4S0UC

Crystal structure of nkg2d in complex with ulbp6
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
DPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
total genus 48
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4s0uC00
2X4RA 3SDCA 1VGKA 1ZT4A 3GSNH 3MV7A 1HYRC 1S9XA 4MS8A 3FQRA 4Y16A 5D7JC 3JTTA 5HYJA 1BZ9A 5E6IC 2GT9A 3FQTA 3MRPA 3P4NA 3TO2A 2X70A 3MRJA 4NQCA 4PJIA 3T8XA 4D0BA 5C0AA 3QDGA 4K71B 4NNYA 1FZKA 1HHKA 4F7TA 1C16A 4CVZA 1WBZA 4G8IA 1QSEA 2WY3A 1ZT7A 1CE6A 4MJ6A 2FYYA 4MQ7A 1LEKA 5D7IA 3KXFA 1OF2A 1G7QA 3RL2A 2GUOA 4GUPA 3H7BA 1P4LA 3LN5A 4FTVA 1P7QA 3TA3A 1BIIA 1S7QA 2VLJA 4U1HA 3WS3A 1AGBA 1IM3A 4IIQC 5L2JA 3OX8A 4PG9A 3DX8A 4G59A 4HKJA 1NEZA 3B6SA 3QDJA 2BVPA 1L8JA 3RWEA 1YDPA 2F53A 3TJHA 3CVHA 3HE7A 3O3AA 3HLAA 1RK0A 3MRNA 3AREA 4PV8A 1LD9A 3CH1A 1KJ3H 5C08A 1QRNA 1FFPA 4WDIA 5AD0A 3VFTA 2VABA 1X7QA 3VXOA 1UXSA 3BP4A 4X6DA 4PRHA 1JUFA 1KPVA 5INDA 3ROOA 3RZCA 5FA4A 4LNRA 1AGCA 1RK1A 3W0WA 3BO8A 4U6YA 1S7TA 3FRUA 4PJ9A 3BH9A 4FFEX 2AV1A 3QUYA 3KPQA 3M17A 4JFEA 1S7UA 3RGVC 4L8CA 1JGEA 3RWGA 3TBTA 4QRTA 3RL1A 4PJBA 3X14A 3SDXA 3ARGA 1FO0H 3X11A 3RWCA 2GITA 1S8DA 1VADA 4NO3A 3WL9A 3VJ6A 3VRIA 5IB4A 2F54A 3ARDA 4D0DA 5BJTA 4IHOA 5B39A 3GMNA 5C07A 4F7MA 1NAMH 3DTXA 4N0UA 4PJXA 3VXMA 3GSXA 3E6FA 3MV9A 3MRIA 4PGDA 4JFPA 1JHTA 3HCVA 5ENWA 2X4TA 5IB2A 5FDWA 5IB5A 2XPGA 3L3HA 4N0CA 4PRNA 4MVBA 1XR9A 4U1NA 3CPLA 3UTQA 1KCGC 4NO2A 3CCHA 3P4MA 4Y4HA 3L3KA 4LCWA 2X4PA 4MJIA 5HGHA 2HJKA 3KPRA 3QUKA 2OI9A 3WUWA 4G9FA 4L29A 2CKBH 2H26A 2DYPA 2BVQA 1R3HA 3PQYA 2X4SA 5SWSA 1I1YA 4QRRA 4EI5A 2X4OA 3VFRA 3IT8D 5INCA 3QFDA 3VXUA 2P5EA 3FOLA 3OXSA 1EEZA 5BRZA 3P77A 1I1AA 3PWNA 4PRPA 3GJFA 3GSQA 3DXAA 1T1XA 3LKNA 1DE4A 5IB1A 1ZVSA 1AGEA 1TMCA 3D18A 3FTGA 5HHQA 3AM8A 3SKMA 2AKRA 4PREA 3FQUA 3TBVA 1HHIA 3B3IA 2AXFA 1KJVA 2HLAA 3MA7A 3V5DA 1QO3A 2FZ3A 4IRSA 1EEYA 5DEGA 5SWQA 4E5XA 1YN7A 1ZHKA 2CLRA 3LKPA 5EFIA 3MRRA 2FWOA 5FKPA 5E00A 4PJGA 3MGOA 5C0DA 4L4TA 4ZUWA 5C0CA 3D2UA 4HWZA 3SDAA 1FFNA 5EU6A 5EOTA 1XR8A 5GSVA 3MRDA 5EU4A 5D7LA 4APQA 1A1MA 5C0EA 3LKQA 5C0FA 3BZFA 2BVOA 3VFWA 3FT2A 2XFXA 1FG2A 2YPKA 1ED3A 3D25A 4G8GA 4QOKA 3MRKA 1KJMA 1Z5LA 4IRJA 4HUWA 3U0PA 1QEWA 1HOCA 4L3EA 1CD1A 2JCCA 4HUUA 1QSFA 4QRSA 1QQDA 5C9JA 2GTZA 4PR5A 4X6FA 3L3JA 3KYOA 3TIDA 3GSVA 3GMQA 4NQEA 2A83A 4N8VA 1FZJA 3BH8A 5HGAA 4MXQA 1A1OA 5J1AA 2H6PA 4GKSA 3VXPA 5IM7A 1WBXA 1MI5A 4U1SA 3QQ3A 4NQVA 4PJCA 4PG2A 3SCMA 4UQ2A 1T7WA 3PWPA 4G42A 1HSBA 5IVXA 1I1FA 3T1FA 3GMPA 3LV3A 4LCYA 2VLKA 4S0UC 4JRXA 5E8NA 2VAAA 1MHCA 1TVBA 4PJAA 4MNQA 5C0IA 3O8XA 2CIKA 3DBXA 2RFXA 1T0MA 5L2KA 3UTTA 5F1IA 2FO4A 3O3DA 4ZUTA 2OL3H 5MEQA 4WWKC 1ZHNA 3TBYA 3GMRA 1W72A 4UQ3A 1S9WA 4PJEA 3HE6A 4LHUA 1NANH 1T7YA 2BSSA 3FOMA 3I6GA 5D2NA 4F7CA 3KYNA 5D5MA 3LKOA 2PYEA 3IXAA 4QRUA 2P5WA 4I48A 4L4VA 3QDMA 4WJ5A 5EU5A 3MROA 1LDPH 3I6LD 1N59A 3BEWA 1JF1A 1B0GA 1LEGA 3MR9A 3WLBA 1SYSA 3CZFA 4PJ5A 1T7XA 4U1MA 1I4FA 4F7PA 4HUVA 1TVHA 3BUYA 4G43A 3TO4A 2BNQA 2YEZA 3I6KA 3PWUA 3TVMA 1OGTA 4WU5A 3TF7A 1T21A 1BD2A 3PWVA 2AV7A 1QLFA 3C9NA 4MX7A 3BHBA 1ZT1A 3SJVA 3RWJA 1A6ZA 3P9LA 1RJZA 3S6CA 4Z77A 5F7DA 4L8DA 1YN6A 1S9YA 1IM9A 4O2FA 3O3EA 1HHGA 1FZMA 4HUXA 1WBYA 3LKSA 3ES6A 4JQXA 4JQVA 5IB3A 3TPUE 3L9RA 1T7ZA 4G9DA 4WU7A 5EO1A 2ZOKA 3RTQA 1I7RA 3GMMA 2CLVA 3MRCA 3PWJA 5BS0A 4PJ8A 3JTCA 4PRBA 4LCCC 1E27A 3VFUA 5HHNA 3VXNA 3SDDA 2X4NA 3OV6A 1SYVA 1N3NA 4ZUUA 4JFFA 3BWAA 4QRPA 4X6CA 5F9JA 3TBWA 2NW3A 1B0RA 1M05A 3KWWA 4ZAKA 3LN4A 2Q7YA 4O2CA 4O2EA 2D31A 1EXUA 3HAEA 3MRGA 1KPRA 4I4WA 5D9SA 2V2WA 3V5HA 2VE6A 5MENA 2V2XA 2X4QA 3GSOA 4PP8C 3DMMA 4L9LC 2AXGA 1ZHLA 4Y4FA 4ZUSA 3E2HA 1KPUA 4NT6A 5ISZA 2MHAA 3D3VA 3RUGA 3L3IA 1MWAH 4U1JA 1VACA 3TBSA 3D39A 5DEFA 5MEPA 5HGBA 1KBGH 3VRJA 3QUZA 4JFQA 4CW1A 3VWKA 3KPLA 3BP7A 1HHJA 1I7UA 1AO7A 3HG1A 4Y4KA 3VFPA 3SPVA 1FFOA 3FQWA 3GMOA 3O3BA 1JPFA 3VFMA 2BCKA 3MRHA 3UBXA 3RWHA 3H9SA 4PJFA 5E9DA 1T1WA 3PWLA 1G7PA 5H94A 4ZUVA 1LP9A 3MRMA 1M6OA 5GSRA 5HHOA 1KJ2H 3P4OA 4JFOA 3SKOA 5E8OA 4PV9A 2HN7A 3PABA 5C09A 4EN3C 3GSRA 3DX6A 1S7WA 4CVXA 3UTSA 3VFNA 1A9BA 3JVGA 2ESVA 1T0NA 1OSZA 2UWEA 1LQVA 3GSWA 5ACZA 1K5NA 4U1IA 1W0WA 2PO6A 3HPJA 5IEHA 3QFJA 3NFNA 1I7TA 1K8DA 3TZVC 3QZWA 2CLZA 2CIIA 1ONQA 5D2LA 3C8KA 5EU3A 1GZPA 1T7VA 5HGDA 3GIVA 3RWDA 4NHUE 3ERYA 2GJ6A 3VXSA 3V5KA 1LK2A 3MYJA 5F1NA 4PGBA 4Z78A 3CDGA 3QI9A 1S7VA 4Z76A 5C0JA 2ZSVA 1BQHA 1QR1A 4HV8A 3VWJA 2BSTA 1GZQA 3AU1A 1DUZA 3GMLA 3REWA 3VH8A 1INQA 4K7FA 3MRQA 4ONOA 1EFXA 2NX5A 3P73A 4PJHA 5B38A 4MNGA 3W39A 4NQXA 3FQXA 3BGMA 1MHEA 3L3GA 4PGCA 1P1ZA 3KPNA 3L3DA 3BVNA 4L3CA 3BXNA 3ECBA 3VCLA 3P9MA 1T22A 3KPPA 4E0RA 2J8UA 2VLLA 3WS6A 3UPRA 3VFOA 3GSUA 1AGFA 4PJDA 4X6EA 5IEKA 5HHMA 1HHHA 3KPOA 5EUOA 4F7EA 1CG9A 3O9WA 4MJ5A 1OGAA 3O4LA 5C0BA 3FQNA 1AKJA 2AK4A 2E7LE 1JFMA 1KTLA 3MGTA 5MEOA 2ZOLA 1UQSA 3VFVA 2ZSWA 2VLRA 1U58A 3MV8A 4PRDA 4PRAA 4U1LA 4V3EB 4L8BA 1T80A 4NO5A 4WW2C 3TN0A 4JRYA 4PGEA 1PQZA 5MERA 3OXRA 3FT4A 1XZ0A 3QQ4A 3M1BA 1T20A 2GTWA 3FT3A 4HS3A 4PDCE 4EUPA 2F74A 1AGDA 4L8SC 5IROA 5J6HA 1XH3A 3ILQC 2X4UA 3QEQA 3RWFA 3JTSA 4NO0A 3X12A 1DUYA 4PRIA 5SWZA 5C0GA 3ROLA 5J6GA 4D0CA 3E6HA 2C7UA 4QRQA 3KPMA 5JHDA 1N2RA 3KPSA 3VFSA 2HJLA 1HSAA 3BZEA 3QULA 4NQDA 3DX7A 4HX1A 5FA3A 2BNRA 3MRLA 1JE6A 1RJYA 4ZFZA 1ZAGA 1JPGA 3RWIA 1ZS8A 1W0VA 2FIKA 3MRFA 3MREA 5DDHA 1ZHBA 3BW9A 4JFDA 3VXRA 1S7RA 3KLAA 4NNXA 2GAZA 3G08A 3BEVA 3QUXA 1YPZA 1QVOA 4N5EA 4Y2DA 3TFKA 3TIEA 1DDHA 3ARBA 1UXWA 4WUUA 1T1YA 4N0FA 4PJ7A 3FFCA 4NSKA 3MRBA 3X13A 1A9EA 4U6XA 4U1KA 3HUJA 3CC5A 3H9HA 5EO0A 3ARFA 5BXFA 2BSRA 1T1ZA 1S7SA 3E3QA 1B3JA 2YPLA 4ELMA 1G6RH 1Q94A 1E28A 3ILPA 4WO4A 5HHPA 1A1NA 1JGDA 1FZOA 4GKNA 4V3DB 5E8PA 4XXCA 1N5AA 3LKRA 1S7XA 1ZSDA 3FONA
