2CLZA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct Orientation of the Alloreactive Monoclonal Cd8 T Cell Activation Program by Three Different Peptide/Mhc Complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 278
sequence length 278
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2clzA01
4TOYH 2F74B 4ZG1A 1LO4H 5FEBA 5J4MA 1ORQB 3CPLB 1IAMA 1VERA 1BWMA 4X9IA 2P45B 4DOHE 1N4XH 1FGNL 2EIEA 1FNGA 4HMCA 4XP6H 3GMQA 3QFJD 4LSPH 3B5GA 5GS1B 1U3HB 2ICWI 2R2EA 2B4CL 4UTBL 2NY1C 2CLRA 4FQHA 2EH8L 4Q58C 4F3FB 1JGVH 1QA9B 4MJ5B 3FT4B 3I6GB 1AGFB 3LAFA 3NIGF 3S5LG 4JO1L 5C07E 5EUKB 4U1HB 1IZKA 1QNZH 4LCIL 2PYED 2R56H 1AR1D 5FDYA 2YUVA 3GMLA 5TPWH 2FD6H 5C92A 4JFQA 4MNGB 3W81A 4MAYC 5E99H 1NCNA 1F3DH 4HUWA 3ZKNC 3HZMA 4R4FH 4NQDA 2VTFA 2P7TA 3VXNA 2P5WA 5EOCL 4K7PH 2D2OA 3CVHA 4N0UA 4P4KA 2NX5D 4QRPD 3O11B 4OLXH 3NPSB 3D9AL 1FZJA 3HI5H 3QRGH 1DUZA 3IDIA 4DZBB 1PEWA 2BXZA 1RI8A 4QGTA 2XZCH 1VFAB 1WJ3A 5DHVA 3C9NB 2IALB 3LKNB 1MLCA 4KMLB 3OXSB 5D7LA 4WU7A 2DL9A 1U36A 4F8QA 1B9ZA 2P1YA 4M6NH 2H32A 5CGYC 1N2RA 1GIGH 1KEML 4LLMB 5L88H 1A6UH 4ZXBB 1Q0XH 4ZPTB 1OGAE 2MQ0A 3L5HA 3N9GL 1VENA 4HKJB 15C8H 3WIIL 4D0BB 2AXHA 5E5RB 4FXKA 3S3SA 1QFWM 1AE6L 3F6LA 5IFAH 1VACB 1U8PA 3W0WB 5D6DA 3IFPB 4LHQB 2DWDA 4F57H 5MP6H 2DBJA 4PJ5E 2PETA 4MSWB 1F3RB 1NGPL 3E2HA 1KELH 1NKRA 1N6QL 5HPOA 4HAGA 4OBSA 3MBEA 2QADB 3C2AL 4U0RB 3NOIA 1DJSA 1PG7L 1L9MA 5B4MC 3V0WL 1YEJL 4A2LA 3WEXA 2FIKA 4JRXA 4POYA 3VW3L 2HFEB 3IRZA 3EYVA 1KJVB 2QQQA 4C56A 4M1CC 4GKSA 4I2XB 5FGCB 2AK4D 5CZXC 1U9KA 3IJYA 1A3LH 5F7HA 3G5YB 4BELD 2DQJH 2QQNL 3SHSA 5TDPA 1XZ0B 4PJ7E 4PR5A 1FFPA 2XOTA 5I9QB 4YXLH 2AJ3B 4Y2DB 1WEJH 3QG6A 5ADPH 3C8DA 2CDFA 1KGCD 1IQDA 3MV8E 1WBXB 1G9NH 3CFEA 4U6HA 4WI5A 3FQUA 1IGMH 4IEFB 3BKMH 4G8IA 4G7YL 3MLYH 1KLUB 1A7QL 1E4XI 2NY0B 5BQ7A 2JIXB 4RMQA 2HMIC 3OGCA 3Q6FB 5GRWA 5FGBC 1AHWB 4LHUB 4P3CL 3B9KD 2XZQL 4C55A 1KCUH 5J13B 4ZNEE 4NO2B 4L4VA 4UNTA 4L4JA 3LN4B 3WJLA 1MCQA 3TC9A 2AV7B 1JK8A 1P9MC 3QO0A 5DJZB 1MVFA 3IFLH 3VD3A 5DD0H 3D1MC 4OD1L 5IT2L 1EHNA 1TZHA 3V0VB 1RURL 2LABA 2BSTB 2BDNH 2FATH 4OB5H 1FIEA 2OI9B 4RAUA 1TITA 2DYPA 4FMKA 2W92A 1MAJA 5B8CA 2EDDA 1NEZA 1KTRL 4NBZB 1XGPA 4LSTH 1NC4A 5F96L 5KVGH 3CXDL 1P1ZB 4Q2ZA 4WFGD 4GG6F 4MA3A 3GIZH 1MCLA 2AJZB 3P4LA 1I1FB 1R3KA 1OP5H 5KTEH 3GSVA 4HMDA 4WO4D 5C08A 5C0DB 1MCSA 3BH9A 3JXAA 4DUXA 1HYSC 5FM4A 1CU4H 3FT2A 4K8RD 5C9JA 4KI1A 4WHCA 1CGWA 3NABL 2EO1A 1T1YB 3KLSA 3MNVA 4HUXB 2IANE 5FKAB 3KYAA 1HQRA 4JVWA 1MOEA 4JQIL 3JV0A 2O93L 1K4CB 4M3KB 5EWIH 5B3JE 3P11H 2EE9A 1S9VB 3MLXL 4XHQA 2Z92A 5JW4Q 3D0LA 5CBAB 5I1EH 2BVTA 4AG4L 2R0WL 4X7EC 2JELL 1R5VA 5KSAB 5T5FH 2CSPA 2W9DH 3T3MF 1GGIL 1TETH 5I1GL 1BD2E 4LSDA 2W60B 5L0QC 3ULUC 2WP3T 2VO5A 3VXRB 4PRIE 1RVFH 3VWJD 4Z18A 2EDYA 3QSKB 4P2CG 1FZOA 1W2KT 5AUMB 4OV5B 5M95B 1E27A 2VR5A 3Q3GB 1NGXA 5DEZA 2HT2D 4YEFA 3DVGA 1NBVH 1GC1C 4HUUB 1KN2L 4PJGE 2IFFL 1G7QB 2AQ3A 1CYGA 1MCPL 2Q6WB 3MO1A 1D7FA 4ZUTA 5T1KD 3ZYZA 3O0RH 4CVXB 4K3JL 4QOKB 1JI1A 1CDBA 4Y0GA 1XR8A 2QBWA 2VZSA 1JGLH 1MHEA 4L1HA 2CPCA 2A6DA 1AQKL 4UQ3A 3AXLB 2BNQB 4HG4K 2EC9U 1CZ8L 1M7IA 3O6KL 4K71B 4LSRH 2EXYC 1JPGB 4H25B 4N9OB 3O3EB 4K07A 1CFSB 1X5LA 3RWFB 1QFWI 1NBYB 1G7PA 4O2CA 4GW1A 4JREC 3IAPA 5IFJA 4PLKD 1F90H 2X4TA 4AY0A 3QUYC 5BO1H 1HXYB 1HE7A 3FT3B 3PWVA 3TPKA 3N06B 5I76B 4JFDA 1AXSA 3DTXB 3ELAT 4N8VA 4WCYH 3TFKC 4FQXC 4XCEA 1DQJA 2FLBT 2GSGB 2AXGA 3LKPB 4X5XA 1MHPL 4XRCA 3IDMA 2YK1H 5HHNB 2X6MA 5E2TH 1PGRB 4GFTB 3V7MA 5I17B 3QJFA 4QXGL 1SVZA 1KJ3L 3WHE1 1XGUB 4JFZL 1T5WB 1DLHB 3H3PL 2BNRB 6FABL 5HHMB 4P57A 4DTGL 5IK3A 1CGSH 2HJLA 1JZ7A 3KPRD 4NBXB 1MFNA 43CAB 4Y1AA 4LQFH 1PG7X 4YIQB 3K8LA 2Y1VA 2X5PA 4FNLL 4I9WD 4POZD 1KNOA 2E9JA 3DVIA 4XPTL 4MB5A 4S1RH 4UV7L 3V4UL 4GRLA 3K0WA 5D93C 1J87A 1IILE 5I15L 2X89D 4G9FD 1PBYA 5DJXA 4RRPA 3TA3D 3C6LB 2MQCA 2FX9L 1C16A 2AJVH 3P3YA 2Q8BH 5K93A 5JIIA 1RZGA 4P9ML 1OTUC 5KJRL 5IW1B 4JHWL 1QFWH 5IOPA 1XH3A 3UYRL 3X3GL 4XNXH 3L1OH 1FRGH 2DDQH 3P0YH 1TPXB 4I18C 5DD5L 4S2SA 5BCAA 3ZTNL 3QBTB 1FVCA 5E2VH 32C2A 1NAKH 1U3YA 1AGCB 3E3QE 3CFIC 1OB1A 1OVZA 2VZTA 4HMEA 4XVJL 1EJOL 3QIBC 4RMSA 1GJIA 2Y06L 4OSUH 4WW1B 4ZSOE 3MA9L 1QBMH 3QWOA 4N0FB 1BBJA 1G0DA 4KK5D 4OD3L 1CE6B 2YD9A 3G04B 4NT6A 5E6ID 4X8JA 5E5UB 1MNUL 1X44A 1D5IL 2FZ3B 1IL1B 1F8TL 3O6FB 2OJZH 3OB0H 1OAYL 3VFWA 3D18B 1ZS8B 2PCPA 1MI5D 3E6FB 2VNCA 4JHAL 1WT5C 3MREB 4PG2A 5DEGB 1OL0A 2E27L 3IAGC 3PHSA 4K7FB 2VRAA 1CDUA 4YHOH 3TBYB 4WUKH 4JKLA 3QI9C 3LZFL 5C0BB 4HK0A 1ZHKA 2N7BA 4QXWA 3SQOH 4EVNB 2JK5B 1EHXA 4ZAKC 2ADFH 1XIWB 1A6TB 5I1AB 5J12B 1YECL 3ET9F 3DYPA 4IRJB 4P5TA 4WW2F 4X0KA 3IDNB 4ZOCA 5FIEA 2GJ6B 4NQSA 4ODXA 4AIOA 1JNLH 4YFLF 3RI5F 3RWJA 1KB9J 5D96B 2UWEE 3I84A 4KROC 4YXHH 2NLJA 1OD9A 2D31B 3INUH 5ESVA 5IQ7L 1IQWL 4YPJA 2ED9A 3U0TA 3W9EA 4EDXA 4ETYA 4TVSa 1L0QA 1RZIA 4WTZA 1W8NA 2IH1B 4GRWE 4DOHB 3NZHL 3FO1B 1FVEA 4WHDA 4AENA 1N3NA 3GBML 4ODTL 5CJXA 3SDCB 1C08B 2J6EL 3T2QA 4DVBA 5LXGL 5F97E 3JV6B 3GKWL 5BVPH 1N7ML 4PJEB 1JF1A 4MQSB 3GJEB 1CLZL 