4S0UC

Crystal structure of nkg2d in complex with ulbp6
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
DPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
publication title A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4s0uC00
2VAAA 1N59A 3MR9A 5ACZA 1XH3A 3BP7A 2XFXA 4NT6A 1B0RA 2F53A 1L8JA 3RGVC 3V5KA 3L9RA 3VFSA 1R3HA 1RK0A 5EU4A 1WBZA 2GJ6A 3L3DA 5F7DA 2ZSVA 3O3AA 3KXFA 2AK4A 3MV7A 3KLAA 3VRIA 2P5WA 1CG9A 2AXGA 4LHUA 4LCYA 4PDCE 3BH8A 3MRLA 1G6RH 5EU5A 4JRXA 4HUWA 4PRIA 1S9YA 2CLRA 3P9MA 2YPLA 2HLAA 3VFUA 1T22A 1T1XA 4N0CA 5BJTA 5IVXA 3H9SA 5EO1A 1BD2A 1LK2A 4LCWA 1T21A 3D3VA 3FRUA 5BRZA 4E5XA 3AM8A 1WBYA 4U1KA 3VFTA 1EXUA 2CIKA 1T7XA 5INDA 1Q94A 5IB2A 3GSXA 4F7TA 3O3DA 4HKJA 4GKSA 4PJEA 3KPNA 5E9DA 4ZUUA 3D25A 1AKJA 3MV8A 5DEGA 3QI9A 1SYSA 1TMCA 1FFNA 1ZHBA 4PJXA 4PRNA 5HHNA 4Y2DA 3BZEA 1I1YA 3LV3A 3WS3A 3V5HA 4NQCA 3JTSA 1FZKA 3ILQC 1QLFA 1OGAA 3NFNA 4QRSA 4E0RA 5IEKA 3RL2A 4EN3C 1DE4A 4K7FA 4WU7A 1HHIA 4I4WA 5HHQA 3SJVA 3VXSA 3LKOA 1ED3A 1ZT4A 4ZUVA 4IRSA 4EUPA 4WU5A 1B0GA 3RWIA 5EU3A 3CPLA 4U6YA 3ES6A 2X4OA 3FQUA 4L4VA 4V3DB 4MS8A 5E8PA 4I48A 3ARFA 5SWQA 3GJFA 3ILPA 2X70A 3DX7A 3BWAA 3UBXA 4F7CA 5FDWA 3MRMA 4U1JA 2GTZA 1I7UA 3MV9A 4O2CA 1AGEA 4WO4A 5HGAA 3MROA 1NANH 1T1YA 1CE6A 3GMLA 4PR5A 3S6CA 1T7YA 3B3IA 3PABA 4NO0A 1HOCA 1S7XA 5HHPA 3L3IA 2CLZA 4HV8A 3L3HA 3X11A 3HAEA 4V3EB 4NNYA 2VLRA 1T80A 4Z76A 2VLJA 5F1IA 3GMPA 3I6KA 3KWWA 1ONQA 1I1FA 2BVQA 1MWAH 5ENWA 3ERYA 4PGCA 1CD1A 3QZWA 5EU6A 1JUFA 3MYJA 1EEYA 4PJFA 5FA4A 5L2JA 2AV1A 3GSUA 4JFPA 1W72A 4JFDA 4NQEA 4PJ8A 4MNQA 3MRFA 3KPPA 4HS3A 1KBGH 2FYYA 1N3NA 4Y4KA 3CCHA 4PJ7A 5D2NA 3SDXA 2CLVA 3MGOA 1KCGC 2FO4A 5C0FA 5HGDA 1ZSDA 5EO0A 5FKPA 1A6ZA 5D7LA 3HUJA 2P5EA 5C0AA 4JFQA 5D5MA 2X4NA 4L9LC 1FFOA 3FOMA 3GSVA 1ZT7A 3FT3A 4G9FA 3C9NA 1RJZA 5C0GA 1HHKA 5BS0A 2HN7A 1VADA 1KPVA 1SYVA 3GMRA 2FZ3A 5SWSA 3KYOA 3LKQA 3O3EA 4CVXA 2FIKA 4HX1A 3KPQA 3LN4A 3PWVA 4MXQA 4NO2A 5HGBA 3HG1A 3FQRA 5IB4A 3SPVA 3RWCA 3QUKA 3CH1A 4U1MA 2GT9A 1T20A 3O4LA 1KJVA 4O2FA 3MGTA 3UTSA 2MHAA 5IB5A 3PWPA 2VE6A 3RWDA 3PWNA 1A1MA 5H94A 3KPSA 1S7SA 4FFEX 2BNQA 3TBYA 1UXSA 3E6HA 4PRBA 1HHJA 5E00A 3RZCA 1A9EA 5MEPA 2AV7A 2RFXA 3BW9A 4PRHA 1AGBA 3MRBA 5C09A 4D0CA 5J6GA 4MJIA 4U6XA 4IIQC 4U1IA 3RTQA 3FFCA 5E8OA 4PREA 4PV9A 3ROLA 1S9WA 4PP8C 1FZMA 1HHGA 3BEVA 1I7TA 5C08A 3RL1A 5IB3A 2ZSWA 4Y4FA 1PQZA 5E8NA 2OI9A 3FONA 3DBXA 3I6LD 4F7PA 1YDPA 3BEWA 2GITA 3VXOA 3TO4A 1JPFA 1T0MA 3ARDA 3E2HA 2F54A 1P4LA 1WBXA 3HPJA 1T7VA 1YPZA 3M1BA 5J1AA 5BXFA 5GSRA 2XPGA 4MVBA 3TBVA 1W0VA 2ESVA 3GSQA 3HE6A 2BVPA 3MRHA 4NHUE 4ONOA 3TZVC 1X7QA 1LDPH 4QRQA 1KJ3H 2C7UA 3CDGA 5GSVA 1YN6A 3IT8D 4JRYA 3HLAA 5D7JC 3U0PA 3DTXA 3RUGA 3GMQA 4ELMA 4L8CA 1S7UA 1QEWA 3P4NA 3QDMA 2H26A 3LKRA 2BSSA 1MHCA 3BH9A 4NQXA 3RWEA 2AKRA 2PYEA 2YEZA 3KPMA 4EI5A 3GIVA 5JHDA 1KTLA 1YN7A 3O9WA 3P4OA 4HUXA 4N0FA 1IM9A 1JF1A 3VJ6A 3X13A 3FT4A 3QQ3A 4D0DA 3LKPA 3TF7A 3GSRA 1JHTA 3GMOA 3VFVA 4G8GA 1BQHA 1K5NA 1AGCA 2D31A 5C0IA 1KJ2H 2NW3A 2X4UA 3RWJA 4QRPA 3T1FA 5C0DA 4NNXA 3MRRA 3VXNA 4N8VA 1S8DA 1P1ZA 4LCCC 2ZOKA 1T7ZA 3WS6A 1HHHA 2ZOLA 4G42A 1XR9A 4NQVA 3TBTA 4QRRA 3KPLA 1DDHA 4UQ2A 3VXUA 3SDCA 1DUZA 3OV6A 3MA7A 4N5EA 3SCMA 1GZPA 3TVMA 3WL9A 3CVHA 1ZHKA 3MRDA 4U1HA 2NX5A 3BP4A 4XXCA 4QRTA 5IEHA 4PRPA 1GZQA 4MQ7A 1G7QA 3JVGA 5D9SA 1C16A 4X6EA 5EOTA 5J6HA 1UXWA 3OXRA 1UQSA 2GAZA 1FZOA 3IXAA 3P73A 3ROOA 1I4FA 1KPRA 4Y16A 3GSWA 1MI5A 5IM7A 4ZAKA 1QVOA 3MRQA 3QUXA 2HJLA 4IRJA 4NO3A 4D0BA 3T8XA 1ZAGA 3QDJA 1JGEA 4PRAA 1KJMA 3PWJA 4PG2A 1NEZA 3BZFA 3QUZA 4Z78A 2BCKA 2X4SA 5EUOA 2A83A 2VABA 1E28A 3ECBA 3VH8A 1ZHLA 1XR8A 5MEOA 5INCA 3P9LA 4UQ3A 4U1SA 1AGDA 1JPGA 4WWKC 3D39A 5HHOA 3H7BA 3VFOA 3SDDA 3VFRA 3VWJA 2J8UA 3MRPA 1S7QA 1S7VA 1MHEA 3BVNA 3L3GA 1P7QA 1B3JA 4LNRA 5C0CA 3VFPA 1U58A 3DXAA 4APQA 5MENA 1EEZA 4JFEA 1ZS8A 3MREA 1JFMA 4L29A 3GMMA 4FTVA 3QFDA 3VWKA 4PJHA 3VRJA 5HYJA 1QO3A 5EFIA 3ARGA 3LKNA 4MNGA 4F7EA 5DDHA 2F74A 4L3CA 2Q7YA 5MEQA 1I7RA 1M05A 4HWZA 3REWA 1LEKA 5B39A 1A1NA 5MERA 1M6OA 1FG2A 2X4RA 4WDIA 3VFWA 3FQWA 4L8DA 1JGDA 5FA3A 3VXMA 4WUUA 1EFXA 2X4PA 1TVBA 2GUOA 4U1NA 1VGKA 2H6PA 1I1AA 2X4TA 4WJ5A 1S9XA 2YPKA 3P4MA 4GUPA 4PGDA 3SKOA 3X14A 3FOLA 1AGFA 1KPUA 4L4TA 2WY3A 3AREA 4ZUWA 2OL3H 4G9DA 4ZFZA 3VXPA 5IROA 5D7IA 1OF2A 5AD0A 5IB1A 3RWGA 5SWZA 5DEFA 5F9JA 1LEGA 3PWUA 3OX8A 4K71B 4JQXA 3FTGA 5D2LA 3D18A 4PGEA 3P77A 3AU1A 4NSKA 1INQA 1N5AA 4QRUA 4JFFA 4PV8A 1W0WA 1T7WA 3DX6A 3E3QA 3PQYA 3FT2A 5C0EA 3RWFA 1LP9A 3WUWA 4F7MA 2E7LE 3M17A 5C0JA 3HCVA 3X12A 2UWEA 2BNRA 1HSBA 1ZT1A 1QQDA 3JTTA 4MJ5A 3BXNA 1T0NA 3KYNA 4PJCA 4X6CA 4X6DA 4MJ6A 3GSOA 1ZHNA 5HHMA 4ZUTA 3TIDA 3OXSA 3FQXA 3KPRA 3VCLA 4CVZA 2V2XA 3RWHA 5L2KA 3BUYA 3QFJA 2PO6A 3FQTA 3DX8A 4U1LA 1OSZA 1JE6A 4PGBA 3TFKA 3MRJA 5C9JA 1ZVSA 3QEQA 3VXRA 1LD9A 1HYRC 3VFNA 3VFMA 3TIEA 3L3KA 2BSTA 1OGTA 4PJ9A 3E6FA 1IM3A 2CKBH 1S7TA 4L8BA 4N0UA 3PWLA 4Y4HA 3L3JA 1QR1A 4PJDA 1TVHA 3QQ4A 4NQDA 1BZ9A 1T1WA 1XZ0A 1A1OA 2V2WA 3LN5A 3W39A 3UPRA 3TO2A 1N2RA 3O3BA 1E27A 3ARBA 3QUYA 4JFOA 2X4QA 3HE7A 4MX7A 3MRGA 4Z77A 4ZUSA 4HUVA 3BGMA 3CC5A 3TBSA 3MRCA 5ISZA 3V5DA 3BO8A 5E6IC 3CZFA 4PJIA 3MRIA 4WW2C 3GSNH 3MRKA 4L8SC 3DMMA 4HUUA 3TA3A 1FZJA 4CW1A 1BIIA 3GMNA 4JQVA 4PJAA 4PJBA 3B6SA 4G43A 3G08A 4IHOA 5B38A 4G8IA 5F1NA 3JTCA 4O2EA 1QSEA 4PG9A 1A9BA 2BSRA 4G59A 5HGHA 3UTTA 1DUYA 5C07A 1T1ZA 3KPOA 3UTQA 4GKNA 2JCCA 3SKMA 1HSAA 1VACA 3H9HA 4PJ5A 3SDAA 1QSFA 1RJYA 1Z5LA 3D2UA 4PRDA 3TJHA 4S0UC 3TN0A 2AXFA 1LQVA 3WLBA 1G7PA 5C0BA 1S7WA 1NAMH 3TPUE 3I6GA 2VLKA 2GTWA 3QDGA 2CIIA 2HJKA 3LKSA 2BVOA 2DYPA 3QULA 2VLLA 3W0WA 3O8XA 1RK1A 2FWOA 4NO5A 3MRNA 4PJGA 3TBWA 4QOKA 3BHBA 3C8KA 4L3EA 1S7RA 3FQNA 1FO0H 1FFPA 4X6FA 1K8DA 1AO7A 1QRNA
