4S0UC

Crystal structure of nkg2d in complex with ulbp6
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
DPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NKG2-D type II integral membrane protein
publication title A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4s0uC00
3P4OA 3MRFA 5HGAA 2OI9A 1L8JA 4PV9A 3E3QA 3WUWA 5MEOA 3RZCA 4Y16A 2ZSWA 3LN4A 1YDPA 2ZOKA 1WBXA 5SWSA 1I7RA 3KPMA 5FDWA 4NHUE 4PJ5A 4L8DA 2AV7A 4NQCA 1FZJA 3GMRA 5SWZA 3KWWA 1ZT1A 4Y4KA 1S7UA 1TMCA 1U58A 2GJ6A 1LK2A 3MV8A 3VXMA 4F7PA 1WBYA 1WBZA 2X4SA 1KBGH 3UTTA 3HUJA 3VFMA 3KPQA 1S9XA 5J6GA 4D0BA 4EUPA 2E7LE 4NNXA 1AGFA 3JTSA 4MJ6A 4MQ7A 1MWAH 3D39A 1T7WA 4V3DB 2PO6A 3I6GA 3GSUA 3MR9A 1JPGA 1VACA 5IEKA 3GMLA 5HHOA 3TIEA 1BIIA 5EUOA 3V5KA 4MJ5A 3B3IA 5EU4A 1NAMH 2AXFA 3ES6A 3MRQA 2HJLA 1HHHA 1T80A 3C8KA 1UQSA 3P4NA 4PRIA 5SWQA 2NW3A 3WL9A 3KXFA 3SDDA 3QQ3A 3GSVA 1ZT4A 2VE6A 3BEVA 3L3JA 3BO8A 4LCWA 3P4MA 4ZUVA 4ZUWA 1QSFA 4F7EA 4PJEA 1W72A 1EEYA 4QRPA 4U1IA 2FO4A 1OF2A 2BVQA 2ESVA 4G9FA 1K8DA 1K5NA 1XR8A 2CLRA 1UXWA 2XPGA 5EU6A 3RWEA 1T7VA 1FG2A 3PWPA 3BWAA 3REWA 3RWIA 3WLBA 1QQDA 4G8IA 3TVMA 4F7CA 1KJVA 4HUWA 5C08A 3TBSA 2GAZA 3DMMA 4G8GA 1OSZA 4QRSA 4G59A 2AV1A 1EFXA 4PJAA 5BJTA 3MRNA 3QUYA 1JPFA 5DDHA 5IB3A 4NSKA 3MRGA 5HHNA 4UQ2A 4WU5A 2AK4A 5C0GA 3RWGA 3L3HA 4G9DA 3LKPA 3GMPA 3QDGA 1QLFA 5IEHA 4NQEA 1SYVA 1SYSA 4NO5A 4WO4A 4U1LA 3OV6A 3FFCA 4O2FA 1DDHA 3B6SA 4K7FA 3ROOA 5IB5A 3JTTA 3HG1A 3C9NA 1HOCA 3X11A 3ARFA 5HGHA 4PJ7A 1MI5A 3FTGA 3KPSA 2YPKA 4NO2A 2H26A 4PRNA 4F7MA 4PDCE 3ECBA 3BZFA 3NFNA 1P4LA 4L8BA 5IB4A 4QOKA 1GZPA 2X70A 3H9SA 3M1BA 3O3BA 5DEFA 3VFRA 2BVPA 3MRIA 3GSNH 3SJVA 3FQTA 2DYPA 3MRCA 4GKNA 2FIKA 5FA3A 3U0PA 3TN0A 3UTSA 4N0CA 1CG9A 4WUUA 1YN7A 3LKSA 4PP8C 2HN7A 3ILQC 4Y4HA 1G7PA 1N3NA 3ARDA 1S7VA 3GSOA 4PJHA 1AKJA 4PJDA 1T0MA 1S9WA 2BSTA 4HUVA 3TBVA 4U6XA 1OGTA 3HE6A 3VFPA 3LKOA 3SKOA 3VRIA 3W0WA 2VLKA 5E9DA 3KPNA 3TPUE 5HGBA 1CE6A 3GMQA 1X7QA 1T1YA 1S7WA 5D5MA 4N0UA 3G08A 3CZFA 3DXAA 1RJZA 3MV9A 3TFKA 4QRRA 5MENA 3CC5A 5INDA 5D9SA 2X4OA 1LQVA 3MRJA 1OGAA 1FO0H 2GT9A 4HKJA 5C0AA 3LKQA 3VJ6A 1DUYA 1E27A 1ZHNA 3MRRA 4Y2DA 3VFNA 1JGEA 3FT3A 4Z76A 1A6ZA 3MGTA 5IB1A 5L2JA 3O9WA 5HHMA 1M05A 1RK1A 2VABA 3MROA 3FQXA 1I1YA 3D18A 3HE7A 4X6CA 5EO1A 1B0GA 3SCMA 3VCLA 4WU7A 1BZ9A 5F7DA 4NQXA 4JQVA 3TA3A 3MA7A 1S7RA 3FT4A 5E8PA 2GTWA 3ARGA 4XXCA 3FOLA 1PQZA 1A1NA 1NEZA 3VFUA 4U1JA 5EO0A 3TIDA 5C0CA 3O3DA 3X14A 2CLVA 4WDIA 4LHUA 2PYEA 1AGDA 1TVBA 5HHPA 3GIVA 5BXFA 3MRLA 3TF7A 4L8CA 3DTXA 1T1WA 2V2WA 3FOMA 2YPLA 3MGOA 4FTVA 1T1ZA 3TBTA 3VXOA 3PWLA 1FZMA 4JQXA 2HJKA 4JFDA 3OXSA 3RL2A 5B38A 4L29A 1JUFA 4F7TA 4I4WA 1DE4A 2CIKA 3D25A 4MNQA 3VFOA 4ZUTA 3RTQA 3QDMA 3GMOA 1G6RH 3HAEA 5D7LA 3BEWA 2X4RA 1B0RA 1RK0A 3MRPA 3DX8A 3I6LD 1HHKA 2BNRA 1QR1A 3HCVA 3L3KA 5IROA 4G43A 5ACZA 5H94A 4NO3A 1UXSA 3QZWA 4JFFA 3D2UA 3QUKA 3RGVC 1VADA 1JF1A 1ZS8A 4MVBA 1LP9A 4Z78A 4IRJA 1A9BA 5J6HA 3H9HA 3BP4A 3DBXA 1DUZA 4PJ9A 5D7IA 3RL1A 4CVZA 5IB2A 3IXAA 1TVHA 2F53A 4HS3A 3L3DA 4I48A 3X13A 1FFNA 4MXQA 3KYNA 4WWKC 4D0CA 2CLZA 1LEGA 3AU1A 4L4TA 4GUPA 3VFVA 2X4QA 5JHDA 5B39A 1Z5LA 5GSRA 3SDAA 5J1AA 4U1NA 2GTZA 1KCGC 1I4FA 3D3VA 3TBWA 4E0RA 2XFXA 3HLAA 3WS3A 1A1MA 2BNQA 3LKRA 3RWFA 4PGCA 4PJGA 2WY3A 3IT8D 2JCCA 5F1NA 4NT6A 3RWDA 2ZOLA 4LNRA 3WS6A 4CW1A 2FZ3A 1ZHLA 1KJ2H 1QVOA 1KJ3H 2BSRA 3QFDA 1B3JA 1LD9A 2OL3H 4HUXA 3JTCA 2X4NA 2MHAA 4MX7A 4L9LC 1A9EA 1S7TA 3GSQA 1EXUA 1I1FA 4FFEX 2VLLA 1I7TA 3BXNA 1JGDA 1MHEA 3KPRA 4O2CA 3HPJA 5MEQA 4QRUA 4U6YA 1KJMA 3L9RA 3OXRA 4L3EA 1ZHBA 2GUOA 3BZEA 3CDGA 4L3CA 4PGBA 4PR5A 4JFOA 1N59A 3BH8A 3I6KA 2H6PA 4HWZA 3OX8A 3RWJA 3FONA 4U1KA 3GMMA 4LCCC 4MNGA 3TO2A 3VXUA 5AD0A 3M17A 5EU3A 1JFMA 5FA4A 3SKMA 2X4PA 3VWJA 2NX5A 1R3HA 5IM7A 3GSWA 3O8XA 5E00A 5E8OA 4E5XA 3QDJA 3QQ4A 4G42A 4EI5A 1N5AA 1T20A 2ZSVA 3TZVC 3RUGA 4U1SA 5MERA 1YN6A 3PQYA 1QRNA 4EN3C 1FZKA 1FZOA 1Q94A 4N8VA 4NNYA 1S8DA 2VLJA 3QFJA 3QUZA 5EU5A 3VXSA 3T1FA 5E6IC 2AKRA 3VWKA 3FQUA 3S6CA 2A83A 4U1MA 5C0IA 5FKPA 3V5HA 3DX7A 4K71B 3KPLA 1HSBA 3CCHA 4ELMA 4GKSA 2Q7YA 4PRBA 1CD1A 1RJYA 4V3EB 4PJBA 5D7JC 2C7UA 3CPLA 4U1HA 3VFWA 3AREA 1ONQA 4PRAA 5C07A 5ENWA 1S7XA 1I7UA 2UWEA 3O3AA 5EOTA 4LCYA 5C9JA 3E6FA 3ROLA 5MEPA 3GSXA 2BCKA 4JRYA 4NQDA 1XH3A 2HLAA 4NQVA 3TO4A 5GSVA 2F74A 2CIIA 2P5WA 2X4TA 1INQA 4PG9A 4QRTA 3PABA 4ONOA 3PWNA 1I1AA 3KPOA 5C0JA 5E8NA 3VH8A 1YPZA 1T7ZA 3X12A 3P9MA 4PREA 3FQNA 5F1IA 1JHTA 3AM8A 3MRMA 3T8XA 3UBXA 3GSRA 1FFOA 3BW9A 3KLAA 5HHQA 2GITA 3E6HA 1G7QA 1T1XA 1HHJA 1T22A 1W0WA 3SDCA 3BUYA 3KPPA 4IHOA 4N5EA 4PJ8A 4X6DA 1HYRC 1P7QA 3P9LA 4PGDA 2AXGA 3GJFA 5INCA 1N2RA 3P73A 4PJXA 3UPRA 4N0FA 2D31A 3FQRA 3VRJA 1IM3A 1KPVA 4PGEA 3KYOA 1LEKA 4PG2A 4CVXA 1MHCA 1C16A 1HHIA 3VXRA 5HYJA 3VFTA 1AGBA 5BS0A 1QEWA 3BH9A 3E2HA 5DEGA 1E28A 2BSSA 3P77A 3FT2A 4PV8A 3SPVA 4Z77A 1M6OA 1S9YA 3RWHA 1IM9A 5ISZA 3SDXA 5HGDA 5C0FA 4JFQA 3ILPA 5C0BA 1T7YA 1T7XA 4JRXA 4HUUA 3BVNA 1HHGA 1KTLA 4IIQC 1S7SA 3H7BA 3ERYA 4Y4FA 4PJFA 4X6FA 1AGCA 5F9JA 1BD2A 5IVXA 3QEQA 1XR9A 3QUXA 3BP7A 4L8SC 2J8UA 4O2EA 3VXNA 1HSAA 2VAAA 5C0EA 4PJIA 4ZFZA 1BQHA 3MRBA 2VLRA 3MRDA 3PWVA 3FRUA 3O4LA 3RWCA 3L3GA 1NANH 4JFPA 4HX1A 2CKBH 3MRHA 1QSEA 3LN5A 3UTQA 2YEZA 3JVGA 3BGMA 1JE6A 3CVHA 4QRQA 1T21A 3PWJA 4NO0A 1ZT7A 1W0VA 5D2NA 5L2KA 2V2XA 4IRSA 1ED3A 1ZVSA 2P5EA 3L3IA 2FWOA 4WW2C 4APQA 3MV7A 3BHBA 3MYJA 4ZUUA 1AO7A 3GMNA 1EEZA 3MRKA 1KPRA 3QULA 1ZSDA 1QO3A 3VXPA 1P1ZA 1S7QA 4PJCA 4ZUSA 2FYYA 3FQWA 4WJ5A 4ZAKA 4X6EA 3TJHA 5EFIA 1FFPA 2X4UA 5C09A 5C0DA 3VFSA 3TBYA 3DX6A 3PWUA 3CH1A 4L4VA 4PRDA 1AGEA 3LV3A 3LKNA 3ARBA 3O3EA 4JFEA 4S0UC 2RFXA 1A1OA 1GZQA 1VGKA 2F54A 3W39A 5BRZA 4UQ3A 3QI9A 1ZAGA 4HV8A 4MS8A 1ZHKA 1XZ0A 4D0DA 4MJIA 4PRHA 3V5DA 2BVOA 1T0NA 3MREA 4PRPA 1KPUA 1LDPH 5D2LA