1FLRH 1EA9C 3NAAH 3H9ZA 4TNWF 5I0DA 2EC9T 2ERJB 5I1HL 2MPAH 3OKKA 1CDHA 1NGQH 4KTYA 4M1CD 1SM3H 5SX5K 3EO1A 2B5IB 5ECJE 2FO4A 3HAEG 5ITFA 4MAUL 2NY4C 4WY7H 4JLRB 2Z9TA 5HVWA 3BZ4A 3PWNA 2DIAA 4XX1E 1U92A 1KIRA 3VWKC 4TSBL 1NDGA 1G6VK 3ZE0E 2OTWB 3MV11 3ARED 3FFCA 3PGDB 4HW6A 4JDVA 1I9RL 3UTTD 5D7IE 4ELKA 1ZA3B 3QPXH 3MRLB 4EUPG 1T0MA 1I4FB 4LLDA 3VRJB 4XPHH 5L8LB 1I8LA 3ZHDA 3WFDL 5C09A 3VCLB 2XKUA 3VFGL 4BZYA 4CRPA 3OR7A 3UTPD 4N1CA 3NCYP 4CN4A 3ZDYE 2WSKA 2APBA 1A6AB 4X7SH 1JZ3A 2VH5L 5JTWA 5IB3B 5C0FA 3HE6A 3SKJL 4CVZB 4E5XA 1MFBL 1U8OA 2UYLA 4ELME 2DWEB 2NXYC 4G3YL 5CEXB 2H2PC 3RWGB 5BZDA 3GMOB 2ZP0T 4M7ZB 2A6JB 2A6KA 2ZUWA 3U4BL 1TIUA 4LF3A 5JXAH 4U1MA 4J6RH 1IGIL 1AGDB 4UT9H 2EYSB 4AEIH 3ZHKA 5FYJD 1UG9A 2EH7H 4LEOA 4XP4H 1GPOH 1G0YR 4Z7QE 1OP3K 5LCVH 3PWPD 2J88L 3KPQA 4ODHL 5GHWH 4OLUH 4Z7VE 1F6AA 2FB4L 4X6CE 3TO4C 1DZBA 1UB5B 3OKYA 5HGHB 4HD9A 3QUXA 2ID5A 1B6DA 3LS4H 1XGTA 3EOTL 3RWCB 1XF2B 4N90D 3D87B 3HG1D 3PWLA 1Q9OB 2GFBB 2ZJSH 5EU3B 4DUVA 3U30B 5AG8A 4JFEB 3TN0A 3PL6B 3DBXB 3I3BA 3ZHLA 3FQTA 2Q76A 1XCQA 5MENB 1I1YB 3BW9A 4X4ZA 5ADOH 5FGSA 3QNXA 3TO2A 1O7SA 1WISA 2Z8WC 2KZWA 3WKML 3ORJA 3V6OA 1WUNT 3MBXL 1YPZB 3UJJL 5F8QC 4R8WH 3EYSL 1IT9L 1BFOA 1MAKA 4FQ1H 4OGAC 4QHLB 2D03L 1TVHB 1IAKB 4Z95L 5FO9B 5ITBL 4LU5H 1ZMYA 3WJJA 3HKFA 2BFVH 3FN0L 2GCYB 2CO7B 4HK3N 4HGWA 1IM3B 4WI4A 1MRCH 3QPQD 4OGZA 5EBWB 4PTUA 4GAYB 1EO5A 1KBGH 1KJMA 3KLAB 4LKCA 5SV3A 4DQOH 1HILA 3PWJB 4PPTA 5FA3B 4PY7B 1BZ9A 3H9HB 5TDOA 4KRNA 2FEDC 4KWUA 3DETC 1BM3H 1NUDA 2YD8A 1M71B 3G5ZA 3WO4C 1QBLL 2VDOL 5IP4A 1DL7H 5T33L 2AAVA 3HAEH 3CSBA 1NBZA 1TXKA 3HS0A 2GW5A 4ZYKA 3EYQD 4JQVC 1CFTA 5IMOA 5D1XB 3ARGD 3VXPB 1SYSA 2J1KA 3NIFF 3O41A 1NAMH 3VXMA 1E28B 4I77L 3QISA 5D1QC 4MA1C 5DHYA 4XWOC 3UTZA 1X9QA 5HI3C 1V7ML 2H1PL 3DUUA 3VRLF 4EUPH 2OR8A 4HIEB 2ZOKA 4G9DA 2VAJA 4XP5H 1CTNA 1NFDB 3QUMA 3D39D 4KJWC 3HFMH 5TDNB 5D8JL 5E8OA 3PF2A 1T2QL 2YA0A 2XZAL 4KUCF 5LG1A 2I07A 5IB4B 4JFFD 3L3KB 5GJSL 1PEZA 3ARFC 4QY8A 1TLKA 1U8QA 2XT1B 5KSBA 1G7JB 4F58L 3CLEL 3IFOA 4BQ9A 1JWSA 4Q9BA 3GJFB 1J8HE 3GMQB 4L8BB 3CZFA 3GBLA 5F7EH 1YEGH 2ICEA 2PR4H 5E1HB 5KVFL 5IHUL 1AKJA 2CLRB 4PGJA 5IHZB 2DQEL 3PQYA 2XFXA 1Y0LB 2DQGH 5FYKD 1EXUA 3PV6A 4TQEL 1ZAGA 1F4WH 2VDPL 2BY3A 3QEUB 3HI6H 4PJXB 4PRPD 1KCRL 2DN7A 3WS6A 5EOQL 5DUBA 3GMLB 1INEH 5FV1L 2FYYA 5GS2H 2RQ8A 1JIBA 3EZJB 4JVUA 2AS5M 1RUKL 4NQDB 1ZLSL 4K3DL 4PJHE 3U9PL 2QHLA 1G7HA 1DE4A 4NN6C 4U2ZA 1FZJB 4OFYD 4O5LH 3IDIB 1VA9A 2YKLH 4MA8L 4V3DB 2IH3A 4L4TA 3BEWA 4RIRB 4OD2B 4GBXB 4RGOH 5JPNB 1MWAA 4U6VH 3U79A 1YMME 1ZVYA 3MRKB 4WU7B 2DQCH 2BMKA 1QQDA 1YEHL 4KUZH 4A6YB 2AEPL 4MDJA 4ZOEA 2H32B 2BSSA 4GMSH 5ELIA 5DD3L 3EO0A 1A6VH 4KI5E 4UAOC 3UX9B 5E6YA 5E2WH 2NZIA 3P0VH 1NGWB 3RTQD 3WSQH 5K9KA 1IMHC 3T1FB 1JV5B 1U91A 3QXWA 3RVVC 4YO0B 2AGJH 2YRZA 5TE4L 4JRYA 1U8PB 2DWDB 2X7LB 5CJ8A 3MZGB 3PP4H 5GRZA 5HGBB 2XV6B 3KPMB 4UNUA 5I1IH 3F5WA 3N85L 3BPLB 5EOCJ 3O9WD 5CEYB 4KTDL 4RGNE 4GXUM 2VLLA 4H0IA 5CJOL 1E6OH 3O2VL 2F53B 3IU3A 1GOFA 3W82A 4WTXA 4PJDA 2QR0A 3BMWA 1UCTA 5IEKA 4HWUA 1W8OA 3Q1SL 4Q0XL 5EU6A 1GAFL 4F9PC 4KROD 4MXVE 4Q9QL 3TNMA 3IJYB 4U0QB 4H1LH 4B7LA 3OKNB 4HHAA 2SEBA 1ZLUK 4PR5B 1SYVB 3S3JA 4PJIB 2RIKA 4FFWD 4XAKE 2CDFB 2PO6B 2AEIT 3DXAB 2D4DA 1EGJL 4QHUB 1NL0H 1F97A 3HNTH 5JHDE 1MH5A 4ALAH 1LO3L 3OJ2C 1E6JH 3ZDXF 2OS7A 4CU6A 3NFSH 3QDMD 1A64A 5HPMA 4ZMAT 1GSMA 2C3XA 3H42H 5BQ7B 3MGTB 1L7IH 3UPRB 3QCUL 2X4RA 3RJDA 1AY1H 4L4VB 3QDJA 5IWLC 5EU5A 1BF8A 1C5CH 1QACA 2ICCA 3O81A 4A6YL 3ARBA 4XZUB 4BSWA 1V3MA 1AD0A 4H8WL 5JPMB 3C60B 4I5BB 3I6LD 2VWEC 5I1CH 1Q9WA 1P5VA 4P2YA 2F54E 3QIUC 3QZWA 1C8PA 5BZWA 4K8RH 4KQ3L 1T7ZA 4DW2L 4JZNB 3WO3B 3WN5C 5J6HB 4LDLB 1P2CB 3JSSA 3TVMA 1IFHL 3HB3D 2VUOA 4LIQL 1CVRA 5HHPB 4KQ4L 2YHGA 2AKRA 3A6BH 5T3XD 4NKMA 1I3UA 1KPVB 4XP1H 2WQ8A 5CSZB 4Q2ZB 5E9DB 3H9SE 4HKXA 4MA3B 3KG5A 4XWGL 5C07A 3UTSD 1SY6H 4HH9B 3TJEL 4C4KO 2AQ2A 2NXYD 3GSVB 5GS0C 1NCDH 2C3WA 3M17A 3BGMA 2J5LC 3EOAA 5CHNA 5GGRA 4NKIH 4BZ2L 4G8EB 3TYGL 5BS0B 4TNVF 5C9JB 2YC1B 4JDZB 3RUGE 4UTAH 4NGHH 1OT2A 4RISL 4ACPA 3LDBC 3WLBB 4PRDA 3UZVB 5DQDL 2ESVD 3MGAA 1QLFB 5IKCB 1MEXH 2ZG1A 2X4NA 4WJ5A 1K8DA 2EDNA 3SGJA 3A67H 1T5XB 2R1XA 2XWTA 5TQ2L 1HHKB 4BM7A 4MJ6B 1R5VB 4KKNA 4ZUSA 2HLFD 1ODAA 2P8PA 1A7RH 1WSST 1RIHL 1S5IH 1RZFL 3GSXA 3IAQA 2FH6A 5C86A 1T21B 5GZOD 2E8ZA 4LPVA 4HFWB 3LKRA 4YDIH 2BHYA 1T66D 4LAQL 5E4IA 5F70A 1NGXB 1G6RH 6CGTA 1I7RA 4DK6A 5FYLH 1EEYB 3EJYD 3QIWA 1BGXL 4JZOA 4IBLT 5CP7A 4KTEH 1QYGH 3PHOB 3IETA 4JPKH 1SVCP 5DJ0A 4ZUTB 1DQQA 3MCKA 1SBSH 3DV6A 4OKVA 2KUTA 1YEDB 3NA4A 1OSPH 3DRQA 1S9YA 2R2HA 5IBUB 1MY5A 3IU4L 2DLHA 2OZ4A 4ONFL 4PJ5A 4R96A 3SDDA 2IPTL 3U46B 4HIIA 2UY7A 5L2KE 2CLVA 1H3WM 1IM9B 3RZCA 3G6AB 5EC2A 2BVOB 4NWTH 2A6DB 5FO7B 5GRUH 3LQAL 2HRPL 4LVOC 3ULUE 5F93C 3TYFA 4N5ED 3O6LL 3O4LB 3MRIA 2X1WL 1ZHLB 3JTTB 2QKIA 1RZ7H 3QUKB 3VXSE 4O2CB 3PNWB 1PY9A 4ELMB 1FL3B 3QDGA 1NCWH 3SCMA 1JGUH 1UC6A 3FOLB 4PJ7A 3PWVB 1H3XA 3ARXA 4DN4L 2E9WA 3L3HB 3LPGA 4XMKL 2AXGB 3VJ6A 3TZVD 