4S0UC

Crystal structure of nkg2d in complex with ulbp6
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
DPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NKG2-D type II integral membrane protein
publication title A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4s0uC00
3D25A 3SKMA 1BZ9A 4S0UC 3RWGA 3VFOA 1LDPH 1FZKA 4F7EA 5D5MA 3SDDA 3P4MA 2VABA 1G7PA 3V5HA 5DDHA 4K7FA 3AREA 4IIQC 3BWAA 4F7CA 4E0RA 3O8XA 3TFKA 4QRPA 4WUUA 1VGKA 5MENA 3VXOA 4PV8A 3HG1A 4U1JA 3X12A 2ZOKA 2GTZA 4MJIA 4PJ5A 3VXUA 3KPMA 1DE4A 3GSXA 2BNQA 3PWNA 2GJ6A 3QDJA 3MGTA 5F1NA 4L8BA 1S7XA 1T7WA 3VWJA 2X4UA 3GSWA 3TBWA 3GMQA 1KPVA 4XXCA 3AM8A 1T20A 3RWJA 1IM9A 5MEPA 1I1FA 1CG9A 4ZUWA 4NNXA 1AGEA 3VXMA 2CLZA 4G59A 2AK4A 5L2KA 4PRDA 3LKQA 5EFIA 1JPGA 1QLFA 1ZVSA 2YPKA 3O9WA 4V3EB 5EU6A 4PJCA 3VFSA 4U1IA 3ARBA 3MRJA 4PRBA 3T1FA 1EFXA 1E27A 3QI9A 3KPOA 2OI9A 3L3JA 1KPRA 5E9DA 1DUZA 5BJTA 4PJGA 2AXFA 1ZHBA 3TA3A 3QDGA 3VFPA 1R3HA 3UTSA 4PJHA 3RL1A 3V5KA 3HCVA 3KLAA 3CVHA 4U1KA 1ZT7A 4NHUE 1UXWA 1ZAGA 1MHEA 1S9YA 1BD2A 4MJ5A 1LEKA 3LKSA 4HWZA 2H26A 1LQVA 2NX5A 4L8SC 1LEGA 3RWCA 2X4PA 1WBZA 3BO8A 2AKRA 4MQ7A 2V2XA 2VLRA 3QULA 2VE6A 1AO7A 1QVOA 3C8KA 3H7BA 2H6PA 2CLRA 4PG2A 5EO0A 1KTLA 2CLVA 3TN0A 3FONA 4PG9A 2A83A 2VAAA 4Y4KA 3GMOA 3X13A 5B38A 3GIVA 4WWKC 1ZSDA 3L9RA 1S9WA 1ONQA 4LCWA 4Y2DA 1XR9A 3SCMA 1JF1A 1T7VA 4JRYA 5D9SA 5IB5A 3TF7A 3MRLA 1KJ2H 3DX7A 2GTWA 3BZFA 1FO0H 1UQSA 4F7TA 5EOTA 5C0EA 2BSTA 4NQDA 3TBSA 1OGAA 2MHAA 1S9XA 3RZCA 1AGFA 1IM3A 1EEYA 1X7QA 3ROOA 4CVXA 3TIEA 2ZSVA 1XR8A 3MV7A 4Y16A 4NQEA 1ZHKA 1KCGC 3L3GA 4WU7A 3QUZA 1S8DA 3DTXA 3P73A 3PQYA 4L9LC 3FQXA 5HHOA 1JHTA 2UWEA 3BH8A 4F7MA 1YN6A 3BEWA 3OXSA 3KPQA 3LKNA 5HHQA 1KJ3H 3WLBA 4G43A 4JFEA 3O3BA 5MEOA 2X4SA 3C9NA 1CE6A 3ERYA 4HX1A 4PRHA 3TO2A 1JGEA 5IB4A 4L8DA 4O2EA 4L8CA 3FQUA 2ESVA 4I4WA 4N0UA 1ED3A 3FQWA 1ZT1A 1JFMA 2PYEA 1PQZA 3QUKA 4G8GA 3MRDA 5SWZA 3MRBA 3MRRA 4X6CA 3RGVC 1LD9A 5C0JA 3IXAA 5HGHA 4JFPA 1FZJA 1MHCA 3BHBA 3VWKA 5HHPA 4O2CA 1A1OA 2J8UA 3CH1A 1I4FA 4L3EA 4PJIA 2OL3H 1KPUA 4PGDA 4PRIA 4D0BA 3TBYA 4WW2C 3LV3A 3NFNA 4CVZA 2DYPA 4N5EA 1K5NA 1EEZA 5FA4A 3PWUA 1C16A 4MNGA 1G6RH 3GMLA 1AGBA 3KXFA 4HUWA 3FTGA 4ZUSA 1T1XA 4PGCA 3MV8A 4PDCE 3VCLA 4L4TA 2X4NA 3ILQC 3MRPA 3E3QA 1HYRC 2HLAA 3P9MA 3SDCA 3VFTA 1P4LA 3GSOA 1RJZA 5EU5A 4D0DA 1I1AA 1M6OA 1XZ0A 2BVPA 3DX6A 5D7IA 1A1MA 2GUOA 1S7SA 1S7VA 4Y4HA 3CCHA 1B0GA 1SYVA 2WY3A 3MRHA 3VXPA 3GSVA 3BZEA 4N8VA 2BVQA 3SDAA 3SJVA 2NW3A 3B6SA 2AV1A 1HHHA 3D2UA 3VXRA 4PJ9A 1NAMH 4HS3A 3S6CA 5IVXA 3HAEA 1MWAH 1P7QA 3JTTA 5AD0A 3CPLA 2ZSWA 2XFXA 4U1LA 2CIKA 1T1YA 3FOLA 5E00A 4Z76A 5E8NA 1B0RA 4QRUA 3L3HA 5BXFA 3KPPA 3QQ3A 4ZUTA 1FFPA 1SYSA 1JE6A 5FA3A 1M05A 3PWVA 4NQXA 3PABA 3B3IA 4QOKA 3TIDA 3VFVA 1UXSA 5SWQA 1GZQA 2AV7A 3BVNA 5H94A 4WDIA 2CIIA 5HHNA 2X4OA 3FQTA 4G42A 1T21A 1ZHNA 3BP4A 4PJDA 1A6ZA 4NNYA 4G9FA 1KBGH 1TMCA 1WBXA 3DX8A 4K71B 4PV9A 3P4OA 3GMRA 3CZFA 3D18A 1BIIA 4MXQA 1FFOA 1VACA 3G08A 4ELMA 3P9LA 4O2FA 3MRCA 2Q7YA 3RWIA 1I7UA 5SWSA 4FTVA 3E6HA 3KYNA 1GZPA 3QFDA 2BSRA 3MRNA 5F9JA 1FFNA 3QUXA 4F7PA 5IEKA 2BCKA 4PJFA 1T1ZA 4U6YA 5F1IA 5HYJA 4GKNA 3TZVC 3GMNA 3HPJA 3LKPA 3VRJA 5J6HA 1T7ZA 3LN5A 5INDA 3VFNA 1ZHLA 5BRZA 3SPVA 5C9JA 1T22A 5HGBA 1NEZA 1ZT4A 4HUUA 3MRFA 1S7QA 3RWEA 5L2JA 1HSBA 1Z5LA 3DXAA 3O3AA 2VLJA 3BW9A 2F74A 2VLLA 4FFEX 1N2RA 4D0CA 1AGDA 1OF2A 3MA7A 5C0CA 2FO4A 3X11A 3TPUE 3U0PA 3PWLA 5INCA 3TVMA 4EN3C 3DBXA 4JFQA 5HGAA 4MVBA 5DEFA 3HE7A 4U1HA 5DEGA 3VXSA 3QFJA 1LP9A 4ZUUA 3TJHA 1HHIA 5C0IA 5MEQA 3W39A 4ZAKA 5C0AA 1JUFA 2GITA 1RK1A 1OGTA 4Z78A 4G9DA 5E8OA 4WJ5A 4PREA 5J1AA 1DUYA 2F54A 3HLAA 4JFOA 1OSZA 3MR9A 1ZS8A 1S7WA 4X6FA 5C09A 3REWA 3L3DA 3D3VA 1XH3A 1KJVA 4ZUVA 3RWFA 4EI5A 2FYYA 3GSRA 4JRXA 3X14A 5FKPA 4JFFA 1I7TA 3V5DA 1T7XA 1WBYA 3O3DA 3DMMA 3CC5A 1QR1A 3H9HA 3ES6A 3P77A 3TBVA 3JTCA 3QQ4A 3WUWA 1W0VA 3L3IA 5D7LA 3M17A 4ONOA 3UPRA 1T0NA 3MRIA 1G7QA 1QO3A 1INQA 3L3KA 5D7JC 4PRNA 3UBXA 2FWOA 3ARFA 3GMPA 1B3JA 2AXGA 2X4TA 2X4RA 3MRQA 4NQVA 2BNRA 4QRTA 1N3NA 1U58A 1AKJA 1HHGA 1T1WA 3O4LA 3ECBA 3GJFA 3VRIA 5JHDA 2FIKA 2E7LE 1HSAA 1K8DA 2BVOA 1JGDA 1HHJA 3QZWA 3UTTA 3FT2A 4NO5A 5F7DA 3GMMA 3D39A 5GSRA 1I1YA 4QRRA 2CKBH 5EUOA 1QSEA 4UQ3A 3MREA 4X6DA 4QRSA 3LKRA 3FRUA 4X6EA 1L8JA 2V2WA 4PJEA 4HKJA 4HUVA 4GUPA 3WS3A 3ARDA 1P1ZA 3UTQA 3LKOA 3MRMA 3GSQA 3FQRA 4PR5A 3MYJA 4LNRA 5GSVA 4APQA 1QSFA 4N0CA 1W0WA 3KPLA 3PWJA 2X70A 1S7TA 2GT9A 4U1NA 5IB1A 2P5EA 3BUYA 3MROA 5C08A 2F53A 3VXNA 1KJMA 1HHKA 3MV9A 5EU4A 5C0FA 4UQ2A 4G8IA 1JPFA 1RJYA 4I48A 3KWWA 3TBTA 1I7RA 3MGOA 3PWPA 4NSKA 3CDGA 3H9SA 3MRGA 4U6XA 2GAZA 3VFUA 5HHMA 4NO0A 1FZOA 3KYOA 4MJ6A 4L29A 2RFXA 3VJ6A 3O3EA 1EXUA 4PP8C 5EO1A 5IROA 3BP7A 4PRAA 1AGCA 4IRSA 2XPGA 5IB3A 1T0MA 4NQCA 1HOCA 2D31A 1RK0A 1N59A 4Y4FA 5ACZA 3FOMA 1Q94A 3I6GA 2P5WA 3OX8A 4LCYA 4PJBA 1QRNA 3JVGA 1YPZA 5IB2A 4PGBA 4PGEA 4LCCC 5BS0A 3P4NA 1QEWA 2YPLA 3SKOA 5C07A 1TVHA 4WO4A 4NO3A 4U1SA 1YDPA 1CD1A 3ARGA 4NT6A 1A1NA 1S7UA 1LK2A 3E6FA 1YN7A 5IEHA 4IHOA 3MRKA 3VFRA 4Z77A 1A9BA 3ROLA 3KPNA 4L4VA 3AU1A 1NANH 3KPSA 4LHUA 3VFMA 4CW1A 3E2HA 3JTSA 4PJ8A 1QQDA 3I6LD 1N5AA 4EUPA 3RTQA 3I6KA 4MS8A 3SDXA 3FFCA 3ILPA 4L3CA 4PJAA 5D2NA 4E5XA 3RWDA 4JQXA 2X4QA 5HGDA 4MX7A 5C0DA 1TVBA 4HUXA 3LN4A 2HJLA 3QUYA 1W72A 5D2LA 4JFDA 3RUGA 1A9EA 4QRQA 3FT3A 3WS6A 5MERA 2JCCA 1E28A 2YEZA 3BGMA 3BH9A 4V3DB 1VADA 3OXRA 4NO2A 3RL2A 3HUJA 5ENWA 4JQVA 3TO4A 2PO6A 1DDHA 4GKSA 5EU3A 5ISZA 3KPRA 4PJ7A 1T80A 3FQNA 3QEQA 2ZOLA 5E8PA 4ZFZA 5FDWA 4MNQA 5J6GA 4U1MA 2BSSA 2HN7A 3RWHA 3FT4A 5C0BA 4WU5A 4N0FA 5B39A 2VLKA 2FZ3A 3OV6A 3IT8D 1MI5A 3HE6A 3VH8A 3QDMA 2HJKA 3M1BA 5E6IC 3W0WA 3WL9A 1BQHA 4PRPA 1S7RA 3VFWA 1T7YA 4PJXA 1FG2A 1FZMA 4HV8A 2C7UA 3GSNH 3GSUA 3T8XA 5C0GA 4IRJA 5IM7A 3BXNA 3BEVA
