2CLZA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct Orientation of the Alloreactive Monoclonal Cd8 T Cell Activation Program by Three Different Peptide/Mhc Complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 278
sequence length 278
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2clzA01
2D9CA 2JB6B 1U8JB 4Z0BH 4FQ2H 1A14L 4HUXB 4JFFD 3GDBA 1WWBX 3MV11 3RL2B 3W9DA 2E27L 2AKRA 1W8NA 4X6BB 4ETQB 1P7KA 1R5WA 1P7QD 4M62H 4X7SL 2H1PH 1UH2A 4YPGA 3C9NA 1M7DB 2XICA 2FBJL 5D71H 3R8BB 4EDXB 5AAWA 1PX3A 4JO3H 3LIZH 2I25N 1U8PA 4FQXC 5EH1A 1YDPA 4RFOL 2DQHH 2A83B 1SMOA 5ISZE 5JW3H 1RJLA 3HUJF 5GGSB 1I7RA 1G7MA 2FJHB 2HRPH 2F54A 3MLWL 4EJ1C 1REIA 1P1ZA 5EUKA 1KN2L 1DJSA 3PL6A 4XPFH 1YMMB 1E6JH 4P9HH 1JJUA 1Q1JH 4NJAL 1EGJH 1ADQH 3CFDB 3VRIB 2DM4A 3FQXA 1D6VL 3NA9H 3TPUB 1MIMH 1MCBA 4X4ME 3B9KD 4ODWB 5I15L 2VZUA 4PUBH 4I48A 4FP8L 2I07A 3STZB 1A5FL 3BOVA 1KCSH 5DRWB 1ND0B 5IB4A 4JN1H 5D4QA 3K7UA 4NUJA 3MRCB 4YO0A 1I8KB 5F97E 5C0ND 4P59L 2GSIA 1NGXA 5EFIB 4N9GB 3KYNB 2ID5A 1R3KA 4GBXA 4OUUA 2MPAL 4ZAKD 1YQVH 4DZBA 4PB0L 3QUXD 4Q6IC 3GMRA 4R26H 4YGVA 3HMXA 2VXSH 5DJ0B 3T0BA 2EDJA 3WLBA 1BJ1H 3T0DA 3KWWB 3S4SA 5ADPH 3QP3A 2R1XA 3F7YB 3ZYOA 1P53A 5JOPE 2J6EH 4AT6A 4H0GA 1XAUA 5AZ2H 2IEPA 2BK8A 5K9OB 1H5BA 4KK9D 4KROC 5MHSE 4HWBA 5IFJB 4Y4HC 1VB9A 1CFSB 3L5XL 3MRBB 3MLPA 2E6JA 2BOCA 3LQAC 2NW3A 2ZUWA 3O41A 3FCTB 3BRGC 3IDYB 3HNVH 2Q8AH 2O5XH 5FGCE 1N6QL 4MQ7B 1QRKA 1QRNE 3HAEG 3JXAA 1MFCH 5JHDE 2OQJB 4NO0D 5IWLA 4HSQA 4HCRL 3QAZC 5JW4M 4HS6A 2IALA 1T1XB 2CUHA 5HYQA 1VFBB 3A67H 2DF3A 3CK0H 1GGBH 3CNKA 2ITCB 1CFVH 4CL7A 1T2QL 4LLMA 3MXWH 3LSOA 1MEXL 2FJFB 3ROLA 3B6SB 4FFZL 3BSZL 5C09A 1MRFL 3MRNB 3WIHL 1WAAA 1DUYB 2BVEA 4YXKL 2O5YL 5ILTL 3MRRB 5IVXB 1ZHLA 1BWWA 4JG1L 5IW3A 2ICEB 5EO1B 3QO0B 1QHOA 4NQVA 2NX5E 3CSGA 4G8GA 3RAJL 4ORGB 1MJ8L 4Z7VA 4L8SC 1Z3GL 4R3SA 4JHWH 4R0LA 4MZ2A 3PDOA 4BFGA 3CPLA 3L3JA 3OG4B 5C7XL 4HQQL 5MEOA 2VDOH 3CAFA 2AJUL 3OKEA 4JO1H 3S3SA 4WY7L 5J7CC 2C1PB 4L9LB 3VFOA 3P73A 1K5NA 4HKBA 3TCLA 4DGIL 1NJ9B 1EO8L 5BMFH 3DX6B 1LWRA 4QRPA 3TBTA 3WIIL 4XMKL 1NSNH 4FFVD 3GBLA 1QBMH 3RKDD 1AHWA 3OF6D 3MRDB 1A1NB 1UM5L 2X70B 2ADJB 2VLKA 4Z76A 1IAIM 3K8KA 1X5YA 3QULB 3I50L 4HH8A 4QHUA 4PJHB 3HMXH 2UWEE 1ETZB 3GJFB 4QXUH 4X0KB 4Z77B 3SDYH 3RUGB 1NEUA 1U8QA 4KUZL 1FL6B 2VABA 3O4LD 3BKMH 1F4YL 1UB5B 4JLRA 1J5OH 5GZOC 4NZRL 1AD0B 4NFBA 5F9DC 1KTLB 4M43H 1U3HD 5IB2B 5H94A 1HHHA 3SE4C 5DRXA 1DANT 3FOMA 1OAKH 2V7NB 1U8IB 4NO3A 1AJ7L 1JF1A 3GK8L 4U1NA 4QRSA 2M8XA 2JCCA 2ZOLB 3PDGA 5IBTL 3U48A 4EDWH 4G5ZL 5K59F 1TQBB 2DQUH 4XAWL 4KXZI 4XVTL 4BH8A 2J3SA 3TO4B 1QSEE 1K4CB 1G9EA 1NL0H 4CN1A 4P3CL 4LPVA 4Q0XH 2D0HA 1NBZB 2XZCL 4TVPL 2ESVD 4I0KA 1WC7B 2NY0D 3KPRB 1OTSC 3QZWB 1HHIB 3LN9A 2VXUH 2EYRA 1HXMA 2Z8WC 4NCC2 5IIEB 5B39B 3BZEB 2EXWD 1JF5A 3WN5B 1NGPH 5ALBH 4GO6B 3C5ZD 3QYCA 3LMJL 1T1YB 1NC2D 3ECBA 2AXGB 5GGSY 2VLJD 5BO1L 3VXUA 4X8JB 3BWAA 4OCXL 4N5ED 1IEAB 3LKQA 4IHOA 5JQ6H 2OZ4H 4RGOH 3UYRH 1EVUA 4U7MA 5C71A 3IDGA 3MTRA 1PG7X 1UM6H 2EDDA 3FTGB 3TJEH 1U58A 3DRTA 3FO0H 5KBNC 2YD9A 1RJYA 3CSBA 4Y5XC 4LDEB 2VLRB 2FYYB 2P45B 2BNQD 4O5LL 5ESQA 2NY3B 1CFNA 2DI7A 3L3OB 4P46D 2Y4SA 5JHLL 2X7LA 1AI1L 4LSPL 2WLYA 43C9B 5JA8B 2IJ0C 4HJGB 1T7XA 1OP9A 1MPAL 2H3NB 3LN5A 3ARGC 3G08B 2AW2A 3RZCC 1YY9D 5C0IB 1VGEL 2YC1A 4NHUB 3DRQB 4Y2DD 5D7LD 3SDXA 3IFLL 4ENED 3FJTA 4YR6B 3SQBA 5C0CD 1KTDB 2NY6D 1DDHB 4FQ2L 4WI4A 5HVHC 5IQ9A 5BS0A 2YBRB 1OD9A 4XPTH 3PWVA 3NZ8B 1RZFH 3BQUC 1T1ZA 1QR4A 1PSKH 1C5BL 4MJ5B 4LSUH 4F7EB 4ZMAT 2H1PL 2FGZA 2A77L 5GS0H 1J0IA 3PWJA 4FNLL 1SJHB 5D71L 4JO3L 3LIZL 4MJID 3OKOA 4U1IB 4TSCH 2DLIA 2DQHL 3MO1B 1LEIA 5JW3L 3DYOA 3OL2A 3VXRD 4HT1H 4PV9A 5JR1H 3IT8D 1A6TA 1QP1A 2HRPL 5DA4A 3L6FB 1MHPH 1Z9OA 1YNKL 4XPFL 3MNWB 1E6JL 3GSRB 1Q1JL 1FFRA 5AUMB 1EGJL 5SWQB 4UUJB 3HE6C 4MJ6A 4Y5YC 4PGCB 4MLIA 1BZ7A 2PETA 1S9WA 1BZ9B 3NA9L 3H3PH 3LZFH 1MIML 2XG5A 4A2MA 3HZYB 2F74A 4ZFOA 4I0CC 4CADA 5GGRA 3KS0J 4PUBL 3EGSB 5HI5D 3B2VH 3F7QA 1DQLH 4PJFF 3REVB 3Q2CA 3IAGC 2Q76A 3BVNB 2GCYA 5IW1A 4U6VH 4JN1L 5HGDB 5MEPB 2DM2A 3NCBB 5C0JA 5FDWA 4X6DE 5I1AB 1UXWA 2P5WD 4GRLD 1YQVL 2YXFA 3QWQB 3NCYS 4GW4B 3RTQC 4ZFGL 3FB8B 4J3SA 4ZD3L 4R26L 4L5FH 2H41A 2VXSL 5SWSD 5ACMA 4G6JL 4OD3H 4OT1H 1SYVA 2EYTA 4QHLA 3T8XA 3P4OA 4KY1H 4MXQD 3D0VA 4Z18A 3TFKD 3V0WH 3DBXB 4KV5F 8FABB 1TFHA 4Y5VC 1J1OH 5AZ2L 3S4SG 4E41B 4MXVF 4ZUTA 3BJLA 1DVFB 4OZIE 4HMDA 4H26B 4XMPH 3RGVD 1ZLUK 3DUSB 3D25B 1BD2D 4WJ5B 4MNGA 2X42A 2ZP0T 3HNVL 2O5XL 1BBJB 3MRFB 3O6MH 1L9NA 1TJHH 3R1GH 1MFCL 3O9WA 4P2QE 1KEMH 1X3DA 1U8HB 5JXEC 3IDJA 3FB5A 2V5RA 4NQDE 1Y0LB 5CD3A 2X5PA 1RV6X 3A67L 1A1OB 3CK0L 1GGBL 4MS8C 4DEPB 4M7LT 3S9DB 4BSVA 3BW9A 4NHCH 3VWJD 3U9UB 3V5KB 3DMMC 3RIFK 1JYVA 3NA4A 3CFCH 5DEFB 5I8EB 3T0EA 2OTWB 3V6ZA 1N8ZB 2QADB 4NN7B 4M6NH 4JRYE 1KPUB 4LSRH 4DCQB 3KR3H 2BVOB 3WIFB 2R2CA 1HHGB 4PP2B 1QO3A 4U1MA 2H26A 1F11A 2HFEB 3QT2A 3CSYA 1WWAX 2NZ9D 3N1PC 4NSKB 4JHWL 1DP0A 1JZ5A 3HE7A 1G7HA 3IFPB 4PJAF 4XXCC 4ZPTB 2VDOL 1KB9J 3O6FC 2VO5A 