4M1GL 5CZKA 1HHIB 3MV8A 2JTDA 5D1QD 1S8DA 3QJFB 3QQ3A 1Q8MA 3HMXH 2VSCA 5HI3D 4PRBA 4OFPA 1S7SB 2V2WB 4ZOBA 3HHRB 4PJCB 3BKCH 3NTCH 3ZKXC 3O8XA 4NSKA 4ZUVB 3OV6A 3MRQA 5IK3B 1W0WB 2VC2L 3T4YA 5HYSB 2NR6D 4G6JL 1ZWIB 4ZNEA 4E42A 3OKEB 1SJVA 4P2RB 5LWYL 7FABL 5DLML 1JHKH 4UDUB 4LLUB 5D2NC 2FSEA 4GW5A 2YXMA 3KPSD 1KNOB 2HT4C 1HHHB 1TZGH 2E9BA 4M7JL 2ATPA 2B0SH 3T0AA 4GRLB 5ILTL 3VDAA 1F3JB 2ATKA 1U6AL 1Q0YH 3F7YA 3D0VA 1HKFA 3ILPA 3IKCA 2ZWLT 3QEQD 5D1ZA 1R0AL 4LCCC 4D94A 5IOPB 1XH3B 1UWXK 2RBLA 1T1ZA 4XXDA 4G6FB 4HXAL 4S2SB 4L8CA 3UBXA 4WV1C 3T0BA 5I8OH 1FVCB 5JHLL 3GUTA 1CR9L 4H5SA 5EZIL 32C2B 5I75B 3OF6A 5F7WC 1N64H 3TM6A 4QHNB 1BMGA 3RHWF 2WV3A 1X4ZA 3FMGH 4YC2B 4FTVE 1U95B 1FFNA 2ITCA 4K23L 1KT2B 4HWZB 3OAZK 4KGJA 4NJ9H 5DQJB 4G5ZL 4KC3B 1MIML 3I50H 3NGBC 1BBJB 1GGTA 5IVNA 3VH8G 2QSCH 3OWEA 1WZMA 3E1F1 3NVQA 4PD4K 4WWKA 5F7DB 1YNKH 5BOPA 1QLRB 1Y6KR 4FQLL 4EI5B 2BNUA 1XR9B 1QSFD 2IANA 3UXFA 4JM2F 2PCPB 2VLJD 3BXNB 1JYVA 5DMKA 5EIIA 4KRPB 2AV1B 1MCIA 4WW2C 1ETZA 3HNSH 4I48B 3CK0H 1NSNL 5HHXL 3DURA 3QNZB 4AQOA 4JKMA 1DDHB 1ZHKB 5SX5H 3MJGX 2CRIA 4NNPL 4V1DE 5ALBH 2A1WH 3EYFB 1EAPA 4YHYC 5F3BA 4L8SC 1UWEH 5I0ZA 1AO7D 4P5TB 4JG1H 1FYTD 4YHPA 5ICYB 5MERA 5T1DL 3OKOA 3MOBL 4ODXB 5GGTH 3WUWB 3VFRA 1IEBB 5DJCA 1I75A 4LBEA 1NQBA 3GSNH 2D9QB 1JZ6A 2O5YL 4PJGA 2ZOLB 5HI4C 4YXKH 3BISA 4JGMA 1UM6L 3OKMB 1K2DA 3W9EB 2CO6B 1TQBB 1ITCA 3MFGB 3KR3H 5C0AA 2NY7L 3JWDH 1RULL 3SJVE 4W6XB 1AFVL 3UMTA 1JFQL 1N3NB 4EZMA 4NC0B 3LH2L 4R4BB 4OCMC 4OF3A 3RDTA 5LBSH 3K74B 4LNVA 4DVBB 1T3FB 3Q6GL 3LHPL 1JF1B 5JQ6L 2W07A 2R1WB 1YQVH 3G5VB 4WU5B 3EO1B 3EFFB 2NY5L 5EUOA 2LQRA 3KPNB 5KANG 1AI1L 5EZJB 1QPPA 4UQ2B 1T7WA 1OP3H 3BZ4B 4U1NA 1KUMA 4KRLB 2CRZA 1P7QD 4LLQB 1XCTA 4DCQA 5DJ2A 4PJHB 1HHJB 4F7EA 4JDVB 5TF1H 4Y19A 4CNIB 1JTPA 1T0MB 1G9ML 1U8HA 4AL8L 4LLDB 4N1EA 4OF6A 4JRWA 4JO3H 4U31A 3HRZB 4MVBC 3T0EB 5FYJH 2E7BA 4PG9B 3NCMA 1WAAF 4OZHB 3G6DL 3PHQA 4C83B 2J3SA 4ETQA 5C0FB 3HE6B 4JFPB 4E5XB 5E24E 2FJFA 2NTSP 3HUJE 1W72A 4PRHB 1FO0A 2CRMA 3VFOB 1KLFA 4MJID 3F7RA 1I8IA 1QRNE 3GGWB 3GIVB 1GGYA 1YN6A 3QIUD 5BZDB 1CFNB 3HMWH 2F58L 2VQ1B 2HT3D 1JNNH 3DJ9A 4NWUH 2DTML 3MRGB 1V3KA 4PV9B 3MXWL 5CINH 4XC3H 1L8JA 5BOZG 2Z0BA 3MUY1 4NC1E 4JPWL 4B41A 2G75A 2VZVA 1GHFL 3MLSL 2XN9D 1ZVSB 5J6GB 1F6AB 2WBKA 4LCYA 3L9RA 3I3EA 3E3QA 3IJSB 4MGXA 2OL3H 5CJBA 1QSEB 3AY4C 4FA8A 4HKZA 3QUXB 5GS0D 4ZSOA 3A0OA 1FFRA 1F42A 3BT2H 4KRMB 4UV4L 4OZGF 3W39A 2IQ9L 2EE2A 4M6OH 5KANI 3CMOL 2ZUQB 1IAIL 5DMYA 5GSRA 2R29H 2D3VA 4K2UL 4F33B 4MNQE 4O02H 4MD0B 5C0GA 1BAFL 5DWUL 3GFUA 5I30H 4DWHA 2CR6A 5A16A 1LEIB 1IC1A 4PP2A 2D7PA 1PSKH 1UH3A 1BFOB 1DQLH 3L5WA 5JHDB 5FGRA 3SE4A 1LDPL 4ORZC 4XVSH 12E8H 4Z7UA 5E7FA 1T0NA 4X6DB 5F3HB 1BFTA 2BCKB 5TQ0L 5B39G 1CDGA 3T3PE 1ADQH 1A4JA 2GITA 4U4BA 5D7KE 4HPOL 1LEGA 4PBVC 4OCRL 2BJML 1LGVA 3Q5YA 3EFDH 4LKCB 2AEWA 1CDJA 5FOBB 1HILB 3B3IA 1KEGH 1MF2H 4CGTA 5TDOB 2UWEA 5DA0B 1ZGLM 3D3VE 43C9A 2XTJB 3MUGA 4NYLB 3CNKA 5ESQA 3ZKMD 1VGEH 1RUQH 2OSLB 3LRSA 3MACH 1S5HA 1CFTB 2FGWL 1BIIA 4KHXL 2XACC 3DX7B 5CMAB 4CADB 1ND0A 1P53A 3DSFL 3FONA 1UZ6E 1CL7I 5EOTA 4OZFH 2ICWB 5ACLA 3CLFL 5I73B 1OAZL 1BLNA 1ZANH 2GJZA 3RWDB 1JFMA 2GTZB 3BQUB 2EZ0C 2GK0B 1U2CA 5D72H 4CL7A 4YHKH 5CILL 5FYKH 3C08H 2I07B 4M93B 3BP4B 4QY8B 4FP8L 3F12B 1BECA 1HKLH 5EN2A 4F7PA 1B88A 4TOYL 3MA7B 5D2LB 4KJQD 2X4SB 4I0PA 1LO4L 5EB9A 1AXIB 1JWSB 4AM0A 4EN3C 3PP3K 1VADA 1N4XL 5D7IA 4OZIA 3OXRB 4XP6L 2CUMA 2VDLH 3HZVA 3QXDA 4LSPL 4KXZH 3OR6B 5A3IC 1JPFA 2YS4A 1AKJB 4P46B 4I8DA 3PQYB 4JFOA 1ZHNA 4L3ED 3MROA 4OAWA 3NCEB 4PV8A 4RAVA 3FJTA 4HKBA 5F72S 3G6JA 3BPNC 4PJEF 2X9YA 3H0TA 3QXVA 3T08A 1QNZL 3BPOB 5HHOE 3UC0H 4UNVA 3KPLA 1R5IA 5A2FA 2R56L 5K33A 5JIKA 2CK2A 4UTBH 5BV7C 5E99L 1IKNC 5E00A 5GISH 1RZKC 1MHHA 3S6CA 1QKZH 2X9WA 1INQB 2X1PA 3IGAB 1WICA 3EJJX 4K7PL 2OCFD 2MNUA 2R0KL 4JO1H 4YQXH 3PUCA 1VKXA 3EOBA 1AGBA 1VEMA 3QRGL 4NUGH 2IH3B 3PL6D 2YA1A 2XZCL 4Z7VA 1WC7B 2V7NA 5JLZB 5HYFA 3QNYA 3LVEA 4LP4A 4RNRB 4RGMB 1RQ5A 1MY7A 4X99B 5T3ZD 2CJUL 2GEEA 4YDJA 2J7LA 4I0CC 5ID1A 4OLVL 3JWOH 4P2QD 1H3PH 4O2FB 2WW8A 5LGHH 1GZPB 1NLDH 3B5HA 5D5MA 3H7LA 3LN5A 4NCC1 1NC2A 3LKOB 3S5LB 4BA8A 5SWZE 4M6NL 1MAMH 3EO0B 5SWSD 1ZLUH 1HNGA 2FWOA 1GIGL 3MLZH 1UJTA 1CICC 3AB0B 5HYJD 5L88L 3WHXB 4QCIA 1A6UL 3HNVH 2IEPA 5K9KB 15C8L 1VFOA 2ZPKH 1U91B 4LLVA 4XT1C 5EPMB 3PIQB 4PRAB 3MGOB 1S7WB 4JB9H 4LCUA 5D7JB 3AU1B 4EEEA 1MPAH 2XWJA 3G08A 1KEMH 4F57L 4QRUA 5MP6L 2WBWB 3JTCA 3ZYOA 4NM8H 1KCGC 1KELL 3DRTB 2H26A 1X3DA 1GGBH 3AVEA 3MRFB 2B4CC 1T04A 3ARDD 5MEPB 2DI7A 5DQ9B 1X6LA 2VLLB 4Y4HC 1I8MA 4B7IA 3WFCL 5HGDA 4MQXD 1L0YA 5IEKB 2MMXA 1RUPL 3IYLW 4Y4FD 2OR9H 4YUEL 2P24A 1WITA 2VKWA 3T09A 1LEKB 1EZVX 1TJGL 4MQ7B 1CN4A 1A3LL 2CUIA 2VXVH 4UIMA 2DQJL 3D69A 1PG7H 4YDVA 1I3RA 4K9EH 3HLAB 3FL7A 4NBYB 5DRWA 4YXLL 3CZJA 2FJGA 3ZMRA 1YPZF 5ADPL 2PNDA 1ZT1B 1K9TA 1VGKA 1VESA 1Y18B 4BQ8A 1DVFB 5HPMB 1UQSB 3D2UD 1IGML 4ONGH 3BKML 2PXYC 3R0MA 3U4EB 3MLYL 4XCFH 3QB7C 4MLSA 2X4RB 4PGDB 4FTVB 1CVSC 2WBJC 