3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
5C0GA 3TJHA 1NEZA 4GKSA 3KYOA 3X13A 3LKOA 3KPLA 1KCGC 1QSEA 1JF1A 3GMMA 3P77A 3FT3A 5EO1A 1ED3A 3MRCA 5DEGA 3BH9A 3L3DA 3DBXA 3KPPA 3MRDA 3QDMA 1T1YA 4O2CA 4E5XA 3FFCA 1I7UA 4NQEA 2YEZA 3LKSA 5BXFA 3ARFA 5EU4A 3MRJA 1BIIA 1U58A 4MJIA 2C7UA 3X12A 4FFEX 2BNRA 3HE6A 3SDXA 3ILPA 3PWLA 4PJEA 3RWGA 1INQA 1AO7A 4CVZA 3VXSA 4V3EB 3VXUA 3L3JA 5C0BA 1FFNA 1JPGA 1QLFA 3FQRA 3ROOA 4F7EA 3GSXA 2X4OA 1I1AA 3O9WA 4PJ8A 2HJKA 4JQXA 5EU5A 1LEGA 1T7XA 4U1KA 3LN5A 2E7LE 1YDPA 1S7TA 3TBTA 1G7PA 4QRUA 1JE6A 3GIVA 4WDIA 3P4MA 3KYNA 4NQCA 3TPUE 1S7SA 1XH3A 1DUYA 1M05A 4IRJA 1T7ZA 1TMCA 3BEVA 4XXCA 3VRJA 5C9JA 1QSFA 3REWA 3P4OA 4X6CA 3VFRA 3WS3A 4MX7A 4PJ5A 3BWAA 2ZOKA 4I48A 4UQ3A 4F7PA 2BVPA 3FRUA 5E9DA 4K71B 4NQXA 4ZUWA 4MVBA 3O8XA 5HGDA 3ES6A 3PWUA 4JFQA 1GZPA 4MNQA 1R3HA 3FT4A 3TIDA 4ZUTA 5HHOA 1SYSA 3VFMA 4PJBA 5HHNA 3KPMA 5EU3A 3RL1A 2GJ6A 3QUXA 3ROLA 3DMMA 1ZT7A 4F7CA 3JTSA 3L3KA 1T7WA 4PJGA 4PGEA 4NT6A 3W0WA 5INCA 2AXFA 5IM7A 5D9SA 2FIKA 1YN6A 3MRLA 3O3DA 1RJYA 4WU7A 4O2FA 5C09A 4EUPA 2BCKA 3PQYA 4NO3A 1HHKA 2AV1A 2FYYA 1QRNA 3RWHA 1ZT4A 3V5DA 3I6LD 3BP4A 1ZHLA 1ZT1A 3VXOA 2HN7A 3VXPA 3BW9A 3QEQA 4L4VA 4HUWA 1ZAGA 1P4LA 2VLKA 2NX5A 3KPRA 4U6YA 3SJVA 4N8VA 3MROA 2BNQA 3MYJA 3UPRA 1DDHA 2CLZA 2X4PA 3CPLA 4V3DB 3GMOA 2AV7A 3VCLA 2XPGA 3TBYA 5FKPA 1T1ZA 3BHBA 1B0GA 2BVOA 1ZSDA 4JRXA 2PYEA 3U0PA 3VFOA 3MGTA 5IB3A 2Q7YA 3MRRA 3VXRA 1EFXA 3UTQA 5HYJA 3ARGA 1MI5A 3SKMA 4LCYA 3SDCA 1KJ3H 1BZ9A 3O4LA 5E8NA 1CE6A 3O3BA 3MRFA 4QOKA 4HX1A 3MRQA 3AU1A 4G59A 4FTVA 3MR9A 5C0IA 5IROA 1AGFA 5ISZA 5IEHA 1W72A 1FG2A 4G9DA 5EU6A 2BSRA 5C07A 3QQ4A 4U1SA 1JFMA 3CH1A 3JTTA 3RWJA 4ZUUA 4LHUA 1E28A 1GZQA 4N0CA 1WBYA 3D39A 3FQWA 5F9JA 3TN0A 2ZSWA 3SKOA 4L3CA 2BSTA 1VADA 3HLAA 5IB4A 1FZJA 1HHHA 3GSVA 4EI5A 5D5MA 2PO6A 1KBGH 1KTLA 4L8CA 2VLRA 2BVQA 1P1ZA 5MEPA 2V2XA 1T0NA 3DTXA 2P5EA 1S7WA 4NNXA 3L3GA 1T22A 4HKJA 3WL9A 4L9LC 1JGDA 3KPNA 1AGEA 1RK1A 2CIIA 4NO2A 4Z76A 3D2UA 5C0JA 5SWSA 5EOTA 4IRSA 5DDHA 3ECBA 3MREA 4UQ2A 3SCMA 1UXWA 3PWPA 3RWDA 3QFJA 4PREA 1T7YA 4EN3C 5FA3A 5D2LA 2X4UA 5DEFA 1LEKA 3LKRA 3RWIA 4NHUE 3CVHA 4Y16A 5IB2A 1HHGA 3I6GA 3VFNA 5C0CA 3HAEA 1G6RH 1T21A 1A1MA 4NO5A 3WLBA 3FONA 4D0BA 2HJLA 4PRBA 2X4TA 3H9SA 2X4RA 4MXQA 3VXNA 1G7QA 4L8BA 5J6GA 4PV8A 4JFOA 4ZAKA 3SDDA 4L4TA 3DX7A 3TVMA 1QQDA 4Z77A 2FWOA 5E8PA 5B39A 3MV9A 4F7TA 1N3NA 1LP9A 3B3IA 3GSWA 5C0AA 3GMRA 3HPJA 2MHAA 2YPLA 2F74A 2OL3H 1LD9A 2X4QA 3M1BA 1LDPH 3CCHA 4WJ5A 4LNRA 3FQXA 1VGKA 2YPKA 3JVGA 4IIQC 3BO8A 3BH8A 1MHEA 1I1FA 3D3VA 4L29A 3BUYA 3MRKA 1A9BA 2AKRA 3IT8D 3T1FA 4X6FA 5ACZA 3MRGA 5MENA 4Y4HA 1YPZA 5SWZA 4CVXA 1CD1A 4E0RA 5HHPA 3LN4A 1EEZA 1AGDA 1JHTA 3PWNA 2X70A 3QI9A 1S7QA 4JQVA 4PGDA 4X6EA 5D7LA 1W0WA 4U1NA 5F7DA 4PJDA 3M17A 1LQVA 3QULA 3E6FA 3H9HA 3V5KA 4HUUA 4CW1A 2DYPA 3JTCA 3P9MA 4MS8A 3ERYA 5D7JC 3VJ6A 1B0RA 3SPVA 3C9NA 3TO2A 1RK0A 5J6HA 4U1LA 4U1HA 3AM8A 1KJVA 1M6OA 3HCVA 2GT9A 3VXMA 2ZOLA 4U6XA 4WW2C 1N2RA 3VFVA 4PRDA 5HGBA 2X4NA 3E6HA 3TO4A 4WUUA 4MJ5A 3RGVC 3UBXA 3BVNA 1N59A 1E27A 5IB5A 3S6CA 3OXRA 3P9LA 3QDGA 3GMQA 5EO0A 4QRSA 4PG2A 1FFPA 4G42A 1S8DA 4D0CA 2GITA 5D7IA 1JPFA 1KJMA 4PJXA 1FZKA 3TZVC 3WUWA 3MGOA 3GJFA 2HLAA 1HOCA 1T7VA 4PGBA 4NO0A 5SWQA 5L2KA 1HSBA 1XZ0A 2FZ3A 4QRQA 5HHQA 1PQZA 1HHJA 2VE6A 5BJTA 1T1WA 5E8OA 3FT2A 1T1XA 3MRIA 2GUOA 3VFWA 1T80A 3VFSA 1IM9A 4WWKC 3MRPA 5INDA 2VLLA 3KXFA 2WY3A 3FQNA 1I4FA 1C16A 4GKNA 1S7XA 3ILQC 5C0DA 3E3QA 3O3AA 4LCWA 4PP8C 3RL2A 3TF7A 3HUJA 4PJ7A 3GMLA 1ZHKA 3RUGA 3GMPA 3PWVA 3RWEA 1QEWA 1OGAA 5JHDA 3AREA 3DXAA 3MV7A 3E2HA 3BP7A 3QQ3A 1EEYA 2UWEA 5FA4A 5EUOA 1MHCA 4G9FA 4F7MA 1I7TA 2J8UA 1K5NA 1KPRA 3LKQA 3V5HA 3X11A 1SYVA 2XFXA 4HUVA 4PRHA 1OSZA 2F53A 3IXAA 3BGMA 4HV8A 4PG9A 3VH8A 1ZVSA 3OV6A 4PV9A 5EFIA 1UXSA 3PWJA 3D18A 4GUPA 1EXUA 4JFDA 1A1OA 1HHIA 1T0MA 2VLJA 3KPQA 4IHOA 5HHMA 3QFDA 1KPVA 3VFUA 4PJ9A 1S7VA 4WO4A 1FZMA 4HS3A 3RTQA 3T8XA 3HG1A 3TFKA 4U1IA 3TBSA 4G43A 3GSRA 1A6ZA 3BXNA 5HGHA 4ZUSA 5AD0A 5MEQA 1LK2A 2RFXA 1HSAA 5ENWA 1FFOA 1P7QA 2BSSA 4PJCA 3RWCA 1OF2A 3CDGA 1S9WA 4QRTA 4S0UC 2FO4A 3QDJA 3CZFA 3BEWA 5C08A 4PJAA 5C0FA 1AGBA 4MQ7A 3ARDA 2JCCA 4MJ6A 3NFNA 2X4SA 3FTGA 5B38A 1WBZA 3H7BA 1AKJA 4APQA 3HE7A 3QUYA 1KPUA 1RJZA 5D2NA 4PRNA 1NAMH 4X6DA 4JFEA 1ZHBA 2AXGA 3FQUA 5E6IC 4PJIA 4NSKA 4O2EA 1T20A 3CC5A 4MNGA 1IM3A 1DUZA 1WBXA 1XR9A 1HYRC 2GAZA 3ARBA 1N5AA 3BZFA 1I1YA 2ESVA 4Y4KA 5IB1A 1CG9A 3BZEA 3D25A 4ONOA 4PJFA 3C8KA 4WU5A 2P5WA 4ZFZA 4N5EA 2CKBH 1S9XA 3RZCA 3DX6A 5GSRA 1UQSA 3KWWA 2AK4A 3LV3A 3W39A 4NQVA 1S7UA 3FOLA 3I6KA 1QVOA 5F1NA 3KPSA 4JRYA 1QR1A 4L3EA 3TA3A 3WS6A 1ZS8A 3GMNA 4Z78A 2CLVA 3GSUA 3MRHA 3VRIA 1BD2A 1DE4A 1VACA 1BQHA 3GSNH 4G8GA 1X7QA 5MEOA 4PDCE 2VABA 4JFPA 1YN7A 1B3JA 2A83A 3MA7A 3L9RA 3SDAA 5C0EA 1TVHA 1L8JA 3MV8A 4PR5A 3TBVA 5FDWA 1K8DA 3DX8A 2D31A 3GSQA 5H94A 3L3HA 5BRZA 3FQTA 4HWZA 4PRAA 3GSOA 5BS0A 1A1NA 4NQDA 4Y2DA 1JUFA 2ZSVA 3VWJA 1A9EA 2H6PA 2VAAA 5F1IA 3OX8A 4HUXA 1TVBA 4PJHA 5GSVA 5L2JA 2CLRA 3X14A 1KJ2H 2F54A 4NNYA 4PRIA 3RWFA 3TIEA 2OI9A 5IEKA 3VFTA 1XR8A 3VWKA 1FZOA 3MRBA 3UTTA 2GTZA 4N0UA 3TBWA 4ELMA 4JFFA 5MERA 3FOMA 1QO3A 1AGCA 5E00A 5J1AA 3L3IA 3KLAA 3LKPA 5IVXA 1S7RA 4L8SC 3OXSA 4U1MA 1Q94A 4QRRA 3P4NA 4QRPA 4D0DA 1JGEA 1NANH 2CIKA 4G8IA 3LKNA 1S9YA 3KPOA 3O3EA 3QZWA 4I4WA 1FO0H 2V2WA 4L8DA 4ZUVA 2NW3A 3UTSA 4Y4FA 3VFPA 1MWAH 1OGTA 3B6SA 2GTWA 3P73A 4LCCC 4K7FA 3QUZA 1ONQA 3MRMA 1Z5LA 4PGCA 3QUKA 4U1JA 3PABA 1ZHNA 4N0FA 4PRPA 2H26A 1W0VA 3MRNA 5HGAA 1I7RA 3G08A
