3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
2X70A 1AGCA 1EEZA 1I7UA 2CLZA 3O9WA 5J1AA 3RGVC 3SDXA 4LNRA 3UTSA 3B3IA 3VJ6A 2FIKA 5F9JA 5SWQA 3VRIA 5L2JA 1PQZA 3ERYA 5B39A 3G08A 1E27A 1DE4A 3DX6A 1T0NA 3C8KA 1TVBA 4WWKC 3MRFA 4PJEA 3FTGA 3JTCA 1LDPH 4UQ2A 3RWGA 1HSBA 3L3JA 3QDGA 4K71B 3KYNA 4QOKA 4X6EA 3ARDA 3FQNA 3MRQA 3GMOA 4PRIA 4PGDA 4HS3A 4EUPA 5HHPA 1M6OA 4UQ3A 4PJIA 1ZT4A 5D2LA 1U58A 3TBSA 1T7VA 3GMQA 4U6XA 3SKMA 3LKQA 3ROLA 3MGTA 5D2NA 2XFXA 3QDMA 3JTTA 4MNQA 1ED3A 3B6SA 3VCLA 4JFEA 3D3VA 1EEYA 3WL9A 1YDPA 5E8NA 3H9SA 2GJ6A 3L3DA 5HHOA 4LCYA 4JFDA 3VFOA 3FONA 5EO0A 1P4LA 3E6HA 3ECBA 1UXSA 3GSVA 4G9DA 2P5WA 5D7LA 4L8SC 4F7PA 3QI9A 3KPMA 4HKJA 3WUWA 5E6IC 3QQ4A 3SDCA 3KYOA 1S8DA 1ZT1A 1OF2A 3HE6A 1KTLA 3HUJA 2OL3H 5HHMA 1JE6A 3PWJA 2AXGA 5C0BA 2F74A 4GKSA 3VFVA 3OV6A 3U0PA 2AV7A 2BVOA 3MRPA 4NO0A 5EU6A 4L8DA 4PGBA 2FZ3A 4PP8C 3HCVA 4IRJA 2BVQA 3VWJA 2X4OA 4G9FA 4QRPA 2HJLA 4NQEA 4WDIA 3VFSA 4JFQA 4G43A 3LKPA 3UPRA 1T20A 1S7QA 2GITA 3CZFA 3GSNH 4L8BA 4MJ6A 5C08A 3PWUA 3TPUE 2X4NA 5BS0A 3E2HA 4U1NA 4O2FA 1CG9A 1QO3A 3CPLA 2P5EA 3RL2A 3KPRA 5EFIA 3FT3A 5INDA 3TBWA 3GSQA 3TJHA 3ILPA 4PJ9A 3TIDA 2BNQA 3KPOA 5IB5A 1OGAA 4FTVA 3T1FA 3MRMA 5AD0A 1KCGC 5GSRA 1NANH 3DMMA 3OXSA 4PJFA 4ZUTA 5E8OA 3VFNA 3FRUA 3O4LA 2AV1A 3MYJA 5FDWA 3LKNA 5IB2A 4JFPA 1MHEA 2BSRA 4WW2C 1I7RA 2HJKA 1T1ZA 2BSSA 1HHHA 1W72A 3D39A 3HPJA 2HN7A 1VADA 5MERA 3FQWA 3KPPA 4HUVA 1N2RA 1S7XA 2FWOA 4JQXA 3GJFA 1B3JA 1LEGA 4ONOA 4G8IA 4WU7A 3SDDA 1XZ0A 3HLAA 1WBZA 2PO6A 4L3EA 3MRIA 4PJGA 3VFRA 5ENWA 5JHDA 1KPVA 2ZOLA 3QUYA 4JRXA 4F7EA 3W0WA 4IRSA 3GSWA 4HUWA 3RL1A 3MRJA 1Q94A 3BWAA 3UTQA 3VRJA 3VWKA 4XXCA 3RWJA 3QEQA 3QUXA 5D9SA 5IB3A 5F7DA 3GMPA 4ZUUA 1FO0H 1G7PA 1TVHA 3VXSA 2H6PA 4NHUE 1T7WA 4V3DB 1GZQA 1JGDA 5FA4A 5IEKA 3CVHA 3TA3A 1QEWA 1ZSDA 3BZEA 4Z77A 4Y4FA 1T21A 1A1MA 1G6RH 1ZHLA 1G7QA 3O3EA 4U1JA 2V2WA 3KWWA 3QDJA 3FQUA 1CD1A 3BEWA 1L8JA 2ZSVA 4G42A 4X6FA 3LV3A 2VLJA 4Y16A 1T7ZA 3L3IA 3P4MA 2GT9A 1FZKA 3MREA 2H26A 5MEQA 2YPLA 1FG2A 3DX7A 3HG1A 1BD2A 4Z76A 3MRRA 3DXAA 3BXNA 3MRBA 1WBXA 3GSUA 3MR9A 4PRPA 3VXNA 3BZFA 4CVZA 3MV8A 1T0MA 3KLAA 3P73A 4U1SA 2Q7YA 3LKOA 2JCCA 3GSXA 2VAAA 1T80A 3UTTA 5SWZA 2ESVA 2X4UA 4X6CA 4O2EA 4PDCE 4D0CA 3V5KA 3TN0A 3W39A 1A1NA 3P4OA 1A9BA 1YPZA 5FA3A 2UWEA 4PRHA 4EN3C 2MHAA 3BVNA 1ZS8A 2CIIA 4I4WA 1S7WA 4D0BA 3D18A 4ZUWA 4QRTA 5C09A 1HHIA 3HAEA 3BO8A 2VLRA 3I6GA 1QLFA 4MNGA 2F54A 4WUUA 3VH8A 1S7TA 1YN7A 3GSRA 4PJDA 4N5EA 3QUZA 3HE7A 1T7XA 1HSAA 3QULA 3P9MA 4MJ5A 4PRBA 1T7YA 4NNXA 1QR1A 5DDHA 4L4VA 4U6YA 2YPKA 4N0CA 5EUOA 4CW1A 4CVXA 1N3NA 1QVOA 1A6ZA 3FT4A 5C0DA 3BW9A 2X4QA 3FQXA 3PQYA 1QQDA 4PJAA 5EOTA 5GSVA 3I6LD 1X7QA 4PJ8A 2XPGA 1JF1A 3MRGA 3UBXA 3RWDA 2NX5A 3L3KA 3MV9A 1B0RA 2ZSWA 4MXQA 2BNRA 1M05A 4LCWA 5MENA 2BVPA 4HWZA 4NQVA 3P4NA 5HYJA 3X12A 2A83A 3LKSA 1QSEA 1B0GA 1EFXA 1GZPA 3CH1A 1I4FA 1MHCA 5E00A 5INCA 1CE6A 3MRNA 3LN5A 2NW3A 5IEHA 4PJBA 1FZMA 1ZHBA 3KPLA 5HHQA 1FFOA 4ZAKA 3REWA 4QRUA 1S7UA 1RJYA 3VXRA 3WS6A 3L3GA 4IIQC 4S0UC 3DBXA 5MEPA 1T1YA 1RK1A 4ZUSA 3S6CA 2GAZA 4NNYA 4LCCC 1JGEA 3GSOA 1HOCA 1HYRC 4NO3A 5HGBA 1Z5LA 5DEFA 5IM7A 4PG2A 1QSFA 2VLKA 4WO4A 3VFUA 3D25A 4F7TA 3T8XA 3BP7A 4L29A 5ISZA 3SPVA 1KJ3H 3TFKA 4MVBA 3FFCA 3BH8A 1FFNA 3FQTA 1I1FA 3X11A 3PWLA 1QRNA 4PJCA 3BH9A 3ARBA 3VXOA 1XH3A 3SKOA 4Y4HA 1XR9A 4N0FA 1FZOA 4U1HA 5C0IA 4NO2A 5EU4A 1BZ9A 2AXFA 3GMLA 5C07A 1VGKA 5EU5A 1DDHA 2RFXA 1I1YA 3TBVA 5B38A 1SYVA 5E9DA 3E3QA 1LEKA 3FQRA 1KBGH 3RZCA 5F1IA 3TO4A 1IM3A 3BEVA 4NSKA 3MGOA 3O3BA 1UQSA 4WJ5A 1RJZA 1SYSA 5C0EA 3I6KA 5IB4A 5D7IA 4E0RA 1JPFA 2X4TA 3PABA 3IT8D 1OSZA 2PYEA 2FO4A 3VFMA 4EI5A 4NQDA 3ILQC 4GUPA 5DEGA 1S7RA 3VXPA 5C0JA 5D5MA 1LD9A 3PWVA 1KPRA 1YN6A 3QZWA 2GUOA 1BQHA 5BRZA 5J6HA 1AGBA 3GMMA 3IXAA 4PRNA 1N59A 4G59A 1S9XA 2HLAA 1S9YA 4NQXA 3VFPA 4IHOA 4K7FA 1DUYA 5FKPA 3TIEA 1XR8A 3FOMA 1NAMH 4PG9A 1LP9A 3GIVA 4ZUVA 3TF7A 1AGFA 3FOLA 4PGCA 3MV7A 2VE6A 3BGMA 4L8CA 2GTWA 1HHGA 2YEZA 4PGEA 4PV9A 4MS8A 1ZT7A 4I48A 4MJIA 4MQ7A 4WU5A 4GKNA 4F7CA 5HHNA 3PWNA 2CLRA 5C0CA 3FT2A 1AGEA 3H9HA 5D7JC 2F53A 3GMRA 3GMNA 2X4PA 2CLVA 4APQA 3DTXA 4PREA 4PRAA 5C0FA 3LKRA 5EO1A 5H94A 5HGHA 3WS3A 1JHTA 4X6DA 5C0AA 3M17A 5J6GA 3CDGA 1ZHNA 3OXRA 2DYPA 1MWAH 3AREA 5HGAA 1E28A 1AGDA 5IROA 4N8VA 2BCKA 3P9LA 1DUZA 1S7VA 4ELMA 3MRKA 3CC5A 4HUUA 3BUYA 3NFNA 1UXWA 1R3HA 3KPQA 2BSTA 4Y4KA 3SJVA 3RWEA 3ES6A 5BJTA 3QUKA 5MEOA 3L3HA 1MI5A 1BIIA 4LHUA 4PJ7A 1EXUA 4PJHA 4JRYA 2X4RA 5F1NA 3CCHA 4PRDA 1NEZA 2FYYA 3KPNA 1FZJA 1T22A 3JVGA 3MRHA 4Z78A 3TBYA 5BXFA 1INQA 1C16A 4PR5A 1OGTA 1W0WA 2E7LE 1T1XA 1I1AA 2GTZA 4JFFA 3SCMA 3V5DA 4JFOA 3VFTA 3QFJA 3VXMA 4F7MA 1KJMA 3RTQA 3MA7A 3RWFA 3O8XA 2CIKA 3TBTA 2D31A 1S9WA 2J8UA 1JPGA 3O3DA 1VACA 3JTSA 3AM8A 1K8DA 3D2UA 1P1ZA 4HX1A 3MROA 4L9LC 4PJXA 3E6FA 3OX8A 4E5XA 1LQVA 4N0UA 4U1KA 3PWPA 3TO2A 1KJ2H 1W0VA 3VXUA 3KXFA 3BHBA 3ROOA 1LK2A 3P77A 3TVMA 1I7TA 1KPUA 4QRQA 1JUFA 4U1LA 4U1IA 3ARFA 3WLBA 2AK4A 5C0GA 2X4SA 3H7BA 3KPSA 4V3EB 3V5HA 4L3CA 3RWHA 1JFMA 3L9RA 4FFEX 1KJVA 3VFWA 1AKJA 3QFDA 1FFPA 2CKBH 4JQVA 1WBYA 3O3AA 3SDAA 1TMCA 5IVXA 5L2KA 2C7UA 1RK0A 3MRDA 4L4TA 4QRSA 1HHJA 2WY3A 2OI9A 5IB1A 3DX8A 3MRCA 4D0DA 5SWSA 4NO5A 5HGDA 5C9JA 4Y2DA 2AKRA 2V2XA 1ZVSA 3MRLA 1A9EA 4HV8A 4ZFZA 4PJ5A 1ZHKA 3RWIA 4NQCA 1S7SA 4NT6A 4U1MA 1N5AA 3ARGA 4O2CA 3QQ3A 1P7QA 3BP4A 3LN4A 3TZVC 2VABA 5ACZA 3M1BA 5E8PA 1ZAGA 3RUGA 1IM9A 3RWCA 4QRRA 4HUXA 3AU1A 1AO7A 3C9NA 1T1WA 4PV8A 4MX7A 2ZOKA 1A1OA 3X13A 5EU3A 3X14A 1K5NA 4G8GA 1HHKA 1ONQA 2VLLA