4RDQG 2UZIL 5ERWA 5T3XH 1KCUL 4PGBB 3CFKA 5EBMB 1UENA 5F9OH 2RFXA 5I1LA 3GI9H 4S1QH 2MCG1 1XEDA 4FRWA 3IFLL 3MODH 5DD0L 2J12B 4JZJC 2JJSA 1UVQB 2VZOA 2VXUH 3MV9B 1NUFA 1P5UA 3ULSA 4D9LH 1KG0A 2PW1A 1J8HA 1HCFX 3WUZA 2BDNL 2FATL 4Y8DC 5DRNA 4MVBD 3RX5A 1JMXA 4NOFA 3RVUC 4TSCH 5IROA 3VXQB 2VXQL 3STLB 4LSTL 2P5WD 4OCLC 4OD1H 1QFUH 5IT2H 5KVGL 1A2YA 4M6ML 4P4KD 1CWVA 1RURH 3GIZL 3WNKA 1FC1A 3NCCB 1MHCB 3BGMB 5GS1C 3EOAB 4GKZB 5EO1B 5IJVA 5GGRB 1E4XL 4I3SH 5EULV 2AK4E 5TF0A 1FCGA 5FM5O 1CU4L 1D9KC 5D7LD 4GG6E 4N1HB 4Z77B 4U1GB 1FFQA 3RL2A 5DMGC 4P3WA 5LAXA 1MREH 4P99A 2KZ1B 2X4NB 5EWIL 5DK2A 4OUUB 2DIJA 3P11L 3CU1A 2YD1A 5B3JF 5I8CB 2XICA 3CFBA 3HE7A 4LPXA 5IBLC 4WFED 5I1EL 1YMMA 1F2QA 5T5FL 1EX0A 1A22B 4POUB 2W9DL 2I9TB 4MCYA 1TETL 4PS4H 5IUSA 4JQIH 1P4IL 3ZE1E 1MJJA 3BE1L 1RVFL 3FFDA 1TENA 5H35B 4PJXF 5I2IB 3CC5B 5FKPA 3V8CA 4MAYA 4AQ1B 4YBLB 2E6JA 3NCBB 4AG4H 3RVWC 3TBTB 3T3ME 1UADC 1AXTH 2I27N 3MBED 1KJ2A 3O3AA 3RNQA 5I1GH 1NBVL 1S7TB 4V3EB 2DQUL 3UO1H 4NZRH 5CJXC 3IETB 4GMTH 2I60H 1DQQB 3MJ7A 2HG5B 2YD7A 3C8KA 4K7PX 3VU2A 1IEHA 4PY8I 4DAGH 2APWA 1KTKE 1AD9A 4FG6D 3S8WA 3O0RL 1RU9H 1OHQA 2JCCE 4NHCH 4JRXD 4ZXBC 4IJ3B 1KN4H 4NQED 4QRQA 2WM0A 4C56D 4R4NC 3LKSA 1TCRA 2C3VB 5EC2B 5T1MA 5BMFH 1JGLL 1CLOH 1NGZA 2IFFH 3UJIL 5A2KH 5IIEA 3BJLA 4WRLA 3SKUD 2OJEA 3DIFB 1C12A 1BZ7B 3BN3B 2Q8AL 3MOAH 2QKIB 3KPOB 3TBWB 4LCWE 5GIRB 2ZG3A 4WHYG 5EA0H 2BSRA 2QADC 4U0RC 4LL9A 1F90L 2YSSA 2YPLE 4F7CA 1AQKH 1LO2H 2Z93A 2VDMH 3BUTA 4L4VD 4WCYL 3GKZA 4P0DA 2IBZY 4HS6B 2YK1L 5E2TL 1LILA 4KMQA 3B2UC 1UB6B 4WDIB 3K4ZA 4ZQKA 5E8NA 3DX6A 1T20B 3DMMB 3W9DA 2P5EB 3P4NB 1CGSL 5CZVH 1U8NA 4XHJC 5I66B 4LQFL 4Z0BL 4E42B 3RGVB 1PQZA 4JR9H 2DYPD 5L2JA 4Y16B 3RP1A 5IB2A 2YUWA 1NC4D 1N0LA 2ATKB 4PRNA 2F54A 1YNTA 4L8DA 4DTGH 3SGEI 4JHBA 3IKCB 3KXFB 2AJVL 5J13C 2Q8BL 2JF1A 1HSAB 4PJIF 1ZA6A 1QFWL 5C08D 4U6YB 1JGDB 5C0EB 4XNXL 4L8CB 3L1OL 1FRGL 2DDQL 3P0YL 1FNHA 4I3RL 4M3JA 4YHZH 1A4KB 1U8KA 3LEVH 5E2VL 1Q9KB 4JM2C 1NAKL 1KFAH 5DJYA 2Y6SC 5FGBA 5GJTH 1Z5LA 3H9SA 1LO5A 3SDYH 4XBGB 2OI9C 4OSUL 3VRIB 5KJRH 5FYLE 2FL5B 1QBML 1KV3A 4PJAE 3G5XB 4XB8A 5DDHA 2K3TA 2M2DA 4PGZA 1HNFA 1P9MA 3I9GL 4GS7B 4JPVH 4J3WA 2CIIA 4PJFA 3SO3B 4X6FB 2V2TA 3BP6A 4Y4KC 2OJZL 1F6LL 1J1XH 1EJOH 3EHBD 1IGYA 3O2WH 5ICZA 5FK9B 1FC2D 1UH2A 4CW1B 1ETZB 2X4UB 2GUOB 2XNAA 5CWSB 1T1WB 3ECBA 3WXWH 1MNUH 1WFUA 1D5IH 3O2DA 2VXTL 3SGEH 3PWPA 1F8TH 2A0LC 4BH8A 4WUKL 4DFIA 1Z2KA 1P7HL 1IBGH 1OAXL 1EAPB 5C3LD 3WKNA 2X4OA 2ADFL 5ICXB 1KIQA 2CMRH 3QHFH 3UZEA 4YHPB 1MJUH 3IJHA 4WHTB 4QNPE 5KSAC 4R3SA 3V6ZB 3D85B 1EVTC 3EDEA 4QHKJ 5DJCB 3LZFH 4G9FE 3OX8A 3Q0HA 3QQ9C 1P4BH 5BVJA 3WE6A 1RY7B 3P9MB 4YXHL 2EDJA 3FQWB 2VZUA 2EDWA 3BI9X 3FZUD 2OMNA 2APFA 2IPKA 3VXTA 4ZFFA 4BYHA 4PBXA 4KKAC 3P73A 5C0AB 5J56B 4CDGC 1URLA 2BERA 3NFNA 5L2KA 2ADIB 3RDTB 1MFDH 3P9WB 1TZIB 4NUJA 2BVQA 4JFDD 5ISZE 2FBOJ 3VFVA 5J1AB 5BVPL 1LD9B 4A2MA 3P4OA 3GSRA 1FLRL 2P8LB 1A6WH 3NAAL 3VXSA 2MPAL 4NO0A 5F1IB 4N8CL 1UXWB 5EUOB 4ZTOH 2KKQA 5HHOB 1FSKC 3S88H 2VITB 3DO7B 1A1NB 1Q1JH 3KPPA 4WY7L 2QQKH 4Y1AD 2OXHA 5FA4B 4LDEB 4R2GD 5C71A 4K71C 3OAYK 3VXUE 1IGJB 3IKKA 3CFJA 5I1HH 4Y19B 3T0WA 1RHHA 2PXYD 3QPXL 5GPRA 2N56A 1FV1A 4MAUH 1SEBB 1A14H 5K9OA 4X6EA 5D6CB 3ULVD 1CFVH 4ETQB 5LVEA 1UJ3B 4IMLA 1VEOA 4X7SL 5KOMC 1QHPA 2VAAB 1BX2B 3OKLA 3MJ8B 1FO0B 5I71C 1FVDA 3SOBH 4X6BA 5ID0A 1AH1A 2R69H 2DQHH 3TPUA 1EHAA 1D5XA 4Z76B 2NXZB 3QUYA 4MQTB 1KPRB 5F9JA 2KDGA 5ACZA 3HAEB 4ELMF 3VFGH 5DEFB 4ZFOB 3UCRA 3QUZC 3VFUA 5JXAL 4FQXA 2VH5H 3VGBA 3TFKA 3IXTA 4J6RL 4UT9L 1NAMB 1DBKH 4D9RE 1OF2B 3SKOA 2EH7L 4XP4L 1GPOL 4MDIB 1T2XA 2VISA 3QFJB 5LCVL 3MV7E 4EUPB 1VCAA 5GHWL 5BRZE 4OLUL 4TVPE 3BYYA 4PJCF 5IESH 4WI6A 5FUCC 3JV4A 4HKZB 4OZ4B 2Q3AA 4AIZB 3BP7B 2PW2A 4U49A 3GMMA 4X6CF 1KPUB 5C0CE 5F7LB 3LS4L 1IKFL 4TNVK 4W6YB 1TPXC 1UXSB 1CFBA 1D9KD 2ZJSL 4PRPA 2AI0H 2PYEB 3MNWB 4ODHH 2DBLH 4W6WB 1OSZA 1U8MB 2FB4H 1FJ1B 2H8PB 2IADA 5DK3A 1FAIH 4HS8H 5AZEH 5MEOB 5DMGD 5LGJB 3KAAA 4IRSC 5CLWA 2R4RH 2BY2A 4L9LC 5ADOL 4OV6F 1DFBL 1YEEH 1MCWM 1DN0A 3RVTC 5DMIL 1HEZA 2NX5B 4QRPB 3UTTE 3DPBA 5GRVK 1E4JA 5IBLD 4I18A 5BW7C 1JTTA 1LMKA 4R8WL 5EH1A 4HJJH 2G5BA 2RAMA 5IF0B 3O6FC 4OFIA 4WI9A 2XG4A 4LU5L 3FKUS 3QIBA 4ODWB 5F6HJ 2D0HA 2WK2A 1LE5A 4MS8C 1F5WA 1I9JH 1OP9A 4LOUD 2KBGA 4NNXB 2FJHA 1MRCL 4TYUA 3CH1A 5LKNA 5GZNC 1X5FA 1VPOL 4Z95H 3PP3H 4DQOL 1CG9B 3LIZH 1KF9B 3ARYA 4FQJH 1WT5A 3IXAA 1EHLL 1DL7L 2HVJB 3LRSB 1DBJH 5J12C 1XAUA 4GXVL 4YDKL 4ZFOL 3MRDB 1DP0A 5CKGA 5TGBA 4PJBA 3WXVH 4APQC 3SJVA 4NC2B 1ND0B 4X4ME 1NAML 2JE8A 3QI9A 4FXGA 4V2CB 4PLNC 2LVEA 5D9SA 5D96C 2KQNA 5JO5A 4HBQA 4ZAKA 3RWIB 5B39A 3O3DB 4UU9A 5DC0A 3FFCD 4XP5L 5L6YL 4PREA 3QO1B 1IGTA 1KC5L 4QTHA 3HFML 1WBYA 1V3JA 5C09D 1FORH 4I77H 4L3CA 3VRLE 3SDCC 3EYUH 4Z7WB 3O4OC 2VE6B 3WV0A 1OTSD 1A3QA 1OLZA 4KJYB 1FNSH 1PZ5A 4YFLI 3GSQB 3CFDB 2ERJC 2VDQL 2YPKB 4NQCE 1WV7T 4G42A 3FO2A 4HLZG 3TBVB 1EEUA 5DRZB 1OWRM 2X70B 2FCBA 2XZAH 5F7EL 1YEGL 4EKXA 2PR4L 4AEHH 5C8JB 2UUDH 5GJSH 3LQMA 