chains in the Genus database with same CATH superfamily
2VAAA 1N59A 3MR9A 5ACZA 1XH3A 3BP7A 2XFXA 4NT6A 1B0RA 2F53A 1L8JA 3RGVC 3V5KA 3L9RA 3VFSA 1R3HA 1RK0A 5EU4A 1WBZA 2GJ6A 3L3DA 5F7DA 2ZSVA 3O3AA 3KXFA 2AK4A 3MV7A 3KLAA 3VRIA 2P5WA 1CG9A 2AXGA 4LHUA 4LCYA 4PDCE 3BH8A 3MRLA 1G6RH 5EU5A 4JRXA 4HUWA 4PRIA 1S9YA 2CLRA 3P9MA 2YPLA 2HLAA 3VFUA 1T22A 1T1XA 4N0CA 5BJTA 5IVXA 3H9SA 5EO1A 1BD2A 1LK2A 4LCWA 1T21A 3D3VA 3FRUA 5BRZA 4E5XA 3AM8A 1WBYA 4U1KA 3VFTA 1EXUA 2CIKA 1T7XA 5INDA 1Q94A 5IB2A 3GSXA 4F7TA 3O3DA 4HKJA 4GKSA 4PJEA 3KPNA 5E9DA 4ZUUA 3D25A 1AKJA 3MV8A 5DEGA 3QI9A 1SYSA 1TMCA 1FFNA 1ZHBA 4PJXA 4PRNA 5HHNA 4Y2DA 3BZEA 1I1YA 3LV3A 3WS3A 3V5HA 4NQCA 3JTSA 1FZKA 3ILQC 1QLFA 1OGAA 3NFNA 4QRSA 4E0RA 5IEKA 3RL2A 4EN3C 1DE4A 4K7FA 4WU7A 1HHIA 4I4WA 5HHQA 3SJVA 3VXSA 3LKOA 1ED3A 1ZT4A 4ZUVA 4IRSA 4EUPA 4WU5A 1B0GA 3RWIA 5EU3A 3CPLA 4U6YA 3ES6A 2X4OA 3FQUA 4L4VA 4V3DB 4MS8A 5E8PA 4I48A 3ARFA 5SWQA 3GJFA 3ILPA 2X70A 3DX7A 3BWAA 3UBXA 4F7CA 5FDWA 3MRMA 4U1JA 2GTZA 1I7UA 3MV9A 4O2CA 1AGEA 4WO4A 5HGAA 3MROA 1NANH 1T1YA 1CE6A 3GMLA 4PR5A 3S6CA 1T7YA 3B3IA 3PABA 4NO0A 1HOCA 1S7XA 5HHPA 3L3IA 2CLZA 4HV8A 3L3HA 3X11A 3HAEA 4V3EB 4NNYA 2VLRA 1T80A 4Z76A 2VLJA 5F1IA 3GMPA 3I6KA 3KWWA 1ONQA 1I1FA 2BVQA 1MWAH 5ENWA 3ERYA 4PGCA 4JO8A 1CD1A 3QZWA 5EU6A 1JUFA 3MYJA 1EEYA 4PJFA 5FA4A 5L2JA 2AV1A 3GSUA 4JFPA 1W72A 4JFDA 4NQEA 4PJ8A 4MNQA 3MRFA 3KPPA 4HS3A 1KBGH 2FYYA 1N3NA 4Y4KA 3CCHA 4PJ7A 5D2NA 3SDXA 2CLVA 3MGOA 1KCGC 2FO4A 5C0FA 5HGDA 1ZSDA 5EO0A 5FKPA 1A6ZA 5D7LA 3HUJA 2P5EA 5C0AA 4JFQA 5D5MA 2X4NA 4L9LC 1FFOA 3FOMA 3GSVA 1ZT7A 3FT3A 4G9FA 3C9NA 1RJZA 5C0GA 1HHKA 5BS0A 2HN7A 1VADA 1KPVA 1SYVA 3GMRA 2FZ3A 5SWSA 3KYOA 3LKQA 3O3EA 4CVXA 2FIKA 4HX1A 3KPQA 3LN4A 3PWVA 4MXQA 4NO2A 5HGBA 3HG1A 3FQRA 5IB4A 3SPVA 3RWCA 3QUKA 3CH1A 4U1MA 2GT9A 1T20A 3O4LA 1KJVA 4O2FA 3MGTA 3UTSA 2MHAA 5IB5A 3PWPA 2VE6A 3RWDA 3PWNA 1A1MA 5H94A 3KPSA 1S7SA 4FFEX 2BNQA 3TBYA 1UXSA 3E6HA 4PRBA 1HHJA 5E00A 3RZCA 1A9EA 5MEPA 2AV7A 2RFXA 3BW9A 4PRHA 1AGBA 3MRBA 5C09A 4D0CA 5J6GA 4MJIA 4U6XA 4IIQC 4U1IA 3RTQA 3FFCA 5E8OA 4PREA 4PV9A 3ROLA 1S9WA 4PP8C 1FZMA 1HHGA 3BEVA 1I7TA 5C08A 3RL1A 5IB3A 2ZSWA 4Y4FA 1PQZA 5E8NA 2OI9A 3FONA 3DBXA 3I6LD 4F7PA 1YDPA 3BEWA 2GITA 3VXOA 3TO4A 1JPFA 1T0MA 3ARDA 3E2HA 2F54A 1P4LA 1WBXA 3HPJA 1T7VA 1YPZA 3M1BA 5J1AA 5BXFA 5GSRA 2XPGA 4MVBA 3TBVA 1W0VA 2ESVA 3GSQA 3HE6A 2BVPA 3MRHA 4NHUE 4ONOA 3TZVC 1X7QA 1LDPH 4QRQA 1KJ3H 2C7UA 3CDGA 5GSVA 1YN6A 3IT8D 4JRYA 3HLAA 5D7JC 3U0PA 3DTXA 3RUGA 3GMQA 4ELMA 4L8CA 1S7UA 1QEWA 3P4NA 3QDMA 2H26A 3LKRA 2BSSA 1MHCA 3BH9A 4NQXA 3RWEA 2AKRA 2PYEA 2YEZA 3KPMA 4EI5A 3GIVA 5JHDA 1KTLA 1YN7A 3O9WA 3P4OA 4HUXA 4N0FA 1IM9A 1JF1A 3VJ6A 3X13A 3FT4A 3QQ3A 4D0DA 3LKPA 3TF7A 3GSRA 1JHTA 3GMOA 3VFVA 4G8GA 1BQHA 1K5NA 1AGCA 2D31A 5C0IA 1KJ2H 2NW3A 2X4UA 3RWJA 4QRPA 3T1FA 5C0DA 4NNXA 3MRRA 3VXNA 4N8VA 1S8DA 1P1ZA 4LCCC 2ZOKA 1T7ZA 3WS6A 1HHHA 2ZOLA 4G42A 1XR9A 4NQVA 3TBTA 4QRRA 3KPLA 1DDHA 4UQ2A 3VXUA 3SDCA 1DUZA 3OV6A 3MA7A 4N5EA 3SCMA 1GZPA 3TVMA 3WL9A 3CVHA 1ZHKA 3MRDA 4U1HA 2NX5A 3BP4A 4XXCA 4QRTA 5IEHA 4PRPA 1GZQA 4MQ7A 1G7QA 3JVGA 5D9SA 1C16A 4X6EA 5EOTA 5J6HA 1UXWA 3OXRA 1UQSA 2GAZA 1FZOA 3IXAA 3P73A 3ROOA 1I4FA 1KPRA 4Y16A 3GSWA 1MI5A 5IM7A 4ZAKA 1QVOA 3MRQA 3QUXA 2HJLA 4IRJA 4NO3A 4D0BA 3T8XA 1ZAGA 3QDJA 1JGEA 4PRAA 1KJMA 3PWJA 4PG2A 1NEZA 3BZFA 3QUZA 4Z78A 2BCKA 2X4SA 5EUOA 2A83A 2VABA 1E28A 3ECBA 3VH8A 1ZHLA 1XR8A 5MEOA 5INCA 3P9LA 4UQ3A 4U1SA 1AGDA 1JPGA 4WWKC 3D39A 5HHOA 3H7BA 4BKWA 3VFOA 3SDDA 3VFRA 3VWJA 2J8UA 3MRPA 1S7QA 1S7VA 1MHEA 3BVNA 3L3GA 1P7QA 1B3JA 4LNRA 5C0CA 3VFPA 1U58A 3DXAA 4APQA 5MENA 1EEZA 4JFEA 1ZS8A 3MREA 1JFMA 4L29A 3GMMA 4FTVA 3QFDA 3VWKA 4PJHA 3VRJA 5HYJA 1QO3A 5EFIA 3ARGA 3LKNA 4MNGA 4F7EA 5DDHA 2F74A 4L3CA 2Q7YA 5MEQA 1I7RA 1M05A 4HWZA 3REWA 1LEKA 5B39A 1A1NA 5MERA 1M6OA 1FG2A 2X4RA 4WDIA 3VFWA 3FQWA 4L8DA 1JGDA 5FA3A 3VXMA 4WUUA 1EFXA 2X4PA 1TVBA 2GUOA 4U1NA 1VGKA 2H6PA 1I1AA 2NYKA 2X4TA 4WJ5A 1S9XA 2YPKA 3P4MA 4GUPA 4PGDA 3SKOA 3X14A 3FOLA 1AGFA 1KPUA 4L4TA 2WY3A 3AREA 4ZUWA 2OL3H 4G9DA 4ZFZA 3VXPA 5IROA 5D7IA 1OF2A 5AD0A 5IB1A 3RWGA 5SWZA 5DEFA 5F9JA 1LEGA 3PWUA 3OX8A 4K71B 4JQXA 3FTGA 5D2LA 3D18A 4PGEA 3P77A 3AU1A 4NSKA 1INQA 1N5AA 4QRUA 4JFFA 4PV8A 1W0WA 1T7WA 3DX6A 3E3QA 3PQYA 3FT2A 5C0EA 3RWFA 1LP9A 3WUWA 4F7MA 2E7LE 3M17A 5C0JA 3HCVA 3X12A 2UWEA 2BNRA 1HSBA 1ZT1A 1QQDA 3JTTA 4MJ5A 3BXNA 1T0NA 3KYNA 4PJCA 4X6CA 4X6DA 4MJ6A 2O5NA 3GSOA 1ZHNA 5HHMA 4ZUTA 3TIDA 3OXSA 3FQXA 3KPRA 3VCLA 4CVZA 2V2XA 3RWHA 5L2KA 3BUYA 3QFJA 2PO6A 3FQTA 3DX8A 4U1LA 1OSZA 1JE6A 4PGBA 3TFKA 3MRJA 5C9JA 1ZVSA 3QEQA 4G59C 3VXRA 1LD9A 1HYRC 3VFNA 3VFMA 3TIEA 3L3KA 2BSTA 1OGTA 4PJ9A 3E6FA 