chains in the Genus database with same CATH superfamily
2X70A 1AGCA 1EEZA 1I7UA 2CLZA 3O9WA 5J1AA 3RGVC 3SDXA 4LNRA 3UTSA 3B3IA 3VJ6A 2FIKA 5F9JA 5SWQA 3VRIA 5L2JA 1PQZA 3ERYA 5B39A 3G08A 1E27A 1DE4A 3DX6A 1T0NA 3C8KA 1TVBA 4WWKC 3MRFA 4PJEA 3FTGA 3JTCA 1LDPH 4UQ2A 3RWGA 1HSBA 3L3JA 3QDGA 4K71B 3KYNA 4QOKA 4X6EA 3ARDA 3FQNA 3MRQA 3GMOA 4PRIA 4PGDA 4HS3A 4EUPA 5HHPA 1M6OA 4UQ3A 4PJIA 1ZT4A 5D2LA 1U58A 3TBSA 1T7VA 3GMQA 4U6XA 3SKMA 3LKQA 3ROLA 3MGTA 5D2NA 2XFXA 3QDMA 3JTTA 4MNQA 1ED3A 3B6SA 3VCLA 4JFEA 3D3VA 1EEYA 3WL9A 1YDPA 5E8NA 3H9SA 2GJ6A 3L3DA 5HHOA 4LCYA 4JFDA 3VFOA 3FONA 5EO0A 1P4LA 3E6HA 3ECBA 1UXSA 3GSVA 4G9DA 2P5WA 5D7LA 4L8SC 4F7PA 3QI9A 3KPMA 4HKJA 3WUWA 5E6IC 3QQ4A 3SDCA 3KYOA 1S8DA 1ZT1A 1OF2A 3HE6A 1KTLA 3HUJA 2OL3H 5HHMA 1JE6A 3PWJA 2AXGA 5C0BA 2F74A 4GKSA 3VFVA 3OV6A 3U0PA 2AV7A 2BVOA 3MRPA 4NO0A 5EU6A 4L8DA 4PGBA 2FZ3A 4PP8C 3HCVA 4IRJA 2BVQA 3VWJA 2X4OA 4G9FA 4QRPA 2HJLA 4NQEA 4WDIA 3VFSA 4JFQA 4G43A 3LKPA 3UPRA 1T20A 1S7QA 2GITA 3CZFA 3GSNH 4L8BA 4MJ6A 5C08A 3PWUA 3TPUE 2X4NA 5BS0A 3E2HA 4U1NA 4O2FA 1CG9A 1QO3A 3CPLA 2P5EA 3RL2A 3KPRA 5EFIA 3FT3A 5INDA 3TBWA 3GSQA 3TJHA 3ILPA 4PJ9A 3TIDA 2BNQA 3KPOA 5IB5A 1OGAA 4FTVA 3T1FA 3MRMA 5AD0A 1KCGC 5GSRA 1NANH 3DMMA 3OXSA 4PJFA 4ZUTA 5E8OA 3VFNA 3FRUA 3O4LA 2AV1A 3MYJA 5FDWA 3LKNA 5IB2A 4JFPA 1MHEA 2BSRA 4WW2C 1I7RA 2HJKA 1T1ZA 2BSSA 1HHHA 1W72A 3D39A 3HPJA 2HN7A 1VADA 5MERA 3FQWA 3KPPA 4HUVA 1N2RA 1S7XA 2FWOA 4JQXA 3GJFA 1B3JA 1LEGA 4ONOA 4G8IA 4WU7A 3SDDA 1XZ0A 3HLAA 1WBZA 2PO6A 4L3EA 3MRIA 4PJGA 3VFRA 5ENWA 5JHDA 1KPVA 2ZOLA 3QUYA 4JRXA 4F7EA 3W0WA 4IRSA 3GSWA 4HUWA 3RL1A 3MRJA 1Q94A 3BWAA 3UTQA 3VRJA 3VWKA 4XXCA 3RWJA 3QEQA 3QUXA 5D9SA 5IB3A 5F7DA 3GMPA 4ZUUA 1FO0H 1G7PA 1TVHA 3VXSA 2H6PA 4NHUE 1T7WA 4V3DB 1GZQA 1JGDA 5FA4A 5IEKA 3CVHA 3TA3A 1QEWA 1ZSDA 3BZEA 4Z77A 4Y4FA 1T21A 1A1MA 1G6RH 1ZHLA 1G7QA 3O3EA 4U1JA 2V2WA 3KWWA 3QDJA 3FQUA 1CD1A 3BEWA 1L8JA 2ZSVA 4G42A 4X6FA 3LV3A 2VLJA 4Y16A 1T7ZA 3L3IA 3P4MA 2GT9A 1FZKA 3MREA 2H26A 5MEQA 2YPLA 1FG2A 3DX7A 3HG1A 1BD2A 4Z76A 3MRRA 3DXAA 3BXNA 3MRBA 1WBXA 3GSUA 3MR9A 4PRPA 3VXNA 3BZFA 4CVZA 3MV8A 1T0MA 3KLAA 3P73A 4U1SA 2Q7YA 3LKOA 2JCCA 3GSXA 2VAAA 1T80A 3UTTA 5SWZA 2ESVA 2X4UA 4X6CA 4O2EA 4PDCE 4D0CA 3V5KA 3TN0A 3W39A 1A1NA 3P4OA 1A9BA 1YPZA 5FA3A 2UWEA 4PRHA 4EN3C 2MHAA 3BVNA 1ZS8A 2CIIA 4I4WA 1S7WA 4D0BA 3D18A 4ZUWA 4QRTA 5C09A 1HHIA 3HAEA 3BO8A 2VLRA 3I6GA 1QLFA 4MNGA 2F54A 4WUUA 3VH8A 1S7TA 1YN7A 3GSRA 4PJDA 4N5EA 3QUZA 3HE7A 1T7XA 1HSAA 3QULA 3P9MA 4MJ5A 4PRBA 1T7YA 4NNXA 1QR1A 5DDHA 2IA1A 4L4VA 4U6YA 2YPKA 4N0CA 5EUOA 4CW1A 4CVXA 1N3NA 1QVOA 1A6ZA 3FT4A 5C0DA 3BW9A 2X4QA 3FQXA 3PQYA 1QQDA 4PJAA 5EOTA 5GSVA 3I6LD 1X7QA 4PJ8A 2XPGA 1JF1A 3MRGA 3UBXA 3RWDA 2NX5A 3L3KA 3MV9A 1B0RA 2ZSWA 4MXQA 2BNRA 1M05A 4LCWA 5MENA 2BVPA 4HWZA 4NQVA 3P4NA 5HYJA 3X12A 2A83A 3LKSA 1QSEA 1B0GA 1EFXA 1GZPA 3CH1A 1I4FA 1MHCA 5E00A 5INCA 1CE6A 3MRNA 3LN5A 2NW3A 5IEHA 4PJBA 1FZMA 1ZHBA 3KPLA 5HHQA 1FFOA 4ZAKA 3REWA 4QRUA 1S7UA 1RJYA 3VXRA 3WS6A 3L3GA 4IIQC 4S0UC 3DBXA 5MEPA 1T1YA 1RK1A 4ZUSA 3S6CA 2GAZA 4NNYA 4LCCC 1JGEA 3GSOA 1HOCA 1HYRC 4NO3A 5HGBA 1Z5LA 5DEFA 5IM7A 4PG2A 1QSFA 2VLKA 4WO4A 3VFUA 3D25A 4F7TA 3T8XA 3BP7A 4L29A 5ISZA 3SPVA 1KJ3H 3TFKA 4MVBA 3FFCA 3BH8A 1FFNA 3FQTA 1I1FA 3X11A 3PWLA 1QRNA 4PJCA 3BH9A 3ARBA 3VXOA 1XH3A 3SKOA 4Y4HA 1XR9A 4N0FA 1FZOA 4U1HA 5C0IA 4NO2A 5EU4A 1BZ9A 2AXFA 3GMLA 5C07A 1VGKA 5EU5A 1DDHA 2RFXA 1I1YA 3TBVA 5B38A 1SYVA 4G59C 5E9DA 3E3QA 1LEKA 3FQRA 1KBGH 3RZCA 5F1IA 3TO4A 1IM3A 3BEVA 4NSKA 3MGOA 3O3BA 1UQSA 4WJ5A 1RJZA 1SYSA 5C0EA 3I6KA 5IB4A 5D7IA 4E0RA 1JPFA 2X4TA 3PABA 2NYKA 3IT8D 1OSZA 2PYEA 2FO4A 3VFMA 4EI5A 4NQDA 3ILQC 4GUPA 5DEGA 1S7RA 3VXPA 5C0JA 5D5MA 1LD9A 3PWVA 1KPRA 1YN6A 3QZWA 2GUOA 1BQHA 5BRZA 5J6HA 1AGBA 3GMMA 3IXAA 4PRNA 1N59A 4G59A 1S9XA 2HLAA 1S9YA 4NQXA 3VFPA 4IHOA 4K7FA 1DUYA 5FKPA 3TIEA 1XR8A 3FOMA 1NAMH 4PG9A 1LP9A 3GIVA 4ZUVA 3TF7A 1AGFA 3FOLA 4PGCA 3MV7A 2VE6A 3BGMA 4L8CA 2GTWA 1HHGA 2YEZA 4PGEA 4PV9A 4MS8A 1ZT7A 4I48A 4MJIA 4MQ7A 4WU5A 4GKNA 4F7CA 5HHNA 3PWNA 2CLRA 5C0CA 3FT2A 1AGEA 3H9HA 5D7JC 2F53A 3GMRA 3I0TA 3GMNA 2X4PA 2CLVA 4APQA 3DTXA 4PREA 4PRAA 5C0FA 3LKRA 5EO1A 5H94A 5HGHA 3WS3A 1JHTA 4X6DA 5C0AA 3M17A 5J6GA 3CDGA 1ZHNA 3OXRA 2O5NA 2DYPA 1MWAH 3AREA 5HGAA 1E28A 1AGDA 5IROA 4N8VA 2BCKA 3P9LA 1DUZA 1S7VA 4ELMA 3MRKA 3CC5A 4HUUA 3BUYA 3NFNA 1UXWA 1R3HA 3KPQA 2BSTA 4Y4KA 3SJVA 3RWEA 3ES6A 5BJTA 3QUKA 5MEOA 3L3HA 1MI5A 1BIIA 4LHUA 4PJ7A 1EXUA 4PJHA 4JRYA 2X4RA 5F1NA 3CCHA 4PRDA 1NEZA 2FYYA 3KPNA 1FZJA 1T22A 3JVGA 3MRHA 4Z78A 3TBYA 5BXFA 1INQA 1C16A 4PR5A 1OGTA 1W0WA 2E7LE 1T1XA 1I1AA 2GTZA 4JFFA 3SCMA 3V5DA 4JFOA 3VFTA 3QFJA 3VXMA 4F7MA 1KJMA 3RTQA 3MA7A 3RWFA 3O8XA 2CIKA 3TBTA 2D31A 1S9WA 2J8UA 1JPGA 3O3DA 1VACA 3JTSA 3AM8A 1K8DA 3D2UA 1P1ZA 4HX1A 3MROA 4L9LC 4PJXA 3E6FA 3OX8A 4E5XA 1LQVA 4N0UA 4U1KA 3PWPA 3TO2A 1KJ2H 1W0VA 3VXUA 3KXFA 3BHBA 3ROOA 1LK2A 3P77A 3TVMA 1I7TA 1KPUA 4QRQA 1JUFA 4U1LA 4U1IA 3ARFA 3WLBA 2AK4A 5C0GA 2X4SA 3H7BA 3KPSA 4V3EB 3V5HA 4L3CA 3RWHA 1JFMA 3L9RA 4FFEX 1KJVA 3VFWA 1AKJA 3QFDA 1FFPA 2CKBH 4JQVA 1WBYA 3O3AA 3SDAA 1TMCA 5IVXA 5L2KA 2C7UA 1RK0A 3MRDA 4L4TA 4QRSA 1HHJA 2WY3A 2OI9A 5IB1A 3DX8A 3MRCA 4D0DA 4JO8A 5SWSA 4NO5A 5HGDA 5C9JA 4Y2DA 2AKRA 2V2XA 1ZVSA 3MRLA 1A9EA 4HV8A 4ZFZA 4BKWA 4PJ5A 1ZHKA 3RWIA 4NQCA 1S7SA 4NT6A 4U1MA 1N5AA 3ARGA 4O2CA 3QQ3A 1P7QA 3BP4A 3LN4A 3TZVC 2VABA 5ACZA 3M1BA 5E8PA 1ZAGA 3RUGA 1IM9A 3RWCA 4QRRA 4HUXA 3AU1A 1AO7A 3C9NA 1T1WA 4PV8A 4MX7A 2ZOKA 1A1OA 3X13A 5EU3A 3X14A 1K5NA 4G8GA 1HHKA 1ONQA 2VLLA