chains in the Genus database with same CATH superfamily
2X4RA 3SDCA 1VGKA 1ZT4A 3GSNH 3MV7A 1HYRC 1S9XA 4MS8A 3FQRA 4Y16A 5D7JC 3JTTA 5HYJA 1BZ9A 5E6IC 2NYKA 2GT9A 3FQTA 3MRPA 3P4NA 3TO2A 2X70A 3MRJA 4NQCA 4PJIA 3T8XA 4D0BA 5C0AA 3QDGA 4K71B 4NNYA 1FZKA 1HHKA 4F7TA 1C16A 4CVZA 1WBZA 4G8IA 1QSEA 2WY3A 1ZT7A 1CE6A 4MJ6A 2FYYA 4MQ7A 1LEKA 5D7IA 3KXFA 1OF2A 1G7QA 3RL2A 2GUOA 4BKWA 4GUPA 3H7BA 1P4LA 3LN5A 4FTVA 1P7QA 3TA3A 1BIIA 1S7QA 2VLJA 4U1HA 3WS3A 1AGBA 1IM3A 4IIQC 5L2JA 3OX8A 4PG9A 3DX8A 4G59A 4HKJA 1NEZA 3B6SA 3QDJA 2BVPA 1L8JA 3RWEA 1YDPA 2F53A 3TJHA 3CVHA 3HE7A 3O3AA 3HLAA 1RK0A 3MRNA 3AREA 4PV8A 1LD9A 3CH1A 1KJ3H 5C08A 1QRNA 1FFPA 4WDIA 5AD0A 3VFTA 2VABA 1X7QA 3VXOA 1UXSA 3BP4A 4X6DA 4PRHA 1JUFA 1KPVA 5INDA 3ROOA 3RZCA 5FA4A 4LNRA 1AGCA 1RK1A 3W0WA 3BO8A 4U6YA 1S7TA 3FRUA 4PJ9A 3BH9A 4FFEX 2AV1A 3QUYA 4G59C 3KPQA 3M17A 4JFEA 1S7UA 3RGVC 4L8CA 1JGEA 3RWGA 3TBTA 4QRTA 3RL1A 4PJBA 3X14A 3SDXA 3ARGA 1FO0H 3X11A 3RWCA 2GITA 1S8DA 1VADA 4NO3A 3WL9A 3VJ6A 3VRIA 5IB4A 2F54A 3ARDA 4D0DA 5BJTA 4IHOA 5B39A 3GMNA 5C07A 4F7MA 1NAMH 3DTXA 4N0UA 4PJXA 3VXMA 3GSXA 3E6FA 3MV9A 3MRIA 4PGDA 4JFPA 1JHTA 3HCVA 5ENWA 2X4TA 5IB2A 5FDWA 5IB5A 2XPGA 3L3HA 4N0CA 4PRNA 4MVBA 1XR9A 4U1NA 3CPLA 3UTQA 1KCGC 4NO2A 3CCHA 3P4MA 4Y4HA 3L3KA 4LCWA 2X4PA 4MJIA 5HGHA 2HJKA 3KPRA 3QUKA 2OI9A 3WUWA 4G9FA 4L29A 2CKBH 2H26A 2DYPA 2BVQA 1R3HA 3PQYA 2X4SA 5SWSA 1I1YA 4QRRA 4EI5A 2X4OA 3VFRA 3IT8D 5INCA 3QFDA 3VXUA 2P5EA 3FOLA 3OXSA 1EEZA 5BRZA 3P77A 1I1AA 3PWNA 4PRPA 3GJFA 3GSQA 3DXAA 1T1XA 3LKNA 1DE4A 5IB1A 1ZVSA 1AGEA 1TMCA 3D18A 3FTGA 5HHQA 3AM8A 3SKMA 2AKRA 4PREA 3FQUA 3TBVA 1HHIA 3B3IA 2AXFA 1KJVA 2HLAA 3MA7A 3V5DA 1QO3A 2FZ3A 4IRSA 1EEYA 5DEGA 5SWQA 4E5XA 1YN7A 1ZHKA 2CLRA 3LKPA 5EFIA 3MRRA 2FWOA 5FKPA 5E00A 4PJGA 3MGOA 5C0DA 4L4TA 4ZUWA 5C0CA 3D2UA 4HWZA 3SDAA 1FFNA 5EU6A 5EOTA 1XR8A 5GSVA 3MRDA 5EU4A 5D7LA 4APQA 1A1MA 5C0EA 3LKQA 5C0FA 3BZFA 2BVOA 3VFWA 3FT2A 2XFXA 1FG2A 2YPKA 1ED3A 3D25A 4G8GA 4QOKA 3MRKA 1KJMA 1Z5LA 4IRJA 4HUWA 3U0PA 1QEWA 1HOCA 4L3EA 1CD1A 2IA1A 2JCCA 4HUUA 1QSFA 4QRSA 1QQDA 5C9JA 2GTZA 4PR5A 4X6FA 3L3JA 3KYOA 3TIDA 3GSVA 3GMQA 4NQEA 2A83A 4N8VA 1FZJA 3BH8A 5HGAA 4MXQA 1A1OA 5J1AA 2H6PA 4GKSA 3VXPA 5IM7A 1WBXA 1MI5A 4U1SA 3QQ3A 4NQVA 4PJCA 4PG2A 3SCMA 4UQ2A 1T7WA 3PWPA 4G42A 1HSBA 5IVXA 1I1FA 3T1FA 3GMPA 3LV3A 4LCYA 2VLKA 4S0UC 4JRXA 5E8NA 2VAAA 1MHCA 1TVBA 4PJAA 4MNQA 5C0IA 3O8XA 2CIKA 3DBXA 2RFXA 1T0MA 5L2KA 3UTTA 5F1IA 2FO4A 3O3DA 4ZUTA 2OL3H 5MEQA 4WWKC 1ZHNA 3TBYA 3GMRA 1W72A 4UQ3A 1S9WA 4PJEA 3HE6A 4LHUA 1NANH 1T7YA 2BSSA 3FOMA 3I6GA 5D2NA 4F7CA 3KYNA 5D5MA 3LKOA 2PYEA 3IXAA 4QRUA 2P5WA 4I48A 4L4VA 3QDMA 4WJ5A 5EU5A 3MROA 1LDPH 3I6LD 1N59A 3BEWA 1JF1A 1B0GA 1LEGA 3MR9A 3WLBA 1SYSA 3CZFA 4PJ5A 1T7XA 4U1MA 1I4FA 4F7PA 4HUVA 1TVHA 3BUYA 4G43A 3TO4A 2BNQA 2YEZA 3I6KA 3PWUA 3TVMA 1OGTA 4WU5A 3TF7A 1T21A 1BD2A 3PWVA 2AV7A 1QLFA 3C9NA 4MX7A 3BHBA 1ZT1A 3SJVA 3RWJA 1A6ZA 3P9LA 1RJZA 3S6CA 4Z77A 5F7DA 4L8DA 1YN6A 1S9YA 1IM9A 4O2FA 3O3EA 1HHGA 1FZMA 4HUXA 1WBYA 3LKSA 3ES6A 4JQXA 4JQVA 5IB3A 3TPUE 3L9RA 1T7ZA 4G9DA 4WU7A 5EO1A 2ZOKA 3RTQA 1I7RA 3GMMA 2CLVA 3MRCA 3PWJA 5BS0A 4PJ8A 3JTCA 4PRBA 4LCCC 1E27A 3VFUA 5HHNA 3VXNA 3SDDA 2X4NA 3OV6A 1SYVA 1N3NA 4ZUUA 4JFFA 3BWAA 4QRPA 4X6CA 5F9JA 3TBWA 2NW3A 1B0RA 1M05A 3KWWA 4ZAKA 3LN4A 2Q7YA 4O2CA 4O2EA 2D31A 1EXUA 3HAEA 3MRGA 1KPRA 4I4WA 5D9SA 2V2WA 3V5HA 2VE6A 5MENA 2V2XA 2X4QA 3GSOA 4PP8C 3DMMA 4L9LC 2AXGA 1ZHLA 4Y4FA 4ZUSA 3E2HA 1KPUA 4NT6A 5ISZA 2MHAA 3D3VA 3RUGA 3L3IA 1MWAH 4U1JA 1VACA 3TBSA 3D39A 5DEFA 5MEPA 5HGBA 1KBGH 3VRJA 3QUZA 4JFQA 4CW1A 3VWKA 3KPLA 3BP7A 1HHJA 1I7UA 1AO7A 3HG1A 4Y4KA 3VFPA 3SPVA 1FFOA 3FQWA 3GMOA 3O3BA 1JPFA 3VFMA 2BCKA 3MRHA 3UBXA 3RWHA 3H9SA 4PJFA 5E9DA 1T1WA 3PWLA 1G7PA 5H94A 4ZUVA 1LP9A 3MRMA 1M6OA 5GSRA 5HHOA 1KJ2H 3P4OA 4JFOA 3SKOA 5E8OA 4PV9A 2HN7A 3PABA 5C09A 4EN3C 3GSRA 3DX6A 1S7WA 4CVXA 3UTSA 3I0TA 1A9BA 3VFNA 3JVGA 2ESVA 1T0NA 1OSZA 2UWEA 1LQVA 3GSWA 5ACZA 1K5NA 4U1IA 1W0WA 2PO6A 3HPJA 5IEHA 3QFJA 3NFNA 1I7TA 1K8DA 3TZVC 3QZWA 2CLZA 2CIIA 1ONQA 5D2LA 3C8KA 5EU3A 1GZPA 1T7VA 5HGDA 3GIVA 3RWDA 4NHUE 3ERYA 2GJ6A 3VXSA 3V5KA 1LK2A 3MYJA 5F1NA 4PGBA 4Z78A 3CDGA 3QI9A 1S7VA 4Z76A 5C0JA 2O5NA 2ZSVA 1BQHA 1QR1A 4HV8A 3VWJA 2BSTA 1GZQA 3AU1A 1DUZA 3GMLA 3REWA 3VH8A 1INQA 4K7FA 3MRQA 4ONOA 1EFXA 2NX5A 3P73A 4PJHA 5B38A 4MNGA 3W39A 4NQXA 3FQXA 3BGMA 1MHEA 3L3GA 4PGCA 1P1ZA 3KPNA 3L3DA 3BVNA 4L3CA 3BXNA 3ECBA 3VCLA 3P9MA 1T22A 3KPPA 4E0RA 2J8UA 2VLLA 3WS6A 3UPRA 3VFOA 3GSUA 1AGFA 4PJDA 4X6EA 5IEKA 5HHMA 1HHHA 3KPOA 5EUOA 4F7EA 1CG9A 3O9WA 4MJ5A 1OGAA 3O4LA 5C0BA 3FQNA 1AKJA 2AK4A 2E7LE 1JFMA 1KTLA 3MGTA 5MEOA 2ZOLA 1UQSA 3VFVA 2ZSWA 2VLRA 1U58A 