4S0UC

Crystal structure of nkg2d in complex with ulbp6
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
DPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
total genus 48
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4s0uC00
3KPPA 4X6FA 3FFCA 3VXSA 5ENWA 5HHOA 5IVXA 3QULA 4U1JA 1KCGC 5EUOA 1QR1A 4ZUWA 3LN4A 4U1HA 2P5EA 2YPKA 4PR5A 2VE6A 3I6LD 4FFEX 3L9RA 4PRPA 2E7LE 3VRJA 4PP8C 1I7UA 4WU5A 5MEQA 1T1YA 3VRIA 1AGBA 2CLZA 3AU1A 3MRCA 3V5DA 4NNYA 5IEKA 4WWKC 5EU5A 5BRZA 3GSVA 3M1BA 1G6RH 1YN6A 3TVMA 1RJYA 3E2HA 4HUWA 3RUGA 4F7CA 4PJEA 4JFFA 3TBYA 3T8XA 3HUJA 3MR9A 3HPJA 4L8CA 4QRTA 1S8DA 3MRNA 4PRNA 3V5HA 2MHAA 1S7RA 5L2KA 4N0FA 2A83A 5IB3A 1ZS8A 1T1WA 5F1IA 1HHGA 3TN0A 3WS3A 3P4OA 4JQXA 1ZHBA 1A1OA 1AKJA 1RK0A 2JCCA 1JHTA 4PJ9A 1T80A 2GITA 1M05A 1ED3A 1T22A 5GSVA 3JTSA 1SYSA 4Y4HA 3P4NA 2GT9A 4LCWA 1T20A 2BSTA 4NO2A 2NX5A 3LKPA 4U1MA 3BH9A 3ILPA 1ZT7A 3PWUA 3RTQA 3MV9A 5BXFA 3D3VA 2Q7YA 3FT3A 2VLJA 5HGAA 1S7XA 4U1SA 4N5EA 4PG2A 3W39A 3L3HA 4U6XA 3VXOA 3D18A 1DE4A 3OV6A 3LKOA 1Z5LA 2AK4A 3GIVA 1T1XA 3PQYA 5C0EA 3QDJA 5MENA 3W0WA 5E8PA 4XXCA 5D5MA 4S0UC 1MHCA 4U1KA 5BS0A 2HJKA 1MHEA 4GKNA 5SWSA 3LV3A 5FDWA 3QUXA 2VAAA 3S6CA 3X11A 5GSRA 4F7PA 5IEHA 4PRBA 1I7RA 3CPLA 1HSAA 3JTTA 3KXFA 2BNRA 5IROA 3DMMA 4QRUA 3BP4A 5SWZA 3DX8A 3HE6A 2CLVA 4ZAKA 5MEOA 4LCYA 1FZKA 3PABA 4PV8A 5ISZA 1XR8A 4JFQA 4ZUTA 1QSEA 4NO3A 3TBTA 4APQA 4IHOA 3VH8A 1HHHA 4O2EA 1JE6A 3VFVA 3NFNA 3O8XA 3TA3A 3O4LA 4PG9A 1A9BA 4MX7A 1CD1A 4U1IA 3UTQA 3DBXA 1I1FA 1LQVA 3QUKA 4O2CA 1JGEA 3ARDA 2HJLA 2BVOA 4D0CA 4ZFZA 3O3EA 3P4MA 3UBXA 1LEKA 4G8GA 1C16A 4L3CA 3D25A 3MRJA 5HYJA 5HGHA 1N2RA 2XFXA 2ZSWA 3MRMA 1T0NA 1VGKA 4UQ2A 3VXRA 1ZVSA 5F1NA 1UXSA 5FA4A 3ES6A 3VFPA 3ARFA 1T7XA 1W72A 1T21A 4V3EB 3GMNA 3VFUA 1R3HA 