chains in the Genus database with same CATH topology
2X70A 1AGCA 1EEZA 1I7UA 2CLZA 3O9WA 5J1AA 3RGVC 3SDXA 4LNRA 3UTSA 3B3IA 3VJ6A 2FIKA 5F9JA 5SWQA 3VRIA 5L2JA 1PQZA 3ERYA 5B39A 3G08A 1E27A 1DE4A 3DX6A 1T0NA 3C8KA 1TVBA 4WWKC 3MRFA 4PJEA 3FTGA 3JTCA 1LDPH 4UQ2A 3RWGA 1HSBA 3L3JA 3QDGA 4K71B 3KYNA 4QOKA 4X6EA 3ARDA 3FQNA 3MRQA 3GMOA 4PRIA 4PGDA 4HS3A 4EUPA 5HHPA 1M6OA 4UQ3A 4PJIA 1ZT4A 5D2LA 1U58A 3TBSA 1T7VA 3GMQA 4U6XA 3SKMA 3LKQA 3ROLA 3MGTA 5D2NA 2XFXA 3QDMA 3JTTA 4MNQA 1ED3A 3B6SA 3VCLA 4JFEA 3D3VA 1EEYA 3WL9A 1YDPA 5E8NA 3H9SA 2GJ6A 3L3DA 5HHOA 4LCYA 4JFDA 3VFOA 3FONA 5EO0A 1P4LA 3E6HA 3ECBA 1UXSA 3GSVA 4G9DA 2P5WA 5D7LA 4L8SC 4F7PA 3QI9A 3KPMA 4HKJA 3WUWA 5E6IC 3QQ4A 3SDCA 3KYOA 1S8DA 1ZT1A 1OF2A 3HE6A 1KTLA 3HUJA 2OL3H 5HHMA 1JE6A 3PWJA 2AXGA 5C0BA 2F74A 4GKSA 3VFVA 3OV6A 3U0PA 2AV7A 2BVOA 3MRPA 4NO0A 5EU6A 4L8DA 4PGBA 2FZ3A 4PP8C 3HCVA 4IRJA 2BVQA 3VWJA 2X4OA 4G9FA 4QRPA 2HJLA 4NQEA 4WDIA 3VFSA 4JFQA 4G43A 3LKPA 3UPRA 1T20A 1S7QA 2GITA 3CZFA 3GSNH 4L8BA 4MJ6A 5C08A 3PWUA 3TPUE 2X4NA 5BS0A 3E2HA 4U1NA 4O2FA 1CG9A 1QO3A 3CPLA 2P5EA 3RL2A 3KPRA 5EFIA 3FT3A 5INDA 3TBWA 3GSQA 3TJHA 3ILPA 4PJ9A 3TIDA 2BNQA 3KPOA 5IB5A 1OGAA 4FTVA 3T1FA 3MRMA 5AD0A 1KCGC 5GSRA 1NANH 3DMMA 3OXSA 4PJFA 4ZUTA 5E8OA 3VFNA 3FRUA 3O4LA 2AV1A 3MYJA 5FDWA 3LKNA 5IB2A 4JFPA 1MHEA 2BSRA 4WW2C 1I7RA 2HJKA 1T1ZA 2BSSA 1HHHA 1W72A 3D39A 3HPJA 2HN7A 1VADA 5MERA 3FQWA 3KPPA 4HUVA 1N2RA 1S7XA 2FWOA 4JQXA 3GJFA 1B3JA 1LEGA 4ONOA 4G8IA 4WU7A 3SDDA 1XZ0A 3HLAA 1WBZA 2PO6A 4L3EA 3MRIA 4PJGA 3VFRA 5ENWA 5JHDA 1KPVA 2ZOLA 3QUYA 4JRXA 4F7EA 3W0WA 4IRSA 3GSWA 4HUWA 3RL1A 3MRJA 1Q94A 3BWAA 3UTQA 3VRJA 3VWKA 4XXCA 3RWJA 3QEQA 3QUXA 5D9SA 5IB3A 5F7DA 3GMPA 4ZUUA 1FO0H 1G7PA 1TVHA 3VXSA 2H6PA 4NHUE 1T7WA 4V3DB 1GZQA 1JGDA 5FA4A 5IEKA 3CVHA 3TA3A 1QEWA 1ZSDA 3BZEA 4Z77A 4Y4FA 1T21A 1A1MA 1G6RH 1ZHLA 1G7QA 3O3EA 4U1JA 2V2WA 3KWWA 3QDJA 3FQUA 1CD1A 3BEWA 1L8JA 2ZSVA 4G42A 4X6FA 3LV3A 2VLJA 4Y16A 1T7ZA 3L3IA 3P4MA 2GT9A 1FZKA 3MREA 2H26A 5MEQA 2YPLA 1FG2A 3DX7A 3HG1A 1BD2A 4Z76A 3MRRA 3DXAA 3BXNA 3MRBA 1WBXA 3GSUA 3MR9A 4PRPA 3VXNA 3BZFA 4CVZA 3MV8A 1T0MA 3KLAA 3P73A 4U1SA 2Q7YA 3LKOA 2JCCA 3GSXA 2VAAA 1T80A 3UTTA 5SWZA 2ESVA 2X4UA 4X6CA 4O2EA 4PDCE 4D0CA 3V5KA 3TN0A 3W39A 1A1NA 3P4OA 1A9BA 1YPZA 5FA3A 2UWEA 4PRHA 4EN3C 2MHAA 3BVNA 1ZS8A 2CIIA 4I4WA 1S7WA 4D0BA 3D18A 4ZUWA 4QRTA 5C09A 1HHIA 3HAEA 3BO8A 2VLRA 3I6GA 1QLFA 4MNGA 2F54A 4WUUA 3VH8A 1S7TA 1YN7A 3GSRA 4PJDA 4N5EA 3QUZA 3HE7A 1T7XA 1HSAA 3QULA 3P9MA 4MJ5A 4PRBA 1T7YA 4NNXA 1QR1A 5DDHA 4L4VA 4U6YA 2YPKA 4N0CA 5EUOA 4CW1A 4CVXA 1N3NA 1QVOA 1A6ZA 3FT4A 5C0DA 3BW9A 2X4QA 3FQXA 3PQYA 1QQDA 4PJAA 5EOTA 5GSVA 3I6LD 1X7QA 4PJ8A 2XPGA 1JF1A 3MRGA 3UBXA 3RWDA 2NX5A 3L3KA 3MV9A 1B0RA 2ZSWA 4MXQA 2BNRA 1M05A 4LCWA 5MENA 2BVPA 4HWZA 4NQVA 3P4NA 5HYJA 3X12A 2A83A 3LKSA 1QSEA 1B0GA 1EFXA 1GZPA 3CH1A 1I4FA 1MHCA 5E00A 5INCA 1CE6A 3MRNA 3LN5A 2NW3A 5IEHA 4PJBA 1FZMA 1ZHBA 3KPLA 5HHQA 1FFOA 4ZAKA 3REWA 4QRUA 1S7UA 1RJYA 3VXRA 3WS6A 3L3GA 4IIQC 4S0UC 3DBXA 5MEPA 1T1YA 1RK1A 4ZUSA 3S6CA 2GAZA 4NNYA 4LCCC 1JGEA 3GSOA 1HOCA 1HYRC 4NO3A 5HGBA 1Z5LA 5DEFA 5IM7A 4PG2A 1QSFA 2VLKA 4WO4A 3VFUA 3D25A 4F7TA 3T8XA 3BP7A 4L29A 5ISZA 3SPVA 1KJ3H 3TFKA 4MVBA 3FFCA 3BH8A 1FFNA 3FQTA 1I1FA 3X11A 3PWLA 1QRNA 4PJCA 3BH9A 3ARBA 3VXOA 1XH3A 3SKOA 4Y4HA 1XR9A 4N0FA 1FZOA 4U1HA 5C0IA 4NO2A 5EU4A 1BZ9A 2AXFA 3GMLA 5C07A 1VGKA 5EU5A 1DDHA 2RFXA 1I1YA 3TBVA 5B38A 1SYVA 5E9DA 3E3QA 1LEKA 3FQRA 1KBGH 3RZCA 5F1IA 3TO4A 1IM3A 3BEVA 4NSKA 3MGOA 3O3BA 1UQSA 4WJ5A 1RJZA 1SYSA 5C0EA 3I6KA 5IB4A 5D7IA 4E0RA 1JPFA 2X4TA 3PABA 3IT8D 1OSZA 2PYEA 2FO4A 3VFMA 4EI5A 4NQDA 3ILQC 4GUPA 5DEGA 1S7RA 3VXPA 5C0JA 5D5MA 1LD9A 3PWVA 1KPRA 1YN6A 3QZWA 2GUOA 1BQHA 5BRZA 5J6HA 1AGBA 3GMMA 3IXAA 4PRNA 1N59A 4G59A 1S9XA 2HLAA 1S9YA 4NQXA 3VFPA 4IHOA 4K7FA 1DUYA 5FKPA 3TIEA 1XR8A 3FOMA 1NAMH 4PG9A 1LP9A 3GIVA 4ZUVA 3TF7A 1AGFA 3FOLA 4PGCA 3MV7A 2VE6A 3BGMA 4L8CA 2GTWA 1HHGA 2YEZA 4PGEA 4PV9A 4MS8A 1ZT7A 4I48A 4MJIA 4MQ7A 4WU5A 4GKNA 4F7CA 5HHNA 3PWNA 2CLRA 5C0CA 3FT2A 1AGEA 3H9HA 5D7JC 2F53A 3GMRA 3GMNA 2X4PA 2CLVA 4APQA 3DTXA 4PREA 4PRAA 5C0FA 3LKRA 5EO1A 5H94A 5HGHA 3WS3A 1JHTA 4X6DA 5C0AA 3M17A 5J6GA 3CDGA 1ZHNA 3OXRA 2DYPA 1MWAH 3AREA 5HGAA 1E28A 1AGDA 5IROA 4N8VA 2BCKA 3P9LA 1DUZA 1S7VA 4ELMA 3MRKA 3CC5A 4HUUA 3BUYA 3NFNA 1UXWA 1R3HA 3KPQA 2BSTA 4Y4KA 3SJVA 3RWEA 3ES6A 5BJTA 3QUKA 5MEOA 3L3HA 1MI5A 1BIIA 4LHUA 4PJ7A 1EXUA 4PJHA 4JRYA 2X4RA 