chains in the Genus database with same CATH superfamily
3D25A 3SKMA 1BZ9A 4S0UC 3RWGA 3VFOA 1LDPH 1FZKA 4F7EA 5D5MA 3SDDA 3P4MA 2VABA 1G7PA 3V5HA 5DDHA 4K7FA 3AREA 4IIQC 3BWAA 4F7CA 4E0RA 3O8XA 3TFKA 4QRPA 4WUUA 1VGKA 5MENA 3VXOA 4PV8A 3HG1A 4U1JA 3X12A 2ZOKA 2GTZA 4MJIA 4PJ5A 3VXUA 3KPMA 1DE4A 3GSXA 2BNQA 4JO8A 3PWNA 2GJ6A 3QDJA 3MGTA 5F1NA 4L8BA 1S7XA 1T7WA 3VWJA 2X4UA 3GSWA 3TBWA 3GMQA 1KPVA 4XXCA 3AM8A 1T20A 3RWJA 1IM9A 5MEPA 1I1FA 1CG9A 4ZUWA 4NNXA 1AGEA 3VXMA 2CLZA 4G59A 2AK4A 5L2KA 4PRDA 3LKQA 5EFIA 1JPGA 1QLFA 1ZVSA 2YPKA 3O9WA 4V3EB 5EU6A 4PJCA 3VFSA 4U1IA 3ARBA 3MRJA 4PRBA 3T1FA 1EFXA 1E27A 3QI9A 3KPOA 2OI9A 3L3JA 1KPRA 5E9DA 1DUZA 5BJTA 2O5NA 4PJGA 2AXFA 1ZHBA 3TA3A 3QDGA 3VFPA 1R3HA 3UTSA 4PJHA 3RL1A 3V5KA 3HCVA 3KLAA 3CVHA 4U1KA 1ZT7A 4NHUE 1UXWA 1ZAGA 1MHEA 1S9YA 1BD2A 4MJ5A 1LEKA 3LKSA 4HWZA 2H26A 1LQVA 2NX5A 4L8SC 1LEGA 3RWCA 2X4PA 1WBZA 3BO8A 2AKRA 4MQ7A 2V2XA 2VLRA 3QULA 2VE6A 1AO7A 1QVOA 3C8KA 3H7BA 2H6PA 2CLRA 4PG2A 5EO0A 1KTLA 2CLVA 3TN0A 3FONA 4PG9A 2A83A 2VAAA 4Y4KA 3GMOA 3X13A 5B38A 3GIVA 4WWKC 1ZSDA 3L9RA 1S9WA 1ONQA 4LCWA 4Y2DA 1XR9A 3SCMA 1JF1A 1T7VA 4JRYA 5D9SA 5IB5A 3TF7A 3MRLA 1KJ2H 3DX7A 2GTWA 3BZFA 1FO0H 1UQSA 4F7TA 5EOTA 5C0EA 2BSTA 4NQDA 3TBSA 1OGAA 2MHAA 1S9XA 3RZCA 1AGFA 1IM3A 1EEYA 1X7QA 3ROOA 4CVXA 3TIEA 2ZSVA 1XR8A 3MV7A 4Y16A 4NQEA 1ZHKA 1KCGC 3L3GA 4WU7A 3QUZA 1S8DA 3DTXA 3P73A 3PQYA 4L9LC 3FQXA 5HHOA 1JHTA 2UWEA 3BH8A 4F7MA 1YN6A 3BEWA 3OXSA 3KPQA 3LKNA 5HHQA 1KJ3H 3WLBA 4G43A 4JFEA 3O3BA 5MEOA 2X4SA 3C9NA 1CE6A 3ERYA 4HX1A 4PRHA 3TO2A 1JGEA 5IB4A 4L8DA 4O2EA 4L8CA 3FQUA 2ESVA 4I4WA 4N0UA 1ED3A 3FQWA 1ZT1A 1JFMA 2PYEA 1PQZA 3QUKA 4G8GA 3MRDA 5SWZA 3MRBA 3MRRA 4X6CA 3RGVC 1LD9A 5C0JA 3IXAA 5HGHA 4JFPA 1FZJA 1MHCA 3BHBA 3VWKA 5HHPA 4O2CA 1A1OA 2J8UA 3CH1A 1I4FA 4L3EA 4PJIA 2OL3H 1KPUA 4PGDA 4PRIA 4D0BA 3TBYA 4WW2C 3LV3A 3NFNA 4CVZA 2DYPA 4N5EA 1K5NA 2NYKA 1EEZA 5FA4A 3PWUA 1C16A 4MNGA 1G6RH 3GMLA 1AGBA 3KXFA 4HUWA 3FTGA 4ZUSA 1T1XA 4PGCA 3MV8A 4PDCE 3VCLA 4L4TA 2X4NA 3ILQC 3MRPA 3E3QA 1HYRC 2HLAA 3P9MA 3SDCA 3VFTA 1P4LA 3GSOA 1RJZA 5EU5A 4D0DA 1I1AA 1M6OA 1XZ0A 2BVPA 3DX6A 5D7IA 1A1MA 2GUOA 1S7SA 1S7VA 4Y4HA 3CCHA 1B0GA 1SYVA 2WY3A 3MRHA 3VXPA 3GSVA 3BZEA 4N8VA 2BVQA 3SDAA 3SJVA 2NW3A 3B6SA 2AV1A 1HHHA 3D2UA 3VXRA 4PJ9A 1NAMH 4HS3A 3S6CA 5IVXA 3HAEA 1MWAH 1P7QA 3JTTA 5AD0A 3CPLA 2ZSWA 2XFXA 4U1LA 2CIKA 1T1YA 3FOLA 5E00A 4Z76A 5E8NA 1B0RA 4QRUA 3L3HA 5BXFA 3KPPA 3QQ3A 4ZUTA 1FFPA 1SYSA 1JE6A 5FA3A 1M05A 3PWVA 4NQXA 3PABA 3B3IA 4QOKA 3TIDA 3VFVA 1UXSA 5SWQA 1GZQA 2AV7A 3BVNA 5H94A 4WDIA 2CIIA 5HHNA 2X4OA 3FQTA 4G42A 1T21A 1ZHNA 3BP4A 4PJDA 1A6ZA 4NNYA 4G9FA 1KBGH 1TMCA 1WBXA 3DX8A 3I0TA 4K71B 4PV9A 3P4OA 3GMRA 3CZFA 3D18A 1BIIA 4MXQA 1FFOA 1VACA 3G08A 4ELMA 3P9LA 4O2FA 3MRCA 2Q7YA 3RWIA 1I7UA 5SWSA 4FTVA 3E6HA 3KYNA 1GZPA 3QFDA 2BSRA 3MRNA 5F9JA 1FFNA 3QUXA 4F7PA 5IEKA 2BCKA 4PJFA 1T1ZA 4U6YA 5F1IA 5HYJA 4GKNA 3TZVC 3GMNA 3HPJA 3LKPA 3VRJA 5J6HA 1T7ZA 3LN5A 5INDA 3VFNA 1ZHLA 5BRZA 3SPVA 5C9JA 1T22A 5HGBA 1NEZA 1ZT4A 4HUUA 3MRFA 1S7QA 3RWEA 5L2JA 1HSBA 1Z5LA 3DXAA 3O3AA 2VLJA 3BW9A 2F74A 2VLLA 4FFEX 1N2RA 4D0CA 1AGDA 1OF2A 3MA7A 5C0CA 2FO4A 3X11A 3TPUE 3U0PA 3PWLA 5INCA 3TVMA 4EN3C 3DBXA 4JFQA 5HGAA 4MVBA 5DEFA 3HE7A 4U1HA 5DEGA 3VXSA 3QFJA 1LP9A 4ZUUA 3TJHA 1HHIA 5C0IA 5MEQA 3W39A 4ZAKA 5C0AA 1JUFA 2GITA 1RK1A 1OGTA 4Z78A 4G9DA 5E8OA 4WJ5A 4PREA 5J1AA 1DUYA 2F54A 3HLAA 4JFOA 1OSZA 3MR9A 1ZS8A 1S7WA 4X6FA 5C09A 3REWA 3L3DA 3D3VA 1XH3A 1KJVA 4ZUVA 3RWFA 4EI5A 2FYYA 3GSRA 4JRXA 3X14A 5FKPA 4JFFA 1I7TA 3V5DA 1T7XA 1WBYA 3O3DA 3DMMA 3CC5A 1QR1A 3H9HA 3ES6A 3P77A 3TBVA 3JTCA 3QQ4A 3WUWA 1W0VA 3L3IA 5D7LA 3M17A 4ONOA 3UPRA 1T0NA 3MRIA 1G7QA 4BKWA 1QO3A 1INQA 3L3KA 5D7JC 4PRNA 3UBXA 2FWOA 3ARFA 3GMPA 1B3JA 2AXGA 2X4TA 2X4RA 3MRQA 4NQVA 2BNRA 4QRTA 1N3NA 1U58A 1AKJA 1HHGA 1T1WA 3O4LA 3ECBA 3GJFA 3VRIA 5JHDA 2FIKA 2E7LE 1HSAA 1K8DA 2BVOA 1JGDA 1HHJA 3QZWA 3UTTA 3FT2A 4NO5A 5F7DA 3GMMA 3D39A 5GSRA 1I1YA 4QRRA 2CKBH 5EUOA 1QSEA 4UQ3A 3MREA 4X6DA 4QRSA 3LKRA 3FRUA 4X6EA 1L8JA 2V2WA 4PJEA 4HKJA 4HUVA 4GUPA 3WS3A 3ARDA 1P1ZA 3UTQA 3LKOA 3MRMA 3GSQA 3FQRA 4PR5A 3MYJA 4LNRA 5GSVA 4APQA 1QSFA 4N0CA 1W0WA 3KPLA 3PWJA 2X70A 1S7TA 2GT9A 4U1NA 5IB1A 2P5EA 3BUYA 3MROA 5C08A 2F53A 3VXNA 1KJMA 1HHKA 3MV9A 5EU4A 5C0FA 4UQ2A 4G8IA 1JPFA 1RJYA 4I48A 3KWWA 3TBTA 1I7RA 3MGOA 3PWPA 4NSKA 3CDGA 4G59C 3H9SA 3MRGA 4U6XA 2GAZA 3VFUA 5HHMA 4NO0A 1FZOA 3KYOA 4MJ6A 4L29A 2RFXA 3VJ6A 3O3EA 1EXUA 4PP8C 5EO1A 5IROA 3BP7A 4PRAA 1AGCA 4IRSA 2XPGA 5IB3A 1T0MA 4NQCA 1HOCA 2D31A 1RK0A 1N59A 4Y4FA 5ACZA 3FOMA 1Q94A 3I6GA 2P5WA 3OX8A 4LCYA 4PJBA 1QRNA 3JVGA 1YPZA 5IB2A 4PGBA 4PGEA 