chains in the Genus database with same CATH superfamily
5C0GA 3TJHA 1NEZA 4GKSA 3KYOA 3X13A 3LKOA 3KPLA 1KCGC 1QSEA 1JF1A 3GMMA 3P77A 3FT3A 5EO1A 1ED3A 3MRCA 5DEGA 3BH9A 3L3DA 3DBXA 3KPPA 3MRDA 3QDMA 1T1YA 4O2CA 4E5XA 3FFCA 1I7UA 4NQEA 2YEZA 3LKSA 5BXFA 3ARFA 5EU4A 3MRJA 1BIIA 1U58A 4MJIA 2C7UA 3X12A 4FFEX 2BNRA 3HE6A 3SDXA 3ILPA 3PWLA 4PJEA 3RWGA 1INQA 1AO7A 4CVZA 3I0TA 3VXSA 4V3EB 3VXUA 3L3JA 5C0BA 1FFNA 1JPGA 1QLFA 3FQRA 3ROOA 4F7EA 3GSXA 2X4OA 1I1AA 3O9WA 4PJ8A 2HJKA 4JQXA 5EU5A 1LEGA 1T7XA 4U1KA 3LN5A 2E7LE 1YDPA 1S7TA 3TBTA 1G7PA 4QRUA 1JE6A 3GIVA 4WDIA 3P4MA 3KYNA 4NQCA 3TPUE 1S7SA 1XH3A 1DUYA 1M05A 4IRJA 1T7ZA 1TMCA 3BEVA 4XXCA 3VRJA 5C9JA 1QSFA 3REWA 3P4OA 4X6CA 3VFRA 3WS3A 4MX7A 4PJ5A 3BWAA 2ZOKA 4I48A 4UQ3A 4F7PA 2BVPA 3FRUA 5E9DA 4K71B 4NQXA 4ZUWA 4MVBA 3O8XA 5HGDA 3ES6A 3PWUA 4JFQA 1GZPA 4MNQA 1R3HA 3FT4A 3TIDA 4ZUTA 5HHOA 1SYSA 3VFMA 4PJBA 5HHNA 3KPMA 5EU3A 3RL1A 2GJ6A 3QUXA 3ROLA 3DMMA 1ZT7A 4F7CA 3JTSA 3L3KA 1T7WA 4PJGA 4PGEA 4NT6A 3W0WA 5INCA 2AXFA 5IM7A 5D9SA 2FIKA 1YN6A 3MRLA 3O3DA 1RJYA 4WU7A 4O2FA 5C09A 4EUPA 2BCKA 3PQYA 4NO3A 1HHKA 2AV1A 2FYYA 1QRNA 3RWHA 1ZT4A 3V5DA 3I6LD 3BP4A 1ZHLA 1ZT1A 3VXOA 2HN7A 3VXPA 3BW9A 3QEQA 4L4VA 4HUWA 1ZAGA 1P4LA 2VLKA 2NX5A 3KPRA 4U6YA 3SJVA 4N8VA 3MROA 2BNQA 3MYJA 3UPRA 1DDHA 2CLZA 2X4PA 3CPLA 4V3DB 3GMOA 2AV7A 3VCLA 2XPGA 3TBYA 5FKPA 1T1ZA 3BHBA 1B0GA 2BVOA 1ZSDA 4JRXA 2PYEA 3U0PA 3VFOA 3MGTA 5IB3A 2Q7YA 3MRRA 4G59C 3VXRA 1EFXA 3UTQA 5HYJA 3ARGA 1MI5A 3SKMA 4LCYA 3SDCA 1KJ3H 1BZ9A 3O4LA 5E8NA 1CE6A 3O3BA 3MRFA 4QOKA 4HX1A 3MRQA 3AU1A 4G59A 4FTVA 3MR9A 5C0IA 5IROA 1AGFA 5ISZA 5IEHA 1W72A 1FG2A 4G9DA 5EU6A 2BSRA 5C07A 3QQ4A 4U1SA 1JFMA 3CH1A 3JTTA 3RWJA 4ZUUA 4LHUA 1E28A 1GZQA 4N0CA 1WBYA 3D39A 3FQWA 5F9JA 3TN0A 2ZSWA 3SKOA 4L3CA 2BSTA 1VADA 3HLAA 5IB4A 1FZJA 1HHHA 3GSVA 4EI5A 5D5MA 2PO6A 1KBGH 1KTLA 4L8CA 2VLRA 2BVQA 1P1ZA 5MEPA 2V2XA 1T0NA 3DTXA 2P5EA 1S7WA 4NNXA 3L3GA 1T22A 4HKJA 3WL9A 4L9LC 1JGDA 3KPNA 1AGEA 1RK1A 2CIIA 4NO2A 4Z76A 3D2UA 5C0JA 5SWSA 5EOTA 4IRSA 5DDHA 3ECBA 3MREA 4UQ2A 3SCMA 1UXWA 3PWPA 3RWDA 3QFJA 4PREA 1T7YA 4EN3C 5FA3A 5D2LA 2X4UA 5DEFA 1LEKA 3LKRA 3RWIA 4NHUE 3CVHA 4Y16A 5IB2A 1HHGA 3I6GA 3VFNA 5C0CA 3HAEA 1G6RH 1T21A 1A1MA 4NO5A 3WLBA 3FONA 4D0BA 2HJLA 4PRBA 2X4TA 3H9SA 2X4RA 4MXQA 3VXNA 1G7QA 4L8BA 5J6GA 4PV8A 4JFOA 4ZAKA 3SDDA 4L4TA 3DX7A 3TVMA 1QQDA 4Z77A 2FWOA 5E8PA 5B39A 3MV9A 4F7TA 1N3NA 1LP9A 3B3IA 3GSWA 5C0AA 3GMRA 3HPJA 2MHAA 2YPLA 2F74A 2OL3H 1LD9A 2X4QA 3M1BA 1LDPH 3CCHA 4WJ5A 4LNRA 3FQXA 1VGKA 2YPKA 3JVGA 4IIQC 3BO8A 3BH8A 1MHEA 1I1FA 3D3VA 4L29A 3BUYA 3MRKA 1A9BA 2AKRA 3IT8D 3T1FA 4X6FA 5ACZA 3MRGA 5MENA 4Y4HA 1YPZA 5SWZA 4CVXA 1CD1A 4E0RA 5HHPA 3LN4A 1EEZA 1AGDA 1JHTA 3PWNA 2X70A 3QI9A 1S7QA 4JQVA 4PGDA 4X6EA 5D7LA 1W0WA 4U1NA 5F7DA 4PJDA 3M17A 1LQVA 3QULA 3E6FA 3H9HA 3V5KA 4HUUA 4CW1A 2DYPA 3JTCA 3P9MA 4MS8A 3ERYA 5D7JC 3VJ6A 1B0RA 3SPVA 3C9NA 3TO2A 1RK0A 5J6HA 4U1LA 4U1HA 3AM8A 1KJVA 1M6OA 3HCVA 2GT9A 3VXMA 2ZOLA 4U6XA 4WW2C 1N2RA 3VFVA 4PRDA 5HGBA 2X4NA 3E6HA 3TO4A 4WUUA 4MJ5A 3RGVC 3UBXA 3BVNA 1N59A 1E27A 5IB5A 3S6CA 3OXRA 3P9LA 3QDGA 3GMQA 5EO0A 4QRSA 4PG2A 1FFPA 4G42A 1S8DA 4D0CA 2GITA 5D7IA 1JPFA 1KJMA 4PJXA 1FZKA 3TZVC 3WUWA 3MGOA 3GJFA 2HLAA 1HOCA 1T7VA 4PGBA 4NO0A 5SWQA 5L2KA 1HSBA 1XZ0A 2FZ3A 4QRQA 5HHQA 1PQZA 1HHJA 2O5NA 2VE6A 5BJTA 1T1WA 5E8OA 3FT2A 1T1XA 3MRIA 2GUOA 3VFWA 1T80A 3VFSA 1IM9A 4WWKC 3MRPA 5INDA 2VLLA 3KXFA 2WY3A 3FQNA 1I4FA 1C16A 4GKNA 1S7XA 3ILQC 5C0DA 3E3QA 3O3AA 4LCWA 4PP8C 3RL2A 3TF7A 3HUJA 4PJ7A 3GMLA 1ZHKA 3RUGA 3GMPA 3PWVA 3RWEA 1QEWA 1OGAA 5JHDA 3AREA 3DXAA 3MV7A 3E2HA 3BP7A 3QQ3A 1EEYA 2UWEA 5FA4A 5EUOA 1MHCA 4G9FA 4F7MA 1I7TA 2J8UA 1K5NA 1KPRA 3LKQA 3V5HA 3X11A 1SYVA 2XFXA 4HUVA 4PRHA 1OSZA 2F53A 3IXAA 3BGMA 4HV8A 4PG9A 3VH8A 1ZVSA 3OV6A 4PV9A 5EFIA 1UXSA 3PWJA 3D18A 4GUPA 1EXUA 4JFDA 1A1OA 1HHIA 1T0MA 2VLJA 3KPQA 4IHOA 5HHMA 3QFDA 1KPVA 3VFUA 4PJ9A 1S7VA 4WO4A 1FZMA 4HS3A 3RTQA 3T8XA 3HG1A 3TFKA 4U1IA 3TBSA 2NYKA 4G43A 3GSRA 1A6ZA 3BXNA 5HGHA 4ZUSA 5AD0A 5MEQA 1LK2A 2RFXA 1HSAA 5ENWA 1FFOA 1P7QA 2BSSA 4PJCA 3RWCA 1OF2A 3CDGA 1S9WA 4QRTA 4S0UC 2FO4A 3QDJA 3CZFA 3BEWA 5C08A 4PJAA 5C0FA 1AGBA 4MQ7A 3ARDA 2JCCA 4MJ6A 3NFNA 2X4SA 3FTGA 5B38A 1WBZA 3H7BA 1AKJA 4APQA 3HE7A 3QUYA 1KPUA 1RJZA 5D2NA 4PRNA 1NAMH 4X6DA 4JFEA 1ZHBA 2AXGA 3FQUA 5E6IC 4PJIA 4NSKA 4O2EA 1T20A 3CC5A 4MNGA 1IM3A 1DUZA 1WBXA 1XR9A 1HYRC 2GAZA 3ARBA 1N5AA 3BZFA 1I1YA 2ESVA 4Y4KA 5IB1A 4BKWA 1CG9A 3BZEA 3D25A 4ONOA 4PJFA 3C8KA 4WU5A 2P5WA 4ZFZA 4N5EA 2CKBH 1S9XA 3RZCA 3DX6A 5GSRA 1UQSA 3KWWA 2AK4A 3LV3A 3W39A 4NQVA 1S7UA 3FOLA 3I6KA 1QVOA 5F1NA 3KPSA 4JRYA 1QR1A 4L3EA 3TA3A 3WS6A 1ZS8A 3GMNA 4Z78A 2CLVA 3GSUA 3MRHA 3VRIA 1BD2A 1DE4A 1VACA 1BQHA 3GSNH 4G8GA 1X7QA 5MEOA 4PDCE 2VABA 4JFPA 1YN7A 1B3JA 2A83A 3MA7A 3L9RA 3SDAA 5C0EA 1TVHA 1L8JA 3MV8A 4PR5A 3TBVA 5FDWA 1K8DA 3DX8A 2D31A 3GSQA 5H94A 3L3HA 5BRZA 3FQTA 4HWZA 4PRAA 4JO8A 3GSOA 5BS0A 1A1NA 4NQDA 4Y2DA 1JUFA 2ZSVA 3VWJA 1A9EA 2H6PA 2VAAA 5F1IA 3OX8A 4HUXA 1TVBA 4PJHA 5GSVA 5L2JA 2CLRA 3X14A 1KJ2H 2F54A 4NNYA 4PRIA 3RWFA 3TIEA 2OI9A 5IEKA 3VFTA 1XR8A 3VWKA 1FZOA 2IA1A 3MRBA 3UTTA 2GTZA 4N0UA 3TBWA 4ELMA 4JFFA 5MERA 3FOMA 1QO3A 1AGCA 5E00A 5J1AA 3L3IA 3KLAA 3LKPA 5IVXA 1S7RA 4L8SC 3OXSA 4U1MA 1Q94A 4QRRA 3P4NA 4QRPA 4D0DA 1JGEA 1NANH 2CIKA 4G8IA 3LKNA 1S9YA 3KPOA 3O3EA 3QZWA 4I4WA 1FO0H 2V2WA 4L8DA 4ZUVA 2NW3A 3UTSA 4Y4FA 3VFPA 1MWAH 1OGTA 3B6SA 2GTWA 3P73A 4LCCC 4K7FA 3QUZA 1ONQA 3MRMA 1Z5LA 4PGCA 3QUKA 4U1JA 3PABA 1ZHNA 4N0FA 4PRPA 2H26A 1W0VA 3MRNA 5HGAA 1I7RA 3G08A