3MV8A 4PRDA 4PRAA 4U1LA 4V3EB 4L8BA 1T80A 4NO5A 4WW2C 3TN0A 4JRYA 4PGEA 1PQZA 5MERA 3OXRA 3FT4A 1XZ0A 3QQ4A 3M1BA 1T20A 2GTWA 3FT3A 4HS3A 4PDCE 4EUPA 2F74A 1AGDA 4L8SC 5IROA 5J6HA 1XH3A 3ILQC 2X4UA 3QEQA 3RWFA 3JTSA 4NO0A 3X12A 1DUYA 4PRIA 5SWZA 5C0GA 3ROLA 5J6GA 4D0CA 3E6HA 4JO8A 2C7UA 4QRQA 3KPMA 5JHDA 1N2RA 3KPSA 3VFSA 2HJLA 1HSAA 3BZEA 3QULA 4NQDA 3DX7A 4HX1A 5FA3A 2BNRA 3MRLA 1JE6A 1RJYA 4ZFZA 1ZAGA 1JPGA 3RWIA 1ZS8A 1W0VA 2FIKA 3MRFA 3MREA 5DDHA 1ZHBA 3BW9A 4JFDA 3VXRA 1S7RA 3KLAA 4NNXA 2GAZA 3G08A 3BEVA 3QUXA 1YPZA 1QVOA 4N5EA 4Y2DA 3TFKA 3TIEA 1DDHA 3ARBA 1UXWA 4WUUA 1T1YA 4N0FA 4PJ7A 3FFCA 4NSKA 3MRBA 3X13A 1A9EA 4U6XA 4U1KA 3HUJA 3CC5A 3H9HA 5EO0A 3ARFA 5BXFA 2BSRA 1T1ZA 1S7SA 3E3QA 1B3JA 2YPLA 4ELMA 1G6RH 1Q94A 1E28A 3ILPA 4WO4A 5HHPA 1A1NA 1JGDA 1FZOA 4GKNA 4V3DB 5E8PA 4XXCA 1N5AA 3LKRA 1S7XA 1ZSDA 3FONA
chains in the Genus database with same CATH topology
2X4RA 3SDCA 1VGKA 1ZT4A 3GSNH 3MV7A 1HYRC 1S9XA 4MS8A 3FQRA 4Y16A 5D7JC 3JTTA 5HYJA 1BZ9A 5E6IC 2GT9A 3FQTA 3MRPA 3P4NA 3TO2A 2X70A 3MRJA 4NQCA 4PJIA 3T8XA 4D0BA 5C0AA 3QDGA 4K71B 4NNYA 1FZKA 1HHKA 4F7TA 1C16A 4CVZA 1WBZA 4G8IA 1QSEA 2WY3A 1ZT7A 1CE6A 4MJ6A 2FYYA 4MQ7A 1LEKA 5D7IA 3KXFA 1OF2A 1G7QA 3RL2A 2GUOA 4GUPA 3H7BA 1P4LA 3LN5A 4FTVA 1P7QA 3TA3A 1BIIA 1S7QA 2VLJA 4U1HA 3WS3A 1AGBA 1IM3A 4IIQC 5L2JA 3OX8A 4PG9A 3DX8A 4G59A 4HKJA 1NEZA 3B6SA 3QDJA 2BVPA 1L8JA 3RWEA 1YDPA 2F53A 3TJHA 3CVHA 3HE7A 3O3AA 3HLAA 1RK0A 3MRNA 3AREA 4PV8A 1LD9A 3CH1A 1KJ3H 5C08A 1QRNA 1FFPA 4WDIA 5AD0A 3VFTA 2VABA 1X7QA 3VXOA 1UXSA 3BP4A 4X6DA 4PRHA 1JUFA 1KPVA 5INDA 3ROOA 3RZCA 5FA4A 4LNRA 1AGCA 1RK1A 3W0WA 3BO8A 4U6YA 1S7TA 3FRUA 4PJ9A 3BH9A 4FFEX 2AV1A 3QUYA 3KPQA 3M17A 4JFEA 1S7UA 3RGVC 4L8CA 1JGEA 3RWGA 3TBTA 4QRTA 3RL1A 4PJBA 3X14A 3SDXA 3ARGA 1FO0H 3X11A 3RWCA 2GITA 1S8DA 1VADA 4NO3A 3WL9A 3VJ6A 3VRIA 5IB4A 2F54A 3ARDA 4D0DA 5BJTA 4IHOA 5B39A 3GMNA 5C07A 4F7MA 1NAMH 3DTXA 4N0UA 4PJXA 3VXMA 3GSXA 3E6FA 3MV9A 3MRIA 4PGDA 4JFPA 1JHTA 3HCVA 5ENWA 2X4TA 5IB2A 5FDWA 5IB5A 2XPGA 3L3HA 4N0CA 4PRNA 4MVBA 1XR9A 4U1NA 3CPLA 3UTQA 1KCGC 4NO2A 3CCHA 3P4MA 4Y4HA 3L3KA 4LCWA 2X4PA 4MJIA 5HGHA 2HJKA 3KPRA 3QUKA 2OI9A 3WUWA 4G9FA 4L29A 2CKBH 2H26A 2DYPA 2BVQA 1R3HA 3PQYA 2X4SA 5SWSA 1I1YA 4QRRA 4EI5A 2X4OA 3VFRA 3IT8D 5INCA 3QFDA 3VXUA 2P5EA 3FOLA 3OXSA 1EEZA 5BRZA 3P77A 1I1AA 3PWNA 4PRPA 3GJFA 3GSQA 3DXAA 1T1XA 3LKNA 1DE4A 5IB1A 1ZVSA 1AGEA 1TMCA 3D18A 3FTGA 5HHQA 3AM8A 3SKMA 2AKRA 4PREA 3FQUA 3TBVA 1HHIA 3B3IA 2AXFA 1KJVA 2HLAA 3MA7A 3V5DA 1QO3A 2FZ3A 4IRSA 1EEYA 5DEGA 5SWQA 4E5XA 1YN7A 1ZHKA 2CLRA 3LKPA 5EFIA 3MRRA 2FWOA 5FKPA 5E00A 4PJGA 3MGOA 5C0DA 4L4TA 4ZUWA 5C0CA 3D2UA 4HWZA 3SDAA 1FFNA 5EU6A 5EOTA 1XR8A 5GSVA 3MRDA 5EU4A 5D7LA 4APQA 1A1MA 5C0EA 3LKQA 5C0FA 3BZFA 2BVOA 3VFWA 3FT2A 2XFXA 1FG2A 2YPKA 1ED3A 3D25A 4G8GA 4QOKA 3MRKA 1KJMA 1Z5LA 4IRJA 4HUWA 3U0PA 1QEWA 1HOCA 4L3EA 1CD1A 2JCCA 4HUUA 1QSFA 4QRSA 1QQDA 5C9JA 2GTZA 4PR5A 4X6FA 3L3JA 3KYOA 3TIDA 3GSVA 3GMQA 4NQEA 2A83A 4N8VA 1FZJA 3BH8A 5HGAA 4MXQA 1A1OA 5J1AA 2H6PA 4GKSA 3VXPA 5IM7A 1WBXA 1MI5A 4U1SA 3QQ3A 4NQVA 4PJCA 4PG2A 3SCMA 4UQ2A 1T7WA 3PWPA 4G42A 1HSBA 5IVXA 1I1FA 3T1FA 3GMPA 3LV3A 4LCYA 2VLKA 4S0UC 4JRXA 5E8NA 2VAAA 1MHCA 1TVBA 4PJAA 4MNQA 5C0IA 3O8XA 2CIKA 3DBXA 2RFXA 1T0MA 5L2KA 3UTTA 5F1IA 2FO4A 3O3DA 4ZUTA 2OL3H 5MEQA 4WWKC 1ZHNA 3TBYA 3GMRA 1W72A 4UQ3A 1S9WA 4PJEA 3HE6A 4LHUA 1NANH 1T7YA 2BSSA 3FOMA 3I6GA 5D2NA 4F7CA 3KYNA 5D5MA 3LKOA 2PYEA 3IXAA 4QRUA 2P5WA 4I48A 4L4VA 3QDMA 4WJ5A 5EU5A 3MROA 1LDPH 3I6LD 1N59A 3BEWA 1JF1A 1B0GA 1LEGA 3MR9A 3WLBA 1SYSA 3CZFA 4PJ5A 1T7XA 4U1MA 1I4FA 4F7PA 4HUVA 1TVHA 3BUYA 4G43A 3TO4A 2BNQA 2YEZA 3I6KA 3PWUA 3TVMA 1OGTA 4WU5A 3TF7A 1T21A 1BD2A 3PWVA 2AV7A 1QLFA 3C9NA 4MX7A 3BHBA 1ZT1A 3SJVA 3RWJA 1A6ZA 3P9LA 1RJZA 3S6CA 4Z77A 5F7DA 4L8DA 1YN6A 1S9YA 1IM9A 4O2FA 3O3EA 1HHGA 1FZMA 4HUXA 1WBYA 3LKSA 3ES6A 4JQXA 4JQVA 5IB3A 3TPUE 3L9RA 1T7ZA 4G9DA 4WU7A 5EO1A 2ZOKA 3RTQA 1I7RA 3GMMA 2CLVA 3MRCA 3PWJA 5BS0A 4PJ8A 3JTCA 4PRBA 4LCCC 1E27A 3VFUA 5HHNA 3VXNA 3SDDA 2X4NA 3OV6A 1SYVA 1N3NA 4ZUUA 4JFFA 3BWAA 4QRPA 4X6CA 5F9JA 3TBWA 2NW3A 1B0RA 1M05A 3KWWA 4ZAKA 3LN4A 2Q7YA 4O2CA 4O2EA 2D31A 1EXUA 3HAEA 3MRGA 1KPRA 4I4WA 5D9SA 2V2WA 3V5HA 2VE6A 5MENA 2V2XA 2X4QA 3GSOA 4PP8C 3DMMA 4L9LC 2AXGA 1ZHLA 4Y4FA 4ZUSA 3E2HA 1KPUA 4NT6A 5ISZA 2MHAA 3D3VA 3RUGA 3L3IA 1MWAH 4U1JA 1VACA 3TBSA 3D39A 5DEFA 5MEPA 5HGBA 1KBGH 3VRJA 3QUZA 4JFQA 4CW1A 3VWKA 3KPLA 3BP7A 1HHJA 1I7UA 1AO7A 3HG1A 4Y4KA 3VFPA 3SPVA 1FFOA 3FQWA 3GMOA 3O3BA 1JPFA 3VFMA 2BCKA 3MRHA 3UBXA 3RWHA 3H9SA 4PJFA 5E9DA 1T1WA 3PWLA 1G7PA 5H94A 4ZUVA 1LP9A 3MRMA 1M6OA 5GSRA 5HHOA 1KJ2H 3P4OA 4JFOA 3SKOA 5E8OA 4PV9A 2HN7A 3PABA 5C09A 4EN3C 3GSRA 3DX6A 1S7WA 4CVXA 3UTSA 3VFNA 1A9BA 3JVGA 2ESVA 1T0NA 1OSZA 2UWEA 1LQVA 3GSWA 5ACZA 1K5NA 4U1IA 1W0WA 2PO6A 3HPJA 5IEHA 3QFJA 3NFNA 1I7TA 1K8DA 3TZVC 3QZWA 2CLZA 2CIIA 1ONQA 5D2LA 3C8KA 5EU3A 1GZPA 1T7VA 5HGDA 3GIVA 3RWDA 4NHUE 3ERYA 2GJ6A 3VXSA 3V5KA 1LK2A 3MYJA 5F1NA 4PGBA 4Z78A 3CDGA 3QI9A 1S7VA 4Z76A 5C0JA 2ZSVA 1BQHA 1QR1A 4HV8A 3VWJA 2BSTA 1GZQA 3AU1A 1DUZA 3GMLA 3REWA 3VH8A 1INQA 4K7FA 3MRQA 4ONOA 1EFXA 2NX5A 3P73A 4PJHA 5B38A 4MNGA 3W39A 4NQXA 3FQXA 3BGMA 