4JFOB 2XQYK 2W0FB 4NRYB 2WNGA 1MCCA 3WFHA 5CEZE 2DQGL 4RAVB 1QLEL 1P4LA 3HUJA 3T77B 3O3BA 1F4WL 5IQ9B 5T3ZH 3B9KB 2DQIH 2Y23A 1H3TA 4KU1A 4UILH 2MJWA 5DD6B 3MXVH 4MD4A 1INEL 1KYOK 3VE0A 2C9AA 2CKBA 5IR1A 2VABA 2V5RA 4DKAA 3SDXB 3VWKA 2PTTA 1JP5A 2VDPH 5JOFB 4PLOB 4PJHF 4W4OC 1O7VA 1KCRH 1FFOB 5DC4B 1AQDB 1D6EB 3TN0D 2YKLL 2VDRL 4JM2D 4MXQA 4JCLA 2KL6A 3ARTA 4M7ZC 4NDMB 2Y5TA 5INCB 2GY7B 2VLMD 2NW2A 5E8PA 1G84A 4LLYA 5M7QA 2EDLA 2QQLH 1ZLSH 2EKSB 4OZHF 4JY5H 4K3DH 4LSUH 2DQCL 4MHHG 5AWNH 4TUJB 5D5MB 3QIWC 1M4KA 4RBPK 3D39E 4PUBH 3S96B 1YDPA 3F62A 3RJQB 2LV4A 1H5BB 1EBPA 2HTLD 4GMSL 4EDWH 4WO4B 4BH7A 4ZUUB 3X14A 3MRMA 1EH9A 1A6VL 4JFFE 4Y4KD 2WLYA 4OBRA 4IIQB 2DM2A 4MNQA 4KI5F 5LGKA 5E2WL 3LMJH 1X7QA 4Y5XB 3P0VL 5DF0A 3WSQL 2XY1A 3ROLA 2CLZA 1S9WA 3B8SA 3C5ZA 4NFCA 5BJTB 1OAQL 1L0XA 2ESVA 4JM4H 4LCUB 1V05A 5DI8B 3U30C 3H7BA 5JA8B 2XWJB 3RL1B 5F7MC 5J9PA 5K9JL 4ODUA 4R0LC 3V4VH 3OTTA 3PP4L 4JPIB 3U83A 3TO4A 3L7EA 4TUOA 5I1IL 3FN9A 4PTTA 4UIKH 3TH3T 3IDYB 3FQRA 2WIIA 1ZTXH 1ACYH 3L3IA 2DTSA 4KVCH 2G2RB 4OCNC 2P8MB 5TE4H 1OQXA 1E6OL 3VWJB 3KS0H 1IARB 3VXMD 1FNEA 1YJDL 3QQ9D 4ZD3L 4BKLB 3GJFH 5F9WB 2DQDH 5GGVL 5AAWA 3D3VA 4M7LH 1PZUB 3O8XC 4QGYA 4KTDH 5GGSY 5HDQH 4NN5B 3LN9A 2YD3A 1S7UB 2FJGB 3KNBA 2ICWJ 5T1KB 2VERN 1FHGA 3HNTL 1ZHBB 1XF4B 1E6JL 1LO0L 5E1AA 4HDIB 3NFSL 1OOAA 1RZJH 3QJHB 4JN1H 3NCFB 3VFPA 1R3JA 3DI2B 4MHHI 5HD8C 3NN8B 3H42L 4X6DF 3T2PA 1L7IL 1EERB 5DZNA 3I85A 4EXKA 1HHGB 3VFMA 2XRAL 5J1TC 4LSVL 1ZOXA 2VIRB 5ERWB 5D1XC 5DYOA 1G6RB 2PF6A 1C5CL 1RFDL 1NEZG 3GSUB 4PJAB 5C0RH 2JLLA 1ZT7B 1H9VA 4QRRE 2WWMD 3B6SA 2FHCA 2CIKB 5I1CL 4X9FA 4X7DC 1EIBA 5DHVH 3ULSB 1HI6A 3QCUH 4HJGB 3WIFA 1GGCH 4JQVA 4K8RL 2NYYC 1Z0MA 5DRNB 5GQBA 5GGUB 3JUZA 1N59A 3ES6A 4QXTA 1M1SA 3MLPA 2H32H 2X4QB 2HKFH 3A6BL 4KK9C 4XP1L 1JUFB 1NFIA 5ALCH 3N1PC 3ILQD 3KPRB 1IC7H 4ZPVB 4RA0C 1WQVT 2V7HB 1NCDL 5IJVB 2A83B 4P2OA 4ZDHA 4L4TD 3OKDB 4BSVB 4M1DH 1YY8A 1IFHH 3LPWA 4LIQH 4NKIL 5HYEA 1OWWA 3ARFA 3QUZD 3MMEB 1FZKA 1ULVA 5DR5H 1HXMB 4UTAL 5HI5D 1JWUA 3SY0A 5D2LF 1ZVHA 4XBEL 4XBPA 3TA3B 3RUGF 4GQ9H 5HVGB 1C7SA 1JL8A 4NPYA 1MSPA 1MUJA 2H6PA 1CF8H 3BUYB 3A67L 2GHWB 4BZ2H 1A9EA 3KYOA 1RJCA 3HC3H 4QRSA 2C4FU 4RISH 2VXSH 1A7RL 1BHGA 5DQDH 1CXKA 3ROOB 3AAZB 3T8XB 4JRYD 4MD5A 1WBZB 2NTFA 5SWZA 1X5IA 4XVTL 5TH2A 3KYMA 2X40A 5TQ2H 2YA2A 5E6IB 4YDIL 1GRWA 3SDAC 1FN4A 4M9OA 3A6OA 1G6RL 3RNQB 2DLIA 1K4DB 2X2YA 4KTEL 3MJ7B 1QYGL 1CS6A 4JPKL 1MI5B 4QEGA 4H8WC 1AD9B 3WNLA 3S9DB 3RPIA 1OSPL 3L3GB 4LNRB 4XPAL 5JXEA 4MNGE 4HFUH 5EU6D 4KZDL 4QRQB 4XH2A 5FB8B 2I9LA 5T3XE 3LEXA 3LD8C 5T1MB 2Y7QA 4NWTL 4R9HA 1RJLB 2MOVA 2E9IA 3QQ4B 5GRUL 1N8ZB 1PKOA 5E70A 3BMVA 1XF3A 4HIJB 4Q97A 4N8VG 3TBSB 2HKHL 2OJEB 4NCC2 2GY5A 5E6ZA 4Z0XA 3MYZA 1P7KB 3HPJB 5KAQG 5JIHA 5DJ6A 5EBLB 3DX8B 3D25B 4YR6B 2QLVB 1RZ7L 2IPTH 5IEHB 4WUUD 1JNJA 2XWBB 2ZSWB 3QEHA 1OT1A 2EDBA 2YSSB 1NCWL 4F7CB 1JGUL 1ONQA 3S34H 1TMCA 2WINA 4APQD 3QDJD 1NANI 4AYFA 3NCJH 1SBBA 2OQJA 1RV6X 4LAJH 2DL2A 1J86A 2XG5A 3ARBD 3HMXL 2K7PA 4U1IA 2EDHA 3ARUA 3BKCL 3NTCL 3PGCA 4RRPG 1C5DB 4GW4B 3RRQA 3NZ8B 4R26H 5DGQA 3C6SB 1ZLVK 4HJ0C 3W0WE 2PO6C 2Y07H 3VGAB 4G43B 4DEPB 3RWEA 1JHKL 1CD9B 1T4KB 3GSNB 1KCVL 3TVMD 1TVBA 4DGYH 4F9PA 1NMBH 1B0RB 3OAUH 2B0SL 2RJMA 3BN9C 3BWAB 5GGSB 4QKXB 3E3QC 4OIBA 1Q0YL 1D6VH 5C07D 1U58A 5E2JA 5I6XB 3EO9L 3UTQB 4OTXL 1ZA6B 4JO4H 5GRJH 1HH6B 4ENEC 5JW5A 5DLMH 3AREB 5CLTA 5HDBE 1RHFA 3UYPA 4MZ3A 3UTTB 2VDKH 1RZ8A 5FGCE 4I2XE 3E8UL 3C60C 1CCZA 1U8KB 5I8OL 1PFCA 2F8OA 2H9GA 4XCNB 1N64L 3GB7B 2JJWA 3FMGL 3ZSSA 3EDDA 1LO5B 2ZCHH 2F5AH 3QAZC 4NJ9L 3CX2A 4EI6B 4NZTH 3K1KC 2UVFA 4P5MB 2NZ9D 2VOTA 5IWLA 4KZEH 1UFUA 3LS5H 3SKNA 3LQAC 3B2VH 4WFHE 2QSCL 3C5JB 1QTYT 5DS8B 1T22A 5EZIH 2ITDA 5EU7C 1YNKL 3I02B 4YHIB 4OCXH 4GG6A 2BVPA 4O2EB 4RFEA 3GMNA 4L1DA 3BP6B 2NY2D 3SKMA 3HCVB 3L7FA 4MWFA 4K23H 5KBNC 4OCYH 4XTRC 3ZE2F 5IMLA 2O61B 1IGYB 3P4MB 4LSQH 5IVZA 2X1XR 3VMNA 4PB9H 2NY3D 2OK0H 4X4XA 3HNSL 1H15A 1EBAA 2VJXA 5IMMA 3CK0L 3PWPB 3KVQA 1OGAD 3K2MC 1CXLA 1SHMA 4BH8B 4PGCB 3QIWD 5F7NC 4J2XA 2C4FT 5ALBL 4O9HL 2GAZA 1TNNA 4H1LA 4WTZG 1UWEL 1JN6A 3KPSE 4PJ5D 3HG1B 2YZ8A 4JG1L 3VH8B 3SDDD 4R3SB 4B50A 3RZCD 1BIHA 5GGTL 4M4PA 1CT8A 3GSNL 1G9EA 4NNPH 2XZZA 1P69B 4AEEA 2ZUVA 1DBAH 4OGXH 3S35H 2X10A 1HOCB 3FB7B 4CJ0A 4IRZH 2V9RA 3RIAF 2RHEA 1RJZA 2OL3B 3JWDL 1FGVH 2CUHA 3QDGD 2W9LA 3SCMD 3REVB 4PGEA 2HAZA 5L0QB 5LBSL 4RMVA 1DBML 1OARH 2L0DA 3VFVB 4H0HB 4X98B 3M45A 3ARWA 4OQTA 3P4OB 4RMWA 3MV8D 3ULVH 2V2XA 3ESUF 5B22A 1YQVL 2NY7H 1M6OB 4LCWA 1E4KC 1JFQH 4N9GA 3V52L 3TEUA 3O8XD 2XQYG 3WFEH 2YPLA 3KPPB 4NCDA 2N4IA 3H2WA 3VXRE 1K85A 3GRWL 3Q6GH 3EJZC 2ZCKH 3QWRD 3LHPH 1MCEA 2G5RA 3KWWB 2J8UB 3WIHL 3SPVB 3TJHC 4Q9RH 2FR4B 1RHHB 3EYOB 3GMRA 4KV5F 3V5HB 3SBWC 1J12A 3ARGB 1SY6A 4JO3L 5FHBH 5FYJL 5K9OB 4ONOA 5IB1B 3FTGA 1EMTH 3BIKA 1FG9C 5D1ZD 4PP1C 1T7YA 3OKLB 4QOKE 1IAOB 4FZEL 3U0WH 4X9HA 1DSFH 3RNKA 4X6BB 1YYMH 1H0DB 2BC4B 3TPUB 3T4AB 4J4PC 1FNAA 1WAAE 1WZKA 3QUYB 4UUJB 3HMWL 2GSIA 3G6DH 4W4NA 