3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
3L3JA 4PJ7A 3LN5A 4QRQA 2GJ6A 3TVMA 4NO3A 1TMCA 5INCA 2PO6A 4ZUWA 1A9BA 2CIIA 3TBWA 3DTXA 2BSRA 4PRAA 3DX8A 3RWDA 2BSTA 3KXFA 1FZKA 3HPJA 4U1JA 3TBTA 3VFVA 1ZHKA 4K71B 5HHQA 4S0UC 5D2NA 1UXWA 3V5KA 1AGCA 3MV7A 4PV9A 5BJTA 5C0IA 5MEOA 3KLAA 4QRRA 1HHKA 5SWZA 4G8GA 3FOMA 4I4WA 5C0CA 4NO5A 5C0EA 1FFOA 4D0DA 4QRSA 1NEZA 3X13A 5IROA 1B0GA 1JFMA 1E27A 3NFNA 3B3IA 3GMRA 3CVHA 4E0RA 3VXOA 1P7QA 3MRPA 3DX6A 2FZ3A 3DXAA 3I6KA 2Q7YA 3QUXA 1N2RA 4NQDA 3GSWA 2CLVA 3GMMA 3ES6A 3FQRA 5C0JA 3AM8A 4N0FA 4NO2A 3ARGA 3BZFA 3IT8D 3IXAA 1MHCA 1UXSA 1FG2A 3AU1A 4Z76A 3GJFA 4JFEA 1Q94A 1HSBA 3P4MA 3KPOA 5B38A 2X4OA 1FZJA 3GSXA 3VFRA 3BP4A 5MERA 3ROLA 1YN7A 5EU4A 4MS8A 1S9XA 2AKRA 5HGDA 2UWEA 1YN6A 1KPRA 4PRHA 1M05A 1INQA 3TO2A 3SDAA 4ZUUA 3E6HA 3MRIA 1A1OA 2VLJA 4O2CA 2CLZA 3RWEA 2X4TA 1CD1A 3CC5A 3O8XA 4E5XA 3RWIA 3BVNA 4MX7A 3FONA 1QLFA 4U1IA 1X7QA 4IRSA 3VXUA 2OL3H 1LDPH 2ZOLA 4PV8A 5EOTA 4HX1A 5F1NA 3OX8A 5C07A 3HE6A 3REWA 4PJXA 5SWQA 1IM9A 3SCMA 3BW9A 3TN0A 5BS0A 4JQVA 3FT3A 5F9JA 3LKRA 3VFSA 1ZS8A 4LHUA 2PYEA 1E28A 3D25A 1S7QA 4L8BA 1UQSA 3HE7A 4LCCC 2X4QA 2HJKA 5EFIA 1JPGA 1KJMA 1PQZA 2ESVA 3L3KA 3VFPA 1QSFA 4NQCA 4U1NA 3O4LA 4G9DA 1OSZA 2YPKA 1T1XA 3MV8A 3VRIA 3M1BA 1W0WA 2HJLA 1ONQA 3PWUA 4JFDA 1I1AA 1S9YA 2GTZA 2RFXA 2P5WA 5E8NA 4U1LA 1LQVA 4ZUSA 3KPQA 3VFTA 3W0WA 4L8CA 3QQ3A 4L8DA 4MJIA 3V5DA 2AV1A 4N0UA 4PJFA 1ZVSA 1XZ0A 3RUGA 1DUZA 1T1ZA 1ZT4A 4PGCA 3QZWA 1JF1A 1T7YA 4HV8A 3MRJA 1T1YA 4PJCA 3JTCA 3UTSA 3L3HA 2YEZA 4X6DA 3P73A 1DDHA 2X4RA 2BSSA 5HHMA 4L4VA 4NSKA 5C0BA 3BEVA 4Y4KA 3RWGA 1WBXA 2BCKA 2FYYA 4F7TA 2XFXA 1HYRC 4F7PA 1QEWA 1T22A 4PP8C 1S7XA 4NQEA 3BH9A 3DMMA 3VFMA 2GAZA 5D7JC 2VLLA 4L29A 3PWVA 1N5AA 5E8PA 1NANH 4PJAA 4HKJA 3GMOA 4PG2A 1EEYA 2CKBH 3KPMA 3VH8A 1VACA 1T20A 3PWLA 4MJ6A 2FWOA 1RK0A 5IM7A 2YPLA 3RWHA 5C9JA 5FA4A 3QEQA 3UTTA 3KPNA 4ONOA 2DYPA 3O3BA 1B0RA 4QRTA 5IB5A 1HHIA 4IIQC 4PDCE 1AGDA 4JFFA 5INDA 3MRCA 3SJVA 4JFPA 4V3EB 5BRZA 3BH8A 3WS3A 3L9RA 1B3JA 4Y16A 5EO0A 3VWJA 1I1FA 1S7TA 3SDCA 3SDXA 3P9LA 3OXSA 4APQA 3D2UA 4CW1A 3LV3A 2OI9A 4L3CA 5DDHA 3UBXA 3ROOA 3MA7A 3KWWA 3TFKA 2HN7A 2VLRA 1CG9A 3BXNA 3ILPA 3QFDA 4U1SA 3GMLA 4F7MA 4FFEX 1AKJA 4N0CA 5IB3A 1T80A 3BEWA 2AXFA 4QRPA 3QI9A 4PRBA 5C0DA 5HHOA 5H94A 5EUOA 3LKPA 5D7LA 5C08A 5E00A 3VXPA 3E2HA 1A6ZA 4HUXA 3GSUA 3H9SA 4JRYA 2F54A 4L3EA 4PJHA 3MRMA 3HLAA 3QDJA 4LCWA 4WWKC 2FO4A 3BGMA 1G6RH 3BHBA 3I6GA 4PG9A 4PREA 1W72A 3VFOA 3JTTA 3JTSA 5BXFA 4LCYA 3MREA 3LKNA 5C0AA 2CLRA 1MHEA 4ZUTA 4JFOA 4ZFZA 3ILQC 4NT6A 4G9FA 5E8OA 3SKOA 3FT2A 1S7UA 1ED3A 5D7IA 5B39A 3GSQA 3FRUA 5C09A 2ZSWA 3U0PA 3LN4A 1TVHA 3VFNA 5HGBA 3RWFA 1ZHLA 3MRRA 3GSNH 1XR9A 3VWKA 1QR1A 3TIDA 3MV9A 3RZCA 5J6GA 1T7WA 3D39A 3GIVA 3X11A 2V2WA 1QRNA 3L3IA 2ZOKA 1AGEA 4XXCA 5E6IC 3C9NA 5HGHA 2VE6A 4WDIA 5C0FA 3SDDA 3UPRA 1FZMA 4PRIA 2GT9A 3B6SA 4PJEA 3VXSA 3KPRA 3GMQA 2F53A 3SPVA 1EFXA 3WUWA 3MROA 4N8VA 3GSVA 4MNQA 3I6LD 2GTWA 1QSEA 1OGTA 3MR9A 5F1IA 3E3QA 1QQDA 3MRKA 3GSOA 1HHJA 3PWPA 4F7CA 1I4FA 4U6YA 1SYVA 4QOKA 1GZPA 3QDGA 3LKOA 2BNQA 1I7TA 5HHPA 5L2KA 5ACZA 4HWZA 1JGDA 3MRLA 1JPFA 1KTLA 4EUPA 1HHHA 1AGBA 1EXUA 1I1YA 1KJVA 1MI5A 2HLAA 4PRPA 1T0NA 2FIKA 4PGDA 3G08A 3PQYA 4NHUE 3RWCA 5DEGA 1NAMH 3P4OA 4U1MA 1XR8A 4L8SC 1HHGA 2AK4A 3O3AA 4GKSA 4G59A 5MENA 1KPVA 1YPZA 2A83A 1A1MA 4JRXA 3RWJA 1KPUA 1W0VA 5HYJA 1U58A 1P1ZA 1QVOA 4WJ5A 3BWAA 2VAAA 2BVPA 1T1WA 4PRNA 4NQXA 4PJ8A 2F74A 4V3DB 3V5HA 4L4TA 3ARFA 2C7UA 4PJDA 1T7XA 2GITA 1EEZA 3D18A 4PGBA 4U1KA 3QDMA 4Z78A 3KPPA 3KYNA 1S7SA 2AXGA 2BNRA 3MRBA 4IHOA 3RGVC 1T0MA 2X4UA 2X4NA 3GSRA 3VCLA 4F7EA 3TBSA 4Y2DA 1BQHA 1S8DA 3TF7A 3MRFA 3KPLA 3BUYA 3T1FA 3P77A 5IVXA 1G7PA 1KBGH 5IB4A 5J6HA 3X14A 3OXRA 1P4LA 3CDGA 1BZ9A 1LK2A 1N3NA 3FQXA 3FQUA 1T21A 3KYOA 2P5EA 3QUZA 2NX5A 3PABA 4U6XA 3LKSA 2X4PA 4X6CA 4ZAKA 3KPSA 4Y4FA 3P9MA 3VJ6A 4JQXA 3VFUA 1T7VA 2H26A 4U1HA 5EU5A 5L2JA 3BZEA 5GSVA 3WLBA 5JHDA 5GSRA 3DX7A 3UTQA 1BD2A 3TO4A 4D0CA 5E9DA 1LEKA 3OV6A 4NNXA 1Z5LA 1RK1A 2H6PA 3HUJA 1RJZA 3QUKA 3FT4A 1FFPA 5EU6A 3MRDA 3DBXA 5HGAA 4PGEA 3FQWA 3T8XA 1FZOA 4Y4HA 3WL9A 4D0BA 5MEQA 2BVQA 3X12A 4GUPA 1K8DA 4NO0A 1M6OA 4EN3C 4PJ5A 5C0GA 3PWJA 3L3DA 1ZT7A 4UQ2A 3FOLA 4WW2C 3QFJA 1QO3A 1KJ2H 3CPLA 3FQNA 3H7BA 4WU7A 1OGAA 3MRNA 4N5EA 1ZHNA 3TBVA 3RL2A 4MQ7A 5D9SA 1I7UA 3W39A 1G7QA 2WY3A 1L8JA 4HUUA 3ARBA 3M17A 4PR5A 1XH3A 4MJ5A 5ENWA 1MWAH 3QUYA 3S6CA 1JHTA 5D2LA 4PRDA 4NNYA 5EU3A 5F7DA 3TBYA 5ISZA 3H9HA 3MRHA 2XPGA 1S7RA 1KCGC 1ZT1A 2E7LE 1AGFA 4X6FA 1ZAGA 3GMNA 4G43A 3ECBA 5IB2A 1AO7A 2X70A 2MHAA 1I7RA 3RTQA 1SYSA 3TPUE 4O2EA 4PJGA 1IM3A 3O3DA 3TZVC 1CE6A 2GUOA 2X4SA 5HHNA 3CCHA 1DUYA 5D5MA 4GKNA 3MGOA 3QULA 1KJ3H 4PJ9A 1ZSDA 3MRQA 4Z77A 4HUVA 3LKQA 4X6EA 3TIEA 3VRJA 5AD0A 3TJHA 5IEHA 3O3EA 3MYJA 1ZHBA 3BP7A 1S9WA 5IB1A 1A9EA 1T7ZA 3E6FA 1FO0H 5IEKA 4WU5A 2CIKA 1TVBA 1RJYA 4FTVA 3VFWA 1BIIA 1N59A 3BO8A 3VXNA 4CVZA 3SKMA 4HS3A 1JE6A 5SWSA 4UQ3A 3ERYA 1A1NA 1S7WA 1VADA 1VGKA 3FQTA 4K7FA 4PJBA 4ZUVA 1YDPA 2ZSVA 3FFCA 1WBYA 3P4NA 4MXQA 4NQVA 3MRGA 5MEPA 3ARDA 1JUFA 3TA3A 4MVBA 1LEGA 1LP9A 4CVXA 2AV7A 4G8IA 3VXRA 1HOCA 4L9LC 4WUUA 4HUWA 4IRJA 2V2XA 2VLKA 5FDWA 3O9WA 3VXMA 3FTGA 3GMPA 3HAEA 2NW3A 4EI5A 2BVOA 4JFQA 5FKPA 4MNGA 1OF2A 5FA3A 3CH1A 1GZQA 3D3VA 4PJIA 5J1AA 1C16A 3WS6A 1DE4A 3QQ4A 3CZFA 3HG1A 5DEFA 1JGEA 1K5NA 4G42A 1HSAA 3HCVA 3L3GA 1S7VA 4LNRA 2JCCA 3MGTA 1LD9A 4WO4A 2J8UA 1FFNA 3C8KA 2VABA 3JVGA 4O2FA 1WBZA 1R3HA 4I48A 2D31A 4QRUA 4ELMA 3AREA 3RL1A 5EO1A 3PWNA
