VFU A;  4PJI A;  5JHD A;  3FOM A;  1BZ9 A;  4MJ6 A;  4ZAK A;  3B3I A;  3KPR A;  3SPV A;  3DX7 A;  4L3C A;  1FFP A;  4G9F A;  4PGC A;  3QDJ A;  5L2K A;  1RK0 A;  3JTS A;  1MHC A;  4N0F A;  1UXS A;  3LV3 A;  5C09 A;  1NAN H;  3IXA A;  4Z76 A;  1K5N A;  3HE7 A;  2VAA A;  1HHG A;  1N59 A;  3C8K A;  1QRN A;  4NT6 A;  1ZT7 A;  2FIK A;  5EUO A;  5IEH A;  3TFK A;  5C0B A;  1AGD A;  4K7F A;  4WU5 A;  3QDG A;  1KPV A;  3HPJ A;  2J8U A;  1XH3 A;  4F7M A;  3H7B A;  1OGT A;  1A9E A;  3AU1 A;  3TO4 A;  3LKR A;  4QRS A;  2H6P A;  3CDG A;  4F7C A;  1ZSD A;  4PRN A;  3L3J A;  4Y16 A;  5SWQ A;  3MRB A;  5GSR A;  3PWU A;  4LCY A;  4ZUU A;  2MHA A;  5BRZ A;  5J6H A;  5MEQ A;  4F7E A;  3QUK A;  3GML A;  1HHI A;  3BVN A;  1ZS8 A;  1S7S A;  2ZSV A;  1JGE A;  3O4L A;  3WLB A;  5D7I A;  4PJ9 A;  5SWS A;  4PRP A;  1N3N A;  2GT9 A;  3HAE A;  3RWG A;  1HYR C;  1KPU A;  2AXF A;  2YPL A;  3CPL A;  2C7U A;  3TO2 A;  4HKJ A;  4PJG A;  3TBY A;  3BXN A;  3VFP A;  1OSZ A;  2X4R A;  2X4O A;  4Y4F A;  3ES6 A;  1PQZ A;  3MR9 A;  4QRU A;  5D9S A;  4FFE X;  4NO3 A;  1EXU A;  3VFO A;  3GJF A;  1E27 A;  1FG2 A;  3BH9 A;  2X70 A;  2BVO A;  3FT3 A;  1JPF A;  5HHM A;  3QDM A;  4L29 A;  5D7J C;  2ZOK A;  3FQN A;  4PGB A;  3JTT A;  4G59 A;  3MRQ A;  3BP7 A;  2HLA A;  3SCM A;  1KPR A;  2GJ6 A;  3DMM A;  2ESV A;  3HCV A;  3MRK A;  3VWJ A;  3P9L A;  3VFT A;  1T1Z A;  1FZM A;  3UTQ A;  3RWI A;  5AD0 A;  4QRR A;  1EFX A;  2A83 A;  1XR8 A;  3L9R A;  5C0A A;  5E8P A;  4N8V A;  2YPK A;  3MRR A;  4NQX A;  3VXS A;  3D18 A;  1I1F A;  1NEZ A;  4ZFZ A;  5HHQ A;  4ONO A;  1FZO A;  5IRO A;  3MV7 A;  2NW3 A;  1BII A;  1BQH A;  1K8D A;  2AV7 A;  2OL3 H;  4HS3 A;  2ZOL A;  3VCL A;  5MER A;  2WY3 A;  1EEZ A;  4PGD A;  3VFR A;  3L3K A;  3GSO A;  1ZHL A;  1ZT4 A;  3X13 A;  2VLJ A;  5E9D A;  5F9J A;  3KPS A;  4NHU E;  4U1S A;  4WJ5 A;  4WWK C;  3QUL A;  3WS6 A;  1AGC A;  3MV9 A;  4PP8 C;  4U6X A;  3MRO A;  2AKR A;  1HSB A;  5INC A;  1CE6 A;  1KJV A;  1A1N A;  4L8D A;  3VFM A;  3WL9 A;  3L3G A;  1FZJ A;  2VLK A;  3SKM A;  4U6Y A;  4G43 A;  3RZC A;  4IRS A;  3P77 A;  3MV8 A;  1QO3 A;  4MJ5 A;  1KJ3 H;  3P73 A;  3SDX A;  1P1Z A;  4WU7 A;  2FYY A;  1LK2 A;  3QUX A;  3NFN A;  1RK1 A;  3O9W A;  1M6O A;  1YN7 A;  3G08 A;  1JE6 A;  1JFM A;  3BEV A;  4NQE A;  5HGA A;  4O2C A;  3TJH A;  4U1I A;  1T80 A;  3H9H A;  4UQ2 A;  1N5A A;  3ARE A;  1IM9 A;  1S7R A;  3H9S A;  3W39 A;  1G7P A;  2AK4 A;  3GSX A;  3D3V A;  4IRJ A;  1U58 A;  2XFX A;  3ARF A;  3MRC A;  3SDC A;  3GSQ A;  3RUG A;  1S7V A;  3KPP A;  4D0C A;  1INQ A;  1JHT A;  1ZHB A;  4I48 A;  4MVB A;  4MQ7 A;  1A1O A;  3VRI A;  1WBZ A;  1S7U A;  4PRA A;  3MRD A;  3QQ4 A;  5EU3 A;  1RJY A;  2H26 A;  4EUP A;  2F53 