1IM3A 2CKBH 1S7TA 4L8BA 4N0UA 3PWLA 4Y4HA 2IA1A 3L3JA 1QR1A 4PJDA 1TVHA 3QQ4A 4NQDA 1BZ9A 1T1WA 1XZ0A 1A1OA 2V2WA 3LN5A 3W39A 3UPRA 3TO2A 1N2RA 3O3BA 1E27A 3ARBA 3QUYA 4JFOA 2X4QA 3HE7A 4MX7A 3MRGA 4Z77A 4ZUSA 4HUVA 3BGMA 3CC5A 3TBSA 3MRCA 5ISZA 3V5DA 3BO8A 5E6IC 3CZFA 4PJIA 3MRIA 4WW2C 3GSNH 3MRKA 4L8SC 3DMMA 4HUUA 3TA3A 1FZJA 4CW1A 1BIIA 3GMNA 4JQVA 4PJAA 4PJBA 3B6SA 4G43A 3G08A 4IHOA 5B38A 4G8IA 5F1NA 3JTCA 4O2EA 1QSEA 4PG9A 1A9BA 2BSRA 4G59A 5HGHA 3UTTA 1DUYA 5C07A 1T1ZA 3KPOA 3UTQA 4GKNA 2JCCA 3SKMA 1HSAA 1VACA 3H9HA 4PJ5A 3SDAA 1QSFA 1RJYA 1Z5LA 3D2UA 4PRDA 3TJHA 4S0UC 3TN0A 2AXFA 1LQVA 3WLBA 1G7PA 5C0BA 1S7WA 1NAMH 3TPUE 3I6GA 2VLKA 2GTWA 3QDGA 2CIIA 2HJKA 3LKSA 2BVOA 2DYPA 3QULA 2VLLA 3I0TA 3W0WA 3O8XA 1RK1A 2FWOA 4NO5A 3MRNA 4PJGA 3TBWA 4QOKA 3BHBA 3C8KA 4L3EA 1S7RA 3FQNA 1FO0H 1FFPA 4X6FA 1K8DA 1AO7A 1QRNA
chains in the Genus database with same CATH topology
2VAAA 1N59A 3MR9A 5ACZA 1XH3A 3BP7A 2XFXA 4NT6A 1B0RA 2F53A 1L8JA 3RGVC 3V5KA 3L9RA 3VFSA 1R3HA 1RK0A 5EU4A 1WBZA 2GJ6A 3L3DA 5F7DA 2ZSVA 3O3AA 3KXFA 2AK4A 3MV7A 3KLAA 3VRIA 2P5WA 1CG9A 2AXGA 4LHUA 4LCYA 4PDCE 3BH8A 3MRLA 1G6RH 5EU5A 4JRXA 4HUWA 4PRIA 1S9YA 2CLRA 3P9MA 2YPLA 2HLAA 3VFUA 1T22A 1T1XA 4N0CA 5BJTA 5IVXA 3H9SA 5EO1A 1BD2A 1LK2A 4LCWA 1T21A 3D3VA 3FRUA 5BRZA 4E5XA 3AM8A 1WBYA 4U1KA 3VFTA 1EXUA 2CIKA 1T7XA 5INDA 1Q94A 5IB2A 3GSXA 4F7TA 3O3DA 4HKJA 4GKSA 4PJEA 3KPNA 5E9DA 4ZUUA 3D25A 1AKJA 3MV8A 5DEGA 3QI9A 1SYSA 1TMCA 1FFNA 1ZHBA 4PJXA 4PRNA 5HHNA 4Y2DA 3BZEA 1I1YA 3LV3A 3WS3A 3V5HA 4NQCA 3JTSA 1FZKA 3ILQC 1QLFA 1OGAA 3NFNA 4QRSA 4E0RA 5IEKA 3RL2A 4EN3C 1DE4A 4K7FA 4WU7A 1HHIA 4I4WA 5HHQA 3SJVA 3VXSA 3LKOA 1ED3A 1ZT4A 4ZUVA 4IRSA 4EUPA 4WU5A 1B0GA 3RWIA 5EU3A 3CPLA 4U6YA 3ES6A 2X4OA 3FQUA 4L4VA 4V3DB 4MS8A 5E8PA 4I48A 3ARFA 5SWQA 3GJFA 3ILPA 2X70A 3DX7A 3BWAA 3UBXA 4F7CA 5FDWA 3MRMA 4U1JA 2GTZA 1I7UA 3MV9A 4O2CA 1AGEA 4WO4A 5HGAA 3MROA 1NANH 1T1YA 1CE6A 3GMLA 4PR5A 3S6CA 1T7YA 3B3IA 3PABA 4NO0A 1HOCA 1S7XA 5HHPA 3L3IA 2CLZA 4HV8A 3L3HA 3X11A 3HAEA 4V3EB 4NNYA 2VLRA 1T80A 4Z76A 2VLJA 5F1IA 3GMPA 3I6KA 3KWWA 1ONQA 1I1FA 2BVQA 1MWAH 5ENWA 3ERYA 4PGCA 1CD1A 3QZWA 5EU6A 1JUFA 3MYJA 1EEYA 4PJFA 5FA4A 5L2JA 2AV1A 3GSUA 4JFPA 1W72A 4JFDA 4NQEA 4PJ8A 4MNQA 3MRFA 3KPPA 4HS3A 1KBGH 2FYYA 1N3NA 4Y4KA 3CCHA 4PJ7A 5D2NA 3SDXA 2CLVA 3MGOA 1KCGC 2FO4A 5C0FA 5HGDA 1ZSDA 5EO0A 5FKPA 1A6ZA 5D7LA 3HUJA 2P5EA 5C0AA 4JFQA 5D5MA 2X4NA 4L9LC 1FFOA 3FOMA 3GSVA 1ZT7A 3FT3A 4G9FA 3C9NA 1RJZA 5C0GA 1HHKA 5BS0A 2HN7A 1VADA 1KPVA 1SYVA 3GMRA 2FZ3A 5SWSA 3KYOA 3LKQA 3O3EA 4CVXA 2FIKA 4HX1A 3KPQA 3LN4A 3PWVA 4MXQA 4NO2A 5HGBA 3HG1A 3FQRA 5IB4A 3SPVA 3RWCA 3QUKA 3CH1A 4U1MA 2GT9A 1T20A 3O4LA 1KJVA 4O2FA 3MGTA 3UTSA 2MHAA 5IB5A 3PWPA 2VE6A 3RWDA 3PWNA 1A1MA 5H94A 3KPSA 1S7SA 4FFEX 2BNQA 3TBYA 1UXSA 3E6HA 4PRBA 1HHJA 5E00A 3RZCA 1A9EA 5MEPA 2AV7A 2RFXA 3BW9A 4PRHA 1AGBA 3MRBA 5C09A 4D0CA 5J6GA 4MJIA 4U6XA 4IIQC 4U1IA 3RTQA 3FFCA 5E8OA 4PREA 4PV9A 3ROLA 1S9WA 4PP8C 1FZMA 1HHGA 3BEVA 1I7TA 5C08A 3RL1A 5IB3A 2ZSWA 4Y4FA 1PQZA 5E8NA 2OI9A 3FONA 3DBXA 3I6LD 4F7PA 1YDPA 3BEWA 2GITA 3VXOA 3TO4A 1JPFA 1T0MA 3ARDA 3E2HA 2F54A 1P4LA 1WBXA 3HPJA 1T7VA 1YPZA 3M1BA 5J1AA 5BXFA 5GSRA 2XPGA 4MVBA 3TBVA 1W0VA 2ESVA 3GSQA 3HE6A 2BVPA 3MRHA 4NHUE 4ONOA 3TZVC 1X7QA 1LDPH 4QRQA 1KJ3H 2C7UA 3CDGA 5GSVA 1YN6A 3IT8D 4JRYA 3HLAA 5D7JC 3U0PA 3DTXA 3RUGA 3GMQA 4ELMA 4L8CA 1S7UA 1QEWA 3P4NA 3QDMA 2H26A 3LKRA 2BSSA 1MHCA 3BH9A 4NQXA 3RWEA 2AKRA 2PYEA 2YEZA 3KPMA 4EI5A 3GIVA 5JHDA 1KTLA 1YN7A 3O9WA 3P4OA 4HUXA 4N0FA 1IM9A 1JF1A 3VJ6A 3X13A 3FT4A 3QQ3A 4D0DA 3LKPA 3TF7A 3GSRA 1JHTA 3GMOA 3VFVA 4G8GA 1BQHA 1K5NA 1AGCA 2D31A 5C0IA 1KJ2H 2NW3A 2X4UA 3RWJA 4QRPA 3T1FA 5C0DA 4NNXA 3MRRA 3VXNA 4N8VA 1S8DA 1P1ZA 4LCCC 2ZOKA 1T7ZA 3WS6A 1HHHA 2ZOLA 4G42A 1XR9A 4NQVA 3TBTA 4QRRA 3KPLA 1DDHA 4UQ2A 3VXUA 3SDCA 1DUZA 3OV6A 3MA7A 4N5EA 3SCMA 1GZPA 3TVMA 3WL9A 3CVHA 1ZHKA 3MRDA 4U1HA 2NX5A 3BP4A 4XXCA 4QRTA 5IEHA 4PRPA 1GZQA 4MQ7A 1G7QA 3JVGA 5D9SA 1C16A 4X6EA 5EOTA 5J6HA 1UXWA 3OXRA 1UQSA 2GAZA 1FZOA 3IXAA 3P73A 3ROOA 1I4FA 1KPRA 4Y16A 3GSWA 1MI5A 5IM7A 4ZAKA 1QVOA 3MRQA 3QUXA 2HJLA 4IRJA 4NO3A 4D0BA 3T8XA 1ZAGA 3QDJA 1JGEA 4PRAA 1KJMA 3PWJA 4PG2A 1NEZA 3BZFA 3QUZA 4Z78A 2BCKA 2X4SA 5EUOA 2A83A 2VABA 1E28A 3ECBA 3VH8A 1ZHLA 1XR8A 5MEOA 5INCA 3P9LA 4UQ3A 4U1SA 1AGDA 1JPGA 4WWKC 3D39A 5HHOA 3H7BA 3VFOA 3SDDA 3VFRA 3VWJA 2J8UA 3MRPA 1S7QA 1S7VA 1MHEA 3BVNA 3L3GA 1P7QA 1B3JA 4LNRA 5C0CA 3VFPA 1U58A 3DXAA 4APQA 5MENA 1EEZA 4JFEA 1ZS8A 3MREA 1JFMA 4L29A 3GMMA 4FTVA 3QFDA 3VWKA 4PJHA 3VRJA 5HYJA 1QO3A 5EFIA 3ARGA 3LKNA 4MNGA 4F7EA 5DDHA 2F74A 4L3CA 2Q7YA 5MEQA 1I7RA 1M05A 4HWZA 3REWA 1LEKA 5B39A 1A1NA 5MERA 1M6OA 1FG2A 2X4RA 4WDIA 3VFWA 3FQWA 4L8DA 1JGDA 5FA3A 3VXMA 4WUUA 1EFXA 2X4PA 1TVBA 2GUOA 4U1NA 1VGKA 2H6PA 1I1AA 2X4TA 4WJ5A 1S9XA 2YPKA 3P4MA 4GUPA 4PGDA 3SKOA 3X14A 3FOLA 1AGFA 1KPUA 4L4TA 2WY3A 3AREA 4ZUWA 2OL3H 4G9DA 4ZFZA 3VXPA 5IROA 5D7IA 1OF2A 5AD0A 5IB1A 3RWGA 5SWZA 5DEFA 5F9JA 1LEGA 3PWUA 3OX8A 4K71B 4JQXA 3FTGA 5D2LA 3D18A 4PGEA 3P77A 3AU1A 4NSKA 1INQA 1N5AA 4QRUA 4JFFA 4PV8A 1W0WA 1T7WA 3DX6A 3E3QA 3PQYA 3FT2A 5C0EA 3RWFA 1LP9A 3WUWA 4F7MA 2E7LE 3M17A 5C0JA 3HCVA 3X12A 2UWEA 