chains in the Genus database with same CATH superfamily
3L3JA 4BKWA 4PJ7A 3LN5A 4QRQA 2GJ6A 3TVMA 4NO3A 1TMCA 5INCA 2PO6A 4ZUWA 1A9BA 2CIIA 3TBWA 3DTXA 2BSRA 4PRAA 3DX8A 3RWDA 2BSTA 3KXFA 1FZKA 3HPJA 4U1JA 3TBTA 3VFVA 1ZHKA 4K71B 5HHQA 4S0UC 5D2NA 1UXWA 3V5KA 1AGCA 3MV7A 4PV9A 5BJTA 5C0IA 5MEOA 3KLAA 4QRRA 1HHKA 5SWZA 4G8GA 3FOMA 4I4WA 5C0CA 4NO5A 5C0EA 1FFOA 4D0DA 4QRSA 1NEZA 3X13A 5IROA 1B0GA 1JFMA 1E27A 3NFNA 3B3IA 3GMRA 3CVHA 4E0RA 3VXOA 1P7QA 3MRPA 3DX6A 2FZ3A 3DXAA 3I6KA 2Q7YA 3QUXA 1N2RA 4NQDA 3GSWA 2CLVA 3GMMA 3ES6A 3FQRA 5C0JA 3AM8A 4N0FA 4NO2A 3ARGA 3BZFA 3IT8D 3IXAA 1MHCA 1UXSA 1FG2A 3AU1A 4Z76A 3GJFA 4JFEA 1Q94A 1HSBA 3P4MA 3KPOA 5B38A 2X4OA 1FZJA 3GSXA 3VFRA 3BP4A 5MERA 3ROLA 1YN7A 5EU4A 4MS8A 1S9XA 2AKRA 5HGDA 2UWEA 1YN6A 1KPRA 4PRHA 1M05A 1INQA 3TO2A 3SDAA 4ZUUA 3E6HA 3MRIA 1A1OA 2VLJA 4O2CA 2CLZA 3RWEA 2X4TA 1CD1A 3CC5A 3O8XA 4E5XA 3RWIA 3BVNA 4MX7A 3FONA 1QLFA 4U1IA 1X7QA 4IRSA 3VXUA 2OL3H 1LDPH 3I0TA 2ZOLA 4PV8A 5EOTA 4HX1A 5F1NA 3OX8A 5C07A 3HE6A 3REWA 4PJXA 5SWQA 1IM9A 3SCMA 3BW9A 3TN0A 5BS0A 4JQVA 3FT3A 5F9JA 3LKRA 3VFSA 1ZS8A 4LHUA 2PYEA 1E28A 3D25A 1S7QA 4L8BA 1UQSA 3HE7A 4LCCC 2X4QA 2HJKA 5EFIA 1JPGA 1KJMA 1PQZA 2ESVA 3L3KA 3VFPA 1QSFA 4NQCA 4U1NA 3O4LA 4G9DA 1OSZA 2YPKA 1T1XA 3MV8A 3VRIA 3M1BA 1W0WA 2HJLA 1ONQA 3PWUA 4JFDA 1I1AA 1S9YA 2GTZA 2RFXA 2P5WA 5E8NA 4U1LA 1LQVA 4ZUSA 3KPQA 3VFTA 3W0WA 4L8CA 3QQ3A 4L8DA 4MJIA 3V5DA 2AV1A 4N0UA 4PJFA 1ZVSA 1XZ0A 3RUGA 1DUZA 1T1ZA 1ZT4A 4PGCA 3QZWA 1JF1A 1T7YA 4HV8A 3MRJA 1T1YA 4PJCA 3JTCA 3UTSA 3L3HA 2YEZA 4X6DA 3P73A 1DDHA 2X4RA 2BSSA 5HHMA 4L4VA 4NSKA 5C0BA 3BEVA 4Y4KA 3RWGA 1WBXA 2BCKA 2FYYA 4F7TA 2XFXA 1HYRC 4F7PA 1QEWA 1T22A 4PP8C 1S7XA 4NQEA 3BH9A 3DMMA 3VFMA 2GAZA 5D7JC 2VLLA 4L29A 3PWVA 1N5AA 5E8PA 1NANH 4PJAA 4HKJA 3GMOA 4PG2A 1EEYA 2CKBH 3KPMA 3VH8A 1VACA 1T20A 3PWLA 4MJ6A 2FWOA 1RK0A 5IM7A 2YPLA 3RWHA 5C9JA 5FA4A 3QEQA 3UTTA 3KPNA 4ONOA 2DYPA 3O3BA 1B0RA 4QRTA 5IB5A 1HHIA 4IIQC 4PDCE 1AGDA 4JFFA 5INDA 3MRCA 3SJVA 4JFPA 4V3EB 5BRZA 3BH8A 3WS3A 3L9RA 1B3JA 2IA1A 4Y16A 5EO0A 3VWJA 1I1FA 1S7TA 3SDCA 3SDXA 3P9LA 3OXSA 4APQA 3D2UA 4CW1A 3LV3A 2OI9A 4L3CA 5DDHA 3UBXA 3ROOA 3MA7A 3KWWA 3TFKA 2HN7A 2VLRA 1CG9A 3BXNA 3ILPA 3QFDA 4U1SA 3GMLA 4F7MA 4FFEX 1AKJA 4N0CA 5IB3A 1T80A 3BEWA 2AXFA 4QRPA 3QI9A 4PRBA 5C0DA 5HHOA 5H94A 5EUOA 3LKPA 5D7LA 5C08A 5E00A 3VXPA 3E2HA 1A6ZA 4HUXA 3GSUA 3H9SA 4JRYA 2F54A 4L3EA 4PJHA 3MRMA 3HLAA 3QDJA 4LCWA 4WWKC 2FO4A 3BGMA 1G6RH 3BHBA 3I6GA 4PG9A 4PREA 1W72A 3VFOA 3JTTA 3JTSA 5BXFA 4LCYA 3MREA 3LKNA 5C0AA 2CLRA 1MHEA 4ZUTA 4JFOA 4ZFZA 3ILQC 4NT6A 4G59C 4G9FA 5E8OA 3SKOA 3FT2A 1S7UA 1ED3A 5D7IA 5B39A 3GSQA 3FRUA 5C09A 2ZSWA 3U0PA 3LN4A 1TVHA 3VFNA 5HGBA 3RWFA 1ZHLA 3MRRA 3GSNH 1XR9A 3VWKA 1QR1A 3TIDA 3MV9A 3RZCA 5J6GA 1T7WA 3D39A 3GIVA 3X11A 2V2WA 1QRNA 3L3IA 2ZOKA 1AGEA 4XXCA 5E6IC 3C9NA 5HGHA 2VE6A 4WDIA 5C0FA 3SDDA 3UPRA 1FZMA 4PRIA 2GT9A 3B6SA 4PJEA 3VXSA 3KPRA 3GMQA 2F53A 3SPVA 1EFXA 3WUWA 3MROA 4N8VA 3GSVA 4MNQA 3I6LD 2GTWA 1QSEA 1OGTA 3MR9A 5F1IA 3E3QA 1QQDA 3MRKA 3GSOA 1HHJA 3PWPA 4F7CA 1I4FA 4U6YA 1SYVA 4QOKA 1GZPA 3QDGA 3LKOA 2BNQA 1I7TA 5HHPA 5L2KA 5ACZA 4HWZA 1JGDA 3MRLA 1JPFA 1KTLA 4EUPA 1HHHA 1AGBA 1EXUA 1I1YA 1KJVA 1MI5A 2HLAA 4PRPA 1T0NA 2FIKA 4PGDA 3G08A 3PQYA 4NHUE 3RWCA 5DEGA 1NAMH 3P4OA 4U1MA 1XR8A 4L8SC 1HHGA 2AK4A 3O3AA 4GKSA 4G59A 5MENA 1KPVA 1YPZA 2A83A 1A1MA 4JRXA 3RWJA 1KPUA 1W0VA 5HYJA 1U58A 1P1ZA 1QVOA 4WJ5A 3BWAA 2VAAA 2BVPA 1T1WA 4PRNA 4NQXA 4PJ8A 2F74A 4V3DB 3V5HA 4L4TA 3ARFA 2C7UA 4PJDA 1T7XA 2GITA 1EEZA 3D18A 4PGBA 4U1KA 3QDMA 4Z78A 3KPPA 3KYNA 1S7SA 2AXGA 2BNRA 3MRBA 4IHOA 3RGVC 1T0MA 2X4UA 2X4NA 3GSRA 3VCLA 4F7EA 3TBSA 4Y2DA 1BQHA 1S8DA 3TF7A 3MRFA 3KPLA 3BUYA 3T1FA 3P77A 5IVXA 1G7PA 1KBGH 5IB4A 5J6HA 3X14A 3OXRA 1P4LA 3CDGA 1BZ9A 1LK2A 1N3NA 3FQXA 3FQUA 1T21A 3KYOA 2P5EA 3QUZA 2NX5A 3PABA 4U6XA 3LKSA 2X4PA 4X6CA 4ZAKA 3KPSA 4Y4FA 3P9MA 3VJ6A 4JQXA 3VFUA 1T7VA 2H26A 4U1HA 5EU5A 5L2JA 3BZEA 5GSVA 3WLBA 5JHDA 5GSRA 3DX7A 3UTQA 1BD2A 3TO4A 4D0CA 5E9DA 1LEKA 3OV6A 4NNXA 1Z5LA 1RK1A 2H6PA 3HUJA 1RJZA 3QUKA 3FT4A 1FFPA 5EU6A 3MRDA 3DBXA 5HGAA 4PGEA 3FQWA 3T8XA 1FZOA 4Y4HA 3WL9A 4D0BA 5MEQA 2BVQA 3X12A 4GUPA 1K8DA 4NO0A 1M6OA 4EN3C 4PJ5A 5C0GA 3PWJA 3L3DA 1ZT7A 4UQ2A 3FOLA 4WW2C 3QFJA 1QO3A 1KJ2H 3CPLA 3FQNA 3H7BA 4WU7A 1OGAA 3MRNA 4N5EA 1ZHNA 3TBVA 3RL2A 4MQ7A 5D9SA 1I7UA 3W39A 1G7QA 2WY3A 1L8JA 4HUUA 3ARBA 3M17A 4PR5A 1XH3A 4MJ5A 5ENWA 1MWAH 3QUYA 3S6CA 1JHTA 5D2LA 4PRDA 4NNYA 5EU3A 5F7DA 3TBYA 5ISZA 3H9HA 3MRHA 2XPGA 1S7RA 1KCGC 1ZT1A 2E7LE 1AGFA 4X6FA 1ZAGA 3GMNA 4G43A 3ECBA 5IB2A 1AO7A 2X70A 2MHAA 1I7RA 3RTQA 1SYSA 3TPUE 4O2EA 4PJGA 1IM3A 3O3DA 3TZVC 1CE6A 2GUOA 2X4SA 5HHNA 3CCHA 1DUYA 5D5MA 4GKNA 3MGOA 3QULA 1KJ3H 4PJ9A 1ZSDA 3MRQA 4Z77A 4HUVA 3LKQA 4X6EA 3TIEA 3VRJA 5AD0A 3TJHA 5IEHA 3O3EA 3MYJA 1ZHBA 3BP7A 1S9WA 5IB1A 1A9EA 1T7ZA 3E6FA 1FO0H 5IEKA 4WU5A 2CIKA 1TVBA 1RJYA 4FTVA 3VFWA 1BIIA 1N59A 3BO8A 3VXNA 4CVZA 3SKMA 4HS3A 1JE6A 5SWSA 4UQ3A 3ERYA 1A1NA 1S7WA 1VADA 1VGKA 3FQTA 4K7FA 4PJBA 4ZUVA 1YDPA 2ZSVA 3FFCA 1WBYA 3P4NA 2O5NA 4MXQA 3MRGA 4NQVA 3ARDA 1JUFA 3TA3A 5MEPA 4MVBA 1LEGA 1LP9A 4CVXA 2AV7A 4G8IA 2NYKA 3VXRA 1HOCA 4L9LC 4WUUA 4HUWA 4IRJA 2V2XA 2VLKA 5FDWA 3O9WA 3VXMA 3FTGA 3GMPA 3HAEA 2NW3A 4EI5A 2BVOA 4JFQA 5FKPA 4MNGA 1OF2A 5FA3A 3CH1A 1GZQA 3D3VA 4PJIA 5J1AA 1C16A 3WS6A 1DE4A 3QQ4A 3CZFA 3HG1A 5DEFA 1JGEA 1K5NA 4JO8A 4G42A 1HSAA 3HCVA 3L3GA 1S7VA 4LNRA 2JCCA 3MGTA 1LD9A 4WO4A 2J8UA 1FFNA 3C8KA 2VABA 3JVGA 4O2FA 1WBZA 1R3HA 4I48A 2D31A 4QRUA 4ELMA 3AREA 3RL1A 5EO1A 3PWNA