chains in the Genus database with same CATH superfamily
3P4OA 3MRFA 5HGAA 2OI9A 1L8JA 4PV9A 3E3QA 3WUWA 5MEOA 3RZCA 4Y16A 2ZSWA 3LN4A 1YDPA 2ZOKA 1WBXA 5SWSA 1I7RA 3KPMA 5FDWA 4NHUE 4PJ5A 4L8DA 2AV7A 4NQCA 1FZJA 3GMRA 5SWZA 3KWWA 1ZT1A 4Y4KA 1S7UA 1TMCA 1U58A 2GJ6A 1LK2A 3MV8A 3VXMA 4F7PA 1WBYA 1WBZA 2X4SA 1KBGH 3UTTA 3HUJA 3VFMA 3KPQA 1S9XA 5J6GA 4D0BA 4EUPA 2E7LE 4NNXA 1AGFA 3JTSA 4MJ6A 4MQ7A 1MWAH 3D39A 1T7WA 4V3DB 2PO6A 3I6GA 3GSUA 3MR9A 1JPGA 1VACA 5IEKA 3GMLA 5HHOA 3TIEA 1BIIA 5EUOA 3V5KA 4MJ5A 3B3IA 5EU4A 1NAMH 2AXFA 3ES6A 3MRQA 2HJLA 1HHHA 1T80A 3C8KA 1UQSA 3P4NA 4PRIA 5SWQA 2NW3A 3WL9A 3KXFA 3SDDA 3QQ3A 3GSVA 1ZT4A 2VE6A 3BEVA 3L3JA 3BO8A 4LCWA 3P4MA 4ZUVA 4ZUWA 1QSFA 4F7EA 4PJEA 1W72A 1EEYA 4QRPA 4U1IA 2FO4A 1OF2A 2BVQA 2ESVA 4G9FA 1K8DA 1K5NA 1XR8A 2CLRA 1UXWA 2XPGA 5EU6A 3RWEA 1T7VA 1FG2A 3PWPA 3BWAA 3REWA 3RWIA 3WLBA 1QQDA 4G8IA 3TVMA 4F7CA 1KJVA 4HUWA 5C08A 3TBSA 2GAZA 3DMMA 4G8GA 4JO8A 1OSZA 4QRSA 4G59A 2AV1A 1EFXA 4PJAA 5BJTA 3MRNA 3QUYA 1JPFA 5DDHA 5IB3A 4NSKA 3MRGA 5HHNA 4UQ2A 4WU5A 2AK4A 5C0GA 3RWGA 3L3HA 4G9DA 3LKPA 3GMPA 3QDGA 1QLFA 5IEHA 4NQEA 1SYVA 1SYSA 4NO5A 4WO4A 4U1LA 3OV6A 3FFCA 4O2FA 1DDHA 3B6SA 4K7FA 3ROOA 5IB5A 3JTTA 3HG1A 3C9NA 1HOCA 3X11A 3ARFA 5HGHA 4PJ7A 1MI5A 3FTGA 3KPSA 2YPKA 4NO2A 2H26A 4PRNA 4F7MA 4PDCE 3ECBA 3BZFA 3NFNA 1P4LA 4L8BA 5IB4A 4QOKA 1GZPA 2X70A 3H9SA 3M1BA 3O3BA 5DEFA 3VFRA 2BVPA 3MRIA 3GSNH 3SJVA 3FQTA 2DYPA 3MRCA 4GKNA 2FIKA 5FA3A 3U0PA 3TN0A 3UTSA 4N0CA 1CG9A 4WUUA 1YN7A 3LKSA 4PP8C 2HN7A 3ILQC 4Y4HA 1G7PA 1N3NA 3ARDA 1S7VA 3GSOA 4PJHA 1AKJA 4PJDA 1T0MA 1S9WA 2BSTA 4HUVA 3TBVA 4U6XA 1OGTA 3HE6A 3VFPA 3LKOA 3SKOA 3VRIA 3W0WA 2VLKA 5E9DA 3KPNA 3TPUE 5HGBA 1CE6A 3GMQA 1X7QA 1T1YA 1S7WA 5D5MA 4N0UA 3G08A 3CZFA 3DXAA 1RJZA 3MV9A 3TFKA 4QRRA 5MENA 3CC5A 5INDA 5D9SA 2X4OA 1LQVA 3MRJA 1OGAA 1FO0H 2GT9A 4HKJA 5C0AA 3LKQA 3VJ6A 1DUYA 1E27A 1ZHNA 3MRRA 4Y2DA 3VFNA 1JGEA 3FT3A 3I0TA 4Z76A 1A6ZA 3MGTA 5IB1A 5L2JA 3O9WA 5HHMA 1M05A 1RK1A 2VABA 3MROA 3FQXA 1I1YA 3D18A 3HE7A 4X6CA 5EO1A 1B0GA 3SCMA 3VCLA 4WU7A 1BZ9A 5F7DA 4NQXA 4JQVA 3TA3A 3MA7A 1S7RA 3FT4A 5E8PA 2GTWA 3ARGA 4XXCA 3FOLA 1PQZA 1A1NA 1NEZA 3VFUA 4U1JA 5EO0A 3TIDA 5C0CA 3O3DA 3X14A 2CLVA 4WDIA 4LHUA 2PYEA 1AGDA 1TVBA 5HHPA 3GIVA 5BXFA 3MRLA 3TF7A 4L8CA 3DTXA 1T1WA 2V2WA 3FOMA 2YPLA 3MGOA 4FTVA 1T1ZA 3TBTA 3VXOA 3PWLA 1FZMA 4JQXA 2HJKA 4JFDA 3OXSA 3RL2A 5B38A 4L29A 1JUFA 4F7TA 4I4WA 1DE4A 2CIKA 3D25A 4MNQA 3VFOA 4ZUTA 3RTQA 3QDMA 3GMOA 1G6RH 3HAEA 5D7LA 3BEWA 2X4RA 1B0RA 1RK0A 3MRPA 3DX8A 3I6LD 1HHKA 2BNRA 1QR1A 3HCVA 3L3KA 5IROA 4G43A 5ACZA 5H94A 4NO3A 1UXSA 3QZWA 4JFFA 3D2UA 3QUKA 3RGVC 1VADA 1JF1A 1ZS8A 4MVBA 1LP9A 4Z78A 4IRJA 1A9BA 5J6HA 3H9HA 3BP4A 3DBXA 1DUZA 4PJ9A 5D7IA 3RL1A 4CVZA 5IB2A 3IXAA 1TVHA 2F53A 4HS3A 3L3DA 4I48A 3X13A 1FFNA 4MXQA 3KYNA 4WWKC 4D0CA 2CLZA 1LEGA 3AU1A 4L4TA 4GUPA 3VFVA 2X4QA 4BKWA 5JHDA 5B39A 1Z5LA 5GSRA 3SDAA 5J1AA 4U1NA 2GTZA 1KCGC 1I4FA 3D3VA 3TBWA 4E0RA 2XFXA 3HLAA 3WS3A 1A1MA 2BNQA 3LKRA 3RWFA 4PGCA 4PJGA 2WY3A 3IT8D 2JCCA 5F1NA 4NT6A 3RWDA 2ZOLA 4LNRA 3WS6A 4CW1A 2FZ3A 1ZHLA 1KJ2H 1QVOA 1KJ3H 2BSRA 3QFDA 1B3JA 1LD9A 2OL3H 4HUXA 3JTCA 2X4NA 2MHAA 4MX7A 4L9LC 1A9EA 1S7TA 3GSQA 1EXUA 1I1FA 4FFEX 2VLLA 1I7TA 3BXNA 1JGDA 1MHEA 3KPRA 4O2CA 2NYKA 2O5NA 3HPJA 5MEQA 4QRUA 4U6YA 1KJMA 3L9RA 3OXRA 4L3EA 1ZHBA 2GUOA 3BZEA 3CDGA 4L3CA 4PGBA 4PR5A 4JFOA 1N59A 3BH8A 3I6KA 2H6PA 4HWZA 3OX8A 3RWJA 3FONA 4U1KA 3GMMA 4LCCC 4MNGA 3TO2A 3VXUA 5AD0A 3M17A 5EU3A 1JFMA 5FA4A 3SKMA 2X4PA 3VWJA 2NX5A 1R3HA 5IM7A 3GSWA 3O8XA 5E00A 5E8OA 4E5XA 3QDJA 3QQ4A 4G42A 4EI5A 1N5AA 1T20A 2ZSVA 3TZVC 3RUGA 4U1SA 5MERA 1YN6A 3PQYA 1QRNA 4EN3C 1FZKA 1FZOA 1Q94A 4N8VA 4NNYA 1S8DA 2VLJA 3QFJA 3QUZA 5EU5A 3VXSA 3T1FA 5E6IC 2AKRA 3VWKA 3FQUA 3S6CA 2A83A 4U1MA 5C0IA 5FKPA 3V5HA 3DX7A 4K71B 3KPLA 1HSBA 3CCHA 4ELMA 4GKSA 2Q7YA 4PRBA 1CD1A 1RJYA 4V3EB 4PJBA 5D7JC 2C7UA 3CPLA 4U1HA 3VFWA 3AREA 1ONQA 4PRAA 5C07A 5ENWA 1S7XA 1I7UA 2UWEA 3O3AA 5EOTA 4LCYA 5C9JA 3E6FA 3ROLA 5MEPA 3GSXA 2BCKA 4JRYA 4NQDA 1XH3A 2HLAA 4NQVA 3TO4A 5GSVA 2F74A 2CIIA 2P5WA 2X4TA 1INQA 4PG9A 4QRTA 3PABA 4ONOA 3PWNA 1I1AA 3KPOA 5C0JA 5E8NA 3VH8A 1YPZA 1T7ZA 3X12A 3P9MA 4PREA 3FQNA 5F1IA 1JHTA 3AM8A 3MRMA 3T8XA 3UBXA 3GSRA 1FFOA 3BW9A 3KLAA 4G59C 5HHQA 2GITA 3E6HA 1G7QA 1T1XA 1HHJA 1T22A 1W0WA 3SDCA 3BUYA 3KPPA 4IHOA 4N5EA 4PJ8A 4X6DA 1HYRC 1P7QA 3P9LA 4PGDA 2AXGA 3GJFA 5INCA 1N2RA 3P73A 4PJXA 3UPRA 4N0FA 2D31A 3FQRA 3VRJA 1IM3A 1KPVA 4PGEA 3KYOA 1LEKA 4PG2A 4CVXA 1MHCA 1C16A 1HHIA 3VXRA 5HYJA 3VFTA 1AGBA 5BS0A 1QEWA 3BH9A 3E2HA 5DEGA 1E28A 2BSSA 3P77A 3FT2A 4PV8A 3SPVA 4Z77A 1M6OA 1S9YA 3RWHA 1IM9A 5ISZA 3SDXA 