3E3QA

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
b'GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 175
sequence length 175
chains with identical sequence B, H, L, P, U, Y, c
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e3qA00
4ELMA 5IVXA 1T1YA 3P4OA 1M6OA 4JFPA 4LCWA 1QVOA 3RTQA 3UTSA 1PQZA 3D2UA 2GTWA 4PRNA 4QOKA 1KJMA 4Z78A 2FWOA 1HHIA 3GJFA 3TN0A 3QULA 4MS8A 4G8GA 3GSOA 5DDHA 3VWJA 5F1IA 4ZUWA 2BVPA 3SJVA 1E28A 1N59A 2PO6A 1VGKA 3QDMA 4JFQA 1QSFA 5HHQA 3ROLA 1A1NA 3TO2A 3WS6A 1FZKA 3O3DA 3BEVA 4PRPA 1AGCA 1GZPA 3OV6A 3RZCA 3FQWA 1HHKA 3KPQA 1WBZA 4JRYA 4ONOA 5D5MA 4D0BA 3JTTA 4PRIA 4WO4A 5E9DA 3LKNA 1S9XA 3RWHA 2JCCA 3E3QA 4PGBA 5HHOA 1S7VA 3TBSA 3O8XA 1AO7A 1JUFA 1HSAA 3CPLA 3GMQA 1XZ0A 3PWJA 3KPPA 3O3BA 3RGVC 4F7CA 3SDXA 3DX8A 3BO8A 1VADA 1IM3A 2VLLA 3ERYA 1UXSA 4O2CA 3TO4A 3MR9A 1S7XA 2J8UA 3LKSA 3P73A 2FYYA 3VXRA 1LEGA 1OSZA 4Y16A 1K5NA 2GUOA 3D39A 3QDGA 3VH8A 1P4LA 4IRJA 4JQXA 5D2NA 3VFNA 5FDWA 2E7LE 1I7RA 3O3EA 2ZOKA 5C07A 2NX5A 2AKRA 3B3IA 3KLAA 3BZFA 3RWJA 4JRXA 5E8OA 3ARDA 2D31A 3V5HA 3X11A 2BNQA 5F7DA 5EU4A 1DUYA 1RJZA 3TA3A 3MRLA 3IT8D 1NEZA 3BH9A 3QI9A 4PRDA 3MA7A 1LEKA 4WU5A 4G9DA 5GSRA 4HUUA 1T7VA 3TF7A 1EEYA 3MRRA 3FONA 4NNXA 1S7UA 3I6LD 3ILPA 4G9FA 2CLRA 4PJ5A 3MRKA 4Y4FA 2F53A 3TZVC 1P7QA 3FFCA 1M05A 1AGDA 4NNYA 4PV8A 2X4PA 3BW9A 5DEFA 3U0PA 4PJDA 5MEPA 1S7WA 1S8DA 1TMCA 1JGEA 1T7YA 5HGDA 3FQRA 3SDDA 3C9NA 4S0UC 5IB2A 1VACA 2CIKA 4IRSA 4PGDA 3MRJA 3ROOA 1K8DA 2CLVA 4WWKC 3UPRA 1JE6A 3D3VA 4PREA 2ZOLA 4MJIA 1KTLA 3LN5A 1EFXA 3PABA 4U1NA 1W0VA 4X6FA 4NQVA 2GITA 4L3CA 3KPSA 1HYRC 3MRIA 4PR5A 5C08A 2RFXA 2BSRA 2CLZA 3MGOA 2AXFA 3KPOA 3VXNA 3FT3A 1FZJA 1ZSDA 5HGAA 3GSWA 4CVZA 1LD9A 2UWEA 5C09A 3VFRA 2VE6A 4PJHA 1DUZA 4MNQA 4U1HA 4PJEA 1TVBA 3E2HA 5F1NA 3L3JA 3FQUA 3RWFA 2PYEA 3X12A 3HCVA 1FFOA 1FFNA 1DE4A 5E00A 1OGAA 4EI5A 2VABA 4HV8A 5EFIA 1QO3A 3VFWA 5MEOA 1B0RA 1NANH 3IXAA 4V3EB 3KPNA 4G42A 5DEGA 4IHOA 1KPRA 3PWVA 3B6SA 5IEKA 5EUOA 3L3IA 3SPVA 3UBXA 5IEHA 2GJ6A 4ZFZA 3VFUA 4QRRA 4UQ2A 1KBGH 3P9MA 3GMPA 4E0RA 5EO0A 4XXCA 3QUZA 3NFNA 4U6YA 2HJKA 2OL3H 4G59A 5GSVA 1W72A 2VLRA 1A9BA 4HKJA 1CD1A 4MNGA 3W0WA 5IB5A 1UXWA 2CIIA 4MXQA 4NQDA 3DMMA 3BXNA 5D9SA 4ZAKA 4U1KA 3KWWA 4ZUUA 5HGHA 1XR9A 1DDHA 2AXGA 3X13A 3L3GA 1FG2A 1UQSA 1ZS8A 5E6IC 4PJXA 5FA3A 1S7TA 3LV3A 5INDA 3S6CA 4UQ3A 3V5DA 3O9WA 5J6HA 4G8IA 3VXSA 1LQVA 1N5AA 1T1XA 2FIKA 2ESVA 4WU7A 1S9WA 3FQNA 3QEQA 4L8SC 1ZT4A 1B3JA 3BZEA 1B0GA 1U58A 3BP4A 3FRUA 3PWLA 1KJ2H 3SCMA 1JF1A 2F74A 3TBTA 3TFKA 3W39A 5MERA 1N3NA 1I1AA 3JTSA 5L2JA 3MV8A 4U1IA 1WBXA 2BNRA 3QZWA 1INQA 4N0FA 5FKPA 5B39A 3ES6A 4X6CA 2AV1A 5JHDA 1ZHBA 3TPUE 2XPGA 1ZHLA 3H7BA 4K71B 4IIQC 3QDJA 3L3DA 3E6HA 3RL1A 1KJVA 3CVHA 3BUYA 1RK1A 3PWUA 2X4OA 3GSRA 5IB1A 1ZVSA 3CC5A 1YDPA 3SDCA 5C0DA 4PG2A 4PRHA 1ZAGA 4X6DA 5C0BA 3REWA 3VFMA 2X4NA 3VRJA 3QQ4A 1T7WA 1MI5A 3CDGA 4QRPA 5FA4A 1MHEA 4PJBA 1BZ9A 1OGTA 3TVMA 2CKBH 2GTZA 2YPLA 3VWKA 2HN7A 5J1AA 4WJ5A 1HSBA 4PJCA 3H9SA 4L8BA 1JGDA 4QRQA 2A83A 3T8XA 1QQDA 3P9LA 5C0GA 1YN7A 4E5XA 3UTTA 4Z76A 3L3KA 3SDAA 1FZMA 1IM9A 4ZUTA 2X70A 4PDCE 1W0WA 3VFSA 3RWGA 3GSQA 4GKSA 2BCKA 5AD0A 1JFMA 3BGMA 3H9HA 5ENWA 5ISZA 2MHAA 4MX7A 3VXUA 5C0JA 1HHGA 4N5EA 1LP9A 4X6EA 3VFTA 1T21A 1ZHNA 3TBVA 5F9JA 1A1OA 4NT6A 4PRBA 1FFPA 2HJLA 5L2KA 1G6RH 1AGEA 5D7LA 4HUXA 3SKMA 4HS3A 5BJTA 2X4RA 3HUJA 1KPVA 1T7XA 2H26A 2Q7YA 3VXOA 4JQVA 1QEWA 3M1BA 3P4MA 2VAAA 3QUXA 4CVXA 5C0IA 5MEQA 4Y4KA 4PJ8A 3MREA 3AM8A 2GAZA 3CCHA 3MV7A 4V3DB 3MROA 1QRNA 3FOMA 3BWAA 3TIDA 1KJ3H 4G43A 4L29A 3UTQA 3RWIA 3RWEA 2H6PA 4PJ9A 2GT9A 4LHUA 1Q94A 2ZSVA 1KCGC 3LKPA 4N8VA 4ZUVA 5D7IA 2C7UA 2AV7A 3MRGA 3VFOA 3X14A 3JVGA 4NQEA 3PQYA 3FQXA 1CE6A 1E27A 1XR8A 3TJHA 4D0DA 5C9JA 1FZOA 2ZSWA 4F7TA 3DTXA 3GSXA 1ZHKA 4GKNA 5SWSA 4K7FA 4HUWA 3E6FA 1YPZA 3QQ3A 3QFJA 4FFEX 1XH3A 4HX1A 4NO5A 3BP7A 3AU1A 3MRQA 4F7MA 4JFEA 4NQCA 3KPLA 3MRBA 1I4FA 4NSKA 5HGBA 5B38A 3QUYA 1Z5LA 4NHUE 5EO1A 3OXSA 3WS3A 3DX7A 1I1YA 4EUPA 3TBYA 3MV9A 3HG1A 4U1JA 2BVOA 3AREA 5EU5A 3WUWA 2NW3A 4N0UA 5EU3A 1T80A 3HPJA 3ILQC 1SYSA 3WLBA 2BSTA 3CH1A 5SWZA 2YPKA 3L9RA 3HAEA 5C0CA 2X4TA 1ED3A 3M17A 3MGTA 4PGEA 3V5KA 3GIVA 1KPUA 2P5EA 3MRNA 2V2XA 4LCYA 4WUUA 1I1FA 4NO2A 1WBYA 1S7QA 4GUPA 4ZUSA 4O2EA 4HUVA 1OF2A 1JPGA 5E8PA 1S7RA 3LKOA 2X4SA 3C8KA 3VCLA 1EEZA 3GSUA 1RK0A 2BVQA 1NAMH 3GSNH 4Y4HA 3GMMA 3BVNA 5HHNA 3PWNA 5IROA 3I6KA 4U1MA 4L4TA 2FZ3A 4WW2C 4D0CA 3P4NA 4PJ7A 4U1LA 4Z77A 1T1ZA 3KXFA 4I48A 3MRCA 3VJ6A 5ACZA 4F7EA 3ARBA 1T0NA 1X7QA 3VFVA 4LNRA 3MRHA 3O3AA 3QFDA 4MJ5A 3VFPA 1P1ZA 3P77A 4L3EA 3RWCA 3BHBA 1A9EA 4JFDA 5C0EA 1A1MA 3GMNA 2WY3A 1HHJA 3OX8A 1QR1A 1QSEA 3DXAA 1ZT1A 3HLAA 4L9LC 1MHCA 1T0MA 4L8DA 3HE6A 4MVBA 1AGFA 3WL9A 5IB3A 3TIEA 3RL2A 2VLKA 3D25A 1YN6A 1L8JA 3DX6A 2F54A 1T22A 1T1WA 2X4UA 1BQHA 3CZFA 4EN3C 3LN4A 2DYPA 1G7PA 4NO3A 3FTGA 3TBWA 3FQTA 3I6GA 1AGBA 3ECBA 3JTCA 3VXPA 2AK4A 3LKRA 3GMOA 1RJYA 3OXRA 1ONQA 1T7ZA 2OI9A 4Y2DA 3HE7A 1BD2A 1N2RA 4HWZA 4U1SA 3SKOA 3KYNA 3VXMA 1A6ZA 4LCCC 5IB4A 4L8CA 1EXUA 3MRDA 4PV9A 1JHTA 1I7TA 1HOCA 3T1FA 5BS0A 5BXFA 1AKJA 5HHMA 5C0AA 4QRSA 3D18A 2VLJA 4N0CA 3QUKA 1I7UA 4FTVA 3L3HA 3RUGA 3ARGA 3FT4A 5HYJA 5J6GA 1ZT7A 4JFOA 2P5WA 5INCA 4NQXA 1LK2A 4PJAA 4PJGA 3PWPA 1HHHA 4MQ7A 1GZQA 5EOTA 1JPFA 3LKQA 2YEZA 4PJIA 1G7QA 4PGCA 1C16A 2BSSA 1BIIA 3GMRA 3RWDA 3MRMA 4F7PA 4QRTA 1T20A 2XFXA 5E8NA 4U6XA 4APQA 5SWQA 5BRZA 3G08A 1S7SA 3KPMA 4PG9A 3BH8A 3KPRA 1QLFA 3VRIA 3FT2A 1FO0H 1MWAH 2X4QA 1LDPH 3KYOA 5D7JC 5IM7A 4JFFA 4PP8C 4O2FA 2FO4A 5H94A 3FOLA 5MENA 5EU6A 3DBXA 4PRAA 4L4VA 3MYJA 2V2WA 2HLAA 4QRUA 4CW1A 1SYVA 3O4LA 5D2LA 4WDIA 1R3HA 1S9YA 1TVHA 5C0FA 4MJ6A 3GSVA 4NO0A 3GMLA 3MRFA 3MRPA 4PJFA 3BEWA 4I4WA 1CG9A 5HHPA 3ARFA