1WBXA 2AV1A 2CLRA 3KPQA 3SDXA 5IB1A 3KPRA 4HS3A 5C07A 3BP7A 1OSZA 1FFNA 1I7TA 1QRNA 2X4QA 3FRUA 4CVZA 3FT4A 4PJ5A 1WBYA 1JF1A 1N3NA 1XH3A 3QFDA 4JFEA 5FA3A 5C0DA 4G42A 5B39A 1KPVA 5INDA 3WUWA 4NQVA 4FTVA 3TBSA 1NEZA 4IRJA 3FONA 1VACA 1KJ2H 3LKSA 5IB2A 4IIQC 4I4WA 3QUZA 4PRAA 2VLLA 3MRLA 4PRDA 2F54A 3SKMA 5C0IA 4MJ6A 4N0UA 4U1NA 4WO4A 1MWAH 3SKOA 3RWGA 1ONQA 1AO7A 3I6KA 4L8SC 1ZHNA 3ARGA 5E8OA 4D0BA 3WS6A 3ROOA 3MYJA 2X70A 3VFWA 2X4NA 2YPLA 3MRFA 2FO4A 3MRHA 3OXSA 3SDDA 4JFPA 4JFDA 2H6PA 3CDGA 4ZUVA 1DUYA 4PGDA 3RZCA 1B0GA 1AGDA 4O2FA 4Y2DA 1T7YA 3RGVC 3VJ6A 2ZOLA 3QUYA 3D2UA 3QZWA 3SDCA 3VFSA 3LN5A 3IXAA 1CE6A 2BVQA 3L3IA 1FZMA 3SCMA 2BVPA 4K7FA 1HHKA 1YDPA 3WLBA 4Y4KA 2ZOKA 3ECBA 1QEWA 5HHPA 3PWNA 3VFNA 2FZ3A 1AGCA 4QRQA 3QDMA 3HG1A 4UQ3A 1G7PA 3O3AA 2FWOA 4WDIA 2GAZA 3TBVA 3VCLA 3LKRA 4L8DA 1S7VA 2GTZA 1OGAA 1BIIA 1HHJA 3CH1A 3L3GA 3MGOA 3MA7A 1L8JA 3SDAA 3HAEA 3MRRA 2X4PA 2ZSVA 5IB4A 3UPRA 1QSFA 5EOTA 3V5KA 3E3QA 4EN3C 1GZPA 5J1AA 3TIEA 4I48A 2PO6A 1S9WA 4K71B 1QLFA 1I4FA 1QQDA 1VADA 3D39A 5J6HA 2PYEA 3KYOA 4PJIA 5ACZA 1LK2A 3MRBA 4QOKA 2FYYA 3JTCA 3MRPA 4GUPA 1I1YA 3TZVC 1AGEA 3RWDA 1BZ9A 2GJ6A 1FZOA 1OF2A 3DXAA 3CVHA 3BZFA 5DEGA 1INQA 1JFMA 3P77A 3BWAA 4PJ7A 3HLAA 1ZT4A 5C0JA 3L3DA 3CCHA 4HKJA 4NHUE 4HUUA 3QQ3A 4NO5A 4MS8A 3M17A 3PWJA 1CG9A 3ARBA 3GJFA 4L4VA 4PRHA 2BSRA 3CZFA 3MRKA 2GUOA 4MJIA 3KYNA 1X7QA 1U58A 4L29A 3VWKA 4NQCA 1T7WA 5D9SA 4PRIA 4PJDA 4NQDA 5MEPA 1TMCA 3VWJA 3L3JA 3MRIA 3FOMA 1RK1A 4PGEA 1YN7A 5C08A 2ESVA 1JPFA 3BEWA 3KPLA 3MV8A 3TIDA 3U0PA 1A6ZA 1ZHKA 1B3JA 3GMRA 3PWLA 3TFKA 5E9DA 5E00A 5EU3A 4NQXA 1HSBA 2GTWA 4PDCE 4N8VA 5H94A 3P9LA 2WY3A 1KTLA 5HHMA 3VXMA 4F7EA 3QDGA 1EFXA 4F7TA 5D2LA 4PJFA 4E0RA 4Z76A 5D2NA 1FFPA 3TJHA 4PJXA 3VXPA 4WUUA 4IRSA 1EEZA 1XR9A 