2BNRA 1HSBA 1ZT1A 1QQDA 3JTTA 4MJ5A 3BXNA 1T0NA 3KYNA 4PJCA 4X6CA 4X6DA 4MJ6A 3GSOA 1ZHNA 5HHMA 4ZUTA 3TIDA 3OXSA 3FQXA 3KPRA 3VCLA 4CVZA 2V2XA 3RWHA 5L2KA 3BUYA 3QFJA 2PO6A 3FQTA 3DX8A 4U1LA 1OSZA 1JE6A 4PGBA 3TFKA 3MRJA 5C9JA 1ZVSA 3QEQA 3VXRA 1LD9A 1HYRC 3VFNA 3VFMA 3TIEA 3L3KA 2BSTA 1OGTA 4PJ9A 3E6FA 1IM3A 2CKBH 1S7TA 4L8BA 4N0UA 3PWLA 4Y4HA 3L3JA 1QR1A 4PJDA 1TVHA 3QQ4A 4NQDA 1BZ9A 1T1WA 1XZ0A 1A1OA 2V2WA 3LN5A 3W39A 3UPRA 3TO2A 1N2RA 3O3BA 1E27A 3ARBA 3QUYA 4JFOA 2X4QA 3HE7A 4MX7A 3MRGA 4Z77A 4ZUSA 4HUVA 3BGMA 3CC5A 3TBSA 3MRCA 5ISZA 3V5DA 3BO8A 5E6IC 3CZFA 4PJIA 3MRIA 4WW2C 3GSNH 3MRKA 4L8SC 3DMMA 4HUUA 3TA3A 1FZJA 4CW1A 1BIIA 3GMNA 4JQVA 4PJAA 4PJBA 3B6SA 4G43A 3G08A 4IHOA 5B38A 4G8IA 5F1NA 3JTCA 4O2EA 1QSEA 4PG9A 1A9BA 2BSRA 4G59A 5HGHA 3UTTA 1DUYA 5C07A 1T1ZA 3KPOA 3UTQA 4GKNA 2JCCA 3SKMA 1HSAA 1VACA 3H9HA 4PJ5A 3SDAA 1QSFA 1RJYA 1Z5LA 3D2UA 4PRDA 3TJHA 4S0UC 3TN0A 2AXFA 1LQVA 3WLBA 1G7PA 5C0BA 1S7WA 1NAMH 3TPUE 3I6GA 2VLKA 2GTWA 3QDGA 2CIIA 2HJKA 3LKSA 2BVOA 2DYPA 3QULA 2VLLA 3W0WA 3O8XA 1RK1A 2FWOA 4NO5A 3MRNA 4PJGA 3TBWA 4QOKA 3BHBA 3C8KA 4L3EA 1S7RA 3FQNA 1FO0H 1FFPA 4X6FA 1K8DA 1AO7A 1QRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VAA A;  1N59 A;  3MR9 A;  5ACZ A;  1XH3 A;  3BP7 A;  2XFX A;  4NT6 A;  1B0R A;  2F53 A;  1L8J A;  3RGV C;  3V5K A;  3L9R A;  3VFS A;  1R3H A;  1RK0 A;  5EU4 A;  1WBZ A;  2GJ6 A;  3L3D A;  5F7D A;  2ZSV A;  3O3A A;  3KXF A;  2AK4 A;  3MV7 A;  3KLA A;  3VRI A;  2P5W A;  1CG9 A;  2AXG A;  4LHU A;  4LCY A;  4PDC E;  3BH8 A;  3MRL A;  1G6R H;  5EU5 A;  4JRX A;  4HUW A;  4PRI A;  1S9Y A;  2CLR A;  3P9M A;  2YPL A;  2HLA A;  3VFU A;  1T22 A;  1T1X A;  4N0C A;  5BJT A;  5IVX A;  3H9S A;  5EO1 A;  1BD2 A;  1LK2 A;  4LCW A;  1T21 A;  3D3V A;  3FRU A;  5BRZ A;  4E5X A;  3AM8 A;  1WBY A;  4U1K A;  3VFT A;  1EXU A;  2CIK A;  1T7X A;  5IND A;  1Q94 A;  5IB2 A;  3GSX A;  4F7T A;  3O3D A;  4HKJ A;  4GKS A;  4PJE A;  3KPN A;  5E9D A;  4ZUU A;  3D25 A;  1AKJ A;  3MV8 A;  5DEG A;  3QI9 A;  1SYS A;  1TMC A;  1FFN A;  1ZHB A;  4PJX A;  4PRN A;  5HHN A;  4Y2D A;  3BZE A;  1I1Y A;  3LV3 A;  3WS3 A;  3V5H A;  4NQC A;  3JTS A;  1FZK A;  3ILQ C;  1QLF A;  1OGA A;  3NFN A;  4QRS A;  4E0R A;  5IEK A;  3RL2 A;  4EN3 C;  1DE4 A;  4K7F A;  4WU7 A;  1HHI A;  4I4W A;  5HHQ A;  3SJV A;  3VXS A;  3LKO A;  1ED3 A;  1ZT4 A;  4ZUV A;  4IRS A;  4EUP A;  4WU5 A;  1B0G A;  3RWI A;  5EU3 A;  3CPL A;  4U6Y A;  3ES6 A;  2X4O A;  3FQU A;  4L4V A;  4V3D B;  4MS8 A;  5E8P A;  4I48 A;  3ARF A;  5SWQ A;  3GJF A;  3ILP A;  2X70 A;  3DX7 A;  3BWA A;  3UBX A;  4F7C A;  5FDW A;  3MRM A;  4U1J A;  2GTZ A;  1I7U A;  3MV9 A;  4O2C A;  1AGE A;  4WO4 A;  5HGA A;  3MRO A;  1NAN H;  1T1Y A;  1CE6 A;  3GML A;  4PR5 A;  3S6C A;  1T7Y A;  3B3I A;  3PAB A;  4NO0 A;  1HOC A;  1S7X A;  5HHP A;  3L3I A;  2CLZ A;  4HV8 A;  3L3H A;  3X11 A;  3HAE A;  4V3E B;  4NNY A;  2VLR A;  1T80 A;  4Z76 A;  2VLJ A;  5F1I A;  3GMP A;  3I6K A;  3KWW A;  1ONQ A;  1I1F A;  2BVQ A;  1MWA H;  5ENW A;  3ERY A;  4PGC A;  1CD1 A;  3QZW A;  5EU6 A;  1JUF A;  3MYJ A;  1EEY A;  4PJF A;  5FA4 A;  5L2J A;  2AV1 A;  3GSU A;  4JFP A;  1W72 A;  4JFD A;  4NQE A;  4PJ8 A;  4MNQ A;  3MRF A;  3KPP A;  4HS3 A;  1KBG H;  2FYY A;  1N3N A;  4Y4K A;  3CCH A;  4PJ7 A;  5D2N A;  3SDX A;  2CLV A;  3MGO A;  1KCG C;  2FO4 A;  5C0F A;  5HGD A;  1ZSD A;  5EO0 A;  5FKP A;  1A6Z A;  5D7L A;  3HUJ A;  2P5E A;  5C0A A;  4JFQ A;  5D5M A;  2X4N A;  4L9L C;  1FFO A;  3FOM A;  3GSV A;  1ZT7 A;  3FT3 A;  4G9F A;  3C9N A;  1RJZ A;  5C0G A;  1HHK A;  5BS0 A;  2HN7 A;  1VAD A;  1KPV A;  1SYV A;  3GMR A;  2FZ3 A;  5SWS A;  3KYO A;  3LKQ A;  3O3E A;  4CVX A;  2FIK A;  4HX1 A;  3KPQ A;  3LN4 A;  3PWV A;  4MXQ A;  4NO2 A;  5HGB A;  3HG1 A;  3FQR A;  5IB4 A;  3SPV A;  3RWC A;  3QUK A;  3CH1 A;  4U1M A;  2GT9 A;  1T20 A;  3O4L A;  1KJV A;  4O2F A;  3MGT A;  3UTS A;  2MHA A;  5IB5 A;  3PWP A;  2VE6 A;  3RWD A;  3PWN A;  1A1M A;  5H94 A;  3KPS A;  1S7S A;  4FFE X;  2BNQ A;  3TBY A;  1UXS A;  3E6H A;  4PRB A;  1HHJ A;  5E00 A;  3RZC A;  1A9E A;  5MEP A;  2AV7 A;  2RFX A;  3BW9 A;  4PRH A;  1AGB A;  3MRB A;  5C09 A;  4D0C A;  5J6G A;  4MJI A;  4U6X A;  4IIQ C;  4U1I A;  3RTQ A;  3FFC A;  5E8O A;  4PRE A;  4PV9 A;  3ROL A;  1S9W A;  4PP8 C;  1FZM A;  1HHG A;  3BEV A;  1I7T A;  5C08 A;  3RL1 A;  5IB3 A;  2ZSW A;  4Y4F A;  1PQZ A;  5E8N A;  2OI9 A;  3FON A;  3DBX A;  3I6L D;  4F7P A;  1YDP A;  3BEW A;  2GIT A;  3VXO A;  3TO4 A;  1JPF A;  1T0M A;  3ARD A;  3E2H A;  2F54 A;  1P4L A;  1WBX A;  3HPJ A;  1T7V A;  1YPZ A;  3M1B A;  5J1A A;  5BXF A;  5GSR A;  2XPG A;  4MVB A;  3TBV A;  1W0V A;  2ESV A;  3GSQ A;  3HE6 A;  2BVP A;  3MRH A;  4NHU E;  4ONO A;  3TZV C;  1X7Q A;  1LDP H;  4QRQ A;  1KJ3 H;  2C7U A;  3CDG A;  5GSV A;  1YN6 A;  3IT8 D;  4JRY A;  3HLA A;  5D7J C;  3U0P A;  3DTX A;  3RUG A;  3GMQ A;  4ELM A;  4L8C A;  1S7U A;  1QEW A;  3P4N A;  3QDM A;  2H26 A;  3LKR A;  2BSS A;  1MHC A;  3BH9 A;  4NQX A;  3RWE A;  2AKR A;  2PYE A;  2YEZ A;  3KPM A;  4EI5 A;  3GIV A;  5JHD A;  1KTL A;  1YN7 A;  3O9W A;  3P4O A;  4HUX A;  4N0F A;  1IM9 A;  1JF1 A;  3VJ6 A;  3X13 A;  