5HGDA 5C0FA 4JFQA 3ILPA 5C0BA 1T7YA 1T7XA 4JRXA 4HUUA 3BVNA 1HHGA 1KTLA 4IIQC 1S7SA 3H7BA 3ERYA 4Y4FA 4PJFA 4X6FA 1AGCA 5F9JA 1BD2A 5IVXA 3QEQA 1XR9A 3QUXA 3BP7A 4L8SC 2J8UA 4O2EA 3VXNA 1HSAA 2VAAA 5C0EA 4PJIA 4ZFZA 1BQHA 3MRBA 2VLRA 3MRDA 3PWVA 3FRUA 3O4LA 3RWCA 3L3GA 1NANH 4JFPA 4HX1A 2CKBH 3MRHA 1QSEA 3LN5A 3UTQA 2YEZA 3JVGA 3BGMA 1JE6A 3CVHA 4QRQA 1T21A 3PWJA 4NO0A 1ZT7A 1W0VA 5D2NA 5L2KA 2V2XA 4IRSA 1ED3A 1ZVSA 2P5EA 3L3IA 2FWOA 4WW2C 4APQA 3MV7A 2IA1A 3BHBA 3MYJA 4ZUUA 1AO7A 3GMNA 1EEZA 3MRKA 1KPRA 3QULA 1ZSDA 1QO3A 3VXPA 1P1ZA 1S7QA 4PJCA 4ZUSA 2FYYA 3FQWA 4WJ5A 4ZAKA 4X6EA 3TJHA 5EFIA 1FFPA 2X4UA 5C09A 5C0DA 3VFSA 3TBYA 3DX6A 3PWUA 3CH1A 4L4VA 4PRDA 1AGEA 3LV3A 3LKNA 3ARBA 3O3EA 4JFEA 4S0UC 2RFXA 1A1OA 1GZQA 1VGKA 2F54A 3W39A 5BRZA 4UQ3A 3QI9A 1ZAGA 4HV8A 4MS8A 1ZHKA 1XZ0A 4D0DA 4MJIA 4PRHA 3V5DA 2BVOA 1T0NA 3MREA 4PRPA 1KPUA 1LDPH 5D2LA
chains in the Genus database with same CATH topology
3P4OA 3MRFA 5HGAA 2OI9A 1L8JA 4PV9A 3E3QA 3WUWA 5MEOA 3RZCA 4Y16A 2ZSWA 3LN4A 1YDPA 2ZOKA 1WBXA 5SWSA 1I7RA 3KPMA 5FDWA 4NHUE 4PJ5A 4L8DA 2AV7A 4NQCA 1FZJA 3GMRA 5SWZA 3KWWA 1ZT1A 4Y4KA 1S7UA 1TMCA 1U58A 2GJ6A 1LK2A 3MV8A 3VXMA 4F7PA 1WBYA 1WBZA 2X4SA 1KBGH 3UTTA 3HUJA 3VFMA 3KPQA 1S9XA 5J6GA 4D0BA 4EUPA 2E7LE 4NNXA 1AGFA 3JTSA 4MJ6A 4MQ7A 1MWAH 3D39A 1T7WA 4V3DB 2PO6A 3I6GA 3GSUA 3MR9A 1JPGA 1VACA 5IEKA 3GMLA 5HHOA 3TIEA 1BIIA 5EUOA 3V5KA 4MJ5A 3B3IA 5EU4A 1NAMH 2AXFA 3ES6A 3MRQA 2HJLA 1HHHA 1T80A 3C8KA 1UQSA 3P4NA 4PRIA 5SWQA 2NW3A 3WL9A 3KXFA 3SDDA 3QQ3A 3GSVA 1ZT4A 2VE6A 3BEVA 3L3JA 3BO8A 4LCWA 3P4MA 4ZUVA 4ZUWA 1QSFA 4F7EA 4PJEA 1W72A 1EEYA 4QRPA 4U1IA 2FO4A 1OF2A 2BVQA 2ESVA 4G9FA 1K8DA 1K5NA 1XR8A 2CLRA 1UXWA 2XPGA 5EU6A 3RWEA 1T7VA 1FG2A 3PWPA 3BWAA 3REWA 3RWIA 3WLBA 1QQDA 4G8IA 3TVMA 4F7CA 1KJVA 4HUWA 5C08A 3TBSA 2GAZA 3DMMA 4G8GA 1OSZA 4QRSA 4G59A 2AV1A 1EFXA 4PJAA 5BJTA 3MRNA 3QUYA 1JPFA 5DDHA 5IB3A 4NSKA 3MRGA 5HHNA 4UQ2A 4WU5A 2AK4A 5C0GA 3RWGA 3L3HA 4G9DA 3LKPA 3GMPA 3QDGA 1QLFA 5IEHA 4NQEA 1SYVA 1SYSA 4NO5A 4WO4A 4U1LA 3OV6A 3FFCA 4O2FA 1DDHA 3B6SA 4K7FA 3ROOA 5IB5A 3JTTA 3HG1A 3C9NA 1HOCA 3X11A 3ARFA 5HGHA 4PJ7A 1MI5A 3FTGA 3KPSA 2YPKA 4NO2A 2H26A 4PRNA 4F7MA 4PDCE 3ECBA 3BZFA 3NFNA 1P4LA 4L8BA 5IB4A 4QOKA 1GZPA 2X70A 3H9SA 3M1BA 3O3BA 5DEFA 3VFRA 2BVPA 3MRIA 3GSNH 3SJVA 3FQTA 2DYPA 3MRCA 4GKNA 2FIKA 5FA3A 3U0PA 3TN0A 3UTSA 4N0CA 1CG9A 4WUUA 1YN7A 3LKSA 4PP8C 2HN7A 3ILQC 4Y4HA 1G7PA 1N3NA 3ARDA 1S7VA 3GSOA 4PJHA 1AKJA 4PJDA 1T0MA 1S9WA 2BSTA 4HUVA 3TBVA 4U6XA 1OGTA 3HE6A 3VFPA 3LKOA 3SKOA 3VRIA 3W0WA 2VLKA 5E9DA 3KPNA 3TPUE 5HGBA 1CE6A 3GMQA 1X7QA 1T1YA 1S7WA 5D5MA 4N0UA 3G08A 3CZFA 3DXAA 1RJZA 3MV9A 3TFKA 4QRRA 5MENA 3CC5A 5INDA 5D9SA 2X4OA 1LQVA 3MRJA 1OGAA 1FO0H 2GT9A 4HKJA 5C0AA 3LKQA 3VJ6A 1DUYA 1E27A 1ZHNA 3MRRA 4Y2DA 3VFNA 1JGEA 3FT3A 4Z76A 1A6ZA 3MGTA 5IB1A 5L2JA 3O9WA 5HHMA 1M05A 1RK1A 2VABA 3MROA 3FQXA 1I1YA 3D18A 3HE7A 4X6CA 5EO1A 1B0GA 3SCMA 3VCLA 4WU7A 1BZ9A 5F7DA 4NQXA 4JQVA 3TA3A 3MA7A 1S7RA 3FT4A 5E8PA 2GTWA 3ARGA 4XXCA 3FOLA 1PQZA 1A1NA 1NEZA 3VFUA 4U1JA 5EO0A 3TIDA 5C0CA 3O3DA 3X14A 2CLVA 4WDIA 4LHUA 2PYEA 1AGDA 1TVBA 5HHPA 3GIVA 5BXFA 3MRLA 3TF7A 4L8CA 3DTXA 1T1WA 2V2WA 3FOMA 2YPLA 3MGOA 4FTVA 1T1ZA 3TBTA 3VXOA 3PWLA 1FZMA 4JQXA 2HJKA 4JFDA 3OXSA 3RL2A 5B38A 4L29A 1JUFA 4F7TA 4I4WA 1DE4A 2CIKA 3D25A 4MNQA 3VFOA 4ZUTA 3RTQA 3QDMA 3GMOA 1G6RH 3HAEA 5D7LA 3BEWA 2X4RA 1B0RA 1RK0A 3MRPA 3DX8A 3I6LD 1HHKA 2BNRA 1QR1A 3HCVA 3L3KA 5IROA 4G43A 5ACZA 5H94A 4NO3A 1UXSA 3QZWA 4JFFA 3D2UA 3QUKA 3RGVC 1VADA 1JF1A 1ZS8A 4MVBA 1LP9A 4Z78A 4IRJA 1A9BA 5J6HA 3H9HA 3BP4A 3DBXA 1DUZA 4PJ9A 5D7IA 3RL1A 4CVZA 5IB2A 3IXAA 1TVHA 2F53A 4HS3A 3L3DA 4I48A 3X13A 1FFNA 4MXQA 3KYNA 4WWKC 4D0CA 2CLZA 1LEGA 3AU1A 4L4TA 4GUPA 3VFVA 2X4QA 5JHDA 5B39A 1Z5LA 5GSRA 3SDAA 5J1AA 4U1NA 2GTZA 1KCGC 1I4FA 3D3VA 3TBWA 4E0RA 2XFXA 3HLAA 3WS3A 1A1MA 2BNQA 3LKRA 3RWFA 4PGCA 4PJGA 2WY3A 3IT8D 2JCCA 5F1NA 4NT6A 3RWDA 2ZOLA 4LNRA 3WS6A 4CW1A 2FZ3A 1ZHLA 1KJ2H 1QVOA 1KJ3H 2BSRA 3QFDA 1B3JA 1LD9A 2OL3H 4HUXA 3JTCA 2X4NA 2MHAA 4MX7A 4L9LC 1A9EA 1S7TA 3GSQA 1EXUA 1I1FA 4FFEX 2VLLA 1I7TA 3BXNA 1JGDA 1MHEA 3KPRA 4O2CA 3HPJA 5MEQA 4QRUA 4U6YA 1KJMA 3L9RA 3OXRA 4L3EA 1ZHBA 2GUOA 3BZEA 3CDGA 4L3CA 4PGBA 4PR5A 4JFOA 1N59A 3BH8A 3I6KA 2H6PA 4HWZA 3OX8A 3RWJA 3FONA 4U1KA 3GMMA 4LCCC 4MNGA 3TO2A 3VXUA 5AD0A 3M17A 5EU3A 1JFMA 5FA4A 3SKMA 2X4PA 3VWJA 2NX5A 1R3HA 5IM7A 3GSWA 3O8XA 5E00A 5E8OA 4E5XA 3QDJA 3QQ4A 4G42A 4EI5A 1N5AA 1T20A 2ZSVA 3TZVC 3RUGA 4U1SA 5MERA 1YN6A 3PQYA 1QRNA 4EN3C 1FZKA 1FZOA 1Q94A 4N8VA 4NNYA 1S8DA 2VLJA 3QFJA 3QUZA 5EU5A 3VXSA 3T1FA 5E6IC 2AKRA 3VWKA 3FQUA 3S6CA 2A83A 4U1MA 5C0IA 5FKPA 3V5HA 3DX7A 4K71B 3KPLA 1HSBA 3CCHA 4ELMA 4GKSA 2Q7YA 4PRBA 1CD1A 1RJYA 4V3EB 4PJBA 5D7JC 2C7UA 3CPLA 4U1HA 3VFWA 3AREA 1ONQA 4PRAA 5C07A 5ENWA 1S7XA 1I7UA 2UWEA 3O3AA 5EOTA 4LCYA 5C9JA 3E6FA 3ROLA 5MEPA 3GSXA 2BCKA 4JRYA 4NQDA 1XH3A 2HLAA 4NQVA 3TO4A 5GSVA 2F74A 2CIIA 2P5WA 2X4TA 1INQA 4PG9A 4QRTA 3PABA 4ONOA 3PWNA 1I1AA 3KPOA 5C0JA 5E8NA 3VH8A 1YPZA 1T7ZA 3X12A 3P9MA 4PREA 3FQNA 5F1IA 1JHTA 3AM8A 3MRMA 3T8XA 3UBXA 3GSRA 1FFOA 3BW9A 3KLAA 5HHQA 2GITA 3E6HA 1G7QA 1T1XA 1HHJA 1T22A 1W0WA 3SDCA 3BUYA 3KPPA 4IHOA 