1MHEA 3L3GA 4PGCA 1P1ZA 3KPNA 3L3DA 3BVNA 4L3CA 3BXNA 3ECBA 3VCLA 3P9MA 1T22A 3KPPA 4E0RA 2J8UA 2VLLA 3WS6A 3UPRA 3VFOA 3GSUA 1AGFA 4PJDA 4X6EA 5IEKA 5HHMA 1HHHA 3KPOA 5EUOA 4F7EA 1CG9A 3O9WA 4MJ5A 1OGAA 3O4LA 5C0BA 3FQNA 1AKJA 2AK4A 2E7LE 1JFMA 1KTLA 3MGTA 5MEOA 2ZOLA 1UQSA 3VFVA 2ZSWA 2VLRA 1U58A 3MV8A 4PRDA 4PRAA 4U1LA 4V3EB 4L8BA 1T80A 4NO5A 4WW2C 3TN0A 4JRYA 4PGEA 1PQZA 5MERA 3OXRA 3FT4A 1XZ0A 3QQ4A 3M1BA 1T20A 2GTWA 3FT3A 4HS3A 4PDCE 4EUPA 2F74A 1AGDA 4L8SC 5IROA 5J6HA 1XH3A 3ILQC 2X4UA 3QEQA 3RWFA 3JTSA 4NO0A 3X12A 1DUYA 4PRIA 5SWZA 5C0GA 3ROLA 5J6GA 4D0CA 3E6HA 2C7UA 4QRQA 3KPMA 5JHDA 1N2RA 3KPSA 3VFSA 2HJLA 1HSAA 3BZEA 3QULA 4NQDA 3DX7A 4HX1A 5FA3A 2BNRA 3MRLA 1JE6A 1RJYA 4ZFZA 1ZAGA 1JPGA 3RWIA 1ZS8A 1W0VA 2FIKA 3MRFA 3MREA 5DDHA 1ZHBA 3BW9A 4JFDA 3VXRA 1S7RA 3KLAA 4NNXA 2GAZA 3G08A 3BEVA 3QUXA 1YPZA 1QVOA 4N5EA 4Y2DA 3TFKA 3TIEA 1DDHA 3ARBA 1UXWA 4WUUA 1T1YA 4N0FA 4PJ7A 3FFCA 4NSKA 3MRBA 3X13A 1A9EA 4U6XA 4U1KA 3HUJA 3CC5A 3H9HA 5EO0A 3ARFA 5BXFA 2BSRA 1T1ZA 1S7SA 3E3QA 1B3JA 2YPLA 4ELMA 1G6RH 1Q94A 1E28A 3ILPA 4WO4A 5HHPA 1A1NA 1JGDA 1FZOA 4GKNA 4V3DB 5E8PA 4XXCA 1N5AA 3LKRA 1S7XA 1ZSDA 3FONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X4R A;  3SDC A;  1VGK A;  1ZT4 A;  3GSN H;  3MV7 A;  1HYR C;  1S9X A;  4MS8 A;  3FQR A;  4Y16 A;  5D7J C;  3JTT A;  5HYJ A;  1BZ9 A;  5E6I C;  2GT9 A;  3FQT A;  3MRP A;  3P4N A;  3TO2 A;  2X70 A;  3MRJ A;  4NQC A;  4PJI A;  3T8X A;  4D0B A;  5C0A A;  3QDG A;  4K71 B;  4NNY A;  1FZK A;  1HHK A;  4F7T A;  1C16 A;  4CVZ A;  1WBZ A;  4G8I A;  1QSE A;  2WY3 A;  1ZT7 A;  1CE6 A;  4MJ6 A;  2FYY A;  4MQ7 A;  1LEK A;  5D7I A;  3KXF A;  1OF2 A;  1G7Q A;  3RL2 A;  2GUO A;  4GUP A;  3H7B A;  1P4L A;  3LN5 A;  4FTV A;  1P7Q A;  3TA3 A;  1BII A;  1S7Q A;  2VLJ A;  4U1H A;  3WS3 A;  1AGB A;  1IM3 A;  4IIQ C;  5L2J A;  3OX8 A;  4PG9 A;  3DX8 A;  4G59 A;  4HKJ A;  1NEZ A;  3B6S A;  3QDJ A;  2BVP A;  1L8J A;  3RWE A;  1YDP A;  2F53 A;  3TJH A;  3CVH A;  3HE7 A;  3O3A A;  3HLA A;  1RK0 A;  3MRN A;  3ARE A;  4PV8 A;  1LD9 A;  3CH1 A;  1KJ3 H;  5C08 A;  1QRN A;  1FFP A;  4WDI A;  5AD0 A;  3VFT A;  2VAB A;  1X7Q A;  3VXO A;  1UXS A;  3BP4 A;  4X6D A;  4PRH A;  1JUF A;  1KPV A;  5IND A;  3ROO A;  3RZC A;  5FA4 A;  4LNR A;  1AGC A;  1RK1 A;  3W0W A;  3BO8 A;  4U6Y A;  1S7T A;  3FRU A;  4PJ9 A;  3BH9 A;  4FFE X;  2AV1 A;  3QUY A;  3KPQ A;  3M17 A;  4JFE A;  1S7U A;  3RGV C;  4L8C A;  1JGE A;  3RWG A;  3TBT A;  4QRT A;  3RL1 A;  4PJB A;  3X14 A;  3SDX A;  3ARG A;  1FO0 H;  3X11 A;  3RWC A;  2GIT A;  1S8D A;  1VAD A;  4NO3 A;  3WL9 A;  3VJ6 A;  3VRI A;  5IB4 A;  2F54 A;  3ARD A;  4D0D A;  5BJT A;  4IHO A;  5B39 A;  3GMN A;  5C07 A;  4F7M A;  1NAM H;  3DTX A;  4N0U A;  4PJX A;  3VXM A;  3GSX A;  3E6F A;  3MV9 A;  3MRI A;  4PGD A;  4JFP A;  1JHT A;  3HCV A;  5ENW A;  2X4T A;  5IB2 A;  5FDW A;  5IB5 A;  2XPG A;  3L3H A;  4N0C A;  4PRN A;  4MVB A;  1XR9 A;  4U1N A;  3CPL A;  3UTQ A;  1KCG C;  4NO2 A;  3CCH A;  3P4M A;  4Y4H A;  3L3K A;  4LCW A;  2X4P A;  4MJI A;  5HGH A;  2HJK A;  3KPR A;  3QUK A;  2OI9 A;  3WUW A;  4G9F A;  4L29 A;  2CKB H;  2H26 A;  2DYP A;  2BVQ A;  1R3H A;  3PQY A;  2X4S A;  5SWS A;  1I1Y A;  4QRR A;  4EI5 A;  2X4O A;  3VFR A;  3IT8 D;  5INC A;  3QFD A;  3VXU A;  2P5E A;  3FOL A;  3OXS A;  1EEZ A;  5BRZ A;  3P77 A;  1I1A A;  3PWN A;  4PRP A;  3GJF A;  3GSQ A;  3DXA A;  1T1X A;  3LKN A;  1DE4 A;  5IB1 A;  1ZVS A;  1AGE A;  1TMC A;  3D18 A;  3FTG A;  5HHQ A;  3AM8 A;  3SKM A;  2AKR A;  4PRE A;  3FQU A;  3TBV A;  1HHI A;  3B3I A;  2AXF A;  1KJV A;  2HLA A;  3MA7 A;  3V5D A;  1QO3 A;  2FZ3 A;  4IRS A;  1EEY A;  5DEG A;  5SWQ A;  4E5X A;  1YN7 A;  1ZHK A;  2CLR A;  3LKP A;  5EFI A;  3MRR A;  2FWO A;  5FKP A;  5E00 A;  4PJG A;  3MGO A;  5C0D A;  4L4T A;  4ZUW A;  5C0C A;  3D2U A;  4HWZ A;  3SDA A;  1FFN A;  5EU6 A;  5EOT A;  1XR8 A;  5GSV A;  3MRD A;  5EU4 A;  5D7L A;  4APQ A;  1A1M A;  5C0E A;  3LKQ A;  5C0F A;  3BZF A;  2BVO A;  3VFW A;  3FT2 A;  2XFX A;  1FG2 A;  2YPK A;  1ED3 A;  3D25 A;  4G8G A;  4QOK A;  3MRK A;  1KJM A;  1Z5L A;  4IRJ A;  4HUW A;  3U0P A;  1QEW A;  1HOC A;  4L3E A;  1CD1 A;  2JCC A;  4HUU A;  1QSF A;  4QRS A;  1QQD A;  5C9J A;  2GTZ A;  4PR5 A;  4X6F A;  3L3J A;  3KYO A;  3TID A;  3GSV A;  3GMQ A;  4NQE A;  2A83 A;  4N8V A;  1FZJ A;  3BH8 A;  5HGA A;  4MXQ A;  1A1O A;  5J1A A;  2H6P A;  4GKS A;  3VXP A;  5IM7 A;  1WBX A;  1MI5 A;  4U1S A;  3QQ3 A;  4NQV A;  4PJC A;  4PG2 A;  3SCM A;  4UQ2 A;  1T7W A;  3PWP A;  4G42 A;  1HSB A;  5IVX A;  1I1F A;  3T1F A;  3GMP A;  3LV3 A;  4LCY A;  2VLK A;  4S0U C;  4JRX A;  5E8N A;  2VAA A;  1MHC A;  1TVB A;  4PJA A;  4MNQ A;  5C0I A;  3O8X A;  2CIK A;  3DBX A;  2RFX A;  1T0M A;  5L2K A;  3UTT A;  5F1I A;  2FO4 A;  3O3D A;  4ZUT A;  2OL3 H;  5MEQ A;  4WWK C;  1ZHN A;  3TBY A;  3GMR A;  1W72 A;  4UQ3 A;  1S9W A;  4PJE A;  3HE6 A;  4LHU A;  1NAN H;  1T7Y A;  2BSS A;  3FOM A;  3I6G A;  5D2N A;  4F7C A;  3KYN A;  5D5M A;  3LKO A;  2PYE A;  3IXA A;  4QRU A;  2P5W A;  4I48 A;  4L4V A;  3QDM A;  4WJ5 A;  5EU5 A;  3MRO A;  1LDP H;  3I6L D;  1N59 A;  3BEW A;  1JF1 A;  1B0G A;  1LEG A;  3MR9 A;  3WLB