5F1NA 3CCHA 4PRDA 1NEZA 2FYYA 3KPNA 1FZJA 1T22A 3JVGA 3MRHA 4Z78A 3TBYA 5BXFA 1INQA 1C16A 4PR5A 1OGTA 1W0WA 2E7LE 1T1XA 1I1AA 2GTZA 4JFFA 3SCMA 3V5DA 4JFOA 3VFTA 3QFJA 3VXMA 4F7MA 1KJMA 3RTQA 3MA7A 3RWFA 3O8XA 2CIKA 3TBTA 2D31A 1S9WA 2J8UA 1JPGA 3O3DA 1VACA 3JTSA 3AM8A 1K8DA 3D2UA 1P1ZA 4HX1A 3MROA 4L9LC 4PJXA 3E6FA 3OX8A 4E5XA 1LQVA 4N0UA 4U1KA 3PWPA 3TO2A 1KJ2H 1W0VA 3VXUA 3KXFA 3BHBA 3ROOA 1LK2A 3P77A 3TVMA 1I7TA 1KPUA 4QRQA 1JUFA 4U1LA 4U1IA 3ARFA 3WLBA 2AK4A 5C0GA 2X4SA 3H7BA 3KPSA 4V3EB 3V5HA 4L3CA 3RWHA 1JFMA 3L9RA 4FFEX 1KJVA 3VFWA 1AKJA 3QFDA 1FFPA 2CKBH 4JQVA 1WBYA 3O3AA 3SDAA 1TMCA 5IVXA 5L2KA 2C7UA 1RK0A 3MRDA 4L4TA 4QRSA 1HHJA 2WY3A 2OI9A 5IB1A 3DX8A 3MRCA 4D0DA 5SWSA 4NO5A 5HGDA 5C9JA 4Y2DA 2AKRA 2V2XA 1ZVSA 3MRLA 1A9EA 4HV8A 4ZFZA 4PJ5A 1ZHKA 3RWIA 4NQCA 1S7SA 4NT6A 4U1MA 1N5AA 3ARGA 4O2CA 3QQ3A 1P7QA 3BP4A 3LN4A 3TZVC 2VABA 5ACZA 3M1BA 5E8PA 1ZAGA 3RUGA 1IM9A 3RWCA 4QRRA 4HUXA 3AU1A 1AO7A 3C9NA 1T1WA 4PV8A 4MX7A 2ZOKA 1A1OA 3X13A 5EU3A 3X14A 1K5NA 4G8GA 1HHKA 1ONQA 2VLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X70 A;  1AGC A;  1EEZ A;  1I7U A;  2CLZ A;  3O9W A;  5J1A A;  3RGV C;  3SDX A;  4LNR A;  3UTS A;  3B3I A;  3VJ6 A;  2FIK A;  5F9J A;  5SWQ A;  3VRI A;  5L2J A;  1PQZ A;  3ERY A;  5B39 A;  3G08 A;  1E27 A;  1DE4 A;  3DX6 A;  1T0N A;  3C8K A;  1TVB A;  4WWK C;  3MRF A;  4PJE A;  3FTG A;  3JTC A;  1LDP H;  4UQ2 A;  3RWG A;  1HSB A;  3L3J A;  3QDG A;  4K71 B;  3KYN A;  4QOK A;  4X6E A;  3ARD A;  3FQN A;  3MRQ A;  3GMO A;  4PRI A;  4PGD A;  4HS3 A;  4EUP A;  5HHP A;  1M6O A;  4UQ3 A;  4PJI A;  1ZT4 A;  5D2L A;  1U58 A;  3TBS A;  1T7V A;  3GMQ A;  4U6X A;  3SKM A;  3LKQ A;  3ROL A;  3MGT A;  5D2N A;  2XFX A;  3QDM A;  3JTT A;  4MNQ A;  1ED3 A;  3B6S A;  3VCL A;  4JFE A;  3D3V A;  1EEY A;  3WL9 A;  1YDP A;  5E8N A;  3H9S A;  2GJ6 A;  3L3D A;  5HHO A;  4LCY A;  4JFD A;  3VFO A;  3FON A;  5EO0 A;  1P4L A;  3E6H A;  3ECB A;  1UXS A;  3GSV A;  4G9D A;  2P5W A;  5D7L A;  4L8S C;  4F7P A;  3QI9 A;  3KPM A;  4HKJ A;  3WUW A;  5E6I C;  3QQ4 A;  3SDC A;  3KYO A;  1S8D A;  1ZT1 A;  1OF2 A;  3HE6 A;  1KTL A;  3HUJ A;  2OL3 H;  5HHM A;  1JE6 A;  3PWJ A;  2AXG A;  5C0B A;  2F74 A;  4GKS A;  3VFV A;  3OV6 A;  3U0P A;  2AV7 A;  2BVO A;  3MRP A;  4NO0 A;  5EU6 A;  4L8D A;  4PGB A;  2FZ3 A;  4PP8 C;  3HCV A;  4IRJ A;  2BVQ A;  3VWJ A;  2X4O A;  4G9F A;  4QRP A;  2HJL A;  4NQE A;  4WDI A;  3VFS A;  4JFQ A;  4G43 A;  3LKP A;  3UPR A;  1T20 A;  1S7Q A;  2GIT A;  3CZF A;  3GSN H;  4L8B A;  4MJ6 A;  5C08 A;  3PWU A;  3TPU E;  2X4N A;  5BS0 A;  3E2H A;  4U1N A;  4O2F A;  1CG9 A;  1QO3 A;  3CPL A;  2P5E A;  3RL2 A;  3KPR A;  5EFI A;  3FT3 A;  5IND A;  3TBW A;  3GSQ A;  3TJH A;  3ILP A;  4PJ9 A;  3TID A;  2BNQ A;  3KPO A;  5IB5 A;  1OGA A;  4FTV A;  3T1F A;  3MRM A;  5AD0 A;  1KCG C;  5GSR A;  1NAN H;  3DMM A;  3OXS A;  4PJF A;  4ZUT A;  5E8O A;  3VFN A;  3FRU A;  3O4L A;  2AV1 A;  3MYJ A;  5FDW A;  3LKN A;  5IB2 A;  4JFP A;  1MHE A;  2BSR A;  4WW2 C;  1I7R A;  2HJK A;  1T1Z A;  2BSS A;  1HHH A;  1W72 A;  3D39 A;  3HPJ A;  2HN7 A;  1VAD A;  5MER A;  3FQW A;  3KPP A;  4HUV A;  1N2R A;  1S7X A;  2FWO A;  4JQX A;  3GJF A;  1B3J A;  1LEG A;  4ONO A;  4G8I A;  4WU7 A;  3SDD A;  1XZ0 A;  3HLA A;  1WBZ A;  2PO6 A;  4L3E A;  3MRI A;  4PJG A;  3VFR A;  5ENW A;  5JHD A;  1KPV A;  2ZOL A;  3QUY A;  4JRX A;  4F7E A;  3W0W A;  4IRS A;  3GSW A;  4HUW A;  3RL1 A;  3MRJ A;  1Q94 A;  3BWA A;  3UTQ A;  3VRJ A;  3VWK A;  4XXC A;  3RWJ A;  3QEQ A;  3QUX A;  5D9S A;  5IB3 A;  5F7D A;  3GMP A;  4ZUU A;  1FO0 H;  1G7P A;  1TVH A;  3VXS A;  2H6P A;  4NHU E;  1T7W A;  4V3D B;  1GZQ A;  1JGD A;  5FA4 A;  5IEK A;  3CVH A;  3TA3 A;  1QEW A;  1ZSD A;  3BZE A;  4Z77 A;  4Y4F A;  1T21 A;  1A1M A;  1G6R H;  1ZHL A;  1G7Q A;  3O3E A;  4U1J A;  2V2W A;  3KWW A;  3QDJ A;  3FQU A;  1CD1 A;  3BEW A;  1L8J A;  2ZSV A;  4G42 A;  4X6F A;  3LV3 A;  2VLJ A;  4Y16 A;  1T7Z A;  3L3I A;  3P4M A;  2GT9 A;  1FZK A;  3MRE A;  2H26 A;  5MEQ A;  2YPL A;  1FG2 A;  3DX7 A;  3HG1 A;  1BD2 A;  4Z76 A;  3MRR A;  3DXA A;  3BXN A;  3MRB A;  1WBX A;  3GSU A;  3MR9 A;  4PRP A;  3VXN A;  3BZF A;  4CVZ A;  3MV8 A;  1T0M A;  3KLA A;  3P73 A;  4U1S A;  2Q7Y A;  3LKO A;  2JCC A;  3GSX A;  2VAA A;  1T80 A;  3UTT A;  5SWZ A;  2ESV A;  2X4U A;  4X6C A;  4O2E A;  4PDC E;  4D0C A;  3V5K A;  3TN0 A;  3W39 A;  1A1N A;  3P4O A;  1A9B A;  1YPZ A;  5FA3 A;  2UWE A;  4PRH A;  4EN3 C;  2MHA A;  3BVN A;  1ZS8 A;  2CII A;  4I4W A;  1S7W A;  4D0B A;  3D18 A;  4ZUW A;  4QRT A;  5C09 A;  1HHI A;  3HAE A;  3BO8 A;  2VLR A;  3I6G A;  1QLF A;  4MNG A;  2F54 A;  4WUU A;  3VH8 A;  1S7T A;  1YN7 A;  3GSR A;  4PJD A;  4N5E A;  3QUZ A;  3HE7 A;  1T7X A;  1HSA A;  3QUL A;  3P9M A;  4MJ5 A;  4PRB A;  1T7Y A;  4NNX A;  1QR1 A;  5DDH A;  4L4V A;  4U6Y A;  2YPK A;  4N0C A;  5EUO A;  4CW1 A;  4CVX A;  1N3N A;  1QVO A;  1A6Z A;  3FT4 A;  5C0D A;  3BW9 A;  2X4Q A;  3FQX A;  3PQY A;  1QQD A;  4PJA A;  5EOT A;  5GSV A;  3I6L D;  1X7Q A;  4PJ8 A;  2XPG A;  1JF1 A;  3MRG A;  3UBX A;  3RWD A;  2NX5 A;  3L3K A;  3MV9 A;  1B0R A;  2ZSW A;  4MXQ A;  2BNR