4N5EA 4PJ8A 4X6DA 1HYRC 1P7QA 3P9LA 4PGDA 2AXGA 3GJFA 5INCA 1N2RA 3P73A 4PJXA 3UPRA 4N0FA 2D31A 3FQRA 3VRJA 1IM3A 1KPVA 4PGEA 3KYOA 1LEKA 4PG2A 4CVXA 1MHCA 1C16A 1HHIA 3VXRA 5HYJA 3VFTA 1AGBA 5BS0A 1QEWA 3BH9A 3E2HA 5DEGA 1E28A 2BSSA 3P77A 3FT2A 4PV8A 3SPVA 4Z77A 1M6OA 1S9YA 3RWHA 1IM9A 5ISZA 3SDXA 5HGDA 5C0FA 4JFQA 3ILPA 5C0BA 1T7YA 1T7XA 4JRXA 4HUUA 3BVNA 1HHGA 1KTLA 4IIQC 1S7SA 3H7BA 3ERYA 4Y4FA 4PJFA 4X6FA 1AGCA 5F9JA 1BD2A 5IVXA 3QEQA 1XR9A 3QUXA 3BP7A 4L8SC 2J8UA 4O2EA 3VXNA 1HSAA 2VAAA 5C0EA 4PJIA 4ZFZA 1BQHA 3MRBA 2VLRA 3MRDA 3PWVA 3FRUA 3O4LA 3RWCA 3L3GA 1NANH 4JFPA 4HX1A 2CKBH 3MRHA 1QSEA 3LN5A 3UTQA 2YEZA 3JVGA 3BGMA 1JE6A 3CVHA 4QRQA 1T21A 3PWJA 4NO0A 1ZT7A 1W0VA 5D2NA 5L2KA 2V2XA 4IRSA 1ED3A 1ZVSA 2P5EA 3L3IA 2FWOA 4WW2C 4APQA 3MV7A 3BHBA 3MYJA 4ZUUA 1AO7A 3GMNA 1EEZA 3MRKA 1KPRA 3QULA 1ZSDA 1QO3A 3VXPA 1P1ZA 1S7QA 4PJCA 4ZUSA 2FYYA 3FQWA 4WJ5A 4ZAKA 4X6EA 3TJHA 5EFIA 1FFPA 2X4UA 5C09A 5C0DA 3VFSA 3TBYA 3DX6A 3PWUA 3CH1A 4L4VA 4PRDA 1AGEA 3LV3A 3LKNA 3ARBA 3O3EA 4JFEA 4S0UC 2RFXA 1A1OA 1GZQA 1VGKA 2F54A 3W39A 5BRZA 4UQ3A 3QI9A 1ZAGA 4HV8A 4MS8A 1ZHKA 1XZ0A 4D0DA 4MJIA 4PRHA 3V5DA 2BVOA 1T0NA 3MREA 4PRPA 1KPUA 1LDPH 5D2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4O A;  3MRF A;  5HGA A;  2OI9 A;  1L8J A;  4PV9 A;  3E3Q A;  3WUW A;  5MEO A;  3RZC A;  4Y16 A;  2ZSW A;  3LN4 A;  1YDP A;  2ZOK A;  1WBX A;  5SWS A;  1I7R A;  3KPM A;  5FDW A;  4NHU E;  4PJ5 A;  4L8D A;  2AV7 A;  4NQC A;  1FZJ A;  3GMR A;  5SWZ A;  3KWW A;  1ZT1 A;  4Y4K A;  1S7U A;  1TMC A;  1U58 A;  2GJ6 A;  1LK2 A;  3MV8 A;  3VXM A;  4F7P A;  1WBY A;  1WBZ A;  2X4S A;  1KBG H;  3UTT A;  3HUJ A;  3VFM A;  3KPQ A;  1S9X A;  5J6G A;  4D0B A;  4EUP A;  2E7L E;  4NNX A;  1AGF A;  3JTS A;  4MJ6 A;  4MQ7 A;  1MWA H;  3D39 A;  1T7W A;  4V3D B;  2PO6 A;  3I6G A;  3GSU A;  3MR9 A;  1JPG A;  1VAC A;  5IEK A;  3GML A;  5HHO A;  3TIE A;  1BII A;  5EUO A;  3V5K A;  4MJ5 A;  3B3I A;  5EU4 A;  1NAM H;  2AXF A;  3ES6 A;  3MRQ A;  2HJL A;  1HHH A;  1T80 A;  3C8K A;  1UQS A;  3P4N A;  4PRI A;  5SWQ A;  2NW3 A;  3WL9 A;  3KXF A;  3SDD A;  3QQ3 A;  3GSV A;  1ZT4 A;  2VE6 A;  3BEV A;  3L3J A;  3BO8 A;  4LCW A;  3P4M A;  4ZUV A;  4ZUW A;  1QSF A;  4F7E A;  4PJE A;  1W72 A;  1EEY A;  4QRP A;  4U1I A;  2FO4 A;  1OF2 A;  2BVQ A;  2ESV A;  4G9F A;  1K8D A;  1K5N A;  1XR8 A;  2CLR A;  1UXW A;  2XPG A;  5EU6 A;  3RWE A;  1T7V A;  1FG2 A;  3PWP A;  3BWA A;  3REW A;  3RWI A;  3WLB A;  1QQD A;  4G8I A;  3TVM A;  4F7C A;  1KJV A;  4HUW A;  5C08 A;  3TBS A;  2GAZ A;  3DMM A;  4G8G A;  1OSZ A;  4QRS A;  4G59 A;  2AV1 A;  1EFX A;  4PJA A;  5BJT A;  3MRN A;  3QUY A;  1JPF A;  5DDH A;  5IB3 A;  4NSK A;  3MRG A;  5HHN A;  4UQ2 A;  4WU5 A;  2AK4 A;  5C0G A;  3RWG A;  3L3H A;  4G9D A;  3LKP A;  3GMP A;  3QDG A;  1QLF A;  5IEH A;  4NQE A;  1SYV A;  1SYS A;  4NO5 A;  4WO4 A;  4U1L A;  3OV6 A;  3FFC A;  4O2F A;  1DDH A;  3B6S A;  4K7F A;  3ROO A;  5IB5 A;  3JTT A;  3HG1 A;  3C9N A;  1HOC A;  3X11 A;  3ARF A;  5HGH A;  4PJ7 A;  1MI5 A;  3FTG A;  3KPS A;  2YPK A;  4NO2 A;  2H26 A;  4PRN A;  4F7M A;  4PDC E;  3ECB A;  3BZF A;  3NFN A;  1P4L A;  4L8B A;  5IB4 A;  4QOK A;  1GZP A;  2X70 A;  3H9S A;  3M1B A;  3O3B A;  5DEF A;  3VFR A;  2BVP A;  3MRI A;  3GSN H;  3SJV A;  3FQT A;  2DYP A;  3MRC A;  4GKN A;  2FIK A;  5FA3 A;  3U0P A;  3TN0 A;  3UTS A;  4N0C A;  1CG9 A;  4WUU A;  1YN7 A;  3LKS A;  4PP8 C;  2HN7 A;  3ILQ C;  4Y4H A;  1G7P A;  1N3N A;  3ARD A;  1S7V A;  3GSO A;  4PJH A;  1AKJ A;  4PJD A;  1T0M A;  1S9W A;  2BST A;  4HUV A;  3TBV A;  4U6X A;  1OGT A;  3HE6 A;  3VFP A;  3LKO A;  3SKO A;  3VRI A;  3W0W A;  2VLK A;  5E9D A;  3KPN A;  3TPU E;  5HGB A;  1CE6 A;  3GMQ A;  1X7Q A;  1T1Y A;  1S7W A;  5D5M A;  4N0U A;  3G08 A;  3CZF A;  3DXA A;  1RJZ A;  3MV9 A;  3TFK A;  4QRR A;  5MEN A;  3CC5 A;  5IND A;  5D9S A;  2X4O A;  1LQV A;  3MRJ A;  1OGA A;  1FO0 H;  2GT9 A;  4HKJ A;  5C0A A;  3LKQ A;  3VJ6 A;  1DUY A;  1E27 A;  1ZHN A;  3MRR A;  4Y2D A;  3VFN A;  1JGE A;  3FT3 A;  4Z76 A;  1A6Z A;  3MGT A;  5IB1 A;  5L2J A;  3O9W A;  5HHM A;  1M05 A;  1RK1 A;  2VAB A;  3MRO A;  3FQX A;  1I1Y A;  3D18 A;  3HE7 A;  4X6C A;  5EO1 A;  1B0G A;  3SCM A;  3VCL A;  4WU7 A;  1BZ9 A;  5F7D A;  4NQX A;  4JQV A;  3TA3 A;  3MA7 A;  1S7R A;  3FT4 A;  5E8P A;  2GTW A;  3ARG A;  4XXC A;  3FOL A;  1PQZ A;  1A1N A;  1NEZ A;  3VFU A;  4U1J A;  5EO0 A;  3TID A;  5C0C A;  3O3D A;  3X14 A;  2CLV A;  4WDI A;  4LHU A;  2PYE A;  1AGD A;  1TVB A;  5HHP A;  3GIV A;  5BXF A;  3MRL A;  3TF7 A;  4L8C A;  3DTX A;  1T1W A;  2V2W A;  3FOM A;  2YPL A;  3MGO A;  4FTV A;  1T1Z A;  3TBT A;  3VXO A;  3PWL A;  1FZM A;  4JQX A;  2HJK A;  4JFD A;  3OXS A;  3RL2 A;  5B38 A;  4L29 A;  1JUF A;  4F7T A;  4I4W A;  1DE4 A;  2CIK A;  3D25 A;  4MNQ A;  3VFO A;  4ZUT A;  3RTQ A;  3QDM A;  3GMO A;  1G6R H;  3HAE A;  5D7L A;  3BEW A;  2X4R A;  1B0R A;  1RK0 A;  3MRP A;  3DX8 A;  3I6L D;  1HHK A;  2BNR A;  1QR1 A;  3HCV A;  3L3K A;  5IRO A;  4G43 A;  5ACZ A;  5H94 A;  4NO3 A;  1UXS A;  3QZW A;  4JFF A;  3D2U A;  3QUK A;  3RGV C;  1VAD A;  1JF1 A;  1ZS8 A;  4MVB A;  1LP9 A;  4Z78 A;  4IRJ A;  1A9B A;  5J6H A;  