4LCCC 5BS0A 3P4NA 1QEWA 2YPLA 3SKOA 5C07A 1TVHA 4WO4A 4NO3A 4U1SA 1YDPA 1CD1A 3ARGA 4NT6A 1A1NA 1S7UA 1LK2A 3E6FA 1YN7A 5IEHA 4IHOA 3MRKA 3VFRA 4Z77A 1A9BA 3ROLA 3KPNA 4L4VA 3AU1A 1NANH 3KPSA 4LHUA 3VFMA 4CW1A 3E2HA 3JTSA 4PJ8A 1QQDA 3I6LD 1N5AA 4EUPA 3RTQA 3I6KA 4MS8A 3SDXA 3FFCA 3ILPA 4L3CA 4PJAA 5D2NA 2IA1A 4E5XA 3RWDA 4JQXA 2X4QA 5HGDA 4MX7A 5C0DA 1TVBA 4HUXA 3LN4A 2HJLA 3QUYA 1W72A 5D2LA 4JFDA 3RUGA 1A9EA 4QRQA 3FT3A 3WS6A 5MERA 2JCCA 1E28A 2YEZA 3BGMA 3BH9A 4V3DB 1VADA 3OXRA 4NO2A 3RL2A 3HUJA 5ENWA 4JQVA 3TO4A 2PO6A 1DDHA 4GKSA 5EU3A 5ISZA 3KPRA 4PJ7A 1T80A 3FQNA 3QEQA 2ZOLA 5E8PA 4ZFZA 5FDWA 4MNQA 5J6GA 4U1MA 2BSSA 2HN7A 3RWHA 3FT4A 5C0BA 4WU5A 4N0FA 5B39A 2VLKA 2FZ3A 3OV6A 3IT8D 1MI5A 3HE6A 3VH8A 3QDMA 2HJKA 3M1BA 5E6IC 3W0WA 3WL9A 1BQHA 4PRPA 1S7RA 3VFWA 1T7YA 4PJXA 1FG2A 1FZMA 4HV8A 2C7UA 3GSNH 3GSUA 3T8XA 5C0GA 4IRJA 5IM7A 3BXNA 3BEVA
chains in the Genus database with same CATH topology
3D25A 3SKMA 1BZ9A 4S0UC 3RWGA 3VFOA 1LDPH 1FZKA 4F7EA 5D5MA 3SDDA 3P4MA 2VABA 1G7PA 3V5HA 5DDHA 4K7FA 3AREA 4IIQC 3BWAA 4F7CA 4E0RA 3O8XA 3TFKA 4QRPA 4WUUA 1VGKA 5MENA 3VXOA 4PV8A 3HG1A 4U1JA 3X12A 2ZOKA 2GTZA 4MJIA 4PJ5A 3VXUA 3KPMA 1DE4A 3GSXA 2BNQA 3PWNA 2GJ6A 3QDJA 3MGTA 5F1NA 4L8BA 1S7XA 1T7WA 3VWJA 2X4UA 3GSWA 3TBWA 3GMQA 1KPVA 4XXCA 3AM8A 1T20A 3RWJA 1IM9A 5MEPA 1I1FA 1CG9A 4ZUWA 4NNXA 1AGEA 3VXMA 2CLZA 4G59A 2AK4A 5L2KA 4PRDA 3LKQA 5EFIA 1JPGA 1QLFA 1ZVSA 2YPKA 3O9WA 4V3EB 5EU6A 4PJCA 3VFSA 4U1IA 3ARBA 3MRJA 4PRBA 3T1FA 1EFXA 1E27A 3QI9A 3KPOA 2OI9A 3L3JA 1KPRA 5E9DA 1DUZA 5BJTA 4PJGA 2AXFA 1ZHBA 3TA3A 3QDGA 3VFPA 1R3HA 3UTSA 4PJHA 3RL1A 3V5KA 3HCVA 3KLAA 3CVHA 4U1KA 1ZT7A 4NHUE 1UXWA 1ZAGA 1MHEA 1S9YA 1BD2A 4MJ5A 1LEKA 3LKSA 4HWZA 2H26A 1LQVA 2NX5A 4L8SC 1LEGA 3RWCA 2X4PA 1WBZA 3BO8A 2AKRA 4MQ7A 2V2XA 2VLRA 3QULA 2VE6A 1AO7A 1QVOA 3C8KA 3H7BA 2H6PA 2CLRA 4PG2A 5EO0A 1KTLA 2CLVA 3TN0A 3FONA 4PG9A 2A83A 2VAAA 4Y4KA 3GMOA 3X13A 5B38A 3GIVA 4WWKC 1ZSDA 3L9RA 1S9WA 1ONQA 4LCWA 4Y2DA 1XR9A 3SCMA 1JF1A 1T7VA 4JRYA 5D9SA 5IB5A 3TF7A 3MRLA 1KJ2H 3DX7A 2GTWA 3BZFA 1FO0H 1UQSA 4F7TA 5EOTA 5C0EA 2BSTA 4NQDA 3TBSA 1OGAA 2MHAA 1S9XA 3RZCA 1AGFA 1IM3A 1EEYA 1X7QA 3ROOA 4CVXA 3TIEA 2ZSVA 1XR8A 3MV7A 4Y16A 4NQEA 1ZHKA 1KCGC 3L3GA 4WU7A 3QUZA 1S8DA 3DTXA 3P73A 3PQYA 4L9LC 3FQXA 5HHOA 1JHTA 2UWEA 3BH8A 4F7MA 1YN6A 3BEWA 3OXSA 3KPQA 3LKNA 5HHQA 1KJ3H 3WLBA 4G43A 4JFEA 3O3BA 5MEOA 2X4SA 3C9NA 1CE6A 3ERYA 4HX1A 4PRHA 3TO2A 1JGEA 5IB4A 4L8DA 4O2EA 4L8CA 3FQUA 2ESVA 4I4WA 4N0UA 1ED3A 3FQWA 1ZT1A 1JFMA 2PYEA 1PQZA 3QUKA 4G8GA 3MRDA 5SWZA 3MRBA 3MRRA 4X6CA 3RGVC 1LD9A 5C0JA 3IXAA 5HGHA 4JFPA 1FZJA 1MHCA 3BHBA 3VWKA 5HHPA 4O2CA 1A1OA 2J8UA 3CH1A 1I4FA 4L3EA 4PJIA 2OL3H 1KPUA 4PGDA 4PRIA 4D0BA 3TBYA 4WW2C 3LV3A 3NFNA 4CVZA 2DYPA 4N5EA 1K5NA 1EEZA 5FA4A 3PWUA 1C16A 4MNGA 1G6RH 3GMLA 1AGBA 3KXFA 4HUWA 3FTGA 4ZUSA 1T1XA 4PGCA 3MV8A 4PDCE 3VCLA 4L4TA 2X4NA 3ILQC 3MRPA 3E3QA 1HYRC 2HLAA 3P9MA 3SDCA 3VFTA 1P4LA 3GSOA 1RJZA 5EU5A 4D0DA 1I1AA 1M6OA 1XZ0A 2BVPA 3DX6A 5D7IA 1A1MA 2GUOA 1S7SA 1S7VA 4Y4HA 3CCHA 1B0GA 1SYVA 2WY3A 3MRHA 3VXPA 3GSVA 3BZEA 4N8VA 2BVQA 3SDAA 3SJVA 2NW3A 3B6SA 2AV1A 1HHHA 3D2UA 3VXRA 4PJ9A 1NAMH 4HS3A 3S6CA 5IVXA 3HAEA 1MWAH 1P7QA 3JTTA 5AD0A 3CPLA 2ZSWA 2XFXA 4U1LA 2CIKA 1T1YA 3FOLA 5E00A 4Z76A 5E8NA 1B0RA 4QRUA 3L3HA 5BXFA 3KPPA 3QQ3A 4ZUTA 1FFPA 1SYSA 1JE6A 5FA3A 1M05A 3PWVA 4NQXA 3PABA 3B3IA 4QOKA 3TIDA 3VFVA 1UXSA 5SWQA 1GZQA 2AV7A 3BVNA 5H94A 4WDIA 2CIIA 5HHNA 2X4OA 3FQTA 4G42A 1T21A 1ZHNA 3BP4A 4PJDA 1A6ZA 4NNYA 4G9FA 1KBGH 1TMCA 1WBXA 3DX8A 4K71B 4PV9A 3P4OA 3GMRA 3CZFA 3D18A 1BIIA 4MXQA 1FFOA 1VACA 3G08A 4ELMA 3P9LA 4O2FA 3MRCA 2Q7YA 3RWIA 1I7UA 5SWSA 4FTVA 3E6HA 3KYNA 1GZPA 3QFDA 2BSRA 3MRNA 5F9JA 1FFNA 3QUXA 4F7PA 5IEKA 2BCKA 4PJFA 1T1ZA 4U6YA 5F1IA 5HYJA 4GKNA 3TZVC 3GMNA 3HPJA 3LKPA 3VRJA 5J6HA 1T7ZA 3LN5A 5INDA 3VFNA 1ZHLA 5BRZA 3SPVA 5C9JA 1T22A 5HGBA 1NEZA 1ZT4A 4HUUA 3MRFA 1S7QA 3RWEA 5L2JA 1HSBA 1Z5LA 3DXAA 3O3AA 2VLJA 3BW9A 2F74A 2VLLA 4FFEX 1N2RA 4D0CA 1AGDA 1OF2A 3MA7A 5C0CA 2FO4A 3X11A 3TPUE 3U0PA 3PWLA 5INCA 3TVMA 4EN3C 3DBXA 4JFQA 5HGAA 4MVBA 5DEFA 3HE7A 4U1HA 5DEGA 3VXSA 3QFJA 1LP9A 4ZUUA 3TJHA 1HHIA 5C0IA 5MEQA 3W39A 4ZAKA 5C0AA 1JUFA 2GITA 1RK1A 1OGTA 4Z78A 4G9DA 5E8OA 4WJ5A 4PREA 5J1AA 1DUYA 2F54A 3HLAA 4JFOA 1OSZA 3MR9A 1ZS8A 1S7WA 4X6FA 5C09A 3REWA 3L3DA 3D3VA 1XH3A 1KJVA 4ZUVA 3RWFA 4EI5A 2FYYA 3GSRA 4JRXA 3X14A 5FKPA 4JFFA 1I7TA 3V5DA 1T7XA 1WBYA 3O3DA 3DMMA 3CC5A 1QR1A 3H9HA 3ES6A 3P77A 3TBVA 3JTCA 3QQ4A 3WUWA 1W0VA 3L3IA 5D7LA 3M17A 4ONOA 3UPRA 1T0NA 3MRIA 1G7QA 1QO3A 1INQA 3L3KA 5D7JC 4PRNA 3UBXA 2FWOA 3ARFA 3GMPA 1B3JA 2AXGA 2X4TA 2X4RA 3MRQA 4NQVA 2BNRA 4QRTA 1N3NA 1U58A 1AKJA 1HHGA 1T1WA 3O4LA 3ECBA 3GJFA 3VRIA 5JHDA 2FIKA 2E7LE 1HSAA 1K8DA 2BVOA 1JGDA 1HHJA 3QZWA 3UTTA 3FT2A 4NO5A 5F7DA 3GMMA 3D39A 5GSRA 1I1YA 4QRRA 2CKBH 5EUOA 1QSEA 4UQ3A 3MREA 4X6DA 4QRSA 3LKRA 3FRUA 4X6EA 1L8JA 2V2WA 4PJEA 4HKJA 4HUVA 4GUPA 3WS3A 3ARDA 1P1ZA 3UTQA 3LKOA 3MRMA 3GSQA 3FQRA 4PR5A 3MYJA 4LNRA 5GSVA 4APQA 1QSFA 4N0CA 1W0WA 3KPLA 3PWJA 2X70A 1S7TA 2GT9A 4U1NA 5IB1A 2P5EA 3BUYA 3MROA 5C08A 2F53A 3VXNA 1KJMA 1HHKA 3MV9A 5EU4A 5C0FA 4UQ2A 4G8IA 1JPFA 1RJYA 4I48A 3KWWA 3TBTA 1I7RA 