chains in the Genus database with same CATH topology
5C0GA 3TJHA 1NEZA 4GKSA 3KYOA 3X13A 3LKOA 3KPLA 1KCGC 1QSEA 1JF1A 3GMMA 3P77A 3FT3A 5EO1A 1ED3A 3MRCA 5DEGA 3BH9A 3L3DA 3DBXA 3KPPA 3MRDA 3QDMA 1T1YA 4O2CA 4E5XA 3FFCA 1I7UA 4NQEA 2YEZA 3LKSA 5BXFA 3ARFA 5EU4A 3MRJA 1BIIA 1U58A 4MJIA 2C7UA 3X12A 4FFEX 2BNRA 3HE6A 3SDXA 3ILPA 3PWLA 4PJEA 3RWGA 1INQA 1AO7A 4CVZA 3VXSA 4V3EB 3VXUA 3L3JA 5C0BA 1FFNA 1JPGA 1QLFA 3FQRA 3ROOA 4F7EA 3GSXA 2X4OA 1I1AA 3O9WA 4PJ8A 2HJKA 4JQXA 5EU5A 1LEGA 1T7XA 4U1KA 3LN5A 2E7LE 1YDPA 1S7TA 3TBTA 1G7PA 4QRUA 1JE6A 3GIVA 4WDIA 3P4MA 3KYNA 4NQCA 3TPUE 1S7SA 1XH3A 1DUYA 1M05A 4IRJA 1T7ZA 1TMCA 3BEVA 4XXCA 3VRJA 5C9JA 1QSFA 3REWA 3P4OA 4X6CA 3VFRA 3WS3A 4MX7A 4PJ5A 3BWAA 2ZOKA 4I48A 4UQ3A 4F7PA 2BVPA 3FRUA 5E9DA 4K71B 4NQXA 4ZUWA 4MVBA 3O8XA 5HGDA 3ES6A 3PWUA 4JFQA 1GZPA 4MNQA 1R3HA 3FT4A 3TIDA 4ZUTA 5HHOA 1SYSA 3VFMA 4PJBA 5HHNA 3KPMA 5EU3A 3RL1A 2GJ6A 3QUXA 3ROLA 3DMMA 1ZT7A 4F7CA 3JTSA 3L3KA 1T7WA 4PJGA 4PGEA 4NT6A 3W0WA 5INCA 2AXFA 5IM7A 5D9SA 2FIKA 1YN6A 3MRLA 3O3DA 1RJYA 4WU7A 4O2FA 5C09A 4EUPA 2BCKA 3PQYA 4NO3A 1HHKA 2AV1A 2FYYA 1QRNA 3RWHA 1ZT4A 3V5DA 3I6LD 3BP4A 1ZHLA 1ZT1A 3VXOA 2HN7A 3VXPA 3BW9A 3QEQA 4L4VA 4HUWA 1ZAGA 1P4LA 2VLKA 2NX5A 3KPRA 4U6YA 3SJVA 4N8VA 3MROA 2BNQA 3MYJA 3UPRA 1DDHA 2CLZA 2X4PA 3CPLA 4V3DB 3GMOA 2AV7A 3VCLA 2XPGA 3TBYA 5FKPA 1T1ZA 3BHBA 1B0GA 2BVOA 1ZSDA 4JRXA 2PYEA 3U0PA 3VFOA 3MGTA 5IB3A 2Q7YA 3MRRA 3VXRA 1EFXA 3UTQA 5HYJA 3ARGA 1MI5A 3SKMA 4LCYA 3SDCA 1KJ3H 1BZ9A 3O4LA 5E8NA 1CE6A 3O3BA 3MRFA 4QOKA 4HX1A 3MRQA 3AU1A 4G59A 4FTVA 3MR9A 5C0IA 5IROA 1AGFA 5ISZA 5IEHA 1W72A 1FG2A 4G9DA 5EU6A 2BSRA 5C07A 3QQ4A 4U1SA 1JFMA 3CH1A 3JTTA 3RWJA 4ZUUA 4LHUA 1E28A 1GZQA 4N0CA 1WBYA 3D39A 3FQWA 5F9JA 3TN0A 2ZSWA 3SKOA 4L3CA 2BSTA 1VADA 3HLAA 5IB4A 1FZJA 1HHHA 3GSVA 4EI5A 5D5MA 2PO6A 1KBGH 1KTLA 4L8CA 2VLRA 2BVQA 1P1ZA 5MEPA 2V2XA 1T0NA 3DTXA 2P5EA 1S7WA 4NNXA 3L3GA 1T22A 4HKJA 3WL9A 4L9LC 1JGDA 3KPNA 1AGEA 1RK1A 2CIIA 4NO2A 4Z76A 3D2UA 5C0JA 5SWSA 5EOTA 4IRSA 5DDHA 3ECBA 3MREA 4UQ2A 3SCMA 1UXWA 3PWPA 3RWDA 3QFJA 4PREA 1T7YA 4EN3C 5FA3A 5D2LA 2X4UA 5DEFA 1LEKA 3LKRA 3RWIA 4NHUE 3CVHA 4Y16A 5IB2A 1HHGA 3I6GA 3VFNA 5C0CA 3HAEA 1G6RH 1T21A 1A1MA 4NO5A 3WLBA 3FONA 4D0BA 2HJLA 4PRBA 2X4TA 3H9SA 2X4RA 4MXQA 3VXNA 1G7QA 4L8BA 5J6GA 4PV8A 4JFOA 4ZAKA 3SDDA 4L4TA 3DX7A 3TVMA 1QQDA 4Z77A 2FWOA 5E8PA 5B39A 3MV9A 4F7TA 1N3NA 1LP9A 3B3IA 3GSWA 5C0AA 3GMRA 3HPJA 2MHAA 2YPLA 2F74A 2OL3H 1LD9A 2X4QA 3M1BA 1LDPH 3CCHA 4WJ5A 4LNRA 3FQXA 1VGKA 2YPKA 3JVGA 4IIQC 3BO8A 3BH8A 1MHEA 1I1FA 3D3VA 4L29A 3BUYA 3MRKA 1A9BA 2AKRA 3IT8D 3T1FA 4X6FA 5ACZA 3MRGA 5MENA 4Y4HA 1YPZA 5SWZA 4CVXA 1CD1A 4E0RA 5HHPA 3LN4A 1EEZA 1AGDA 1JHTA 3PWNA 2X70A 3QI9A 1S7QA 4JQVA 4PGDA 4X6EA 5D7LA 1W0WA 4U1NA 5F7DA 4PJDA 3M17A 1LQVA 3QULA 3E6FA 3H9HA 3V5KA 4HUUA 4CW1A 2DYPA 3JTCA 3P9MA 4MS8A 3ERYA 5D7JC 3VJ6A 1B0RA 3SPVA 3C9NA 3TO2A 1RK0A 5J6HA 4U1LA 4U1HA 3AM8A 1KJVA 1M6OA 3HCVA 2GT9A 3VXMA 2ZOLA 4U6XA 4WW2C 1N2RA 3VFVA 4PRDA 5HGBA 2X4NA 3E6HA 3TO4A 4WUUA 4MJ5A 3RGVC 3UBXA 3BVNA 1N59A 1E27A 5IB5A 3S6CA 3OXRA 3P9LA 3QDGA 3GMQA 5EO0A 4QRSA 4PG2A 1FFPA 4G42A 1S8DA 4D0CA 2GITA 5D7IA 1JPFA 1KJMA 4PJXA 1FZKA 3TZVC 3WUWA 3MGOA 3GJFA 2HLAA 1HOCA 1T7VA 4PGBA 4NO0A 5SWQA 5L2KA 1HSBA 1XZ0A 2FZ3A 4QRQA 5HHQA 1PQZA 1HHJA 2VE6A 5BJTA 1T1WA 5E8OA 3FT2A 1T1XA 3MRIA 2GUOA 3VFWA 1T80A 3VFSA 1IM9A 4WWKC 3MRPA 5INDA 2VLLA 3KXFA 2WY3A 3FQNA 1I4FA 1C16A 4GKNA 1S7XA 3ILQC 5C0DA 3E3QA 3O3AA 4LCWA 4PP8C 3RL2A 3TF7A 3HUJA 4PJ7A 3GMLA 1ZHKA 3RUGA 3GMPA 3PWVA 3RWEA 1QEWA 1OGAA 5JHDA 3AREA 3DXAA 3MV7A 3E2HA 3BP7A 3QQ3A 1EEYA 2UWEA 5FA4A 5EUOA 1MHCA 4G9FA 4F7MA 1I7TA 2J8UA 1K5NA 1KPRA 3LKQA 3V5HA 3X11A 1SYVA 2XFXA 4HUVA 4PRHA 1OSZA 2F53A 3IXAA 3BGMA 4HV8A 4PG9A 3VH8A 1ZVSA 3OV6A 4PV9A 5EFIA 1UXSA 3PWJA 3D18A 4GUPA 1EXUA 4JFDA 1A1OA 1HHIA 1T0MA 2VLJA 3KPQA 4IHOA 5HHMA 3QFDA 1KPVA 3VFUA 4PJ9A 1S7VA 4WO4A 1FZMA 4HS3A 3RTQA 3T8XA 3HG1A 3TFKA 4U1IA 3TBSA 4G43A 3GSRA 1A6ZA 3BXNA 5HGHA 4ZUSA 5AD0A 5MEQA 1LK2A 2RFXA 1HSAA 5ENWA 1FFOA 1P7QA 2BSSA 4PJCA 3RWCA 1OF2A 3CDGA 1S9WA 4QRTA 4S0UC 2FO4A 3QDJA 3CZFA 3BEWA 5C08A 4PJAA 5C0FA 1AGBA 4MQ7A 3ARDA 2JCCA 4MJ6A 3NFNA 2X4SA 3FTGA 5B38A 1WBZA 3H7BA 1AKJA 4APQA 3HE7A 3QUYA 1KPUA 1RJZA 5D2NA 4PRNA 1NAMH 4X6DA 4JFEA 1ZHBA 2AXGA 3FQUA 5E6IC 4PJIA 4NSKA 4O2EA 1T20A 3CC5A 4MNGA 1IM3A 1DUZA 1WBXA 1XR9A 1HYRC 2GAZA 3ARBA 1N5AA 3BZFA 1I1YA 2ESVA 4Y4KA 5IB1A 1CG9A 3BZEA 3D25A 4ONOA 4PJFA 