3H9H A;  3BP4 A;  3DBX A;  1DUZ A;  4PJ9 A;  5D7I A;  3RL1 A;  4CVZ A;  5IB2 A;  3IXA A;  1TVH A;  2F53 A;  4HS3 A;  3L3D A;  4I48 A;  3X13 A;  1FFN A;  4MXQ A;  3KYN A;  4WWK C;  4D0C A;  2CLZ A;  1LEG A;  3AU1 A;  4L4T A;  4GUP A;  3VFV A;  2X4Q A;  5JHD A;  5B39 A;  1Z5L A;  5GSR A;  3SDA A;  5J1A A;  4U1N A;  2GTZ A;  1KCG C;  1I4F A;  3D3V A;  3TBW A;  4E0R A;  2XFX A;  3HLA A;  3WS3 A;  1A1M A;  2BNQ A;  3LKR A;  3RWF A;  4PGC A;  4PJG A;  2WY3 A;  3IT8 D;  2JCC A;  5F1N A;  4NT6 A;  3RWD A;  2ZOL A;  4LNR A;  3WS6 A;  4CW1 A;  2FZ3 A;  1ZHL A;  1KJ2 H;  1QVO A;  1KJ3 H;  2BSR A;  3QFD A;  1B3J A;  1LD9 A;  2OL3 H;  4HUX A;  3JTC A;  2X4N A;  2MHA A;  4MX7 A;  4L9L C;  1A9E A;  1S7T A;  3GSQ A;  1EXU A;  1I1F A;  4FFE X;  2VLL A;  1I7T A;  3BXN A;  1JGD A;  1MHE A;  3KPR A;  4O2C A;  3HPJ A;  5MEQ A;  4QRU A;  4U6Y A;  1KJM A;  3L9R A;  3OXR A;  4L3E A;  1ZHB A;  2GUO A;  3BZE A;  3CDG A;  4L3C A;  4PGB A;  4PR5 A;  4JFO A;  1N59 A;  3BH8 A;  3I6K A;  2H6P A;  4HWZ A;  3OX8 A;  3RWJ A;  3FON A;  4U1K A;  3GMM A;  4LCC C;  4MNG A;  3TO2 A;  3VXU A;  5AD0 A;  3M17 A;  5EU3 A;  1JFM A;  5FA4 A;  3SKM A;  2X4P A;  3VWJ A;  2NX5 A;  1R3H A;  5IM7 A;  3GSW A;  3O8X A;  5E00 A;  5E8O A;  4E5X A;  3QDJ A;  3QQ4 A;  4G42 A;  4EI5 A;  1N5A A;  1T20 A;  2ZSV A;  3TZV C;  3RUG A;  4U1S A;  5MER A;  1YN6 A;  3PQY A;  1QRN A;  4EN3 C;  1FZK A;  1FZO A;  1Q94 A;  4N8V A;  4NNY A;  1S8D A;  2VLJ A;  3QFJ A;  3QUZ A;  5EU5 A;  3VXS A;  3T1F A;  5E6I C;  2AKR A;  3VWK A;  3FQU A;  3S6C A;  2A83 A;  4U1M A;  5C0I A;  5FKP A;  3V5H A;  3DX7 A;  4K71 B;  3KPL A;  1HSB A;  3CCH A;  4ELM A;  4GKS A;  2Q7Y A;  4PRB A;  1CD1 A;  1RJY A;  4V3E B;  4PJB A;  5D7J C;  2C7U A;  3CPL A;  4U1H A;  3VFW A;  3ARE A;  1ONQ A;  4PRA A;  5C07 A;  5ENW A;  1S7X A;  1I7U A;  2UWE A;  3O3A A;  5EOT A;  4LCY A;  5C9J A;  3E6F A;  3ROL A;  5MEP A;  3GSX A;  2BCK A;  4JRY A;  4NQD A;  1XH3 A;  2HLA A;  4NQV A;  3TO4 A;  5GSV A;  2F74 A;  2CII A;  2P5W A;  2X4T A;  1INQ A;  4PG9 A;  4QRT A;  3PAB A;  4ONO A;  3PWN A;  1I1A A;  3KPO A;  5C0J A;  5E8N A;  3VH8 A;  1YPZ A;  1T7Z A;  3X12 A;  3P9M A;  4PRE A;  3FQN A;  5F1I A;  1JHT A;  3AM8 A;  3MRM A;  3T8X A;  3UBX A;  3GSR A;  1FFO A;  3BW9 A;  3KLA A;  5HHQ A;  2GIT A;  3E6H A;  1G7Q A;  1T1X A;  1HHJ A;  1T22 A;  1W0W A;  3SDC A;  3BUY A;  3KPP A;  4IHO A;  4N5E A;  4PJ8 A;  4X6D A;  1HYR C;  1P7Q A;  3P9L A;  4PGD A;  2AXG A;  3GJF A;  5INC A;  1N2R A;  3P73 A;  4PJX A;  3UPR A;  4N0F A;  2D31 A;  3FQR A;  3VRJ A;  1IM3 A;  1KPV A;  4PGE A;  3KYO A;  1LEK A;  4PG2 A;  4CVX A;  1MHC A;  1C16 A;  1HHI A;  3VXR A;  5HYJ A;  3VFT A;  1AGB A;  5BS0 A;  1QEW A;  3BH9 A;  3E2H A;  5DEG A;  1E28 A;  2BSS A;  3P77 A;  3FT2 A;  4PV8 A;  3SPV A;  4Z77 A;  1M6O A;  1S9Y A;  3RWH A;  1IM9 A;  5ISZ A;  3SDX A;  5HGD A;  5C0F A;  4JFQ A;  3ILP A;  5C0B A;  1T7Y A;  1T7X A;  4JRX A;  4HUU A;  3BVN A;  1HHG A;  1KTL A;  4IIQ C;  1S7S A;  3H7B A;  3ERY A;  4Y4F A;  4PJF A;  4X6F A;  1AGC A;  5F9J A;  1BD2 A;  5IVX A;  3QEQ A;  1XR9 A;  3QUX A;  3BP7 A;  4L8S C;  2J8U A;  4O2E A;  3VXN A;  1HSA A;  2VAA A;  5C0E A;  4PJI A;  4ZFZ A;  1BQH A;  3MRB A;  2VLR A;  3MRD A;  3PWV A;  3FRU A;  3O4L A;  3RWC A;  3L3G A;  1NAN H;  4JFP A;  4HX1 A;  2CKB H;  3MRH A;  1QSE A;  3LN5 A;  3UTQ A;  2YEZ A;  3JVG A;  3BGM A;  1JE6 A;  3CVH A;  4QRQ A;  1T21 A;  3PWJ A;  4NO0 A;  1ZT7 A;  1W0V A;  5D2N A;  5L2K A;  2V2X A;  4IRS A;  1ED3 A;  1ZVS A;  2P5E A;  3L3I A;  2FWO A;  4WW2 C;  4APQ A;  3MV7 A;  3BHB A;  3MYJ A;  4ZUU A;  1AO7 A;  3GMN A;  1EEZ A;  3MRK A;  1KPR A;  3QUL A;  1ZSD A;  1QO3 A;  3VXP A;  1P1Z A;  1S7Q A;  4PJC A;  4ZUS A;  2FYY A;  3FQW A;  4WJ5 A;  4ZAK A;  4X6E A;  3TJH A;  5EFI A;  1FFP A;  2X4U A;  5C09 A;  5C0D A;  3VFS A;  3TBY A;  3DX6 A;  3PWU A;  3CH1 A;  4L4V A;  4PRD A;  1AGE A;  3LV3 A;  3LKN A;  3ARB A;  3O3E A;  4JFE A;  4S0U C;  2RFX A;  1A1O A;  1GZQ A;  1VGK A;  2F54 A;  3W39 A;  5BRZ A;  4UQ3 A;  3QI9 A;  1ZAG A;  4HV8 A;  4MS8 A;  1ZHK A;  1XZ0 A;  4D0D A;  4MJI A;  4PRH A;  3V5D A;  2BVO A;  1T0N A;  3MRE A;  4PRP A;  1KPU A;  1LDP H;  5D2L A; 
#chains in the Genus database with same CATH topology
 3P4O A;  3MRF A;  5HGA A;  2OI9 A;  1L8J A;  4PV9 A;  3E3Q A;  3WUW A;  5MEO A;  3RZC A;  4Y16 A;  2ZSW A;  3LN4 A;  1YDP A;  2ZOK A;  1WBX A;  5SWS A;  1I7R A;  3KPM A;  5FDW A;  4NHU E;  4PJ5 A;  4L8D A;  2AV7 A;  4NQC A;  1FZJ A;  3GMR A;  5SWZ A;  3KWW A;  1ZT1 A;  4Y4K A;  1S7U A;  1TMC A;  1U58 A;  2GJ6 A;  1LK2 A;  3MV8 A;  3VXM A;  4F7P A;  1WBY A;  1WBZ A;  2X4S A;  1KBG H;  3UTT A;  3HUJ A;  3VFM A;  3KPQ A;  1S9X A;  5J6G A;  4D0B A;  4EUP A;  2E7L E;  4NNX A;  1AGF A;  3JTS A;  4MJ6 A;  4MQ7 A;  1MWA H;  3D39 A;  1T7W A;  4V3D B;  2PO6 A;  3I6G A;  3GSU A;  3MR9 A;  1JPG A;  1VAC A;  5IEK A;  3GML A;  5HHO A;  3TIE A;  1BII A;  5EUO A;  3V5K A;  4MJ5 A;  3B3I A;  5EU4 A;  1NAM H;  2AXF A;  3ES6 A;  3MRQ A;  2HJL A;  1HHH A;  1T80 A;  3C8K A;  1UQS A;  3P4N A;  4PRI A;  5SWQ A;  2NW3 A;  3WL9 A;  3KXF A;  3SDD A;  3QQ3 A;  3GSV A;  1ZT4 A;  2VE6 A;  3BEV A;  