3MGOA 3PWPA 4NSKA 3CDGA 3H9SA 3MRGA 4U6XA 2GAZA 3VFUA 5HHMA 4NO0A 1FZOA 3KYOA 4MJ6A 4L29A 2RFXA 3VJ6A 3O3EA 1EXUA 4PP8C 5EO1A 5IROA 3BP7A 4PRAA 1AGCA 4IRSA 2XPGA 5IB3A 1T0MA 4NQCA 1HOCA 2D31A 1RK0A 1N59A 4Y4FA 5ACZA 3FOMA 1Q94A 3I6GA 2P5WA 3OX8A 4LCYA 4PJBA 1QRNA 3JVGA 1YPZA 5IB2A 4PGBA 4PGEA 4LCCC 5BS0A 3P4NA 1QEWA 2YPLA 3SKOA 5C07A 1TVHA 4WO4A 4NO3A 4U1SA 1YDPA 1CD1A 3ARGA 4NT6A 1A1NA 1S7UA 1LK2A 3E6FA 1YN7A 5IEHA 4IHOA 3MRKA 3VFRA 4Z77A 1A9BA 3ROLA 3KPNA 4L4VA 3AU1A 1NANH 3KPSA 4LHUA 3VFMA 4CW1A 3E2HA 3JTSA 4PJ8A 1QQDA 3I6LD 1N5AA 4EUPA 3RTQA 3I6KA 4MS8A 3SDXA 3FFCA 3ILPA 4L3CA 4PJAA 5D2NA 4E5XA 3RWDA 4JQXA 2X4QA 5HGDA 4MX7A 5C0DA 1TVBA 4HUXA 3LN4A 2HJLA 3QUYA 1W72A 5D2LA 4JFDA 3RUGA 1A9EA 4QRQA 3FT3A 3WS6A 5MERA 2JCCA 1E28A 2YEZA 3BGMA 3BH9A 4V3DB 1VADA 3OXRA 4NO2A 3RL2A 3HUJA 5ENWA 4JQVA 3TO4A 2PO6A 1DDHA 4GKSA 5EU3A 5ISZA 3KPRA 4PJ7A 1T80A 3FQNA 3QEQA 2ZOLA 5E8PA 4ZFZA 5FDWA 4MNQA 5J6GA 4U1MA 2BSSA 2HN7A 3RWHA 3FT4A 5C0BA 4WU5A 4N0FA 5B39A 2VLKA 2FZ3A 3OV6A 3IT8D 1MI5A 3HE6A 3VH8A 3QDMA 2HJKA 3M1BA 5E6IC 3W0WA 3WL9A 1BQHA 4PRPA 1S7RA 3VFWA 1T7YA 4PJXA 1FG2A 1FZMA 4HV8A 2C7UA 3GSNH 3GSUA 3T8XA 5C0GA 4IRJA 5IM7A 3BXNA 3BEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D25 A;  3SKM A;  1BZ9 A;  4S0U C;  3RWG A;  3VFO A;  1LDP H;  1FZK A;  4F7E A;  5D5M A;  3SDD A;  3P4M A;  2VAB A;  1G7P A;  3V5H A;  5DDH A;  4K7F A;  3ARE A;  4IIQ C;  3BWA A;  4F7C A;  4E0R A;  3O8X A;  3TFK A;  4QRP A;  4WUU A;  1VGK A;  5MEN A;  3VXO A;  4PV8 A;  3HG1 A;  4U1J A;  3X12 A;  2ZOK A;  2GTZ A;  4MJI A;  4PJ5 A;  3VXU A;  3KPM A;  1DE4 A;  3GSX A;  2BNQ A;  3PWN A;  2GJ6 A;  3QDJ A;  3MGT A;  5F1N A;  4L8B A;  1S7X A;  1T7W A;  3VWJ A;  2X4U A;  3GSW A;  3TBW A;  3GMQ A;  1KPV A;  4XXC A;  3AM8 A;  1T20 A;  3RWJ A;  1IM9 A;  5MEP A;  1I1F A;  1CG9 A;  4ZUW A;  4NNX A;  1AGE A;  3VXM A;  2CLZ A;  4G59 A;  2AK4 A;  5L2K A;  4PRD A;  3LKQ A;  5EFI A;  1JPG A;  1QLF A;  1ZVS A;  2YPK A;  3O9W A;  4V3E B;  5EU6 A;  4PJC A;  3VFS A;  4U1I A;  3ARB A;  3MRJ A;  4PRB A;  3T1F A;  1EFX A;  1E27 A;  3QI9 A;  3KPO A;  2OI9 A;  3L3J A;  1KPR A;  5E9D A;  1DUZ A;  5BJT A;  4PJG A;  2AXF A;  1ZHB A;  3TA3 A;  3QDG A;  3VFP A;  1R3H A;  3UTS A;  4PJH A;  3RL1 A;  3V5K A;  3HCV A;  3KLA A;  3CVH A;  4U1K A;  1ZT7 A;  4NHU E;  1UXW A;  1ZAG A;  1MHE A;  1S9Y A;  1BD2 A;  4MJ5 A;  1LEK A;  3LKS A;  4HWZ A;  2H26 A;  1LQV A;  2NX5 A;  4L8S C;  1LEG A;  3RWC A;  2X4P A;  1WBZ A;  3BO8 A;  2AKR A;  4MQ7 A;  2V2X A;  2VLR A;  3QUL A;  2VE6 A;  1AO7 A;  1QVO A;  3C8K A;  3H7B A;  2H6P A;  2CLR A;  4PG2 A;  5EO0 A;  1KTL A;  2CLV A;  3TN0 A;  3FON A;  4PG9 A;  2A83 A;  2VAA A;  4Y4K A;  3GMO A;  3X13 A;  5B38 A;  3GIV A;  4WWK C;  1ZSD A;  3L9R A;  1S9W A;  1ONQ A;  4LCW A;  4Y2D A;  1XR9 A;  3SCM A;  1JF1 A;  1T7V A;  4JRY A;  5D9S A;  5IB5 A;  3TF7 A;  3MRL A;  1KJ2 H;  3DX7 A;  2GTW A;  3BZF A;  1FO0 H;  1UQS A;  4F7T A;  5EOT A;  5C0E A;  2BST A;  4NQD A;  3TBS A;  1OGA A;  2MHA A;  1S9X A;  3RZC A;  1AGF A;  1IM3 A;  1EEY A;  1X7Q A;  3ROO A;  4CVX A;  3TIE A;  2ZSV A;  1XR8 A;  3MV7 A;  4Y16 A;  4NQE A;  1ZHK A;  1KCG C;  3L3G A;  4WU7 A;  3QUZ A;  1S8D A;  3DTX A;  3P73 A;  3PQY A;  4L9L C;  3FQX A;  5HHO A;  1JHT A;  2UWE A;  3BH8 A;  4F7M A;  1YN6 A;  3BEW A;  3OXS A;  3KPQ A;  3LKN A;  5HHQ A;  1KJ3 H;  3WLB A;  4G43 A;  4JFE A;  3O3B A;  5MEO A;  2X4S A;  3C9N A;  1CE6 A;  3ERY A;  4HX1 A;  4PRH A;  3TO2 A;  1JGE A;  5IB4 A;  4L8D A;  4O2E A;  4L8C A;  3FQU A;  2ESV A;  4I4W A;  4N0U A;  1ED3 A;  3FQW A;  1ZT1 A;  1JFM A;  2PYE A;  1PQZ A;  3QUK A;  4G8G A;  3MRD A;  5SWZ A;  3MRB A;  3MRR A;  4X6C A;  3RGV C;  1LD9 A;  5C0J A;  3IXA A;  5HGH A;  4JFP A;  1FZJ A;  1MHC A;  3BHB A;  3VWK A;  5HHP A;  4O2C A;  1A1O A;  2J8U A;  3CH1 A;  1I4F A;  4L3E A;  4PJI A;  2OL3 H;  1KPU A;  4PGD A;  4PRI A;  4D0B A;  3TBY A;  4WW2 C;  3LV3 A;  3NFN A;  4CVZ A;  2DYP A;  4N5E A;  1K5N A;  1EEZ A;  5FA4 A;  3PWU A;  1C16 A;  4MNG A;  1G6R H;  3GML A;  1AGB A;  3KXF A;  4HUW A;  3FTG A;  4ZUS A;  1T1X A;  4PGC A;  3MV8 A;  4PDC E;  3VCL A;  4L4T A;  2X4N A;  3ILQ C;  3MRP A;  3E3Q A;  1HYR C;  2HLA A;  3P9M A;  3SDC A;  3VFT A;  1P4L A;  3GSO A;  1RJZ A;  5EU5 A;  4D0D A;  1I1A A;  1M6O A;  1XZ0 A;  2BVP A;  3DX6 A;  5D7I A;  1A1M A;  2GUO A;  1S7S A;  1S7V A;  4Y4H A;  3CCH A;  1B0G A;  1SYV A;  2WY3 A;  3MRH A;  3VXP A;  3GSV A;  3BZE A;  4N8V A;  2BVQ A;  3SDA A;  3SJV A;  2NW3 A;  3B6S A;  2AV1 A;  1HHH A;  3D2U A;  3VXR A;  4PJ9 A;  1NAM H;  4HS3 A;  3S6C A;  5IVX A;  3HAE A;  1MWA H;  1P7Q A;  3JTT A;  5AD0 A;  3CPL A;  2ZSW A;  2XFX A;  4U1L A;  2CIK A;  1T1Y A;  3FOL A;  5E00 A;  4Z76 A;  5E8N A;  1B0R A;  4QRU A;  3L3H A;  5BXF A;  3KPP A;  3QQ3 A;  4ZUT A;  1FFP A;  1SYS A;  1JE6 A;  5FA3 A;  1M05 A;  3PWV A;  4NQX A;  3PAB A;  3B3I A;  4QOK A;  3TID A;  3VFV A;  1UXS A;  5SWQ A;  1GZQ A;  2AV7 A;  3BVN A;  5H94 A;  4WDI A;  2CII A;  5HHN A;  2X4O A;  3FQT A;  4G42 A;  1T21 A;  1ZHN A;  3BP4 A;  4PJD A;  1A6Z A;  4NNY A;  4G9F A;  1KBG H;  1TMC A;  1WBX A;  3DX8 A;  4K71 B;  4PV9 A;  3P4O A;  3GMR A;  3CZF A;  