chains in the Genus database with same CATH superfamily
4ELMA 5IVXA 1T1YA 3P4OA 1M6OA 4JFPA 4LCWA 1QVOA 3RTQA 3UTSA 1PQZA 3D2UA 2GTWA 4PRNA 4QOKA 1KJMA 4Z78A 2FWOA 1HHIA 3GJFA 3TN0A 3QULA 4MS8A 4G8GA 3GSOA 5DDHA 3VWJA 5F1IA 4ZUWA 2BVPA 3SJVA 1E28A 1N59A 2PO6A 1VGKA 3QDMA 4JFQA 1QSFA 5HHQA 3ROLA 1A1NA 3TO2A 3WS6A 1FZKA 3O3DA 3BEVA 4PRPA 1AGCA 1GZPA 3OV6A 3RZCA 3FQWA 1HHKA 3KPQA 1WBZA 4JRYA 4ONOA 5D5MA 4D0BA 3JTTA 4PRIA 4WO4A 5E9DA 3LKNA 1S9XA 3RWHA 2JCCA 3E3QA 4PGBA 5HHOA 1S7VA 3TBSA 3O8XA 1AO7A 1JUFA 1HSAA 3CPLA 3GMQA 1XZ0A 3PWJA 3KPPA 3O3BA 3RGVC 4F7CA 3SDXA 3DX8A 3BO8A 1VADA 1IM3A 2VLLA 3ERYA 1UXSA 4O2CA 3TO4A 3MR9A 1S7XA 2J8UA 3LKSA 3P73A 2FYYA 3VXRA 1LEGA 1OSZA 4Y16A 1K5NA 2GUOA 3D39A 2NYKA 3QDGA 3VH8A 1P4LA 4IRJA 4JQXA 5D2NA 3VFNA 5FDWA 2E7LE 1I7RA 3O3EA 2ZOKA 5C07A 2NX5A 2AKRA 3B3IA 3KLAA 3BZFA 3RWJA 4JRXA 5E8OA 3ARDA 2D31A 3V5HA 3X11A 2BNQA 5F7DA 5EU4A 1DUYA 1RJZA 3TA3A 3MRLA 3IT8D 1NEZA 3BH9A 3QI9A 4PRDA 3MA7A 1LEKA 4WU5A 4G9DA 5GSRA 4HUUA 1T7VA 3TF7A 2IA1A 1EEYA 3MRRA 3FONA 4NNXA 1S7UA 3I6LD 3ILPA 4G9FA 2CLRA 4PJ5A 4BKWA 3MRKA 4Y4FA 2F53A 3TZVC 1P7QA 3FFCA 1M05A 1AGDA 4NNYA 4PV8A 2X4PA 3BW9A 5DEFA 3U0PA 4PJDA 5MEPA 1S7WA 1S8DA 1TMCA 1JGEA 1T7YA 5HGDA 3FQRA 3SDDA 3C9NA 4S0UC 5IB2A 1VACA 2CIKA 4IRSA 4PGDA 3MRJA 3ROOA 1K8DA 2CLVA 4WWKC 3UPRA 1JE6A 3D3VA 4PREA 2ZOLA 4MJIA 1KTLA 3LN5A 1EFXA 3PABA 4U1NA 1W0VA 4X6FA 4NQVA 2GITA 4L3CA 3KPSA 1HYRC 3MRIA 4PR5A 5C08A 2RFXA 2BSRA 2CLZA 3MGOA 2AXFA 3KPOA 3VXNA 3FT3A 1FZJA 1ZSDA 5HGAA 3GSWA 4CVZA 1LD9A 2UWEA 5C09A 3VFRA 2VE6A 4PJHA 1DUZA 4MNQA 4U1HA 4PJEA 1TVBA 3E2HA 5F1NA 3L3JA 3FQUA 3RWFA 2PYEA 3X12A 3HCVA 1FFOA 1FFNA 1DE4A 5E00A 1OGAA 4EI5A 2VABA 4HV8A 5EFIA 1QO3A 3VFWA 5MEOA 1B0RA 1NANH 3IXAA 4V3EB 3KPNA 4G42A 5DEGA 4IHOA 1KPRA 3PWVA 3B6SA 5IEKA 5EUOA 3L3IA 3SPVA 3UBXA 5IEHA 2GJ6A 4ZFZA 3VFUA 4QRRA 4UQ2A 1KBGH 3P9MA 3GMPA 4E0RA 5EO0A 4XXCA 3QUZA 3NFNA 4U6YA 2HJKA 2OL3H 4G59A 5GSVA 1W72A 2VLRA 1A9BA 4HKJA 1CD1A 4MNGA 3W0WA 5IB5A 1UXWA 2CIIA 4MXQA 4NQDA 3DMMA 3BXNA 5D9SA 4ZAKA 4U1KA 3KWWA 4ZUUA 5HGHA 1XR9A 1DDHA 2AXGA 3X13A 3L3GA 1FG2A 1UQSA 1ZS8A 5E6IC 4PJXA 5FA3A 1S7TA 3LV3A 5INDA 3S6CA 4UQ3A 3V5DA 3O9WA 5J6HA 4G8IA 3VXSA 1LQVA 1N5AA 1T1XA 2FIKA 2ESVA 4WU7A 1S9WA 3FQNA 3QEQA 4L8SC 1ZT4A 1B3JA 3BZEA 1B0GA 1U58A 3BP4A 3FRUA 3PWLA 1KJ2H 3SCMA 1JF1A 2F74A 3TBTA 3TFKA 3W39A 5MERA 1N3NA 1I1AA 3JTSA 5L2JA 3MV8A 4U1IA 1WBXA 2BNRA 3QZWA 1INQA 4N0FA 5FKPA 5B39A 3ES6A 4X6CA 2AV1A 5JHDA 1ZHBA 3TPUE 2XPGA 1ZHLA 3H7BA 4K71B 4IIQC 3QDJA 3L3DA 3E6HA 3RL1A 1KJVA 3CVHA 3BUYA 1RK1A 3PWUA 2X4OA 3GSRA 5IB1A 1ZVSA 3CC5A 1YDPA 3SDCA 5C0DA 4PG2A 4PRHA 1ZAGA 4X6DA 5C0BA 3REWA 3VFMA 2X4NA 3VRJA 3QQ4A 1T7WA 1MI5A 3CDGA 4QRPA 5FA4A 1MHEA 4PJBA 1BZ9A 1OGTA 3TVMA 2CKBH 2GTZA 2YPLA 3VWKA 2HN7A 5J1AA 4WJ5A 1HSBA 4PJCA 3H9SA 4L8BA 1JGDA 4QRQA 2A83A 3T8XA 4JO8A 1QQDA 3P9LA 5C0GA 1YN7A 4E5XA 3UTTA 4Z76A 3L3KA 3SDAA 1FZMA 1IM9A 4ZUTA 2X70A 4PDCE 1W0WA 3VFSA 3RWGA 3GSQA 4GKSA 2BCKA 5AD0A 1JFMA 3BGMA 3H9HA 5ENWA 5ISZA 2MHAA 4MX7A 3VXUA 5C0JA 1HHGA 4N5EA 1LP9A 4X6EA 3VFTA 1T21A 1ZHNA 3TBVA 5F9JA 1A1OA 4NT6A 4PRBA 1FFPA 2HJLA 3I0TA 5L2KA 1G6RH 1AGEA 5D7LA 4HUXA 3SKMA 4HS3A 5BJTA 2X4RA 3HUJA 1KPVA 1T7XA 2H26A 2Q7YA 3VXOA 4JQVA 1QEWA 3M1BA 3P4MA 2VAAA 3QUXA 4CVXA 5C0IA 5MEQA 4Y4KA 4PJ8A 3MREA 3AM8A 2GAZA 3CCHA 3MV7A 4V3DB 3MROA 1QRNA 3FOMA 3BWAA 3TIDA 1KJ3H 4G43A 4L29A 3UTQA 3RWIA 3RWEA 2H6PA 4PJ9A 2GT9A 4LHUA 1Q94A 2ZSVA 1KCGC 3LKPA 4N8VA 4ZUVA 5D7IA 2C7UA 2AV7A 3MRGA 3VFOA 3X14A 3JVGA 4NQEA 3PQYA 2O5NA 3FQXA 1CE6A 1E27A 1XR8A 3TJHA 4D0DA 5C9JA 1FZOA 2ZSWA 4F7TA 3DTXA 3GSXA 1ZHKA 4GKNA 5SWSA 4K7FA 4HUWA 3E6FA 1YPZA 3QQ3A 3QFJA 4FFEX 1XH3A 4HX1A 4NO5A 3BP7A 3AU1A 3MRQA 4F7MA 4JFEA 4NQCA 3KPLA 3MRBA 1I4FA 4NSKA 5HGBA 5B38A 3QUYA 1Z5LA 4NHUE 5EO1A 3OXSA 3WS3A 3DX7A 1I1YA 4EUPA 3TBYA 3MV9A 3HG1A 4U1JA 2BVOA 3AREA 5EU5A 3WUWA 2NW3A 4N0UA 5EU3A 1T80A 3HPJA 3ILQC 1SYSA 3WLBA 2BSTA 3CH1A 5SWZA 2YPKA 3L9RA 3HAEA 5C0CA 2X4TA 1ED3A 3M17A 3MGTA 4PGEA 3V5KA 3GIVA 1KPUA 2P5EA 3MRNA 2V2XA 4LCYA 4WUUA 1I1FA 4NO2A 1WBYA 1S7QA 4GUPA 4ZUSA 4O2EA 4HUVA 1OF2A 1JPGA 5E8PA 1S7RA 3LKOA 2X4SA 3C8KA 3VCLA 1EEZA 3GSUA 1RK0A 2BVQA 1NAMH 3GSNH 4Y4HA 3GMMA 3BVNA 5HHNA 3PWNA 5IROA 3I6KA 4U1MA 4L4TA 2FZ3A 4WW2C 4D0CA 3P4NA 4PJ7A 4U1LA 4Z77A 1T1ZA 3KXFA 4I48A 3MRCA 3VJ6A 5ACZA 4F7EA 3ARBA 1T0NA 1X7QA 3VFVA 4LNRA 3MRHA 3O3AA 3QFDA 4MJ5A 3VFPA 1P1ZA 3P77A 4L3EA 3RWCA 3BHBA 1A9EA 4JFDA 5C0EA 1A1MA 3GMNA 2WY3A 1HHJA 3OX8A 1QR1A 1QSEA 3DXAA 1ZT1A 3HLAA 4L9LC 1MHCA 1T0MA 4L8DA 3HE6A 4MVBA 1AGFA 3WL9A 5IB3A 3TIEA 3RL2A 2VLKA 3D25A 1YN6A 1L8JA 3DX6A 2F54A 1T22A 1T1WA 2X4UA 1BQHA 3CZFA 4EN3C 3LN4A 2DYPA 1G7PA 4NO3A 3FTGA 3TBWA 