3L3J A;  3BO8 A;  4LCW A;  3P4M A;  4ZUV A;  4ZUW A;  1QSF A;  4F7E A;  4PJE A;  1W72 A;  1EEY A;  4QRP A;  4U1I A;  2FO4 A;  1OF2 A;  2BVQ A;  2ESV A;  4G9F A;  1K8D A;  1K5N A;  1XR8 A;  2CLR A;  1UXW A;  2XPG A;  5EU6 A;  3RWE A;  1T7V A;  1FG2 A;  3PWP A;  3BWA A;  3REW A;  3RWI A;  3WLB A;  1QQD A;  4G8I A;  3TVM A;  4F7C A;  1KJV A;  4HUW A;  5C08 A;  3TBS A;  2GAZ A;  3DMM A;  4G8G A;  4JO8 A;  1OSZ A;  4QRS A;  4G59 A;  2AV1 A;  1EFX A;  4PJA A;  5BJT A;  3MRN A;  3QUY A;  1JPF A;  5DDH A;  5IB3 A;  4NSK A;  3MRG A;  5HHN A;  4UQ2 A;  4WU5 A;  2AK4 A;  5C0G A;  3RWG A;  3L3H A;  4G9D A;  3LKP A;  3GMP A;  3QDG A;  1QLF A;  5IEH A;  4NQE A;  1SYV A;  1SYS A;  4NO5 A;  4WO4 A;  4U1L A;  3OV6 A;  3FFC A;  4O2F A;  1DDH A;  3B6S A;  4K7F A;  3ROO A;  5IB5 A;  3JTT A;  3HG1 A;  3C9N A;  1HOC A;  3X11 A;  3ARF A;  5HGH A;  4PJ7 A;  1MI5 A;  3FTG A;  3KPS A;  2YPK A;  4NO2 A;  2H26 A;  4PRN A;  4F7M A;  4PDC E;  3ECB A;  3BZF A;  3NFN A;  1P4L A;  4L8B A;  5IB4 A;  4QOK A;  1GZP A;  2X70 A;  3H9S A;  3M1B A;  3O3B A;  5DEF A;  3VFR A;  2BVP A;  3MRI A;  3GSN H;  3SJV A;  3FQT A;  2DYP A;  3MRC A;  4GKN A;  2FIK A;  5FA3 A;  3U0P A;  3TN0 A;  3UTS A;  4N0C A;  1CG9 A;  4WUU A;  1YN7 A;  3LKS A;  4PP8 C;  2HN7 A;  3ILQ C;  4Y4H A;  1G7P A;  1N3N A;  3ARD A;  1S7V A;  3GSO A;  4PJH A;  1AKJ A;  4PJD A;  1T0M A;  1S9W A;  2BST A;  4HUV A;  3TBV A;  4U6X A;  1OGT A;  3HE6 A;  3VFP A;  3LKO A;  3SKO A;  3VRI A;  3W0W A;  2VLK A;  5E9D A;  3KPN A;  3TPU E;  5HGB A;  1CE6 A;  3GMQ A;  1X7Q A;  1T1Y A;  1S7W A;  5D5M A;  4N0U A;  3G08 A;  3CZF A;  3DXA A;  1RJZ A;  3MV9 A;  3TFK A;  4QRR A;  5MEN A;  3CC5 A;  5IND A;  5D9S A;  2X4O A;  1LQV A;  3MRJ A;  1OGA A;  1FO0 H;  2GT9 A;  4HKJ A;  5C0A A;  3LKQ A;  3VJ6 A;  1DUY A;  1E27 A;  1ZHN A;  3MRR A;  4Y2D A;  3VFN A;  1JGE A;  3FT3 A;  3I0T A;  4Z76 A;  1A6Z A;  3MGT A;  5IB1 A;  5L2J A;  3O9W A;  5HHM A;  1M05 A;  1RK1 A;  2VAB A;  3MRO A;  3FQX A;  1I1Y A;  3D18 A;  3HE7 A;  4X6C A;  5EO1 A;  1B0G A;  3SCM A;  3VCL A;  4WU7 A;  1BZ9 A;  5F7D A;  4NQX A;  4JQV A;  3TA3 A;  3MA7 A;  1S7R A;  3FT4 A;  5E8P A;  2GTW A;  3ARG A;  4XXC A;  3FOL A;  1PQZ A;  1A1N A;  1NEZ A;  3VFU A;  4U1J A;  5EO0 A;  3TID A;  5C0C A;  3O3D A;  3X14 A;  2CLV A;  4WDI A;  4LHU A;  2PYE A;  1AGD A;  1TVB A;  5HHP A;  3GIV A;  5BXF A;  3MRL A;  3TF7 A;  4L8C A;  3DTX A;  1T1W A;  2V2W A;  3FOM A;  2YPL A;  3MGO A;  4FTV A;  1T1Z A;  3TBT A;  3VXO A;  3PWL A;  1FZM A;  4JQX A;  2HJK A;  4JFD A;  3OXS A;  3RL2 A;  5B38 A;  4L29 A;  1JUF A;  4F7T A;  4I4W A;  1DE4 A;  2CIK A;  3D25 A;  4MNQ A;  3VFO A;  4ZUT A;  3RTQ A;  3QDM A;  3GMO A;  1G6R H;  3HAE A;  5D7L A;  3BEW A;  2X4R A;  1B0R A;  1RK0 A;  3MRP A;  3DX8 A;  3I6L D;  1HHK A;  2BNR A;  1QR1 A;  3HCV A;  3L3K A;  5IRO A;  4G43 A;  5ACZ A;  5H94 A;  4NO3 A;  1UXS A;  3QZW A;  4JFF A;  3D2U A;  3QUK A;  3RGV C;  1VAD A;  1JF1 A;  1ZS8 A;  4MVB A;  1LP9 A;  4Z78 A;  4IRJ A;  1A9B A;  5J6H A;  3H9H A;  3BP4 A;  3DBX A;  1DUZ A;  4PJ9 A;  5D7I A;  3RL1 A;  4CVZ A;  5IB2 A;  3IXA A;  1TVH A;  2F53 A;  4HS3 A;  3L3D A;  4I48 A;  3X13 A;  1FFN A;  4MXQ A;  3KYN A;  4WWK C;  4D0C A;  2CLZ A;  1LEG A;  3AU1 A;  4L4T A;  4GUP A;  3VFV A;  2X4Q A;  4BKW A;  5JHD A;  5B39 A;  1Z5L A;  5GSR A;  3SDA A;  5J1A A;  4U1N A;  2GTZ A;  1KCG C;  1I4F A;  3D3V A;  3TBW A;  4E0R A;  2XFX A;  3HLA A;  3WS3 A;  1A1M A;  2BNQ A;  3LKR A;  3RWF A;  4PGC A;  4PJG A;  2WY3 A;  3IT8 D;  2JCC A;  5F1N A;  4NT6 A;  3RWD A;  2ZOL A;  4LNR A;  3WS6 A;  4CW1 A;  2FZ3 A;  1ZHL A;  1KJ2 H;  1QVO A;  1KJ3 H;  2BSR A;  3QFD A;  1B3J A;  1LD9 A;  2OL3 H;  4HUX A;  3JTC A;  2X4N A;  2MHA A;  4MX7 A;  4L9L C;  1A9E A;  1S7T A;  3GSQ A;  1EXU A;  1I1F A;  4FFE X;  2VLL A;  1I7T A;  3BXN A;  1JGD A;  1MHE A;  3KPR A;  4O2C A;  2NYK A;  2O5N A;  3HPJ A;  5MEQ A;  4QRU A;  4U6Y A;  1KJM A;  3L9R A;  3OXR A;  4L3E A;  1ZHB A;  2GUO A;  3BZE A;  3CDG A;  4L3C A;  4PGB A;  4PR5 A;  4JFO A;  1N59 A;  3BH8 A;  3I6K A;  2H6P A;  4HWZ A;  3OX8 A;  3RWJ A;  3FON A;  4U1K A;  3GMM A;  4LCC C;  4MNG A;  3TO2 A;  3VXU A;  5AD0 A;  3M17 A;  5EU3 A;  1JFM A;  5FA4 A;  3SKM A;  2X4P A;  3VWJ A;  2NX5 A;  1R3H A;  5IM7 A;  3GSW A;  3O8X A;  5E00 A;  5E8O A;  4E5X A;  3QDJ A;  3QQ4 A;  4G42 A;  4EI5 A;  1N5A A;  1T20 A;  2ZSV A;  3TZV C;  3RUG A;  4U1S A;  5MER A;  1YN6 A;  3PQY A;  1QRN A;  4EN3 C;  1FZK A;  1FZO A;  1Q94 A;  4N8V A;  4NNY A;  1S8D A;  2VLJ A;  3QFJ A;  3QUZ A;  5EU5 A;  3VXS A;  3T1F A;  5E6I C;  2AKR A;  3VWK A;  3FQU A;  3S6C A;  2A83 A;  4U1M A;  5C0I A;  5FKP A;  3V5H A;  3DX7 A;  4K71 B;  3KPL A;  1HSB A;  3CCH A;  4ELM A;  4GKS A;  2Q7Y A;  4PRB A;  1CD1 A;  1RJY A;  4V3E B;  4PJB A;  5D7J C;  2C7U A;  3CPL A;  4U1H A;  3VFW A;  3ARE A;  1ONQ A;  4PRA A;  5C07 A;  5ENW A;  1S7X A;  1I7U A;  2UWE A;  3O3A A;  5EOT A;  4LCY A;  5C9J A;  3E6F A;  3ROL A;  5MEP A;  3GSX A;  2BCK A;  4JRY A;  4NQD A;  1XH3 A;  2HLA A;  4NQV A;  3TO4 A;  5GSV A;  2F74 A;  2CII A;  2P5W A;  2X4T A;  1INQ A;  4PG9 A;  4QRT A;  3PAB A;  4ONO A;  3PWN A;  1I1A A;  3KPO