3D18 A;  1BII A;  4MXQ A;  1FFO A;  1VAC A;  3G08 A;  4ELM A;  3P9L A;  4O2F A;  3MRC A;  2Q7Y A;  3RWI A;  1I7U A;  5SWS A;  4FTV A;  3E6H A;  3KYN A;  1GZP A;  3QFD A;  2BSR A;  3MRN A;  5F9J A;  1FFN A;  3QUX A;  4F7P A;  5IEK A;  2BCK A;  4PJF A;  1T1Z A;  4U6Y A;  5F1I A;  5HYJ A;  4GKN A;  3TZV C;  3GMN A;  3HPJ A;  3LKP A;  3VRJ A;  5J6H A;  1T7Z A;  3LN5 A;  5IND A;  3VFN A;  1ZHL A;  5BRZ A;  3SPV A;  5C9J A;  1T22 A;  5HGB A;  1NEZ A;  1ZT4 A;  4HUU A;  3MRF A;  1S7Q A;  3RWE A;  5L2J A;  1HSB A;  1Z5L A;  3DXA A;  3O3A A;  2VLJ A;  3BW9 A;  2F74 A;  2VLL A;  4FFE X;  1N2R A;  4D0C A;  1AGD A;  1OF2 A;  3MA7 A;  5C0C A;  2FO4 A;  3X11 A;  3TPU E;  3U0P A;  3PWL A;  5INC A;  3TVM A;  4EN3 C;  3DBX A;  4JFQ A;  5HGA A;  4MVB A;  5DEF A;  3HE7 A;  4U1H A;  5DEG A;  3VXS A;  3QFJ A;  1LP9 A;  4ZUU A;  3TJH A;  1HHI A;  5C0I A;  5MEQ A;  3W39 A;  4ZAK A;  5C0A A;  1JUF A;  2GIT A;  1RK1 A;  1OGT A;  4Z78 A;  4G9D A;  5E8O A;  4WJ5 A;  4PRE A;  5J1A A;  1DUY A;  2F54 A;  3HLA A;  4JFO A;  1OSZ A;  3MR9 A;  1ZS8 A;  1S7W A;  4X6F A;  5C09 A;  3REW A;  3L3D A;  3D3V A;  1XH3 A;  1KJV A;  4ZUV A;  3RWF A;  4EI5 A;  2FYY A;  3GSR A;  4JRX A;  3X14 A;  5FKP A;  4JFF A;  1I7T A;  3V5D A;  1T7X A;  1WBY A;  3O3D A;  3DMM A;  3CC5 A;  1QR1 A;  3H9H A;  3ES6 A;  3P77 A;  3TBV A;  3JTC A;  3QQ4 A;  3WUW A;  1W0V A;  3L3I A;  5D7L A;  3M17 A;  4ONO A;  3UPR A;  1T0N A;  3MRI A;  1G7Q A;  1QO3 A;  1INQ A;  3L3K A;  5D7J C;  4PRN A;  3UBX A;  2FWO A;  3ARF A;  3GMP A;  1B3J A;  2AXG A;  2X4T A;  2X4R A;  3MRQ A;  4NQV A;  2BNR A;  4QRT A;  1N3N A;  1U58 A;  1AKJ A;  1HHG A;  1T1W A;  3O4L A;  3ECB A;  3GJF A;  3VRI A;  5JHD A;  2FIK A;  2E7L E;  1HSA A;  1K8D A;  2BVO A;  1JGD A;  1HHJ A;  3QZW A;  3UTT A;  3FT2 A;  4NO5 A;  5F7D A;  3GMM A;  3D39 A;  5GSR A;  1I1Y A;  4QRR A;  2CKB H;  5EUO A;  1QSE A;  4UQ3 A;  3MRE A;  4X6D A;  4QRS A;  3LKR A;  3FRU A;  4X6E A;  1L8J A;  2V2W A;  4PJE A;  4HKJ A;  4HUV A;  4GUP A;  3WS3 A;  3ARD A;  1P1Z A;  3UTQ A;  3LKO A;  3MRM A;  3GSQ A;  3FQR A;  4PR5 A;  3MYJ A;  4LNR A;  5GSV A;  4APQ A;  1QSF A;  4N0C A;  1W0W A;  3KPL A;  3PWJ A;  2X70 A;  1S7T A;  2GT9 A;  4U1N A;  5IB1 A;  2P5E A;  3BUY A;  3MRO A;  5C08 A;  2F53 A;  3VXN A;  1KJM A;  1HHK A;  3MV9 A;  5EU4 A;  5C0F A;  4UQ2 A;  4G8I A;  1JPF A;  1RJY A;  4I48 A;  3KWW A;  3TBT A;  1I7R A;  3MGO A;  3PWP A;  4NSK A;  3CDG A;  3H9S A;  3MRG A;  4U6X A;  2GAZ A;  3VFU A;  5HHM A;  4NO0 A;  1FZO A;  3KYO A;  4MJ6 A;  4L29 A;  2RFX A;  3VJ6 A;  3O3E A;  1EXU A;  4PP8 C;  5EO1 A;  5IRO A;  3BP7 A;  4PRA A;  1AGC A;  4IRS A;  2XPG A;  5IB3 A;  1T0M A;  4NQC A;  1HOC A;  2D31 A;  1RK0 A;  1N59 A;  4Y4F A;  5ACZ A;  3FOM A;  1Q94 A;  3I6G A;  2P5W A;  3OX8 A;  4LCY A;  4PJB A;  1QRN A;  3JVG A;  1YPZ A;  5IB2 A;  4PGB A;  4PGE A;  4LCC C;  5BS0 A;  3P4N A;  1QEW A;  2YPL A;  3SKO A;  5C07 A;  1TVH A;  4WO4 A;  4NO3 A;  4U1S A;  1YDP A;  1CD1 A;  3ARG A;  4NT6 A;  1A1N A;  1S7U A;  1LK2 A;  3E6F A;  1YN7 A;  5IEH A;  4IHO A;  3MRK A;  3VFR A;  4Z77 A;  1A9B A;  3ROL A;  3KPN A;  4L4V A;  3AU1 A;  1NAN H;  3KPS A;  4LHU A;  3VFM A;  4CW1 A;  3E2H A;  3JTS A;  4PJ8 A;  1QQD A;  3I6L D;  1N5A A;  4EUP A;  3RTQ A;  3I6K A;  4MS8 A;  3SDX A;  3FFC A;  3ILP A;  4L3C A;  4PJA A;  5D2N A;  4E5X A;  3RWD A;  4JQX A;  2X4Q A;  5HGD A;  4MX7 A;  5C0D A;  1TVB A;  4HUX A;  3LN4 A;  2HJL A;  3QUY A;  1W72 A;  5D2L A;  4JFD A;  3RUG A;  1A9E A;  4QRQ A;  3FT3 A;  3WS6 A;  5MER A;  2JCC A;  1E28 A;  2YEZ A;  3BGM A;  3BH9 A;  4V3D B;  1VAD A;  3OXR A;  4NO2 A;  3RL2 A;  3HUJ A;  5ENW A;  4JQV A;  3TO4 A;  2PO6 A;  1DDH A;  4GKS A;  5EU3 A;  5ISZ A;  3KPR A;  4PJ7 A;  1T80 A;  3FQN A;  3QEQ A;  2ZOL A;  5E8P A;  4ZFZ A;  5FDW A;  4MNQ A;  5J6G A;  4U1M A;  2BSS A;  2HN7 A;  3RWH A;  3FT4 A;  5C0B A;  4WU5 A;  4N0F A;  5B39 A;  2VLK A;  2FZ3 A;  3OV6 A;  3IT8 D;  1MI5 A;  3HE6 A;  3VH8 A;  3QDM A;  2HJK A;  3M1B A;  5E6I C;  3W0W A;  3WL9 A;  1BQH A;  4PRP A;  1S7R A;  3VFW A;  1T7Y A;  4PJX A;  1FG2 A;  1FZM A;  4HV8 A;  2C7U A;  3GSN H;  3GSU A;  3T8X A;  5C0G A;  4IRJ A;  5IM7 A;  3BXN A;  3BEV A; 
#chains in the Genus database with same CATH topology
 3D25 A;  3SKM A;  1BZ9 A;  4S0U C;  3RWG A;  3VFO A;  1LDP H;  1FZK A;  4F7E A;  5D5M A;  3SDD A;  3P4M A;  2VAB A;  1G7P A;  3V5H A;  5DDH A;  4K7F A;  3ARE A;  4IIQ C;  3BWA A;  4F7C A;  4E0R A;  3O8X A;  3TFK A;  4QRP A;  4WUU A;  1VGK A;  5MEN A;  3VXO A;  4PV8 A;  3HG1 A;  4U1J A;  3X12 A;  2ZOK A;  2GTZ A;  4MJI A;  4PJ5 A;  3VXU A;  3KPM A;  1DE4 A;  3GSX A;  2BNQ A;  4JO8 A;  3PWN A;  2GJ6 A;  3QDJ A;  3MGT A;  5F1N A;  4L8B A;  1S7X A;  1T7W A;  3VWJ A;  2X4U A;  3GSW A;  3TBW A;  3GMQ A;  1KPV A;  4XXC A;  3AM8 A;  1T20 A;  3RWJ A;  1IM9 A;  5MEP A;  1I1F A;  1CG9 A;  4ZUW A;  4NNX A;  1AGE A;  3VXM A;  2CLZ A;  4G59 A;  2AK4 A;  5L2K A;  4PRD A;  3LKQ A;  5EFI A;  1JPG A;  1QLF A;  1ZVS A;  2YPK A;  3O9W A;  4V3E B;  5EU6 A;  4PJC A;  3VFS A;  4U1I A;  3ARB A;  3MRJ A;  4PRB A;  3T1F A;  1EFX A;  1E27 A;  3QI9 A;  3KPO A;  2OI9 A;  3L3J A;  1KPR A;  5E9D