A;  1SYS A;  3CZF A;  4PJ5 A;  1T7X A;  4U1M A;  1I4F A;  4F7P A;  4HUV A;  1TVH A;  3BUY A;  4G43 A;  3TO4 A;  2BNQ A;  2YEZ A;  3I6K A;  3PWU A;  3TVM A;  1OGT A;  4WU5 A;  3TF7 A;  1T21 A;  1BD2 A;  3PWV A;  2AV7 A;  1QLF A;  3C9N A;  4MX7 A;  3BHB A;  1ZT1 A;  3SJV A;  3RWJ A;  1A6Z A;  3P9L A;  1RJZ A;  3S6C A;  4Z77 A;  5F7D A;  4L8D A;  1YN6 A;  1S9Y A;  1IM9 A;  4O2F A;  3O3E A;  1HHG A;  1FZM A;  4HUX A;  1WBY A;  3LKS A;  3ES6 A;  4JQX A;  4JQV A;  5IB3 A;  3TPU E;  3L9R A;  1T7Z A;  4G9D A;  4WU7 A;  5EO1 A;  2ZOK A;  3RTQ A;  1I7R A;  3GMM A;  2CLV A;  3MRC A;  3PWJ A;  5BS0 A;  4PJ8 A;  3JTC A;  4PRB A;  4LCC C;  1E27 A;  3VFU A;  5HHN A;  3VXN A;  3SDD A;  2X4N A;  3OV6 A;  1SYV A;  1N3N A;  4ZUU A;  4JFF A;  3BWA A;  4QRP A;  4X6C A;  5F9J A;  3TBW A;  2NW3 A;  1B0R A;  1M05 A;  3KWW A;  4ZAK A;  3LN4 A;  2Q7Y A;  4O2C A;  4O2E A;  2D31 A;  1EXU A;  3HAE A;  3MRG A;  1KPR A;  4I4W A;  5D9S A;  2V2W A;  3V5H A;  2VE6 A;  5MEN A;  2V2X A;  2X4Q A;  3GSO A;  4PP8 C;  3DMM A;  4L9L C;  2AXG A;  1ZHL A;  4Y4F A;  4ZUS A;  3E2H A;  1KPU A;  4NT6 A;  5ISZ A;  2MHA A;  3D3V A;  3RUG A;  3L3I A;  1MWA H;  4U1J A;  1VAC A;  3TBS A;  3D39 A;  5DEF A;  5MEP A;  5HGB A;  1KBG H;  3VRJ A;  3QUZ A;  4JFQ A;  4CW1 A;  3VWK A;  3KPL A;  3BP7 A;  1HHJ A;  1I7U A;  1AO7 A;  3HG1 A;  4Y4K A;  3VFP A;  3SPV A;  1FFO A;  3FQW A;  3GMO A;  3O3B A;  1JPF A;  3VFM A;  2BCK A;  3MRH A;  3UBX A;  3RWH A;  3H9S A;  4PJF A;  5E9D A;  1T1W A;  3PWL A;  1G7P A;  5H94 A;  4ZUV A;  1LP9 A;  3MRM A;  1M6O A;  5GSR A;  5HHO A;  1KJ2 H;  3P4O A;  4JFO A;  3SKO A;  5E8O A;  4PV9 A;  2HN7 A;  3PAB A;  5C09 A;  4EN3 C;  3GSR A;  3DX6 A;  1S7W A;  4CVX A;  3UTS A;  3VFN A;  1A9B A;  3JVG A;  2ESV A;  1T0N A;  1OSZ A;  2UWE A;  1LQV A;  3GSW A;  5ACZ A;  1K5N A;  4U1I A;  1W0W A;  2PO6 A;  3HPJ A;  5IEH A;  3QFJ A;  3NFN A;  1I7T A;  1K8D A;  3TZV C;  3QZW A;  2CLZ A;  2CII A;  1ONQ A;  5D2L A;  3C8K A;  5EU3 A;  1GZP A;  1T7V A;  5HGD A;  3GIV A;  3RWD A;  4NHU E;  3ERY A;  2GJ6 A;  3VXS A;  3V5K A;  1LK2 A;  3MYJ A;  5F1N A;  4PGB A;  4Z78 A;  3CDG A;  3QI9 A;  1S7V A;  4Z76 A;  5C0J A;  2ZSV A;  1BQH A;  1QR1 A;  4HV8 A;  3VWJ A;  2BST A;  1GZQ A;  3AU1 A;  1DUZ A;  3GML A;  3REW A;  3VH8 A;  1INQ A;  4K7F A;  3MRQ A;  4ONO A;  1EFX A;  2NX5 A;  3P73 A;  4PJH A;  5B38 A;  4MNG A;  3W39 A;  4NQX A;  3FQX A;  3BGM A;  1MHE A;  3L3G A;  4PGC A;  1P1Z A;  3KPN A;  3L3D A;  3BVN A;  4L3C A;  3BXN A;  3ECB A;  3VCL A;  3P9M A;  1T22 A;  3KPP A;  4E0R A;  2J8U A;  2VLL A;  3WS6 A;  3UPR A;  3VFO A;  3GSU A;  1AGF A;  4PJD A;  4X6E A;  5IEK A;  5HHM A;  1HHH A;  3KPO A;  5EUO A;  4F7E A;  1CG9 A;  3O9W A;  4MJ5 A;  1OGA A;  3O4L A;  5C0B A;  3FQN A;  1AKJ A;  2AK4 A;  2E7L E;  1JFM A;  1KTL A;  3MGT A;  5MEO A;  2ZOL A;  1UQS A;  3VFV A;  2ZSW A;  2VLR A;  1U58 A;  3MV8 A;  4PRD A;  4PRA A;  4U1L A;  4V3E B;  4L8B A;  1T80 A;  4NO5 A;  4WW2 C;  3TN0 A;  4JRY A;  4PGE A;  1PQZ A;  5MER A;  3OXR A;  3FT4 A;  1XZ0 A;  3QQ4 A;  3M1B A;  1T20 A;  2GTW A;  3FT3 A;  4HS3 A;  4PDC E;  4EUP A;  2F74 A;  1AGD A;  4L8S C;  5IRO A;  5J6H A;  1XH3 A;  3ILQ C;  2X4U A;  3QEQ A;  3RWF A;  3JTS A;  4NO0 A;  3X12 A;  1DUY A;  4PRI A;  5SWZ A;  5C0G A;  3ROL A;  5J6G A;  4D0C A;  3E6H A;  2C7U A;  4QRQ A;  3KPM A;  5JHD A;  1N2R A;  3KPS A;  3VFS A;  2HJL A;  1HSA A;  3BZE A;  3QUL A;  4NQD A;  3DX7 A;  4HX1 A;  5FA3 A;  2BNR A;  3MRL A;  1JE6 A;  1RJY A;  4ZFZ A;  1ZAG A;  1JPG A;  3RWI A;  1ZS8 A;  1W0V A;  2FIK A;  3MRF A;  3MRE A;  5DDH A;  1ZHB A;  3BW9 A;  4JFD A;  3VXR A;  1S7R A;  3KLA A;  4NNX A;  2GAZ A;  3G08 A;  3BEV A;  3QUX A;  1YPZ A;  1QVO A;  4N5E A;  4Y2D A;  3TFK A;  3TIE A;  1DDH A;  3ARB A;  1UXW A;  4WUU A;  1T1Y A;  4N0F A;  4PJ7 A;  3FFC A;  4NSK A;  3MRB A;  3X13 A;  1A9E A;  4U6X A;  4U1K A;  3HUJ A;  3CC5 A;  3H9H A;  5EO0 A;  3ARF A;  5BXF A;  2BSR A;  1T1Z A;  1S7S A;  3E3Q A;  1B3J A;  2YPL A;  4ELM A;  1G6R H;  1Q94 A;  1E28 A;  3ILP A;  4WO4 A;  5HHP A;  1A1N A;  1JGD A;  1FZO A;  4GKN A;  4V3D B;  5E8P A;  4XXC A;  1N5A A;  3LKR A;  1S7X A;  1ZSD A;  3FON A; 
#chains in the Genus database with same CATH topology
 2X4R A;  3SDC A;  1VGK A;  1ZT4 A;  3GSN H;  3MV7 A;  1HYR C;  1S9X A;  4MS8 A;  3FQR A;  4Y16 A;  5D7J C;  3JTT A;  5HYJ A;  1BZ9 A;  5E6I C;  2NYK A;  2GT9 A;  3FQT A;  3MRP A;  3P4N A;  3TO2 A;  2X70 A;  3MRJ A;  4NQC A;  4PJI A;  3T8X A;  4D0B A;  5C0A A;  3QDG A;  4K71 B;  4NNY A;  1FZK A;  1HHK A;  4F7T A;  1C16 A;  4CVZ A;  1WBZ A;  4G8I A;  1QSE A;  2WY3 A;  1ZT7 A;  1CE6 A;  4MJ6 A;  2FYY A;  4MQ7 A;  1LEK A;  5D7I A;  3KXF A;  1OF2 A;  1G7Q A;  3RL2 A;  2GUO A;  4BKW A;  4GUP A;  3H7B A;  1P4L A;  3LN5 A;  4FTV A;  1P7Q A;  3TA3 A;  1BII A;  1S7Q A;  2VLJ A;  4U1H A;  3WS3 A;  1AGB A;  1IM3 A;  4IIQ C;  5L2J A;  3OX8 A;  4PG9 A;  3DX8 A;  4G59 A;  4HKJ A;  1NEZ A;  3B6S A;  3QDJ A;  2BVP A;  1L8J A;  3RWE A;  1YDP A;  2F53 A;  3TJH A;  3CVH A;  3HE7 A;  3O3A A;  3HLA A;  1RK0 A;  3MRN A;  3ARE A;  4PV8 A;  1LD9 A;  3CH1 A;  1KJ3 H;  5C08 A;  1QRN A;  1FFP A;  4WDI A;  5AD0 