3MLUH 2IG2H 5FHBH 1IAOB 1VHPA 1NFIA 4F58H 2F9BT 1RZJC 5HHXH 1BHGA 1NSNL 2E7BA 5L2JA 1QBML 2E6PA 4Y4FC 3RVXD 2B5IC 1T7YA 5ACLA 2IH1B 3KPSB 1HSBB 2Y23A 4U0RB 4LKXB 1MCOH 2C3XA 2QKIB 3PGDA 4P4KA 2OSLB 2A6JB 4P3DA 2NY1D 4TTGA 3ZHLA 1FFPB 2FH6A 4QXUL 4LIQE 3FRUA 4ODTH 1LE9A 3SDYL 5A2LH 4LFHG 4FQHA 4P2RD 2MQCA 3V0AC 4XCEB 3QXWA 4FXGA 4U7SA 4UIKH 4MVBC 4PY8J 4F33B 2MFNA 1J5OL 1H15A 4P9HC 5IFHH 4JCLA 1QYGH 2LV4A 3LHPH 4JZJC 4M43L 2HTLC 3I6GA 4XH2A 1BECA 4U49A 5FA3A 5FO9A 2GUOA 1OAKL 1FZJA 4Q9QH 4GXVH 4GKOA 1DTUA 4QRUA 5F7NC 4DAGH 3ARFB 4PJBB 4OCYL 4YUEH 5EO9B 4M7ZB 1NC4D 1B3JA 1A22B 2VWEE 5KSAD 4DK6A 4MZ3A 1KB9K 2IQAA 3MJ8B 3FHAA 2D31B 1NL0L 2DWDA 3LKOA 4MNQD 4Q0XL 5CINH 3QEQD 1BOGB 3VXPB 1FNLA 1OQXA 1DUZA 2VXUL 1D5MB 3SE8H 3WO4B 4KWUA 1OP3H 3BZFA 5D2LF 1DEEB 4O2FA 1S9YB 2VERN 1WZLA 3KXFD 4Z78A 1Y18A 5KS9E 1AH1A 1NGPL 2W65A 4ONFH 4QRRD 5ALBL 4JFDB 2DN7A 1PX4A 2F5AH 5F9OH 3TZVC 4JM2F 1EMTL 3WE6B 1YN6A 5C0AB 2ZOKB 2DIJA 2VL5B 1HINL 1LDPH 1WTGT 4UT9L 4U1LB 5GSVB 1S5IH 2QHLA 5JQ6L 1E4KA 2OZ4L 4RGOL 1MLBA 3CDGA 5CFHA 3UYRL 1YMHA 1MI5A 1A3RH 5J11C 1NEZA 5CSGA 1UM6L 3QUZD 4AM0B 5J56B 5C70A 2D7OA 3TJEL 2BSTA 3VXQA 4NQUA 3FO0L 1S7UB 4G8GE 1F4XH 4AJ0A 5HI3D 1IGCH 4NQEA 4Z7VE 3QISA 4IRSB 3DVIA 5GGUB 3CD4A 3D9AH 3VFWB 1CDGA 4RGNB 1XGTA 2K3TA 3GMPA 5GS3A 3CFBB 4WI3A 4JQIH 4EKXA 1I1AB 4U6XA 1K4DA 3MRJB 4U6HB 2XRAH 5EU5A 4C4KO 3JV4B 1CYGA 4QRPE 2ZKHH 3PL6C 5D72H 4AH2A 4L4VD 2LFGA 1UQSA 2CJUH 3MBEB 3CLFH 2Z4QB 4FQLL 4PJ8A 1NMBH 3MRHA 1R3JA 2OXGA 2Q86A 3IKKA 1JYNA 2HVKB 5K93A 4GRMA 3S88H 1Z9SA 4XPTL 2DQJL 1JZ7A 1DQTA 4R7DB 5L6YH 3W9EB 1RZFL 1TVHA 2P8MB 4OKDA 5KAQF 1PSKL 2LQRA 3KNBA 4KRPC 5GS1B 4LSUL 3FT3B 3H7BA 3GM0A 3MUY1 5GS0L 3D3VB 1ZAGA 1INEL 3ALPA 2DS4A 2R56H 4YBQD 5CJBA 1ZLWK 1QEWB 4TSCL 4BFEA 4GBXC 1G1CA 3ZDZF 1N2RB 4AY0A 4HT1L 3P4NA 2A6IA 3U36B 3GUTA 2ICES 5C0GB 5IJKA 5I8CA 2QSVA 5JR1L 3H9SD 4Q9RH 3Q0HA 3U1SH 2WBKA 1MHPL 2GSGB 2EEDA 1AGFA 5CMAB 5KOMC 1UCBH 3M1BA 2VWEC 4LVOC 4PV8A 5B38A 1EBPA 1H5BC 3LZFL 3HB3D 4NKDA 1N0XL 5BXFB 5A16B 1RU9L 2XA8L 1YNTB 5BQ7B 3G9VA 1U91B 1CDCA 3B2VL 1DQLL 2F53A 4J3OC 4U6YB 4L3EE 3EJZD 3K80A 4HUUB 1KG0A 4U6VL 1J7VR 3RDTA 5I74C 5JIKA 3DROA 5IWLC 4YWGH 1YEHH 5KSBF 4HK0A 1FFOB 4HMEA 1XCQB 3MRLB 2RHEA 4M5ZH 4BQ9A 5F9JB 1GSMA 3VXUE 4L5FL 3MJ9A 4OD3L 4UINH 4OT1L 2H8PB 4EXKA 3FFCD 3NFNA 3JWOH 4KVCH 3V0WL 3V5HA 3EJJX 3OX8A 2LAAA 1DLHB 2CPCA 5HHQB 3W2DL 2ARWA 1J8HA 1D7FA 2G75B 4NBYB 4LF3B 2C4FU 4Q9BA 4ZO8A 2ZUUA 4XMPL 4LDOB 5C08B 4QHMB 2ZSVB 4R0LC 2Z31B 5DVOA 2COQA 4BM7A 5JPMA 4ZOEA 2XOTA 3CIQA 2Z91A 3D85B 3O6ML 4CMMB 3R1GL 2HH0H 1ZHKB 5IROA 2OCFD 1KEML 2VIRB 2D7MA 4GOSA 2AJXH 3B3IA 4X9BA 5IW6B 5DWUH 5E9DD 2L4OA 4S10A 1HILA 5E4EB 4NHCL 3KLAA 1AHWC 3K1KC 5JUEH 4AQOA 2Z35B 5E6ID 3CFCL 3SDXE 4M03A 5H37G 4M6NL 1AIFA 4WUKH 3TM6A 3KR3L 1B0RB 1FLRH 5BS0E 3AREA 4YEEA 3TBVB 3SE3A 2DYPB 4BZ1H 3TGXA 4OFYD 4PJ7B 3EO9L 2YSSB 4TUJB 4WTWA 4JZOB 5DRZB 4BA8A 5F96H 1JHTB 4PTUB 4WFGE 1JL8A 1UGNA 4WO4A 1C16A 3I9GH 2HTKC 5E2UH 4ZFFA 1UKTA 1AGDB 3L3GB 3MLUL 5F89B 2IG2L 4D2NA 5FHBL 4HIHA 2CRYA 4NQSA 4HJJL 5TJWK 4C83A 5KW9H 2OTPA 4F58L 1DQMH 5HHXL 4LQ1A 3O2WH 2E5EA 2LTQC 3ZKSD 4CDGC 5H35B 4D9LH 3DXAB 4N8CH 1RJZB 4TRPL 5HTSA 3UTTB 1MCOL 1JZ3A 1A6VH 5HD8D 5B8CA 2J8OA 3PGFL 3IF1A 2EXYC 4OD1H 1WF5A 43CAB 5IHZB 4K3JL 1J9CT 1FL5A 1ZHBA 2WQ8A 1TVBB 3WKMH 3RIFF 3JWDC 2R2EB 3VFSA 2XQYG 4PRBA 3P4MB 4UIKL 5E00A 3QIUA 3I2CH 3DHJA 4HWZB 5EBGA 2D7QA 4G43B 1E4JA 1QYGL 1EFXD 5J6HB 3QHFH 5J3HD 3LHPL 3GMOB 4HFUL 5D2NA 3FRPA 3UJTH 4P57B 5C3TA 1WBZA 4BQ8A 2Y9RT 3TVMD 2BNRA 4Q9QL 5F7HA 4L8SB 2VZTA 4DAGL 2F19H 4Z7NF 2WBJA 4I3RH 1NH6A 1Q9LB 3JUZA 3QIBA 4YUEL 2DKUA 1M05B 2GJZB 4ZS7H 3ZT7A 4ACPA 4G7YH 4PIRF 3EO0B 1F4AA 1W0WB 5ISZB 1EA9C 2GY7B 4GKNA 1KLUB 4POYA 4PJIB 5EU6D 3UPRA 1XGYH 5IG7A 3O3AB 3SGDI 2Y5TA 5CINL 3ARYA 3SE8L 3Q1SH 2Q7YA 3ZKXC 5IMLB 1IC7H 4JDZA 5EBMB 2HG5A 4NPYB 5FOJA 2WUBH 5HGBB 3PHQA 1A6AB 3OGOE 3QCUH 4ONFL 5I66A 1AR1C 1L4IA 5E8EB 3S35X 4FQQB 2F5AL 3MLRH 4D3CH 4QTHB 1HHJB 5DJAB 1GGYA 2I27N 4UB0H 1FC1A 1LDPL 3VFNA 1AKJB 1S5IL 3T1FB 1FV1A 1OGAA 4OFVA 3T0EE 2C3VB 2VITA 1RK1A 3MUGB 4P23C 1T03H 3GRWA 4FQIH 2A2QT 1XGRB 3ZLQC 4B5EA 3RVVD 4HDIB 1NANH 1RZGA 1SBBA 3QNZB 4GKSB 1U8MB 4X9HA 4WW1A 2V17H 3D9AL 1JNHB 4ZNCD 1VA9A 5JIHA 5FK9B 1P9MA 5C07D 1KB5A 3N1FC 1T04B 3MRGB 3ERYA 4MD4A 4J1UB 1JNLH 5EO0A 1QR1A 3STLB 2XRAL 1ZGLP 5E8DH 1ZMYA 4NQCA 4NWTH 4GAYB 4R2GD 3EFDH 1L7IH 3QH3B 5F7WC 4Z7QE 2ZKHL 5D72L 4PJFA 3WHXA 2CJUL 3BT2H 1JYWA 1VKXB 3EOTH 5FGCB 3CLFL 3B2UC 4CKVX 4POZC 4E0RA 1NMBL 1QRNB 4QRTA 4TTDC 1ZGLB 5JHDB 5DSCA 1ZS8B 4GG6F 2KUTA 3C6SA 3S88L 1FNAA 3SN6N 1VPOL 3IVKA 5I17B 2YD3A 5K9KA 5L6YL 4OQTH 4D9RE 4JQXA 1FORH 5GRUH 3HG1A 5D1XA 1FNEA 4PJGE 5FV2A 3ARRA 1F00I 4RNRA 2OL3A 4PLKD 1G7QA 4JQVA 1N3NB 3PGCA 1T83A 3DURA 5FCSH 2UZYB 5TF0A 3MACH 4HPOH 2PYED 2NX5B 4Q9RL 4KMQA 4DWHA 3U1SL 2W07A 5C2BH 5CUSH 2CR6A 1HQ4B 4MXWH 4RWHA 1FG2B 2MWCA 1J11A 4F7PA 1CI5A 4Y1AA 2BSRA 3ULVH 5FUOL 3ZE0F 2BY2A 4ZOAA 5MP6H 2APTA 3KPMB 3S36H 2HT2C 3NIGF 4EN3B 3S5LA 5ID0B 5IGXL 5F1KC 3WNMA 4KI5D 1I1RA 1T22B 1QBAA 3WD5H 3ILQC 2NY5H 5ENWB 3OKDA 3O9WC 1EAPB 2YD8A 4YWGL 1J05A 2XQBH 3N06B 3GMQB 1YEHL 1JPGB 3U30C 4EVNA 4WGWB 5CKAA 2UWEB 2F8VA 4M5ZL 2UVEA 2NY4D 2K7PA 4KI1A 4LLDB 1MCQA 2DQFA 5DD0H 1JFQH 5KSUB 4UINL 3VGFA 2XN9D 3OAYK 1KB5H 3JWOL 1TZIB 3BXNB 3LKRB 4KVCL 3AS2A 3T0EC 1FVCA 2G5BB 4ZUUA 1MIEL 5I71C 5FF6A 1MI5E 4OGXH 1IEHA 1I1FB 4YEFA 1BLNA 4RA3A 5ACZB 1A21A 1GH7A 3HUJE 1I9IH 1JUFA 3QWOB 1OHQA 3ZT5A 3UBXA 3ZDYF 2NTFB 4NQEE 1PQZB 4IOIA 4DVBA 3C60A 2R0ZL 3HE7C 4J3XA 5CGTA 2HH0L 1JE6A 1TETH 2IF7A 3HE6B 4Y5YB 2Q8BH 1I7UA 5J9PA 3BDXA 2AJXL 4I0PA 4JFEA 4FQPA 1QSEB 4DKEH 3QJFB 2D9QB 2F15A 2OL3H 3SJVD 1KUMA 1P5VA 2BFVH 2NYYC 4LRNH 3KPQB 3G6AB 2PR4H 5JUEL 2X4NA 5INDB 2E9IA 5I1GH 3ARBA 4RAVB 2CR3A 4PJCF 2YD2A 2A74A 2IPUK 3HPJB 4P4KC 4WUKL 1UKQA 4WCYH 3V95A 5ICYB 4BZ1L 1N5AB 3ARTA 5DD6B 1EHXA 2VDKL 1NBQA 3VG9C 4OLUL 4YAQB 1CBVH 3GZKA 4URTB 5F96L 2R69L 2L7UA 2P48B 3FQNA 1CLZH 3I9GL 4O2CA 5E2UL 3BAEH 4KJWD 1FYTA 3I6KB 4LCUB 4TNWF 3RZWA 1CICD 4QRQA 4QWWD 2CRIA 1JTTA 3ZDXF 5KW9L 4GQ9H 3EDEA 5C1MB 5T1KB 1DQML 1MCCA 3O2WL 2C7UA 4KDWA 5FFLA 4D9LL 1WFOA 3G6DH 4N8CL 2EICA 4MDIB 3WLWC 3HPLA 5D2LA 3TA3B 5IB5A 1A6VL 3NIFF 3RWEA 1MVUA 2AABH 1YY8A 2G60H 4OD1L 3FN3A 5HHNB 4JM2A 2MKWA 1VCAA 5F7YC 3WKML 4J12A 5T3ZD 3EOAA 1WBXB 3T77B 1YMMD 3D2UB 2CLRB 4OM0H 1I8IA 1FNGB 2WIMA 3I2CL 4H25B 3MV9D 3K0WA 3VFRB 3SCMA 2EDRA 3DMMB 1KLFA 3VWKB 2XNAA 3HI1A 5DJXB 2FGWH 1NAMA 3S96B 3K81A 4K7PL 2B1HH 3IJSA 3U6RA 3QHFL 5E1AA 4X4XA 3UJTL 4MGXA 3TYFB 1KCRL 4LAJH 3TN0B 3T2NH 1Y6KR 1TJIH 4I3RL 1E4KC 3V2AR 4PTTA 1N6UA 5GGQH 4NO5A 4ZS7L 3FB7B 1E27A 1KPVA 4G7YL 3U46B 1A6PA 5D1ZA 4APQA 1J8HE 2H6PA 4KKAD 4ONGH 4ELKA 1QA9A 3FQWA 5C9JB 4XAKE 1Q9OB 3EHBC 4ONHA 2V9RA 3TH2T 3Q1SL 2FEDC 1IC7L 1FGNH 3BIAX 2WUBL 1Z2KA 3GHEH 1CDHA 4I4WA 4F2MA 3JWOC 5C6TH 4U2YA 4M4PA 3OR7B 4NM4L 4XBGB 4M6OL 1FDLH 1RY7B 1XR9B 2JB5H 3ELAT 3MLRL 3D18B 3DTXB 1JCKA 3OTTA 4H20H 4UB0L 3LN4A 2HWZH 3OPZH 2ZUXA 4PJ8C 3O3DA 2UYLA 4X6DB 3HN3A 3NCJH 1IVLA 3OGCB 1T03L 1JV5A 4FQIL 4JN2A 1U8NB 2I9LA 3IFOA 4X7TA 2DD8H 4KHTH 4JY4B 4D94A 4E5XB 2BX5A 2Z93B 3UPCA 5F1OB 3JTTA 1LP9E 1IBGH 4BK4A 5F7DA 5L0QB 1MHHB 1ZXQA 4F8QA 2BVQB 2V7HB 2V17L 4K3DH 1A6WH 2XZAH 1AFVH 1VERA 2EE3A 4CU6A 1G7LB 3V5DA 5IB3B 1CFQB 4CN4A 4FZ8H 5IJKC 5K59E 5C0DB 1JNLL 5FB8B 4PJEF 1DQQA 2BVTA 4FS0A 5E8DL 4NWTL 2V2XB 3T65A 4WV1B 4OZIB 3EFDL 1L7IL 5CP7B 1G84A 3VA2C 4UV7H 5CHNA 3BT2L 4WVRA 3EOTL 2WSKA 3E6FA 3VG0H 4DKFH 1NAMH 4BKLB 2XKUA 2VAAB 3VXSE 2QQLH 1WWCA 4XCCH 3TNNA 1UJTA 4NQDB 5HHOA 5KSBA 5BJTA 4N5UA 1I9RH 3A6BH 3EYUH 4OQTL 3VD4A 1FORL 5GRUL 3JTCA 4PRPB 1AP2B 4I13B 2DAVA 3RDTC 1J0YA 3EO1A 5LGJA 4OGZA 5EZLA 4M1GL 4JRYB 5J1AA 1ERNA 1OLLA 2W0FA 3MACL 4GAJH 4HPOL 4JRWA 2P8LA 3W39A 5D2NE 4K94H 5T3XH 1OWWA 5C2BL 2WW8A 1ZT1A 4MXWL 4ZUSB 1P7KB 1R5WB 2ZCLH 2ZG3A 4JHAH 3C9NB 3W0WA 5GRWA 1V3JA 1U8PB 3WSQL 3ULVL 5C92A 5I1DB 2MQ3A 1YDPB 3P77B 1YA5A 5MP6L 5H8DA 2JELH 5FO7A 1X5AA 4YC2C 3S36L 2HMIC 5DQJB 1G7MB 2VDRH 2VZOA 4WU5A 2MHAA 1P1ZB 4YIQA 2DQDH 4OCSH 1FCGA 2APWA 3PL6B 3WD5L 3H6JA 2NY5L 3ZKMD 1GJIA 5IROC 1PFCA 4MAYA 4GS7B 5GJSH 3UTSA 3T2OA 2XQBL 3S5LG 4EQ2A 2BP3A 2D3VA 4I2XE 1AR2A 1GIGH 3ULUC 1H8SA 3DVNB 5J6GA 3TO4D 5KJRH 3O0RH 4JFFA 3T04D 1RZKC 5GRVL 3V4VL 1HH6B 5HHME 2LU4A 3IDIA 1GC1L 1JFQL 1LMKA 5DD0L 4L8CB 3UC0H 2AEPH 3VE0A 3KPRD 2I07B 4N0CA 2X41A 2H9GA 1P7QA 4KRPB 5CEZH 2I24N 5IB4B 2WK2A 1XGQB 1RURH 1OGAE 1BQHA 4NUJB 4YO0B 1KIUA 2IAMB 1WEJH 3G5YB 3X13A 3SQOH 2GSIB 4OGXL 1NGXB 1RIVH 4JB9H 3AREC 4OUUB 3SE3C 3EYQD 1MHEA 4NRZB 1NDGB 4LLWA 4DZBB 4XZUA 1I9IL 1MLCB 1WZ1H 3Q6GH 3GMRB 4QXGH 5HPMA 3CU1A 3VXME 3DI2B 2R1XB 4WO4C 3U7AA 3VFMA 4KJQC 1TETL 4HJ0C 2Q8BL 3UBXG 5EBLB 4LVOB 4XVSL 4J6RH 4AT6B 3BP7B 3QQ9C 1EXUA 1DFBH 5D93B 1HSAB 3B9KA 4N0FB 4X9FA 5DQ9B 4NQCE 3KYMA 2BFVL 4FN0A 1T66C 3EYSH 2BOCB 3I3DA 2NW3B 2VLRD 2UUDK 3O41B 2PR4L 4R90H 2BJMH 2ZUQC 5FA4A 1IILE 4KRMB 1OARL 1NGZA 2FD6H 4OFDA 4X5XA 5DHYA 5I1GL 3X11B 5KS9B 2A38A 2ZJSH 3JVGA 5B8CC 3TT3L 5HHPA 2HT3C 4WCYL 3FO1A 4ZAKA 1ZLVH 5FYJL 2H2PD 3QUXA 1DQDH 1QFWM 4LLMB 1KJ2A 1TTGA 3LSOB 3QSKB 3HG1E 1CBVL 3QIUC 5L8LB 4R6UA 1U8OA 1CLZL 1G7JA 3GFUA 3CFEB 4RMRA 5I1KH 4KV5E 4XC1H 5D2NC 1ZHLB 4MXVE 2BCKA 2EKSA 4LLQA 5A2FA 2AXJA 4NQVB 5E2VL 1VGKB 1YC7A 4G8GB 1CD1A 4FFEX 4Z7VB 5L7XH 1UB6A 4OZFG 2WBJC 4R3SB 3PIQA 3QIBC 4R0LB 3G6DL 3O4OC 3PDOB 5ERWB 3L3JB 2B4CH 4UMGA 3N9GH 4Y1AE 3JZ7A 4HFWA 4NO0A 5SV4A 1OAYH 2AABL 2G60L 1J86A 4LCWD 3VFOB 3P73B 4ELMF 2MNUA 2B1AH 4HKBB 3MV8E 3TCLB 2IPTL 1F13A 1NGWB 3HZVA 4V1DE 1IM9D 3U4EA 1P5UA 1AHWB 1U6AL 2V5TA 5HSFA 3C8KB 1NMCC 3C6LB 1ZLUH 1V05A 2FGWL 4Z76B 1OOAA 3O45A 5BVJA 2VR4A 4CUCA 1U92A 4MQXC 5I18H 4N8VB 3DV4B 1Q9KB 4ZG1A 4HPYH 1KXVC 4LCIH 4OZ4A 3T2NL 5KVFH 1WZKA 3TBSA 4E42A 4JO4L 4MB3A 3LQZA 3IXTB 1TJIL 4H0HB 4P2OB 2IANE 3FQUA 5GGQL 3HRZA 3U0PA 1PW3A 4PJAE 2ITDA 4NBZB 2YHGA 4FQJH 5C86A 1S7XA 5C9KA 5F1SA 3ZKQD 3MYJA 4YHNB 5H94B 5EG6C 1HEZA 1PEZA 1HHHB 2OTUA 1Q72H 2O93L 3V6FA 2W0PA 1B4RA 