2BNQE 2R4SL 3CAFA 5HYQB 1JNNL 1YN7A 4G8FA 4KK8C 2NYYD 4NWUL 3MCG1 1O5DT 3BD3A 2HLAA 4MYWB 5CINL 2WUCH 2M26A 4NKDA 4XC3L 5ANMA 5I8EB 5EZOL 4Y5YA 3TIEA 2F8VA 2X4PA 4MA7L 2EO9A 4WWKD 1I7ZA 3HC4L 3N1GC 1ERNA 3PG2A 5CD5D 3CDYA 1YYLH 3KYNA 3BZFA 2IAND 2OL3L 3ZLQC 3TNNA 2CGRH 1VFBA 3M07A 1BOGA 4E9LA 5DZLA 4F2MB 1WF5A 3BT2L 4P9HH 2R2BA 5DVLA 2Z8VC 3VMOA 2XPGA 4WI8A 3BRFA 4JPWH 4PRPB 3MLSH 4M6OL 2MQ3A 3EDKA 3HPLA 5D93B 3C5SA 4MB4A 2BNRE 2IADB 4G80B 1BD2D 4YC2C 2NY6D 2R29L 3FB6B 2R9HC 3MSPA 1UA6H 1KTLB 1F13A 5SWQB 2NY5C 4LCCA 4PRID 4WTWA 2NNAB 1BBDL 1Y6NR 4UV4H 3L3JA 4P3DB 3RY5A 4WV1A 3B9DA 1PSKL 3TIDA 5C0NC 4MCZB 2G5BB 4EI5C 4GLRI 3LQZB 4HWBA 4QLRA 5DJDB 1QRKA 4XVSL 4K2UH 5I16B 4CMMA 2G9HA 5FUCE 12E8L 1BVKA 4P5KB 1U93B 4NP4H 1G9MC 3EIFA 5BXFA 1G7IA 4KRPC 2H2SC 3V0AC 1OAKL 4G6AC 1CGUA 4BJLA 3T3PF 5C0AD 5E8EA 3SDAD 4J3UA 4MJIE 2I24N 2KQMA 2B2XH 2DRUA 1KEGL 1MF2L 5FM8A 3L95A 3DVNA 5TQ0H 3RTQB 3CFCH 5EU4A 3IXAB 1ES0A 4WW2A 4YNYA 5FECA 5HVHB 3WMSA 3MACL 1ZKAA 5TGBB 1JF6A 4LPCA 4E41A 3KLHD 1S78D 4NNYB 4CBPA 3V6FA 4FXGB 1JWMB 4MMXC 3V5DA 2FDBP 2E7LC 5ISZA 3H3KA 4QF1A 4L8SA 1ZANL 5B39B 4JANA 3O9WB 2CDEB 3BRDA 3HZYB 5D72L 3B43A 4GO6B 3Q5TA 1RK1B 4YHKL 2VLKA 1FL6A 5FYKL 3C08L 4Y5VC 5C0BE 4J8RA 3CDGA 4KROB 3P40A 1HKLL 1DEEB 3CLFH 1OAZH 4KKCC 4RWHA 5HSFA 2DF3A 3BPCA 4WEBL 3UP1A 3VXUA 1IEAA 3FO2B 1Q72H 2VDLL 3OJDA 4ZS6D 4F7MA 1J18A 1K8IA 3DLQR 3QDMB 3DROA 4FP8H 3FB5A 2H3NA 4HJ0D 1L9NA 2Z35B 3FQNB 2HN7A 1UACL 4BQCA 5HGGS 3HR5A 5EO9A 2ENSA 1A9BB 3W5NA 5FYJU 1RJYB 4MX7A 4MD4B 3UC0L 3T0EC 1Z9MA 3ZSTA 2CKBB 4GRMB 3HE7C 4NFDA 1DEDA 4XCYA 2ARJA 1ORSA 1J5OH 5GISL 1B90A 1QKZL 4NRXA 2PTTB 3O3UN 4PJEE 5H94A 3TH2T 1UM4H 1FZMA 4YQXL 4OFVA 5CJQH 1K5NB 1MELA 1S7RA 3PJSA 3MV7A 4NUGL 3F65A 4MVBA 4I0KA 2DJUA 3JTSA 5BRZA 1RD6A 4KI5C 2ENYA 4LDOB 1C5BH 5A2JH 3ZT7A 4HCRA 4JKKA 3P9LA 1JMZA 5DHXB 4AMKH 1PD6A 1NH6A 2MHAA 5F1NB 5C2UB 4N0CC 4P59H 3JWOL 5C0CA 1H3PL 5DO2D 1JJUA 5LGHL 2R0KH 1NLDL 3ALWA 3X11B 3UTSB 1L4IA 3TCLB 2NXYB 1MAML 1O0VA 3MRMB 3MLZL 2DS4A 4JQXC 5C70A 1R3LB 3PABA 4XTRD 1XGQB 2CJUH 4WI3A 1X7QB 3HNVL 4OLVH 3ROLB 3RZWA 3S7GA 2CLZB 3DI3B 2ZPKL 3QXAA 5IB5B 4D9QE 2MKWA 2ESVB 3MX0A 4RGNC 4J12A 2E7MA 4AT6A 5IW6A 4JB9L 4IOFC 4LGPB 1MPAL 2ZUQC 4KPHH 3MRBB 3QUMH 4HGKC 4L3EE 4NM8L 4R7DA 2AK1H 3AY4A 2VL5A 1QO3B 4NQVB 4YGVA 3KDMB 2WIIB 1GGBL 1M7XA 4IMKC 1N5AA 4J1UB 2ADJB 4Z5RA 2HJKA 1CXIA 4XMPH 4U7SA 1D5ZB 1MLBB 1G7LA 4D8PA 2OR9L 1F58H 4XNQA 5F89B 3MCLH 4F37F 1NKOA 1ZGLB 2XY2A 1A6ZA 2Z91A 3RWHB 1I9IH 3DVFA 1TFHA 2DQFB 1UYWH 2JKXA 2VXVL 2CKBL 4G7VL 4K9EL 4NRZA 3RKDC 3WS3B 4B0MM 4LLWB 3WFCH 3VXOB 4JFEE 1Q9LB 1OPGH 4X4MA 1RUPH 4YUEH 5MENE 4KJPD 5T3ZE 1BJ8A 4NQEA 1EEZA 2HVKB 3GI8H 2YWYA 5E94A 1TJGH 4ONGL 3U2SB 4P2QE 2XTJC 1TCMA 3QZWG 4I0PD 4M61A 4S1SL 4XCFL 3AMLA 1YPZE 1ZGLP 4QT5B 1ACZA 5DYOB 5T3XL 4GQPH 4MNHA 1TQCB 3F7VA 1ZSDA 3JZ7A 5F9OL 3ZT6A 4D0CB 2EIZB 3GI9L 4S1QL 5JUEL 3BGAA 3B6SB 5I73C 3MODL 2YMXH 4HC1A 4OLZL 1JPSH 3X13A 2EYTA 4AH2B 3OZ9H 2CRYA 3B8YA 3BEVB 1HI6B 2VXUL 3WIFB 2A74B 1MWAH 5KS9B 5FYKU 1PKQA 5DK0B 4D9LL 2UZIH 4NQCA 3TZVB 5C0IA 2GIYA 4BK4A 4M93C 5D1QB 2VLRA 1R24A 4MA1B 1EFXA 3D48R 4TSCL 3GMPB 3N50A 3FB8B 1QFUL 3UEZA 2A2QT 3T2OA 4R97C 1PW3A 3BGFB 4DGVH 1T89C 1DQDH 4GUPB 3ARFB 3KPSB 4I3SL 3QG7H 5KSVA 4KK8D 4Z7WF 2VXQH 3LRHA 2IF7A 3BP5A 3SY0B 4P23C 3T65A 4M6MH 1NFDE 4W70A 4AIXA 5I18H 4EN3A 2X41A 3K4AA 1NC2D 3QEQB 5FHAH 1MREL 3BPOC 1LDSA 3MJ9L 3U82B 1HSBA 4JGJA 1ADQA 4YZFF 2A73A 1E4XH 2AERT 2GYSA 5DJAA 4U3HA 1WTLA 3I2CH 1UH4A 1QR1A 4I4WB 4PS4L 1G9NC 1R5WA 9CGTA 4RZCA 1DUYB 2NW3A 1JI2A 2EXWD 2PYFB 4XB7A 5DRXA 2EDOA 3VFNB 2C7UB 4QTIH 3FQXB 5TH2B 2P4AB 2E6PA 3STZA 3ZE1F 3KYMB 1QG3A 2CK0H 5I8KL 4GOSA 4RGMC 5T1LD 1IKNA 2FIRT 1NDMA 4HEME 3NA9H 4NKOA 1AXTL 3SDXF 4YPGA 1QSFB 3UO1L 1FH5H 4NZRL 4HIHB 2VLJB 3QT2A 1P4IH 4YX2H 4GMTL 1IGFH 2I60L 4HUNB 3BE1H 4PJXE 5I19H 3DWTA 5IG7B 4YBHA 4JFXB 2CH8A 4DAGL 5KN5A 2X42A 1RU9L 1MFEH 1B6UA 3AB0C 4XH2B 1U3JA 4NHCL 5EO0A 1ZLVH 1KB5A 1KN4L 1LK2B 4NQDE 4Q6YA 3LEXB 2JCCF 1CFQB 3DX9A 2H2SD 5D70H 5BMFL 1CD1A 1D5BA 1CLOL 4ZFZB 2DQUH 1S7VA 4KK6D 1A7OL 2Y9RT 1LWRA 4Z0XB 5D7JC 4NZDA 5C6PB 5DJ6B 1AO7B 4UAOB 1CICA 3MOAL 4OM0L 4HG4J 1FYTB 4S11A 3MLUH 3REWA 1XGRA 5D7LE 1M7DB 5I1DA 4U6XA 5A1AA 5IJKC 5EA0L 4M48L 3IVKB 1LP9B 3BHBA 4X8XA 3UJIH 2CR3A 1LO2L 4V2BA 4D3CL 2VDML 1J1OH 5HYIA 4OKDA 2Q8AH 4E0RB 3L5XL 3R06B 4WFEE 4GKOA 4XNMB 4GG8B 4U1IB 4WFFE 3U4AA 1YQ2A 3PGCB 3IDJA 5IGXH 5L8JB 1HDMB 1ED3B 3K8KA 3MRCB 1NGYA 3RIFK 4LIQE 4Y4HA 5CZVL 1J8HD 8FABB 3BZEB 1H8NA 3L6FB 1RIVH 35C8L 3X12B 4KMTL 1QBBA 1TDQA 3MRRA 1V7NH 4L9DA 4JR9L 5DURD 3UBXG 1AP2A 5E5MB 4JFYB 4GT7A 5I74B 1DVFC 3CCHA 1FNLA 1M05B 4QRRA 2OTUB 4KKCD 3F58H 1D5MA 3OJMB 4KAQL 4K94H 1ROWA 3AMKA 3TWCL 3L3OB 1PVHA 2F53E 3EW3B 3L3DA 4Z0BH 1LVEA 1P7QB 5B38G 4JRXE 3VFTA 5J0BA 5F21B 3WDHA 1I9EA 4CMHB 1S7QA 2PXYA 3FRUB 1BVLB 5GRXG 3LEVL 4YHZL 4O4YL 2R39A 1KFAL 4CU7A 5GJTL 4PJIE 2WBJA 3CX5K 3SDYL 3DXAE 5GGQL 3S4SA 2NY1D 1JGEB 5HVFB 4I3RH 3HE7D 4CJ1A 4PJAF 4MJIB 