A;  3VFT A;  2VAB A;  1X7Q A;  3VXO A;  1UXS A;  3BP4 A;  4X6D A;  4PRH A;  1JUF A;  1KPV A;  5IND A;  3ROO A;  3RZC A;  5FA4 A;  4LNR A;  1AGC A;  1RK1 A;  3W0W A;  3BO8 A;  4U6Y A;  1S7T A;  3FRU A;  4PJ9 A;  3BH9 A;  4FFE X;  2AV1 A;  3QUY A;  4G59 C;  3KPQ A;  3M17 A;  4JFE A;  1S7U A;  3RGV C;  4L8C A;  1JGE A;  3RWG A;  3TBT A;  4QRT A;  3RL1 A;  4PJB A;  3X14 A;  3SDX A;  3ARG A;  1FO0 H;  3X11 A;  3RWC A;  2GIT A;  1S8D A;  1VAD A;  4NO3 A;  3WL9 A;  3VJ6 A;  3VRI A;  5IB4 A;  2F54 A;  3ARD A;  4D0D A;  5BJT A;  4IHO A;  5B39 A;  3GMN A;  5C07 A;  4F7M A;  1NAM H;  3DTX A;  4N0U A;  4PJX A;  3VXM A;  3GSX A;  3E6F A;  3MV9 A;  3MRI A;  4PGD A;  4JFP A;  1JHT A;  3HCV A;  5ENW A;  2X4T A;  5IB2 A;  5FDW A;  5IB5 A;  2XPG A;  3L3H A;  4N0C A;  4PRN A;  4MVB A;  1XR9 A;  4U1N A;  3CPL A;  3UTQ A;  1KCG C;  4NO2 A;  3CCH A;  3P4M A;  4Y4H A;  3L3K A;  4LCW A;  2X4P A;  4MJI A;  5HGH A;  2HJK A;  3KPR A;  3QUK A;  2OI9 A;  3WUW A;  4G9F A;  4L29 A;  2CKB H;  2H26 A;  2DYP A;  2BVQ A;  1R3H A;  3PQY A;  2X4S A;  5SWS A;  1I1Y A;  4QRR A;  4EI5 A;  2X4O A;  3VFR A;  3IT8 D;  5INC A;  3QFD A;  3VXU A;  2P5E A;  3FOL A;  3OXS A;  1EEZ A;  5BRZ A;  3P77 A;  1I1A A;  3PWN A;  4PRP A;  3GJF A;  3GSQ A;  3DXA A;  1T1X A;  3LKN A;  1DE4 A;  5IB1 A;  1ZVS A;  1AGE A;  1TMC A;  3D18 A;  3FTG A;  5HHQ A;  3AM8 A;  3SKM A;  2AKR A;  4PRE A;  3FQU A;  3TBV A;  1HHI A;  3B3I A;  2AXF A;  1KJV A;  2HLA A;  3MA7 A;  3V5D A;  1QO3 A;  2FZ3 A;  4IRS A;  1EEY A;  5DEG A;  5SWQ A;  4E5X A;  1YN7 A;  1ZHK A;  2CLR A;  3LKP A;  5EFI A;  3MRR A;  2FWO A;  5FKP A;  5E00 A;  4PJG A;  3MGO A;  5C0D A;  4L4T A;  4ZUW A;  5C0C A;  3D2U A;  4HWZ A;  3SDA A;  1FFN A;  5EU6 A;  5EOT A;  1XR8 A;  5GSV A;  3MRD A;  5EU4 A;  5D7L A;  4APQ A;  1A1M A;  5C0E A;  3LKQ A;  5C0F A;  3BZF A;  2BVO A;  3VFW A;  3FT2 A;  2XFX A;  1FG2 A;  2YPK A;  1ED3 A;  3D25 A;  4G8G A;  4QOK A;  3MRK A;  1KJM A;  1Z5L A;  4IRJ A;  4HUW A;  3U0P A;  1QEW A;  1HOC A;  4L3E A;  1CD1 A;  2IA1 A;  2JCC A;  4HUU A;  1QSF A;  4QRS A;  1QQD A;  5C9J A;  2GTZ A;  4PR5 A;  4X6F A;  3L3J A;  3KYO A;  3TID A;  3GSV A;  3GMQ A;  4NQE A;  2A83 A;  4N8V A;  1FZJ A;  3BH8 A;  5HGA A;  4MXQ A;  1A1O A;  5J1A A;  2H6P A;  4GKS A;  3VXP A;  5IM7 A;  1WBX A;  1MI5 A;  4U1S A;  3QQ3 A;  4NQV A;  4PJC A;  4PG2 A;  3SCM A;  4UQ2 A;  1T7W A;  3PWP A;  4G42 A;  1HSB A;  5IVX A;  1I1F A;  3T1F A;  3GMP A;  3LV3 A;  4LCY A;  2VLK A;  4S0U C;  4JRX A;  5E8N A;  2VAA A;  1MHC A;  1TVB A;  4PJA A;  4MNQ A;  5C0I A;  3O8X A;  2CIK A;  3DBX A;  2RFX A;  1T0M A;  5L2K A;  3UTT A;  5F1I A;  2FO4 A;  3O3D A;  4ZUT A;  2OL3 H;  5MEQ A;  4WWK C;  1ZHN A;  3TBY A;  3GMR A;  1W72 A;  4UQ3 A;  1S9W A;  4PJE A;  3HE6 A;  4LHU A;  1NAN H;  1T7Y A;  2BSS A;  3FOM A;  3I6G A;  5D2N A;  4F7C A;  3KYN A;  5D5M A;  3LKO A;  2PYE A;  3IXA A;  4QRU A;  2P5W A;  4I48 A;  4L4V A;  3QDM A;  4WJ5 A;  5EU5 A;  3MRO A;  1LDP H;  3I6L D;  1N59 A;  3BEW A;  1JF1 A;  1B0G A;  1LEG A;  3MR9 A;  3WLB A;  1SYS A;  3CZF A;  4PJ5 A;  1T7X A;  4U1M A;  1I4F A;  4F7P A;  4HUV A;  1TVH A;  3BUY A;  4G43 A;  3TO4 A;  2BNQ A;  2YEZ A;  3I6K A;  3PWU A;  3TVM A;  1OGT A;  4WU5 A;  3TF7 A;  1T21 A;  1BD2 A;  3PWV A;  2AV7 A;  1QLF A;  3C9N A;  4MX7 A;  3BHB A;  1ZT1 A;  3SJV A;  3RWJ A;  1A6Z A;  3P9L A;  1RJZ A;  3S6C A;  4Z77 A;  5F7D A;  4L8D A;  1YN6 A;  1S9Y A;  1IM9 A;  4O2F A;  3O3E A;  1HHG A;  1FZM A;  4HUX A;  1WBY A;  3LKS A;  3ES6 A;  4JQX A;  4JQV A;  5IB3 A;  3TPU E;  3L9R A;  1T7Z A;  4G9D A;  4WU7 A;  5EO1 A;  2ZOK A;  3RTQ A;  1I7R A;  3GMM A;  2CLV A;  3MRC A;  3PWJ A;  5BS0 A;  4PJ8 A;  3JTC A;  4PRB A;  4LCC C;  1E27 A;  3VFU A;  5HHN A;  3VXN A;  3SDD A;  2X4N A;  3OV6 A;  1SYV A;  1N3N A;  4ZUU A;  4JFF A;  3BWA A;  4QRP A;  4X6C A;  5F9J A;  3TBW A;  2NW3 A;  1B0R A;  1M05 A;  3KWW A;  4ZAK A;  3LN4 A;  2Q7Y A;  4O2C A;  4O2E A;  2D31 A;  1EXU A;  3HAE A;  3MRG A;  1KPR A;  4I4W A;  5D9S A;  2V2W A;  3V5H A;  2VE6 A;  5MEN A;  2V2X A;  2X4Q A;  3GSO A;  4PP8 C;  3DMM A;  4L9L C;  2AXG A;  1ZHL A;  4Y4F A;  4ZUS A;  3E2H A;  1KPU A;  4NT6 A;  5ISZ A;  2MHA A;  3D3V A;  3RUG A;  3L3I A;  1MWA H;  4U1J A;  1VAC A;  3TBS A;  3D39 A;  5DEF A;  5MEP A;  5HGB A;  1KBG H;  3VRJ A;  3QUZ A;  4JFQ A;  4CW1 A;  3VWK A;  3KPL A;  3BP7 A;  1HHJ A;  1I7U A;  1AO7 A;  3HG1 A;  4Y4K A;  3VFP A;  3SPV A;  1FFO A;  3FQW A;  3GMO A;  3O3B A;  1JPF A;  3VFM A;  2BCK A;  3MRH A;  3UBX A;  3RWH A;  3H9S A;  4PJF A;  5E9D A;  1T1W A;  3PWL A;  1G7P A;  5H94 A;  4ZUV A;  1LP9 A;  3MRM A;  1M6O A;  5GSR A;  5HHO A;  1KJ2 H;  3P4O A;  4JFO A;  3SKO A;  5E8O A;  4PV9 A;  2HN7 A;  3PAB A;  5C09 A;  4EN3 C;  3GSR A;  3DX6 A;  1S7W A;  4CVX A;  3UTS A;  3I0T A;  1A9B A;  3VFN A;  3JVG A;  2ESV A;  1T0N A;  1OSZ A;  2UWE A;  1LQV A;  3GSW A;  5ACZ A;  1K5N A;  4U1I A;  1W0W A;  2PO6 A;  3HPJ A;  5IEH A;  3QFJ A;  3NFN A;  1I7T A;  1K8D A;  3TZV C;  3QZW A;  2CLZ A;  2CII A;  1ONQ A;  5D2L A;  3C8K A;  5EU3 A;  1GZP A;  1T7V A;  5HGD A;  3GIV A;  3RWD A;  4NHU E;  3ERY A;  2GJ6 A;  3VXS A;  3V5K A;  1LK2 A;  