2LTQB 3UAJD 2ICCA 2Y5EA 3OF6A 1P9MC 3GHEL 3BDBA 4QRSB 1EEZA 1G0YR 1FDLL 4GG6A 4U1SA 5FUZH 4BH8B 4JFEE 1EERB 1DVFD 3MR9A 5D96B 4LFHD 4NP4H 4H20L 4ODSH 1LNUA 4WW2B 5JDSB 2BNUA 4L3EB 3D0LB 4ZPVA 2HWZL 4NKOA 1JPFA 3O4LA 4N68A 3T2PA 1HXMB 4YXLH 2AV1A 1SBSH 1EHNA 3NCJL 5KAQG 2NPLX 5FDYA 2BRRL 1KJVA 5C6PB 2LE9A 4TYUA 5M7QA 4WI7A 3ECBB 2DD8L 1ZT4A 4KHTL 3L7FB 3FZUD 1U3HA 1PLGH 4JQXC 3PJSA 1IBGL 5D1XC 4KGLA 2CIKA 1P4BH 3T0XA 4WEBH 3LRSB 5CJXA 5FEBA 4IHOB 1A6WL 2WBWB 4JQVC 3S3PA 2XZAL 2OM5A 2RCSL 2FEEL 1T83C 5IEKA 2MTPA 1FYTE 1KT2B 4FZ8L 2YRLA 3W5NA 3F7RA 5LBSH 3I75A 1DSFH 1U58B 1A6UH 2X4SA 5CIPB 1OSPH 1RJYB 4UQ3A 2B2XH 2ESVA 4UV7L 5DEGA 1T2JA 4AEIH 4CVUA 3VG0L 4GJTB 1X4YA 4DKFL 1JZ6A 5ESQB 1GHFH 1NUNB 1EZVX 1CFNB 2QQLL 5D2LE 5DURB 3U2SA 3VRJA 5D7IF 3C5ZA 2DB8A 5JORA 3AAZA 1NC2A 4DKAA 3P9MB 5MEQA 1I9RL 1HKFA 2VLJA 3A6BL 3EYUL 4CVXA 2C4FT 3LN5B 4MD5B 4N5EA 4Q58C 4HLZH 2OJEA 1B88A 3TIDB 5T1MB 1Q94B 1RUQH 4OLWL 5IQ9B 5BS0B 4OF7A 4GAJL 1U3JA 2VAJA 1BVKB 3HC3H 5TQ2H 3X12A 3PWVB 1FE8H 5HVFB 1YUHA 1PBYA 4CNIA 2K1MA 1T1ZB 4U0QB 2FIKA 2ZCLL 5DUML 1KN4H 4JHAL 4CMHC 3E6HA 1NCNA 3PWJB 1UG9A 2V2TB 2PYFB 1PZUB 1J87A 2ZPKH 4G6AC 4P46A 5C0BB 4B53A 4WIQA 3V52H 2JELL 1S7TA 4PV9B 3BKCH 4HWNA 4HKXB 3C5SA 5EBWB 3B5TA 3N0PB 3LDBC 2VDRL 2DQDL 4OCSL 3P9LA 3TV3H 4XPAH 3EUUA 5T3XE 1HWGB 4DOHE 3GJEA 2FL5B 4X6CF 4Y2DA 5D7LA 5GJSL 3ORJA 1JZ4A 1UJ3A 2P44B 4PJCA 4RDQF 5TE7H 5C0CA 5F44A 4L4JA 1S9WB 4I0PC 4JY6A 3H0TA 3VFTB 5KSVB 2GYSA 3RWGA 5KJRL 3O0RL 2P7TA 3KGRA 4CADB 5GGRB 3UC0L 3CSPA 4P23D 2KBGA 4HIIB 1FJ1A 2ERJC 5INCA 5CEZL 5IW1B 3ARBC 5HYJE 1RURL 4LHJB 3WUWG 1EHLH 4RFNC 5DXWA 1WEJL 4MJIA 2YWZA 3RWFA 3SQOL 4JB9L 1RIVL 2VXVH 2DQTL 2WMPA 4X8XA 4JFDD 1F3DJ 3ZDZE 3VXRA 5JO5A 4OCLC 4U3CA 1WZ1L 1Q38A 1P2CA 4QXGL 5C0AD 1PAMA 5BVPH 3OMZA 5C2UB 5A2JH 4QHLB 3T8XB 2ENYA 3D0VB 3SGEI 3VA6A 4NNYB 5D6CA 3IB4A 1KIPA 4LU5H 5CEZE 4EQ3A 1XF3A 1LO0L 2PTUA 4JFQB 4NUGH 4S11A 1A6ZA 2EDKA 1EBAA 3T2QA 4ZUTB 5IBLC 3ZE2F 4YXHH 1ZLWH 2PXYD 3EYSL 4R90L 3SBWA 2BJML 5I76B 2FD6L 2NXZD 4RGND 4XB7A 2D7TL 1PYWA 2QV2A 2ZJSL 3IDJB 3FB5B 2P5WA 5KSBE 4RGMC 4GRLA 4OKVA 5CD3B 4IIQA 4JM2C 5IFAH 1DQDL 4QCIB 7CGTA 5SWSA 4BSVB 2PW1A 3BW9B 4YJZL 3MBED 1XCTB 4PD4J 4M5YH 4MXQA 1D5BA 4IOSD 4GAGH 3T0EB 1X4XA 2BVPA 5I1KL 4XC1L 5DF0A 1BIIA 5I1HL 4DQOH 1OTUD 2AS5M 1B9ZA 4H1LG 4KZDL 1QO3B 4BQCA 1F11B 3VFUB 3S97C 3RGVA 1T21B 3CSYB 2DQGH 5EU4A 1BD2A 1DBKH 1ZEAH 2FSEA 4QY8A 3W0WE 4F80A 1G7HB 2B4CL 3S98A 1KENH 4C58B 4LSQH 1ZSDB 3N9GL 2PCPA 1IAKA 5CD5C 5K9QG 1F4HA 3BN9D 4WFED 3RL1B 5D1ZC 1OAYL 1S5HA 4JY5L 3O81A 3ROOB 1BIHA 2B1AL 1MFNA 4YFEA 4L1HA 4HZLA 1JWMB 4KI5F 4K94C 5HYSA 3WXWH 5L2JB 1KC5H 3VWJA 2AK1H 2FRGP 3DNKA 4MYWB 3MRKA 5DJ2A 3AS1A 2AV7A 4P5TD 3WMSA 2Q7NA 4WTXA 5IMKB 2VQ1A 4HGWB 3GIZH 4HWUA 3VCLA 5KZCB 1HHKA 3RNKA 5I18L 4JFFE 2YD5A 3OKLA 4LCIL 1LE9B 4JFYA 5KVFL 4Y16D 1PZ5B 4PJGB 5I9QB 4FXGB 4OGYH 4PD4K 5JMRA 1MOEA 3HMWL 3AXLA 1RQ5A 3BFOA 4FQJL 3WNOA 5TDOA 4G59A 4ESKA 3U0WH 3H9HA 4PJEA 3I6GB 4XH2B 5CSZB 4LPXA 4W68A 3LEXA 1Q72L 2GUOB 1QUNA 1FZJB 4G80A 4ZUVA 5IB1A 1WWWX 1W72H 1KYOJ 4I77H 5EOTA 1F6FB 4JCMA 1FZKA 1FQ9C 4M7LH 3CCHA 5FUZL 3N1QC 2IQAB 1LK2A 3Q5YA 1U41A 2WWKO 2DWDB 1A7RH 4RMVA 4ODSL 4JPKH 1WFNA 1P4LA 2Z31D 5IEHA 2Q3ZA 2I26N 4P2RA 4YGAB 4F7TA 1DUZB 4C56D 3MGTA 4PRID 1MFAH 3BZFB 3BEWB 3GSNA 4YXLL 1SBSL 4Z78B 2NY2C 1HIML 2W65B 1Z6JT 1HXYA 1M7XA 3EYVB 5E03A 4UBDC 3CFKA 4WWKB 1PLGL 3K2UH 5TDPA 1YN6B 4R4ND 1VFMA 5EIVA 5HYFA 3HKFA 1AY1H 1P4BL 5F6IC 3HCVB 4WEBL 3KLSA 2X4QB 2DTMH 2W1NA 3QDMD 1OAQH 3CDGB 1YMHB 1NC4A 4KKLC 5KSAA 4IRZL 1NEZB 5J12C 2DYPD 3LOWA 5LBSL 4U1GC 3HUJB 1DSFL 5EC1A 2BSTB 4MX7A 1U9KA 3VXQB 1A6UL 4NC2B 4M6MH 1MHCA 4MNQA 1OSPL 5GGRY 1JNJA 5FYKH 4NQEB 3QEQA 3F12B 1A4JB 1S9VA 4D0CB 1RK0A 2OLDA 3X17A 2YXMA 1GHFL 2B20A 5IVZA 3VDBA 5DD1H 5I1EH 4R96A 2V9QA 1XGTB 3GMPB 3KXFA 3B5GA 4PRNB 1CDJA 5GSRB 5IMOB 1WZMA 3HTLX 5GQBA 5LQBH 1JZ8A 4QRRA 4QT5A 2VOTA 1ZK9A 1T1WA 5GISH 4AIZA 4MA1B 5EU5B 1TCRA 2CRZA 1U95A 1CXKA 2EH8L 2X09A 3EDJA 1G9NC 3DETD 4OM1H 3DXAD 4MAYC 5KG9A 3ET9F 3UTTD 3VFPB 4BSWA 1R3JB 2Q86B 4PGZA 2X1PA 3G5XB 2R0KH 3HC3L 3QUZA 5TQ2L 1RPQA 1MJ7H 1FE8L 3MRIB 1TVHB 1FSKC 3T4YA 4MWFA 4ODBD 3MGOA 1YEEL 2X4TA 3GSWA 4WUUE 4HHAA 2Y6SD 2ZPKL 3EHBD 1B6DA 3R06A 4UU9A 3AS0A 3V52L 4K07A 3P4NB 2A6IB 3ARPA 3T3MF 3GUTB 1IGFH 2P24A 4YHYC 2XWBB 3BKCL 2GIYA 4H8WH 5SWZE 1K3IA 5DC9B 3LS5L 4L4VA 3TV3L 3ARSA 4XPAL 3BP4A 3QXVA 4AENA 4GRWF 3M1BB 4CGTA 1CS6A 2N7BA 5F7KC 4XI5D 2NLJA 3QDJD 5B38B 1H0DB 3NMEA 1INDH 1HZHH 1XR8A 3UJIH 3B9KC 5FXCH 2MKLC 2R8SL 3UX9B 5DJ8A 4D8PB 5IV2A 2X2YA 2RB8A 2MCPH 4U1KA 5DJDA 1EHLL 3DROB 5C0NC 3JVGC 4PGDA 2VXVL 5D1QD 4ZAKC 5DVLA 3KPPA 4ZDHA 3OHXA 1AGCB 3QFJA 5C6WH 2AEQL 2AEIT 4LLVB 1MAMH 1U8KB 2CDGA 3H9SA 3DPBA 2EDFA 3GHBH 1Q0XH 2NXYB 5BVPL 3TO2B 2ATKA 1AKJD 1OF2B 2YMXH 3V5HB 4WENB 5HGAA 4LU5L 4JRXB 1SY6A 4NUGL 4KHXH 5IVXF 4QHNA 3ZE0E 4KK9C 1J8HB 1QPPA 5F8QC 5E8PB 1ZT7B 5BRZD 1JZ2A 4ELMA 4YC2B 4YE4H 4YXHL 1S9XA 3NIGE 3GSXB 1ITCA 2BDNH 5JPMB 2X4OB 4LBEB 