3FT4 A;  3QQ3 A;  4D0D A;  3LKP A;  3TF7 A;  3GSR A;  1JHT A;  3GMO A;  3VFV A;  4G8G A;  1BQH A;  1K5N A;  1AGC A;  2D31 A;  5C0I A;  1KJ2 H;  2NW3 A;  2X4U A;  3RWJ A;  4QRP A;  3T1F A;  5C0D A;  4NNX A;  3MRR A;  3VXN A;  4N8V A;  1S8D A;  1P1Z A;  4LCC C;  2ZOK A;  1T7Z A;  3WS6 A;  1HHH A;  2ZOL A;  4G42 A;  1XR9 A;  4NQV A;  3TBT A;  4QRR A;  3KPL A;  1DDH A;  4UQ2 A;  3VXU A;  3SDC A;  1DUZ A;  3OV6 A;  3MA7 A;  4N5E A;  3SCM A;  1GZP A;  3TVM A;  3WL9 A;  3CVH A;  1ZHK A;  3MRD A;  4U1H A;  2NX5 A;  3BP4 A;  4XXC A;  4QRT A;  5IEH A;  4PRP A;  1GZQ A;  4MQ7 A;  1G7Q A;  3JVG A;  5D9S A;  1C16 A;  4X6E A;  5EOT A;  5J6H A;  1UXW A;  3OXR A;  1UQS A;  2GAZ A;  1FZO A;  3IXA A;  3P73 A;  3ROO A;  1I4F A;  1KPR A;  4Y16 A;  3GSW A;  1MI5 A;  5IM7 A;  4ZAK A;  1QVO A;  3MRQ A;  3QUX A;  2HJL A;  4IRJ A;  4NO3 A;  4D0B A;  3T8X A;  1ZAG A;  3QDJ A;  1JGE A;  4PRA A;  1KJM A;  3PWJ A;  4PG2 A;  1NEZ A;  3BZF A;  3QUZ A;  4Z78 A;  2BCK A;  2X4S A;  5EUO A;  2A83 A;  2VAB A;  1E28 A;  3ECB A;  3VH8 A;  1ZHL A;  1XR8 A;  5MEO A;  5INC A;  3P9L A;  4UQ3 A;  4U1S A;  1AGD A;  1JPG A;  4WWK C;  3D39 A;  5HHO A;  3H7B A;  3VFO A;  3SDD A;  3VFR A;  3VWJ A;  2J8U A;  3MRP A;  1S7Q A;  1S7V A;  1MHE A;  3BVN A;  3L3G A;  1P7Q A;  1B3J A;  4LNR A;  5C0C A;  3VFP A;  1U58 A;  3DXA A;  4APQ A;  5MEN A;  1EEZ A;  4JFE A;  1ZS8 A;  3MRE A;  1JFM A;  4L29 A;  3GMM A;  4FTV A;  3QFD A;  3VWK A;  4PJH A;  3VRJ A;  5HYJ A;  1QO3 A;  5EFI A;  3ARG A;  3LKN A;  4MNG A;  4F7E A;  5DDH A;  2F74 A;  4L3C A;  2Q7Y A;  5MEQ A;  1I7R A;  1M05 A;  4HWZ A;  3REW A;  1LEK A;  5B39 A;  1A1N A;  5MER A;  1M6O A;  1FG2 A;  2X4R A;  4WDI A;  3VFW A;  3FQW A;  4L8D A;  1JGD A;  5FA3 A;  3VXM A;  4WUU A;  1EFX A;  2X4P A;  1TVB A;  2GUO A;  4U1N A;  1VGK A;  2H6P A;  1I1A A;  2X4T A;  4WJ5 A;  1S9X A;  2YPK A;  3P4M A;  4GUP A;  4PGD A;  3SKO A;  3X14 A;  3FOL A;  1AGF A;  1KPU A;  4L4T A;  2WY3 A;  3ARE A;  4ZUW A;  2OL3 H;  4G9D A;  4ZFZ A;  3VXP A;  5IRO A;  5D7I A;  1OF2 A;  5AD0 A;  5IB1 A;  3RWG A;  5SWZ A;  5DEF A;  5F9J A;  1LEG A;  3PWU A;  3OX8 A;  4K71 B;  4JQX A;  3FTG A;  5D2L A;  3D18 A;  4PGE A;  3P77 A;  3AU1 A;  4NSK A;  1INQ A;  1N5A A;  4QRU A;  4JFF A;  4PV8 A;  1W0W A;  1T7W A;  3DX6 A;  3E3Q A;  3PQY A;  3FT2 A;  5C0E A;  3RWF A;  1LP9 A;  3WUW A;  4F7M A;  2E7L E;  3M17 A;  5C0J A;  3HCV A;  3X12 A;  2UWE A;  2BNR A;  1HSB A;  1ZT1 A;  1QQD A;  3JTT A;  4MJ5 A;  3BXN A;  1T0N A;  3KYN A;  4PJC A;  4X6C A;  4X6D A;  4MJ6 A;  3GSO A;  1ZHN A;  5HHM A;  4ZUT A;  3TID A;  3OXS A;  3FQX A;  3KPR A;  3VCL A;  4CVZ A;  2V2X A;  3RWH A;  5L2K A;  3BUY A;  3QFJ A;  2PO6 A;  3FQT A;  3DX8 A;  4U1L A;  1OSZ A;  1JE6 A;  4PGB A;  3TFK A;  3MRJ A;  5C9J A;  1ZVS A;  3QEQ A;  3VXR A;  1LD9 A;  1HYR C;  3VFN A;  3VFM A;  3TIE A;  3L3K A;  2BST A;  1OGT A;  4PJ9 A;  3E6F A;  1IM3 A;  2CKB H;  1S7T A;  4L8B A;  4N0U A;  3PWL A;  4Y4H A;  3L3J A;  1QR1 A;  4PJD A;  1TVH A;  3QQ4 A;  4NQD A;  1BZ9 A;  1T1W A;  1XZ0 A;  1A1O A;  2V2W A;  3LN5 A;  3W39 A;  3UPR A;  3TO2 A;  1N2R A;  3O3B A;  1E27 A;  3ARB A;  3QUY A;  4JFO A;  2X4Q A;  3HE7 A;  4MX7 A;  3MRG A;  4Z77 A;  4ZUS A;  4HUV A;  3BGM A;  3CC5 A;  3TBS A;  3MRC A;  5ISZ A;  3V5D A;  3BO8 A;  5E6I C;  3CZF A;  4PJI A;  3MRI A;  4WW2 C;  3GSN H;  3MRK A;  4L8S C;  3DMM A;  4HUU A;  3TA3 A;  1FZJ A;  4CW1 A;  1BII A;  3GMN A;  4JQV A;  4PJA A;  4PJB A;  3B6S A;  4G43 A;  3G08 A;  4IHO A;  5B38 A;  4G8I A;  5F1N A;  3JTC A;  4O2E A;  1QSE A;  4PG9 A;  1A9B A;  2BSR A;  4G59 A;  5HGH A;  3UTT A;  1DUY A;  5C07 A;  1T1Z A;  3KPO A;  3UTQ A;  4GKN A;  2JCC A;  3SKM A;  1HSA A;  1VAC A;  3H9H A;  4PJ5 A;  3SDA A;  1QSF A;  1RJY A;  1Z5L A;  3D2U A;  4PRD A;  3TJH A;  4S0U C;  3TN0 A;  2AXF A;  1LQV A;  3WLB A;  1G7P A;  5C0B A;  1S7W A;  1NAM H;  3TPU E;  3I6G A;  2VLK A;  2GTW A;  3QDG A;  2CII A;  2HJK A;  3LKS A;  2BVO A;  2DYP A;  3QUL A;  2VLL A;  3W0W A;  3O8X A;  1RK1 A;  2FWO A;  4NO5 A;  3MRN A;  4PJG A;  3TBW A;  4QOK A;  3BHB A;  3C8K A;  4L3E A;  1S7R A;  3FQN A;  1FO0 H;  1FFP A;  4X6F A;  1K8D A;  1AO7 A;  1QRN A; 
#chains in the Genus database with same CATH topology
 2VAA A;  1N59 A;  3MR9 A;  5ACZ A;  1XH3 A;  3BP7 A;  2XFX A;  4NT6 A;  1B0R A;  2F53 A;  1L8J A;  3RGV C;  3V5K A;  3L9R A;  3VFS A;  1R3H A;  1RK0 A;  5EU4 A;  1WBZ A;  2GJ6 A;  3L3D A;  5F7D A;  2ZSV A;  3O3A A;  3KXF A;  2AK4 A;  3MV7 A;  3KLA A;  3VRI A;  2P5W A;  1CG9 A;  2AXG A;  4LHU A;  4LCY A;  4PDC E;  3BH8 A;  3MRL A;  1G6R H;  5EU5 A;  4JRX A;  4HUW A;  4PRI A;  1S9Y A;  2CLR A;  3P9M A;  2YPL A;  2HLA A;  3VFU A;  1T22 A;  1T1X A;  4N0C A;  5BJT A;  5IVX A;  3H9S A;  5EO1 A;  1BD2 A;  1LK2 A;  4LCW A;  1T21 A;  3D3V A;  3FRU A;  5BRZ A;  4E5X A;  3AM8 A;  1WBY A;  4U1K A;  3VFT A;  1EXU A;  2CIK A;  1T7X A;  5IND A;  1Q94 A;  5IB2 A;  3GSX A;  4F7T A;  3O3D A;  4HKJ A;  4GKS A;  4PJE A;  3KPN A;  5E9D A;  4ZUU A;  3D25 A;  1AKJ A;  3MV8 A;  5DEG A;  3QI9 A;  1SYS A;  1TMC A;  1FFN A;  1ZHB A;  4PJX A;  4PRN A;  5HHN A;  4Y2D A;  3BZE A;  1I1Y A;  3LV3 A;  3WS3 A;  3V5H