3MYJ A;  5F1N A;  4PGB A;  4Z78 A;  3CDG A;  3QI9 A;  1S7V A;  4Z76 A;  5C0J A;  2O5N A;  2ZSV A;  1BQH A;  1QR1 A;  4HV8 A;  3VWJ A;  2BST A;  1GZQ A;  3AU1 A;  1DUZ A;  3GML A;  3REW A;  3VH8 A;  1INQ A;  4K7F A;  3MRQ A;  4ONO A;  1EFX A;  2NX5 A;  3P73 A;  4PJH A;  5B38 A;  4MNG A;  3W39 A;  4NQX A;  3FQX A;  3BGM A;  1MHE A;  3L3G A;  4PGC A;  1P1Z A;  3KPN A;  3L3D A;  3BVN A;  4L3C A;  3BXN A;  3ECB A;  3VCL A;  3P9M A;  1T22 A;  3KPP A;  4E0R A;  2J8U A;  2VLL A;  3WS6 A;  3UPR A;  3VFO A;  3GSU A;  1AGF A;  4PJD A;  4X6E A;  5IEK A;  5HHM A;  1HHH A;  3KPO A;  5EUO A;  4F7E A;  1CG9 A;  3O9W A;  4MJ5 A;  1OGA A;  3O4L A;  5C0B A;  3FQN A;  1AKJ A;  2AK4 A;  2E7L E;  1JFM A;  1KTL A;  3MGT A;  5MEO A;  2ZOL A;  1UQS A;  3VFV A;  2ZSW A;  2VLR A;  1U58 A;  3MV8 A;  4PRD A;  4PRA A;  4U1L A;  4V3E B;  4L8B A;  1T80 A;  4NO5 A;  4WW2 C;  3TN0 A;  4JRY A;  4PGE A;  1PQZ A;  5MER A;  3OXR A;  3FT4 A;  1XZ0 A;  3QQ4 A;  3M1B A;  1T20 A;  2GTW A;  3FT3 A;  4HS3 A;  4PDC E;  4EUP A;  2F74 A;  1AGD A;  4L8S C;  5IRO A;  5J6H A;  1XH3 A;  3ILQ C;  2X4U A;  3QEQ A;  3RWF A;  3JTS A;  4NO0 A;  3X12 A;  1DUY A;  4PRI A;  5SWZ A;  5C0G A;  3ROL A;  5J6G A;  4D0C A;  3E6H A;  4JO8 A;  2C7U A;  4QRQ A;  3KPM A;  5JHD A;  1N2R A;  3KPS A;  3VFS A;  2HJL A;  1HSA A;  3BZE A;  3QUL A;  4NQD A;  3DX7 A;  4HX1 A;  5FA3 A;  2BNR A;  3MRL A;  1JE6 A;  1RJY A;  4ZFZ A;  1ZAG A;  1JPG A;  3RWI A;  1ZS8 A;  1W0V A;  2FIK A;  3MRF A;  3MRE A;  5DDH A;  1ZHB A;  3BW9 A;  4JFD A;  3VXR A;  1S7R A;  3KLA A;  4NNX A;  2GAZ A;  3G08 A;  3BEV A;  3QUX A;  1YPZ A;  1QVO A;  4N5E A;  4Y2D A;  3TFK A;  3TIE A;  1DDH A;  3ARB A;  1UXW A;  4WUU A;  1T1Y A;  4N0F A;  4PJ7 A;  3FFC A;  4NSK A;  3MRB A;  3X13 A;  1A9E A;  4U6X A;  4U1K A;  3HUJ A;  3CC5 A;  3H9H A;  5EO0 A;  3ARF A;  5BXF A;  2BSR A;  1T1Z A;  1S7S A;  3E3Q A;  1B3J A;  2YPL A;  4ELM A;  1G6R H;  1Q94 A;  1E28 A;  3ILP A;  4WO4 A;  5HHP A;  1A1N A;  1JGD A;  1FZO A;  4GKN A;  4V3D B;  5E8P A;  4XXC A;  1N5A A;  3LKR A;  1S7X A;  1ZSD A;  3FON A; 
#chains in the Genus database with same CATH homology
 2X4R A;  3SDC A;  1VGK A;  1ZT4 A;  3GSN H;  3MV7 A;  1HYR C;  1S9X A;  4MS8 A;  3FQR A;  4Y16 A;  5D7J C;  3JTT A;  5HYJ A;  1BZ9 A;  5E6I C;  2GT9 A;  3FQT A;  3MRP A;  3P4N A;  3TO2 A;  2X70 A;  3MRJ A;  4NQC A;  4PJI A;  3T8X A;  4D0B A;  5C0A A;  3QDG A;  4K71 B;  4NNY A;  1FZK A;  1HHK A;  4F7T A;  1C16 A;  4CVZ A;  1WBZ A;  4G8I A;  1QSE A;  2WY3 A;  1ZT7 A;  1CE6 A;  4MJ6 A;  2FYY A;  4MQ7 A;  1LEK A;  5D7I A;  3KXF A;  1OF2 A;  1G7Q A;  3RL2 A;  2GUO A;  4GUP A;  3H7B A;  1P4L A;  3LN5 A;  4FTV A;  1P7Q A;  3TA3 A;  1BII A;  1S7Q A;  2VLJ A;  4U1H A;  3WS3 A;  1AGB A;  1IM3 A;  4IIQ C;  5L2J A;  3OX8 A;  4PG9 A;  3DX8 A;  4G59 A;  4HKJ A;  1NEZ A;  3B6S A;  3QDJ A;  2BVP A;  1L8J A;  3RWE A;  1YDP A;  2F53 A;  3TJH A;  3CVH A;  3HE7 A;  3O3A A;  3HLA A;  1RK0 A;  3MRN A;  3ARE A;  4PV8 A;  1LD9 A;  3CH1 A;  1KJ3 H;  5C08 A;  1QRN A;  1FFP A;  4WDI A;  5AD0 A;  3VFT A;  2VAB A;  1X7Q A;  3VXO A;  1UXS A;  3BP4 A;  4X6D A;  4PRH A;  1JUF A;  1KPV A;  5IND A;  3ROO A;  3RZC A;  5FA4 A;  4LNR A;  1AGC A;  1RK1 A;  3W0W A;  3BO8 A;  4U6Y A;  1S7T A;  3FRU A;  4PJ9 A;  3BH9 A;  4FFE X;  2AV1 A;  3QUY A;  3KPQ A;  3M17 A;  4JFE A;  1S7U A;  3RGV C;  4L8C A;  1JGE A;  3RWG A;  3TBT A;  4QRT A;  3RL1 A;  4PJB A;  3X14 A;  3SDX A;  3ARG A;  1FO0 H;  3X11 A;  3RWC A;  2GIT A;  1S8D A;  1VAD A;  4NO3 A;  3WL9 A;  3VJ6 A;  3VRI A;  5IB4 A;  2F54 A;  3ARD A;  4D0D A;  5BJT A;  4IHO A;  5B39 A;  3GMN A;  5C07 A;  4F7M A;  1NAM H;  3DTX A;  4N0U A;  4PJX A;  3VXM A;  3GSX A;  3E6F A;  3MV9 A;  3MRI A;  4PGD A;  4JFP A;  1JHT A;  3HCV A;  5ENW A;  2X4T A;  5IB2 A;  5FDW A;  5IB5 A;  2XPG A;  3L3H A;  4N0C A;  4PRN A;  4MVB A;  1XR9 A;  4U1N A;  3CPL A;  3UTQ A;  1KCG C;  4NO2 A;  3CCH A;  3P4M A;  4Y4H A;  3L3K A;  4LCW A;  2X4P A;  4MJI A;  5HGH A;  2HJK A;  3KPR A;  3QUK A;  2OI9 A;  3WUW A;  4G9F A;  4L29 A;  2CKB H;  2H26 A;  2DYP A;  2BVQ A;  1R3H A;  3PQY A;  2X4S A;  5SWS A;  1I1Y A;  4QRR A;  4EI5 A;  2X4O A;  3VFR A;  3IT8 D;  5INC A;  3QFD A;  3VXU A;  2P5E A;  3FOL A;  3OXS A;  1EEZ A;  5BRZ A;  3P77 A;  1I1A A;  3PWN A;  4PRP A;  3GJF A;  3GSQ A;  3DXA A;  1T1X A;  3LKN A;  1DE4 A;  5IB1 A;  1ZVS A;  1AGE A;  1TMC A;  3D18 A;  3FTG A;  5HHQ A;  3AM8 A;  3SKM A;  2AKR A;  4PRE A;  3FQU A;  3TBV A;  1HHI A;  3B3I A;  2AXF A;  1KJV A;  2HLA A;  3MA7 A;  3V5D A;  1QO3 A;  2FZ3 A;  4IRS A;  1EEY A;  5DEG A;  5SWQ A;  4E5X A;  1YN7 A;  1ZHK A;  2CLR A;  3LKP A;  5EFI A;  3MRR A;  2FWO A;  5FKP A;  5E00 A;  4PJG A;  3MGO A;  5C0D A;  4L4T A;  4ZUW A;  5C0C A;  3D2U A;  4HWZ A;  3SDA A;  1FFN A;  5EU6 A;  5EOT A;  1XR8 A;  5GSV A;  3MRD A;  5EU4 A;  5D7L A;  4APQ A;  1A1M A;  5C0E A;  3LKQ A;  5C0F A;  3BZF A;  2BVO A;  3VFW A;  3FT2 A;  2XFX A;  1FG2 A;  2YPK A;  1ED3 A;  3D25 A;  4G8G A;  4QOK A;  3MRK A;  1KJM A;  1Z5L A;  4IRJ A;  4HUW A;  3U0P A;  1QEW A;  1HOC A;  4L3E A;  1CD1 A;  2JCC A;  4HUU A;  1QSF A;  4QRS A;  1QQD A;  5C9J A;  2GTZ A;  