1YEJH 5JOPD 2Y7QA 4X6EB 3WKNA 2EECA 3ILPA 3I02A 4PYGA 4ZOCA 3PWUA 2VLJE 4LLAA 1HILB 5I8OH 5E7FA 1UWGH 4DGVH 3KLAB 1DLFH 3FFCA 3CGTA 1V5JA 4NQTA 4M9OA 1QRND 1JPSL 1IGYA 4GAGL 5JHDD 3FB6A 3QO1B 1SJXA 2AGJH 1AIFB 5HJ3A 2CLZB 3QUKB 2ZG2A 4DQOL 2PF6A 3AREB 3DX7B 1CDYA 2HJKA 3IDMA 1LP9B 3LQMA 4Q6YA 4G6ML 3IXAB 3RUGF 4IRJB 4WFFD 3ZDYE 1TNNA 2DQGL 3QCTH 5I2IB 1DBKL 1ZEAL 3VJ6A 1N59B 4XNQA 3CVHA 3V7AE 2N56A 4LSQL 3SDDB 1FO0L 1QFHA 2IMMA 3OAYH 4KXZH 2R1WA 4NQSB 1QVOB 3G9AB 4C83B 4LSSH 2DBLL 5E9DA 4MD0A 4Z7WE 4C55A 1IC5H 1F5WA 1FZMB 3LKSA 2XTJE 4FFVC 1QFWL 3WXWL 5CSBA 1KC5L 3RKDC 1BF8A 1I7ZA 2AK1L 4YHIB 4UT7H 1QHPA 5E6IA 3VXSB 5D7LE 3HA0A 4PJCE 4RMSA 3UTQA 3GIVB 3GIZL 3VH8G 4P48A 3WDHA 3VFGH 2QLVB 1H3VA 4EN3D 4OFYA 3S3JA 1FL5B 1ZHBB 2PUQT 1YN7A 3L5WA 3EYOA 2ICWA 1VEPA 3CX2A 3SKUD 1QTYT 5E00B 1SY6H 1RAMA 4OGYL 1CFTA 1LE5B 3AGVA 4MJIE 1GOFA 3VRLF 4HEPG 2DRUA 1O5DT 3U0WL 5FOBA 1U3HC 5D2NB 5JZ7D 4OLVL 5LJYH 4HLJA 2D0GA 1U93B 1DN0A 2XKNA 4N0UA 5CJXC 1X44A 4FXKA 1FL3A 1T4KB 1W72L 2WBJB 1RZIA 3CXDH 2CMRL 1QFOA 3O4OB 4Q7DA 4M7LL 1E4WH 3NIFE 4W4OA 5CEXB 4GKNB 5D7IA 1S7SB 3RNQA 1P6FA 3UPRB 5IG7B 2GJ6A 1A7RL 2Y5TB 1X9QA 4Q9CA 3UZEA 4PJ9D 1CZ8H 2NY0C 4JPKL 5LKNA 2GTWA 4GMTH 4LSVL 4L4TD 3AU1A 1KF9B 1T80A 4OD2A 4D0DB 3N85L 1MFAL 1EEUA 2YPLB 5GRZA 2EXWC 3ZYIA 3GMMA 3CH1A 4I2XB 3GMNA 3GI8L 1J0JA 5LVEA 3C5ZC 1EFXA 1H8OA 4OF0A 2P5WE 1QSED 1VENA 5LAXA 5HHMB 5J13B 3K2UL 1OL0A 5GJTH 3TVMA 1AY1L 3NCEB 4N5EC 5SWSE 4BELD 4YHZH 2ZUYA 3IDUA 2A6DA 3QPQD 1FV1B 4HV8A 1ED3B 1U36A 3QJHB 1MQKH 1OAQL 4Z8FH 4GXUM 2VITB 3WJJA 2EC8A 3O2DH 4JE4B 5ELIA 2UV3A 3EOYG 3FONA 4FQCL 4M00A 4HKZA 5E5RB 4CVWA 2XZZA 5EU6A 3L7EB 3VXOA 1DBBH 1KJMA 1QZ1A 5FYKL 3TC9A 1KCUH 3FQTA 3VGHA 2DMCA 3VXMB 2KQNA 1PG7H 2E8ZA 1BD2E 2C5DC 2AQ1A 4TVPD 5EOCJ 5I1EL 2EIZB 4X6CA 1MAKA 4P46C 5LQBL 5KANI 1KULA 4PRAB 5GGTH 1FFNB 1F3JA 2FH8A 5HVGB 1XF4B 4CJ0A 4TUKH 5GISL 1KCVH 1T5WA 1A02N 5T1KD 5CLWA 4J3VA 4NQCB 1S7WA 1YY9C 5B3JF 3OXRA 4R7NB 1UXSB 4LPWA 2R29H 4Y2DC 4ENEC 2XQYK 5FYKE 4QRTB 1UJ3C 2K9UA 3TA3D 2NY6C 2WNGA 2E7LE 5E8NB 1HI6A 1M7IA 3E1F1 3IVKB 4MNHB 3DYMA 1MJ7L 1CE1H 3QDGE 4JHZA 3O2VH 4MQSB 3FAWA 5FGRA 5KVDH 3HG1B 3D2UD 4RNRB 2OL3B 2VMFA 4NKIL 2NNAA 4PY7B 1IFHH 3VWKD 4K23L 2ED8A 5JNYA 1QFPA 3DURB 4QGTA 1S3KH 1WCBA 3L3KB 4L9DA 3KVQA 1IGFL 3UTZA 4RIRA 1V7NH 1I3GH 2DQEH 4PJEE 4H8WL 3TN0D 2CIIB 3PUCA 1VFUA 4NNPH 4HIEA 5DMJB 2CH8A 4F7PB 3G5ZA 5DC4B 4Y1AB 2BSRB 1BBDH 1INDL 3TBWA 4QNPF 1HZHL 3Q5OA 5EZJA 3UJIL 3PHOA 4PJ5D 4XWOD 1CGSH 3MV8B 4NNXB 5BZWA 5EU3A 5HI5C 4YZFF 5IBUB 4FFWD 4V1DB 4K3HA 3QNYA 3SBWC 3ZTJH 3LQAH 4ZXBB 3MUJA 4LQFH 5JLZA 4EVNB 3DX8A 5E5UB 3HI6H 4GRLC 1X5IA 4IIQC 4XCYB 1A2YA 1J0HA 2PYEA 2XTLA 1MAML 2FJGB 5D7JB 3GHBL 1Q0XL 1IM3A 3PP3H 5JOFA 3BIKA 1ES0A 3BISA 2VL4A 4MXQC 2R0LH 2YMXL 4OGAD 2ZSWB 3MLZH 4CMHB 3SKNA 3TFKC 4G8IA 5ICZA 2IANB 3UZQA 3X3FH 3QHZH 1LDSA 1FVCB 4PJAB 3PWNA 5FF6B 4KHXL 2ADIB 1DQJB 3KJ6H 3PV6B 4KFZC 4YE4L 1JUFB 3TLRA 1A9EA 4G7VH 4MNQE 1G6RA 2BDNL 3LDBB 4IOIB 4FQ1L 3QEQE 3C60B 4X80H 1MCDA 3QXDA 4OLEA 2VYRE 5J9PB 3LH2H 5I73C 5DUBB 2W92A 1U2HA 1UZ8A 4PRHD 1SVZA 2XFXA 2XKSA 4HWEH 3MROA 2VDNL 5I8OL 2DM7A 3V4PH 2HJLB 1UWGL 3ZE1E 4DGVL 2A6KA 3VWJC 1DLFL 5DGQA 1OSZA 1QSVA 2XN9A 4YX2H 2X4NB 4JZNB 2YPKA 5K9QI 4FTVD 1RZ8A 3ARBB 3HLAB 4R4BB 2AGJL 4PJDF 4RFNB 3E3QE 3QI9B 4NQDD 1LQVA 4XNYH 2Y06H 3BUYB 1IL1B 4ISVB 3CC5A 4PGEA 1J10A 2CDEA 3OXSA 4PRPD 2NZ9C 3QCTL 3S6CA 1ZVSA 5HDBF 1NCUA 4YNYB 2BRQA 4YHLH 3DIFA 4HS3A 4JRYD 4O2CB 5F9WB 1FYTB 2CKBA 1X5XA 1WBYA 2EYSB 4GUPA 2CO6B 2CDFA 5KN5A 4KUCD 3S37L 1IC5L 3SJVA 4XHQA 2HLAA 5CBAB 4HKJA 3BH8A 4WHYH 4PJBF 3KPLA 3RVXC 3HS0A 4L4VE 5FYLL 4UT7L 4GQPH 3BKYH 5D2LB 5IB5B 4WHTA 1N64H 3RWEB 2EDQA 4KTDH 5F3HB 2X05A 5J0BA 1MVUB 4TQEH 2NY1C 1YY8B 3VFGL 5EN2A 1YYMH 4JM2B 3U0TB 1VACA 2EIEA 1QSZA 3MOBH 5DTFA 4KK8D 5TE6H 4ZNEA 2ADGA 4H8WC 3CMGA 4EUPH 1SY6L 4EOWH 1B4JH 4MJ2A 3SCMB 2DBJA 3BRFA 2JB6A 3HI1B 1YQ2A 1OTTD 2UUDH 3CLEH 1NAMB 2EO1A 1CICA 5EA0H 4KAQH 1NUGA 5E1AB 4X4XB 3GSUB 1G6RH 2R23A 4ERSL 1B0WA 1GPOL 3QFJE 4L29A 3RL2A 1ZWIA 3H9SE 3UTOA 4X6BA 2JIXD 4JREB 4ETQA 3IETA 5IOPB 2G9HA 1M7DA 4LKCA 3ULSA 3CXDL 4PTTB 1BFTA 4QTIH 4YBHA 4EDXA 2IAMD 3VI4E 5KSAC 1E27B 1KPVB 1KEGH 1E4WL 1FIGH 5D1ZB 3Q6FA 4APQB 4LLYA 2H6PB 2ZWLT 3NABH 3INUH 4ELME 4EI5B 2FJHA 5ITFA 1CZ8L 1TPXC 4GMTL 4UTAL 5BZDA 1YMMA 1VADB 1NMAH 4DOHB 3MV9A 3MRQA 4I4WB 3CFDA 3VRIA 3WS3B 1H9VA 2BVYA 4ZTOH 3PQYD 3TPUA 4HIJA 1KOAA 5FM5O 2VXQH 4DTGL 1JBJA 3OKKA 4ODWA 5MI0B 4OFIA 5GJTL 2HAZA 3LN4B 4YHZL 1T5XB 1MCSA 2IFGA 1SEBB 3GGWA 4XNMB 5DRWA 3F62A 1MJJB 1ND0A 5HYJB 3FFCE 2R4RH 4RA0C 1Y6NR 2CKBH 1I8KA 3O3DB 1MQKL 4XNZC 4Z8FL 3R8QA 2UYLB 1R24A 4DW2L 4N9GA 5IF0A 3O2DL 3TCXA 2R2BA 1JV5B 3QUZC 2Y25A 3GB7A 2I9LB 4LASH 2X44D 4Y89A 1BVZA 3WBDA 5CD5D 1DBBL 3JTTB 4FRWA 3L5JA 1AQKH 5HI3C 1KCUL 1LVEA 4DN4H 4JVUA 4I5BA 1PG7L 4DUWA 3GSVB 2HFTA 1OT2A 4WNQB 2E7CA 2X4PA 3F7YA 3MJ7B 2YPVH 3AY4A 3DHMA 5KTEH 3NCYP 5GGTL 3MV01 1CFBA 4ZQKB 5K9OA 3UXFA 3NZHH 2J8UF 4TUKL 1KCVL 1DQQB 3O3EA 