A;  1M05 A;  4LCW A;  5MEN A;  2BVP A;  4HWZ A;  4NQV A;  3P4N A;  5HYJ A;  3X12 A;  2A83 A;  3LKS A;  1QSE A;  1B0G A;  1EFX A;  1GZP A;  3CH1 A;  1I4F A;  1MHC A;  5E00 A;  5INC A;  1CE6 A;  3MRN A;  3LN5 A;  2NW3 A;  5IEH A;  4PJB A;  1FZM A;  1ZHB A;  3KPL A;  5HHQ A;  1FFO A;  4ZAK A;  3REW A;  4QRU A;  1S7U A;  1RJY A;  3VXR A;  3WS6 A;  3L3G A;  4IIQ C;  4S0U C;  3DBX A;  5MEP A;  1T1Y A;  1RK1 A;  4ZUS A;  3S6C A;  2GAZ A;  4NNY A;  4LCC C;  1JGE A;  3GSO A;  1HOC A;  1HYR C;  4NO3 A;  5HGB A;  1Z5L A;  5DEF A;  5IM7 A;  4PG2 A;  1QSF A;  2VLK A;  4WO4 A;  3VFU A;  3D25 A;  4F7T A;  3T8X A;  3BP7 A;  4L29 A;  5ISZ A;  3SPV A;  1KJ3 H;  3TFK A;  4MVB A;  3FFC A;  3BH8 A;  1FFN A;  3FQT A;  1I1F A;  3X11 A;  3PWL A;  1QRN A;  4PJC A;  3BH9 A;  3ARB A;  3VXO A;  1XH3 A;  3SKO A;  4Y4H A;  1XR9 A;  4N0F A;  1FZO A;  4U1H A;  5C0I A;  4NO2 A;  5EU4 A;  1BZ9 A;  2AXF A;  3GML A;  5C07 A;  1VGK A;  5EU5 A;  1DDH A;  2RFX A;  1I1Y A;  3TBV A;  5B38 A;  1SYV A;  5E9D A;  3E3Q A;  1LEK A;  3FQR A;  1KBG H;  3RZC A;  5F1I A;  3TO4 A;  1IM3 A;  3BEV A;  4NSK A;  3MGO A;  3O3B A;  1UQS A;  4WJ5 A;  1RJZ A;  1SYS A;  5C0E A;  3I6K A;  5IB4 A;  5D7I A;  4E0R A;  1JPF A;  2X4T A;  3PAB A;  3IT8 D;  1OSZ A;  2PYE A;  2FO4 A;  3VFM A;  4EI5 A;  4NQD A;  3ILQ C;  4GUP A;  5DEG A;  1S7R A;  3VXP A;  5C0J A;  5D5M A;  1LD9 A;  3PWV A;  1KPR A;  1YN6 A;  3QZW A;  2GUO A;  1BQH A;  5BRZ A;  5J6H A;  1AGB A;  3GMM A;  3IXA A;  4PRN A;  1N59 A;  4G59 A;  1S9X A;  2HLA A;  1S9Y A;  4NQX A;  3VFP A;  4IHO A;  4K7F A;  1DUY A;  5FKP A;  3TIE A;  1XR8 A;  3FOM A;  1NAM H;  4PG9 A;  1LP9 A;  3GIV A;  4ZUV A;  3TF7 A;  1AGF A;  3FOL A;  4PGC A;  3MV7 A;  2VE6 A;  3BGM A;  4L8C A;  2GTW A;  1HHG A;  2YEZ A;  4PGE A;  4PV9 A;  4MS8 A;  1ZT7 A;  4I48 A;  4MJI A;  4MQ7 A;  4WU5 A;  4GKN A;  4F7C A;  5HHN A;  3PWN A;  2CLR A;  5C0C A;  3FT2 A;  1AGE A;  3H9H A;  5D7J C;  2F53 A;  3GMR A;  3GMN A;  2X4P A;  2CLV A;  4APQ A;  3DTX A;  4PRE A;  4PRA A;  5C0F A;  3LKR A;  5EO1 A;  5H94 A;  5HGH A;  3WS3 A;  1JHT A;  4X6D A;  5C0A A;  3M17 A;  5J6G A;  3CDG A;  1ZHN A;  3OXR A;  2DYP A;  1MWA H;  3ARE A;  5HGA A;  1E28 A;  1AGD A;  5IRO A;  4N8V A;  2BCK A;  3P9L A;  1DUZ A;  1S7V A;  4ELM A;  3MRK A;  3CC5 A;  4HUU A;  3BUY A;  3NFN A;  1UXW A;  1R3H A;  3KPQ A;  2BST A;  4Y4K A;  3SJV A;  3RWE A;  3ES6 A;  5BJT A;  3QUK A;  5MEO A;  3L3H A;  1MI5 A;  1BII A;  4LHU A;  4PJ7 A;  1EXU A;  4PJH A;  4JRY A;  2X4R A;  5F1N A;  3CCH A;  4PRD A;  1NEZ A;  2FYY A;  3KPN A;  1FZJ A;  1T22 A;  3JVG A;  3MRH A;  4Z78 A;  3TBY A;  5BXF A;  1INQ A;  1C16 A;  4PR5 A;  1OGT A;  1W0W A;  2E7L E;  1T1X A;  1I1A A;  2GTZ A;  4JFF A;  3SCM A;  3V5D A;  4JFO A;  3VFT A;  3QFJ A;  3VXM A;  4F7M A;  1KJM A;  3RTQ A;  3MA7 A;  3RWF A;  3O8X A;  2CIK A;  3TBT A;  2D31 A;  1S9W A;  2J8U A;  1JPG A;  3O3D A;  1VAC A;  3JTS A;  3AM8 A;  1K8D A;  3D2U A;  1P1Z A;  4HX1 A;  3MRO A;  4L9L C;  4PJX A;  3E6F A;  3OX8 A;  4E5X A;  1LQV A;  4N0U A;  4U1K A;  3PWP A;  3TO2 A;  1KJ2 H;  1W0V A;  3VXU A;  3KXF A;  3BHB A;  3ROO A;  1LK2 A;  3P77 A;  3TVM A;  1I7T A;  1KPU A;  4QRQ A;  1JUF A;  4U1L A;  4U1I A;  3ARF A;  3WLB A;  2AK4 A;  5C0G A;  2X4S A;  3H7B A;  3KPS A;  4V3E B;  3V5H A;  4L3C A;  3RWH A;  1JFM A;  3L9R A;  4FFE X;  1KJV A;  3VFW A;  1AKJ A;  3QFD A;  1FFP A;  2CKB H;  4JQV A;  1WBY A;  3O3A A;  3SDA A;  1TMC A;  5IVX A;  5L2K A;  2C7U A;  1RK0 A;  3MRD A;  4L4T A;  4QRS A;  1HHJ A;  2WY3 A;  2OI9 A;  5IB1 A;  3DX8 A;  3MRC A;  4D0D A;  5SWS A;  4NO5 A;  5HGD A;  5C9J A;  4Y2D A;  2AKR A;  2V2X A;  1ZVS A;  3MRL A;  1A9E A;  4HV8 A;  4ZFZ A;  4PJ5 A;  1ZHK A;  3RWI A;  4NQC A;  1S7S A;  4NT6 A;  4U1M A;  1N5A A;  3ARG A;  4O2C A;  3QQ3 A;  1P7Q A;  3BP4 A;  3LN4 A;  3TZV C;  2VAB A;  5ACZ A;  3M1B A;  5E8P A;  1ZAG A;  3RUG A;  1IM9 A;  3RWC A;  4QRR A;  4HUX A;  3AU1 A;  1AO7 A;  3C9N A;  1T1W A;  4PV8 A;  4MX7 A;  2ZOK A;  1A1O A;  3X13 A;  5EU3 A;  3X14 A;  1K5N A;  4G8G A;  1HHK A;  1ONQ A;  2VLL A; 
#chains in the Genus database with same CATH topology
 2X70 A;  1AGC A;  1EEZ A;  1I7U A;  2CLZ A;  3O9W A;  5J1A A;  3RGV C;  3SDX A;  4LNR A;  3UTS A;  3B3I A;  3VJ6 A;  2FIK A;  5F9J A;  5SWQ A;  3VRI A;  5L2J A;  1PQZ A;  3ERY A;  5B39 A;  3G08 A;  1E27 A;  1DE4 A;  3DX6 A;  1T0N A;  3C8K A;  1TVB A;  4WWK C;  3MRF A;  4PJE A;  3FTG A;  3JTC A;  1LDP H;  4UQ2 A;  3RWG A;  1HSB A;  3L3J A;  3QDG A;  4K71 B;  3KYN A;  4QOK A;  4X6E A;  3ARD A;  3FQN A;  3MRQ A;  3GMO A;  4PRI A;  4PGD A;  4HS3 A;  4EUP A;  5HHP A;  1M6O A;  4UQ3 A;  4PJI A;  1ZT4 A;  5D2L A;  1U58 A;  3TBS A;  1T7V A;  3GMQ A;  4U6X A;  3SKM A;  3LKQ A;  3ROL A;  3MGT A;  5D2N A;  2XFX A;  3QDM A;  3JTT A;  4MNQ A;  1ED3 A;  3B6S A;  3VCL A;  4JFE A;  3D3V A;  1EEY A;  3WL9 A;  1YDP A;  5E8N A;  3H9S A;  2GJ6 A;  3L3D A;  5HHO A;  4LCY A;  4JFD A;  3VFO A;  3FON A;  5EO0 A;  1P4L A;  3E6H A;  3ECB A;  1UXS A;  3GSV A;  4G9D A;  2P5W A;  5D7L A;  4L8S C;  4F7P A;  3QI9 A;  3KPM A;  4HKJ A;  3WUW A;  5E6I C;  3QQ4 A;  3SDC A;  3KYO A;  1S8D