chains in the Genus database with same CATH topology
3L3JA 4PJ7A 3LN5A 4QRQA 2GJ6A 3TVMA 4NO3A 1TMCA 5INCA 2PO6A 4ZUWA 1A9BA 2CIIA 3TBWA 3DTXA 2BSRA 4PRAA 3DX8A 3RWDA 2BSTA 3KXFA 1FZKA 3HPJA 4U1JA 3TBTA 3VFVA 1ZHKA 4K71B 5HHQA 4S0UC 5D2NA 1UXWA 3V5KA 1AGCA 3MV7A 4PV9A 5BJTA 5C0IA 5MEOA 3KLAA 4QRRA 1HHKA 5SWZA 4G8GA 3FOMA 4I4WA 5C0CA 4NO5A 5C0EA 1FFOA 4D0DA 4QRSA 1NEZA 3X13A 5IROA 1B0GA 1JFMA 1E27A 3NFNA 3B3IA 3GMRA 3CVHA 4E0RA 3VXOA 1P7QA 3MRPA 3DX6A 2FZ3A 3DXAA 3I6KA 2Q7YA 3QUXA 1N2RA 4NQDA 3GSWA 2CLVA 3GMMA 3ES6A 3FQRA 5C0JA 3AM8A 4N0FA 4NO2A 3ARGA 3BZFA 3IT8D 3IXAA 1MHCA 1UXSA 1FG2A 3AU1A 4Z76A 3GJFA 4JFEA 1Q94A 1HSBA 3P4MA 3KPOA 5B38A 2X4OA 1FZJA 3GSXA 3VFRA 3BP4A 5MERA 3ROLA 1YN7A 5EU4A 4MS8A 1S9XA 2AKRA 5HGDA 2UWEA 1YN6A 1KPRA 4PRHA 1M05A 1INQA 3TO2A 3SDAA 4ZUUA 3E6HA 3MRIA 1A1OA 2VLJA 4O2CA 2CLZA 3RWEA 2X4TA 1CD1A 3CC5A 3O8XA 4E5XA 3RWIA 3BVNA 4MX7A 3FONA 1QLFA 4U1IA 1X7QA 4IRSA 3VXUA 2OL3H 1LDPH 2ZOLA 4PV8A 5EOTA 4HX1A 5F1NA 3OX8A 5C07A 3HE6A 3REWA 4PJXA 5SWQA 1IM9A 3SCMA 3BW9A 3TN0A 5BS0A 4JQVA 3FT3A 5F9JA 3LKRA 3VFSA 1ZS8A 4LHUA 2PYEA 1E28A 3D25A 1S7QA 4L8BA 1UQSA 3HE7A 4LCCC 2X4QA 2HJKA 5EFIA 1JPGA 1KJMA 1PQZA 2ESVA 3L3KA 3VFPA 1QSFA 4NQCA 4U1NA 3O4LA 4G9DA 1OSZA 2YPKA 1T1XA 3MV8A 3VRIA 3M1BA 1W0WA 2HJLA 1ONQA 3PWUA 4JFDA 1I1AA 1S9YA 2GTZA 2RFXA 2P5WA 5E8NA 4U1LA 1LQVA 4ZUSA 3KPQA 3VFTA 3W0WA 4L8CA 3QQ3A 4L8DA 4MJIA 3V5DA 2AV1A 4N0UA 4PJFA 1ZVSA 1XZ0A 3RUGA 1DUZA 1T1ZA 1ZT4A 4PGCA 3QZWA 1JF1A 1T7YA 4HV8A 3MRJA 1T1YA 4PJCA 3JTCA 3UTSA 3L3HA 2YEZA 4X6DA 3P73A 1DDHA 2X4RA 2BSSA 5HHMA 4L4VA 4NSKA 5C0BA 3BEVA 4Y4KA 3RWGA 1WBXA 2BCKA 2FYYA 4F7TA 2XFXA 1HYRC 4F7PA 1QEWA 1T22A 4PP8C 1S7XA 4NQEA 3BH9A 3DMMA 3VFMA 2GAZA 5D7JC 2VLLA 4L29A 3PWVA 1N5AA 5E8PA 1NANH 4PJAA 4HKJA 3GMOA 4PG2A 1EEYA 2CKBH 3KPMA 3VH8A 1VACA 1T20A 3PWLA 4MJ6A 2FWOA 1RK0A 5IM7A 2YPLA 3RWHA 5C9JA 5FA4A 3QEQA 3UTTA 3KPNA 4ONOA 2DYPA 3O3BA 1B0RA 4QRTA 5IB5A 1HHIA 4IIQC 4PDCE 1AGDA 4JFFA 5INDA 3MRCA 3SJVA 4JFPA 4V3EB 5BRZA 3BH8A 3WS3A 3L9RA 1B3JA 4Y16A 5EO0A 3VWJA 1I1FA 1S7TA 3SDCA 3SDXA 3P9LA 3OXSA 4APQA 3D2UA 4CW1A 3LV3A 2OI9A 4L3CA 5DDHA 3UBXA 3ROOA 3MA7A 3KWWA 3TFKA 2HN7A 2VLRA 1CG9A 3BXNA 3ILPA 3QFDA 4U1SA 3GMLA 4F7MA 4FFEX 1AKJA 4N0CA 5IB3A 1T80A 3BEWA 2AXFA 4QRPA 3QI9A 4PRBA 5C0DA 5HHOA 5H94A 5EUOA 3LKPA 5D7LA 5C08A 5E00A 3VXPA 3E2HA 1A6ZA 4HUXA 3GSUA 3H9SA 4JRYA 2F54A 4L3EA 4PJHA 3MRMA 3HLAA 3QDJA 4LCWA 4WWKC 2FO4A 3BGMA 1G6RH 3BHBA 3I6GA 4PG9A 4PREA 1W72A 3VFOA 3JTTA 3JTSA 5BXFA 4LCYA 3MREA 3LKNA 5C0AA 2CLRA 1MHEA 4ZUTA 4JFOA 4ZFZA 3ILQC 4NT6A 4G9FA 5E8OA 3SKOA 3FT2A 1S7UA 1ED3A 5D7IA 5B39A 3GSQA 3FRUA 5C09A 2ZSWA 3U0PA 3LN4A 1TVHA 3VFNA 5HGBA 3RWFA 1ZHLA 3MRRA 3GSNH 1XR9A 3VWKA 1QR1A 3TIDA 3MV9A 3RZCA 5J6GA 1T7WA 3D39A 3GIVA 3X11A 2V2WA 1QRNA 3L3IA 2ZOKA 1AGEA 4XXCA 5E6IC 3C9NA 5HGHA 2VE6A 4WDIA 5C0FA 3SDDA 3UPRA 1FZMA 4PRIA 2GT9A 3B6SA 4PJEA 3VXSA 3KPRA 3GMQA 2F53A 3SPVA 1EFXA 3WUWA 3MROA 4N8VA 3GSVA 4MNQA 3I6LD 2GTWA 1QSEA 1OGTA 3MR9A 5F1IA 3E3QA 1QQDA 3MRKA 3GSOA 1HHJA 3PWPA 4F7CA 1I4FA 4U6YA 1SYVA 4QOKA 1GZPA 3QDGA 3LKOA 2BNQA 1I7TA 5HHPA 5L2KA 5ACZA 4HWZA 1JGDA 3MRLA 1JPFA 1KTLA 4EUPA 1HHHA 1AGBA 1EXUA 1I1YA 1KJVA 1MI5A 2HLAA 4PRPA 1T0NA 2FIKA 4PGDA 3G08A 3PQYA 4NHUE 3RWCA 5DEGA 1NAMH 3P4OA 4U1MA 1XR8A 4L8SC 1HHGA 2AK4A 3O3AA 4GKSA 4G59A 5MENA 1KPVA 1YPZA 2A83A 1A1MA 4JRXA 3RWJA 1KPUA 1W0VA 5HYJA 1U58A 1P1ZA 1QVOA 4WJ5A 3BWAA 2VAAA 2BVPA 1T1WA 4PRNA 4NQXA 4PJ8A 2F74A 4V3DB 3V5HA 4L4TA 3ARFA 2C7UA 4PJDA 1T7XA 2GITA 1EEZA 3D18A 4PGBA 4U1KA 3QDMA 4Z78A 3KPPA 3KYNA 1S7SA 2AXGA 2BNRA 3MRBA 4IHOA 3RGVC 1T0MA 2X4UA 2X4NA 3GSRA 3VCLA 4F7EA 3TBSA 4Y2DA 1BQHA 1S8DA 3TF7A 3MRFA 3KPLA 3BUYA 3T1FA 3P77A 5IVXA 1G7PA 1KBGH 5IB4A 5J6HA 3X14A 3OXRA 1P4LA 3CDGA 1BZ9A 1LK2A 1N3NA 3FQXA 3FQUA 1T21A 3KYOA 2P5EA 3QUZA 2NX5A 3PABA 4U6XA 3LKSA 2X4PA 4X6CA 4ZAKA 3KPSA 4Y4FA 3P9MA 3VJ6A 4JQXA 3VFUA 1T7VA 2H26A 4U1HA 5EU5A 5L2JA 3BZEA 5GSVA 3WLBA 5JHDA 5GSRA 3DX7A 3UTQA 1BD2A 3TO4A 4D0CA 5E9DA 1LEKA 3OV6A 4NNXA 1Z5LA 1RK1A 2H6PA 3HUJA 1RJZA 3QUKA 3FT4A 1FFPA 5EU6A 3MRDA 3DBXA 5HGAA 4PGEA 3FQWA 3T8XA 1FZOA 4Y4HA 3WL9A 4D0BA 5MEQA 2BVQA 3X12A 4GUPA 1K8DA 4NO0A 1M6OA 4EN3C 4PJ5A 5C0GA 3PWJA 3L3DA 1ZT7A 4UQ2A 3FOLA 4WW2C 3QFJA 1QO3A 1KJ2H 3CPLA 3FQNA 3H7BA 4WU7A 1OGAA 3MRNA 4N5EA 1ZHNA 3TBVA 3RL2A 4MQ7A 5D9SA 1I7UA 3W39A 1G7QA 2WY3A 1L8JA 4HUUA 3ARBA 3M17A 4PR5A 1XH3A 4MJ5A 5ENWA 1MWAH 3QUYA 3S6CA 1JHTA 5D2LA 4PRDA 4NNYA 5EU3A 5F7DA 