3FQTA 3I6GA 1AGBA 3ECBA 3JTCA 3VXPA 2AK4A 3LKRA 3GMOA 1RJYA 3OXRA 1ONQA 1T7ZA 2OI9A 4Y2DA 3HE7A 1BD2A 1N2RA 4HWZA 4U1SA 3SKOA 3KYNA 3VXMA 1A6ZA 4LCCC 5IB4A 4L8CA 1EXUA 3MRDA 4PV9A 1JHTA 1I7TA 1HOCA 3T1FA 5BS0A 5BXFA 1AKJA 5HHMA 5C0AA 4QRSA 3D18A 2VLJA 4N0CA 3QUKA 1I7UA 4FTVA 3L3HA 3RUGA 3ARGA 3FT4A 5HYJA 5J6GA 1ZT7A 4JFOA 2P5WA 5INCA 4NQXA 4G59C 1LK2A 4PJAA 4PJGA 3PWPA 1HHHA 4MQ7A 1GZQA 5EOTA 1JPFA 3LKQA 2YEZA 4PJIA 1G7QA 4PGCA 1C16A 2BSSA 1BIIA 3GMRA 3RWDA 3MRMA 4F7PA 4QRTA 1T20A 2XFXA 5E8NA 4U6XA 4APQA 5SWQA 5BRZA 3G08A 1S7SA 3KPMA 4PG9A 3BH8A 3KPRA 1QLFA 3VRIA 3FT2A 1FO0H 1MWAH 2X4QA 1LDPH 3KYOA 5D7JC 5IM7A 4JFFA 4PP8C 4O2FA 2FO4A 5H94A 3FOLA 5MENA 5EU6A 3DBXA 4PRAA 4L4VA 3MYJA 2V2WA 2HLAA 4QRUA 4CW1A 1SYVA 3O4LA 5D2LA 4WDIA 1R3HA 1S9YA 1TVHA 5C0FA 4MJ6A 3GSVA 4NO0A 3GMLA 3MRFA 3MRPA 4PJFA 3BEWA 4I4WA 1CG9A 5HHPA 3ARFA
chains in the Genus database with same CATH topology
4ELMA 5IVXA 1T1YA 3P4OA 1M6OA 4JFPA 4LCWA 1QVOA 3RTQA 3UTSA 1PQZA 3D2UA 2GTWA 4PRNA 4QOKA 1KJMA 4Z78A 2FWOA 1HHIA 3GJFA 3TN0A 3QULA 4MS8A 4G8GA 3GSOA 5DDHA 3VWJA 5F1IA 4ZUWA 2BVPA 3SJVA 1E28A 1N59A 2PO6A 1VGKA 3QDMA 4JFQA 1QSFA 5HHQA 3ROLA 1A1NA 3TO2A 3WS6A 1FZKA 3O3DA 3BEVA 4PRPA 1AGCA 1GZPA 3OV6A 3RZCA 3FQWA 1HHKA 3KPQA 1WBZA 4JRYA 4ONOA 5D5MA 4D0BA 3JTTA 4PRIA 4WO4A 5E9DA 3LKNA 1S9XA 3RWHA 2JCCA 3E3QA 4PGBA 5HHOA 1S7VA 3TBSA 3O8XA 1AO7A 1JUFA 1HSAA 3CPLA 3GMQA 1XZ0A 3PWJA 3KPPA 3O3BA 3RGVC 4F7CA 3SDXA 3DX8A 3BO8A 1VADA 1IM3A 2VLLA 3ERYA 1UXSA 4O2CA 3TO4A 3MR9A 1S7XA 2J8UA 3LKSA 3P73A 2FYYA 3VXRA 1LEGA 1OSZA 4Y16A 1K5NA 2GUOA 3D39A 3QDGA 3VH8A 1P4LA 4IRJA 4JQXA 5D2NA 3VFNA 5FDWA 2E7LE 1I7RA 3O3EA 2ZOKA 5C07A 2NX5A 2AKRA 3B3IA 3KLAA 3BZFA 3RWJA 4JRXA 5E8OA 3ARDA 2D31A 3V5HA 3X11A 2BNQA 5F7DA 5EU4A 1DUYA 1RJZA 3TA3A 3MRLA 3IT8D 1NEZA 3BH9A 3QI9A 4PRDA 3MA7A 1LEKA 4WU5A 4G9DA 5GSRA 4HUUA 1T7VA 3TF7A 1EEYA 3MRRA 3FONA 4NNXA 1S7UA 3I6LD 3ILPA 4G9FA 2CLRA 4PJ5A 3MRKA 4Y4FA 2F53A 3TZVC 1P7QA 3FFCA 1M05A 1AGDA 4NNYA 4PV8A 2X4PA 3BW9A 5DEFA 3U0PA 4PJDA 5MEPA 1S7WA 1S8DA 1TMCA 1JGEA 1T7YA 5HGDA 3FQRA 3SDDA 3C9NA 4S0UC 5IB2A 1VACA 2CIKA 4IRSA 4PGDA 3MRJA 3ROOA 1K8DA 2CLVA 4WWKC 3UPRA 1JE6A 3D3VA 4PREA 2ZOLA 4MJIA 1KTLA 3LN5A 1EFXA 3PABA 4U1NA 1W0VA 4X6FA 4NQVA 2GITA 4L3CA 3KPSA 1HYRC 3MRIA 4PR5A 5C08A 2RFXA 2BSRA 2CLZA 3MGOA 2AXFA 3KPOA 3VXNA 3FT3A 1FZJA 1ZSDA 5HGAA 3GSWA 4CVZA 1LD9A 2UWEA 5C09A 3VFRA 2VE6A 4PJHA 1DUZA 4MNQA 4U1HA 4PJEA 1TVBA 3E2HA 5F1NA 3L3JA 3FQUA 3RWFA 2PYEA 3X12A 3HCVA 1FFOA 1FFNA 1DE4A 5E00A 1OGAA 4EI5A 2VABA 4HV8A 5EFIA 1QO3A 3VFWA 5MEOA 1B0RA 1NANH 3IXAA 4V3EB 3KPNA 4G42A 5DEGA 4IHOA 1KPRA 3PWVA 3B6SA 5IEKA 5EUOA 3L3IA 3SPVA 3UBXA 5IEHA 2GJ6A 4ZFZA 3VFUA 4QRRA 4UQ2A 1KBGH 3P9MA 3GMPA 4E0RA 5EO0A 4XXCA 3QUZA 3NFNA 4U6YA 2HJKA 2OL3H 4G59A 5GSVA 1W72A 2VLRA 1A9BA 4HKJA 1CD1A 4MNGA 3W0WA 5IB5A 1UXWA 2CIIA 4MXQA 4NQDA 3DMMA 3BXNA 5D9SA 4ZAKA 4U1KA 3KWWA 4ZUUA 5HGHA 1XR9A 1DDHA 2AXGA 3X13A 3L3GA 1FG2A 1UQSA 1ZS8A 5E6IC 4PJXA 5FA3A 1S7TA 3LV3A 5INDA 3S6CA 4UQ3A 3V5DA 3O9WA 5J6HA 4G8IA 3VXSA 1LQVA 1N5AA 1T1XA 2FIKA 2ESVA 4WU7A 1S9WA 3FQNA 3QEQA 4L8SC 1ZT4A 1B3JA 3BZEA 1B0GA 1U58A 3BP4A 3FRUA 3PWLA 1KJ2H 3SCMA 1JF1A 2F74A 3TBTA 3TFKA 3W39A 5MERA 1N3NA 1I1AA 3JTSA 5L2JA 3MV8A 4U1IA 1WBXA 2BNRA 3QZWA 1INQA 4N0FA 5FKPA 5B39A 3ES6A 4X6CA 2AV1A 5JHDA 1ZHBA 3TPUE 2XPGA 1ZHLA 3H7BA 4K71B 4IIQC 3QDJA 3L3DA 3E6HA 3RL1A 1KJVA 3CVHA 3BUYA 1RK1A 3PWUA 2X4OA 3GSRA 5IB1A 1ZVSA 3CC5A 1YDPA 3SDCA 5C0DA 4PG2A 4PRHA 1ZAGA 4X6DA 5C0BA 3REWA 3VFMA 2X4NA 3VRJA 3QQ4A 1T7WA 1MI5A 3CDGA 4QRPA 5FA4A 1MHEA 4PJBA 1BZ9A 1OGTA 3TVMA 2CKBH 2GTZA 2YPLA 3VWKA 2HN7A 5J1AA 4WJ5A 1HSBA 4PJCA 3H9SA 4L8BA 1JGDA 4QRQA 2A83A 3T8XA 1QQDA 3P9LA 5C0GA 1YN7A 4E5XA 3UTTA 4Z76A 3L3KA 3SDAA 1FZMA 1IM9A 4ZUTA 2X70A 4PDCE 1W0WA 3VFSA 3RWGA 3GSQA 4GKSA 2BCKA 5AD0A 1JFMA 3BGMA 3H9HA 5ENWA 5ISZA 2MHAA 4MX7A 3VXUA 5C0JA 1HHGA 4N5EA 1LP9A 4X6EA 3VFTA 1T21A 1ZHNA 3TBVA 5F9JA 1A1OA 4NT6A 4PRBA 1FFPA 2HJLA 5L2KA 1G6RH 1AGEA 5D7LA 4HUXA 3SKMA 4HS3A 5BJTA 2X4RA 3HUJA 1KPVA 1T7XA 2H26A 2Q7YA 3VXOA 4JQVA 1QEWA 3M1BA 3P4MA 2VAAA 3QUXA 4CVXA 5C0IA 5MEQA 4Y4KA 4PJ8A 3MREA 3AM8A 2GAZA 3CCHA 3MV7A 4V3DB 3MROA 1QRNA 3FOMA 3BWAA 3TIDA 1KJ3H 4G43A 4L29A 3UTQA 3RWIA 3RWEA 2H6PA 4PJ9A 2GT9A 4LHUA 1Q94A 2ZSVA 1KCGC 3LKPA 4N8VA 4ZUVA 5D7IA 2C7UA 2AV7A 3MRGA 3VFOA 3X14A 3JVGA 4NQEA 3PQYA 3FQXA 1CE6A 1E27A 1XR8A 3TJHA 4D0DA 5C9JA 1FZOA 2ZSWA 4F7TA 3DTXA 3GSXA 1ZHKA 4GKNA 5SWSA 4K7FA 4HUWA 3E6FA 1YPZA 3QQ3A 3QFJA 4FFEX 1XH3A 4HX1A 4NO5A 3BP7A 3AU1A 3MRQA 4F7MA 4JFEA 4NQCA 3KPLA 3MRBA 1I4FA 4NSKA 5HGBA 5B38A 3QUYA 1Z5LA 4NHUE 5EO1A 3OXSA 3WS3A 3DX7A 1I1YA 4EUPA 3TBYA 3MV9A 3HG1A 4U1JA 2BVOA 3AREA 5EU5A 3WUWA 2NW3A 4N0UA 5EU3A 1T80A 3HPJA 3ILQC 1SYSA 3WLBA 2BSTA 3CH1A 5SWZA 2YPKA 3L9RA 3HAEA 5C0CA 2X4TA 1ED3A 3M17A 3MGTA 4PGEA 3V5KA 3GIVA 1KPUA 2P5EA 3MRNA 2V2XA 4LCYA 4WUUA 1I1FA 4NO2A 1WBYA 1S7QA 4GUPA 4ZUSA 4O2EA 4HUVA 1OF2A 1JPGA 5E8PA 1S7RA 3LKOA 2X4SA 3C8KA 3VCLA 1EEZA 3GSUA 1RK0A 2BVQA 1NAMH 3GSNH 4Y4HA 3GMMA 3BVNA 5HHNA 3PWNA 5IROA 3I6KA 4U1MA 4L4TA 2FZ3A 4WW2C 4D0CA 3P4NA 4PJ7A 4U1LA 4Z77A 1T1ZA 3KXFA 4I48A 3MRCA 3VJ6A 5ACZA 4F7EA 3ARBA 1T0NA 1X7QA 3VFVA 4LNRA 3MRHA 3O3AA 