A;  1ZT1 A;  1OF2 A;  3HE6 A;  1KTL A;  3HUJ A;  2OL3 H;  5HHM A;  1JE6 A;  3PWJ A;  2AXG A;  5C0B A;  2F74 A;  4GKS A;  3VFV A;  3OV6 A;  3U0P A;  2AV7 A;  2BVO A;  3MRP A;  4NO0 A;  5EU6 A;  4L8D A;  4PGB A;  2FZ3 A;  4PP8 C;  3HCV A;  4IRJ A;  2BVQ A;  3VWJ A;  2X4O A;  4G9F A;  4QRP A;  2HJL A;  4NQE A;  4WDI A;  3VFS A;  4JFQ A;  4G43 A;  3LKP A;  3UPR A;  1T20 A;  1S7Q A;  2GIT A;  3CZF A;  3GSN H;  4L8B A;  4MJ6 A;  5C08 A;  3PWU A;  3TPU E;  2X4N A;  5BS0 A;  3E2H A;  4U1N A;  4O2F A;  1CG9 A;  1QO3 A;  3CPL A;  2P5E A;  3RL2 A;  3KPR A;  5EFI A;  3FT3 A;  5IND A;  3TBW A;  3GSQ A;  3TJH A;  3ILP A;  4PJ9 A;  3TID A;  2BNQ A;  3KPO A;  5IB5 A;  1OGA A;  4FTV A;  3T1F A;  3MRM A;  5AD0 A;  1KCG C;  5GSR A;  1NAN H;  3DMM A;  3OXS A;  4PJF A;  4ZUT A;  5E8O A;  3VFN A;  3FRU A;  3O4L A;  2AV1 A;  3MYJ A;  5FDW A;  3LKN A;  5IB2 A;  4JFP A;  1MHE A;  2BSR A;  4WW2 C;  1I7R A;  2HJK A;  1T1Z A;  2BSS A;  1HHH A;  1W72 A;  3D39 A;  3HPJ A;  2HN7 A;  1VAD A;  5MER A;  3FQW A;  3KPP A;  4HUV A;  1N2R A;  1S7X A;  2FWO A;  4JQX A;  3GJF A;  1B3J A;  1LEG A;  4ONO A;  4G8I A;  4WU7 A;  3SDD A;  1XZ0 A;  3HLA A;  1WBZ A;  2PO6 A;  4L3E A;  3MRI A;  4PJG A;  3VFR A;  5ENW A;  5JHD A;  1KPV A;  2ZOL A;  3QUY A;  4JRX A;  4F7E A;  3W0W A;  4IRS A;  3GSW A;  4HUW A;  3RL1 A;  3MRJ A;  1Q94 A;  3BWA A;  3UTQ A;  3VRJ A;  3VWK A;  4XXC A;  3RWJ A;  3QEQ A;  3QUX A;  5D9S A;  5IB3 A;  5F7D A;  3GMP A;  4ZUU A;  1FO0 H;  1G7P A;  1TVH A;  3VXS A;  2H6P A;  4NHU E;  1T7W A;  4V3D B;  1GZQ A;  1JGD A;  5FA4 A;  5IEK A;  3CVH A;  3TA3 A;  1QEW A;  1ZSD A;  3BZE A;  4Z77 A;  4Y4F A;  1T21 A;  1A1M A;  1G6R H;  1ZHL A;  1G7Q A;  3O3E A;  4U1J A;  2V2W A;  3KWW A;  3QDJ A;  3FQU A;  1CD1 A;  3BEW A;  1L8J A;  2ZSV A;  4G42 A;  4X6F A;  3LV3 A;  2VLJ A;  4Y16 A;  1T7Z A;  3L3I A;  3P4M A;  2GT9 A;  1FZK A;  3MRE A;  2H26 A;  5MEQ A;  2YPL A;  1FG2 A;  3DX7 A;  3HG1 A;  1BD2 A;  4Z76 A;  3MRR A;  3DXA A;  3BXN A;  3MRB A;  1WBX A;  3GSU A;  3MR9 A;  4PRP A;  3VXN A;  3BZF A;  4CVZ A;  3MV8 A;  1T0M A;  3KLA A;  3P73 A;  4U1S A;  2Q7Y A;  3LKO A;  2JCC A;  3GSX A;  2VAA A;  1T80 A;  3UTT A;  5SWZ A;  2ESV A;  2X4U A;  4X6C A;  4O2E A;  4PDC E;  4D0C A;  3V5K A;  3TN0 A;  3W39 A;  1A1N A;  3P4O A;  1A9B A;  1YPZ A;  5FA3 A;  2UWE A;  4PRH A;  4EN3 C;  2MHA A;  3BVN A;  1ZS8 A;  2CII A;  4I4W A;  1S7W A;  4D0B A;  3D18 A;  4ZUW A;  4QRT A;  5C09 A;  1HHI A;  3HAE A;  3BO8 A;  2VLR A;  3I6G A;  1QLF A;  4MNG A;  2F54 A;  4WUU A;  3VH8 A;  1S7T A;  1YN7 A;  3GSR A;  4PJD A;  4N5E A;  3QUZ A;  3HE7 A;  1T7X A;  1HSA A;  3QUL A;  3P9M A;  4MJ5 A;  4PRB A;  1T7Y A;  4NNX A;  1QR1 A;  5DDH A;  2IA1 A;  4L4V A;  4U6Y A;  2YPK A;  4N0C A;  5EUO A;  4CW1 A;  4CVX A;  1N3N A;  1QVO A;  1A6Z A;  3FT4 A;  5C0D A;  3BW9 A;  2X4Q A;  3FQX A;  3PQY A;  1QQD A;  4PJA A;  5EOT A;  5GSV A;  3I6L D;  1X7Q A;  4PJ8 A;  2XPG A;  1JF1 A;  3MRG A;  3UBX A;  3RWD A;  2NX5 A;  3L3K A;  3MV9 A;  1B0R A;  2ZSW A;  4MXQ A;  2BNR A;  1M05 A;  4LCW A;  5MEN A;  2BVP A;  4HWZ A;  4NQV A;  3P4N A;  5HYJ A;  3X12 A;  2A83 A;  3LKS A;  1QSE A;  1B0G A;  1EFX A;  1GZP A;  3CH1 A;  1I4F A;  1MHC A;  5E00 A;  5INC A;  1CE6 A;  3MRN A;  3LN5 A;  2NW3 A;  5IEH A;  4PJB A;  1FZM A;  1ZHB A;  3KPL A;  5HHQ A;  1FFO A;  4ZAK A;  3REW A;  4QRU A;  1S7U A;  1RJY A;  3VXR A;  3WS6 A;  3L3G A;  4IIQ C;  4S0U C;  3DBX A;  5MEP A;  1T1Y A;  1RK1 A;  4ZUS A;  3S6C A;  2GAZ A;  4NNY A;  4LCC C;  1JGE A;  3GSO A;  1HOC A;  1HYR C;  4NO3 A;  5HGB A;  1Z5L A;  5DEF A;  5IM7 A;  4PG2 A;  1QSF A;  2VLK A;  4WO4 A;  3VFU A;  3D25 A;  4F7T A;  3T8X A;  3BP7 A;  4L29 A;  5ISZ A;  3SPV A;  1KJ3 H;  3TFK A;  4MVB A;  3FFC A;  3BH8 A;  1FFN A;  3FQT A;  1I1F A;  3X11 A;  3PWL A;  1QRN A;  4PJC A;  3BH9 A;  3ARB A;  3VXO A;  1XH3 A;  3SKO A;  4Y4H A;  1XR9 A;  4N0F A;  1FZO A;  4U1H A;  5C0I A;  4NO2 A;  5EU4 A;  1BZ9 A;  2AXF A;  3GML A;  5C07 A;  1VGK A;  5EU5 A;  1DDH A;  2RFX A;  1I1Y A;  3TBV A;  5B38 A;  1SYV A;  4G59 C;  5E9D A;  3E3Q A;  1LEK A;  3FQR A;  1KBG H;  3RZC A;  5F1I A;  3TO4 A;  1IM3 A;  3BEV A;  4NSK A;  3MGO A;  3O3B A;  1UQS A;  4WJ5 A;  1RJZ A;  1SYS A;  5C0E A;  3I6K A;  5IB4 A;  5D7I A;  4E0R A;  1JPF A;  2X4T A;  3PAB A;  2NYK A;  3IT8 D;  1OSZ A;  2PYE A;  2FO4 A;  3VFM A;  4EI5 A;  4NQD A;  3ILQ C;  4GUP A;  5DEG A;  1S7R A;  3VXP A;  5C0J A;  5D5M A;  1LD9 A;  3PWV A;  1KPR A;  1YN6 A;  3QZW A;  2GUO A;  1BQH A;  5BRZ A;  5J6H A;  1AGB A;  3GMM A;  3IXA A;  4PRN A;  1N59 A;  4G59 A;  1S9X A;  2HLA A;  1S9Y A;  4NQX A;  3VFP A;  4IHO A;  4K7F A;  1DUY A;  5FKP A;  3TIE A;  1XR8 A;  3FOM A;  1NAM H;  4PG9 A;  1LP9 A;  3GIV A;  4ZUV A;  3TF7 A;  1AGF A;  3FOL A;  4PGC A;  3MV7 A;  2VE6 A;  3BGM A;  4L8C A;  2GTW A;  1HHG A;  2YEZ A;  4PGE A;  4PV9 A;  4MS8 A;  1ZT7 A;  4I48 A;  4MJI A;  4MQ7 A;  4WU5 A;  4GKN A;  4F7C A;  5HHN A;  3PWN A;  2CLR A;  5C0C A;  3FT2 A;  1AGE A;  3H9H A;  5D7J C;  2F53 A;  3GMR A;  3I0T A;  3GMN A;  2X4P A;  2CLV A;  4APQ A;  3DTX A;  4PRE A;  4PRA A;  5C0F A;  3LKR A;  5EO1 A;  