3C8KA 4WU5A 2P5WA 4ZFZA 4N5EA 2CKBH 1S9XA 3RZCA 3DX6A 5GSRA 1UQSA 3KWWA 2AK4A 3LV3A 3W39A 4NQVA 1S7UA 3FOLA 3I6KA 1QVOA 5F1NA 3KPSA 4JRYA 1QR1A 4L3EA 3TA3A 3WS6A 1ZS8A 3GMNA 4Z78A 2CLVA 3GSUA 3MRHA 3VRIA 1BD2A 1DE4A 1VACA 1BQHA 3GSNH 4G8GA 1X7QA 5MEOA 4PDCE 2VABA 4JFPA 1YN7A 1B3JA 2A83A 3MA7A 3L9RA 3SDAA 5C0EA 1TVHA 1L8JA 3MV8A 4PR5A 3TBVA 5FDWA 1K8DA 3DX8A 2D31A 3GSQA 5H94A 3L3HA 5BRZA 3FQTA 4HWZA 4PRAA 3GSOA 5BS0A 1A1NA 4NQDA 4Y2DA 1JUFA 2ZSVA 3VWJA 1A9EA 2H6PA 2VAAA 5F1IA 3OX8A 4HUXA 1TVBA 4PJHA 5GSVA 5L2JA 2CLRA 3X14A 1KJ2H 2F54A 4NNYA 4PRIA 3RWFA 3TIEA 2OI9A 5IEKA 3VFTA 1XR8A 3VWKA 1FZOA 3MRBA 3UTTA 2GTZA 4N0UA 3TBWA 4ELMA 4JFFA 5MERA 3FOMA 1QO3A 1AGCA 5E00A 5J1AA 3L3IA 3KLAA 3LKPA 5IVXA 1S7RA 4L8SC 3OXSA 4U1MA 1Q94A 4QRRA 3P4NA 4QRPA 4D0DA 1JGEA 1NANH 2CIKA 4G8IA 3LKNA 1S9YA 3KPOA 3O3EA 3QZWA 4I4WA 1FO0H 2V2WA 4L8DA 4ZUVA 2NW3A 3UTSA 4Y4FA 3VFPA 1MWAH 1OGTA 3B6SA 2GTWA 3P73A 4LCCC 4K7FA 3QUZA 1ONQA 3MRMA 1Z5LA 4PGCA 3QUKA 4U1JA 3PABA 1ZHNA 4N0FA 4PRPA 2H26A 1W0VA 3MRNA 5HGAA 1I7RA 3G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0G A;  3TJH A;  1NEZ A;  4GKS A;  3KYO A;  3X13 A;  3LKO A;  3KPL A;  1KCG C;  1QSE A;  1JF1 A;  3GMM A;  3P77 A;  3FT3 A;  5EO1 A;  1ED3 A;  3MRC A;  5DEG A;  3BH9 A;  3L3D A;  3DBX A;  3KPP A;  3MRD A;  3QDM A;  1T1Y A;  4O2C A;  4E5X A;  3FFC A;  1I7U A;  4NQE A;  2YEZ A;  3LKS A;  5BXF A;  3ARF A;  5EU4 A;  3MRJ A;  1BII A;  1U58 A;  4MJI A;  2C7U A;  3X12 A;  4FFE X;  2BNR A;  3HE6 A;  3SDX A;  3ILP A;  3PWL A;  4PJE A;  3RWG A;  1INQ A;  1AO7 A;  4CVZ A;  3VXS A;  4V3E B;  3VXU A;  3L3J A;  5C0B A;  1FFN A;  1JPG A;  1QLF A;  3FQR A;  3ROO A;  4F7E A;  3GSX A;  2X4O A;  1I1A A;  3O9W A;  4PJ8 A;  2HJK A;  4JQX A;  5EU5 A;  1LEG A;  1T7X A;  4U1K A;  3LN5 A;  2E7L E;  1YDP A;  1S7T A;  3TBT A;  1G7P A;  4QRU A;  1JE6 A;  3GIV A;  4WDI A;  3P4M A;  3KYN A;  4NQC A;  3TPU E;  1S7S A;  1XH3 A;  1DUY A;  1M05 A;  4IRJ A;  1T7Z A;  1TMC A;  3BEV A;  4XXC A;  3VRJ A;  5C9J A;  1QSF A;  3REW A;  3P4O A;  4X6C A;  3VFR A;  3WS3 A;  4MX7 A;  4PJ5 A;  3BWA A;  2ZOK A;  4I48 A;  4UQ3 A;  4F7P A;  2BVP A;  3FRU A;  5E9D A;  4K71 B;  4NQX A;  4ZUW A;  4MVB A;  3O8X A;  5HGD A;  3ES6 A;  3PWU A;  4JFQ A;  1GZP A;  4MNQ A;  1R3H A;  3FT4 A;  3TID A;  4ZUT A;  5HHO A;  1SYS A;  3VFM A;  4PJB A;  5HHN A;  3KPM A;  5EU3 A;  3RL1 A;  2GJ6 A;  3QUX A;  3ROL A;  3DMM A;  1ZT7 A;  4F7C A;  3JTS A;  3L3K A;  1T7W A;  4PJG A;  4PGE A;  4NT6 A;  3W0W A;  5INC A;  2AXF A;  5IM7 A;  5D9S A;  2FIK A;  1YN6 A;  3MRL A;  3O3D A;  1RJY A;  4WU7 A;  4O2F A;  5C09 A;  4EUP A;  2BCK A;  3PQY A;  4NO3 A;  1HHK A;  2AV1 A;  2FYY A;  1QRN A;  3RWH A;  1ZT4 A;  3V5D A;  3I6L D;  3BP4 A;  1ZHL A;  1ZT1 A;  3VXO A;  2HN7 A;  3VXP A;  3BW9 A;  3QEQ A;  4L4V A;  4HUW A;  1ZAG A;  1P4L A;  2VLK A;  2NX5 A;  3KPR A;  4U6Y A;  3SJV A;  4N8V A;  3MRO A;  2BNQ A;  3MYJ A;  3UPR A;  1DDH A;  2CLZ A;  2X4P A;  3CPL A;  4V3D B;  3GMO A;  2AV7 A;  3VCL A;  2XPG A;  3TBY A;  5FKP A;  1T1Z A;  3BHB A;  1B0G A;  2BVO A;  1ZSD A;  4JRX A;  2PYE A;  3U0P A;  3VFO A;  3MGT A;  5IB3 A;  2Q7Y A;  3MRR A;  3VXR A;  1EFX A;  3UTQ A;  5HYJ A;  3ARG A;  1MI5 A;  3SKM A;  4LCY A;  3SDC A;  1KJ3 H;  1BZ9 A;  3O4L A;  5E8N A;  1CE6 A;  3O3B A;  3MRF A;  4QOK A;  4HX1 A;  3MRQ A;  3AU1 A;  4G59 A;  4FTV A;  3MR9 A;  5C0I A;  5IRO A;  1AGF A;  5ISZ A;  5IEH A;  1W72 A;  1FG2 A;  4G9D A;  5EU6 A;  2BSR A;  5C07 A;  3QQ4 A;  4U1S A;  1JFM A;  3CH1 A;  3JTT A;  3RWJ A;  4ZUU A;  4LHU A;  1E28 A;  1GZQ A;  4N0C A;  1WBY A;  3D39 A;  3FQW A;  5F9J A;  3TN0 A;  2ZSW A;  3SKO A;  4L3C A;  2BST A;  1VAD A;  3HLA A;  5IB4 A;  1FZJ A;  1HHH A;  3GSV A;  4EI5 A;  5D5M A;  2PO6 A;  1KBG H;  1KTL A;  4L8C A;  2VLR A;  2BVQ A;  1P1Z A;  5MEP A;  2V2X A;  1T0N A;  3DTX A;  2P5E A;  1S7W A;  4NNX A;  3L3G A;  1T22 A;  4HKJ A;  3WL9 A;  4L9L C;  1JGD A;  3KPN A;  1AGE A;  1RK1 A;  2CII A;  4NO2 A;  4Z76 A;  3D2U A;  5C0J A;  5SWS A;  5EOT A;  4IRS A;  5DDH A;  3ECB A;  3MRE A;  4UQ2 A;  3SCM A;  1UXW A;  3PWP A;  3RWD A;  3QFJ A;  4PRE A;  1T7Y A;  4EN3 C;  5FA3 A;  5D2L A;  2X4U A;  5DEF A;  1LEK A;  3LKR A;  3RWI A;  4NHU E;  3CVH A;  4Y16 A;  5IB2 A;  1HHG A;  3I6G A;  3VFN A;  5C0C A;  3HAE A;  1G6R H;  1T21 A;  1A1M A;  4NO5 A;  3WLB A;  3FON A;  4D0B A;  2HJL A;  4PRB A;  2X4T A;  3H9S A;  2X4R A;  4MXQ A;  3VXN A;  1G7Q A;  4L8B A;  5J6G A;  4PV8 A;  4JFO A;  4ZAK A;  3SDD A;  4L4T A;  3DX7 A;  3TVM A;  1QQD A;  4Z77 A;  2FWO A;  5E8P A;  5B39 A;  3MV9 A;  4F7T A;  1N3N A;  1LP9 A;  3B3I A;  3GSW A;  5C0A A;  3GMR A;  3HPJ A;  2MHA A;  2YPL A;  2F74 A;  2OL3 H;  1LD9 A;  2X4Q A;  3M1B A;  1LDP H;  3CCH A;  4WJ5 A;  4LNR A;  3FQX A;  1VGK A;  2YPK A;  3JVG A;  4IIQ C;  3BO8 A;  3BH8 A;  1MHE A;  1I1F A;  3D3V A;  4L29 A;  3BUY A;  3MRK A;  1A9B A;  2AKR A;  3IT8 D;  3T1F A;  4X6F A;  5ACZ A;  3MRG A;  5MEN A;  4Y4H A;  1YPZ A;  5SWZ A;  4CVX A;  1CD1 A;  4E0R A;  5HHP A;  3LN4 A;  1EEZ A;  1AGD A;  1JHT A;  3PWN A;  2X70 A;  3QI9 A;  1S7Q A;  4JQV A;  4PGD A;  4X6E A;  5D7L A;  1W0W A;  4U1N A;  5F7D A;  4PJD A;  3M17 A;  1LQV A;  3QUL A;  3E6F A;  3H9H A;  3V5K A;  4HUU A;  4CW1 A;  2DYP A;  3JTC A;  3P9M A;  4MS8 A;  3ERY A;  5D7J C;  3VJ6 A;  1B0R A;  3SPV A;  3C9N A;  3TO2 A;  1RK0 A;  5J6H A;  4U1L A;  4U1H A;  3AM8 A;  1KJV A;  1M6O A;  3HCV A;  2GT9 A;  3VXM A;  2ZOL A;  4U6X A;  4WW2 C;  1N2R A;  3VFV A;  4PRD A;  5HGB A;  2X4N A;  3E6H A;  3TO4 A;  4WUU A;  4MJ5 A;  3RGV C;  3UBX A;  3BVN A;  1N59 A;  1E27 A;  5IB5 A;  3S6C A;  3OXR A;  3P9L A;  3QDG A;  3GMQ A;  5EO0 A;  4QRS A;  4PG2 A;  1FFP A;  4G42 A;  1S8D A;  4D0C A;  2GIT A;  5D7I A;  1JPF A;  1KJM A;  4PJX A;  1FZK A;  3TZV C;  3WUW A;  3MGO A;  3GJF A;  2HLA A;  1HOC A;  1T7V A;  4PGB A;  4NO0 A;  5SWQ A;  5L2K A;  1HSB A;  1XZ0 A;  2FZ3 A;  4QRQ A;  5HHQ A;  1PQZ A;  1HHJ A;  2VE6 A;  5BJT A;  1T1W A;  5E8O A;  3FT2 A;  1T1X A;  3MRI A;  2GUO A;  3VFW A;  1T80 A;  3VFS A;  1IM9 A;  4WWK C;  3MRP A;  5IND A;  2VLL A;  3KXF A;  2WY3 A;  3FQN A;  1I4F A;  1C16 A;  4GKN A;  1S7X A;  3ILQ C;  5C0D A;  3E3Q A;  3O3A A;  4LCW A;  4PP8 C;  3RL2 A;  3TF7 A;  3HUJ A;  4PJ7 A;  3GML A;  1ZHK A;  3RUG A;  3GMP A;  3PWV A;  3RWE A;  1QEW A;  1OGA A;  5JHD A;  3ARE A;  3DXA A;  3MV7 A;  3E2H A;  3BP7 A;  3QQ3 A;  1EEY A;  2UWE A;  5FA4 A;  5EUO A;  1MHC A;  4G9F A;  4F7M A;  1I7T A;  2J8U A;  1K5N A;  1KPR A;  3LKQ A;  3V5H A;  3X11 A;  1SYV A;  2XFX A;  4HUV A;  4PRH A;  1OSZ A;  2F53 A;  3IXA A;  3BGM A;  4HV8 A;  4PG9 A;  3VH8 A;  1ZVS A;  3OV6 A;  4PV9 A;  5EFI A;  1UXS A;  3PWJ A;  3D18 A;  4GUP A;  1EXU A;  4JFD A;  1A1O A;  1HHI A;  1T0M A;  2VLJ A;  3KPQ A;  4IHO A;  5HHM A;  3QFD A;  1KPV A;  3VFU A;  4PJ9 A;  1S7V A;  4WO4 A;  1FZM A;  4HS3 A;  3RTQ A;  3T8X A;  3HG1 A;  3TFK A;  4U1I A;  3TBS A;  4G43 A;  3GSR A;  1A6Z A;  3BXN A;  5HGH A;  4ZUS A;  5AD0 A;  5MEQ A;  1LK2 A;  2RFX A;  1HSA A;  5ENW A;  1FFO A;  1P7Q A;  2BSS A;  4PJC A;  3RWC A;  1OF2 A;  3CDG A;  1S9W A;  4QRT A;  4S0U C;  2FO4 A;  3QDJ A;  3CZF A;  3BEW A;  5C08 A;  4PJA A;  5C0F A;  1AGB A;  4MQ7 A;  3ARD A;  2JCC A;  4MJ6 A;  3NFN A;  2X4S A;  3FTG A;  5B38 A;  1WBZ A;  3H7B A;  1AKJ A;  4APQ A;  3HE7 A;  3QUY A;  1KPU A;  1RJZ A;  5D2N A;  4PRN A;  1NAM H;  4X6D A;  4JFE A;  1ZHB A;  2AXG A;  3FQU A;  5E6I C;  4PJI A;  4NSK A;  4O2E A;  1T20 A;  3CC5 A;  4MNG A;  1IM3 A;  1DUZ A;  1WBX A;  1XR9 A;  1HYR C;  2GAZ A;  3ARB A;  1N5A A;  3BZF A;  1I1Y A;  2ESV A;  4Y4K A;  5IB1 A;  1CG9 A;  3BZE A;  3D25 A;  4ONO A;  4PJF A;  3C8K A;  4WU5 A;  2P5W A;  4ZFZ A;  4N5E A;  2CKB H;  1S9X A;  3RZC A;  3DX6 A;  5GSR A;  1UQS A;  3KWW A;  2AK4 A;  3LV3 A;  3W39 A;  4NQV A;  1S7U A;  3FOL A;  3I6K A;  1QVO A;  5F1N A;  3KPS A;  4JRY A;  1QR1 A;  4L3E A;  3TA3 A;  3WS6 A;  1ZS8 A;  3GMN A;  4Z78 A;  2CLV A;  3GSU A;  3MRH A;  3VRI A;  1BD2 A;  1DE4 A;  1VAC A;  1BQH A;  3GSN H;  4G8G A;  1X7Q A;  5MEO A;  4PDC E;  2VAB A;  4JFP A;  1YN7 A;  1B3J A;  2A83 A;  3MA7 A;  3L9R A;  3SDA A;  5C0E A;  1TVH A;  1L8J A;  3MV8 A;  4PR5 A;  3TBV A;  5FDW A;  1K8D A;  3DX8 A;  2D31 A;  3GSQ A;  5H94 A;  3L3H A;  5BRZ A;  3FQT A;  4HWZ A;  4PRA A;  3GSO A;  5BS0 A;  1A1N A;  4NQD A;  4Y2D A;  1JUF A;  2ZSV A;  3VWJ A;  1A9E A;  2H6P A;  2VAA A;  5F1I A;  3OX8 A;  4HUX A;  1TVB A;  4PJH A;  5GSV A;  5L2J A;  2CLR A;  3X14 A;  1KJ2 H;  2F54 A;  4NNY A;  4PRI A;  3RWF A;  3TIE A;  2OI9 A;  5IEK A;  3VFT A;  1XR8 A;  3VWK A;  1FZO A;  3MRB A;  3UTT A;  2GTZ A;  4N0U A;  3TBW A;  4ELM A;  4JFF A;  5MER A;  3FOM A;  1QO3 A;  1AGC A;  5E00 A;  5J1A A;  3L3I A;  3KLA A;  3LKP A;  5IVX A;  1S7R A;  4L8S C;  3OXS A;  4U1M A;  1Q94 A;  4QRR A;  3P4N A;  4QRP A;  4D0D A;  1JGE A;  1NAN H;  2CIK A;  4G8I A;  3LKN A;  1S9Y A;  3KPO A;  3O3E A;  3QZW A;  4I4W A;  1FO0 H;  2V2W A;  4L8D A;  4ZUV A;  2NW3 A;  3UTS A;  4Y4F A;  3VFP A;  1MWA H;  1OGT A;  3B6S A;  2GTW A;  3P73 A;  4LCC C;  4K7F A;  3QUZ A;  1ONQ A;  3MRM A;  1Z5L A;  4PGC A;  3QUK A;  4U1J A;  3PAB A;  1ZHN A;  4N0F A;  4PRP A;  2H26 A;  1W0V A;  3MRN A;  5HGA A;  1I7R A;  3G08 A; 
#chains in the Genus database with same CATH topology
 5C0G A;  3TJH A;  1NEZ A;  4GKS A;  3KYO A;  3X13 A;  3LKO A;  3KPL A;  1KCG C;  1QSE A;  1JF1 A;  3GMM A;  3P77 A;  3FT3 A;  5EO1 A;  1ED3 A;  3MRC A;  5DEG A;  3BH9 A;  3L3D A;  3DBX A;  3KPP A;  3MRD A;  3QDM A;  1T1Y A;  4O2C A;  4E5X A;  3FFC A;  1I7U A;  4NQE A;  2YEZ A;  3LKS A;  5BXF A;  3ARF A;  5EU4 A;  3MRJ A;  1BII A;  1U58 A;  4MJI A;  2C7U A;  3X12 A;  4FFE X;  2BNR A;  3HE6 A;  3SDX A;  3ILP A;  3PWL A;  4PJE A;  3RWG A;  1INQ A;  1AO7 A;  4CVZ A;  3I0T A;  3VXS A;  4V3E B;  3VXU A;  3L3J A;  5C0B A;  1FFN A;  1JPG A;  1QLF A;  3FQR A;  3ROO A;  4F7E A;  3GSX A;  2X4O A;  1I1A A;  3O9W A;  4PJ8 A;  2HJK A;  4JQX A;  5EU5 A;  1LEG A;  1T7X A;  4U1K A;  3LN5 A;  2E7L E;  1YDP A;  1S7T A;  3TBT A;  1G7P A;  4QRU A;  1JE6 A;  3GIV A;  4WDI A;  3P4M A;  3KYN A;  4NQC A;  3TPU E;  1S7S A;  1XH3 A;  1DUY A;  1M05 A;  4IRJ A;  1T7Z A;  1TMC A;  3BEV A;  4XXC A;  3VRJ A;  5C9J A;  1QSF A;  3REW A;  3P4O A;  4X6C A;  3VFR A;  3WS3 A;  4MX7 A;  4PJ5 