3QFDA 4MJ5A 3VFPA 1P1ZA 3P77A 4L3EA 3RWCA 3BHBA 1A9EA 4JFDA 5C0EA 1A1MA 3GMNA 2WY3A 1HHJA 3OX8A 1QR1A 1QSEA 3DXAA 1ZT1A 3HLAA 4L9LC 1MHCA 1T0MA 4L8DA 3HE6A 4MVBA 1AGFA 3WL9A 5IB3A 3TIEA 3RL2A 2VLKA 3D25A 1YN6A 1L8JA 3DX6A 2F54A 1T22A 1T1WA 2X4UA 1BQHA 3CZFA 4EN3C 3LN4A 2DYPA 1G7PA 4NO3A 3FTGA 3TBWA 3FQTA 3I6GA 1AGBA 3ECBA 3JTCA 3VXPA 2AK4A 3LKRA 3GMOA 1RJYA 3OXRA 1ONQA 1T7ZA 2OI9A 4Y2DA 3HE7A 1BD2A 1N2RA 4HWZA 4U1SA 3SKOA 3KYNA 3VXMA 1A6ZA 4LCCC 5IB4A 4L8CA 1EXUA 3MRDA 4PV9A 1JHTA 1I7TA 1HOCA 3T1FA 5BS0A 5BXFA 1AKJA 5HHMA 5C0AA 4QRSA 3D18A 2VLJA 4N0CA 3QUKA 1I7UA 4FTVA 3L3HA 3RUGA 3ARGA 3FT4A 5HYJA 5J6GA 1ZT7A 4JFOA 2P5WA 5INCA 4NQXA 1LK2A 4PJAA 4PJGA 3PWPA 1HHHA 4MQ7A 1GZQA 5EOTA 1JPFA 3LKQA 2YEZA 4PJIA 1G7QA 4PGCA 1C16A 2BSSA 1BIIA 3GMRA 3RWDA 3MRMA 4F7PA 4QRTA 1T20A 2XFXA 5E8NA 4U6XA 4APQA 5SWQA 5BRZA 3G08A 1S7SA 3KPMA 4PG9A 3BH8A 3KPRA 1QLFA 3VRIA 3FT2A 1FO0H 1MWAH 2X4QA 1LDPH 3KYOA 5D7JC 5IM7A 4JFFA 4PP8C 4O2FA 2FO4A 5H94A 3FOLA 5MENA 5EU6A 3DBXA 4PRAA 4L4VA 3MYJA 2V2WA 2HLAA 4QRUA 4CW1A 1SYVA 3O4LA 5D2LA 4WDIA 1R3HA 1S9YA 1TVHA 5C0FA 4MJ6A 3GSVA 4NO0A 3GMLA 3MRFA 3MRPA 4PJFA 3BEWA 4I4WA 1CG9A 5HHPA 3ARFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELM A;  5IVX A;  1T1Y A;  3P4O A;  1M6O A;  4JFP A;  4LCW A;  1QVO A;  3RTQ A;  3UTS A;  1PQZ A;  3D2U A;  2GTW A;  4PRN A;  4QOK A;  1KJM A;  4Z78 A;  2FWO A;  1HHI A;  3GJF A;  3TN0 A;  3QUL A;  4MS8 A;  4G8G A;  3GSO A;  5DDH A;  3VWJ A;  5F1I A;  4ZUW A;  2BVP A;  3SJV A;  1E28 A;  1N59 A;  2PO6 A;  1VGK A;  3QDM A;  4JFQ A;  1QSF A;  5HHQ A;  3ROL A;  1A1N A;  3TO2 A;  3WS6 A;  1FZK A;  3O3D A;  3BEV A;  4PRP A;  1AGC A;  1GZP A;  3OV6 A;  3RZC A;  3FQW A;  1HHK A;  3KPQ A;  1WBZ A;  4JRY A;  4ONO A;  5D5M A;  4D0B A;  3JTT A;  4PRI A;  4WO4 A;  5E9D A;  3LKN A;  1S9X A;  3RWH A;  2JCC A;  3E3Q A;  4PGB A;  5HHO A;  1S7V A;  3TBS A;  3O8X A;  1AO7 A;  1JUF A;  1HSA A;  3CPL A;  3GMQ A;  1XZ0 A;  3PWJ A;  3KPP A;  3O3B A;  3RGV C;  4F7C A;  3SDX A;  3DX8 A;  3BO8 A;  1VAD A;  1IM3 A;  2VLL A;  3ERY A;  1UXS A;  4O2C A;  3TO4 A;  3MR9 A;  1S7X A;  2J8U A;  3LKS A;  3P73 A;  2FYY A;  3VXR A;  1LEG A;  1OSZ A;  4Y16 A;  1K5N A;  2GUO A;  3D39 A;  3QDG A;  3VH8 A;  1P4L A;  4IRJ A;  4JQX A;  5D2N A;  3VFN A;  5FDW A;  2E7L E;  1I7R A;  3O3E A;  2ZOK A;  5C07 A;  2NX5 A;  2AKR A;  3B3I A;  3KLA A;  3BZF A;  3RWJ A;  4JRX A;  5E8O A;  3ARD A;  2D31 A;  3V5H A;  3X11 A;  2BNQ A;  5F7D A;  5EU4 A;  1DUY A;  1RJZ A;  3TA3 A;  3MRL A;  3IT8 D;  1NEZ A;  3BH9 A;  3QI9 A;  4PRD A;  3MA7 A;  1LEK A;  4WU5 A;  4G9D A;  5GSR A;  4HUU A;  1T7V A;  3TF7 A;  1EEY A;  3MRR A;  3FON A;  4NNX A;  1S7U A;  3I6L D;  3ILP A;  4G9F A;  2CLR A;  4PJ5 A;  3MRK A;  4Y4F A;  2F53 A;  3TZV C;  1P7Q A;  3FFC A;  1M05 A;  1AGD A;  4NNY A;  4PV8 A;  2X4P A;  3BW9 A;  5DEF A;  3U0P A;  4PJD A;  5MEP A;  1S7W A;  1S8D A;  1TMC A;  1JGE A;  1T7Y A;  5HGD A;  3FQR A;  3SDD A;  3C9N A;  4S0U C;  5IB2 A;  1VAC A;  2CIK A;  4IRS A;  4PGD A;  3MRJ A;  3ROO A;  1K8D A;  2CLV A;  4WWK C;  3UPR A;  1JE6 A;  3D3V A;  4PRE A;  2ZOL A;  4MJI A;  1KTL A;  3LN5 A;  1EFX A;  3PAB A;  4U1N A;  1W0V A;  4X6F A;  4NQV A;  2GIT A;  4L3C A;  3KPS A;  1HYR C;  3MRI A;  4PR5 A;  5C08 A;  2RFX A;  2BSR A;  2CLZ A;  3MGO A;  2AXF A;  3KPO A;  3VXN A;  3FT3 A;  1FZJ A;  1ZSD A;  5HGA A;  3GSW A;  4CVZ A;  1LD9 A;  2UWE A;  5C09 A;  3VFR A;  2VE6 A;  4PJH A;  1DUZ A;  4MNQ A;  4U1H A;  4PJE A;  1TVB A;  3E2H A;  5F1N A;  3L3J A;  3FQU A;  3RWF A;  2PYE A;  3X12 A;  3HCV A;  1FFO A;  1FFN A;  1DE4 A;  5E00 A;  1OGA A;  4EI5 A;  2VAB A;  4HV8 A;  5EFI A;  1QO3 A;  3VFW A;  5MEO A;  1B0R A;  1NAN H;  3IXA A;  4V3E B;  3KPN A;  4G42 A;  5DEG A;  4IHO A;  1KPR A;  3PWV A;  3B6S A;  5IEK A;  5EUO A;  3L3I A;  3SPV A;  3UBX A;  5IEH A;  2GJ6 A;  4ZFZ A;  3VFU A;  4QRR A;  4UQ2 A;  1KBG H;  3P9M A;  3GMP A;  4E0R A;  5EO0 A;  4XXC A;  3QUZ A;  3NFN A;  4U6Y A;  2HJK A;  2OL3 H;  4G59 A;  5GSV A;  1W72 A;  2VLR A;  1A9B A;  4HKJ A;  1CD1 A;  4MNG A;  3W0W A;  5IB5 A;  1UXW A;  2CII A;  4MXQ A;  4NQD A;  3DMM A;  3BXN A;  5D9S A;  4ZAK A;  4U1K A;  3KWW A;  4ZUU A;  5HGH A;  1XR9 A;  1DDH A;  2AXG A;  3X13 A;  3L3G A;  1FG2 A;  1UQS A;  1ZS8 A;  5E6I C;  4PJX A;  5FA3 A;  1S7T A;  3LV3 A;  5IND A;  3S6C A;  4UQ3 A;  3V5D A;  3O9W A;  5J6H A;  4G8I A;  3VXS A;  1LQV A;  1N5A A;  1T1X A;  2FIK A;  2ESV A;  4WU7 A;  1S9W A;  3FQN A;  3QEQ A;  4L8S C;  1ZT4 A;  1B3J A;  3BZE A;  1B0G A;  1U58 A;  3BP4 A;  3FRU A;  3PWL A;  1KJ2 H;  3SCM A;  1JF1 A;  2F74 A;  3TBT A;  3TFK A;  3W39 A;  5MER A;  1N3N A;  1I1A A;  3JTS A;  5L2J A;  3MV8 A;  4U1I A;  1WBX A;  2BNR A;  3QZW A;  1INQ A;  4N0F A;  5FKP A;  5B39 A;  3ES6 A;  4X6C A;  2AV1 A;  5JHD A;  1ZHB A;  3TPU E;  2XPG A;  1ZHL A;  3H7B A;  4K71 B;  4IIQ C;  3QDJ A;  3L3D A;  3E6H A;  3RL1 A;  1KJV A;  3CVH A;  3BUY A;  1RK1 A;  3PWU A;  2X4O A;  3GSR A;  5IB1 A;  1ZVS A;  3CC5 A;  1YDP A;  3SDC A;  5C0D A;  4PG2 A;  4PRH A;  1ZAG A;  4X6D A;  5C0B A;  3REW A;  3VFM A;  2X4N A;  3VRJ A;  3QQ4 A;  1T7W A;  1MI5 A;  3CDG A;  4QRP A;  5FA4 A;  1MHE