A;  4NQC A;  3JTS A;  1FZK A;  3ILQ C;  1QLF A;  1OGA A;  3NFN A;  4QRS A;  4E0R A;  5IEK A;  3RL2 A;  4EN3 C;  1DE4 A;  4K7F A;  4WU7 A;  1HHI A;  4I4W A;  5HHQ A;  3SJV A;  3VXS A;  3LKO A;  1ED3 A;  1ZT4 A;  4ZUV A;  4IRS A;  4EUP A;  4WU5 A;  1B0G A;  3RWI A;  5EU3 A;  3CPL A;  4U6Y A;  3ES6 A;  2X4O A;  3FQU A;  4L4V A;  4V3D B;  4MS8 A;  5E8P A;  4I48 A;  3ARF A;  5SWQ A;  3GJF A;  3ILP A;  2X70 A;  3DX7 A;  3BWA A;  3UBX A;  4F7C A;  5FDW A;  3MRM A;  4U1J A;  2GTZ A;  1I7U A;  3MV9 A;  4O2C A;  1AGE A;  4WO4 A;  5HGA A;  3MRO A;  1NAN H;  1T1Y A;  1CE6 A;  3GML A;  4PR5 A;  3S6C A;  1T7Y A;  3B3I A;  3PAB A;  4NO0 A;  1HOC A;  1S7X A;  5HHP A;  3L3I A;  2CLZ A;  4HV8 A;  3L3H A;  3X11 A;  3HAE A;  4V3E B;  4NNY A;  2VLR A;  1T80 A;  4Z76 A;  2VLJ A;  5F1I A;  3GMP A;  3I6K A;  3KWW A;  1ONQ A;  1I1F A;  2BVQ A;  1MWA H;  5ENW A;  3ERY A;  4PGC A;  4JO8 A;  1CD1 A;  3QZW A;  5EU6 A;  1JUF A;  3MYJ A;  1EEY A;  4PJF A;  5FA4 A;  5L2J A;  2AV1 A;  3GSU A;  4JFP A;  1W72 A;  4JFD A;  4NQE A;  4PJ8 A;  4MNQ A;  3MRF A;  3KPP A;  4HS3 A;  1KBG H;  2FYY A;  1N3N A;  4Y4K A;  3CCH A;  4PJ7 A;  5D2N A;  3SDX A;  2CLV A;  3MGO A;  1KCG C;  2FO4 A;  5C0F A;  5HGD A;  1ZSD A;  5EO0 A;  5FKP A;  1A6Z A;  5D7L A;  3HUJ A;  2P5E A;  5C0A A;  4JFQ A;  5D5M A;  2X4N A;  4L9L C;  1FFO A;  3FOM A;  3GSV A;  1ZT7 A;  3FT3 A;  4G9F A;  3C9N A;  1RJZ A;  5C0G A;  1HHK A;  5BS0 A;  2HN7 A;  1VAD A;  1KPV A;  1SYV A;  3GMR A;  2FZ3 A;  5SWS A;  3KYO A;  3LKQ A;  3O3E A;  4CVX A;  2FIK A;  4HX1 A;  3KPQ A;  3LN4 A;  3PWV A;  4MXQ A;  4NO2 A;  5HGB A;  3HG1 A;  3FQR A;  5IB4 A;  3SPV A;  3RWC A;  3QUK A;  3CH1 A;  4U1M A;  2GT9 A;  1T20 A;  3O4L A;  1KJV A;  4O2F A;  3MGT A;  3UTS A;  2MHA A;  5IB5 A;  3PWP A;  2VE6 A;  3RWD A;  3PWN A;  1A1M A;  5H94 A;  3KPS A;  1S7S A;  4FFE X;  2BNQ A;  3TBY A;  1UXS A;  3E6H A;  4PRB A;  1HHJ A;  5E00 A;  3RZC A;  1A9E A;  5MEP A;  2AV7 A;  2RFX A;  3BW9 A;  4PRH A;  1AGB A;  3MRB A;  5C09 A;  4D0C A;  5J6G A;  4MJI A;  4U6X A;  4IIQ C;  4U1I A;  3RTQ A;  3FFC A;  5E8O A;  4PRE A;  4PV9 A;  3ROL A;  1S9W A;  4PP8 C;  1FZM A;  1HHG A;  3BEV A;  1I7T A;  5C08 A;  3RL1 A;  5IB3 A;  2ZSW A;  4Y4F A;  1PQZ A;  5E8N A;  2OI9 A;  3FON A;  3DBX A;  3I6L D;  4F7P A;  1YDP A;  3BEW A;  2GIT A;  3VXO A;  3TO4 A;  1JPF A;  1T0M A;  3ARD A;  3E2H A;  2F54 A;  1P4L A;  1WBX A;  3HPJ A;  1T7V A;  1YPZ A;  3M1B A;  5J1A A;  5BXF A;  5GSR A;  2XPG A;  4MVB A;  3TBV A;  1W0V A;  2ESV A;  3GSQ A;  3HE6 A;  2BVP A;  3MRH A;  4NHU E;  4ONO A;  3TZV C;  1X7Q A;  1LDP H;  4QRQ A;  1KJ3 H;  2C7U A;  3CDG A;  5GSV A;  1YN6 A;  3IT8 D;  4JRY A;  3HLA A;  5D7J C;  3U0P A;  3DTX A;  3RUG A;  3GMQ A;  4ELM A;  4L8C A;  1S7U A;  1QEW A;  3P4N A;  3QDM A;  2H26 A;  3LKR A;  2BSS A;  1MHC A;  3BH9 A;  4NQX A;  3RWE A;  2AKR A;  2PYE A;  2YEZ A;  3KPM A;  4EI5 A;  3GIV A;  5JHD A;  1KTL A;  1YN7 A;  3O9W A;  3P4O A;  4HUX A;  4N0F A;  1IM9 A;  1JF1 A;  3VJ6 A;  3X13 A;  3FT4 A;  3QQ3 A;  4D0D A;  3LKP A;  3TF7 A;  3GSR A;  1JHT A;  3GMO A;  3VFV A;  4G8G A;  1BQH A;  1K5N A;  1AGC A;  2D31 A;  5C0I A;  1KJ2 H;  2NW3 A;  2X4U A;  3RWJ A;  4QRP A;  3T1F A;  5C0D A;  4NNX A;  3MRR A;  3VXN A;  4N8V A;  1S8D A;  1P1Z A;  4LCC C;  2ZOK A;  1T7Z A;  3WS6 A;  1HHH A;  2ZOL A;  4G42 A;  1XR9 A;  4NQV A;  3TBT A;  4QRR A;  3KPL A;  1DDH A;  4UQ2 A;  3VXU A;  3SDC A;  1DUZ A;  3OV6 A;  3MA7 A;  4N5E A;  3SCM A;  1GZP A;  3TVM A;  3WL9 A;  3CVH A;  1ZHK A;  3MRD A;  4U1H A;  2NX5 A;  3BP4 A;  4XXC A;  4QRT A;  5IEH A;  4PRP A;  1GZQ A;  4MQ7 A;  1G7Q A;  3JVG A;  5D9S A;  1C16 A;  4X6E A;  5EOT A;  5J6H A;  1UXW A;  3OXR A;  1UQS A;  2GAZ A;  1FZO A;  3IXA A;  3P73 A;  3ROO A;  1I4F A;  1KPR A;  4Y16 A;  3GSW A;  1MI5 A;  5IM7 A;  4ZAK A;  1QVO A;  3MRQ A;  3QUX A;  2HJL A;  4IRJ A;  4NO3 A;  4D0B A;  3T8X A;  1ZAG A;  3QDJ A;  1JGE A;  4PRA A;  1KJM A;  3PWJ A;  4PG2 A;  1NEZ A;  3BZF A;  3QUZ A;  4Z78 A;  2BCK A;  2X4S A;  5EUO A;  2A83 A;  2VAB A;  1E28 A;  3ECB A;  3VH8 A;  1ZHL A;  1XR8 A;  5MEO A;  5INC A;  3P9L A;  4UQ3 A;  4U1S A;  1AGD A;  1JPG A;  4WWK C;  3D39 A;  5HHO A;  3H7B A;  4BKW A;  3VFO A;  3SDD A;  3VFR A;  3VWJ A;  2J8U A;  3MRP A;  1S7Q A;  1S7V A;  1MHE A;  3BVN A;  3L3G A;  1P7Q A;  1B3J A;  4LNR A;  5C0C A;  3VFP A;  1U58 A;  3DXA A;  4APQ A;  5MEN A;  1EEZ A;  4JFE A;  1ZS8 A;  3MRE A;  1JFM A;  4L29 A;  3GMM A;  4FTV A;  3QFD A;  3VWK A;  4PJH A;  3VRJ A;  5HYJ A;  1QO3 A;  5EFI A;  3ARG A;  3LKN A;  4MNG A;  4F7E A;  5DDH A;  2F74 A;  4L3C A;  2Q7Y A;  5MEQ A;  1I7R A;  1M05 A;  4HWZ A;  3REW A;  1LEK A;  5B39 A;  1A1N A;  5MER A;  1M6O A;  1FG2 A;  2X4R A;  4WDI A;  3VFW A;  3FQW A;  4L8D A;  1JGD A;  5FA3 A;  3VXM A;  4WUU A;  1EFX A;  2X4P A;  1TVB A;  2GUO A;  4U1N A;  1VGK A;  2H6P A;  1I1A A;  2NYK A;  2X4T A;  4WJ5 A;  1S9X A;  2YPK A;  3P4M A;  4GUP A;  4PGD A;  3SKO A;  3X14 A;  3FOL A;  1AGF A;  1KPU A;  4L4T A;  2WY3 A;  3ARE A;  4ZUW A;  2OL3 H;  4G9D A;  4ZFZ A;  3VXP A;  5IRO A;  5D7I A;  1OF2 A;  5AD0 A;  5IB1 A;  3RWG A;  5SWZ A;  5DEF A;  5F9J A;  1LEG A;  