A;  3BWA A;  2ZOK A;  4I48 A;  4UQ3 A;  4F7P A;  2BVP A;  3FRU A;  5E9D A;  4K71 B;  4NQX A;  4ZUW A;  4MVB A;  3O8X A;  5HGD A;  3ES6 A;  3PWU A;  4JFQ A;  1GZP A;  4MNQ A;  1R3H A;  3FT4 A;  3TID A;  4ZUT A;  5HHO A;  1SYS A;  3VFM A;  4PJB A;  5HHN A;  3KPM A;  5EU3 A;  3RL1 A;  2GJ6 A;  3QUX A;  3ROL A;  3DMM A;  1ZT7 A;  4F7C A;  3JTS A;  3L3K A;  1T7W A;  4PJG A;  4PGE A;  4NT6 A;  3W0W A;  5INC A;  2AXF A;  5IM7 A;  5D9S A;  2FIK A;  1YN6 A;  3MRL A;  3O3D A;  1RJY A;  4WU7 A;  4O2F A;  5C09 A;  4EUP A;  2BCK A;  3PQY A;  4NO3 A;  1HHK A;  2AV1 A;  2FYY A;  1QRN A;  3RWH A;  1ZT4 A;  3V5D A;  3I6L D;  3BP4 A;  1ZHL A;  1ZT1 A;  3VXO A;  2HN7 A;  3VXP A;  3BW9 A;  3QEQ A;  4L4V A;  4HUW A;  1ZAG A;  1P4L A;  2VLK A;  2NX5 A;  3KPR A;  4U6Y A;  3SJV A;  4N8V A;  3MRO A;  2BNQ A;  3MYJ A;  3UPR A;  1DDH A;  2CLZ A;  2X4P A;  3CPL A;  4V3D B;  3GMO A;  2AV7 A;  3VCL A;  2XPG A;  3TBY A;  5FKP A;  1T1Z A;  3BHB A;  1B0G A;  2BVO A;  1ZSD A;  4JRX A;  2PYE A;  3U0P A;  3VFO A;  3MGT A;  5IB3 A;  2Q7Y A;  3MRR A;  4G59 C;  3VXR A;  1EFX A;  3UTQ A;  5HYJ A;  3ARG A;  1MI5 A;  3SKM A;  4LCY A;  3SDC A;  1KJ3 H;  1BZ9 A;  3O4L A;  5E8N A;  1CE6 A;  3O3B A;  3MRF A;  4QOK A;  4HX1 A;  3MRQ A;  3AU1 A;  4G59 A;  4FTV A;  3MR9 A;  5C0I A;  5IRO A;  1AGF A;  5ISZ A;  5IEH A;  1W72 A;  1FG2 A;  4G9D A;  5EU6 A;  2BSR A;  5C07 A;  3QQ4 A;  4U1S A;  1JFM A;  3CH1 A;  3JTT A;  3RWJ A;  4ZUU A;  4LHU A;  1E28 A;  1GZQ A;  4N0C A;  1WBY A;  3D39 A;  3FQW A;  5F9J A;  3TN0 A;  2ZSW A;  3SKO A;  4L3C A;  2BST A;  1VAD A;  3HLA A;  5IB4 A;  1FZJ A;  1HHH A;  3GSV A;  4EI5 A;  5D5M A;  2PO6 A;  1KBG H;  1KTL A;  4L8C A;  2VLR A;  2BVQ A;  1P1Z A;  5MEP A;  2V2X A;  1T0N A;  3DTX A;  2P5E A;  1S7W A;  4NNX A;  3L3G A;  1T22 A;  4HKJ A;  3WL9 A;  4L9L C;  1JGD A;  3KPN A;  1AGE A;  1RK1 A;  2CII A;  4NO2 A;  4Z76 A;  3D2U A;  5C0J A;  5SWS A;  5EOT A;  4IRS A;  5DDH A;  3ECB A;  3MRE A;  4UQ2 A;  3SCM A;  1UXW A;  3PWP A;  3RWD A;  3QFJ A;  4PRE A;  1T7Y A;  4EN3 C;  5FA3 A;  5D2L A;  2X4U A;  5DEF A;  1LEK A;  3LKR A;  3RWI A;  4NHU E;  3CVH A;  4Y16 A;  5IB2 A;  1HHG A;  3I6G A;  3VFN A;  5C0C A;  3HAE A;  1G6R H;  1T21 A;  1A1M A;  4NO5 A;  3WLB A;  3FON A;  4D0B A;  2HJL A;  4PRB A;  2X4T A;  3H9S A;  2X4R A;  4MXQ A;  3VXN A;  1G7Q A;  4L8B A;  5J6G A;  4PV8 A;  4JFO A;  4ZAK A;  3SDD A;  4L4T A;  3DX7 A;  3TVM A;  1QQD A;  4Z77 A;  2FWO A;  5E8P A;  5B39 A;  3MV9 A;  4F7T A;  1N3N A;  1LP9 A;  3B3I A;  3GSW A;  5C0A A;  3GMR A;  3HPJ A;  2MHA A;  2YPL A;  2F74 A;  2OL3 H;  1LD9 A;  2X4Q A;  3M1B A;  1LDP H;  3CCH A;  4WJ5 A;  4LNR A;  3FQX A;  1VGK A;  2YPK A;  3JVG A;  4IIQ C;  3BO8 A;  3BH8 A;  1MHE A;  1I1F A;  3D3V A;  4L29 A;  3BUY A;  3MRK A;  1A9B A;  2AKR A;  3IT8 D;  3T1F A;  4X6F A;  5ACZ A;  3MRG A;  5MEN A;  4Y4H A;  1YPZ A;  5SWZ A;  4CVX A;  1CD1 A;  4E0R A;  5HHP A;  3LN4 A;  1EEZ A;  1AGD A;  1JHT A;  3PWN A;  2X70 A;  3QI9 A;  1S7Q A;  4JQV A;  4PGD A;  4X6E A;  5D7L A;  1W0W A;  4U1N A;  5F7D A;  4PJD A;  3M17 A;  1LQV A;  3QUL A;  3E6F A;  3H9H A;  3V5K A;  4HUU A;  4CW1 A;  2DYP A;  3JTC A;  3P9M A;  4MS8 A;  3ERY A;  5D7J C;  3VJ6 A;  1B0R A;  3SPV A;  3C9N A;  3TO2 A;  1RK0 A;  5J6H A;  4U1L A;  4U1H A;  3AM8 A;  1KJV A;  1M6O A;  3HCV A;  2GT9 A;  3VXM A;  2ZOL A;  4U6X A;  4WW2 C;  1N2R A;  3VFV A;  4PRD A;  5HGB A;  2X4N A;  3E6H A;  3TO4 A;  4WUU A;  4MJ5 A;  3RGV C;  3UBX A;  3BVN A;  1N59 A;  1E27 A;  5IB5 A;  3S6C A;  3OXR A;  3P9L A;  3QDG A;  3GMQ A;  5EO0 A;  4QRS A;  4PG2 A;  1FFP A;  4G42 A;  1S8D A;  4D0C A;  2GIT A;  5D7I A;  1JPF A;  1KJM A;  4PJX A;  1FZK A;  3TZV C;  3WUW A;  3MGO A;  3GJF A;  2HLA A;  1HOC A;  1T7V A;  4PGB A;  4NO0 A;  5SWQ A;  5L2K A;  1HSB A;  1XZ0 A;  2FZ3 A;  4QRQ A;  5HHQ A;  1PQZ A;  1HHJ A;  2O5N A;  2VE6 A;  5BJT A;  1T1W A;  5E8O A;  3FT2 A;  1T1X A;  3MRI A;  2GUO A;  3VFW A;  1T80 A;  3VFS A;  1IM9 A;  4WWK C;  3MRP A;  5IND A;  2VLL A;  3KXF A;  2WY3 A;  3FQN A;  1I4F A;  1C16 A;  4GKN A;  1S7X A;  3ILQ C;  5C0D A;  3E3Q A;  3O3A A;  4LCW A;  4PP8 C;  3RL2 A;  3TF7 A;  3HUJ A;  4PJ7 A;  3GML A;  1ZHK A;  3RUG A;  3GMP A;  3PWV A;  3RWE A;  1QEW A;  1OGA A;  5JHD A;  3ARE A;  3DXA A;  3MV7 A;  3E2H A;  3BP7 A;  3QQ3 A;  1EEY A;  2UWE A;  5FA4 A;  5EUO A;  1MHC A;  4G9F A;  4F7M A;  1I7T A;  2J8U A;  1K5N A;  1KPR A;  3LKQ A;  3V5H A;  3X11 A;  1SYV A;  2XFX A;  4HUV A;  4PRH A;  1OSZ A;  2F53 A;  3IXA A;  3BGM A;  4HV8 A;  4PG9 A;  3VH8 A;  1ZVS A;  3OV6 A;  4PV9 A;  5EFI A;  1UXS A;  3PWJ A;  3D18 A;  4GUP A;  1EXU A;  4JFD A;  1A1O A;  1HHI A;  1T0M A;  2VLJ A;  3KPQ A;  4IHO A;  5HHM A;  3QFD A;  1KPV A;  3VFU A;  4PJ9 A;  1S7V A;  4WO4 A;  1FZM A;  4HS3 A;  3RTQ A;  3T8X A;  3HG1 A;  3TFK A;  4U1I A;  3TBS A;  2NYK A;  4G43 A;  3GSR A;  1A6Z A;  3BXN A;  5HGH A;  4ZUS A;  5AD0 A;  5MEQ A;  1LK2 A;  2RFX A;  1HSA A;  5ENW A;  1FFO A;  1P7Q A;  2BSS A;  4PJC A;  3RWC A;  1OF2 A;  3CDG A;  1S9W A;  4QRT A;  4S0U C;  2FO4 A;  3QDJ A;  3CZF A;  3BEW A;  5C08 A;  4PJA A;  5C0F A;  1AGB A;  4MQ7 A;  