A;  5C0J A;  5E8N A;  3VH8 A;  1YPZ A;  1T7Z A;  3X12 A;  3P9M A;  4PRE A;  3FQN A;  5F1I A;  1JHT A;  3AM8 A;  3MRM A;  3T8X A;  3UBX A;  3GSR A;  1FFO A;  3BW9 A;  3KLA A;  4G59 C;  5HHQ A;  2GIT A;  3E6H A;  1G7Q A;  1T1X A;  1HHJ A;  1T22 A;  1W0W A;  3SDC A;  3BUY A;  3KPP A;  4IHO A;  4N5E A;  4PJ8 A;  4X6D A;  1HYR C;  1P7Q A;  3P9L A;  4PGD A;  2AXG A;  3GJF A;  5INC A;  1N2R A;  3P73 A;  4PJX A;  3UPR A;  4N0F A;  2D31 A;  3FQR A;  3VRJ A;  1IM3 A;  1KPV A;  4PGE A;  3KYO A;  1LEK A;  4PG2 A;  4CVX A;  1MHC A;  1C16 A;  1HHI A;  3VXR A;  5HYJ A;  3VFT A;  1AGB A;  5BS0 A;  1QEW A;  3BH9 A;  3E2H A;  5DEG A;  1E28 A;  2BSS A;  3P77 A;  3FT2 A;  4PV8 A;  3SPV A;  4Z77 A;  1M6O A;  1S9Y A;  3RWH A;  1IM9 A;  5ISZ A;  3SDX A;  5HGD A;  5C0F A;  4JFQ A;  3ILP A;  5C0B A;  1T7Y A;  1T7X A;  4JRX A;  4HUU A;  3BVN A;  1HHG A;  1KTL A;  4IIQ C;  1S7S A;  3H7B A;  3ERY A;  4Y4F A;  4PJF A;  4X6F A;  1AGC A;  5F9J A;  1BD2 A;  5IVX A;  3QEQ A;  1XR9 A;  3QUX A;  3BP7 A;  4L8S C;  2J8U A;  4O2E A;  3VXN A;  1HSA A;  2VAA A;  5C0E A;  4PJI A;  4ZFZ A;  1BQH A;  3MRB A;  2VLR A;  3MRD A;  3PWV A;  3FRU A;  3O4L A;  3RWC A;  3L3G A;  1NAN H;  4JFP A;  4HX1 A;  2CKB H;  3MRH A;  1QSE A;  3LN5 A;  3UTQ A;  2YEZ A;  3JVG A;  3BGM A;  1JE6 A;  3CVH A;  4QRQ A;  1T21 A;  3PWJ A;  4NO0 A;  1ZT7 A;  1W0V A;  5D2N A;  5L2K A;  2V2X A;  4IRS A;  1ED3 A;  1ZVS A;  2P5E A;  3L3I A;  2FWO A;  4WW2 C;  4APQ A;  3MV7 A;  2IA1 A;  3BHB A;  3MYJ A;  4ZUU A;  1AO7 A;  3GMN A;  1EEZ A;  3MRK A;  1KPR A;  3QUL A;  1ZSD A;  1QO3 A;  3VXP A;  1P1Z A;  1S7Q A;  4PJC A;  4ZUS A;  2FYY A;  3FQW A;  4WJ5 A;  4ZAK A;  4X6E A;  3TJH A;  5EFI A;  1FFP A;  2X4U A;  5C09 A;  5C0D A;  3VFS A;  3TBY A;  3DX6 A;  3PWU A;  3CH1 A;  4L4V A;  4PRD A;  1AGE A;  3LV3 A;  3LKN A;  3ARB A;  3O3E A;  4JFE A;  4S0U C;  2RFX A;  1A1O A;  1GZQ A;  1VGK A;  2F54 A;  3W39 A;  5BRZ A;  4UQ3 A;  3QI9 A;  1ZAG A;  4HV8 A;  4MS8 A;  1ZHK A;  1XZ0 A;  4D0D A;  4MJI A;  4PRH A;  3V5D A;  2BVO A;  1T0N A;  3MRE A;  4PRP A;  1KPU A;  1LDP H;  5D2L A; 
#chains in the Genus database with same CATH homology
 3P4O A;  3MRF A;  5HGA A;  2OI9 A;  1L8J A;  4PV9 A;  3E3Q A;  3WUW A;  5MEO A;  3RZC A;  4Y16 A;  2ZSW A;  3LN4 A;  1YDP A;  2ZOK A;  1WBX A;  5SWS A;  1I7R A;  3KPM A;  5FDW A;  4NHU E;  4PJ5 A;  4L8D A;  2AV7 A;  4NQC A;  1FZJ A;  3GMR A;  5SWZ A;  3KWW A;  1ZT1 A;  4Y4K A;  1S7U A;  1TMC A;  1U58 A;  2GJ6 A;  1LK2 A;  3MV8 A;  3VXM A;  4F7P A;  1WBY A;  1WBZ A;  2X4S A;  1KBG H;  3UTT A;  3HUJ A;  3VFM A;  3KPQ A;  1S9X A;  5J6G A;  4D0B A;  4EUP A;  2E7L E;  4NNX A;  1AGF A;  3JTS A;  4MJ6 A;  4MQ7 A;  1MWA H;  3D39 A;  1T7W A;  4V3D B;  2PO6 A;  3I6G A;  3GSU A;  3MR9 A;  1JPG A;  1VAC A;  5IEK A;  3GML A;  5HHO A;  3TIE A;  1BII A;  5EUO A;  3V5K A;  4MJ5 A;  3B3I A;  5EU4 A;  1NAM H;  2AXF A;  3ES6 A;  3MRQ A;  2HJL A;  1HHH A;  1T80 A;  3C8K A;  1UQS A;  3P4N A;  4PRI A;  5SWQ A;  2NW3 A;  3WL9 A;  3KXF A;  3SDD A;  3QQ3 A;  3GSV A;  1ZT4 A;  2VE6 A;  3BEV A;  3L3J A;  3BO8 A;  4LCW A;  3P4M A;  4ZUV A;  4ZUW A;  1QSF A;  4F7E A;  4PJE A;  1W72 A;  1EEY A;  4QRP A;  4U1I A;  2FO4 A;  1OF2 A;  2BVQ A;  2ESV A;  4G9F A;  1K8D A;  1K5N A;  1XR8 A;  2CLR A;  1UXW A;  2XPG A;  5EU6 A;  3RWE A;  1T7V A;  1FG2 A;  3PWP A;  3BWA A;  3REW A;  3RWI A;  3WLB A;  1QQD A;  4G8I A;  3TVM A;  4F7C A;  1KJV A;  4HUW A;  5C08 A;  3TBS A;  2GAZ A;  3DMM A;  4G8G A;  1OSZ A;  4QRS A;  4G59 A;  2AV1 A;  1EFX A;  4PJA A;  5BJT A;  3MRN A;  3QUY A;  1JPF A;  5DDH A;  5IB3 A;  4NSK A;  3MRG A;  5HHN A;  4UQ2 A;  4WU5 A;  2AK4 A;  5C0G A;  3RWG A;  3L3H A;  4G9D A;  3LKP A;  3GMP A;  3QDG A;  1QLF A;  5IEH A;  4NQE A;  1SYV A;  1SYS A;  4NO5 A;  4WO4 A;  4U1L A;  3OV6 A;  3FFC A;  4O2F A;  1DDH A;  3B6S A;  4K7F A;  3ROO A;  5IB5 A;  3JTT A;  3HG1 A;  3C9N A;  1HOC A;  3X11 A;  3ARF A;  5HGH A;  4PJ7 A;  1MI5 A;  3FTG A;  3KPS A;  2YPK A;  4NO2 A;  2H26 A;  4PRN A;  4F7M A;  4PDC E;  3ECB A;  3BZF A;  3NFN A;  1P4L A;  4L8B A;  5IB4 A;  4QOK A;  1GZP A;  2X70 A;  3H9S A;  3M1B A;  3O3B A;  5DEF A;  3VFR A;  2BVP A;  3MRI A;  3GSN H;  3SJV A;  3FQT A;  2DYP A;  3MRC A;  4GKN A;  2FIK A;  5FA3 A;  3U0P A;  3TN0 A;  3UTS A;  4N0C A;  1CG9 A;  4WUU A;  1YN7 A;  3LKS A;  4PP8 C;  2HN7 A;  3ILQ C;  4Y4H A;  1G7P A;  1N3N A;  3ARD A;  1S7V A;  3GSO A;  4PJH A;  1AKJ A;  4PJD A;  1T0M A;  1S9W A;  2BST A;  4HUV A;  3TBV A;  4U6X A;  1OGT A;  3HE6 A;  3VFP A;  3LKO A;  3SKO A;  3VRI A;  3W0W A;  2VLK A;  5E9D A;  3KPN A;  3TPU E;  5HGB A;  1CE6 A;  3GMQ A;  1X7Q A;  1T1Y A;  1S7W A;  5D5M A;  4N0U A;  3G08 A;  3CZF A;  3DXA A;  1RJZ A;  3MV9 A;  3TFK A;  4QRR A;  5MEN A;  3CC5 A;  5IND A;  5D9S A;  2X4O A;  1LQV A;  3MRJ A;  1OGA A;  1FO0 H;  2GT9 A;  4HKJ A;  5C0A A;  3LKQ A;  3VJ6 A;  1DUY A;  1E27 A;  1ZHN A;  3MRR A;  4Y2D A;  3VFN A;  1JGE A;  3FT3 A;  4Z76 A;  1A6Z A;  3MGT A;  5IB1 A;  5L2J A;  3O9W A;  5HHM A;  1M05 A;  1RK1 A;  2VAB A;  3MRO A;  3FQX A;  1I1Y A;  3D18 A;  3HE7 A;  4X6C A;  5EO1 A;  1B0G A;  3SCM A;  3VCL A;  4WU7 A;  1BZ9 A;  5F7D A;  4NQX