A;  1DUZ A;  5BJT A;  2O5N A;  4PJG A;  2AXF A;  1ZHB A;  3TA3 A;  3QDG A;  3VFP A;  1R3H A;  3UTS A;  4PJH A;  3RL1 A;  3V5K A;  3HCV A;  3KLA A;  3CVH A;  4U1K A;  1ZT7 A;  4NHU E;  1UXW A;  1ZAG A;  1MHE A;  1S9Y A;  1BD2 A;  4MJ5 A;  1LEK A;  3LKS A;  4HWZ A;  2H26 A;  1LQV A;  2NX5 A;  4L8S C;  1LEG A;  3RWC A;  2X4P A;  1WBZ A;  3BO8 A;  2AKR A;  4MQ7 A;  2V2X A;  2VLR A;  3QUL A;  2VE6 A;  1AO7 A;  1QVO A;  3C8K A;  3H7B A;  2H6P A;  2CLR A;  4PG2 A;  5EO0 A;  1KTL A;  2CLV A;  3TN0 A;  3FON A;  4PG9 A;  2A83 A;  2VAA A;  4Y4K A;  3GMO A;  3X13 A;  5B38 A;  3GIV A;  4WWK C;  1ZSD A;  3L9R A;  1S9W A;  1ONQ A;  4LCW A;  4Y2D A;  1XR9 A;  3SCM A;  1JF1 A;  1T7V A;  4JRY A;  5D9S A;  5IB5 A;  3TF7 A;  3MRL A;  1KJ2 H;  3DX7 A;  2GTW A;  3BZF A;  1FO0 H;  1UQS A;  4F7T A;  5EOT A;  5C0E A;  2BST A;  4NQD A;  3TBS A;  1OGA A;  2MHA A;  1S9X A;  3RZC A;  1AGF A;  1IM3 A;  1EEY A;  1X7Q A;  3ROO A;  4CVX A;  3TIE A;  2ZSV A;  1XR8 A;  3MV7 A;  4Y16 A;  4NQE A;  1ZHK A;  1KCG C;  3L3G A;  4WU7 A;  3QUZ A;  1S8D A;  3DTX A;  3P73 A;  3PQY A;  4L9L C;  3FQX A;  5HHO A;  1JHT A;  2UWE A;  3BH8 A;  4F7M A;  1YN6 A;  3BEW A;  3OXS A;  3KPQ A;  3LKN A;  5HHQ A;  1KJ3 H;  3WLB A;  4G43 A;  4JFE A;  3O3B A;  5MEO A;  2X4S A;  3C9N A;  1CE6 A;  3ERY A;  4HX1 A;  4PRH A;  3TO2 A;  1JGE A;  5IB4 A;  4L8D A;  4O2E A;  4L8C A;  3FQU A;  2ESV A;  4I4W A;  4N0U A;  1ED3 A;  3FQW A;  1ZT1 A;  1JFM A;  2PYE A;  1PQZ A;  3QUK A;  4G8G A;  3MRD A;  5SWZ A;  3MRB A;  3MRR A;  4X6C A;  3RGV C;  1LD9 A;  5C0J A;  3IXA A;  5HGH A;  4JFP A;  1FZJ A;  1MHC A;  3BHB A;  3VWK A;  5HHP A;  4O2C A;  1A1O A;  2J8U A;  3CH1 A;  1I4F A;  4L3E A;  4PJI A;  2OL3 H;  1KPU A;  4PGD A;  4PRI A;  4D0B A;  3TBY A;  4WW2 C;  3LV3 A;  3NFN A;  4CVZ A;  2DYP A;  4N5E A;  1K5N A;  2NYK A;  1EEZ A;  5FA4 A;  3PWU A;  1C16 A;  4MNG A;  1G6R H;  3GML A;  1AGB A;  3KXF A;  4HUW A;  3FTG A;  4ZUS A;  1T1X A;  4PGC A;  3MV8 A;  4PDC E;  3VCL A;  4L4T A;  2X4N A;  3ILQ C;  3MRP A;  3E3Q A;  1HYR C;  2HLA A;  3P9M A;  3SDC A;  3VFT A;  1P4L A;  3GSO A;  1RJZ A;  5EU5 A;  4D0D A;  1I1A A;  1M6O A;  1XZ0 A;  2BVP A;  3DX6 A;  5D7I A;  1A1M A;  2GUO A;  1S7S A;  1S7V A;  4Y4H A;  3CCH A;  1B0G A;  1SYV A;  2WY3 A;  3MRH A;  3VXP A;  3GSV A;  3BZE A;  4N8V A;  2BVQ A;  3SDA A;  3SJV A;  2NW3 A;  3B6S A;  2AV1 A;  1HHH A;  3D2U A;  3VXR A;  4PJ9 A;  1NAM H;  4HS3 A;  3S6C A;  5IVX A;  3HAE A;  1MWA H;  1P7Q A;  3JTT A;  5AD0 A;  3CPL A;  2ZSW A;  2XFX A;  4U1L A;  2CIK A;  1T1Y A;  3FOL A;  5E00 A;  4Z76 A;  5E8N A;  1B0R A;  4QRU A;  3L3H A;  5BXF A;  3KPP A;  3QQ3 A;  4ZUT A;  1FFP A;  1SYS A;  1JE6 A;  5FA3 A;  1M05 A;  3PWV A;  4NQX A;  3PAB A;  3B3I A;  4QOK A;  3TID A;  3VFV A;  1UXS A;  5SWQ A;  1GZQ A;  2AV7 A;  3BVN A;  5H94 A;  4WDI A;  2CII A;  5HHN A;  2X4O A;  3FQT A;  4G42 A;  1T21 A;  1ZHN A;  3BP4 A;  4PJD A;  1A6Z A;  4NNY A;  4G9F A;  1KBG H;  1TMC A;  1WBX A;  3DX8 A;  3I0T A;  4K71 B;  4PV9 A;  3P4O A;  3GMR A;  3CZF A;  3D18 A;  1BII A;  4MXQ A;  1FFO A;  1VAC A;  3G08 A;  4ELM A;  3P9L A;  4O2F A;  3MRC A;  2Q7Y A;  3RWI A;  1I7U A;  5SWS A;  4FTV A;  3E6H A;  3KYN A;  1GZP A;  3QFD A;  2BSR A;  3MRN A;  5F9J A;  1FFN A;  3QUX A;  4F7P A;  5IEK A;  2BCK A;  4PJF A;  1T1Z A;  4U6Y A;  5F1I A;  5HYJ A;  4GKN A;  3TZV C;  3GMN A;  3HPJ A;  3LKP A;  3VRJ A;  5J6H A;  1T7Z A;  3LN5 A;  5IND A;  3VFN A;  1ZHL A;  5BRZ A;  3SPV A;  5C9J A;  1T22 A;  5HGB A;  1NEZ A;  1ZT4 A;  4HUU A;  3MRF A;  1S7Q A;  3RWE A;  5L2J A;  1HSB A;  1Z5L A;  3DXA A;  3O3A A;  2VLJ A;  3BW9 A;  2F74 A;  2VLL A;  4FFE X;  1N2R A;  4D0C A;  1AGD A;  1OF2 A;  3MA7 A;  5C0C A;  2FO4 A;  3X11 A;  3TPU E;  3U0P A;  3PWL A;  5INC A;  3TVM A;  4EN3 C;  3DBX A;  4JFQ A;  5HGA A;  4MVB A;  5DEF A;  3HE7 A;  4U1H A;  5DEG A;  3VXS A;  3QFJ A;  1LP9 A;  4ZUU A;  3TJH A;  1HHI A;  5C0I A;  5MEQ A;  3W39 A;  4ZAK A;  5C0A A;  1JUF A;  2GIT A;  1RK1 A;  1OGT A;  4Z78 A;  4G9D A;  5E8O A;  4WJ5 A;  4PRE A;  5J1A A;  1DUY A;  2F54 A;  3HLA A;  4JFO A;  1OSZ A;  3MR9 A;  1ZS8 A;  1S7W A;  4X6F A;  5C09 A;  3REW A;  3L3D A;  3D3V A;  1XH3 A;  1KJV A;  4ZUV A;  3RWF A;  4EI5 A;  2FYY A;  3GSR A;  4JRX A;  3X14 A;  5FKP A;  4JFF A;  1I7T A;  3V5D A;  1T7X A;  1WBY A;  3O3D A;  3DMM A;  3CC5 A;  1QR1 A;  3H9H A;  3ES6 A;  3P77 A;  3TBV A;  3JTC A;  3QQ4 A;  3WUW A;  1W0V A;  3L3I A;  5D7L A;  3M17 A;  4ONO A;  3UPR A;  1T0N A;  3MRI A;  1G7Q A;  4BKW A;  1QO3 A;  1INQ A;  3L3K A;  5D7J C;  4PRN A;  3UBX A;  2FWO A;  3ARF A;  3GMP A;  1B3J A;  2AXG A;  2X4T A;  2X4R A;  3MRQ A;  4NQV A;  2BNR A;  4QRT A;  1N3N A;  1U58 A;  1AKJ A;  1HHG A;  1T1W A;  3O4L A;  3ECB A;  3GJF A;  3VRI A;  5JHD A;  2FIK A;  2E7L E;  1HSA A;  1K8D A;  2BVO A;  1JGD A;  1HHJ A;  3QZW A;  3UTT A;  3FT2 A;  4NO5 A;  5F7D A;  3GMM A;  3D39 A;  5GSR A;  1I1Y A;  4QRR A;  2CKB H;  5EUO A;  1QSE A;  4UQ3 A;  3MRE A;  4X6D A;  4QRS A;  3LKR A;  3FRU A;  4X6E A;  1L8J A;  2V2W A;  4PJE A;  4HKJ A;  4HUV A;  4GUP A;  3WS3 A;  3ARD A;  1P1Z A;  3UTQ A;  3LKO A;  3MRM A;  3GSQ A;  3FQR A;  4PR5 A;  3MYJ A;  4LNR A;  5GSV A;  4APQ A;  1QSF A;  4N0C A;  1W0W A;  3KPL A;  3PWJ A;  2X70 A;  1S7T A;  2GT9 A;  4U1N A;  5IB1 A;  2P5E A;  3BUY A;  3MRO A;  5C08 A;  2F53 A;  3VXN A;  1KJM A;  1HHK A;  3MV9 A;  5EU4 A;  5C0F A;  4UQ2 A;  4G8I A;  1JPF A;  1RJY A;  4I48 A;  3KWW A;  3TBT A;  1I7R A;  3MGO A;  3PWP A;  4NSK A;  3CDG A;  4G59 C;  3H9S A;  3MRG A;  4U6X A;  2GAZ A;  3VFU A;  5HHM A;  4NO0 A;  1FZO A;  3KYO A;  4MJ6 A;  4L29 A;  2RFX A;  3VJ6 A;  3O3E A;  1EXU A;  4PP8 C;  5EO1 A;  5IRO A;  3BP7 A;  4PRA A;  1AGC A;  4IRS A;  2XPG A;  5IB3 A;  1T0M A;  4NQC A;  1HOC A;  2D31 A;  1RK0 A;  1N59 A;  4Y4F A;  5ACZ A;  3FOM A;  1Q94 A;  3I6G A;  2P5W A;  3OX8 A;  4LCY A;  4PJB A;  1QRN A;  3JVG A;  1YPZ A;  5IB2 A;  4PGB A;  4PGE A;  4LCC C;  5BS0 A;  3P4N A;  1QEW A;  2YPL A;  3SKO A;  5C07 A;  1TVH A;  4WO4 A;  4NO3 A;  4U1S A;  1YDP A;  1CD1 A;  3ARG A;  4NT6 A;  1A1N A;  1S7U A;  1LK2 A;  3E6F A;  1YN7 A;  5IEH A;  4IHO A;  3MRK A;  3VFR A;  4Z77 A;  1A9B A;  3ROL A;  3KPN A;  4L4V A;  3AU1 A;  1NAN H;  3KPS A;  4LHU A;  3VFM A;  4CW1 A;  3E2H A;  3JTS A;  4PJ8 A;  1QQD A;  3I6L D;  1N5A A;  4EUP A;  3RTQ A;  3I6K A;  4MS8 A;  3SDX A;  3FFC A;  3ILP A;  4L3C A;  4PJA A;  5D2N A;  2IA1 A;  4E5X A;  3RWD A;  4JQX A;  2X4Q A;  5HGD A;  4MX7 A;  5C0D A;  1TVB A;  4HUX A;  3LN4 A;  2HJL A;  3QUY A;  1W72 A;  5D2L A;  4JFD A;  3RUG A;  1A9E A;  4QRQ A;  3FT3 A;  3WS6 A;  5MER A;  2JCC A;  1E28 A;  2YEZ A;  3BGM A;  3BH9 A;  4V3D B;  1VAD A;  3OXR A;  4NO2 A;  3RL2 A;  3HUJ A;  5ENW A;  4JQV A;  3TO4 A;  2PO6 A;  1DDH A;  4GKS A;  5EU3 A;  5ISZ A;  3KPR A;  4PJ7 A;  1T80 A;  3FQN A;  3QEQ A;  2ZOL A;  5E8P A;  4ZFZ A;  5FDW A;  4MNQ A;  5J6G A;  4U1M A;  2BSS A;  2HN7 A;  3RWH A;  3FT4 A;  5C0B A;  4WU5 A;  4N0F A;  5B39 A;  2VLK A;  2FZ3 A;  3OV6 A;  3IT8 D;  1MI5 A;  3HE6 A;  3VH8 A;  3QDM A;  2HJK A;  3M1B A;  5E6I C;  3W0W A;  3WL9 A;  1BQH A;  4PRP A;  1S7R A;  3VFW A;  1T7Y A;  4PJX A;  1FG2 A;  1FZM A;  4HV8 A;  2C7U A;  3GSN H;  3GSU A;  3T8X A;  5C0G A;  4IRJ A;  5IM7 A;  3BXN A;  3BEV A; 
#chains in the Genus database with same CATH homology
 3D25 A;  3SKM A;  1BZ9 A;  4S0U C;  3RWG A;  3VFO A;  1LDP H;  1FZK A;  4F7E A;  5D5M A;  3SDD A;  3P4M A;  2VAB A;  1G7P A;  3V5H A;  5DDH A;  4K7F A;  3ARE A;  4IIQ C;  3BWA A;  4F7C A;  4E0R A;  3O8X A;  3TFK A;  4QRP A;  4WUU A;  1VGK A;  5MEN A;  3VXO A;  4PV8 A;  3HG1 A;  4U1J A;  3X12 A;  2ZOK A;  2GTZ A;  4MJI A;  4PJ5 A;  3VXU A;  3KPM A;  1DE4 A;  3GSX A;  2BNQ A;  3PWN A;  2GJ6 A;  3QDJ A;  3MGT A;  5F1N A;  4L8B A;  1S7X A;  1T7W A;  3VWJ A;  2X4U A;  3GSW A;  3TBW A;  3GMQ A;  1KPV A;  4XXC A;  3AM8 A;  1T20 A;  3RWJ A;  1IM9 A;  5MEP A;  1I1F A;  1CG9 A;  4ZUW A;  4NNX A;  1AGE A;  3VXM A;  2CLZ A;  4G59 A;  2AK4 A;  5L2K A;  4PRD A;  3LKQ A;  5EFI A;  1JPG A;  1QLF A;  1ZVS A;  2YPK A;  3O9W A;  4V3E B;  5EU6 A;  4PJC A;  3VFS A;  4U1I A;  3ARB A;  3MRJ A;  4PRB A;  3T1F A;  1EFX A;  1E27 A;  3QI9 A;  3KPO A;  2OI9 A;  3L3J A;  1KPR A;  5E9D A;  1DUZ A;  5BJT A;  4PJG A;  2AXF A;  1ZHB A;  3TA3 A;  3QDG A;  3VFP A;  1R3H A;  3UTS A;  4PJH A;  3RL1 A;  3V5K A;  3HCV A;  3KLA A;  3CVH A;  4U1K A;  1ZT7 A;  4NHU E;  1UXW A;  1ZAG A;  1MHE A;  1S9Y A;  1BD2 A;  4MJ5 A;  1LEK A;  3LKS A;  4HWZ A;  2H26 A;  1LQV A;  2NX5 A;  4L8S C;  1LEG A;  3RWC A;  2X4P A;  1WBZ A;  3BO8 A;  2AKR A;  4MQ7 A;  2V2X A;  2VLR A;  3QUL A;  2VE6 A;  1AO7 A;  1QVO A;  3C8K A;  3H7B A;  2H6P A;  2CLR A;  4PG2 A;  5EO0 A;  1KTL A;  2CLV A;  3TN0 A;  3FON A;  4PG9 A;  2A83 A;  2VAA A;  4Y4K A;  3GMO A;  3X13 A;  5B38 A;  3GIV A;  4WWK C;  1ZSD A;  3L9R A;  1S9W A;  1ONQ A;  4LCW A;  4Y2D A;  1XR9 A;  3SCM A;  1JF1 A;  1T7V A;  4JRY A;  5D9S A;  5IB5 A;  3TF7 A;  3MRL A;  1KJ2 H;  3DX7 A;  2GTW A;  3BZF A;  1FO0 H;  1UQS A;  4F7T A;  5EOT A;  5C0E A;  2BST A;  4NQD A;  3TBS A;  1OGA A;  2MHA A;  1S9X A;  3RZC A;  1AGF A;  1IM3 A;  1EEY A;  1X7Q A;  3ROO A;  4CVX A;  3TIE A;  2ZSV A;  1XR8 A;  3MV7 A;  4Y16 A;  4NQE A;  1ZHK A;  1KCG C;  3L3G A;  4WU7 A;  3QUZ A;  1S8D A;  3DTX A;  3P73 A;  3PQY A;  4L9L C;  3FQX A;  5HHO A;  1JHT A;  2UWE A;  3BH8 A;  4F7M A;  1YN6 A;  3BEW A;  3OXS A;  3KPQ A;  3LKN A;  5HHQ A;  1KJ3 H;  3WLB A;  4G43 A;  4JFE A;  3O3B A;  5MEO A;  2X4S A;  3C9N A;  1CE6 A;  3ERY A;  4HX1 A;  4PRH A;  3TO2 A;  1JGE A;  5IB4 A;  4L8D A;  4O2E A;  4L8C A;  3FQU A;  2ESV A;  4I4W A;  4N0U A;  1ED3 A;  3FQW A;  1ZT1 A;  1JFM A;  2PYE A;  1PQZ A;  3QUK A;  4G8G A;  3MRD A;  5SWZ A;  3MRB A;  3MRR A;  4X6C A;  3RGV C;  1LD9 A;  5C0J A;  3IXA A;  5HGH A;  4JFP A;  1FZJ A;  1MHC A;  3BHB A;  3VWK A;  5HHP A;  4O2C A;  1A1O A;  2J8U A;  3CH1 A;  1I4F A;  4L3E A;  4PJI A;  2OL3 H;  1KPU A;  4PGD A;  4PRI A;  4D0B A;  3TBY A;  4WW2 C;  3LV3 A;  3NFN A;  4CVZ A;  2DYP A;  4N5E A;  1K5N A;  1EEZ A;  5FA4 A;  3PWU A;  1C16 A;  4MNG A;  1G6R H;  3GML A;  1AGB A;  3KXF A;  4HUW A;  3FTG A;  4ZUS A;  1T1X A;  4PGC A;  3MV8 A;  4PDC E;  3VCL A;  4L4T A;  2X4N A;  3ILQ C;  3MRP A;  3E3Q A;  1HYR C;  2HLA A;  3P9M A;  3SDC A;  3VFT A;  1P4L A;  3GSO A;  1RJZ A;  5EU5 A;  4D0D A;  1I1A A;  1M6O A;  1XZ0 A;  2BVP A;  3DX6 A;  5D7I A;  1A1M A;  2GUO A;  1S7S A;  1S7V A;  4Y4H A;  3CCH A;  1B0G A;  1SYV A;  2WY3 A;  3MRH A;  3VXP A;  3GSV A;  3BZE A;  4N8V A;  2BVQ A;  3SDA A;  3SJV A;  2NW3 A;  3B6S A;  2AV1 A;  1HHH A;  3D2U A;  3VXR A;  4PJ9 A;  1NAM H;  4HS3 A;  3S6C A;  5IVX A;  3HAE A;  1MWA H;  1P7Q A;  3JTT A;  5AD0 A;  3CPL A;  2ZSW A;  2XFX A;  4U1L A;  2CIK A;  1T1Y A;  3FOL A;  5E00 A;  4Z76 A;  5E8N A;  1B0R A;  4QRU A;  3L3H A;  5BXF A;  3KPP A;  3QQ3 A;  4ZUT A;  1FFP A;  1SYS A;  1JE6 A;  5FA3 A;  1M05 A;  3PWV A;  4NQX A;  3PAB A;  3B3I A;  4QOK A;  3TID A;  3VFV A;  1UXS A;  5SWQ A;  1GZQ A;  2AV7 A;  3BVN A;  5H94 A;  4WDI A;  2CII A;  5HHN A;  2X4O A;  3FQT A;  4G42 A;  1T21 A;  1ZHN A;  3BP4 A;  4PJD A;  1A6Z A;  4NNY A;  4G9F A;  1KBG H;  1TMC A;  1WBX A;  3DX8 A;  4K71 B;  4PV9 A;  3P4O A;  3GMR A;  3CZF A;  3D18 A;  1BII A;  4MXQ A;  1FFO A;  1VAC A;  3G08 A;  4ELM A;  3P9L A;  4O2F A;  3MRC A;  2Q7Y A;  3RWI A;  1I7U A;  5SWS A;  4FTV A;  3E6H A;  3KYN A;  1GZP A;  3QFD A;  2BSR A;  3MRN A;  5F9J A;  1FFN A;  3QUX A;  4F7P A;  5IEK A;  2BCK A;  4PJF A;  1T1Z A;  4U6Y A;  5F1I A;  5HYJ A;  4GKN A;  3TZV C;  3GMN A;  3HPJ A;  3LKP A;  3VRJ A;  5J6H A;  1T7Z A;  3LN5 A;  5IND A;  3VFN A;  1ZHL A;  5BRZ A;  3SPV A;  5C9J A;  1T22 A;  5HGB A;  1NEZ A;  1ZT4 A;  4HUU A;  3MRF A;  1S7Q A;  3RWE A;  5L2J A;  1HSB A;  1Z5L A;  3DXA A;  3O3A A;  2VLJ A;  3BW9 A;  2F74 A;  2VLL A;  4FFE X;  1N2R A;  4D0C A;  1AGD A;  1OF2 A;  3MA7 A;  5C0C A;  2FO4 A;  3X11 A;  3TPU E;  3U0P A;  3PWL A;  5INC A;  3TVM A;  4EN3 C;  3DBX A;  4JFQ A;  5HGA A;  4MVB A;  5DEF A;  3HE7 A;  4U1H A;  5DEG A;  3VXS A;  3QFJ A;  1LP9 A;  4ZUU A;  3TJH A;  1HHI A;  5C0I A;  5MEQ A;  3W39 A;  4ZAK A;  5C0A A;  1JUF A;  2GIT A;  1RK1 A;  1OGT A;  4Z78 A;  4G9D A;  5E8O A;  4WJ5 A;  4PRE A;  5J1A A;  1DUY A;  2F54 A;  3HLA A;  4JFO A;  1OSZ A;  3MR9 A;  1ZS8 A;  1S7W A;  4X6F A;  5C09 A;  3REW A;  3L3D A;  3D3V A;  1XH3 A;  1KJV A;  4ZUV A;  3RWF A;  4EI5 A;  2FYY A;  3GSR A;  4JRX A;  3X14 A;  5FKP A;  4JFF A;  1I7T A;  3V5D A;  1T7X A;  1WBY A;  3O3D A;  3DMM A;  3CC5 A;  1QR1 A;  3H9H A;  3ES6 A;  3P77 A;  3TBV A;  3JTC A;  3QQ4 A;  3WUW A;  1W0V A;  3L3I A;  5D7L A;  3M17 A;  4ONO A;  3UPR A;  1T0N A;  3MRI A;  1G7Q A;  1QO3 A;  1INQ A;  3L3K A;  5D7J C;  4PRN A;  3UBX A;  2FWO A;  3ARF A;  3GMP A;  1B3J A;  2AXG A;  2X4T A;  2X4R A;  3MRQ A;  4NQV A;  2BNR A;  4QRT A;  1N3N A;  1U58 A;  1AKJ A;  1HHG A;  1T1W A;  3O4L A;  3ECB A;  3GJF A;  3VRI A;  5JHD A;  2FIK A;  2E7L E;  1HSA A;  1K8D A;  2BVO A;  1JGD A;  1HHJ A;  3QZW A;  3UTT A;  3FT2 A;  4NO5 A;  5F7D A;  3GMM A;  3D39 A;  5GSR A;  1I1Y A;  4QRR A;  2CKB H;  5EUO A;  1QSE A;  4UQ3 A;  3MRE A;  4X6D A;  4QRS A;  3LKR A;  3FRU A;  4X6E A;  1L8J A;  2V2W A;  4PJE A;  4HKJ A;  4HUV A;  4GUP A;  3WS3 A;  3ARD A;  1P1Z A;  3UTQ A;  3LKO A;  3MRM A;  3GSQ A;  3FQR A;  4PR5 A;  3MYJ A;  4LNR A;  5GSV A;  4APQ A;  1QSF A;  4N0C A;  1W0W A;  3KPL A;  3PWJ A;  2X70 A;  1S7T A;  2GT9 A;  4U1N A;  5IB1 A;  2P5E A;  3BUY A;  3MRO A;  5C08 A;  2F53 A;  3VXN A;  1KJM A;  1HHK A;  3MV9 A;  5EU4 A;  5C0F A;  4UQ2 A;  4G8I A;  1JPF A;  1RJY A;  4I48 A;  3KWW A;  3TBT A;  1I7R A;  3MGO A;  3PWP A;  4NSK A;  3CDG A;  3H9S A;  3MRG A;  4U6X A;  2GAZ A;  3VFU A;  5HHM A;  4NO0 A;  1FZO A;  3KYO A;  4MJ6 A;  4L29 A;  2RFX A;  3VJ6 A;  3O3E A;  1EXU A;  4PP8 C;  5EO1 A;  5IRO A;  3BP7 A;  4PRA A;  1AGC A;  4IRS A;  2XPG A;  5IB3 A;  1T0M A;  4NQC A;  1HOC A;  2D31 A;  1RK0 A;  1N59 A;  4Y4F A;  5ACZ A;  3FOM A;  1Q94 A;  3I6G A;  2P5W A;  3OX8 A;  4LCY A;  4PJB A;  1QRN A;  3JVG A;  1YPZ A;  5IB2 A;  4PGB A;  4PGE A;  4LCC C;  5BS0 A;  3P4N A;  1QEW A;  2YPL A;  3SKO A;  5C07 A;  1TVH A;  4WO4 A;  4NO3 A;  4U1S A;  1YDP A;  1CD1 A;  3ARG A;  4NT6 A;  1A1N A;  1S7U A;  1LK2 A;  3E6F A;  1YN7 A;  5IEH A;  4IHO A;  3MRK A;  3VFR A;  4Z77 A;  1A9B A;  3ROL A;  3KPN A;  4L4V A;  3AU1 A;  1NAN H;  3KPS A;  4LHU A;  3VFM A;  4CW1 A;  3E2H A;  3JTS A;  4PJ8 A;  1QQD A;  3I6L D;  1N5A A;  4EUP A;  3RTQ A;  3I6K A;  4MS8 A;  3SDX A;  3FFC A;  3ILP A;  4L3C A;  4PJA A;  5D2N A;  4E5X A;  3RWD A;  4JQX A;  2X4Q A;  5HGD A;  4MX7 A;  5C0D A;  1TVB A;  4HUX A;  3LN4 A;  2HJL A;  3QUY A;  1W72 A;  5D2L A;  4JFD A;  3RUG A;  1A9E A;  4QRQ A;  3FT3 A;  3WS6 A;  5MER A;  2JCC A;  1E28 A;  2YEZ A;  3BGM A;  3BH9 A;  4V3D B;  1VAD A;  3OXR A;  4NO2 A;  3RL2 A;  3HUJ A;  5ENW A;  4JQV A;  3TO4 A;  2PO6 A;  1DDH A;  4GKS A;  5EU3 A;  5ISZ A;  3KPR A;  4PJ7 A;  1T80 A;  3FQN A;  3QEQ A;  2ZOL A;  5E8P A;  4ZFZ A;  5FDW A;  4MNQ A;  5J6G A;  4U1M A;  2BSS A;  2HN7 A;  3RWH A;  3FT4 A;  5C0B A;  4WU5 A;  4N0F A;  5B39 A;  2VLK A;  2FZ3 A;  3OV6 A;  3IT8 D;  1MI5 A;  3HE6 A;  3VH8 A;  3QDM A;  2HJK A;  3M1B A;  5E6I C;  3W0W A;  3WL9 A;  1BQH A;  4PRP A;  1S7R A;  3VFW A;  1T7Y A;  4PJX A;  1FG2 A;  1FZM A;  4HV8 A;  2C7U A;  3GSN H;  3GSU A;  3T8X A;  5C0G A;  4IRJ A;  5IM7 A;  3BXN A;  3BEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...