3ARD A;  2JCC A;  4MJ6 A;  3NFN A;  2X4S A;  3FTG A;  5B38 A;  1WBZ A;  3H7B A;  1AKJ A;  4APQ A;  3HE7 A;  3QUY A;  1KPU A;  1RJZ A;  5D2N A;  4PRN A;  1NAM H;  4X6D A;  4JFE A;  1ZHB A;  2AXG A;  3FQU A;  5E6I C;  4PJI A;  4NSK A;  4O2E A;  1T20 A;  3CC5 A;  4MNG A;  1IM3 A;  1DUZ A;  1WBX A;  1XR9 A;  1HYR C;  2GAZ A;  3ARB A;  1N5A A;  3BZF A;  1I1Y A;  2ESV A;  4Y4K A;  5IB1 A;  4BKW A;  1CG9 A;  3BZE A;  3D25 A;  4ONO A;  4PJF A;  3C8K A;  4WU5 A;  2P5W A;  4ZFZ A;  4N5E A;  2CKB H;  1S9X A;  3RZC A;  3DX6 A;  5GSR A;  1UQS A;  3KWW A;  2AK4 A;  3LV3 A;  3W39 A;  4NQV A;  1S7U A;  3FOL A;  3I6K A;  1QVO A;  5F1N A;  3KPS A;  4JRY A;  1QR1 A;  4L3E A;  3TA3 A;  3WS6 A;  1ZS8 A;  3GMN A;  4Z78 A;  2CLV A;  3GSU A;  3MRH A;  3VRI A;  1BD2 A;  1DE4 A;  1VAC A;  1BQH A;  3GSN H;  4G8G A;  1X7Q A;  5MEO A;  4PDC E;  2VAB A;  4JFP A;  1YN7 A;  1B3J A;  2A83 A;  3MA7 A;  3L9R A;  3SDA A;  5C0E A;  1TVH A;  1L8J A;  3MV8 A;  4PR5 A;  3TBV A;  5FDW A;  1K8D A;  3DX8 A;  2D31 A;  3GSQ A;  5H94 A;  3L3H A;  5BRZ A;  3FQT A;  4HWZ A;  4PRA A;  4JO8 A;  3GSO A;  5BS0 A;  1A1N A;  4NQD A;  4Y2D A;  1JUF A;  2ZSV A;  3VWJ A;  1A9E A;  2H6P A;  2VAA A;  5F1I A;  3OX8 A;  4HUX A;  1TVB A;  4PJH A;  5GSV A;  5L2J A;  2CLR A;  3X14 A;  1KJ2 H;  2F54 A;  4NNY A;  4PRI A;  3RWF A;  3TIE A;  2OI9 A;  5IEK A;  3VFT A;  1XR8 A;  3VWK A;  1FZO A;  2IA1 A;  3MRB A;  3UTT A;  2GTZ A;  4N0U A;  3TBW A;  4ELM A;  4JFF A;  5MER A;  3FOM A;  1QO3 A;  1AGC A;  5E00 A;  5J1A A;  3L3I A;  3KLA A;  3LKP A;  5IVX A;  1S7R A;  4L8S C;  3OXS A;  4U1M A;  1Q94 A;  4QRR A;  3P4N A;  4QRP A;  4D0D A;  1JGE A;  1NAN H;  2CIK A;  4G8I A;  3LKN A;  1S9Y A;  3KPO A;  3O3E A;  3QZW A;  4I4W A;  1FO0 H;  2V2W A;  4L8D A;  4ZUV A;  2NW3 A;  3UTS A;  4Y4F A;  3VFP A;  1MWA H;  1OGT A;  3B6S A;  2GTW A;  3P73 A;  4LCC C;  4K7F A;  3QUZ A;  1ONQ A;  3MRM A;  1Z5L A;  4PGC A;  3QUK A;  4U1J A;  3PAB A;  1ZHN A;  4N0F A;  4PRP A;  2H26 A;  1W0V A;  3MRN A;  5HGA A;  1I7R A;  3G08 A; 
#chains in the Genus database with same CATH homology
 5C0G A;  3TJH A;  1NEZ A;  4GKS A;  3KYO A;  3X13 A;  3LKO A;  3KPL A;  1KCG C;  1QSE A;  1JF1 A;  3GMM A;  3P77 A;  3FT3 A;  5EO1 A;  1ED3 A;  3MRC A;  5DEG A;  3BH9 A;  3L3D A;  3DBX A;  3KPP A;  3MRD A;  3QDM A;  1T1Y A;  4O2C A;  4E5X A;  3FFC A;  1I7U A;  4NQE A;  2YEZ A;  3LKS A;  5BXF A;  3ARF A;  5EU4 A;  3MRJ A;  1BII A;  1U58 A;  4MJI A;  2C7U A;  3X12 A;  4FFE X;  2BNR A;  3HE6 A;  3SDX A;  3ILP A;  3PWL A;  4PJE A;  3RWG A;  1INQ A;  1AO7 A;  4CVZ A;  3VXS A;  4V3E B;  3VXU A;  3L3J A;  5C0B A;  1FFN A;  1JPG A;  1QLF A;  3FQR A;  3ROO A;  4F7E A;  3GSX A;  2X4O A;  1I1A A;  3O9W A;  4PJ8 A;  2HJK A;  4JQX A;  5EU5 A;  1LEG A;  1T7X A;  4U1K A;  3LN5 A;  2E7L E;  1YDP A;  1S7T A;  3TBT A;  1G7P A;  4QRU A;  1JE6 A;  3GIV A;  4WDI A;  3P4M A;  3KYN A;  4NQC A;  3TPU E;  1S7S A;  1XH3 A;  1DUY A;  1M05 A;  4IRJ A;  1T7Z A;  1TMC A;  3BEV A;  4XXC A;  3VRJ A;  5C9J A;  1QSF A;  3REW A;  3P4O A;  4X6C A;  3VFR A;  3WS3 A;  4MX7 A;  4PJ5 A;  3BWA A;  2ZOK A;  4I48 A;  4UQ3 A;  4F7P A;  2BVP A;  3FRU A;  5E9D A;  4K71 B;  4NQX A;  4ZUW A;  4MVB A;  3O8X A;  5HGD A;  3ES6 A;  3PWU A;  4JFQ A;  1GZP A;  4MNQ A;  1R3H A;  3FT4 A;  3TID A;  4ZUT A;  5HHO A;  1SYS A;  3VFM A;  4PJB A;  5HHN A;  3KPM A;  5EU3 A;  3RL1 A;  2GJ6 A;  3QUX A;  3ROL A;  3DMM A;  1ZT7 A;  4F7C A;  3JTS A;  3L3K A;  1T7W A;  4PJG A;  4PGE A;  4NT6 A;  3W0W A;  5INC A;  2AXF A;  5IM7 A;  5D9S A;  2FIK A;  1YN6 A;  3MRL A;  3O3D A;  1RJY A;  4WU7 A;  4O2F A;  5C09 A;  4EUP A;  2BCK A;  3PQY A;  4NO3 A;  1HHK A;  2AV1 A;  2FYY A;  1QRN A;  3RWH A;  1ZT4 A;  3V5D A;  3I6L D;  3BP4 A;  1ZHL A;  1ZT1 A;  3VXO A;  2HN7 A;  3VXP A;  3BW9 A;  3QEQ A;  4L4V A;  4HUW A;  1ZAG A;  1P4L A;  2VLK A;  2NX5 A;  3KPR A;  4U6Y A;  3SJV A;  4N8V A;  3MRO A;  2BNQ A;  3MYJ A;  3UPR A;  1DDH A;  2CLZ A;  2X4P A;  3CPL A;  4V3D B;  3GMO A;  2AV7 A;  3VCL A;  2XPG A;  3TBY A;  5FKP A;  1T1Z A;  3BHB A;  1B0G A;  2BVO A;  1ZSD A;  4JRX A;  2PYE A;  3U0P A;  3VFO A;  3MGT A;  5IB3 A;  2Q7Y A;  3MRR A;  3VXR A;  1EFX A;  3UTQ A;  5HYJ A;  3ARG A;  1MI5 A;  3SKM A;  4LCY A;  3SDC A;  1KJ3 H;  1BZ9 A;  3O4L A;  5E8N A;  1CE6 A;  3O3B A;  3MRF A;  4QOK A;  4HX1 A;  3MRQ A;  3AU1 A;  4G59 A;  4FTV A;  3MR9 A;  5C0I A;  5IRO A;  1AGF A;  5ISZ A;  5IEH A;  1W72 A;  1FG2 A;  4G9D A;  5EU6 A;  2BSR A;  5C07 A;  3QQ4 A;  4U1S A;  1JFM A;  3CH1 A;  3JTT A;  3RWJ A;  4ZUU A;  4LHU A;  1E28 A;  1GZQ A;  4N0C A;  1WBY A;  3D39 A;  3FQW A;  5F9J A;  3TN0 A;  2ZSW A;  3SKO A;  4L3C A;  2BST A;  1VAD A;  3HLA A;  5IB4 A;  1FZJ A;  1HHH A;  3GSV A;  4EI5 A;  5D5M A;  2PO6 A;  1KBG H;  1KTL A;  4L8C A;  2VLR A;  2BVQ A;  1P1Z A;  5MEP A;  2V2X A;  1T0N A;  3DTX A;  2P5E A;  1S7W A;  4NNX A;  3L3G A;  1T22 A;  4HKJ A;  3WL9 A;  4L9L C;  1JGD A;  3KPN A;  1AGE A;  1RK1 A;  2CII A;  4NO2 A;  4Z76 A;  3D2U A;  5C0J A;  5SWS A;  5EOT A;  4IRS A;  5DDH A;  3ECB A;  3MRE A;  4UQ2 A;  3SCM A;  1UXW A;  3PWP A;  3RWD A;  3QFJ A;  4PRE A;  1T7Y