3TBYA 5ISZA 3H9HA 3MRHA 2XPGA 1S7RA 1KCGC 1ZT1A 2E7LE 1AGFA 4X6FA 1ZAGA 3GMNA 4G43A 3ECBA 5IB2A 1AO7A 2X70A 2MHAA 1I7RA 3RTQA 1SYSA 3TPUE 4O2EA 4PJGA 1IM3A 3O3DA 3TZVC 1CE6A 2GUOA 2X4SA 5HHNA 3CCHA 1DUYA 5D5MA 4GKNA 3MGOA 3QULA 1KJ3H 4PJ9A 1ZSDA 3MRQA 4Z77A 4HUVA 3LKQA 4X6EA 3TIEA 3VRJA 5AD0A 3TJHA 5IEHA 3O3EA 3MYJA 1ZHBA 3BP7A 1S9WA 5IB1A 1A9EA 1T7ZA 3E6FA 1FO0H 5IEKA 4WU5A 2CIKA 1TVBA 1RJYA 4FTVA 3VFWA 1BIIA 1N59A 3BO8A 3VXNA 4CVZA 3SKMA 4HS3A 1JE6A 5SWSA 4UQ3A 3ERYA 1A1NA 1S7WA 1VADA 1VGKA 3FQTA 4K7FA 4PJBA 4ZUVA 1YDPA 2ZSVA 3FFCA 1WBYA 3P4NA 4MXQA 4NQVA 3MRGA 5MEPA 3ARDA 1JUFA 3TA3A 4MVBA 1LEGA 1LP9A 4CVXA 2AV7A 4G8IA 3VXRA 1HOCA 4L9LC 4WUUA 4HUWA 4IRJA 2V2XA 2VLKA 5FDWA 3O9WA 3VXMA 3FTGA 3GMPA 3HAEA 2NW3A 4EI5A 2BVOA 4JFQA 5FKPA 4MNGA 1OF2A 5FA3A 3CH1A 1GZQA 3D3VA 4PJIA 5J1AA 1C16A 3WS6A 1DE4A 3QQ4A 3CZFA 3HG1A 5DEFA 1JGEA 1K5NA 4G42A 1HSAA 3HCVA 3L3GA 1S7VA 4LNRA 2JCCA 3MGTA 1LD9A 4WO4A 2J8UA 1FFNA 3C8KA 2VABA 3JVGA 4O2FA 1WBZA 1R3HA 4I48A 2D31A 4QRUA 4ELMA 3AREA 3RL1A 5EO1A 3PWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3J A;  4PJ7 A;  3LN5 A;  4QRQ A;  2GJ6 A;  3TVM A;  4NO3 A;  1TMC A;  5INC A;  2PO6 A;  4ZUW A;  1A9B A;  2CII A;  3TBW A;  3DTX A;  2BSR A;  4PRA A;  3DX8 A;  3RWD A;  2BST A;  3KXF A;  1FZK A;  3HPJ A;  4U1J A;  3TBT A;  3VFV A;  1ZHK A;  4K71 B;  5HHQ A;  4S0U C;  5D2N A;  1UXW A;  3V5K A;  1AGC A;  3MV7 A;  4PV9 A;  5BJT A;  5C0I A;  5MEO A;  3KLA A;  4QRR A;  1HHK A;  5SWZ A;  4G8G A;  3FOM A;  4I4W A;  5C0C A;  4NO5 A;  5C0E A;  1FFO A;  4D0D A;  4QRS A;  1NEZ A;  3X13 A;  5IRO A;  1B0G A;  1JFM A;  1E27 A;  3NFN A;  3B3I A;  3GMR A;  3CVH A;  4E0R A;  3VXO A;  1P7Q A;  3MRP A;  3DX6 A;  2FZ3 A;  3DXA A;  3I6K A;  2Q7Y A;  3QUX A;  1N2R A;  4NQD A;  3GSW A;  2CLV A;  3GMM A;  3ES6 A;  3FQR A;  5C0J A;  3AM8 A;  4N0F A;  4NO2 A;  3ARG A;  3BZF A;  3IT8 D;  3IXA A;  1MHC A;  1UXS A;  1FG2 A;  3AU1 A;  4Z76 A;  3GJF A;  4JFE A;  1Q94 A;  1HSB A;  3P4M A;  3KPO A;  5B38 A;  2X4O A;  1FZJ A;  3GSX A;  3VFR A;  3BP4 A;  5MER A;  3ROL A;  1YN7 A;  5EU4 A;  4MS8 A;  1S9X A;  2AKR A;  5HGD A;  2UWE A;  1YN6 A;  1KPR A;  4PRH A;  1M05 A;  1INQ A;  3TO2 A;  3SDA A;  4ZUU A;  3E6H A;  3MRI A;  1A1O A;  2VLJ A;  4O2C A;  2CLZ A;  3RWE A;  2X4T A;  1CD1 A;  3CC5 A;  3O8X A;  4E5X A;  3RWI A;  3BVN A;  4MX7 A;  3FON A;  1QLF A;  4U1I A;  1X7Q A;  4IRS A;  3VXU A;  2OL3 H;  1LDP H;  2ZOL A;  4PV8 A;  5EOT A;  4HX1 A;  5F1N A;  3OX8 A;  5C07 A;  3HE6 A;  3REW A;  4PJX A;  5SWQ A;  1IM9 A;  3SCM A;  3BW9 A;  3TN0 A;  5BS0 A;  4JQV A;  3FT3 A;  5F9J A;  3LKR A;  3VFS A;  1ZS8 A;  4LHU A;  2PYE A;  1E28 A;  3D25 A;  1S7Q A;  4L8B A;  1UQS A;  3HE7 A;  4LCC C;  2X4Q A;  2HJK A;  5EFI A;  1JPG A;  1KJM A;  1PQZ A;  2ESV A;  3L3K A;  3VFP A;  1QSF A;  4NQC A;  4U1N A;  3O4L A;  4G9D A;  1OSZ A;  2YPK A;  1T1X A;  3MV8 A;  3VRI A;  3M1B A;  1W0W A;  2HJL A;  1ONQ A;  3PWU A;  4JFD A;  1I1A A;  1S9Y A;  2GTZ A;  2RFX A;  2P5W A;  5E8N A;  4U1L A;  1LQV A;  4ZUS A;  3KPQ A;  3VFT A;  3W0W A;  4L8C A;  3QQ3 A;  4L8D A;  4MJI A;  3V5D A;  2AV1 A;  4N0U A;  4PJF A;  1ZVS A;  1XZ0 A;  3RUG A;  1DUZ A;  1T1Z A;  1ZT4 A;  4PGC A;  3QZW A;  1JF1 A;  1T7Y A;  4HV8 A;  3MRJ A;  1T1Y A;  4PJC A;  3JTC A;  3UTS A;  3L3H A;  2YEZ A;  4X6D A;  3P73 A;  1DDH A;  2X4R A;  2BSS A;  5HHM A;  4L4V A;  4NSK A;  5C0B A;  3BEV A;  4Y4K A;  3RWG A;  1WBX A;  2BCK A;  2FYY A;  4F7T A;  2XFX A;  1HYR C;  4F7P A;  1QEW A;  1T22 A;  4PP8 C;  1S7X A;  4NQE A;  3BH9 A;  3DMM A;  3VFM A;  2GAZ A;  5D7J C;  2VLL A;  4L29 A;  3PWV A;  1N5A A;  5E8P A;  1NAN H;  4PJA A;  4HKJ A;  3GMO A;  4PG2 A;  1EEY A;  2CKB H;  3KPM A;  3VH8 A;  1VAC A;  1T20 A;  3PWL A;  4MJ6 A;  2FWO A;  1RK0 A;  5IM7 A;  2YPL A;  3RWH A;  5C9J A;  5FA4 A;  3QEQ A;  3UTT A;  3KPN A;  4ONO A;  2DYP A;  3O3B A;  1B0R A;  4QRT A;  5IB5 A;  1HHI A;  4IIQ C;  4PDC E;  1AGD A;  4JFF A;  5IND A;  3MRC A;  3SJV A;  4JFP A;  4V3E B;  5BRZ A;  3BH8 A;  3WS3 A;  3L9R A;  1B3J A;  4Y16 A;  5EO0 A;  3VWJ A;  1I1F A;  1S7T A;  3SDC A;  3SDX A;  3P9L A;  3OXS A;  4APQ A;  3D2U A;  4CW1 A;  3LV3 A;  2OI9 A;  4L3C A;  5DDH A;  3UBX A;  3ROO A;  3MA7 A;  3KWW A;  3TFK A;  2HN7 A;  2VLR A;  1CG9 A;  3BXN A;  3ILP A;  3QFD A;  4U1S A;  3GML A;  4F7M A;  4FFE X;  1AKJ A;  4N0C A;  5IB3 A;  1T80 A;  3BEW A;  2AXF A;  4QRP A;  3QI9 A;  4PRB A;  5C0D A;  5HHO A;  5H94 A;  5EUO A;  3LKP A;  5D7L A;  5C08 A;  5E00 A;  3VXP A;  3E2H A;  1A6Z A;  4HUX A;  3GSU A;  3H9S A;  4JRY A;  2F54 A;  4L3E A;  4PJH A;  3MRM A;  3HLA A;  3QDJ A;  4LCW A;  4WWK C;  2FO4 A;  3BGM A;  1G6R H;  3BHB A;  3I6G A;  4PG9 A;  4PRE A;  1W72 A;  3VFO A;  3JTT A;  3JTS A;  5BXF A;  4LCY A;  3MRE A;  3LKN A;  5C0A A;  2CLR A;  1MHE A;  4ZUT A;  4JFO A;  4ZFZ A;  3ILQ C;  4NT6 A;  4G9F A;  5E8O A;  3SKO A;  3FT2 A;  1S7U A;  1ED3 A;  5D7I A;  5B39 A;  3GSQ A;  3FRU A;  5C09 A;  2ZSW A;  3U0P A;  3LN4 A;  1TVH A;  3VFN A;  5HGB A;  3RWF A;  1ZHL A;  3MRR A;  3GSN H;  1XR9 A;  3VWK A;  1QR1 A;  3TID A;  3MV9 A;  3RZC A;  5J6G A;  1T7W A;  3D39 A;  3GIV