A;  4JQV A;  3TA3 A;  3MA7 A;  1S7R A;  3FT4 A;  5E8P A;  2GTW A;  3ARG A;  4XXC A;  3FOL A;  1PQZ A;  1A1N A;  1NEZ A;  3VFU A;  4U1J A;  5EO0 A;  3TID A;  5C0C A;  3O3D A;  3X14 A;  2CLV A;  4WDI A;  4LHU A;  2PYE A;  1AGD A;  1TVB A;  5HHP A;  3GIV A;  5BXF A;  3MRL A;  3TF7 A;  4L8C A;  3DTX A;  1T1W A;  2V2W A;  3FOM A;  2YPL A;  3MGO A;  4FTV A;  1T1Z A;  3TBT A;  3VXO A;  3PWL A;  1FZM A;  4JQX A;  2HJK A;  4JFD A;  3OXS A;  3RL2 A;  5B38 A;  4L29 A;  1JUF A;  4F7T A;  4I4W A;  1DE4 A;  2CIK A;  3D25 A;  4MNQ A;  3VFO A;  4ZUT A;  3RTQ A;  3QDM A;  3GMO A;  1G6R H;  3HAE A;  5D7L A;  3BEW A;  2X4R A;  1B0R A;  1RK0 A;  3MRP A;  3DX8 A;  3I6L D;  1HHK A;  2BNR A;  1QR1 A;  3HCV A;  3L3K A;  5IRO A;  4G43 A;  5ACZ A;  5H94 A;  4NO3 A;  1UXS A;  3QZW A;  4JFF A;  3D2U A;  3QUK A;  3RGV C;  1VAD A;  1JF1 A;  1ZS8 A;  4MVB A;  1LP9 A;  4Z78 A;  4IRJ A;  1A9B A;  5J6H A;  3H9H A;  3BP4 A;  3DBX A;  1DUZ A;  4PJ9 A;  5D7I A;  3RL1 A;  4CVZ A;  5IB2 A;  3IXA A;  1TVH A;  2F53 A;  4HS3 A;  3L3D A;  4I48 A;  3X13 A;  1FFN A;  4MXQ A;  3KYN A;  4WWK C;  4D0C A;  2CLZ A;  1LEG A;  3AU1 A;  4L4T A;  4GUP A;  3VFV A;  2X4Q A;  5JHD A;  5B39 A;  1Z5L A;  5GSR A;  3SDA A;  5J1A A;  4U1N A;  2GTZ A;  1KCG C;  1I4F A;  3D3V A;  3TBW A;  4E0R A;  2XFX A;  3HLA A;  3WS3 A;  1A1M A;  2BNQ A;  3LKR A;  3RWF A;  4PGC A;  4PJG A;  2WY3 A;  3IT8 D;  2JCC A;  5F1N A;  4NT6 A;  3RWD A;  2ZOL A;  4LNR A;  3WS6 A;  4CW1 A;  2FZ3 A;  1ZHL A;  1KJ2 H;  1QVO A;  1KJ3 H;  2BSR A;  3QFD A;  1B3J A;  1LD9 A;  2OL3 H;  4HUX A;  3JTC A;  2X4N A;  2MHA A;  4MX7 A;  4L9L C;  1A9E A;  1S7T A;  3GSQ A;  1EXU A;  1I1F A;  4FFE X;  2VLL A;  1I7T A;  3BXN A;  1JGD A;  1MHE A;  3KPR A;  4O2C A;  3HPJ A;  5MEQ A;  4QRU A;  4U6Y A;  1KJM A;  3L9R A;  3OXR A;  4L3E A;  1ZHB A;  2GUO A;  3BZE A;  3CDG A;  4L3C A;  4PGB A;  4PR5 A;  4JFO A;  1N59 A;  3BH8 A;  3I6K A;  2H6P A;  4HWZ A;  3OX8 A;  3RWJ A;  3FON A;  4U1K A;  3GMM A;  4LCC C;  4MNG A;  3TO2 A;  3VXU A;  5AD0 A;  3M17 A;  5EU3 A;  1JFM A;  5FA4 A;  3SKM A;  2X4P A;  3VWJ A;  2NX5 A;  1R3H A;  5IM7 A;  3GSW A;  3O8X A;  5E00 A;  5E8O A;  4E5X A;  3QDJ A;  3QQ4 A;  4G42 A;  4EI5 A;  1N5A A;  1T20 A;  2ZSV A;  3TZV C;  3RUG A;  4U1S A;  5MER A;  1YN6 A;  3PQY A;  1QRN A;  4EN3 C;  1FZK A;  1FZO A;  1Q94 A;  4N8V A;  4NNY A;  1S8D A;  2VLJ A;  3QFJ A;  3QUZ A;  5EU5 A;  3VXS A;  3T1F A;  5E6I C;  2AKR A;  3VWK A;  3FQU A;  3S6C A;  2A83 A;  4U1M A;  5C0I A;  5FKP A;  3V5H A;  3DX7 A;  4K71 B;  3KPL A;  1HSB A;  3CCH A;  4ELM A;  4GKS A;  2Q7Y A;  4PRB A;  1CD1 A;  1RJY A;  4V3E B;  4PJB A;  5D7J C;  2C7U A;  3CPL A;  4U1H A;  3VFW A;  3ARE A;  1ONQ A;  4PRA A;  5C07 A;  5ENW A;  1S7X A;  1I7U A;  2UWE A;  3O3A A;  5EOT A;  4LCY A;  5C9J A;  3E6F A;  3ROL A;  5MEP A;  3GSX A;  2BCK A;  4JRY A;  4NQD A;  1XH3 A;  2HLA A;  4NQV A;  3TO4 A;  5GSV A;  2F74 A;  2CII A;  2P5W A;  2X4T A;  1INQ A;  4PG9 A;  4QRT A;  3PAB A;  4ONO A;  3PWN A;  1I1A A;  3KPO A;  5C0J A;  5E8N A;  3VH8 A;  1YPZ A;  1T7Z A;  3X12 A;  3P9M A;  4PRE A;  3FQN A;  5F1I A;  1JHT A;  3AM8 A;  3MRM A;  3T8X A;  3UBX A;  3GSR A;  1FFO A;  3BW9 A;  3KLA A;  5HHQ A;  2GIT A;  3E6H A;  1G7Q A;  1T1X A;  1HHJ A;  1T22 A;  1W0W A;  3SDC A;  3BUY A;  3KPP A;  4IHO A;  4N5E A;  4PJ8 A;  4X6D A;  1HYR C;  1P7Q A;  3P9L A;  4PGD A;  2AXG A;  3GJF A;  5INC A;  1N2R A;  3P73 A;  4PJX A;  3UPR A;  4N0F A;  2D31 A;  3FQR A;  3VRJ A;  1IM3 A;  1KPV A;  4PGE A;  3KYO A;  1LEK A;  4PG2 A;  4CVX A;  1MHC A;  1C16 A;  1HHI A;  3VXR A;  5HYJ A;  3VFT A;  1AGB A;  5BS0 A;  1QEW A;  3BH9 A;  3E2H A;  5DEG A;  1E28 A;  2BSS A;  3P77 A;  3FT2 A;  4PV8 A;  3SPV A;  4Z77 A;  1M6O A;  1S9Y A;  3RWH A;  1IM9 A;  5ISZ A;  3SDX A;  5HGD A;  5C0F A;  4JFQ A;  3ILP A;  5C0B A;  1T7Y A;  1T7X A;  4JRX A;  4HUU A;  3BVN A;  1HHG A;  1KTL A;  4IIQ C;  1S7S A;  3H7B A;  3ERY A;  4Y4F A;  4PJF A;  4X6F A;  1AGC A;  5F9J A;  1BD2 A;  5IVX A;  3QEQ A;  1XR9 A;  3QUX A;  3BP7 A;  4L8S C;  2J8U A;  4O2E A;  3VXN A;  1HSA A;  2VAA A;  5C0E A;  4PJI A;  4ZFZ A;  1BQH A;  3MRB A;  2VLR A;  3MRD A;  3PWV A;  3FRU A;  3O4L A;  3RWC A;  3L3G A;  1NAN H;  4JFP A;  4HX1 A;  2CKB H;  3MRH A;  1QSE A;  3LN5 A;  3UTQ A;  2YEZ A;  3JVG A;  3BGM A;  1JE6 A;  3CVH A;  4QRQ A;  1T21 A;  3PWJ A;  4NO0 A;  1ZT7 A;  1W0V A;  5D2N A;  5L2K A;  2V2X A;  4IRS A;  1ED3 A;  1ZVS A;  2P5E A;  3L3I A;  2FWO A;  4WW2 C;  4APQ A;  3MV7 A;  3BHB A;  3MYJ A;  4ZUU A;  1AO7 A;  3GMN A;  1EEZ A;  3MRK A;  1KPR A;  3QUL A;  1ZSD A;  1QO3 A;  3VXP A;  1P1Z A;  1S7Q A;  4PJC A;  4ZUS A;  2FYY A;  3FQW A;  4WJ5 A;  4ZAK A;  4X6E A;  3TJH A;  5EFI A;  1FFP A;  2X4U A;  5C09 A;  5C0D A;  3VFS A;  3TBY A;  3DX6 A;  3PWU A;  3CH1 A;  4L4V A;  4PRD A;  1AGE A;  3LV3 A;  3LKN A;  3ARB A;  3O3E A;  4JFE A;  4S0U C;  2RFX A;  1A1O A;  1GZQ A;  1VGK A;  2F54 A;  3W39 A;  5BRZ A;  4UQ3 A;  3QI9 A;  1ZAG A;  4HV8 A;  4MS8 A;  1ZHK A;  1XZ0 A;  4D0D A;  4MJI A;  4PRH A;  3V5D A;  2BVO A;  1T0N A;  3MRE A;  4PRP A;  1KPU A;  1LDP H;  5D2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...