5TH2B 4U4BA 4IJ3C 4WEMB 4XRCA 3MRBA 5E9DE 4AMKL 4RDQG 2R9HD 3VD3A 2J2ZA 5E1HB 3E6FB 3BD3A 2R29L 4UQ2A 32C2A 4MQ7A 1JRHH 5FUCC 2JK5B 4Z7UE 2OQJA 5I16B 4XNUH 2A1WH 1NKOA 3TNNB 2NY2B 5KSBB 4Y19D 3EDFA 2BXZA 4S1DD 1T1XA 1W0VB 1CE1L 1VFBA 5CILH 4XXCA 1TQCB 2ITCA 1YECH 3HAEH 5KVDL 1GGIH 1YEDB 2FJFA 5FYJU 5F6IB 3EBAA 4K71C 1AQDB 1IFHL 4ODVH 3CVIH 3C6LD 4YBQC 5EZLB 3EOBB 1DUYA 3GSOA 4KTEH 1KIRA 2W0FB 3MRRA 1S3KL 5IVXA 5T3ZH 4KQ4H 3QO0A 1I3GL 5FO8B 5IT2H 4ORGA 4C54A 1F2QA 3R4DA 4LLUB 1ZT1B 1CK0H 4NNPL 1T3FB 4P2OD 4GW1B 3W0WB 4GH7B 4KZEL 3F7VA 3KLHD 4LARL 4O02H 2JTDA 3V6OA 3HB3C 4Z7OF 3QEGH 4L9LA 5D7IE 5LWYH 4NWUH 1CGSL 3V0VA 2GJ6E 2JJSA 5SX4I 3M17A 4LSDA 5FCUH 5IM7B 4MB5A 4WU5B 3EJZC 3ZT6A 2P4AB 5A3ID 3LQAL 4F15C 3M07A 1A1NA 4LQFL 5GS0D 1KNOA 2X70A 2ADJA 4WGVB 4U1JA 5DYOA 3QULA 1BEYH 1T7ZA 3ALWA 4PJHA 1UZ6F 5J6GB 4KPHL 4JFFB 2PTTA 3RWIB 2P5ED 1A9BB 4L3ED 4LCYB 3RUGA 4GRWH 4MCZA 1X5LA 2H9GB 1P7QB 2R0LL 4K7PX 4U7KA 3MLZL 1SJEA 1UB5A 3QHZL 3X3FL 3WS6A 1BQHB 5EC2A 3GKZA 3X13B 2JJTA 1JN6A 4JAMB 1KTLA 3KJ6L 4PJ7F 4XZUB 2I5YH 3RPIA 5EU6E 5IB2A 3FO2B 5HPMB 1PKQE 2V7NA 5DDHA 4X80L 1U8IA 4JANA 1QLFB 5EUOB 3VFMB 4KKCD 2ZOLA 4X6CE 1HYSD 4M1DH 1OGTA 4QHKJ 1DBAH 5I6XC 1MNUH 1WUNT 3TO4A 2WM0A 5IMMA 2OYPA 3B9KB 5EOQH 4HWEL 1S7RB 1NBZA 3KYMB 1P84J 4HF5H 3V4PL 3PG2A 1WC7A 35C8H 3KPRA 3MFGB 4YX2L 1RZJH 4NCC1 3BZ4A 4OCMC 5E6IC 4OUOA 4X5XB 1NGZB 5DHYB 3VGAC 1T2XA 3BZEA 3WN5A 4HAFA 5SV3A 5E99H 4DJMA 3RIAK 3QUYD 1BJ1J 5F93C 5E6YA 4XNYL 2Y06L 1A4KB 3FO1B 4JFOB 2JJVA 4ZAKB 4F9LA 4PLJD 1R3LA 3IS1X 2AXGA 3BPNC 2NTSP 4X8JA 3QUXB 1BX2B 1F02I 4UAOC 1IEAA 1U8OB 4YHLL 1E4XH 4XX1G 4OI8A 1VFAA 4Y8DC 1Y6MR 4QYOB 4XGZB 1EFQA 1EUUA 3DYPA 2OI9B 4LLQB 3FTGA 4OFPA 5GS2H 4BUGA 2VSCA 4TSBH 3U7WH 2G2RA 3E0GA 1CD1B 3ZE2E 2VLRA 3TT1H 4I18A 3FOLB 5DT1H 1N64L 4HFWB 3REWA 3L3OA 4KTDL 5HD8C 1SHMA 4UOW1 4W4OC 4XT1C 5C0BD 1GOHA 5DFVD 3K8MA 2SEBA 4TQEL 5DHXB 4PJIF 1JHLH 4NDMB 1YYML 4HJGA 5IHBA 3D5OF 3MOBL 5E8OA 3G08A 4ZOBA 1P84K 3HZVB 1RVFH 5GHWH 5TE6L 4PLOB 4EOWL 1TZGH 1WIPA 3U4EB 2IMNA 1B4JL 4NHUA 3DRQA 3MV7D 3BPCB 4KKNA 3C8DA 3SY0B 1KTDA 1DDHA 3CLEL 3IKCA 5BVJB 3DX9A 2XXCB 5J3HC 5EA0L 2YBRA 4HBCH 4KAQL 3WL9B 1I4FB 2PYEE 5FGBA 3NZ8A 3RBGA 3TVMC 3BRDA 3WNLA 4OZ4B 4BJLA 2CUIA 4MJ5A 4E42B 4F7EA 4XC3H 3ZHKA 4BZ2H 1SJHA 4QTIL 4WUUB 4JDVB 2MQ0A 4YHPA 4U1IA 3WJJC 1KEGL 5F1NA 2AVGA 3SKMA 3X14A 3IDXH 3ZTNH 1FIGL 5C8JB 3GBNL 4LCWA 3UZVB 3NABL 1V7ML 3INUL 3MYJB 2DKMA 4D9QE 3W11D 3L6FA 5SWZB 2HVJB 3IYLW 2NY7H 4KI5E 1IM9A 3MNWA 5D5MB 3VGDA 2XWJB 5SWQA 3UP1A 4UUJA 3SOBH 4PGCA 4JGUA 2VXQL 4IDJL 5D7SH 4PBVC 3RHWK 3DSFH 3HZYA 2WAHA 1FFQA 1HDMB 4RAUB 3MR9B 4RRPG 1CDBA 4ZPVB 4NKOB 3S35H 4P4RB 1BJMA 3MCLL 2XN9E 4L8DB 2R4RL 2CKBL 4DN3H 3BHBA 5MEPA 2AV1B 4PRDB 1CTOA 1KJVB 4GW4A 4LASL 3GNML 3FB8A 4NZTH 3RVVC 3MPCA 1AQKL 3PJSB 4LIQH 3S8WA 4DN4L 1D9KD 8CGTA 2Z9TA 1LGVA 4LVHB 1T0NA 1EEQA 1J1XH 2YPVL 3DBXA 5IEKB 2FB4L 5KTEL 2FX8H 3D69A 2DIAA 3UJJL 3VU2A 4UOJA 3LEVH 1DVFA 4R2GC 5I19H 4H26A 3SKOA 3SJVE 3ULUF 3DUSA 4UQ3B 4XHJD 5DEGB 2NY0B 2R4SH 1INQA 1BBJA 3MRFA 2OX5A 1JRHL 4NGHH 3DVGB 1XEDA 2A1WL 1U8HA 3VRJB 3EFFA 4S1RH 5JORB 2KZ1B 4Z0XB 1NC2B 5CILL 2VLJB 4HWBH 4O4YH 1YECL 4CVXB 2VDQH 1GGIL 3KJ4B 1CLOH 3Q5TA 3RWCB 4ZNEE 4PLKC 4XXDB 2YEZB 3U9UA 3V5KA 4RMTA 1Q0YH 4ODVL 3SGKA 4YK4C 1N8ZA 1N4XH 1YEIL 4KTEL 4DCQA 4LSTH 3PWPE 2BVOA 5ECJE 5T3ZL 4G8EA 5KZCD 3WIFA 3MJGX 1BM3H 4KQ4L 4NRYB 5IT2L 1H3XA 5F88A 2DM3A 4H0IA 2HFEA 5TDNB 1FIEA 1CK0L 2FIKB 3AS3A 4LCCB 1JF6A 2WANA 5TGBB 1KGCD 4UV4H 3OV6A 4UI2A 1KXTB 4O02L 4ZPTA 4F37K 4CVZA 2IFFH 5D6DA 5CJQH 3QEGL 5LWYL 3N50A 1IAOA 1MCFA 4NWUL 4Z7WB 3C5SB 5FCUL 1QG3A 1NCCH 4KI5C 2Q6WB 2XTJB 5DO2D 4EI6B 5T3ZE 5TFSH 3SGJA 1RHFA 3D6GA 1BVLB 3MV9E 5D7LB 2IH1A 1HSBA 1UJ3B 3LKNB 5TPWH 1BEYL 4PJDA 1RHHA 1NCBH 2QKIA 4CW1A 3H0TB 3BGFC 2OSLA 5EIIA 2FO4A 3U79A 1FO0B 1A1MB 2P7TB 1FFPA 2NY4C 3P2TA 4X4ZA 1FN4A 1SYSB 2JE8A 2D03H 4XCEA 3I84A 1WQVT 4W6WB 2XA3A 1MCEA 4MJIB 3KDMA 4OIIH 1FVDB 3D39B 3MA9H 2DQIH 1JK8B 1UH4A 2WWMC 4WWKD 4XPBH 2I5YL 4I3GA 3UMTA 4A2LA 1RMFH 2HJFA 5IQ7H 4OZGE 3O8XB 4XCNB 3F65A 5IJVB 4PJBA 1IGTB 4GRWE 1XF3B 3MXVL 4M1DL 1DBAL 1UWXK 5BV7H 1MNUL 3TH4T 4H88L 4Z0BL 4N9OB 5EOQL 3N1GC 5MENA 3QBTB 1TITA 4HF5L 4G9DB 4P23A 3F58H 3VD7A 35C8L 2I9TB 1RZJL 1D5MA 1I8MB 1WTLA 1T20B 2PO6B 3U83A 1S9YA 4AIXA 4YDJA 4M62L 3VGEA 1W72B 4U6TA 1PYWB 3BESR 4W4NA 1QLRA 3QZWG 3KPTA 4JFDA 1B0GA 3GBMH 5L8JB 3WE6A 4FABH 3B9VA 5C0AA 2VL5A 2PW1B 5DJ6A 5ICXB 3JWDH 4U1LA 4XNXH 4LEOB 2V5YA 1E4XL 1AO7A 4KJWC 2BVPB 1PG7W 1CICC 4QWWC 4MA8H 3EYFA 4P9HL 3UCRA 15C8H 5IVXE 4AM0A 1UKSA 1ADQL 1OB1B 4TSBL 3U7WL 4BK5A 1S7UA 1X7QA 3HC4H 1QNZH 4F57H 2PXYA 2VLMD 3RGVB 3TT1L 1U42A 5GGUA 5EU4B 1BD2B 2FSEB 1N7MH 5DT1L 4L8BA 4Q2ZB 1KCSL 5EORH 5T5NF 3V6OE 4NO2B 3RWJB 5LXGH 2YS4A 5I73B 1JHLL 4JO2H 4M9PA 4RZCA 5ETUA 1NBVH 1F6AA 4AYFA 3JV4A 2ZZUT 4X9IA 5GHWL 4OZHE 1RVFL 2OR9H 5HYSB 2AJVH 2BSED 3RIAF 1TZGL 5DD5H 4MA7H 3MBEA 5DJ2B 5LGHH 3DGGB 4X98B 2EDTA 2HVKA 4YDIH 5ADPL 2FATH 2X9WA 1XF5B 2VQ1B 