A;  3X11 A;  2V2W A;  1QRN A;  3L3I A;  2ZOK A;  1AGE A;  4XXC A;  5E6I C;  3C9N A;  5HGH A;  2VE6 A;  4WDI A;  5C0F A;  3SDD A;  3UPR A;  1FZM A;  4PRI A;  2GT9 A;  3B6S A;  4PJE A;  3VXS A;  3KPR A;  3GMQ A;  2F53 A;  3SPV A;  1EFX A;  3WUW A;  3MRO A;  4N8V A;  3GSV A;  4MNQ A;  3I6L D;  2GTW A;  1QSE A;  1OGT A;  3MR9 A;  5F1I A;  3E3Q A;  1QQD A;  3MRK A;  3GSO A;  1HHJ A;  3PWP A;  4F7C A;  1I4F A;  4U6Y A;  1SYV A;  4QOK A;  1GZP A;  3QDG A;  3LKO A;  2BNQ A;  1I7T A;  5HHP A;  5L2K A;  5ACZ A;  4HWZ A;  1JGD A;  3MRL A;  1JPF A;  1KTL A;  4EUP A;  1HHH A;  1AGB A;  1EXU A;  1I1Y A;  1KJV A;  1MI5 A;  2HLA A;  4PRP A;  1T0N A;  2FIK A;  4PGD A;  3G08 A;  3PQY A;  4NHU E;  3RWC A;  5DEG A;  1NAM H;  3P4O A;  4U1M A;  1XR8 A;  4L8S C;  1HHG A;  2AK4 A;  3O3A A;  4GKS A;  4G59 A;  5MEN A;  1KPV A;  1YPZ A;  2A83 A;  1A1M A;  4JRX A;  3RWJ A;  1KPU A;  1W0V A;  5HYJ A;  1U58 A;  1P1Z A;  1QVO A;  4WJ5 A;  3BWA A;  2VAA A;  2BVP A;  1T1W A;  4PRN A;  4NQX A;  4PJ8 A;  2F74 A;  4V3D B;  3V5H A;  4L4T A;  3ARF A;  2C7U A;  4PJD A;  1T7X A;  2GIT A;  1EEZ A;  3D18 A;  4PGB A;  4U1K A;  3QDM A;  4Z78 A;  3KPP A;  3KYN A;  1S7S A;  2AXG A;  2BNR A;  3MRB A;  4IHO A;  3RGV C;  1T0M A;  2X4U A;  2X4N A;  3GSR A;  3VCL A;  4F7E A;  3TBS A;  4Y2D A;  1BQH A;  1S8D A;  3TF7 A;  3MRF A;  3KPL A;  3BUY A;  3T1F A;  3P77 A;  5IVX A;  1G7P A;  1KBG H;  5IB4 A;  5J6H A;  3X14 A;  3OXR A;  1P4L A;  3CDG A;  1BZ9 A;  1LK2 A;  1N3N A;  3FQX A;  3FQU A;  1T21 A;  3KYO A;  2P5E A;  3QUZ A;  2NX5 A;  3PAB A;  4U6X A;  3LKS A;  2X4P A;  4X6C A;  4ZAK A;  3KPS A;  4Y4F A;  3P9M A;  3VJ6 A;  4JQX A;  3VFU A;  1T7V A;  2H26 A;  4U1H A;  5EU5 A;  5L2J A;  3BZE A;  5GSV A;  3WLB A;  5JHD A;  5GSR A;  3DX7 A;  3UTQ A;  1BD2 A;  3TO4 A;  4D0C A;  5E9D A;  1LEK A;  3OV6 A;  4NNX A;  1Z5L A;  1RK1 A;  2H6P A;  3HUJ A;  1RJZ A;  3QUK A;  3FT4 A;  1FFP A;  5EU6 A;  3MRD A;  3DBX A;  5HGA A;  4PGE A;  3FQW A;  3T8X A;  1FZO A;  4Y4H A;  3WL9 A;  4D0B A;  5MEQ A;  2BVQ A;  3X12 A;  4GUP A;  1K8D A;  4NO0 A;  1M6O A;  4EN3 C;  4PJ5 A;  5C0G A;  3PWJ A;  3L3D A;  1ZT7 A;  4UQ2 A;  3FOL A;  4WW2 C;  3QFJ A;  1QO3 A;  1KJ2 H;  3CPL A;  3FQN A;  3H7B A;  4WU7 A;  1OGA A;  3MRN A;  4N5E A;  1ZHN A;  3TBV A;  3RL2 A;  4MQ7 A;  5D9S A;  1I7U A;  3W39 A;  1G7Q A;  2WY3 A;  1L8J A;  4HUU A;  3ARB A;  3M17 A;  4PR5 A;  1XH3 A;  4MJ5 A;  5ENW A;  1MWA H;  3QUY A;  3S6C A;  1JHT A;  5D2L A;  4PRD A;  4NNY A;  5EU3 A;  5F7D A;  3TBY A;  5ISZ A;  3H9H A;  3MRH A;  2XPG A;  1S7R A;  1KCG C;  1ZT1 A;  2E7L E;  1AGF A;  4X6F A;  1ZAG A;  3GMN A;  4G43 A;  3ECB A;  5IB2 A;  1AO7 A;  2X70 A;  2MHA A;  1I7R A;  3RTQ A;  1SYS A;  3TPU E;  4O2E A;  4PJG A;  1IM3 A;  3O3D A;  3TZV C;  1CE6 A;  2GUO A;  2X4S A;  5HHN A;  3CCH A;  1DUY A;  5D5M A;  4GKN A;  3MGO A;  3QUL A;  1KJ3 H;  4PJ9 A;  1ZSD A;  3MRQ A;  4Z77 A;  4HUV A;  3LKQ A;  4X6E A;  3TIE A;  3VRJ A;  5AD0 A;  3TJH A;  5IEH A;  3O3E A;  3MYJ A;  1ZHB A;  3BP7 A;  1S9W A;  5IB1 A;  1A9E A;  1T7Z A;  3E6F A;  1FO0 H;  5IEK A;  4WU5 A;  2CIK A;  1TVB A;  1RJY A;  4FTV A;  3VFW A;  1BII A;  1N59 A;  3BO8 A;  3VXN A;  4CVZ A;  3SKM A;  4HS3 A;  1JE6 A;  5SWS A;  4UQ3 A;  3ERY A;  1A1N A;  1S7W A;  1VAD A;  1VGK A;  3FQT A;  4K7F A;  4PJB A;  4ZUV A;  1YDP A;  2ZSV A;  3FFC A;  1WBY A;  3P4N A;  4MXQ A;  4NQV A;  3MRG A;  5MEP A;  3ARD A;  1JUF A;  3TA3 A;  4MVB A;  1LEG A;  1LP9 A;  4CVX A;  2AV7 A;  4G8I A;  3VXR A;  1HOC A;  4L9L C;  4WUU A;  4HUW A;  4IRJ A;  2V2X A;  2VLK A;  5FDW A;  3O9W A;  3VXM A;  3FTG A;  3GMP A;  3HAE A;  2NW3 A;  4EI5 A;  2BVO A;  4JFQ A;  5FKP A;  4MNG A;  1OF2 A;  5FA3 A;  3CH1 A;  1GZQ A;  3D3V A;  4PJI A;  5J1A A;  1C16 A;  3WS6 A;  1DE4 A;  3QQ4 A;  3CZF A;  3HG1 A;  5DEF A;  1JGE A;  1K5N A;  4G42 A;  1HSA A;  3HCV A;  3L3G A;  1S7V A;  4LNR A;  2JCC A;  3MGT A;  1LD9 A;  4WO4 A;  2J8U A;  1FFN A;  3C8K A;  2VAB A;  3JVG A;  4O2F A;  1WBZ A;  1R3H A;  4I48 A;  2D31 A;  4QRU A;  4ELM A;  3ARE A;  3RL1 A;  5EO1 A;  3PWN A; 
#chains in the Genus database with same CATH topology
 3L3J A;  4BKW A;  4PJ7 A;  3LN5 A;  4QRQ A;  2GJ6 A;  3TVM A;  4NO3 A;  1TMC A;  5INC A;  2PO6 A;  4ZUW A;  1A9B A;  2CII A;  3TBW A;  3DTX A;  2BSR A;  4PRA A;  3DX8 A;  3RWD A;  2BST A;  3KXF A;  1FZK A;  3HPJ A;  4U1J A;  3TBT A;  3VFV A;  1ZHK A;  4K71 B;  5HHQ A;  4S0U C;  5D2N A;  1UXW A;  3V5K A;  1AGC A;  3MV7 A;  4PV9 A;  5BJT A;  5C0I A;  5MEO A;  3KLA A;  4QRR A;  1HHK A;  5SWZ A;  4G8G A;  3FOM A;  4I4W A;  5C0C A;  4NO5 A;  5C0E A;  1FFO A;  4D0D A;  4QRS A;  1NEZ A;  3X13 A;  5IRO A;  1B0G A;  1JFM A;  1E27 A;  3NFN A;  3B3I A;  3GMR A;  3CVH A;  4E0R A;  3VXO A;  1P7Q A;  3MRP A;  3DX6 A;  2FZ3 A;  3DXA A;  3I6K A;  2Q7Y A;  3QUX A;  1N2R A;  4NQD A;  3GSW A;  2CLV A;  3GMM A;  3ES6 A;  3FQR A;  5C0J A;  3AM8 A;  4N0F A;  4NO2 A;  3ARG A;  3BZF A;  3IT8 D;  3IXA A;  1MHC A;  1UXS A;  1FG2 A;  3AU1 A;  4Z76 A;  3GJF A;  4JFE A;  1Q94 A;  1HSB A;  3P4M A;  3KPO A;  5B38 A;  2X4O A;  1FZJ A;  3GSX A;  3VFR A;  3BP4 A;  5MER A;  3ROL A;  1YN7 