3PWU A;  3OX8 A;  4K71 B;  4JQX A;  3FTG A;  5D2L A;  3D18 A;  4PGE A;  3P77 A;  3AU1 A;  4NSK A;  1INQ A;  1N5A A;  4QRU A;  4JFF A;  4PV8 A;  1W0W A;  1T7W A;  3DX6 A;  3E3Q A;  3PQY A;  3FT2 A;  5C0E A;  3RWF A;  1LP9 A;  3WUW A;  4F7M A;  2E7L E;  3M17 A;  5C0J A;  3HCV A;  3X12 A;  2UWE A;  2BNR A;  1HSB A;  1ZT1 A;  1QQD A;  3JTT A;  4MJ5 A;  3BXN A;  1T0N A;  3KYN A;  4PJC A;  4X6C A;  4X6D A;  4MJ6 A;  2O5N A;  3GSO A;  1ZHN A;  5HHM A;  4ZUT A;  3TID A;  3OXS A;  3FQX A;  3KPR A;  3VCL A;  4CVZ A;  2V2X A;  3RWH A;  5L2K A;  3BUY A;  3QFJ A;  2PO6 A;  3FQT A;  3DX8 A;  4U1L A;  1OSZ A;  1JE6 A;  4PGB A;  3TFK A;  3MRJ A;  5C9J A;  1ZVS A;  3QEQ A;  4G59 C;  3VXR A;  1LD9 A;  1HYR C;  3VFN A;  3VFM A;  3TIE A;  3L3K A;  2BST A;  1OGT A;  4PJ9 A;  3E6F A;  1IM3 A;  2CKB H;  1S7T A;  4L8B A;  4N0U A;  3PWL A;  4Y4H A;  2IA1 A;  3L3J A;  1QR1 A;  4PJD A;  1TVH A;  3QQ4 A;  4NQD A;  1BZ9 A;  1T1W A;  1XZ0 A;  1A1O A;  2V2W A;  3LN5 A;  3W39 A;  3UPR A;  3TO2 A;  1N2R A;  3O3B A;  1E27 A;  3ARB A;  3QUY A;  4JFO A;  2X4Q A;  3HE7 A;  4MX7 A;  3MRG A;  4Z77 A;  4ZUS A;  4HUV A;  3BGM A;  3CC5 A;  3TBS A;  3MRC A;  5ISZ A;  3V5D A;  3BO8 A;  5E6I C;  3CZF A;  4PJI A;  3MRI A;  4WW2 C;  3GSN H;  3MRK A;  4L8S C;  3DMM A;  4HUU A;  3TA3 A;  1FZJ A;  4CW1 A;  1BII A;  3GMN A;  4JQV A;  4PJA A;  4PJB A;  3B6S A;  4G43 A;  3G08 A;  4IHO A;  5B38 A;  4G8I A;  5F1N A;  3JTC A;  4O2E A;  1QSE A;  4PG9 A;  1A9B A;  2BSR A;  4G59 A;  5HGH A;  3UTT A;  1DUY A;  5C07 A;  1T1Z A;  3KPO A;  3UTQ A;  4GKN A;  2JCC A;  3SKM A;  1HSA A;  1VAC A;  3H9H A;  4PJ5 A;  3SDA A;  1QSF A;  1RJY A;  1Z5L A;  3D2U A;  4PRD A;  3TJH A;  4S0U C;  3TN0 A;  2AXF A;  1LQV A;  3WLB A;  1G7P A;  5C0B A;  1S7W A;  1NAM H;  3TPU E;  3I6G A;  2VLK A;  2GTW A;  3QDG A;  2CII A;  2HJK A;  3LKS A;  2BVO A;  2DYP A;  3QUL A;  2VLL A;  3I0T A;  3W0W A;  3O8X A;  1RK1 A;  2FWO A;  4NO5 A;  3MRN A;  4PJG A;  3TBW A;  4QOK A;  3BHB A;  3C8K A;  4L3E A;  1S7R A;  3FQN A;  1FO0 H;  1FFP A;  4X6F A;  1K8D A;  1AO7 A;  1QRN A; 
#chains in the Genus database with same CATH homology
 2VAA A;  1N59 A;  3MR9 A;  5ACZ A;  1XH3 A;  3BP7 A;  2XFX A;  4NT6 A;  1B0R A;  2F53 A;  1L8J A;  3RGV C;  3V5K A;  3L9R A;  3VFS A;  1R3H A;  1RK0 A;  5EU4 A;  1WBZ A;  2GJ6 A;  3L3D A;  5F7D A;  2ZSV A;  3O3A A;  3KXF A;  2AK4 A;  3MV7 A;  3KLA A;  3VRI A;  2P5W A;  1CG9 A;  2AXG A;  4LHU A;  4LCY A;  4PDC E;  3BH8 A;  3MRL A;  1G6R H;  5EU5 A;  4JRX A;  4HUW A;  4PRI A;  1S9Y A;  2CLR A;  3P9M A;  2YPL A;  2HLA A;  3VFU A;  1T22 A;  1T1X A;  4N0C A;  5BJT A;  5IVX A;  3H9S A;  5EO1 A;  1BD2 A;  1LK2 A;  4LCW A;  1T21 A;  3D3V A;  3FRU A;  5BRZ A;  4E5X A;  3AM8 A;  1WBY A;  4U1K A;  3VFT A;  1EXU A;  2CIK A;  1T7X A;  5IND A;  1Q94 A;  5IB2 A;  3GSX A;  4F7T A;  3O3D A;  4HKJ A;  4GKS A;  4PJE A;  3KPN A;  5E9D A;  4ZUU A;  3D25 A;  1AKJ A;  3MV8 A;  5DEG A;  3QI9 A;  1SYS A;  1TMC A;  1FFN A;  1ZHB A;  4PJX A;  4PRN A;  5HHN A;  4Y2D A;  3BZE A;  1I1Y A;  3LV3 A;  3WS3 A;  3V5H A;  4NQC A;  3JTS A;  1FZK A;  3ILQ C;  1QLF A;  1OGA A;  3NFN A;  4QRS A;  4E0R A;  5IEK A;  3RL2 A;  4EN3 C;  1DE4 A;  4K7F A;  4WU7 A;  1HHI A;  4I4W A;  5HHQ A;  3SJV A;  3VXS A;  3LKO A;  1ED3 A;  1ZT4 A;  4ZUV A;  4IRS A;  4EUP A;  4WU5 A;  1B0G A;  3RWI A;  5EU3 A;  3CPL A;  4U6Y A;  3ES6 A;  2X4O A;  3FQU A;  4L4V A;  4V3D B;  4MS8 A;  5E8P A;  4I48 A;  3ARF A;  5SWQ A;  3GJF A;  3ILP A;  2X70 A;  3DX7 A;  3BWA A;  3UBX A;  4F7C A;  5FDW A;  3MRM A;  4U1J A;  2GTZ A;  1I7U A;  3MV9 A;  4O2C A;  1AGE A;  4WO4 A;  5HGA A;  3MRO A;  1NAN H;  1T1Y A;  1CE6 A;  3GML A;  4PR5 A;  3S6C A;  1T7Y A;  3B3I A;  3PAB A;  4NO0 A;  1HOC A;  1S7X A;  5HHP A;  3L3I A;  2CLZ A;  4HV8 A;  3L3H A;  3X11 A;  3HAE A;  4V3E B;  4NNY A;  2VLR A;  1T80 A;  4Z76 A;  2VLJ A;  5F1I A;  3GMP A;  3I6K A;  3KWW A;  1ONQ A;  1I1F A;  2BVQ A;  1MWA H;  5ENW A;  3ERY A;  4PGC A;  1CD1 A;  3QZW A;  5EU6 A;  1JUF A;  3MYJ A;  1EEY A;  4PJF A;  5FA4 A;  5L2J A;  2AV1 A;  3GSU A;  4JFP A;  1W72 A;  4JFD A;  4NQE A;  4PJ8 A;  4MNQ A;  3MRF A;  3KPP A;  4HS3 A;  1KBG H;  2FYY A;  1N3N A;  4Y4K A;  3CCH A;  4PJ7 A;  5D2N A;  3SDX A;  2CLV A;  3MGO A;  1KCG C;  2FO4 A;  5C0F A;  5HGD A;  1ZSD A;  5EO0 A;  5FKP A;  1A6Z A;  5D7L A;  3HUJ A;  2P5E A;  5C0A A;  4JFQ A;  5D5M A;  2X4N A;  4L9L C;  1FFO A;  3FOM A;  3GSV A;  1ZT7 A;  3FT3 A;  4G9F A;  3C9N A;  1RJZ A;  5C0G A;  1HHK A;  5BS0 A;  2HN7 A;  1VAD A;  1KPV A;  1SYV A;  3GMR A;  2FZ3 A;  5SWS A;  3KYO A;  3LKQ A;  3O3E A;  4CVX A;  2FIK A;  4HX1 A;  3KPQ A;  3LN4 A;  3PWV A;  4MXQ A;  4NO2 A;  5HGB A;  3HG1 A;  3FQR A;  5IB4 A;  3SPV A;  3RWC A;  3QUK A;  3CH1 A;  4U1M A;  2GT9 A;  1T20 A;  3O4L A;  1KJV A;  4O2F A;  3MGT A;  3UTS A;  2MHA A;  5IB5 A;  3PWP A;  2VE6 A;  3RWD A;  3PWN A;  1A1M A;  5H94 A;  3KPS A;  1S7S A;  4FFE X;  2BNQ A;  3TBY A;  1UXS A;  3E6H A;  4PRB A;  1HHJ A;  5E00 A;  3RZC A;  1A9E A;  5MEP A;  2AV7 A;  2RFX A;  3BW9 A;  4PRH A;  1AGB A;  3MRB A;  5C09 A;  4D0C A;  5J6G A;  4MJI A;  4U6X A;  4IIQ C;  4U1I A;  3RTQ A;  