4HBCL 2R1YA 1I3UA 4X6FA 3RNKB 2C3WA 2DI9A 4Y4KD 3W9EA 2J6EL 2P8MA 2X4UB 4RMWA 3QDGB 5HGHB 2W38A 4JFYB 2FR4B 3OBAA 5GS1A 3FT3A 4XC3L 4BZ2L 2OXHA 1P4IH 1IKFH 2J88H 5F7MC 1LK3H 4CN6A 1R5IA 3IDXL 3ZTNL 3ETBF 5TDOB 2Q8AL 1TIUA 5CEYB 3GKWH 3AM8A 4YFLF 3U36A 4KKAC 3QQ3A 5C0GA 1FLTX 1UC6A 2J8UA 2NXYD 1KV3A 1KPRA 5IB1B 2GSGA 2NY7L 3AB0C 1R0AH 5CMAA 1CFVL 3NFSH 3SOBL 3AY4C 3MXWL 4JRXD 4GG8A 4P5TA 3UDWA 2GY5A 4JJHA 2FEEI 2QBWA 2MJWA 1P7HL 3DSFL 5BXFA 1LK2B 5A16A 4OZIF 3RWHB 5BQ7A 4XP9H 1U91A 4U6YA 4RBPK 4Y16A 3MLSH 3IDYC 3KPRE 2V9TA 3HZKB 4DN3L 3MGTB 3NCFB 1CG9A 2GK0B 1CLCA 5LGKA 1HXYB 3VRLE 2F58H 3CFKB 3CUPB 4NZTL 2OK0H 4LIQL 4RSVA 4JO1L 3K3QA 3RX8A 2H8PA 3QRGH 5BMFL 2F54E 2XPGA 1DLHA 1NC4B 2FX8L 4RFEA 1ZA6B 3QG6A 3VMOA 2G75A 5EC1B 4LF3A 2HFGH 4KUCF 4MX7B 5I19L 4L3CA 4Q74A 2IADB 1IGMH 4MNQB 4GLRH 3F5WA 4IRJD 3HMXL 1TPXB 4QHMA 2Z31A 1J18A 1S9VB 2VLRE 2R4SL 5E6ZA 4BZYA 2NR6D 3UO1H 4C56A 4W6XB 4PRIA 5IVZB 4BFBD 3SDDD 4NGHL 5I75B 1CR9H 4BH7A 3V6OC 4OLXH 2AK4B 3LD8C 2GEEA 1AD9B 2ATPB 3BKML 4L9LC 4S1RL 3ZL4H 4FFYH 1AGEB 1RUKH 1T1WB 2YUVA 3ARXA 2JJSC 4HWBL 3IS0X 4O4YL 1U95B 1GL4B 2HLFC 3MNZB 5IKCB 1D6EB 1EV2E 3NCMA 5KG9B 4NHUE 1I1YB 2Z35A 3VXSD 3T1WA 3QDMA 1UH3A 5FECA 1N4XL 4XNZB 1E0OB 1GYAA 4LSTL 3BH9B 1B0RA 5L2KB 1U2CA 1L0XA 2DYPA 4BFIA 3QUZB 5E08H 3DSNA 4PJ7A 4LHUB 4EDWL 2MOVA 2YSSA 2DQUL 1RIUH 1B90A 3ALXA 4J7RA 5H37H 3T4YB 3TBYA 4JZOA 3SDAB 5DRZA 1UA6H 1JHTA 4PTUA 1A0QH 3WEXA 3WS6C 2JLLA 2X4TB 3GSWB 4HHAB 3ABZA 2JJTC 4X4YB 1WISA 1OP5H 4AZ8A 3BMWA 2J5LC 4IDLA 1F58H 1N6VA 2AQ2A 2ED9A 4LCWE 4S0TD 2XIDA 1OP3K 2EDHA 1NCCL 5GZND 3JV6B 5TFSL 5B4MD 2PN5A 5H35A 3PABB 4L4VB 3ZKMC 3DXAA 4YDLC 2W0KA 3UTTA 2QQNH 1TQBC 5TPWL 4NZJA 1CLYH 1NCBL 3LS4H 4LP4A 5C09E 3TO4C 43CAA 1WAAE 4G6KH 3TWCH 5IV2B 2R2EA 1JWSA 2D03L 2D4FA 3U7YH 4NIKB 4QKXB 4XP5H 5DFTA 1MJUH 5J1SC 1H3UA 3MGAA 4W6YB 2YPLD 5GIRA 4QOKD 3WN5C 5KS9F 5IK3B 4XP4H 3RFZC 3IDNB 4G43A 4G9FB 4NT6A 4OIIL 3T0VA 4PGDB 1I7TA 3MA9L 3TF7A 3EYQC 2H2SD 4F9LC 2DKSA 1CCZA 2DQIL 3KPPB 3ULVD 3OHXB 3A6CH 3QFJB 4KK6D 4NN5C 5HHMD 4P57A 3H9SB 4JJ5A 4O9HH 1RUMH 3L9RB 1RMFL 4ZTPH 5IQ7L 2ATKB 1A3QA 4F37F 4UT6H 1UACH 5CBEB 2HA1A 3VGGA 1M05A 2GJZA 3QDJA 1HH9A 2Z8SA 1W0WA 5BV7L 1KLUA 4QNPE 4PJIA 3CH8A 2VLKE 3VXMD 3MRMA 3F58L 3BYTA 1I75A 4I18C 4YZFE 4ZFZB 4LPUA 4OTXH 5EBMA 1TMCA 1O7VA 1A6AA 1MAJA 2LVEA 3QA3A 3ILPB 5D1QA 4LVNB 5E8EA 1MRCH 3GBML 3I02B 4FQQA 3D87B 1XGPA 2H2PC 1I3RB 4OAWA 4QTHA 1K8IA 1HHJA 1JI1A 4FABL 2WP3O 4JFHD 1D5IH 3JWDL 1AKJA 4XNXL 4N0RA 3FFCB 4IEFB 5F71A 2EIDA 4KMTH 1IGYB 3FB6B 2C3VA 2PNDA 4KMLB 3MUGA 1H3PH 4LGPB 4MA8L 4KH2A 1MUJB 15C8L 5FGBC 4K9EH 2JCCE 5BRZA 4HDIA 3IDMB 1YJDH 3HC4L 4JKLA 1QNZL 4KRLB 3WO3B 3H3PL 4F57L 1G9MH 4GKSA 4B0MM 1U8MA 1XF2A 3KLDA 1MF2H 1N7ML 1HQRB 4XNQB 1JNHA 3BPLB 5FYKU 2QSTA 4JM4H 5FK9A 5EORL 4KU1A 4N1CA 3MRGA 2R1WB 4GT7A 4JPIB 5LXGL 4JO2L 3HR5B 5E9DB 2XY2A 1NBVL 4MD0B 4M8QB 5FV1L 1N26A 2GKIA 3ARDD 1F90H 2FLBT 4V2BA 5FYJD 3MMEA 2OR9L 2AJVL 2A73B 1VKXA 3O3BB 5DD5L 4MA7L 4BQ6A 1GAFH 3PNWB 5LGHL 1QRNA 1ZGLA 4Z7UB 5JHDA 1URLA 4P0DA 1ZS8A 3C08H 4YDIL 2QJDA 3UTQB 4KY1L 3X3GH 4PJDE 2FATL 4PFEA 5BOPA 4JFPB 2ADFH 4DKDC 3NH7H 3MV8D 2BC4B 4FQXB 3BPNB 4WW2F 3L5WB 1J1OL 5E94A 3EYOB 4V1DD 2ICWB 4UAOB 2A9NH 4DFHA 3B9AA 1S7QA 4ZXBD 1P4IL 4P49A 1IKFL 1QSFB 2AI0H 5HDBE 3T0AA 1N3NA 4GW5B 3RKPA 1LK3L 2QR0A 1NBYA 3HC0B 3FT4B 1FNSH 4V3DB 4OV5A 2R2HB 2CO7B 1A14H 3GKWL 1BQLH 1TJHL 5FM4A 5D7JD 4WFHD 1FAKT 4HIXH 4HCRA 1T0MB 1HQ4A 1S7VB 1QOKA 2XKNB 5H2BA 4GKZB 1C08B 4FXKB 1R0AL 3UAJC 2IAND 4F7CA 4PJBE 4IMLB 1GGCH 3NFSL 4XMLH 4UZGA 4HH9B 3AFLA 3WIHA 3MCKA 3RNQB 1DVFC 3KPMA 1GZPA 4TUOB 4G8FA 2GJ6B 4EN3A 4LSRL 5MENE 5DFWH 2DL2A 3JBG7 1FP5A 3QIWD 3MLSL 3C60D 1KN2H 1BAFH 1CXIA 3AU1B 4FMFA 1EAPA 5AYQA 4Q6IB 4OLZH 5DHVA 3GMMB 3SDCD 3CH1B 1HCFX 3GMNB 4OJFH 3FZUC 2OK0L 4DEPC 4LLDA 4ZFOL 1LD9B 5BV7C 3I85A 3TVMB 4ZUWA 3QRGL 3DO7A 4XBPA 4KROB 1TZIA 3SGKC 3LKRA 2GT9B 4Y4HB 4QF1A 2G5BA 4NN7C 3HNSH 5AZEH 1AO7E 4P59H 3QI9D 5EZIH 3WHE0 5ACZA 1WLHA 1CD0A 3LV3B 1BQUA 4EIZC 2HFGL 2EDEA 5EU6B 3QWOA 4K2UH 1IGML 3UEZA 2NTFA 3HHRB 1PKQB 4PJ9A 1DZBA 1PQZA 3MJ9H 3QAZB 5ID1B 3K1DA 4PP1D 4Z5RA 4L4TA 3IGAB 3QWRD 3UO1L 3QQ4A 4ODTL 1YYLH 4X7EC 5A1AA 5D6DC 4OLXL 4HUWA 1K85A 3ZL4L 1F3JB 5F1IB 4FFYL 1QSEA 5IHLB 1XF1A 1T5WB 5IFHL 4OCRH 2Q20A 2CXGA 3SGJC 3OXRB 1BFVH 5E5MB 5GGVH 1ZA3A 2C3GA 1DR9A 3LPFA 4K55A 4GXVL 4EBQH 1JGVH 1OPGH 3HPJA 1M7IB 5ESVB 3ARUA 4WI5A 5E08L 3ULUH 5DD6A 3CX5J 1RZKH 3QFDA 1LEGB 2WLZA 1UA6L 3SGEH 2VISA 1A0QL 2CK0H 3BSZH 4FFZH 1MRFH 3WIHH 3FFDB 3WV0A 4LCUA 5JPNA 3I6KA 4POUB 3FT2A 4YXKH 4MNGE 4NQXA 4WFEE 2KQMA 4JG1H 1F58L 2P8PB 2J8UE 5DS8B 5T1KA 4R2GB 5DHVH 5F9OL 3TJHD 1UWEH 3R0MA 3PE9A 4NCDA 4M7ZC 2GAZB 4XVJH 3TA3A 4BQBA 2QQNL 5C7XH 1CLYL 4GAFB 3LS4L 1FRGH 2CGRH 5EZJB 5HHNA 2BSSB 3T09A 3PHOB 4G6KL 3TWCL 5BZWB 4EI5D 1KTKE 3HZMA 1A3RL 5EU3B 4M93C 5BW7A 4AL8H 1T6VN 2LU3A 3GSQA 3WIIH 4XP5L 3QNYB 3QG7H 3D2UA 3NVQA 1MJUL 5ANMA 1FNGA 3LKPB 4H25A 1NKRA 3VFRA 1KIQB 1F4XL 5EPMB 1IGCL 4XP4L 1MY7A 