A;  4PJB A;  1BZ9 A;  1OGT A;  3TVM A;  2CKB H;  2GTZ A;  2YPL A;  3VWK A;  2HN7 A;  5J1A A;  4WJ5 A;  1HSB A;  4PJC A;  3H9S A;  4L8B A;  1JGD A;  4QRQ A;  2A83 A;  3T8X A;  1QQD A;  3P9L A;  5C0G A;  1YN7 A;  4E5X A;  3UTT A;  4Z76 A;  3L3K A;  3SDA A;  1FZM A;  1IM9 A;  4ZUT A;  2X70 A;  4PDC E;  1W0W A;  3VFS A;  3RWG A;  3GSQ A;  4GKS A;  2BCK A;  5AD0 A;  1JFM A;  3BGM A;  3H9H A;  5ENW A;  5ISZ A;  2MHA A;  4MX7 A;  3VXU A;  5C0J A;  1HHG A;  4N5E A;  1LP9 A;  4X6E A;  3VFT A;  1T21 A;  1ZHN A;  3TBV A;  5F9J A;  1A1O A;  4NT6 A;  4PRB A;  1FFP A;  2HJL A;  5L2K A;  1G6R H;  1AGE A;  5D7L A;  4HUX A;  3SKM A;  4HS3 A;  5BJT A;  2X4R A;  3HUJ A;  1KPV A;  1T7X A;  2H26 A;  2Q7Y A;  3VXO A;  4JQV A;  1QEW A;  3M1B A;  3P4M A;  2VAA A;  3QUX A;  4CVX A;  5C0I A;  5MEQ A;  4Y4K A;  4PJ8 A;  3MRE A;  3AM8 A;  2GAZ A;  3CCH A;  3MV7 A;  4V3D B;  3MRO A;  1QRN A;  3FOM A;  3BWA A;  3TID A;  1KJ3 H;  4G43 A;  4L29 A;  3UTQ A;  3RWI A;  3RWE A;  2H6P A;  4PJ9 A;  2GT9 A;  4LHU A;  1Q94 A;  2ZSV A;  1KCG C;  3LKP A;  4N8V A;  4ZUV A;  5D7I A;  2C7U A;  2AV7 A;  3MRG A;  3VFO A;  3X14 A;  3JVG A;  4NQE A;  3PQY A;  3FQX A;  1CE6 A;  1E27 A;  1XR8 A;  3TJH A;  4D0D A;  5C9J A;  1FZO A;  2ZSW A;  4F7T A;  3DTX A;  3GSX A;  1ZHK A;  4GKN A;  5SWS A;  4K7F A;  4HUW A;  3E6F A;  1YPZ A;  3QQ3 A;  3QFJ A;  4FFE X;  1XH3 A;  4HX1 A;  4NO5 A;  3BP7 A;  3AU1 A;  3MRQ A;  4F7M A;  4JFE A;  4NQC A;  3KPL A;  3MRB A;  1I4F A;  4NSK A;  5HGB A;  5B38 A;  3QUY A;  1Z5L A;  4NHU E;  5EO1 A;  3OXS A;  3WS3 A;  3DX7 A;  1I1Y A;  4EUP A;  3TBY A;  3MV9 A;  3HG1 A;  4U1J A;  2BVO A;  3ARE A;  5EU5 A;  3WUW A;  2NW3 A;  4N0U A;  5EU3 A;  1T80 A;  3HPJ A;  3ILQ C;  1SYS A;  3WLB A;  2BST A;  3CH1 A;  5SWZ A;  2YPK A;  3L9R A;  3HAE A;  5C0C A;  2X4T A;  1ED3 A;  3M17 A;  3MGT A;  4PGE A;  3V5K A;  3GIV A;  1KPU A;  2P5E A;  3MRN A;  2V2X A;  4LCY A;  4WUU A;  1I1F A;  4NO2 A;  1WBY A;  1S7Q A;  4GUP A;  4ZUS A;  4O2E A;  4HUV A;  1OF2 A;  1JPG A;  5E8P A;  1S7R A;  3LKO A;  2X4S A;  3C8K A;  3VCL A;  1EEZ A;  3GSU A;  1RK0 A;  2BVQ A;  1NAM H;  3GSN H;  4Y4H A;  3GMM A;  3BVN A;  5HHN A;  3PWN A;  5IRO A;  3I6K A;  4U1M A;  4L4T A;  2FZ3 A;  4WW2 C;  4D0C A;  3P4N A;  4PJ7 A;  4U1L A;  4Z77 A;  1T1Z A;  3KXF A;  4I48 A;  3MRC A;  3VJ6 A;  5ACZ A;  4F7E A;  3ARB A;  1T0N A;  1X7Q A;  3VFV A;  4LNR A;  3MRH A;  3O3A A;  3QFD A;  4MJ5 A;  3VFP A;  1P1Z A;  3P77 A;  4L3E A;  3RWC A;  3BHB A;  1A9E A;  4JFD A;  5C0E A;  1A1M A;  3GMN A;  2WY3 A;  1HHJ A;  3OX8 A;  1QR1 A;  1QSE A;  3DXA A;  1ZT1 A;  3HLA A;  4L9L C;  1MHC A;  1T0M A;  4L8D A;  3HE6 A;  4MVB A;  1AGF A;  3WL9 A;  5IB3 A;  3TIE A;  3RL2 A;  2VLK A;  3D25 A;  1YN6 A;  1L8J A;  3DX6 A;  2F54 A;  1T22 A;  1T1W A;  2X4U A;  1BQH A;  3CZF A;  4EN3 C;  3LN4 A;  2DYP A;  1G7P A;  4NO3 A;  3FTG A;  3TBW A;  3FQT A;  3I6G A;  1AGB A;  3ECB A;  3JTC A;  3VXP A;  2AK4 A;  3LKR A;  3GMO A;  1RJY A;  3OXR A;  1ONQ A;  1T7Z A;  2OI9 A;  4Y2D A;  3HE7 A;  1BD2 A;  1N2R A;  4HWZ A;  4U1S A;  3SKO A;  3KYN A;  3VXM A;  1A6Z A;  4LCC C;  5IB4 A;  4L8C A;  1EXU A;  3MRD A;  4PV9 A;  1JHT A;  1I7T A;  1HOC A;  3T1F A;  5BS0 A;  5BXF A;  1AKJ A;  5HHM A;  5C0A A;  4QRS A;  3D18 A;  2VLJ A;  4N0C A;  3QUK A;  1I7U A;  4FTV A;  3L3H A;  3RUG A;  3ARG A;  3FT4 A;  5HYJ A;  5J6G A;  1ZT7 A;  4JFO A;  2P5W A;  5INC A;  4NQX A;  1LK2 A;  4PJA A;  4PJG A;  3PWP A;  1HHH A;  4MQ7 A;  1GZQ A;  5EOT A;  1JPF A;  3LKQ A;  2YEZ A;  4PJI A;  1G7Q A;  4PGC A;  1C16 A;  2BSS A;  1BII A;  3GMR A;  3RWD A;  3MRM A;  4F7P A;  4QRT A;  1T20 A;  2XFX A;  5E8N A;  4U6X A;  4APQ A;  5SWQ A;  5BRZ A;  3G08 A;  1S7S A;  3KPM A;  4PG9 A;  3BH8 A;  3KPR A;  1QLF A;  3VRI A;  3FT2 A;  1FO0 H;  1MWA H;  2X4Q A;  1LDP H;  3KYO A;  5D7J C;  5IM7 A;  4JFF A;  4PP8 C;  4O2F A;  2FO4 A;  5H94 A;  3FOL A;  5MEN A;  5EU6 A;  3DBX A;  4PRA A;  4L4V A;  3MYJ A;  2V2W A;  2HLA A;  4QRU A;  4CW1 A;  1SYV A;  3O4L A;  5D2L A;  4WDI A;  1R3H A;  1S9Y A;  1TVH A;  5C0F A;  4MJ6 A;  3GSV A;  4NO0 A;  3GML A;  3MRF A;  3MRP A;  4PJF A;  3BEW A;  4I4W A;  1CG9 A;  5HHP A;  3ARF A; 
#chains in the Genus database with same CATH topology
 4ELM A;  5IVX A;  1T1Y A;  3P4O A;  1M6O A;  4JFP A;  4LCW A;  1QVO A;  3RTQ A;  3UTS A;  1PQZ A;  3D2U A;  2GTW A;  4PRN A;  4QOK A;  1KJM A;  4Z78 A;  2FWO A;  1HHI A;  3GJF A;  3TN0 A;  3QUL A;  4MS8 A;  4G8G A;  3GSO A;  5DDH A;  3VWJ A;  5F1I A;  4ZUW A;  2BVP A;  3SJV A;  1E28 A;  1N59 A;  2PO6 A;  1VGK A;  3QDM A;  4JFQ A;  1QSF A;  5HHQ A;  3ROL A;  1A1N A;  3TO2 A;  3WS6 A;  1FZK A;  3O3D A;  3BEV A;  4PRP A;  1AGC A;  1GZP A;  3OV6 A;  3RZC A;  3FQW A;  1HHK A;  3KPQ A;  1WBZ A;  4JRY A;  4ONO A;  5D5M A;  4D0B A;  3JTT A;  4PRI A;  4WO4 A;  5E9D A;  3LKN A;  1S9X A;  3RWH A;  2JCC A;  3E3Q A;  4PGB A;  5HHO A;  1S7V A;  3TBS A;  3O8X A;  1AO7 A;  1JUF A;  1HSA A;  3CPL A;  3GMQ A;  1XZ0 A;  3PWJ A;  3KPP A;  3O3B A;  3RGV C;  4F7C A;  3SDX A;  3DX8 A;  3BO8 A;  1VAD A;  1IM3 A;  2VLL A;  3ERY A;  1UXS A;  4O2C A;  3TO4 A;  3MR9 A;  1S7X A;  2J8U A;  3LKS A;  3P73 A;  