5H94 A;  5HGH A;  3WS3 A;  1JHT A;  4X6D A;  5C0A A;  3M17 A;  5J6G A;  3CDG A;  1ZHN A;  3OXR A;  2O5N A;  2DYP A;  1MWA H;  3ARE A;  5HGA A;  1E28 A;  1AGD A;  5IRO A;  4N8V A;  2BCK A;  3P9L A;  1DUZ A;  1S7V A;  4ELM A;  3MRK A;  3CC5 A;  4HUU A;  3BUY A;  3NFN A;  1UXW A;  1R3H A;  3KPQ A;  2BST A;  4Y4K A;  3SJV A;  3RWE A;  3ES6 A;  5BJT A;  3QUK A;  5MEO A;  3L3H A;  1MI5 A;  1BII A;  4LHU A;  4PJ7 A;  1EXU A;  4PJH A;  4JRY A;  2X4R A;  5F1N A;  3CCH A;  4PRD A;  1NEZ A;  2FYY A;  3KPN A;  1FZJ A;  1T22 A;  3JVG A;  3MRH A;  4Z78 A;  3TBY A;  5BXF A;  1INQ A;  1C16 A;  4PR5 A;  1OGT A;  1W0W A;  2E7L E;  1T1X A;  1I1A A;  2GTZ A;  4JFF A;  3SCM A;  3V5D A;  4JFO A;  3VFT A;  3QFJ A;  3VXM A;  4F7M A;  1KJM A;  3RTQ A;  3MA7 A;  3RWF A;  3O8X A;  2CIK A;  3TBT A;  2D31 A;  1S9W A;  2J8U A;  1JPG A;  3O3D A;  1VAC A;  3JTS A;  3AM8 A;  1K8D A;  3D2U A;  1P1Z A;  4HX1 A;  3MRO A;  4L9L C;  4PJX A;  3E6F A;  3OX8 A;  4E5X A;  1LQV A;  4N0U A;  4U1K A;  3PWP A;  3TO2 A;  1KJ2 H;  1W0V A;  3VXU A;  3KXF A;  3BHB A;  3ROO A;  1LK2 A;  3P77 A;  3TVM A;  1I7T A;  1KPU A;  4QRQ A;  1JUF A;  4U1L A;  4U1I A;  3ARF A;  3WLB A;  2AK4 A;  5C0G A;  2X4S A;  3H7B A;  3KPS A;  4V3E B;  3V5H A;  4L3C A;  3RWH A;  1JFM A;  3L9R A;  4FFE X;  1KJV A;  3VFW A;  1AKJ A;  3QFD A;  1FFP A;  2CKB H;  4JQV A;  1WBY A;  3O3A A;  3SDA A;  1TMC A;  5IVX A;  5L2K A;  2C7U A;  1RK0 A;  3MRD A;  4L4T A;  4QRS A;  1HHJ A;  2WY3 A;  2OI9 A;  5IB1 A;  3DX8 A;  3MRC A;  4D0D A;  4JO8 A;  5SWS A;  4NO5 A;  5HGD A;  5C9J A;  4Y2D A;  2AKR A;  2V2X A;  1ZVS A;  3MRL A;  1A9E A;  4HV8 A;  4ZFZ A;  4BKW A;  4PJ5 A;  1ZHK A;  3RWI A;  4NQC A;  1S7S A;  4NT6 A;  4U1M A;  1N5A A;  3ARG A;  4O2C A;  3QQ3 A;  1P7Q A;  3BP4 A;  3LN4 A;  3TZV C;  2VAB A;  5ACZ A;  3M1B A;  5E8P A;  1ZAG A;  3RUG A;  1IM9 A;  3RWC A;  4QRR A;  4HUX A;  3AU1 A;  1AO7 A;  3C9N A;  1T1W A;  4PV8 A;  4MX7 A;  2ZOK A;  1A1O A;  3X13 A;  5EU3 A;  3X14 A;  1K5N A;  4G8G A;  1HHK A;  1ONQ A;  2VLL A; 
#chains in the Genus database with same CATH homology
 2X70 A;  1AGC A;  1EEZ A;  1I7U A;  2CLZ A;  3O9W A;  5J1A A;  3RGV C;  3SDX A;  4LNR A;  3UTS A;  3B3I A;  3VJ6 A;  2FIK A;  5F9J A;  5SWQ A;  3VRI A;  5L2J A;  1PQZ A;  3ERY A;  5B39 A;  3G08 A;  1E27 A;  1DE4 A;  3DX6 A;  1T0N A;  3C8K A;  1TVB A;  4WWK C;  3MRF A;  4PJE A;  3FTG A;  3JTC A;  1LDP H;  4UQ2 A;  3RWG A;  1HSB A;  3L3J A;  3QDG A;  4K71 B;  3KYN A;  4QOK A;  4X6E A;  3ARD A;  3FQN A;  3MRQ A;  3GMO A;  4PRI A;  4PGD A;  4HS3 A;  4EUP A;  5HHP A;  1M6O A;  4UQ3 A;  4PJI A;  1ZT4 A;  5D2L A;  1U58 A;  3TBS A;  1T7V A;  3GMQ A;  4U6X A;  3SKM A;  3LKQ A;  3ROL A;  3MGT A;  5D2N A;  2XFX A;  3QDM A;  3JTT A;  4MNQ A;  1ED3 A;  3B6S A;  3VCL A;  4JFE A;  3D3V A;  1EEY A;  3WL9 A;  1YDP A;  5E8N A;  3H9S A;  2GJ6 A;  3L3D A;  5HHO A;  4LCY A;  4JFD A;  3VFO A;  3FON A;  5EO0 A;  1P4L A;  3E6H A;  3ECB A;  1UXS A;  3GSV A;  4G9D A;  2P5W A;  5D7L A;  4L8S C;  4F7P A;  3QI9 A;  3KPM A;  4HKJ A;  3WUW A;  5E6I C;  3QQ4 A;  3SDC A;  3KYO A;  1S8D A;  1ZT1 A;  1OF2 A;  3HE6 A;  1KTL A;  3HUJ A;  2OL3 H;  5HHM A;  1JE6 A;  3PWJ A;  2AXG A;  5C0B A;  2F74 A;  4GKS A;  3VFV A;  3OV6 A;  3U0P A;  2AV7 A;  2BVO A;  3MRP A;  4NO0 A;  5EU6 A;  4L8D A;  4PGB A;  2FZ3 A;  4PP8 C;  3HCV A;  4IRJ A;  2BVQ A;  3VWJ A;  2X4O A;  4G9F A;  4QRP A;  2HJL A;  4NQE A;  4WDI A;  3VFS A;  4JFQ A;  4G43 A;  3LKP A;  3UPR A;  1T20 A;  1S7Q A;  2GIT A;  3CZF A;  3GSN H;  4L8B A;  4MJ6 A;  5C08 A;  3PWU A;  3TPU E;  2X4N A;  5BS0 A;  3E2H A;  4U1N A;  4O2F A;  1CG9 A;  1QO3 A;  3CPL A;  2P5E A;  3RL2 A;  3KPR A;  5EFI A;  3FT3 A;  5IND A;  3TBW A;  3GSQ A;  3TJH A;  3ILP A;  4PJ9 A;  3TID A;  2BNQ A;  3KPO A;  5IB5 A;  1OGA A;  4FTV A;  3T1F A;  3MRM A;  5AD0 A;  1KCG C;  5GSR A;  1NAN H;  3DMM A;  3OXS A;  4PJF A;  4ZUT A;  5E8O A;  3VFN A;  3FRU A;  3O4L A;  2AV1 A;  3MYJ A;  5FDW A;  3LKN A;  5IB2 A;  4JFP A;  1MHE A;  2BSR A;  4WW2 C;  1I7R A;  2HJK A;  1T1Z A;  2BSS A;  1HHH A;  1W72 A;  3D39 A;  3HPJ A;  2HN7 A;  1VAD A;  5MER A;  3FQW A;  3KPP A;  4HUV A;  1N2R A;  1S7X A;  2FWO A;  4JQX A;  3GJF A;  1B3J A;  1LEG A;  4ONO A;  4G8I A;  4WU7 A;  3SDD A;  1XZ0 A;  3HLA A;  1WBZ A;  2PO6 A;  4L3E A;  3MRI A;  4PJG A;  3VFR A;  5ENW A;  5JHD A;  1KPV A;  2ZOL A;  3QUY A;  4JRX A;  4F7E A;  3W0W A;  4IRS A;  3GSW A;  4HUW A;  3RL1 A;  3MRJ A;  1Q94 A;  3BWA A;  3UTQ A;  3VRJ A;  3VWK A;  4XXC A;  3RWJ A;  3QEQ A;  3QUX A;  5D9S A;  5IB3 A;  5F7D A;  3GMP A;  4ZUU A;  1FO0 H;  1G7P A;  1TVH A;  3VXS A;  2H6P A;  4NHU E;  1T7W A;  4V3D B;  1GZQ A;  1JGD A;  5FA4 A;  5IEK A;  3CVH A;  3TA3 A;  1QEW A;  1ZSD A;  3BZE A;  4Z77 A;  4Y4F A;  1T21 A;  1A1M A;  1G6R H;  1ZHL A;  1G7Q A;  3O3E A;  4U1J A;  2V2W A;  3KWW A;  3QDJ A;  3FQU A;  1CD1 A;  3BEW A;  1L8J A;  2ZSV A;  4G42 A;  4X6F A;  3LV3 A;  2VLJ A;  4Y16 A;  1T7Z A;  3L3I A;  3P4M A;  2GT9 A;  1FZK A;  3MRE A;  2H26 A;  5MEQ A;  2YPL A;  1FG2 A;  3DX7 A;  3HG1 A;  1BD2 A;  4Z76 A;  3MRR A;  3DXA A;  3BXN A;  3MRB A;  1WBX A;  3GSU A;  3MR9 A;  4PRP A;  3VXN A;  3BZF A;  4CVZ A;  3MV8 A;  1T0M A;  3KLA A;  3P73 A;  4U1S A;  2Q7Y A;  3LKO A;  2JCC A;  3GSX A;  2VAA A;  1T80 A;  3UTT A;  5SWZ A;  2ESV A;  2X4U A;  4X6C A;  4O2E A;  4PDC E;  4D0C A;  3V5K A;  3TN0 A;  3W39 A;  1A1N A;  3P4O A;  1A9B A;  1YPZ A;  5FA3 A;  2UWE A;  4PRH A;  4EN3 C;  2MHA A;  3BVN A;  1ZS8 A;  2CII A;  4I4W A;  1S7W A;  4D0B A;  3D18 A;  4ZUW A;  4QRT A;  5C09 A;  1HHI A;  3HAE A;  3BO8 A;  2VLR A;  3I6G A;  1QLF A;  4MNG A;  2F54 A;  4WUU A;  3VH8 A;  1S7T A;  1YN7 A;  3GSR A;  4PJD A;  4N5E A;  3QUZ A;  3HE7 A;  1T7X A;  1HSA A;  3QUL A;  3P9M A;  4MJ5 A;  4PRB A;  1T7Y A;  4NNX A;  1QR1 A;  5DDH A;  4L4V A;  4U6Y A;  2YPK A;  4N0C A;  5EUO A;  4CW1 A;  4CVX A;  1N3N A;  1QVO A;  1A6Z A;  3FT4 A;  5C0D A;  3BW9 A;  2X4Q A;  3FQX A;  3PQY A;  1QQD A;  4PJA A;  5EOT A;  5GSV A;  3I6L D;  1X7Q A;  4PJ8 A;  2XPG A;  1JF1 A;  3MRG A;  3UBX A;  3RWD A;  2NX5 A;  3L3K A;  3MV9 A;  1B0R A;  2ZSW A;  4MXQ A;  2BNR A;  1M05 A;  4LCW A;  5MEN A;  2BVP A;  4HWZ A;  4NQV A;  3P4N A;  5HYJ A;  3X12 A;  2A83 A;  3LKS A;  1QSE A;  1B0G A;  1EFX A;  1GZP A;  3CH1 A;  1I4F A;  1MHC A;  5E00 A;  5INC A;  1CE6 A;  3MRN A;  3LN5 A;  2NW3 A;  5IEH A;  4PJB A;  1FZM A;  1ZHB A;  3KPL A;  5HHQ A;  1FFO A;  4ZAK A;  3REW A;  4QRU A;  1S7U A;  1RJY A;  3VXR A;  3WS6 A;  3L3G A;  4IIQ C;  4S0U C;  3DBX A;  5MEP A;  1T1Y A;  1RK1 A;  4ZUS A;  3S6C A;  2GAZ A;  4NNY A;  4LCC C;  1JGE A;  3GSO A;  1HOC A;  1HYR C;  4NO3 A;  5HGB A;  1Z5L A;  5DEF A;  5IM7 A;  4PG2 A;  1QSF A;  2VLK A;  4WO4 A;  3VFU A;  3D25 A;  4F7T A;  3T8X A;  3BP7 A;  4L29 A;  5ISZ A;  3SPV A;  1KJ3 H;  3TFK A;  4MVB A;  3FFC A;  3BH8 A;  1FFN A;  3FQT A;  1I1F A;  3X11 A;  3PWL A;  1QRN A;  4PJC A;  3BH9 A;  3ARB A;  3VXO A;  1XH3 A;  3SKO A;  4Y4H A;  1XR9 A;  4N0F A;  1FZO A;  4U1H A;  5C0I A;  4NO2 A;  5EU4 A;  1BZ9 A;  2AXF A;  3GML A;  5C07 A;  1VGK A;  5EU5 A;  1DDH A;  2RFX A;  1I1Y A;  3TBV A;  5B38 A;  1SYV A;  5E9D A;  3E3Q A;  1LEK A;  3FQR A;  1KBG H;  3RZC A;  5F1I A;  3TO4 A;  1IM3 A;  3BEV A;  4NSK A;  3MGO A;  3O3B A;  1UQS A;  4WJ5 A;  1RJZ A;  1SYS A;  5C0E A;  3I6K A;  5IB4 A;  5D7I A;  4E0R A;  1JPF A;  2X4T A;  3PAB A;  3IT8 D;  1OSZ A;  2PYE A;  2FO4 A;  3VFM A;  4EI5 A;  4NQD A;  3ILQ C;  4GUP A;  5DEG A;  1S7R A;  3VXP A;  5C0J A;  5D5M A;  1LD9 A;  3PWV A;  1KPR A;  1YN6 A;  3QZW A;  2GUO A;  1BQH A;  5BRZ A;  5J6H A;  1AGB A;  3GMM A;  3IXA A;  4PRN A;  1N59 A;  4G59 A;  1S9X A;  2HLA A;  1S9Y A;  4NQX A;  3VFP A;  4IHO A;  4K7F A;  1DUY A;  5FKP A;  3TIE A;  1XR8 A;  3FOM A;  1NAM H;  4PG9 A;  1LP9 A;  3GIV A;  4ZUV A;  3TF7 A;  1AGF A;  3FOL A;  4PGC A;  3MV7 A;  2VE6 A;  3BGM A;  4L8C A;  2GTW A;  1HHG A;  2YEZ A;  4PGE A;  4PV9 A;  4MS8 A;  1ZT7 A;  4I48 A;  4MJI A;  4MQ7 A;  4WU5 A;  4GKN A;  4F7C A;  5HHN A;  3PWN A;  2CLR A;  5C0C A;  3FT2 A;  1AGE A;  3H9H A;  5D7J C;  2F53 A;  3GMR A;  3GMN A;  2X4P A;  2CLV A;  4APQ A;  3DTX A;  4PRE A;  4PRA A;  5C0F A;  3LKR A;  5EO1 A;  5H94 A;  5HGH A;  3WS3 A;  1JHT A;  4X6D A;  5C0A A;  3M17 A;  5J6G A;  3CDG A;  1ZHN A;  3OXR A;  2DYP A;  1MWA H;  3ARE A;  5HGA A;  1E28 A;  1AGD A;  5IRO A;  4N8V A;  2BCK A;  3P9L A;  1DUZ A;  1S7V A;  4ELM A;  3MRK A;  3CC5 A;  4HUU A;  3BUY A;  3NFN A;  1UXW A;  1R3H A;  3KPQ A;  2BST A;  4Y4K A;  3SJV A;  3RWE A;  3ES6 A;  5BJT A;  3QUK A;  5MEO A;  3L3H A;  1MI5 A;  1BII A;  4LHU A;  4PJ7 A;  1EXU A;  4PJH A;  4JRY A;  2X4R A;  5F1N A;  3CCH A;  4PRD A;  1NEZ A;  2FYY A;  3KPN A;  1FZJ A;  1T22 A;  3JVG A;  3MRH A;  4Z78 A;  3TBY A;  5BXF A;  1INQ A;  1C16 A;  4PR5 A;  1OGT A;  1W0W A;  2E7L E;  1T1X A;  1I1A A;  2GTZ A;  4JFF A;  3SCM A;  3V5D A;  4JFO A;  3VFT A;  3QFJ A;  3VXM A;  4F7M A;  1KJM A;  3RTQ A;  3MA7 A;  3RWF A;  3O8X A;  2CIK A;  3TBT A;  2D31 A;  1S9W A;  2J8U A;  1JPG A;  3O3D A;  1VAC A;  3JTS A;  3AM8 A;  1K8D A;  3D2U A;  1P1Z A;  4HX1 A;  3MRO A;  4L9L C;  4PJX A;  3E6F A;  3OX8 A;  4E5X A;  1LQV A;  4N0U A;  4U1K A;  3PWP A;  3TO2 A;  1KJ2 H;  1W0V A;  3VXU A;  3KXF A;  3BHB A;  3ROO A;  1LK2 A;  3P77 A;  3TVM A;  1I7T A;  1KPU A;  4QRQ A;  1JUF A;  4U1L A;  4U1I A;  3ARF A;  3WLB A;  2AK4 A;  5C0G A;  2X4S A;  3H7B A;  3KPS A;  4V3E B;  3V5H A;  4L3C A;  3RWH A;  1JFM A;  3L9R A;  4FFE X;  1KJV A;  3VFW A;  1AKJ A;  3QFD A;  1FFP A;  2CKB H;  4JQV A;  1WBY A;  3O3A A;  3SDA A;  1TMC A;  5IVX A;  5L2K A;  2C7U A;  1RK0 A;  3MRD A;  4L4T A;  4QRS A;  1HHJ A;  2WY3 A;  2OI9 A;  5IB1 A;  3DX8 A;  3MRC A;  4D0D A;  5SWS A;  4NO5 A;  5HGD A;  5C9J A;  4Y2D A;  2AKR A;  2V2X A;  1ZVS A;  3MRL A;  1A9E A;  4HV8 A;  4ZFZ A;  4PJ5 A;  1ZHK A;  3RWI A;  4NQC A;  1S7S A;  4NT6 A;  4U1M A;  1N5A A;  3ARG A;  4O2C A;  3QQ3 A;  1P7Q A;  3BP4 A;  3LN4 A;  3TZV C;  2VAB A;  5ACZ A;  3M1B A;  5E8P A;  1ZAG A;  3RUG A;  1IM9 A;  3RWC A;  4QRR A;  4HUX A;  3AU1 A;  1AO7 A;  3C9N A;  1T1W A;  4PV8 A;  4MX7 A;  2ZOK A;  1A1O A;  3X13 A;  5EU3 A;  3X14 A;  1K5N A;  4G8G A;  1HHK A;  1ONQ A;  2VLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...