3FFC A;  5E8O A;  4PRE A;  4PV9 A;  3ROL A;  1S9W A;  4PP8 C;  1FZM A;  1HHG A;  3BEV A;  1I7T A;  5C08 A;  3RL1 A;  5IB3 A;  2ZSW A;  4Y4F A;  1PQZ A;  5E8N A;  2OI9 A;  3FON A;  3DBX A;  3I6L D;  4F7P A;  1YDP A;  3BEW A;  2GIT A;  3VXO A;  3TO4 A;  1JPF A;  1T0M A;  3ARD A;  3E2H A;  2F54 A;  1P4L A;  1WBX A;  3HPJ A;  1T7V A;  1YPZ A;  3M1B A;  5J1A A;  5BXF A;  5GSR A;  2XPG A;  4MVB A;  3TBV A;  1W0V A;  2ESV A;  3GSQ A;  3HE6 A;  2BVP A;  3MRH A;  4NHU E;  4ONO A;  3TZV C;  1X7Q A;  1LDP H;  4QRQ A;  1KJ3 H;  2C7U A;  3CDG A;  5GSV A;  1YN6 A;  3IT8 D;  4JRY A;  3HLA A;  5D7J C;  3U0P A;  3DTX A;  3RUG A;  3GMQ A;  4ELM A;  4L8C A;  1S7U A;  1QEW A;  3P4N A;  3QDM A;  2H26 A;  3LKR A;  2BSS A;  1MHC A;  3BH9 A;  4NQX A;  3RWE A;  2AKR A;  2PYE A;  2YEZ A;  3KPM A;  4EI5 A;  3GIV A;  5JHD A;  1KTL A;  1YN7 A;  3O9W A;  3P4O A;  4HUX A;  4N0F A;  1IM9 A;  1JF1 A;  3VJ6 A;  3X13 A;  3FT4 A;  3QQ3 A;  4D0D A;  3LKP A;  3TF7 A;  3GSR A;  1JHT A;  3GMO A;  3VFV A;  4G8G A;  1BQH A;  1K5N A;  1AGC A;  2D31 A;  5C0I A;  1KJ2 H;  2NW3 A;  2X4U A;  3RWJ A;  4QRP A;  3T1F A;  5C0D A;  4NNX A;  3MRR A;  3VXN A;  4N8V A;  1S8D A;  1P1Z A;  4LCC C;  2ZOK A;  1T7Z A;  3WS6 A;  1HHH A;  2ZOL A;  4G42 A;  1XR9 A;  4NQV A;  3TBT A;  4QRR A;  3KPL A;  1DDH A;  4UQ2 A;  3VXU A;  3SDC A;  1DUZ A;  3OV6 A;  3MA7 A;  4N5E A;  3SCM A;  1GZP A;  3TVM A;  3WL9 A;  3CVH A;  1ZHK A;  3MRD A;  4U1H A;  2NX5 A;  3BP4 A;  4XXC A;  4QRT A;  5IEH A;  4PRP A;  1GZQ A;  4MQ7 A;  1G7Q A;  3JVG A;  5D9S A;  1C16 A;  4X6E A;  5EOT A;  5J6H A;  1UXW A;  3OXR A;  1UQS A;  2GAZ A;  1FZO A;  3IXA A;  3P73 A;  3ROO A;  1I4F A;  1KPR A;  4Y16 A;  3GSW A;  1MI5 A;  5IM7 A;  4ZAK A;  1QVO A;  3MRQ A;  3QUX A;  2HJL A;  4IRJ A;  4NO3 A;  4D0B A;  3T8X A;  1ZAG A;  3QDJ A;  1JGE A;  4PRA A;  1KJM A;  3PWJ A;  4PG2 A;  1NEZ A;  3BZF A;  3QUZ A;  4Z78 A;  2BCK A;  2X4S A;  5EUO A;  2A83 A;  2VAB A;  1E28 A;  3ECB A;  3VH8 A;  1ZHL A;  1XR8 A;  5MEO A;  5INC A;  3P9L A;  4UQ3 A;  4U1S A;  1AGD A;  1JPG A;  4WWK C;  3D39 A;  5HHO A;  3H7B A;  3VFO A;  3SDD A;  3VFR A;  3VWJ A;  2J8U A;  3MRP A;  1S7Q A;  1S7V A;  1MHE A;  3BVN A;  3L3G A;  1P7Q A;  1B3J A;  4LNR A;  5C0C A;  3VFP A;  1U58 A;  3DXA A;  4APQ A;  5MEN A;  1EEZ A;  4JFE A;  1ZS8 A;  3MRE A;  1JFM A;  4L29 A;  3GMM A;  4FTV A;  3QFD A;  3VWK A;  4PJH A;  3VRJ A;  5HYJ A;  1QO3 A;  5EFI A;  3ARG A;  3LKN A;  4MNG A;  4F7E A;  5DDH A;  2F74 A;  4L3C A;  2Q7Y A;  5MEQ A;  1I7R A;  1M05 A;  4HWZ A;  3REW A;  1LEK A;  5B39 A;  1A1N A;  5MER A;  1M6O A;  1FG2 A;  2X4R A;  4WDI A;  3VFW A;  3FQW A;  4L8D A;  1JGD A;  5FA3 A;  3VXM A;  4WUU A;  1EFX A;  2X4P A;  1TVB A;  2GUO A;  4U1N A;  1VGK A;  2H6P A;  1I1A A;  2X4T A;  4WJ5 A;  1S9X A;  2YPK A;  3P4M A;  4GUP A;  4PGD A;  3SKO A;  3X14 A;  3FOL A;  1AGF A;  1KPU A;  4L4T A;  2WY3 A;  3ARE A;  4ZUW A;  2OL3 H;  4G9D A;  4ZFZ A;  3VXP A;  5IRO A;  5D7I A;  1OF2 A;  5AD0 A;  5IB1 A;  3RWG A;  5SWZ A;  5DEF A;  5F9J A;  1LEG A;  3PWU A;  3OX8 A;  4K71 B;  4JQX A;  3FTG A;  5D2L A;  3D18 A;  4PGE A;  3P77 A;  3AU1 A;  4NSK A;  1INQ A;  1N5A A;  4QRU A;  4JFF A;  4PV8 A;  1W0W A;  1T7W A;  3DX6 A;  3E3Q A;  3PQY A;  3FT2 A;  5C0E A;  3RWF A;  1LP9 A;  3WUW A;  4F7M A;  2E7L E;  3M17 A;  5C0J A;  3HCV A;  3X12 A;  2UWE A;  2BNR A;  1HSB A;  1ZT1 A;  1QQD A;  3JTT A;  4MJ5 A;  3BXN A;  1T0N A;  3KYN A;  4PJC A;  4X6C A;  4X6D A;  4MJ6 A;  3GSO A;  1ZHN A;  5HHM A;  4ZUT A;  3TID A;  3OXS A;  3FQX A;  3KPR A;  3VCL A;  4CVZ A;  2V2X A;  3RWH A;  5L2K A;  3BUY A;  3QFJ A;  2PO6 A;  3FQT A;  3DX8 A;  4U1L A;  1OSZ A;  1JE6 A;  4PGB A;  3TFK A;  3MRJ A;  5C9J A;  1ZVS A;  3QEQ A;  3VXR A;  1LD9 A;  1HYR C;  3VFN A;  3VFM A;  3TIE A;  3L3K A;  2BST A;  1OGT A;  4PJ9 A;  3E6F A;  1IM3 A;  2CKB H;  1S7T A;  4L8B A;  4N0U A;  3PWL A;  4Y4H A;  3L3J A;  1QR1 A;  4PJD A;  1TVH A;  3QQ4 A;  4NQD A;  1BZ9 A;  1T1W A;  1XZ0 A;  1A1O A;  2V2W A;  3LN5 A;  3W39 A;  3UPR A;  3TO2 A;  1N2R A;  3O3B A;  1E27 A;  3ARB A;  3QUY A;  4JFO A;  2X4Q A;  3HE7 A;  4MX7 A;  3MRG A;  4Z77 A;  4ZUS A;  4HUV A;  3BGM A;  3CC5 A;  3TBS A;  3MRC A;  5ISZ A;  3V5D A;  3BO8 A;  5E6I C;  3CZF A;  4PJI A;  3MRI A;  4WW2 C;  3GSN H;  3MRK A;  4L8S C;  3DMM A;  4HUU A;  3TA3 A;  1FZJ A;  4CW1 A;  1BII A;  3GMN A;  4JQV A;  4PJA A;  4PJB A;  3B6S A;  4G43 A;  3G08 A;  4IHO A;  5B38 A;  4G8I A;  5F1N A;  3JTC A;  4O2E A;  1QSE A;  4PG9 A;  1A9B A;  2BSR A;  4G59 A;  5HGH A;  3UTT A;  1DUY A;  5C07 A;  1T1Z A;  3KPO A;  3UTQ A;  4GKN A;  2JCC A;  3SKM A;  1HSA A;  1VAC A;  3H9H A;  4PJ5 A;  3SDA A;  1QSF A;  1RJY A;  1Z5L A;  3D2U A;  4PRD A;  3TJH A;  4S0U C;  3TN0 A;  2AXF A;  1LQV A;  3WLB A;  1G7P A;  5C0B A;  1S7W A;  1NAM H;  3TPU E;  3I6G A;  2VLK A;  2GTW A;  3QDG A;  2CII A;  2HJK A;  3LKS A;  2BVO A;  2DYP A;  3QUL A;  2VLL A;  3W0W A;  3O8X A;  1RK1 A;  2FWO A;  4NO5 A;  3MRN A;  4PJG A;  3TBW A;  4QOK A;  3BHB A;  3C8K A;  4L3E A;  1S7R A;  3FQN A;  1FO0 H;  1FFP A;  4X6F A;  1K8D A;  1AO7 A;  1QRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...