2FYY A;  3VXR A;  1LEG A;  1OSZ A;  4Y16 A;  1K5N A;  2GUO A;  3D39 A;  2NYK A;  3QDG A;  3VH8 A;  1P4L A;  4IRJ A;  4JQX A;  5D2N A;  3VFN A;  5FDW A;  2E7L E;  1I7R A;  3O3E A;  2ZOK A;  5C07 A;  2NX5 A;  2AKR A;  3B3I A;  3KLA A;  3BZF A;  3RWJ A;  4JRX A;  5E8O A;  3ARD A;  2D31 A;  3V5H A;  3X11 A;  2BNQ A;  5F7D A;  5EU4 A;  1DUY A;  1RJZ A;  3TA3 A;  3MRL A;  3IT8 D;  1NEZ A;  3BH9 A;  3QI9 A;  4PRD A;  3MA7 A;  1LEK A;  4WU5 A;  4G9D A;  5GSR A;  4HUU A;  1T7V A;  3TF7 A;  2IA1 A;  1EEY A;  3MRR A;  3FON A;  4NNX A;  1S7U A;  3I6L D;  3ILP A;  4G9F A;  2CLR A;  4PJ5 A;  4BKW A;  3MRK A;  4Y4F A;  2F53 A;  3TZV C;  1P7Q A;  3FFC A;  1M05 A;  1AGD A;  4NNY A;  4PV8 A;  2X4P A;  3BW9 A;  5DEF A;  3U0P A;  4PJD A;  5MEP A;  1S7W A;  1S8D A;  1TMC A;  1JGE A;  1T7Y A;  5HGD A;  3FQR A;  3SDD A;  3C9N A;  4S0U C;  5IB2 A;  1VAC A;  2CIK A;  4IRS A;  4PGD A;  3MRJ A;  3ROO A;  1K8D A;  2CLV A;  4WWK C;  3UPR A;  1JE6 A;  3D3V A;  4PRE A;  2ZOL A;  4MJI A;  1KTL A;  3LN5 A;  1EFX A;  3PAB A;  4U1N A;  1W0V A;  4X6F A;  4NQV A;  2GIT A;  4L3C A;  3KPS A;  1HYR C;  3MRI A;  4PR5 A;  5C08 A;  2RFX A;  2BSR A;  2CLZ A;  3MGO A;  2AXF A;  3KPO A;  3VXN A;  3FT3 A;  1FZJ A;  1ZSD A;  5HGA A;  3GSW A;  4CVZ A;  1LD9 A;  2UWE A;  5C09 A;  3VFR A;  2VE6 A;  4PJH A;  1DUZ A;  4MNQ A;  4U1H A;  4PJE A;  1TVB A;  3E2H A;  5F1N A;  3L3J A;  3FQU A;  3RWF A;  2PYE A;  3X12 A;  3HCV A;  1FFO A;  1FFN A;  1DE4 A;  5E00 A;  1OGA A;  4EI5 A;  2VAB A;  4HV8 A;  5EFI A;  1QO3 A;  3VFW A;  5MEO A;  1B0R A;  1NAN H;  3IXA A;  4V3E B;  3KPN A;  4G42 A;  5DEG A;  4IHO A;  1KPR A;  3PWV A;  3B6S A;  5IEK A;  5EUO A;  3L3I A;  3SPV A;  3UBX A;  5IEH A;  2GJ6 A;  4ZFZ A;  3VFU A;  4QRR A;  4UQ2 A;  1KBG H;  3P9M A;  3GMP A;  4E0R A;  5EO0 A;  4XXC A;  3QUZ A;  3NFN A;  4U6Y A;  2HJK A;  2OL3 H;  4G59 A;  5GSV A;  1W72 A;  2VLR A;  1A9B A;  4HKJ A;  1CD1 A;  4MNG A;  3W0W A;  5IB5 A;  1UXW A;  2CII A;  4MXQ A;  4NQD A;  3DMM A;  3BXN A;  5D9S A;  4ZAK A;  4U1K A;  3KWW A;  4ZUU A;  5HGH A;  1XR9 A;  1DDH A;  2AXG A;  3X13 A;  3L3G A;  1FG2 A;  1UQS A;  1ZS8 A;  5E6I C;  4PJX A;  5FA3 A;  1S7T A;  3LV3 A;  5IND A;  3S6C A;  4UQ3 A;  3V5D A;  3O9W A;  5J6H A;  4G8I A;  3VXS A;  1LQV A;  1N5A A;  1T1X A;  2FIK A;  2ESV A;  4WU7 A;  1S9W A;  3FQN A;  3QEQ A;  4L8S C;  1ZT4 A;  1B3J A;  3BZE A;  1B0G A;  1U58 A;  3BP4 A;  3FRU A;  3PWL A;  1KJ2 H;  3SCM A;  1JF1 A;  2F74 A;  3TBT A;  3TFK A;  3W39 A;  5MER A;  1N3N A;  1I1A A;  3JTS A;  5L2J A;  3MV8 A;  4U1I A;  1WBX A;  2BNR A;  3QZW A;  1INQ A;  4N0F A;  5FKP A;  5B39 A;  3ES6 A;  4X6C A;  2AV1 A;  5JHD A;  1ZHB A;  3TPU E;  2XPG A;  1ZHL A;  3H7B A;  4K71 B;  4IIQ C;  3QDJ A;  3L3D A;  3E6H A;  3RL1 A;  1KJV A;  3CVH A;  3BUY A;  1RK1 A;  3PWU A;  2X4O A;  3GSR A;  5IB1 A;  1ZVS A;  3CC5 A;  1YDP A;  3SDC A;  5C0D A;  4PG2 A;  4PRH A;  1ZAG A;  4X6D A;  5C0B A;  3REW A;  3VFM A;  2X4N A;  3VRJ A;  3QQ4 A;  1T7W A;  1MI5 A;  3CDG A;  4QRP A;  5FA4 A;  1MHE A;  4PJB A;  1BZ9 A;  1OGT A;  3TVM A;  2CKB H;  2GTZ A;  2YPL A;  3VWK A;  2HN7 A;  5J1A A;  4WJ5 A;  1HSB A;  4PJC A;  3H9S A;  4L8B A;  1JGD A;  4QRQ A;  2A83 A;  3T8X A;  4JO8 A;  1QQD A;  3P9L A;  5C0G A;  1YN7 A;  4E5X A;  3UTT A;  4Z76 A;  3L3K A;  3SDA A;  1FZM A;  1IM9 A;  4ZUT A;  2X70 A;  4PDC E;  1W0W A;  3VFS A;  3RWG A;  3GSQ A;  4GKS A;  2BCK A;  5AD0 A;  1JFM A;  3BGM A;  3H9H A;  5ENW A;  5ISZ A;  2MHA A;  4MX7 A;  3VXU A;  5C0J A;  1HHG A;  4N5E A;  1LP9 A;  4X6E A;  3VFT A;  1T21 A;  1ZHN A;  3TBV A;  5F9J A;  1A1O A;  4NT6 A;  4PRB A;  1FFP A;  2HJL A;  3I0T A;  5L2K A;  1G6R H;  1AGE A;  5D7L A;  4HUX A;  3SKM A;  4HS3 A;  5BJT A;  2X4R A;  3HUJ A;  1KPV A;  1T7X A;  2H26 A;  2Q7Y A;  3VXO A;  4JQV A;  1QEW A;  3M1B A;  3P4M A;  2VAA A;  3QUX A;  4CVX A;  5C0I A;  5MEQ A;  4Y4K A;  4PJ8 A;  3MRE A;  3AM8 A;  2GAZ A;  3CCH A;  3MV7 A;  4V3D B;  3MRO A;  1QRN A;  3FOM A;  3BWA A;  3TID A;  1KJ3 H;  4G43 A;  4L29 A;  3UTQ A;  3RWI A;  3RWE A;  2H6P A;  4PJ9 A;  2GT9 A;  4LHU A;  1Q94 A;  2ZSV A;  1KCG C;  3LKP A;  4N8V A;  4ZUV A;  5D7I A;  2C7U A;  2AV7 A;  3MRG A;  3VFO A;  3X14 A;  3JVG A;  4NQE A;  3PQY A;  2O5N A;  3FQX A;  1CE6 A;  1E27 A;  1XR8 A;  3TJH A;  4D0D A;  5C9J A;  1FZO A;  2ZSW A;  4F7T A;  3DTX A;  3GSX A;  1ZHK A;  4GKN A;  5SWS A;  4K7F A;  4HUW A;  3E6F A;  1YPZ A;  3QQ3 A;  3QFJ A;  4FFE X;  1XH3 A;  4HX1 A;  4NO5 A;  3BP7 A;  3AU1 A;  3MRQ A;  4F7M A;  4JFE A;  4NQC A;  3KPL A;  3MRB A;  1I4F A;  4NSK A;  5HGB A;  5B38 A;  3QUY A;  1Z5L A;  4NHU E;  5EO1 A;  3OXS A;  3WS3 A;  3DX7 A;  1I1Y A;  4EUP A;  3TBY A;  3MV9 A;  3HG1 A;  4U1J A;  2BVO A;  3ARE A;  5EU5 A;  3WUW A;  2NW3 A;  4N0U A;  5EU3 A;  1T80 A;  3HPJ A;  3ILQ C;  1SYS A;  3WLB A;  2BST A;  3CH1 A;  5SWZ A;  2YPK A;  3L9R A;  3HAE A;  5C0C A;  2X4T A;  1ED3 A;  3M17 A;  3MGT A;  4PGE A;  3V5K A;  3GIV A;  1KPU A;  2P5E A;  3MRN A;  2V2X A;  4LCY A;  4WUU A;  1I1F A;  4NO2 A;  1WBY A;  1S7Q A;  4GUP A;  4ZUS A;  4O2E A;  4HUV A;  1OF2 A;  1JPG A;  5E8P A;  1S7R A;  3LKO A;  2X4S A;  3C8K A;  3VCL A;  1EEZ A;  3GSU A;  1RK0 A;  2BVQ A;  1NAM H;  3GSN H;  4Y4H A;  3GMM A;  3BVN A;  5HHN A;  3PWN A;  5IRO A;  3I6K A;  4U1M A;  4L4T A;  2FZ3 A;  4WW2 C;  4D0C A;  3P4N A;  4PJ7 A;  4U1L A;  4Z77 A;  1T1Z A;  3KXF A;  4I48 A;  3MRC A;  3VJ6 A;  5ACZ A;  4F7E A;  3ARB A;  1T0N A;  1X7Q A;  3VFV A;  4LNR A;  3MRH A;  3O3A A;  3QFD A;  4MJ5 A;  3VFP A;  1P1Z A;  3P77 A;  4L3E A;  3RWC A;  3BHB A;  1A9E A;  4JFD A;  5C0E A;  1A1M A;  3GMN A;  2WY3 A;  1HHJ A;  3OX8 A;  1QR1 A;  1QSE A;  3DXA A;  1ZT1 A;  3HLA A;  4L9L C;  1MHC A;  1T0M A;  4L8D A;  3HE6 A;  4MVB A;  1AGF A;  3WL9 A;  5IB3 A;  3TIE A;  3RL2 A;  2VLK A;  3D25 A;  1YN6 A;  1L8J A;  3DX6 A;  2F54 A;  1T22 A;  1T1W A;  2X4U A;  1BQH A;  3CZF A;  4EN3 C;  3LN4 A;  2DYP A;  1G7P A;  4NO3 A;  3FTG A;  3TBW A;  3FQT A;  3I6G A;  1AGB A;  3ECB A;  3JTC A;  3VXP A;  2AK4 A;  3LKR A;  3GMO A;  1RJY A;  3OXR A;  1ONQ A;  1T7Z A;  2OI9 A;  4Y2D A;  3HE7 A;  1BD2 A;  1N2R A;  4HWZ A;  4U1S A;  3SKO A;  3KYN A;  3VXM A;  1A6Z A;  4LCC C;  5IB4 A;  4L8C A;  1EXU A;  3MRD A;  4PV9 A;  1JHT A;  1I7T A;  1HOC A;  3T1F A;  5BS0 A;  5BXF A;  1AKJ A;  5HHM A;  5C0A A;  4QRS A;  3D18 A;  2VLJ A;  4N0C A;  3QUK A;  1I7U A;  4FTV A;  3L3H A;  3RUG A;  3ARG A;  3FT4 A;  5HYJ A;  5J6G A;  1ZT7 A;  4JFO A;  2P5W A;  5INC A;  4NQX A;  4G59 C;  1LK2 A;  4PJA A;  4PJG A;  3PWP A;  1HHH A;  4MQ7 A;  1GZQ A;  5EOT A;  1JPF A;  3LKQ A;  2YEZ A;  4PJI A;  1G7Q A;  4PGC A;  1C16 A;  2BSS A;  1BII A;  3GMR A;  3RWD A;  3MRM A;  4F7P A;  4QRT A;  1T20 A;  2XFX A;  5E8N A;  4U6X A;  4APQ A;  5SWQ A;  5BRZ A;  3G08 A;  1S7S A;  3KPM A;  4PG9 A;  3BH8 A;  3KPR A;  1QLF A;  3VRI A;  3FT2 A;  1FO0 H;  1MWA H;  2X4Q A;  1LDP H;  3KYO A;  5D7J C;  5IM7 A;  4JFF A;  4PP8 C;  4O2F A;  2FO4 A;  5H94 A;  3FOL A;  5MEN A;  5EU6 A;  3DBX A;  4PRA A;  4L4V A;  3MYJ A;  2V2W A;  2HLA A;  4QRU A;  4CW1 A;  1SYV A;  3O4L A;  5D2L A;  4WDI A;  1R3H A;  1S9Y A;  1TVH A;  5C0F A;  4MJ6 A;  3GSV A;  4NO0 A;  3GML A;  3MRF A;  3MRP A;  4PJF A;  3BEW A;  4I4W A;  1CG9 A;  5HHP A;  3ARF A; 
#chains in the Genus database with same CATH homology
 4ELM A;  5IVX A;  1T1Y A;  3P4O A;  1M6O A;  4JFP A;  4LCW A;  1QVO A;  3RTQ A;  3UTS A;  1PQZ A;  3D2U A;  2GTW A;  4PRN A;  4QOK A;  1KJM A;  4Z78 A;  2FWO A;  1HHI A;  3GJF A;  3TN0 A;  3QUL A;  4MS8 A;  4G8G A;  3GSO A;  5DDH A;  3VWJ A;  5F1I A;  4ZUW A;  2BVP A;  3SJV A;  1E28 A;  1N59 A;  2PO6 A;  1VGK A;  3QDM A;  4JFQ A;  1QSF A;  5HHQ A;  3ROL A;  1A1N A;  3TO2 A;  3WS6 A;  1FZK A;  3O3D A;  3BEV A;  4PRP A;  1AGC A;  1GZP A;  3OV6 A;  3RZC A;  3FQW A;  1HHK A;  3KPQ A;  1WBZ A;  4JRY A;  4ONO A;  5D5M A;  4D0B A;  3JTT A;  4PRI A;  4WO4 A;  5E9D A;  3LKN A;  1S9X A;  3RWH A;  2JCC A;  3E3Q A;  4PGB A;  5HHO A;  1S7V A;  3TBS A;  3O8X A;  1AO7 A;  1JUF A;  1HSA A;  3CPL A;  3GMQ A;  1XZ0 A;  3PWJ A;  3KPP A;  3O3B A;  3RGV C;  4F7C A;  3SDX A;  3DX8 A;  3BO8 A;  1VAD A;  1IM3 A;  2VLL A;  3ERY A;  1UXS A;  4O2C A;  3TO4 A;  3MR9 A;  1S7X A;  2J8U A;  3LKS A;  3P73 A;  2FYY A;  3VXR A;  1LEG A;  1OSZ A;  4Y16 A;  1K5N A;  2GUO A;  3D39 A;  3QDG A;  3VH8 A;  1P4L A;  4IRJ A;  4JQX A;  5D2N A;  3VFN A;  5FDW A;  2E7L E;  1I7R A;  3O3E A;  2ZOK A;  5C07 A;  2NX5 A;  2AKR A;  3B3I A;  3KLA A;  3BZF A;  3RWJ A;  4JRX A;  5E8O A;  3ARD A;  2D31 A;  3V5H A;  3X11 A;  2BNQ A;  5F7D A;  5EU4 A;  1DUY A;  1RJZ A;  3TA3 A;  3MRL A;  3IT8 D;  1NEZ A;  3BH9 A;  3QI9 A;  4PRD A;  3MA7 A;  1LEK A;  4WU5 A;  4G9D A;  5GSR A;  4HUU A;  1T7V A;  3TF7 A;  1EEY A;  3MRR A;  3FON A;  4NNX A;  1S7U A;  3I6L D;  3ILP A;  4G9F A;  2CLR A;  4PJ5 A;  3MRK A;  4Y4F A;  2F53 A;  3TZV C;  1P7Q A;  3FFC A;  1M05 A;  1AGD A;  4NNY A;  4PV8 A;  2X4P A;  3BW9 A;  5DEF A;  3U0P A;  4PJD A;  5MEP A;  1S7W A;  1S8D A;  1TMC A;  1JGE A;  1T7Y A;  5HGD A;  3FQR A;  3SDD A;  3C9N A;  4S0U C;  5IB2 A;  1VAC A;  2CIK A;  4IRS A;  4PGD A;  3MRJ A;  3ROO A;  1K8D A;  2CLV A;  4WWK C;  3UPR A;  1JE6 A;  3D3V A;  4PRE A;  2ZOL A;  4MJI A;  1KTL A;  3LN5 A;  1EFX A;  3PAB A;  4U1N A;  1W0V A;  4X6F A;  4NQV A;  2GIT A;  4L3C A;  3KPS A;  1HYR C;  3MRI A;  4PR5 A;  5C08 A;  2RFX A;  2BSR A;  2CLZ A;  3MGO A;  2AXF A;  3KPO A;  3VXN A;  3FT3 A;  1FZJ A;  1ZSD A;  5HGA A;  3GSW A;  4CVZ A;  1LD9 A;  2UWE A;  5C09 A;  3VFR A;  2VE6 A;  4PJH A;  1DUZ A;  4MNQ A;  4U1H A;  4PJE A;  1TVB A;  3E2H A;  5F1N A;  3L3J A;  3FQU A;  3RWF A;  2PYE A;  3X12 A;  3HCV A;  1FFO A;  1FFN A;  1DE4 A;  5E00 A;  1OGA A;  4EI5 A;  2VAB A;  4HV8 A;  5EFI A;  1QO3 A;  3VFW A;  5MEO A;  1B0R A;  1NAN H;  3IXA A;  4V3E B;  3KPN A;  4G42 A;  5DEG A;  4IHO A;  1KPR A;  3PWV A;  3B6S A;  5IEK A;  5EUO A;  3L3I A;  3SPV A;  3UBX A;  5IEH A;  2GJ6 A;  4ZFZ A;  3VFU A;  4QRR A;  4UQ2 A;  1KBG H;  3P9M A;  3GMP A;  4E0R A;  5EO0 A;  4XXC A;  3QUZ A;  3NFN A;  4U6Y A;  2HJK A;  2OL3 H;  4G59 A;  5GSV A;  1W72 A;  2VLR A;  1A9B A;  4HKJ A;  1CD1 A;  4MNG A;  3W0W A;  5IB5 A;  1UXW A;  2CII A;  4MXQ A;  4NQD A;  3DMM A;  3BXN A;  5D9S A;  4ZAK A;  4U1K A;  3KWW A;  4ZUU A;  5HGH A;  1XR9 A;  1DDH A;  2AXG A;  3X13 A;  