A;  1SYS A;  2PO6 A;  2GTZ A;  1UQS A;  4PRI A;  4HUU A;  1E28 A;  3ECB A;  3OXS A;  5B39 A;  3BWA A;  3O3B A;  5C0G A;  4GKS A;  2YEZ A;  1G6R H;  3PWV A;  3TVM A;  5D5M A;  2F74 A;  3RWC A;  3T1F A;  1KJ2 H;  3BHB A;  1HOC A;  1I4F A;  1ZHN A;  1B0G A;  2HJL A;  5E8N A;  4U1K A;  3TZV C;  1T7W A;  5FDW A;  5MEO A;  4L4T A;  3ILP A;  4NO5 A;  5IB4 A;  1S8D A;  4L8C A;  3JTC A;  5F1N A;  1T1W A;  3D2U A;  3VRJ A;  2HJK A;  2BSS A;  1MI5 A;  2BVP A;  1LD9 A;  3KPL A;  5BXF A;  3E6F A;  5IB5 A;  1T21 A;  3VXR A;  3BEW A;  1UXW A;  5MEN A;  4HUW A;  4V3E B;  4PV8 A;  3CZF A;  1FZK A;  1ZHK A;  4APQ A;  4MX7 A;  5SWZ A;  3TBW A;  4EI5 A;  5DEG A;  3BZF A;  5HHN A;  1T22 A;  4HWZ A;  4GUP A;  4G9D A;  3TPU E;  4HUV A;  3ROL A;  3GSR A;  4WUU A;  4N5E A;  3CVH A;  3QQ3 A;  3KPM A;  4X6D A;  4PJE A;  1OGA A;  3PWN A;  3T8X A;  2ZSW A;  3RWD A;  1JGD A;  1I7U A;  1FO0 H;  3MRJ A;  4JFQ A;  4U1M A;  1WBY A;  5FA3 A;  1N2R A;  4D0D A;  4D0B A;  3FT4 A;  1BD2 A;  3QFJ A;  2CKB H;  3BUY A;  4U1J A;  2VAB A;  1T1Y A;  3I6L D;  3VXM A;  3RWJ A;  3SKO A;  3DX6 A;  4PJD A;  4L9L C;  3BZE A;  4E5X A;  1KJM A;  5HGB A;  5J1A A;  1I7T A;  3BH8 A;  1AGE A;  1ZAG A;  3FT2 A;  5EU4 A;  3LN5 A;  2NX5 A;  3WS3 A;  4E0R A;  4WO4 A;  1DDH A;  4JRY A;  5MEP A;  3PAB A;  1I1Y A;  2BST A;  3MA7 A;  3FQX A;  1T7Z A;  3X11 A;  1GZP A;  4WDI A;  1NAM H;  3ILQ C;  4S0U C;  4F7T A;  3KYN A;  2CLV A;  3HE6 A;  2BSR A;  3GSV A;  3P4O A;  1W0V A;  4NO2 A;  4PJH A;  1KTL A;  3FQW A;  5D2L A;  5F1I A;  3REW A;  3S6C A;  3V5K A;  3VXO A;  4F7P A;  4MJI A;  3RL2 A;  4I4W A;  3FQU A;  3QEQ A;  2PYE A;  5C0I A;  2BCK A;  4HX1 A;  3VWK A;  1CG9 A;  1JPG A;  4LNR A;  3UPR A;  4ZUT A;  1QSF A;  3LKP A;  3L3D A;  4K71 B;  3GSN H;  3PWJ A;  3MRF A;  3I6K A;  5C0C A;  4FTV A;  2V2X A;  3LN4 A;  2X4T A;  3MRH A;  4MXQ A;  4PG2 A;  2BVQ A;  1Z5L A;  1S9X A;  4UQ3 A;  1XR9 A;  5E8O A;  3MYJ A;  3FON A;  2DYP A;  3JVG A;  4PV9 A;  3GIV A;  4PJB A;  1T7X A;  1G7Q A;  2AV1 A;  5HHO A;  3TIE A;  1AGB A;  3I6G A;  3ARG A;  3UBX A;  3VJ6 A;  3BO8 A;  4LHU A;  3PWP A;  1JUF A;  2GTW A;  1TVB A;  4PJ8 A;  2XPG A;  3M1B A;  4JFO A;  4O2F A;  4PRD A;  3VFS A;  3QUZ A;  1ONQ A;  3BGM A;  3GMP A;  1SYV A;  4PDC E;  4PRB A;  1OF2 A;  1YN6 A;  5HGD A;  2VLR A;  4MS8 A;  3IT8 D;  4JFD A;  4N0C A;  3VH8 A;  2FO4 A;  3VXP A;  1M05 A;  1T0M A;  2BNQ A;  3MRL A;  3O3E A;  4QRQ A;  1HHK A;  3FTG A;  2CLR A;  3ARD A;  1MHE A;  2D31 A;  3PWL A;  3RGV C;  3QI9 A;  2E7L E;  1S7X A;  1RJZ A;  2X4N A;  5FA4 A;  4GKN A;  1T0N A;  3VXU A;  4MNQ A;  1HHJ A;  1S7W A;  3L3H A;  4PGE A;  5IB3 A;  4ZUS A;  4G42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...