1UM5H 3VWKA 3O3UN 5DJXA 1WT5A 3S96A 1MCRA 3DX8B 1C7TA 3I50H 4MSWA 3A6CL 2PYEB 1C8PA 3TEUA 4LOUD 4P3WA 3TYFA 5ABDE 3TN0A 4JQIL 1RUML 4V3EB 3CX5K 4X7CC 1XH3B 1WFTA 4ZTPL 3VFVA 1ES0B 1HN1A 4UT6L 1UACL 5HYJD 3SKNB 4G8IB 2EE6A 5ICZB 1F4YH 2DLHA 2X9XA 3WFHA 2ENSA 4EUPB 4JFXB 4NYLB 1MFDH 6CGTA 4IOFD 1CL7I 4Z7OE 4OF3A 1AC6A 4HMCA 3AVEA 4PJ5A 2PXYC 1EH9A 3IAPA 1Q9OA 3BZDA 1ZE3C 1G6RB 3L95A 1OQOA 4CRPA 3BP5A 1AJ7H 2NXZC 3LEYH 4OTXL 5DK0B 4RGNC 4D0BA 4C56E 5D7KE 4PRIE 1JGDB 2A0LD 2ZCHH 4EXPX 4XBGA 3OR7A 1EEYB 1XR9A 3JWNC 1I1AC 1MRCL 3F8UB 2R56L 3OAUH 3OKNB 4XVTH 3E2HA 3IJYB 1UZ6E 2XFXB 5JMOC 2NY4B 4P3CH 3MROB 4TVPH 5DA0B 3T3PF 3DO3A 1D5IL 3LVEA 5DJYB 3MBEC 1OSZB 2XN9B 3MLXH 1ONQB 1QFWI 2HFFA 1RSFA 4KMTL 1RZ8B 3NPSC 5E2WH 1XIWD 2C26A 3QDME 2KKQA 3W5MA 2R15A 1Z5LB 4Y5XB 3G5VA 1J0KA 1OTUC 1U8NA 1UCBL 4X5LA 4MAUH 4JY4A 4PJ7E 4E5XA 1KBGH 2Z93A 1PD6A 3CC5B 1M4KA 1YEGH 4J8RA 1YJDL 4ZSOA 4ZS6C 5GS1C 5C0RH 1J0ZA 2CDEB 4MJ4A 1MHHA 1G9ML 2BVQA 1MF2L 4MA3B 4JM4L 4HS3B 3BN9C 1G7LA 5IB3A 1SM3H 3ARGB 2CKBB 3RZCB 3AM8C 3BD4A 3MZGB 1BF2A 2EH7H 3GRWH 5C0DA 5FB8A 4PRHA 2F5BH 1A47A 5KN5B 4OZIA 2V2XA 5C3LD 2JJUA 4WV1A 4X99B 1F90L 5DJCA 5HVHB 4F8TA 3HS0B 1GAFL 3ZKND 2EDBA 3KPOB 1BREA 4FTVA 1GZQB 2VAAA 3A6OA 3BQUB 4P5TC 1EK3A 5GRVK 3C08L 4WHTB 3UDWC 5MERA 3X3GL 4NQDA 2ADFL 3BP6A 5IP4A 2NW2B 3NH7L 5D8JH 2D7NA 1ROWA 4X9GA 1VACB 1JGEB 3RVUD 1MPAH 4EZMA 4Y16C 4PRPA 2A9NL 1AP2A 3DOSA 5IHUH 2WWMD 1VGEH 1D5XA 1KFAH 2AI0L 3NTCH 3DLQR 2Z0BA 4JRYA 1FNSL 2BY1A 3PWPB 1CICB 1BQLL 2WIIA 1F97A 2R23B 3STBA 4L29B 4HIXL 1ZWIB 2OMNA 2BHYA 3IETB 4N0CD 4ZUSA 3BEVB 1C5BH 1BGXH 2IPKA 4Z95H 3BMVA 5DWUL 2A77H 2G9HB 4LKCB 4FNLH 4NKMA 3ULSB 2YD7A 3HAEB 1GGCL 1KSRA 1I85C 4XMLL 12E8H 5E70A 1MFBH 1NDMB 5I1DA 3QDJE 4I9WD 3WJLA 2DLTA 3P77A 3BUTA 5DJZB 3Q6FB 3F6LA 4LLYB 4PJIE 4HBQA 1MFEH 3DJ9A 5DQJA 5ITFB 3IU3A 1FLRL 2Z31C 4FG6D 1BAFL 1YNKH 2DLFH 5BZDB 3RTQB 1W0YT 3MV9B 3MRQB 4OLZL 4YBLC 5TE4H 4HIJB 4OJFL 3DVNA 3OKKB 5T1LB 1HH6A 4R4NC 4L8CA 5E4EC 4OZFA 5KVGH 2JIXA 4Y5VB 3NBNA 4KK5D 3GGWB 3PHSA 1RUPH 1G7PA 1XGQA 3NIDF 2UVFA 3HNSL 2IAMA 5AZEL 3AROA 3G5YA 3SPVA 2DICA 5EZIL 1R24B 5IF0B 2R2BB 4NRZA 3GB7B 1NDGA 4ZFGH 4OCNC 1K2DA 3WCYA 5JIIA 4HUVB 1MLCA 4HGMA 4K2UL 5CCKH 4ZD3H 5BRZE 1EIBA 3CU7A 4G6JH 1VESA 3MJ9L 4I5BB 4OZGB 4Y8AA 4FHBD 2X10A 3Q3GB 1OY3B 2C9AA 4A6YA 3AB0B 4HAGA 2X4PB 3IRPX 1YYLL 4GRWB 2F53E 5EBLA 1J88A 3NN8A 3ZHDA 3BP7A 5LG1A 3PQYA 4BUHA 1C7SA 5DK3A 1UVQB 1HSAA 4ZODA 3O3EB 4N0FA 5DQ9A 4XRCB 5IR1A 4OCRL 4K9EC 4OB5H 3DETC 1BFVL 1YJDC 5CZXD 5GGVL 1G9MC 4UQ2B 32C2B 3X11A 5ESAA 5KS9A 4EBQL 1JGVL 1OPGL 2F19L 2B8OT 3PV7A 1R3HA 3ULUL 2AJ3B 1RZKL 5E2TH 4WFFE 3O6FB 1XGYL 2CK0L 5DVMA 1M6OB 5JW5A 2Y6SC 2E3VA 3NAAH 3CFEA 5FM8A 3GSOB 3TF7C 2FZ3B 3CFIC 1KIRB 4UDTA 1VEOA 4Y4FB 2B5IB 1VGKA 3QCUL 5HY9A 4F7MA 3N1MC 5KVMC 3ULUE 1UWEL 1JMXA 5E95B 4D3CL 1KLGB 4WUUD 5ERWA 3MNVB 4XI5C 4XVJL 3F7VB 1TLKA 3S37X 4N1EA 1FRGL 1LO5B 2OZ4A 2CGRL 3ZSTA 4OZFH 4Y19A 3LD8B 4DZ8B 4PJXF 1BFOA 3V0VB 1LO4H 5SWZD 3M17B 1MQ8A 2XZQH 4AL8L 1NGWA 4OZHB 2VB5A 3QG7L 4JZJB 5GPRA 3NFPB 1BWMA 1XZ0B 3C8KA 4TNVK 4WDIB 4YHMH 2MMXA 1KNOB 3C6LA 4U1JB 2GHWB 5D1QC 5DYOB 3MA7B 3L3IA 1I9JH 1TZHB 4XTRD 1AGBA 1X5KA 2PTTB 4HX1B 4N8VA 3DV4A 1Q9KA 4A6YH 4NRXA 4PGBB 1CT8A 4MCZB 3IXTA 4P2OA 5DI8A 4KDTA 1IMHC 1SJEB 5EC2B 1L0QA 1MFDL 2F8OA 3LRHA 4O00A 5HI4D 4O51A 1JN6B 4PR5A 4U33A 4RX4D 4I1NB 4P2QB 2J5LB 4YHNA 1LP9F 3RPIB 3DUUB 3MJ6A 2AXFA 5T5NG 5DDHB 3TZVB 4L4TE 3LEYL 4OCYH 2VC2H 4JANB 4MHHI 3MLTB 2ZCHL 1UCTA 2O61A 2HLFD 3MRPA 2VRAA 4YDLB 1T6WA 1OGTB 3OAUL 3I6LE 5IMMB 1XGUA 4WW2A 2OP4H 2P5EA 5FHAH 2J8HA 5JDSA 3TYGH 4L3EA 3D0LA 5J11B 2KPNA 3MLXL 3BZ4B 3W9DB 1C5DA 2FCBA 3MUZ1 1QPXA 2AKRB 5CUSL 5E2WL 2BNRE 4YPGB 1ITBB 4MAUL 5F8RC 1R3LB 2N7AA 3CZJA 1EMTH 3L7FA 1KBGL 4NN5B 1YEGL 5C0RL 1NGQH 1AXTH 3EDKA 3TESA 4TULH 1MCWM 1HINH 1RJLB 3LRSA 1I7RB 4UT9H 5HDOA 1R5VA 4TVPE 2F54B 3P0YH 1WIUA 1SM3L 5EUKB 1VFAB 1KT2A 2EH7L 3GRWL 4HC1A 4YQXH 1FZOA 2F5BL 2XY1A 3FQXB 2YRPA 5DZLA 2G2RB 5CIPA 4I18B 4RQQA 3WUWA 3SO5A 1MWAA 3O6LH 4M61A 3AMLA 4I48B 3REWB 3BPOC 1KB5L 1KTRL 3QUYA 2SEBB 4RMQA 5D8JL 3P9MA 4HUMB 3PXJA 3LAFA 4EN3C 1CE6A 2QL1A 3TP4A 4JVPA 2VDLH 4M1CD 2XTJD 5E8OB 1R3KB 4GBXB 4MD5A 1JMZA 3C8HA 3L5HA 1UWXH 5IHUL 4G6FB 4ZYKA 2K7QA 4X7FC 1KFAL 5ANME 3NTCL 4K8RD 4FQLH 4YGVB 3TIDA 5T1MA 5C0EA 3WLBB 1Q94A 3S4SB 1CD9B 3IKCB 3DX9B 3V4UH 5JIPA 1BVKA 3ULVF 5JZ7C 2DQJH 4EEEA 3WNNA 3RVWD 3BJ91 4YHOH 5T1DH 3CZFA 4M02A 5JW4R 1BGXL 1H5BB 4HD9A 4Z95L 1YPZF 3OJ2C 4DKEL 4KJPD 4B41A 2OL3L 4NFCA 1INEH 2V2TA 2PYFA 3RBSA 12E8L 2KH2B 1MFBL 2ORBH 4LRNL 4YHPB 3S7GA 5DMGD 1L8JA 3D39D 5F1NB 4PJFE 3SKMB 3X14B 2EEAA 5C0BA 2NY3D 1QKZH 3LRGA 1IJ9A 4L1DA 4LCWB 1DCLA 3VMNA 1JPST 5I74B 1MFEL 2OBGA 4HKXA 5EBWA 3MYZA 4PJ5E 3HRPA 4PJ9C 5I30H 1JNNH 2P46B 4HS6B 2IALB 3O8XD 4J4PD 5KOVC 2DLFL 1E6OH 1IM9B 1CQKA 5HYQB 5K9JH 4RCAA 1ZLVK 2FL5A 3MV7A 2VZSA 4ODHH 3KYOA 4JR9H 5TE4L 3ROLB 1PY9A 3VFTA 3C2AH 5KSVA 5C09B 1FVEA 1N0XH 4H1LA 5LCVH 5JQHC 1RU9H 2XA8H 2ICWI 3BAEL