3L3G A;  1FG2 A;  1UQS A;  1ZS8 A;  5E6I C;  4PJX A;  5FA3 A;  1S7T A;  3LV3 A;  5IND A;  3S6C A;  4UQ3 A;  3V5D A;  3O9W A;  5J6H A;  4G8I A;  3VXS A;  1LQV A;  1N5A A;  1T1X A;  2FIK A;  2ESV A;  4WU7 A;  1S9W A;  3FQN A;  3QEQ A;  4L8S C;  1ZT4 A;  1B3J A;  3BZE A;  1B0G A;  1U58 A;  3BP4 A;  3FRU A;  3PWL A;  1KJ2 H;  3SCM A;  1JF1 A;  2F74 A;  3TBT A;  3TFK A;  3W39 A;  5MER A;  1N3N A;  1I1A A;  3JTS A;  5L2J A;  3MV8 A;  4U1I A;  1WBX A;  2BNR A;  3QZW A;  1INQ A;  4N0F A;  5FKP A;  5B39 A;  3ES6 A;  4X6C A;  2AV1 A;  5JHD A;  1ZHB A;  3TPU E;  2XPG A;  1ZHL A;  3H7B A;  4K71 B;  4IIQ C;  3QDJ A;  3L3D A;  3E6H A;  3RL1 A;  1KJV A;  3CVH A;  3BUY A;  1RK1 A;  3PWU A;  2X4O A;  3GSR A;  5IB1 A;  1ZVS A;  3CC5 A;  1YDP A;  3SDC A;  5C0D A;  4PG2 A;  4PRH A;  1ZAG A;  4X6D A;  5C0B A;  3REW A;  3VFM A;  2X4N A;  3VRJ A;  3QQ4 A;  1T7W A;  1MI5 A;  3CDG A;  4QRP A;  5FA4 A;  1MHE A;  4PJB A;  1BZ9 A;  1OGT A;  3TVM A;  2CKB H;  2GTZ A;  2YPL A;  3VWK A;  2HN7 A;  5J1A A;  4WJ5 A;  1HSB A;  4PJC A;  3H9S A;  4L8B A;  1JGD A;  4QRQ A;  2A83 A;  3T8X A;  1QQD A;  3P9L A;  5C0G A;  1YN7 A;  4E5X A;  3UTT A;  4Z76 A;  3L3K A;  3SDA A;  1FZM A;  1IM9 A;  4ZUT A;  2X70 A;  4PDC E;  1W0W A;  3VFS A;  3RWG A;  3GSQ A;  4GKS A;  2BCK A;  5AD0 A;  1JFM A;  3BGM A;  3H9H A;  5ENW A;  5ISZ A;  2MHA A;  4MX7 A;  3VXU A;  5C0J A;  1HHG A;  4N5E A;  1LP9 A;  4X6E A;  3VFT A;  1T21 A;  1ZHN A;  3TBV A;  5F9J A;  1A1O A;  4NT6 A;  4PRB A;  1FFP A;  2HJL A;  5L2K A;  1G6R H;  1AGE A;  5D7L A;  4HUX A;  3SKM A;  4HS3 A;  5BJT A;  2X4R A;  3HUJ A;  1KPV A;  1T7X A;  2H26 A;  2Q7Y A;  3VXO A;  4JQV A;  1QEW A;  3M1B A;  3P4M A;  2VAA A;  3QUX A;  4CVX A;  5C0I A;  5MEQ A;  4Y4K A;  4PJ8 A;  3MRE A;  3AM8 A;  2GAZ A;  3CCH A;  3MV7 A;  4V3D B;  3MRO A;  1QRN A;  3FOM A;  3BWA A;  3TID A;  1KJ3 H;  4G43 A;  4L29 A;  3UTQ A;  3RWI A;  3RWE A;  2H6P A;  4PJ9 A;  2GT9 A;  4LHU A;  1Q94 A;  2ZSV A;  1KCG C;  3LKP A;  4N8V A;  4ZUV A;  5D7I A;  2C7U A;  2AV7 A;  3MRG A;  3VFO A;  3X14 A;  3JVG A;  4NQE A;  3PQY A;  3FQX A;  1CE6 A;  1E27 A;  1XR8 A;  3TJH A;  4D0D A;  5C9J A;  1FZO A;  2ZSW A;  4F7T A;  3DTX A;  3GSX A;  1ZHK A;  4GKN A;  5SWS A;  4K7F A;  4HUW A;  3E6F A;  1YPZ A;  3QQ3 A;  3QFJ A;  4FFE X;  1XH3 A;  4HX1 A;  4NO5 A;  3BP7 A;  3AU1 A;  3MRQ A;  4F7M A;  4JFE A;  4NQC A;  3KPL A;  3MRB A;  1I4F A;  4NSK A;  5HGB A;  5B38 A;  3QUY A;  1Z5L A;  4NHU E;  5EO1 A;  3OXS A;  3WS3 A;  3DX7 A;  1I1Y A;  4EUP A;  3TBY A;  3MV9 A;  3HG1 A;  4U1J A;  2BVO A;  3ARE A;  5EU5 A;  3WUW A;  2NW3 A;  4N0U A;  5EU3 A;  1T80 A;  3HPJ A;  3ILQ C;  1SYS A;  3WLB A;  2BST A;  3CH1 A;  5SWZ A;  2YPK A;  3L9R A;  3HAE A;  5C0C A;  2X4T A;  1ED3 A;  3M17 A;  3MGT A;  4PGE A;  3V5K A;  3GIV A;  1KPU A;  2P5E A;  3MRN A;  2V2X A;  4LCY A;  4WUU A;  1I1F A;  4NO2 A;  1WBY A;  1S7Q A;  4GUP A;  4ZUS A;  4O2E A;  4HUV A;  1OF2 A;  1JPG A;  5E8P A;  1S7R A;  3LKO A;  2X4S A;  3C8K A;  3VCL A;  1EEZ A;  3GSU A;  1RK0 A;  2BVQ A;  1NAM H;  3GSN H;  4Y4H A;  3GMM A;  3BVN A;  5HHN A;  3PWN A;  5IRO A;  3I6K A;  4U1M A;  4L4T A;  2FZ3 A;  4WW2 C;  4D0C A;  3P4N A;  4PJ7 A;  4U1L A;  4Z77 A;  1T1Z A;  3KXF A;  4I48 A;  3MRC A;  3VJ6 A;  5ACZ A;  4F7E A;  3ARB A;  1T0N A;  1X7Q A;  3VFV A;  4LNR A;  3MRH A;  3O3A A;  3QFD A;  4MJ5 A;  3VFP A;  1P1Z A;  3P77 A;  4L3E A;  3RWC A;  3BHB A;  1A9E A;  4JFD A;  5C0E A;  1A1M A;  3GMN A;  2WY3 A;  1HHJ A;  3OX8 A;  1QR1 A;  1QSE A;  3DXA A;  1ZT1 A;  3HLA A;  4L9L C;  1MHC A;  1T0M A;  4L8D A;  3HE6 A;  4MVB A;  1AGF A;  3WL9 A;  5IB3 A;  3TIE A;  3RL2 A;  2VLK A;  3D25 A;  1YN6 A;  1L8J A;  3DX6 A;  2F54 A;  1T22 A;  1T1W A;  2X4U A;  1BQH A;  3CZF A;  4EN3 C;  3LN4 A;  2DYP A;  1G7P A;  4NO3 A;  3FTG A;  3TBW A;  3FQT A;  3I6G A;  1AGB A;  3ECB A;  3JTC A;  3VXP A;  2AK4 A;  3LKR A;  3GMO A;  1RJY A;  3OXR A;  1ONQ A;  1T7Z A;  2OI9 A;  4Y2D A;  3HE7 A;  1BD2 A;  1N2R A;  4HWZ A;  4U1S A;  3SKO A;  3KYN A;  3VXM A;  1A6Z A;  4LCC C;  5IB4 A;  4L8C A;  1EXU A;  3MRD A;  4PV9 A;  1JHT A;  1I7T A;  1HOC A;  3T1F A;  5BS0 A;  5BXF A;  1AKJ A;  5HHM A;  5C0A A;  4QRS A;  3D18 A;  2VLJ A;  4N0C A;  3QUK A;  1I7U A;  4FTV A;  3L3H A;  3RUG A;  3ARG A;  3FT4 A;  5HYJ A;  5J6G A;  1ZT7 A;  4JFO A;  2P5W A;  5INC A;  4NQX A;  1LK2 A;  4PJA A;  4PJG A;  3PWP A;  1HHH A;  4MQ7 A;  1GZQ A;  5EOT A;  1JPF A;  3LKQ A;  2YEZ A;  4PJI A;  1G7Q A;  4PGC A;  1C16 A;  2BSS A;  1BII A;  3GMR A;  3RWD A;  3MRM A;  4F7P A;  4QRT A;  1T20 A;  2XFX A;  5E8N A;  4U6X A;  4APQ A;  5SWQ A;  5BRZ A;  3G08 A;  1S7S A;  3KPM A;  4PG9 A;  3BH8 A;  3KPR A;  1QLF A;  3VRI A;  3FT2 A;  1FO0 H;  1MWA H;  2X4Q A;  1LDP H;  3KYO A;  5D7J C;  5IM7 A;  4JFF A;  4PP8 C;  4O2F A;  2FO4 A;  5H94 A;  3FOL A;  5MEN A;  5EU6 A;  3DBX A;  4PRA A;  4L4V A;  3MYJ A;  2V2W A;  2HLA A;  4QRU A;  4CW1 A;  1SYV A;  3O4L A;  5D2L A;  4WDI A;  1R3H A;  1S9Y A;  1TVH A;  5C0F A;  4MJ6 A;  3GSV A;  4NO0 A;  3GML A;  3MRF A;  3MRP A;  4PJF A;  3BEW A;  4I4W A;  1CG9 A;  5HHP A;  3ARF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...