A;  5EU4 A;  4MS8 A;  1S9X A;  2AKR A;  5HGD A;  2UWE A;  1YN6 A;  1KPR A;  4PRH A;  1M05 A;  1INQ A;  3TO2 A;  3SDA A;  4ZUU A;  3E6H A;  3MRI A;  1A1O A;  2VLJ A;  4O2C A;  2CLZ A;  3RWE A;  2X4T A;  1CD1 A;  3CC5 A;  3O8X A;  4E5X A;  3RWI A;  3BVN A;  4MX7 A;  3FON A;  1QLF A;  4U1I A;  1X7Q A;  4IRS A;  3VXU A;  2OL3 H;  1LDP H;  3I0T A;  2ZOL A;  4PV8 A;  5EOT A;  4HX1 A;  5F1N A;  3OX8 A;  5C07 A;  3HE6 A;  3REW A;  4PJX A;  5SWQ A;  1IM9 A;  3SCM A;  3BW9 A;  3TN0 A;  5BS0 A;  4JQV A;  3FT3 A;  5F9J A;  3LKR A;  3VFS A;  1ZS8 A;  4LHU A;  2PYE A;  1E28 A;  3D25 A;  1S7Q A;  4L8B A;  1UQS A;  3HE7 A;  4LCC C;  2X4Q A;  2HJK A;  5EFI A;  1JPG A;  1KJM A;  1PQZ A;  2ESV A;  3L3K A;  3VFP A;  1QSF A;  4NQC A;  4U1N A;  3O4L A;  4G9D A;  1OSZ A;  2YPK A;  1T1X A;  3MV8 A;  3VRI A;  3M1B A;  1W0W A;  2HJL A;  1ONQ A;  3PWU A;  4JFD A;  1I1A A;  1S9Y A;  2GTZ A;  2RFX A;  2P5W A;  5E8N A;  4U1L A;  1LQV A;  4ZUS A;  3KPQ A;  3VFT A;  3W0W A;  4L8C A;  3QQ3 A;  4L8D A;  4MJI A;  3V5D A;  2AV1 A;  4N0U A;  4PJF A;  1ZVS A;  1XZ0 A;  3RUG A;  1DUZ A;  1T1Z A;  1ZT4 A;  4PGC A;  3QZW A;  1JF1 A;  1T7Y A;  4HV8 A;  3MRJ A;  1T1Y A;  4PJC A;  3JTC A;  3UTS A;  3L3H A;  2YEZ A;  4X6D A;  3P73 A;  1DDH A;  2X4R A;  2BSS A;  5HHM A;  4L4V A;  4NSK A;  5C0B A;  3BEV A;  4Y4K A;  3RWG A;  1WBX A;  2BCK A;  2FYY A;  4F7T A;  2XFX A;  1HYR C;  4F7P A;  1QEW A;  1T22 A;  4PP8 C;  1S7X A;  4NQE A;  3BH9 A;  3DMM A;  3VFM A;  2GAZ A;  5D7J C;  2VLL A;  4L29 A;  3PWV A;  1N5A A;  5E8P A;  1NAN H;  4PJA A;  4HKJ A;  3GMO A;  4PG2 A;  1EEY A;  2CKB H;  3KPM A;  3VH8 A;  1VAC A;  1T20 A;  3PWL A;  4MJ6 A;  2FWO A;  1RK0 A;  5IM7 A;  2YPL A;  3RWH A;  5C9J A;  5FA4 A;  3QEQ A;  3UTT A;  3KPN A;  4ONO A;  2DYP A;  3O3B A;  1B0R A;  4QRT A;  5IB5 A;  1HHI A;  4IIQ C;  4PDC E;  1AGD A;  4JFF A;  5IND A;  3MRC A;  3SJV A;  4JFP A;  4V3E B;  5BRZ A;  3BH8 A;  3WS3 A;  3L9R A;  1B3J A;  2IA1 A;  4Y16 A;  5EO0 A;  3VWJ A;  1I1F A;  1S7T A;  3SDC A;  3SDX A;  3P9L A;  3OXS A;  4APQ A;  3D2U A;  4CW1 A;  3LV3 A;  2OI9 A;  4L3C A;  5DDH A;  3UBX A;  3ROO A;  3MA7 A;  3KWW A;  3TFK A;  2HN7 A;  2VLR A;  1CG9 A;  3BXN A;  3ILP A;  3QFD A;  4U1S A;  3GML A;  4F7M A;  4FFE X;  1AKJ A;  4N0C A;  5IB3 A;  1T80 A;  3BEW A;  2AXF A;  4QRP A;  3QI9 A;  4PRB A;  5C0D A;  5HHO A;  5H94 A;  5EUO A;  3LKP A;  5D7L A;  5C08 A;  5E00 A;  3VXP A;  3E2H A;  1A6Z A;  4HUX A;  3GSU A;  3H9S A;  4JRY A;  2F54 A;  4L3E A;  4PJH A;  3MRM A;  3HLA A;  3QDJ A;  4LCW A;  4WWK C;  2FO4 A;  3BGM A;  1G6R H;  3BHB A;  3I6G A;  4PG9 A;  4PRE A;  1W72 A;  3VFO A;  3JTT A;  3JTS A;  5BXF A;  4LCY A;  3MRE A;  3LKN A;  5C0A A;  2CLR A;  1MHE A;  4ZUT A;  4JFO A;  4ZFZ A;  3ILQ C;  4NT6 A;  4G59 C;  4G9F A;  5E8O A;  3SKO A;  3FT2 A;  1S7U A;  1ED3 A;  5D7I A;  5B39 A;  3GSQ A;  3FRU A;  5C09 A;  2ZSW A;  3U0P A;  3LN4 A;  1TVH A;  3VFN A;  5HGB A;  3RWF A;  1ZHL A;  3MRR A;  3GSN H;  1XR9 A;  3VWK A;  1QR1 A;  3TID A;  3MV9 A;  3RZC A;  5J6G A;  1T7W A;  3D39 A;  3GIV A;  3X11 A;  2V2W A;  1QRN A;  3L3I A;  2ZOK A;  1AGE A;  4XXC A;  5E6I C;  3C9N A;  5HGH A;  2VE6 A;  4WDI A;  5C0F A;  3SDD A;  3UPR A;  1FZM A;  4PRI A;  2GT9 A;  3B6S A;  4PJE A;  3VXS A;  3KPR A;  3GMQ A;  2F53 A;  3SPV A;  1EFX A;  3WUW A;  3MRO A;  4N8V A;  3GSV A;  4MNQ A;  3I6L D;  2GTW A;  1QSE A;  1OGT A;  3MR9 A;  5F1I A;  3E3Q A;  1QQD A;  3MRK A;  3GSO A;  1HHJ A;  3PWP A;  4F7C A;  1I4F A;  4U6Y A;  1SYV A;  4QOK A;  1GZP A;  3QDG A;  3LKO A;  2BNQ A;  1I7T A;  5HHP A;  5L2K A;  5ACZ A;  4HWZ A;  1JGD A;  3MRL A;  1JPF A;  1KTL A;  4EUP A;  1HHH A;  1AGB A;  1EXU A;  1I1Y A;  1KJV A;  1MI5 A;  2HLA A;  4PRP A;  1T0N A;  2FIK A;  4PGD A;  3G08 A;  3PQY A;  4NHU E;  3RWC A;  5DEG A;  1NAM H;  3P4O A;  4U1M A;  1XR8 A;  4L8S C;  1HHG A;  2AK4 A;  3O3A A;  4GKS A;  4G59 A;  5MEN A;  1KPV A;  1YPZ A;  2A83 A;  1A1M A;  4JRX A;  3RWJ A;  1KPU A;  1W0V A;  5HYJ A;  1U58 A;  1P1Z A;  1QVO A;  4WJ5 A;  3BWA A;  2VAA A;  2BVP A;  1T1W A;  4PRN A;  4NQX A;  4PJ8 A;  2F74 A;  4V3D B;  3V5H A;  4L4T A;  3ARF A;  2C7U A;  4PJD A;  1T7X A;  2GIT A;  1EEZ A;  3D18 A;  4PGB A;  4U1K A;  3QDM A;  4Z78 A;  3KPP A;  3KYN A;  1S7S A;  2AXG A;  2BNR A;  3MRB A;  4IHO A;  3RGV C;  1T0M A;  2X4U A;  2X4N A;  3GSR A;  3VCL A;  4F7E A;  3TBS A;  4Y2D A;  1BQH A;  1S8D A;  3TF7 A;  3MRF A;  3KPL A;  3BUY A;  3T1F A;  3P77 A;  5IVX A;  1G7P A;  1KBG H;  5IB4 A;  5J6H A;  3X14 A;  3OXR A;  1P4L A;  3CDG A;  1BZ9 A;  1LK2 A;  1N3N A;  3FQX A;  3FQU A;  1T21 A;  3KYO A;  2P5E A;  3QUZ A;  2NX5 A;  3PAB A;  4U6X A;  3LKS A;  2X4P A;  4X6C A;  4ZAK A;  3KPS A;  4Y4F A;  3P9M A;  3VJ6 A;  4JQX A;  3VFU A;  1T7V A;  2H26 A;  4U1H A;  5EU5 A;  5L2J A;  3BZE A;  5GSV A;  3WLB A;  5JHD A;  5GSR A;  3DX7 A;  3UTQ A;  1BD2 A;  3TO4 A;  4D0C A;  5E9D A;  1LEK A;  3OV6 A;  4NNX A;  1Z5L A;  1RK1 A;  2H6P A;  3HUJ A;  1RJZ A;  3QUK A;  3FT4 A;  1FFP A;  5EU6 A;  3MRD A;  3DBX A;  5HGA A;  4PGE A;  3FQW A;  3T8X A;  1FZO A;  4Y4H A;  3WL9 A;  4D0B A;  5MEQ A;  2BVQ A;  3X12 A;  