4PR5 A;  4X6F A;  3L3J A;  3KYO A;  3TID A;  3GSV A;  3GMQ A;  4NQE A;  2A83 A;  4N8V A;  1FZJ A;  3BH8 A;  5HGA A;  4MXQ A;  1A1O A;  5J1A A;  2H6P A;  4GKS A;  3VXP A;  5IM7 A;  1WBX A;  1MI5 A;  4U1S A;  3QQ3 A;  4NQV A;  4PJC A;  4PG2 A;  3SCM A;  4UQ2 A;  1T7W A;  3PWP A;  4G42 A;  1HSB A;  5IVX A;  1I1F A;  3T1F A;  3GMP A;  3LV3 A;  4LCY A;  2VLK A;  4S0U C;  4JRX A;  5E8N A;  2VAA A;  1MHC A;  1TVB A;  4PJA A;  4MNQ A;  5C0I A;  3O8X A;  2CIK A;  3DBX A;  2RFX A;  1T0M A;  5L2K A;  3UTT A;  5F1I A;  2FO4 A;  3O3D A;  4ZUT A;  2OL3 H;  5MEQ A;  4WWK C;  1ZHN A;  3TBY A;  3GMR A;  1W72 A;  4UQ3 A;  1S9W A;  4PJE A;  3HE6 A;  4LHU A;  1NAN H;  1T7Y A;  2BSS A;  3FOM A;  3I6G A;  5D2N A;  4F7C A;  3KYN A;  5D5M A;  3LKO A;  2PYE A;  3IXA A;  4QRU A;  2P5W A;  4I48 A;  4L4V A;  3QDM A;  4WJ5 A;  5EU5 A;  3MRO A;  1LDP H;  3I6L D;  1N59 A;  3BEW A;  1JF1 A;  1B0G A;  1LEG A;  3MR9 A;  3WLB A;  1SYS A;  3CZF A;  4PJ5 A;  1T7X A;  4U1M A;  1I4F A;  4F7P A;  4HUV A;  1TVH A;  3BUY A;  4G43 A;  3TO4 A;  2BNQ A;  2YEZ A;  3I6K A;  3PWU A;  3TVM A;  1OGT A;  4WU5 A;  3TF7 A;  1T21 A;  1BD2 A;  3PWV A;  2AV7 A;  1QLF A;  3C9N A;  4MX7 A;  3BHB A;  1ZT1 A;  3SJV A;  3RWJ A;  1A6Z A;  3P9L A;  1RJZ A;  3S6C A;  4Z77 A;  5F7D A;  4L8D A;  1YN6 A;  1S9Y A;  1IM9 A;  4O2F A;  3O3E A;  1HHG A;  1FZM A;  4HUX A;  1WBY A;  3LKS A;  3ES6 A;  4JQX A;  4JQV A;  5IB3 A;  3TPU E;  3L9R A;  1T7Z A;  4G9D A;  4WU7 A;  5EO1 A;  2ZOK A;  3RTQ A;  1I7R A;  3GMM A;  2CLV A;  3MRC A;  3PWJ A;  5BS0 A;  4PJ8 A;  3JTC A;  4PRB A;  4LCC C;  1E27 A;  3VFU A;  5HHN A;  3VXN A;  3SDD A;  2X4N A;  3OV6 A;  1SYV A;  1N3N A;  4ZUU A;  4JFF A;  3BWA A;  4QRP A;  4X6C A;  5F9J A;  3TBW A;  2NW3 A;  1B0R A;  1M05 A;  3KWW A;  4ZAK A;  3LN4 A;  2Q7Y A;  4O2C A;  4O2E A;  2D31 A;  1EXU A;  3HAE A;  3MRG A;  1KPR A;  4I4W A;  5D9S A;  2V2W A;  3V5H A;  2VE6 A;  5MEN A;  2V2X A;  2X4Q A;  3GSO A;  4PP8 C;  3DMM A;  4L9L C;  2AXG A;  1ZHL A;  4Y4F A;  4ZUS A;  3E2H A;  1KPU A;  4NT6 A;  5ISZ A;  2MHA A;  3D3V A;  3RUG A;  3L3I A;  1MWA H;  4U1J A;  1VAC A;  3TBS A;  3D39 A;  5DEF A;  5MEP A;  5HGB A;  1KBG H;  3VRJ A;  3QUZ A;  4JFQ A;  4CW1 A;  3VWK A;  3KPL A;  3BP7 A;  1HHJ A;  1I7U A;  1AO7 A;  3HG1 A;  4Y4K A;  3VFP A;  3SPV A;  1FFO A;  3FQW A;  3GMO A;  3O3B A;  1JPF A;  3VFM A;  2BCK A;  3MRH A;  3UBX A;  3RWH A;  3H9S A;  4PJF A;  5E9D A;  1T1W A;  3PWL A;  1G7P A;  5H94 A;  4ZUV A;  1LP9 A;  3MRM A;  1M6O A;  5GSR A;  5HHO A;  1KJ2 H;  3P4O A;  4JFO A;  3SKO A;  5E8O A;  4PV9 A;  2HN7 A;  3PAB A;  5C09 A;  4EN3 C;  3GSR A;  3DX6 A;  1S7W A;  4CVX A;  3UTS A;  3VFN A;  1A9B A;  3JVG A;  2ESV A;  1T0N A;  1OSZ A;  2UWE A;  1LQV A;  3GSW A;  5ACZ A;  1K5N A;  4U1I A;  1W0W A;  2PO6 A;  3HPJ A;  5IEH A;  3QFJ A;  3NFN A;  1I7T A;  1K8D A;  3TZV C;  3QZW A;  2CLZ A;  2CII A;  1ONQ A;  5D2L A;  3C8K A;  5EU3 A;  1GZP A;  1T7V A;  5HGD A;  3GIV A;  3RWD A;  4NHU E;  3ERY A;  2GJ6 A;  3VXS A;  3V5K A;  1LK2 A;  3MYJ A;  5F1N A;  4PGB A;  4Z78 A;  3CDG A;  3QI9 A;  1S7V A;  4Z76 A;  5C0J A;  2ZSV A;  1BQH A;  1QR1 A;  4HV8 A;  3VWJ A;  2BST A;  1GZQ A;  3AU1 A;  1DUZ A;  3GML A;  3REW A;  3VH8 A;  1INQ A;  4K7F A;  3MRQ A;  4ONO A;  1EFX A;  2NX5 A;  3P73 A;  4PJH A;  5B38 A;  4MNG A;  3W39 A;  4NQX A;  3FQX A;  3BGM A;  1MHE A;  3L3G A;  4PGC A;  1P1Z A;  3KPN A;  3L3D A;  3BVN A;  4L3C A;  3BXN A;  3ECB A;  3VCL A;  3P9M A;  1T22 A;  3KPP A;  4E0R A;  2J8U A;  2VLL A;  3WS6 A;  3UPR A;  3VFO A;  3GSU A;  1AGF A;  4PJD A;  4X6E A;  5IEK A;  5HHM A;  1HHH A;  3KPO A;  5EUO A;  4F7E A;  1CG9 A;  3O9W A;  4MJ5 A;  1OGA A;  3O4L A;  5C0B A;  3FQN A;  1AKJ A;  2AK4 A;  2E7L E;  1JFM A;  1KTL A;  3MGT A;  5MEO A;  2ZOL A;  1UQS A;  3VFV A;  2ZSW A;  2VLR A;  1U58 A;  3MV8 A;  4PRD A;  4PRA A;  4U1L A;  4V3E B;  4L8B A;  1T80 A;  4NO5 A;  4WW2 C;  3TN0 A;  4JRY A;  4PGE A;  1PQZ A;  5MER A;  3OXR A;  3FT4 A;  1XZ0 A;  3QQ4 A;  3M1B A;  1T20 A;  2GTW A;  3FT3 A;  4HS3 A;  4PDC E;  4EUP A;  2F74 A;  1AGD A;  4L8S C;  5IRO A;  5J6H A;  1XH3 A;  3ILQ C;  2X4U A;  3QEQ A;  3RWF A;  3JTS A;  4NO0 A;  3X12 A;  1DUY A;  4PRI A;  5SWZ A;  5C0G A;  3ROL A;  5J6G A;  4D0C A;  3E6H A;  2C7U A;  4QRQ A;  3KPM A;  5JHD A;  1N2R A;  3KPS A;  3VFS A;  2HJL A;  1HSA A;  3BZE A;  3QUL A;  4NQD A;  3DX7 A;  4HX1 A;  5FA3 A;  2BNR A;  3MRL A;  1JE6 A;  1RJY A;  4ZFZ A;  1ZAG A;  1JPG A;  3RWI A;  1ZS8 A;  1W0V A;  2FIK A;  3MRF A;  3MRE A;  5DDH A;  1ZHB A;  3BW9 A;  4JFD A;  3VXR A;  1S7R A;  3KLA A;  4NNX A;  2GAZ A;  3G08 A;  3BEV A;  3QUX A;  1YPZ A;  1QVO A;  4N5E A;  4Y2D A;  3TFK A;  3TIE A;  1DDH A;  3ARB A;  1UXW A;  4WUU A;  1T1Y A;  4N0F A;  4PJ7 A;  3FFC A;  4NSK A;  3MRB A;  3X13 A;  1A9E A;  4U6X A;  4U1K A;  3HUJ A;  3CC5 A;  3H9H A;  5EO0 A;  3ARF A;  5BXF A;  2BSR A;  1T1Z A;  1S7S A;  3E3Q A;  1B3J A;  2YPL A;  4ELM A;  1G6R H;  1Q94 A;  1E28 A;  3ILP A;  4WO4 A;  5HHP A;  1A1N A;  1JGD A;  1FZO A;  4GKN A;  4V3D B;  5E8P A;  4XXC A;  1N5A A;  3LKR A;  1S7X A;  1ZSD A;  3FON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...