1YMMD 4JPVL 1UZ8B 2BVPB 4JZJA 3GMNB 3QIUB 5CUSH 5JW4N 2EEBA 2ZSVB 4F7TB 5HHQA 5IMLB 1Q94A 1J1XL 4HBCL 2EKJA 3E6HB 4L4VE 5IVZB 3O2WL 3WN5B 1U8IA 2ZNWA 4X4XB 1YUHB 4MAYD 4WEMB 4BFEA 5CP3A 1H15B 3WXWL 4U2YA 3ZKND 3BO8B 3I9GH 3FO9B 5D71H 3GDBA 2F74A 2XN9B 1I7UB 1CBVH 5FCUL 4JFHD 2FECI 1ORQA 3CPLA 3S36X 4U1GC 1J0KA 1IBGL 2GAZB 5GS1A 2J5LB 3UBXI 3OJVC 1L6XA 2N1KA 3MUJA 2NPLX 4Q74A 2CMRL 3QHFL 4F3FA 1MJUL 2VXTH 5MEQA 1D9KA 5EU7E 1QA9A 3RQ3A 1CLCA 4MJ5A 2YPVL 4J3VA 1OCWH 1AGFA 3LDBB 4HAFA 5ETUA 5E9DE 4QNPF 1FIGH 2BOCB 1P4BL 4URTB 3DNKA 1RSFA 4RGND 1J05B 5EUKA 4U1HA 1OAXH 5CGYD 2VDNL 4PYHA 5C08E 3VI3F 4MNGA 4OM1H 4YBLC 3ZL4H 5BS0E 3RU8H 1NCCH 4S10A 3HR6A 1I3VA 5EIQA 1MFDL 3O11A 2X09A 4DZBA 3GM8A 1MCKA 1J11A 1VFAA 3C9NA 1A6WL 2IALA 3LKNA 2YN5A 1BJMA 4N9GB 3OXSA 1OY3B 3QCVH 2IQAB 1KULA 1BF2A 4ZTOL 4XXCC 3S88L 5B4MD 3RKDD 4W68A 2LTQC 1Q1JL 5F7FA 1PDKA 1NCUA 2QQKL 3E0GA 4N5UA 2V5MA 4Y8AA 4ZXBA 3BDYH 3ZYIA 5KVEH 4ZPTA 3TT3H 5CZXD 4N8CH 4D0BA 2UZYB 5C0JB 1FE8H 2F54D 4LVOB 1A14L 1CFVL 1VACA 3W0WA 3IFPA 1BFVL 1EJ6A 1TTGA 4IOIB 5FDWB 2HH0L 1EVUA 4MSWA 1UEMA 3SOBL 2R69L 4NC1C 5GS0L 1WZ1L 2DQHL 3VG0H 1VSCA 4MXQC 2HMID 5GS3A 3H9SD 3O4LE 2FRGP 4LMQE 4LK4A 5ANMB 1DBKL 2Q86A 2X4PB 4Y16C 1T1XB 3OSKA 1KJVA 3QA3B 3G5YA 3KYNB 1XZ0A 5IESL 1RPQA 2AJ3A 4Y2DA 3U0PA 4L3EB 1JRHI 3OHXA 5EFIB 3VG9C 4U1JB 4M00A 1BOGB 1PLGL 2YWZA 3U9UB 2R2BB 3C5ZC 5D2NB 2P43B 3WNNA 3GSWA 1I1RA 1KLUA 4PJCE 5HJ3B 3WLWC 4BQBA 2AI0L 2DBLL 2JIXA 1XFPA 3I6KB 3ARZA 4P23D 3Q6FA 3BKJH 1JNHA 2P48B 1AHWA 4UB0H 1FAIL 4HS8L 5AZEL 1CDYA 2R4RL 4NO2A 1YEEL 4NHUB 4P2RE 5H2BA 3LN4A 3KHOA 1IKFH 1U0QA 2AV7A 3ESVF 1HYSD 3TIDB 3VFSB 5GSVB 5DJZA 4JO2H 4FZ8H 4HJJL 4JM2A 1JZ8A 5E08L 4AK1A 4K3HA 2BSTA 2AABH 1MRFH 1DFBH 2OI9A 1G7IB 4P2QB 5J8OA 5DMIH 4HZLB 3PGFH 1I9JL 1NJ9A 5HDLA 5SWSB 1PAMA 5L2KD 1JE6A 4C59B 1JRHH 1P1ZA 2R1YA 3PXJA 3ARPA 5AYQA 5HYJB 4Y4KA 5DSCB 4FFVC 5IM7B 2AJZA 3ULUD 1S7XB 4DZ8B 3LIZL 4ZS7H 4U6TA 4FQJL 2MCPL 3VGEA 4U1SA 4X7CC 2Q7YA 5C0DA 3MYJB 1DBJL 2W65B 3VXSD 5IVXB 3WXVL 4NO0D 3WDIA 1I8KA 1VPOH 4EXPX 1KTDA 1W72H 2VB5A 3R4DA 1FO0H 1T1YA 1HINH 3GO1H 4HUXA 5FKAA 4XX1G 1OTTC 5L8KB 1K4CA 4XGZB 4L8SB 4M5YL 1LNUB 1EHLH 4JY4B 1S9VA 1VFMA 3ARDB 3CUPB 4GXVH 4YDKH 5CBAA 4F9LC 2IAMC 3DHMA 1LE9B 1PJ9A 5KSAA 2VLKB 3LKQB 4Y4FB 1CXFA 2A9MH 3NIDE 4L29A 1FORL 5FUOH 1B4JH 3EYUL 1U8JA 3VXRA 3K2UL 4M5ZH 3W11C 1ZT4B 2HJFB 3IDGB 5AUMA 2EXYD 4OV5A 1FNSL 1I1AC 1IEAB 3EZ8A 5L6YH 3PDDA 1KC5H 2DM4A 3Q3GA 3PDOB 3OJDB 5H8DA 3QUYD 4HUUA 4P2OC 4GJTB 1GH7A 4U1KB 4AEHL 4DVRH 1G7QA 5JDSB 2Q6WA 3D2UB 2E7LE 3MLVL 4YDLC 3TFKD 4FQXD 4CVXA 5JW4R 4QOKA 1L7TH 3HR5B 3N1MC 1FG2A 5T3ZL 1FNGB 2J2ZA 2VDQH 2DQIL 3N1QC 4YWGH 4UILL 5EG6C 4Z78A 1WAAA 3MXVL 3R0NA 2R2EB 5HYSG 4FQHB 2BNQA 1YY9C 1ORSB 1UJ3C 3KJ6H 1QLEH 1JPGA 1YEFL 3L5IA 1FZMB 2RR3A 3O3EA 2W91A 3WFBH 1CFSA 4D0DA 2J8UF 2IG2H 2WZPD 2OMBA 4G8GA 3RWFA 4PLJC 3VA6A 2YZ1A 2NXZC 4JEGB 4JFQB 4HUWB 3FT3A 5JIPA 3HZMB 5I76A 3DTXA 2P7TB 2QQLL 3VXNB 1OTUD 2P5WB 4JY5L 1B3JA 3LKPA 1SEQL 4LSUL 3CVHB 5AWNL 4N0UB 5HHNA 4P4KB 4PUBL 1U8LA 1QFHA 3LRGA 1X4YA 1XGUA 1DUZB 3VD4A 1T5WA 2VDRH 1INDH 1DLHA 1YEIH 3T0EE 4EDWL 2PTVA 5JXEC 4NOBA 5HHMA 4OZHE 5DHVB 3PABB 4GRWH 2YR3A 3RY4A 3QUZA 1MLCB 3QIBD 3LMJL 4YIQA 5D7LB 4OZGA 1OAUH 3J7HA 4PRHE 1WIPA 1AR2A 4ZO8A 5A40E 4JM4L 1N2RB 3MR9A 1MJ8H 3N0PB 1AR1C 2Z8RA 1B4RA 3V4VL 3OMZA 2JJTC 3C6LA 4R7DB 4EBQH 4UIKL 5IW1A 4FXKB 1ZTXL 1ACYL 4KVCL 2BRRH 1OAQH 4J3XA 2J6EA 3V7AE 3SJVD 5K9JH 3GBNH 4XNQB 1AGCA 3QI9D 3P0GB 5JW3H 3E2HB 1QSEE 4IRSA 1IE5A 2DQDL 3QDHA 4L9LA 4WW1A 3MBEB 4M7LL 4ZAKD 1VHPA 4NJAL 5JOPD 4OF5A 5HDQL 1CE6A 3KJ4B 2DD8H 5BW7A 2FZ3A 4AEFA 5D7SL 3WEXB 1IL1A 4M7KH 2FIKB 4ZD3H 1YJDH 4PJ8C 4JRXB 3N1FC 2DAVA 3O6FA 4NQEB 1EEZB 3EYVB 4C56B 1RZJL 1ZS8A 3D18A 4GKSB 4JN1L 5GGVH 2DJSA 4WVRA 3E6FA 4OI9A 3ZKSD 1A7PH 3MREA 4MS8A 5DEGA 3V6OE 5TDPB 5DUPH 1I3GL 4QHMA 1FFPB 3QG6B 4Z7NE 3EDJA 4MNHB 3R1GL 1IQDB 3TBYA 3CVHL 1LO0H 5C0BA 3CFEB 4U6HB 5C0RL 3FQUB 4GH7B 3G9VA 4X6DE 4G8IB 4EVNA 4WUUA 2JK5A 3SGDI 1NCBH 3X13B 2EYTB 4FQCH 3OGCB 1XIWA 1A6TA 4MXWH 4J23A 2XRAH 1PKQB 4LSVH 4QXUH 1GGCL 3IDNA 4APQA 2V17H 4HGMA 2GJ6A 1R3IH 1RFDH 2VLRB 2NY4D 1JK8B 3QO0B 5E7BA 2HKFL 2XTJE 5DFWH 5IHLB 3MLWL 4LSSL 1E0OB 2D31A 3VWKD 2GI7A 2C1OA 4PJ9C 1TZHB 4GAJL 5ALCL 4GSDL 1IC7L 3OB0K 4FFZL 3FO1A 2LU3A 4RAUB 2XA3A 3QHZH 4MXQD 1H8OA 2DYPB 3BIAX 2Z31C 3EBAA 3SDCA 4M1DL 5B8CB 2FX7H 1C08A 1NEZB 1MVUA 3FO0H 1XGPB 2XQBL 4WEUD 3BKYH 25C8H 2L7JA 1NC4B 2EDTA 3BP5B 5DR5L 4PJEA 4JE4B 3UJTH 3GJEA 3B9KC 4C4KT 2VSDA 4GQ9L 1FBIL 1R3KB 1S3KH 3VD5A 3HRPA 1MJ7H 1MCJA 2C3HA 5C08B 3ZO0A 3SGDH 2A73B 2H2PD 2APXA 2D7QA 3BH9B 1CF8L 4JLRA 5DJAB 4MNQD 3FT2B 5D2LE 4FOMA 3HC3L 4R7NA 2EECA 2OTWA 3MNVB 1REIA 4XBEH 4ODBD 3C5ZD 2VXSL 1HQRB 5DRXB 1ZA3A 3OG6B 2D0FA 3MRLA 3WLWD 3B83A 4HUVA 5EZLA 3VRJA 3RA7L 3WNOA 3FOMA 5F6IB 4R6UA 3VCLA 2Z92B 5JOEA 3D0LB 4HWEH 2PTUA 3PQYE 2DB8A 3TO4D 4CDHA 4KGLA 1NDMB 1A6AA 2O5XH 5IB3A 4CVZA 1I7TA 2OX5A 4W4OA 4YHMH 1H5BC 4XVTH 2DWEA 1TJHH 2DI8A 4WO4C 2FGZA 1FZOB 