4GUP A;  1K8D A;  4NO0 A;  1M6O A;  4EN3 C;  4PJ5 A;  5C0G A;  3PWJ A;  3L3D A;  1ZT7 A;  4UQ2 A;  3FOL A;  4WW2 C;  3QFJ A;  1QO3 A;  1KJ2 H;  3CPL A;  3FQN A;  3H7B A;  4WU7 A;  1OGA A;  3MRN A;  4N5E A;  1ZHN A;  3TBV A;  3RL2 A;  4MQ7 A;  5D9S A;  1I7U A;  3W39 A;  1G7Q A;  2WY3 A;  1L8J A;  4HUU A;  3ARB A;  3M17 A;  4PR5 A;  1XH3 A;  4MJ5 A;  5ENW A;  1MWA H;  3QUY A;  3S6C A;  1JHT A;  5D2L A;  4PRD A;  4NNY A;  5EU3 A;  5F7D A;  3TBY A;  5ISZ A;  3H9H A;  3MRH A;  2XPG A;  1S7R A;  1KCG C;  1ZT1 A;  2E7L E;  1AGF A;  4X6F A;  1ZAG A;  3GMN A;  4G43 A;  3ECB A;  5IB2 A;  1AO7 A;  2X70 A;  2MHA A;  1I7R A;  3RTQ A;  1SYS A;  3TPU E;  4O2E A;  4PJG A;  1IM3 A;  3O3D A;  3TZV C;  1CE6 A;  2GUO A;  2X4S A;  5HHN A;  3CCH A;  1DUY A;  5D5M A;  4GKN A;  3MGO A;  3QUL A;  1KJ3 H;  4PJ9 A;  1ZSD A;  3MRQ A;  4Z77 A;  4HUV A;  3LKQ A;  4X6E A;  3TIE A;  3VRJ A;  5AD0 A;  3TJH A;  5IEH A;  3O3E A;  3MYJ A;  1ZHB A;  3BP7 A;  1S9W A;  5IB1 A;  1A9E A;  1T7Z A;  3E6F A;  1FO0 H;  5IEK A;  4WU5 A;  2CIK A;  1TVB A;  1RJY A;  4FTV A;  3VFW A;  1BII A;  1N59 A;  3BO8 A;  3VXN A;  4CVZ A;  3SKM A;  4HS3 A;  1JE6 A;  5SWS A;  4UQ3 A;  3ERY A;  1A1N A;  1S7W A;  1VAD A;  1VGK A;  3FQT A;  4K7F A;  4PJB A;  4ZUV A;  1YDP A;  2ZSV A;  3FFC A;  1WBY A;  3P4N A;  2O5N A;  4MXQ A;  3MRG A;  4NQV A;  3ARD A;  1JUF A;  3TA3 A;  5MEP A;  4MVB A;  1LEG A;  1LP9 A;  4CVX A;  2AV7 A;  4G8I A;  2NYK A;  3VXR A;  1HOC A;  4L9L C;  4WUU A;  4HUW A;  4IRJ A;  2V2X A;  2VLK A;  5FDW A;  3O9W A;  3VXM A;  3FTG A;  3GMP A;  3HAE A;  2NW3 A;  4EI5 A;  2BVO A;  4JFQ A;  5FKP A;  4MNG A;  1OF2 A;  5FA3 A;  3CH1 A;  1GZQ A;  3D3V A;  4PJI A;  5J1A A;  1C16 A;  3WS6 A;  1DE4 A;  3QQ4 A;  3CZF A;  3HG1 A;  5DEF A;  1JGE A;  1K5N A;  4JO8 A;  4G42 A;  1HSA A;  3HCV A;  3L3G A;  1S7V A;  4LNR A;  2JCC A;  3MGT A;  1LD9 A;  4WO4 A;  2J8U A;  1FFN A;  3C8K A;  2VAB A;  3JVG A;  4O2F A;  1WBZ A;  1R3H A;  4I48 A;  2D31 A;  4QRU A;  4ELM A;  3ARE A;  3RL1 A;  5EO1 A;  3PWN A; 
#chains in the Genus database with same CATH homology
 3L3J A;  4PJ7 A;  3LN5 A;  4QRQ A;  2GJ6 A;  3TVM A;  4NO3 A;  1TMC A;  5INC A;  2PO6 A;  4ZUW A;  1A9B A;  2CII A;  3TBW A;  3DTX A;  2BSR A;  4PRA A;  3DX8 A;  3RWD A;  2BST A;  3KXF A;  1FZK A;  3HPJ A;  4U1J A;  3TBT A;  3VFV A;  1ZHK A;  4K71 B;  5HHQ A;  4S0U C;  5D2N A;  1UXW A;  3V5K A;  1AGC A;  3MV7 A;  4PV9 A;  5BJT A;  5C0I A;  5MEO A;  3KLA A;  4QRR A;  1HHK A;  5SWZ A;  4G8G A;  3FOM A;  4I4W A;  5C0C A;  4NO5 A;  5C0E A;  1FFO A;  4D0D A;  4QRS A;  1NEZ A;  3X13 A;  5IRO A;  1B0G A;  1JFM A;  1E27 A;  3NFN A;  3B3I A;  3GMR A;  3CVH A;  4E0R A;  3VXO A;  1P7Q A;  3MRP A;  3DX6 A;  2FZ3 A;  3DXA A;  3I6K A;  2Q7Y A;  3QUX A;  1N2R A;  4NQD A;  3GSW A;  2CLV A;  3GMM A;  3ES6 A;  3FQR A;  5C0J A;  3AM8 A;  4N0F A;  4NO2 A;  3ARG A;  3BZF A;  3IT8 D;  3IXA A;  1MHC A;  1UXS A;  1FG2 A;  3AU1 A;  4Z76 A;  3GJF A;  4JFE A;  1Q94 A;  1HSB A;  3P4M A;  3KPO A;  5B38 A;  2X4O A;  1FZJ A;  3GSX A;  3VFR A;  3BP4 A;  5MER A;  3ROL A;  1YN7 A;  5EU4 A;  4MS8 A;  1S9X A;  2AKR A;  5HGD A;  2UWE A;  1YN6 A;  1KPR A;  4PRH A;  1M05 A;  1INQ A;  3TO2 A;  3SDA A;  4ZUU A;  3E6H A;  3MRI A;  1A1O A;  2VLJ A;  4O2C A;  2CLZ A;  3RWE A;  2X4T A;  1CD1 A;  3CC5 A;  3O8X A;  4E5X A;  3RWI A;  3BVN A;  4MX7 A;  3FON A;  1QLF A;  4U1I A;  1X7Q A;  4IRS A;  3VXU A;  2OL3 H;  1LDP H;  2ZOL A;  4PV8 A;  5EOT A;  4HX1 A;  5F1N A;  3OX8 A;  5C07 A;  3HE6 A;  3REW A;  4PJX A;  5SWQ A;  1IM9 A;  3SCM A;  3BW9 A;  3TN0 A;  5BS0 A;  4JQV A;  3FT3 A;  5F9J A;  3LKR A;  3VFS A;  1ZS8 A;  4LHU A;  2PYE A;  1E28 A;  3D25 A;  1S7Q A;  4L8B A;  1UQS A;  3HE7 A;  4LCC C;  2X4Q A;  2HJK A;  5EFI A;  1JPG A;  1KJM A;  1PQZ A;  2ESV A;  3L3K A;  3VFP A;  1QSF A;  4NQC A;  4U1N A;  3O4L A;  4G9D A;  1OSZ A;  2YPK A;  1T1X A;  3MV8 A;  3VRI A;  3M1B A;  1W0W A;  2HJL A;  1ONQ A;  3PWU A;  4JFD A;  1I1A A;  1S9Y A;  2GTZ A;  2RFX A;  2P5W A;  5E8N A;  4U1L A;  1LQV A;  4ZUS A;  3KPQ A;  3VFT A;  3W0W A;  4L8C A;  3QQ3 A;  4L8D A;  4MJI A;  3V5D A;  2AV1 A;  4N0U A;  4PJF A;  1ZVS A;  1XZ0 A;  3RUG A;  1DUZ A;  1T1Z A;  1ZT4 A;  4PGC A;  3QZW A;  1JF1 A;  1T7Y A;  4HV8 A;  3MRJ A;  1T1Y A;  4PJC A;  3JTC A;  3UTS A;  3L3H A;  2YEZ A;  4X6D A;  3P73 A;  1DDH A;  2X4R A;  2BSS A;  5HHM A;  4L4V A;  4NSK A;  5C0B A;  3BEV A;  4Y4K A;  3RWG A;  1WBX A;  2BCK A;  2FYY A;  4F7T A;  2XFX A;  1HYR C;  4F7P A;  1QEW A;  1T22 A;  4PP8 C;  1S7X A;  4NQE A;  3BH9 A;  3DMM A;  3VFM A;  2GAZ A;  5D7J C;  2VLL A;  4L29 A;  3PWV A;  1N5A A;  5E8P A;  1NAN H;  4PJA A;  4HKJ A;  3GMO A;  4PG2 A;  1EEY A;  2CKB H;  3KPM A;  3VH8 A;  1VAC A;  1T20 A;  3PWL A;  4MJ6 A;  2FWO A;  1RK0 A;  5IM7 A;  2YPL A;  3RWH A;  5C9J A;  5FA4 A;  3QEQ A;  3UTT A;  3KPN A;  4ONO A;  2DYP A;  3O3B A;  1B0R A;  4QRT A;  5IB5 A;  1HHI A;  4IIQ C;  4PDC E;  1AGD A;  4JFF A;  5IND A;  3MRC A;  3SJV A;  4JFP A;  4V3E B;  5BRZ A;  3BH8 A;  3WS3 A;  3L9R A;  1B3J A;  4Y16 A;  5EO0 A;  3VWJ A;  1I1F A;  1S7T A;  3SDC A;  3SDX A;  3P9L A;  3OXS A;  