A;  4EN3 C;  5FA3 A;  5D2L A;  2X4U A;  5DEF A;  1LEK A;  3LKR A;  3RWI A;  4NHU E;  3CVH A;  4Y16 A;  5IB2 A;  1HHG A;  3I6G A;  3VFN A;  5C0C A;  3HAE A;  1G6R H;  1T21 A;  1A1M A;  4NO5 A;  3WLB A;  3FON A;  4D0B A;  2HJL A;  4PRB A;  2X4T A;  3H9S A;  2X4R A;  4MXQ A;  3VXN A;  1G7Q A;  4L8B A;  5J6G A;  4PV8 A;  4JFO A;  4ZAK A;  3SDD A;  4L4T A;  3DX7 A;  3TVM A;  1QQD A;  4Z77 A;  2FWO A;  5E8P A;  5B39 A;  3MV9 A;  4F7T A;  1N3N A;  1LP9 A;  3B3I A;  3GSW A;  5C0A A;  3GMR A;  3HPJ A;  2MHA A;  2YPL A;  2F74 A;  2OL3 H;  1LD9 A;  2X4Q A;  3M1B A;  1LDP H;  3CCH A;  4WJ5 A;  4LNR A;  3FQX A;  1VGK A;  2YPK A;  3JVG A;  4IIQ C;  3BO8 A;  3BH8 A;  1MHE A;  1I1F A;  3D3V A;  4L29 A;  3BUY A;  3MRK A;  1A9B A;  2AKR A;  3IT8 D;  3T1F A;  4X6F A;  5ACZ A;  3MRG A;  5MEN A;  4Y4H A;  1YPZ A;  5SWZ A;  4CVX A;  1CD1 A;  4E0R A;  5HHP A;  3LN4 A;  1EEZ A;  1AGD A;  1JHT A;  3PWN A;  2X70 A;  3QI9 A;  1S7Q A;  4JQV A;  4PGD A;  4X6E A;  5D7L A;  1W0W A;  4U1N A;  5F7D A;  4PJD A;  3M17 A;  1LQV A;  3QUL A;  3E6F A;  3H9H A;  3V5K A;  4HUU A;  4CW1 A;  2DYP A;  3JTC A;  3P9M A;  4MS8 A;  3ERY A;  5D7J C;  3VJ6 A;  1B0R A;  3SPV A;  3C9N A;  3TO2 A;  1RK0 A;  5J6H A;  4U1L A;  4U1H A;  3AM8 A;  1KJV A;  1M6O A;  3HCV A;  2GT9 A;  3VXM A;  2ZOL A;  4U6X A;  4WW2 C;  1N2R A;  3VFV A;  4PRD A;  5HGB A;  2X4N A;  3E6H A;  3TO4 A;  4WUU A;  4MJ5 A;  3RGV C;  3UBX A;  3BVN A;  1N59 A;  1E27 A;  5IB5 A;  3S6C A;  3OXR A;  3P9L A;  3QDG A;  3GMQ A;  5EO0 A;  4QRS A;  4PG2 A;  1FFP A;  4G42 A;  1S8D A;  4D0C A;  2GIT A;  5D7I A;  1JPF A;  1KJM A;  4PJX A;  1FZK A;  3TZV C;  3WUW A;  3MGO A;  3GJF A;  2HLA A;  1HOC A;  1T7V A;  4PGB A;  4NO0 A;  5SWQ A;  5L2K A;  1HSB A;  1XZ0 A;  2FZ3 A;  4QRQ A;  5HHQ A;  1PQZ A;  1HHJ A;  2VE6 A;  5BJT A;  1T1W A;  5E8O A;  3FT2 A;  1T1X A;  3MRI A;  2GUO A;  3VFW A;  1T80 A;  3VFS A;  1IM9 A;  4WWK C;  3MRP A;  5IND A;  2VLL A;  3KXF A;  2WY3 A;  3FQN A;  1I4F A;  1C16 A;  4GKN A;  1S7X A;  3ILQ C;  5C0D A;  3E3Q A;  3O3A A;  4LCW A;  4PP8 C;  3RL2 A;  3TF7 A;  3HUJ A;  4PJ7 A;  3GML A;  1ZHK A;  3RUG A;  3GMP A;  3PWV A;  3RWE A;  1QEW A;  1OGA A;  5JHD A;  3ARE A;  3DXA A;  3MV7 A;  3E2H A;  3BP7 A;  3QQ3 A;  1EEY A;  2UWE A;  5FA4 A;  5EUO A;  1MHC A;  4G9F A;  4F7M A;  1I7T A;  2J8U A;  1K5N A;  1KPR A;  3LKQ A;  3V5H A;  3X11 A;  1SYV A;  2XFX A;  4HUV A;  4PRH A;  1OSZ A;  2F53 A;  3IXA A;  3BGM A;  4HV8 A;  4PG9 A;  3VH8 A;  1ZVS A;  3OV6 A;  4PV9 A;  5EFI A;  1UXS A;  3PWJ A;  3D18 A;  4GUP A;  1EXU A;  4JFD A;  1A1O A;  1HHI A;  1T0M A;  2VLJ A;  3KPQ A;  4IHO A;  5HHM A;  3QFD A;  1KPV A;  3VFU A;  4PJ9 A;  1S7V A;  4WO4 A;  1FZM A;  4HS3 A;  3RTQ A;  3T8X A;  3HG1 A;  3TFK A;  4U1I A;  3TBS A;  4G43 A;  3GSR A;  1A6Z A;  3BXN A;  5HGH A;  4ZUS A;  5AD0 A;  5MEQ A;  1LK2 A;  2RFX A;  1HSA A;  5ENW A;  1FFO A;  1P7Q A;  2BSS A;  4PJC A;  3RWC A;  1OF2 A;  3CDG A;  1S9W A;  4QRT A;  4S0U C;  2FO4 A;  3QDJ A;  3CZF A;  3BEW A;  5C08 A;  4PJA A;  5C0F A;  1AGB A;  4MQ7 A;  3ARD A;  2JCC A;  4MJ6 A;  3NFN A;  2X4S A;  3FTG A;  5B38 A;  1WBZ A;  3H7B A;  1AKJ A;  4APQ A;  3HE7 A;  3QUY A;  1KPU A;  1RJZ A;  5D2N A;  4PRN A;  1NAM H;  4X6D A;  4JFE A;  1ZHB A;  2AXG A;  3FQU A;  5E6I C;  4PJI A;  4NSK A;  4O2E A;  1T20 A;  3CC5 A;  4MNG A;  1IM3 A;  1DUZ A;  1WBX A;  1XR9 A;  1HYR C;  2GAZ A;  3ARB A;  1N5A A;  3BZF A;  1I1Y A;  2ESV A;  4Y4K A;  5IB1 A;  1CG9 A;  3BZE A;  3D25 A;  4ONO A;  4PJF A;  3C8K A;  4WU5 A;  2P5W A;  4ZFZ A;  4N5E A;  2CKB H;  1S9X A;  3RZC A;  3DX6 A;  5GSR A;  1UQS A;  3KWW A;  2AK4 A;  3LV3 A;  3W39 A;  4NQV A;  1S7U A;  3FOL A;  3I6K A;  1QVO A;  5F1N A;  3KPS A;  4JRY A;  1QR1 A;  4L3E A;  3TA3 A;  3WS6 A;  1ZS8 A;  3GMN A;  4Z78 A;  2CLV A;  3GSU A;  3MRH A;  3VRI A;  1BD2 A;  1DE4 A;  1VAC A;  1BQH A;  3GSN H;  4G8G A;  1X7Q A;  5MEO A;  4PDC E;  2VAB A;  4JFP A;  1YN7 A;  1B3J A;  2A83 A;  3MA7 A;  3L9R A;  3SDA A;  5C0E A;  1TVH A;  1L8J A;  3MV8 A;  4PR5 A;  3TBV A;  5FDW A;  1K8D A;  3DX8 A;  2D31 A;  3GSQ A;  5H94 A;  3L3H A;  5BRZ A;  3FQT A;  4HWZ A;  4PRA A;  3GSO A;  5BS0 A;  1A1N A;  4NQD A;  4Y2D A;  1JUF A;  2ZSV A;  3VWJ A;  1A9E A;  2H6P A;  2VAA A;  5F1I A;  3OX8 A;  4HUX A;  1TVB A;  4PJH A;  5GSV A;  5L2J A;  2CLR A;  3X14 A;  1KJ2 H;  2F54 A;  4NNY A;  4PRI A;  3RWF A;  3TIE A;  2OI9 A;  5IEK A;  3VFT A;  1XR8 A;  3VWK A;  1FZO A;  3MRB A;  3UTT A;  2GTZ A;  4N0U A;  3TBW A;  4ELM A;  4JFF A;  5MER A;  3FOM A;  1QO3 A;  1AGC A;  5E00 A;  5J1A A;  3L3I A;  3KLA A;  3LKP A;  5IVX A;  1S7R A;  4L8S C;  3OXS A;  4U1M A;  1Q94 A;  4QRR A;  3P4N A;  4QRP A;  4D0D A;  1JGE A;  1NAN H;  2CIK A;  4G8I A;  3LKN A;  1S9Y A;  3KPO A;  3O3E A;  3QZW A;  4I4W A;  1FO0 H;  2V2W A;  4L8D A;  4ZUV A;  2NW3 A;  3UTS A;  4Y4F A;  3VFP A;  1MWA H;  1OGT A;  3B6S A;  2GTW A;  3P73 A;  4LCC C;  4K7F A;  3QUZ A;  1ONQ A;  3MRM A;  1Z5L A;  4PGC A;  3QUK A;  4U1J A;  3PAB A;  1ZHN A;  4N0F A;  4PRP A;  2H26 A;  1W0V A;  3MRN A;  5HGA A;  1I7R A;  3G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...