2XYCA 3VI4F 3RWGA 4HFUL 3GMOA 1E27B 2A6JA 1EZVY 4IIQC 3S37X 4K8RC 4Y89A 3ARSA 1B2WH 3D3VD 1OGAA 4Y5XC 1C1EH 3DVGB 1AGDA 2A77H 1CD1B 2EYSA 4Q9CA 3D6GA 3CXHK 4HSQA 1ZV5A 3OGOE 3MO1B 1HIMH 3AFLA 3MQIA 3SGKC 4OGAD 2VR4A 3IB4A 3K1DA 4XPAH 4KZDH 3ARQA 4FFVD 1XGRB 4X80H 2ZZUT 5HGHA 5I1DB 1CTOA 1XR8B 2F19L 1MHEB 3BHBB 5J89A 3S34L 3RWCA 1XF2A 4UQ3B 2HKHH 2GFBA 5EU3A 1CLYH 4JFEA 1M7IB 3DBXA 3NCJL 4Z9KB 4R0LA 5MENA 1I1YA 4HUKB 1G7PB 5F9WC 2FEDD 4GW1B 5IFJB 3DETD 2X05A 2HT2C 1EK3A 2X4TB 2XA8H 1NGYB 1N0XH 4Z6AT 3WD5L 1YPZA 3PDGA 4NN5C 4R26L 4JFDB 1AXSB 1ZK9A 3Q48A 4N8VB 4XCEB 1DQJB 2Y07L 4QHLA 4X5XB 1TVHA 4XRCB 1IAKA 1OD7A 1XF1A 3IDMB 5HGAA 1WIUA 1AP2B 4HIXH 4X9BA 4Y5YC 2D7OA 4DGYL 4XWOD 1NMBL 1II4E 1RAMA 3DGGA 1CI5A 3OAUL 2D7NA 1KCLA 1I1AD 4P57B 2HJLB 3HTLX 3QR2A 1IM3A 1D6VL 4KJWD 5EBWA 4Y1AB 4R2GB 2B39A 5C7XH 3QWRA 3KLAA 3BAEL 3BVNA 4P2OD 4JO4L 5GRJL 3B9EA 2LVCA 3PWJA 1KCVH 5FA3A 4PY7A 1F4YH 3H9HA 3ARFD 2VDKL 2PXYB 3V4PH 4PLKC 2BY1A 5HDBF 1M71A 3IS1X 3PXHA 4XNYH 5DJXB 2WBJB 4Q6IC 1C16B 2F5AL 2ZCHL 3EO9H 4H0GA 4XNUH 5D1XA 1RZGB 4OTXH 3VMPA 3VXPA 1KJ2H 4NZTL 4XCCH 2P47B 4KZEL 5DFTA 5L7XH 4LVHC 3LS5L 2X9XA 3OG4B 5K9QG 3B2VL 1FNFA 3E8UH 4NN7B 4OCXL 4HIEA 1BJ1H 1VFUA 4PY8J 1OB1B 3WBDA 4N0RA 4PD4J 4FXLA 3OQ3B 4OCYL 3AM8A 3QDJE 5SWZD 5TDNA 5KS9F 4U1LA 4PLJD 4LSQL 5F1OB 2VMFA 3QWOB 5KVMC 4PB9L 3Q2CA 5IB4A 2OK0L 4NT6B 1XMWA 5B38A 4X8JB 1XGYH 4POZC 1A3RH 1G7JA 5CIPA 3MV9E 3ZE2E 3TA3C 2WUBH 3GJFA 4K7PY 3VFWB 2R0LL 4L8BA 5JNYA 2R0ZH 4M9PA 5JXED 4RDQF 5JDJA 5IHZA 5MEQB 1D9KB 3MTRA 3S98A 4FABH 1Y0LA 1G7MA 2Y4SA 5ETUB 4HK0B 1BD2A 2GT9A 4CN6A 3QEUA 4O9HH 4U7MA 4PJXA 1DBAL 1T6VN 4OGXL 4PRIA 3S35L 3GK8L 4LFHD 4KK5C 4WWID 3IF1A 3BH8A 4IRZL 5E6IC 4X0KB 4EOWH 3IFNH 1FGVL 4NQSB 1EGJA 4J3OC 2HFFA 1U2HA 3RWJB 3RVVD 1BZQK 4F15B 1WIOA 4S0UC 2NLJB 1OARL 5ESVB 3QYCA 3U0TB 5K9QI 2XTLA 3QDAA 4EDXB 4F37K 1RZIB 3ULVL 4RIRA 4OD2A 4F8TA 4GBXA 5JPNA 3SDAA 3MRKA 1FVEB 4AENB 3GSOA 2WAHA 3WFEL 4OFKA 5GS2D 3HI1A 4A6YA 1DBMH 4LPWA 5F9AC 3CD4A 2ZCKL 3LY6A 1CGTA 4FQIH 4PJ8D 4M8VA 1A02N 4Q9RL 2JJVA 1F6FB 2AQ1A 3VA2C 3OKKB 5CGMA 2FO4B 1NGWA 5KG9A 3EKCA 3V52H 3T1FA 1MRDH 4M7LT 1JV5A 5FHBL 5ITFB 4YO0A 3PWNB 1EMTL 1U92B 3GRWH 1KIRB 5AZ2H 1NDGB 2X7LA 4DUWA 4KV5E 4HS3A 3WIHH 3U0WL 3FFCB 4QWWC 1DSFL 5HGBA 4ELKB 1YYML 3KPMA 3BYTA 5FCSH 1A6PA 4C57C 4NZUL 1T7VA 4OF8A 3X3FH 5C09B 5GRVL 5CEYA 5J11B 3O2DH 3OR7B 1F02I 2F53A 1LP9F 5F1SA 3VGAC 4DGIL 4FZEH 1X5YA 4JJHA 4DEPC 3MOQA 2Q86B 1MFAH 2WUCL 1U8OB 1IC5H 3CJJA 1J88A 2UYLB 3QDGE 4N0YH 3OKNA 2C3GA 4PJ9D 3BZDA 1YYLL 3U0PB 1SYVA 2R4SH 3OL2A 4PJIA 2CQVA 3OHXB 2A6KB 5I6XC 3JWDC 4LF3B 2PO6A 4U1MB 3DXAA 4QHUA 4LVNB 2CGRL 5GRYA 5DVMA 2Z31D 3AREC 5EZOH 4LEOB 4P9HL 4MA7H 1PG7W 3GSWB 4ZO9A 4ZNCD 4LGRB 3KPQB 2DKMA 3HC4H 2EDXA 3MGTA 1JZ4A 1JNHB 2P5EE 3UPAA 3UPRA 2HP4A 1CGXA 1UA6L 4OJFH 2B1HH 1CQYA 5H2BB 3SE8H 1XGTB 1JHLH 1OGTA 4L5FL 5DVOA 3PWLB 4XZUA 3ULUH 5JPMA 3C60A 3TN0B 1NCAH 2BK8A 4I5BA 4JM2B 4KHTH 1U3ZA 1MCBA 2Q76B 3FQTB 1XCQB 1WCBA 3BW9B 3MLTA 3KXFE 1JYXA 1IC4L 4JZNA 4NP4L 3QNXB 3TO2B 1GC1H 5J6HA 2HFTA 1BBDH 1P2CA 2A9NH 4S0SD 4X5WA 1NJ9B 2W0KA 4DKDC 5HHPA 4DJMA 4LRNL 1KPVA 1A1MA 2XKNA 2R1YB 5F7UA 2B2XL 4NO5A 4Y4KB 5CSZA 5E9DA 2MFNA 3EOYG 4BUGA 4HH9A 2W38A 3CFCL 4U1SB 3TP4A 4HGWB 1OAKH 2Q7YB 5B21A 1A0QH 5CJ5A 4G8EA 5BS0A 4LCWD 1LK3H 4PTUB 2YC1A 1I8KB 4JDZA 2V6HA 1KJMB 1KTDB 4HULB 1AIFA 2YPLD 3WLBA 5EORH 1BZ9B 5FXCH 3G5ZB 1QLFA 1KXQE 5IKCA 1G0XA 3U1SL 2W9EL 1GVIA 1NBZB 1T5XA 3HS0B 1HHKA 4ZYKB 4MJ6A 4KKBC 5IMOB 4LPUA 5SV4A 2OLDA 5J57B 1SYSB 3O41B 1IJ9A 3MUZ1 3VXMB 4L29B 4YK4C 3ETBF 4YJZL 5DHYB 1U8JB 3GM0A 3UTZB 5TE6H 1BEYH 3DUUB 4H88L 5AAMA 1T21A 2WP3O 5F9DC 2ZOKB 4HUMB 4G9DB 1HWGB 1WK0A 4HFWA 3QUMB 3S35X 4KY1H 3QPQC 2RCSH 4RFOH 4KDTC 4GAFB 1IVLA 1NBQA 1Q72L 5E8OB 1EEYA 2ZUXA 1JPTH 4GXUN 3PHOA 5KSBB 1U8QB 5GGRY 2D0GA 3O6MH 1YEDA 4LASH 2OM5A 4JAMA 4WEBH 3IFOB 1N6UA 5I1JH 1FG2B 2EDQA 5C0AE 1TTFA 3EYQC 4GAGH 4XI5C 1NEUA 3U46A 3ARGC 3BIBX 4Z78B 1E4KA 3CZFB 1IM9A 1FSKB 4G59A 2ICEB 3G6AA 2BVOA 5FO7A 3MFFA 2XFXB 1J5OL 1A5FH 1UACH 3O4LA 5KZCD 3AS2A 1EXUB 5FYLD 3HC0A 3PV6B 5CS7A 1ZHLA 1RUAH 4D0DB 1UM4L 3TJHA 3JTTA 3QUKA 4G8GB 1HK6A 2HT4D 5CJQL 5EBGA 3SBWA 4X7FC 1CL7H 3PNWA 5EUOE 4ELMA 1FL3A 5DUBB 4BZ1L 1EUUA 2E7CA 1KIPA 2FYYB 3FOLA 5KSUA 1C5BL 3GHEH 5DFVC 3C87A 4AMKL 3L3HA 1MCNA 5F44A 3C09B 3AC0A 1TJIH 4P59L 3QRFM 1G7HB 5I71B 1HHIA 4JJ5A 3U7WH 4OLYH 1DE4B 1U8LB 4Y19E 4RMTA 1CQKA 1S7SA 2V2WA 4J4PA 4PJCA 2FH8A 4ZUVA 4L4TB 4HH8A 1W0WA 2DLEA 3BEWB 1CD0A 1MWAB 3QUZB 4X6CA 4X83A 1CK0L 5HYSA 4YAQA 1ZWIA 2I25N 4OZGB 5J06A 2BMKB 3OKEA 2C26A 4P2RA 4HQQH 4FHBD 1QQDB 3GHBH 4UDUA 5FOJA 2APVA 4LLUA 4MDJB 1HHHA 2BSSB 4NM4L 3MR9B 2FEEI 1A1OA 3SEPA 1J8KA 1F3JA 4KPHL 1MQ8A 3QUML 1MCFA 2AK1L 4LLAA 3RY6C 2VL4A 4JRYB 3QFJE 4RX4A 1EUTA 4E41D 4XMPL 2YD6A 3CU7A 4LRIC 4QHNA 1F58L 1U95A 5T1LA 2EDRA 3MCLL 4IRSB 1KT2A 4HWZA 4L9LB 2JB5L 5DQJA 5ISZD 1I9IL 1KCSH 3F5WB 3LOWA 3DECA 1T0PB 3F6IA 1UYWL 3IU3B 5F7DA 1QLRA 2PYEE 2VLKD 2YEZA 3QHTC 3K80A 4PJDB