4APQ A;  3D2U A;  4CW1 A;  3LV3 A;  2OI9 A;  4L3C A;  5DDH A;  3UBX A;  3ROO A;  3MA7 A;  3KWW A;  3TFK A;  2HN7 A;  2VLR A;  1CG9 A;  3BXN A;  3ILP A;  3QFD A;  4U1S A;  3GML A;  4F7M A;  4FFE X;  1AKJ A;  4N0C A;  5IB3 A;  1T80 A;  3BEW A;  2AXF A;  4QRP A;  3QI9 A;  4PRB A;  5C0D A;  5HHO A;  5H94 A;  5EUO A;  3LKP A;  5D7L A;  5C08 A;  5E00 A;  3VXP A;  3E2H A;  1A6Z A;  4HUX A;  3GSU A;  3H9S A;  4JRY A;  2F54 A;  4L3E A;  4PJH A;  3MRM A;  3HLA A;  3QDJ A;  4LCW A;  4WWK C;  2FO4 A;  3BGM A;  1G6R H;  3BHB A;  3I6G A;  4PG9 A;  4PRE A;  1W72 A;  3VFO A;  3JTT A;  3JTS A;  5BXF A;  4LCY A;  3MRE A;  3LKN A;  5C0A A;  2CLR A;  1MHE A;  4ZUT A;  4JFO A;  4ZFZ A;  3ILQ C;  4NT6 A;  4G9F A;  5E8O A;  3SKO A;  3FT2 A;  1S7U A;  1ED3 A;  5D7I A;  5B39 A;  3GSQ A;  3FRU A;  5C09 A;  2ZSW A;  3U0P A;  3LN4 A;  1TVH A;  3VFN A;  5HGB A;  3RWF A;  1ZHL A;  3MRR A;  3GSN H;  1XR9 A;  3VWK A;  1QR1 A;  3TID A;  3MV9 A;  3RZC A;  5J6G A;  1T7W A;  3D39 A;  3GIV A;  3X11 A;  2V2W A;  1QRN A;  3L3I A;  2ZOK A;  1AGE A;  4XXC A;  5E6I C;  3C9N A;  5HGH A;  2VE6 A;  4WDI A;  5C0F A;  3SDD A;  3UPR A;  1FZM A;  4PRI A;  2GT9 A;  3B6S A;  4PJE A;  3VXS A;  3KPR A;  3GMQ A;  2F53 A;  3SPV A;  1EFX A;  3WUW A;  3MRO A;  4N8V A;  3GSV A;  4MNQ A;  3I6L D;  2GTW A;  1QSE A;  1OGT A;  3MR9 A;  5F1I A;  3E3Q A;  1QQD A;  3MRK A;  3GSO A;  1HHJ A;  3PWP A;  4F7C A;  1I4F A;  4U6Y A;  1SYV A;  4QOK A;  1GZP A;  3QDG A;  3LKO A;  2BNQ A;  1I7T A;  5HHP A;  5L2K A;  5ACZ A;  4HWZ A;  1JGD A;  3MRL A;  1JPF A;  1KTL A;  4EUP A;  1HHH A;  1AGB A;  1EXU A;  1I1Y A;  1KJV A;  1MI5 A;  2HLA A;  4PRP A;  1T0N A;  2FIK A;  4PGD A;  3G08 A;  3PQY A;  4NHU E;  3RWC A;  5DEG A;  1NAM H;  3P4O A;  4U1M A;  1XR8 A;  4L8S C;  1HHG A;  2AK4 A;  3O3A A;  4GKS A;  4G59 A;  5MEN A;  1KPV A;  1YPZ A;  2A83 A;  1A1M A;  4JRX A;  3RWJ A;  1KPU A;  1W0V A;  5HYJ A;  1U58 A;  1P1Z A;  1QVO A;  4WJ5 A;  3BWA A;  2VAA A;  2BVP A;  1T1W A;  4PRN A;  4NQX A;  4PJ8 A;  2F74 A;  4V3D B;  3V5H A;  4L4T A;  3ARF A;  2C7U A;  4PJD A;  1T7X A;  2GIT A;  1EEZ A;  3D18 A;  4PGB A;  4U1K A;  3QDM A;  4Z78 A;  3KPP A;  3KYN A;  1S7S A;  2AXG A;  2BNR A;  3MRB A;  4IHO A;  3RGV C;  1T0M A;  2X4U A;  2X4N A;  3GSR A;  3VCL A;  4F7E A;  3TBS A;  4Y2D A;  1BQH A;  1S8D A;  3TF7 A;  3MRF A;  3KPL A;  3BUY A;  3T1F A;  3P77 A;  5IVX A;  1G7P A;  1KBG H;  5IB4 A;  5J6H A;  3X14 A;  3OXR A;  1P4L A;  3CDG A;  1BZ9 A;  1LK2 A;  1N3N A;  3FQX A;  3FQU A;  1T21 A;  3KYO A;  2P5E A;  3QUZ A;  2NX5 A;  3PAB A;  4U6X A;  3LKS A;  2X4P A;  4X6C A;  4ZAK A;  3KPS A;  4Y4F A;  3P9M A;  3VJ6 A;  4JQX A;  3VFU A;  1T7V A;  2H26 A;  4U1H A;  5EU5 A;  5L2J A;  3BZE A;  5GSV A;  3WLB A;  5JHD A;  5GSR A;  3DX7 A;  3UTQ A;  1BD2 A;  3TO4 A;  4D0C A;  5E9D A;  1LEK A;  3OV6 A;  4NNX A;  1Z5L A;  1RK1 A;  2H6P A;  3HUJ A;  1RJZ A;  3QUK A;  3FT4 A;  1FFP A;  5EU6 A;  3MRD A;  3DBX A;  5HGA A;  4PGE A;  3FQW A;  3T8X A;  1FZO A;  4Y4H A;  3WL9 A;  4D0B A;  5MEQ A;  2BVQ A;  3X12 A;  4GUP A;  1K8D A;  4NO0 A;  1M6O A;  4EN3 C;  4PJ5 A;  5C0G A;  3PWJ A;  3L3D A;  1ZT7 A;  4UQ2 A;  3FOL A;  4WW2 C;  3QFJ A;  1QO3 A;  1KJ2 H;  3CPL A;  3FQN A;  3H7B A;  4WU7 A;  1OGA A;  3MRN A;  4N5E A;  1ZHN A;  3TBV A;  3RL2 A;  4MQ7 A;  5D9S A;  1I7U A;  3W39 A;  1G7Q A;  2WY3 A;  1L8J A;  4HUU A;  3ARB A;  3M17 A;  4PR5 A;  1XH3 A;  4MJ5 A;  5ENW A;  1MWA H;  3QUY A;  3S6C A;  1JHT A;  5D2L A;  4PRD A;  4NNY A;  5EU3 A;  5F7D A;  3TBY A;  5ISZ A;  3H9H A;  3MRH A;  2XPG A;  1S7R A;  1KCG C;  1ZT1 A;  2E7L E;  1AGF A;  4X6F A;  1ZAG A;  3GMN A;  4G43 A;  3ECB A;  5IB2 A;  1AO7 A;  2X70 A;  2MHA A;  1I7R A;  3RTQ A;  1SYS A;  3TPU E;  4O2E A;  4PJG A;  1IM3 A;  3O3D A;  3TZV C;  1CE6 A;  2GUO A;  2X4S A;  5HHN A;  3CCH A;  1DUY A;  5D5M A;  4GKN A;  3MGO A;  3QUL A;  1KJ3 H;  4PJ9 A;  1ZSD A;  3MRQ A;  4Z77 A;  4HUV A;  3LKQ A;  4X6E A;  3TIE A;  3VRJ A;  5AD0 A;  3TJH A;  5IEH A;  3O3E A;  3MYJ A;  1ZHB A;  3BP7 A;  1S9W A;  5IB1 A;  1A9E A;  1T7Z A;  3E6F A;  1FO0 H;  5IEK A;  4WU5 A;  2CIK A;  1TVB A;  1RJY A;  4FTV A;  3VFW A;  1BII A;  1N59 A;  3BO8 A;  3VXN A;  4CVZ A;  3SKM A;  4HS3 A;  1JE6 A;  5SWS A;  4UQ3 A;  3ERY A;  1A1N A;  1S7W A;  1VAD A;  1VGK A;  3FQT A;  4K7F A;  4PJB A;  4ZUV A;  1YDP A;  2ZSV A;  3FFC A;  1WBY A;  3P4N A;  4MXQ A;  4NQV A;  3MRG A;  5MEP A;  3ARD A;  1JUF A;  3TA3 A;  4MVB A;  1LEG A;  1LP9 A;  4CVX A;  2AV7 A;  4G8I A;  3VXR A;  1HOC A;  4L9L C;  4WUU A;  4HUW A;  4IRJ A;  2V2X A;  2VLK A;  5FDW A;  3O9W A;  3VXM A;  3FTG A;  3GMP A;  3HAE A;  2NW3 A;  4EI5 A;  2BVO A;  4JFQ A;  5FKP A;  4MNG A;  1OF2 A;  5FA3 A;  3CH1 A;  1GZQ A;  3D3V A;  4PJI A;  5J1A A;  1C16 A;  3WS6 A;  1DE4 A;  3QQ4 A;  3CZF A;  3HG1 A;  5DEF A;  1JGE A;  1K5N A;  4G42 A;  1HSA A;  3HCV A;  3L3G A;  1S7V A;  4LNR A;  2JCC A;  3MGT A;  1LD9 A;  4WO4 A;  2J8U A;  1FFN A;  3C8K A;  2VAB A;  3JVG A;  4O2F A;  1WBZ A;  1R3H A;  4I48 A;  2D31 A;  4QRU A;  4ELM A;  3ARE A;  3RL1 A;  5EO1 A;  3PWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...