1DUZA 1ZAGA 4MXQA 4PJAA 1RJZA 1DDHA 4MVBA 5HGBA 1GZQA 4MNGA 4Y16A 1UQSA 4JQVA 1T7VA 2F74A 3FQWA 3GMOA 4QRSA 3RWJA 1OGTA 1S7SA 3HCVA 4JFOA 3SPVA 5C0CA 4N0CA 3O9WA 5EO0A 4G8IA 1BQHA 3C8KA 2CKBH 1P1ZA 1PQZA 3BO8A 4CVXA 3KLAA 5INCA 1W0VA 5C9JA 3TF7A 3TO4A 4JRXA 3TBWA 2V2XA 3FQUA 3RL2A 3GSXA 3GMPA 4ONOA 1T0MA 4D0DA 4G43A 4MJ5A 1XZ0A 1A1NA 1BD2A 1SYVA 3E6FA 5FKPA 2P5WA 3DX7A 3X12A 3TPUE 5EFIA 4ELMA 5EO1A 2BCKA 5C09A 1P7QA 3GSWA 5DDHA 3VXUA 4U1LA 2AKRA 3BUYA 3BHBA 2C7UA 5D7JC 2HLAA 3GMQA 3UTSA 1Q94A 2OL3H 3B6SA 4EUPA 1JGDA 3RWFA 4HUXA 3T1FA 3PWVA 4NO0A 5HGDA 3RWCA 3VFTA 5C0BA 3QQ4A 4LHUA 4PV9A 1MI5A 1T7ZA 5HHQA 3H9SA 4QRRA 4MNQA 1IM9A 3UTTA 3KPNA 1LP9A 2X4UA 3QI9A 1QVOA 5C0FA 1S9XA 2F53A 4PGCA 1I1AA 1FFOA 1JUFA 3FQNA 3P73A 3VXNA 5MERA 3I6GA 1FZJA 3FQRA 3LKQA 4ZUSA 3O3DA 1B0RA 4X6CA 3REWA 4LNRA 3E6HA 1S7TA 1LD9A 3BXNA 2XPGA 3KPOA 3AREA 5B38A 3L3KA 1LEGA 2RFXA 2J8UA 3MRDA 4Z78A 3DTXA 1HHIA 3FQTA 3MGTA 5E8NA 5E6IC 2V2WA 4JRYA 3SJVA 3GSOA 2AXGA 1KJMA 2X4OA 2X4TA 3BGMA 3BZEA 3FQXA 3KPMA 5DEFA 3X14A 4MQ7A 1KPUA 2AV7A 4HUVA 4HX1A 1YPZA 3DX6A 4U6YA 3H9HA 4Z77A 3BEVA 3BH8A 4ZUUA 3GSUA 3O3BA 2CIIA 5C0AA 1ZHLA 4EI5A 3WL9A 1TVHA 1AGFA 3MV7A 4PJGA 1KJ3H 5BJTA 4HWZA 3HE7A 3ROLA 3VFMA 1T1ZA 3IT8D 3FTGA 3GSRA 1LDPH 1P4LA 1E27A 3GSNH 4L4TA 5F9JA 1QO3A 3QEQA 3CC5A 2VABA 4NQEA 4L8BA 2BNQA 1K8DA 3RWEA 3PWPA 3RL1A 1N5AA 5IM7A 1KJVA 3MRGA 1E28A 3OX8A 4HV8A 2X4SA 5SWQA 1W0WA 1IM3A 3RWIA 3OXRA 1S9YA 5J6GA 1FG2A 4G9DA 4WW2C 3G08A 4E5XA 2VLKA 3H7BA 1JPGA 3BVNA 3BW9A 4CW1A 1TVBA 5JHDA 4PJ8A 1G7QA 2UWEA 4L3EA 4X6EA 4G59A 3B3IA 4X6DA 4PGBA 4PREA 2AXFA 2BSSA 3TO2A 5D7LA 1EXUA 3C9NA 4WU7A 4Y4FA 1EEYA 3GMLA 1KBGH 3RWHA 4NSKA 4PJHA 4G9FA 5C0GA 1ZT1A 4WJ5A 5F7DA 3VFRA 1UXWA 3VFOA 5EU6A 1ZSDA 4PJBA 4GKSA 3X13A 2D31A 3FOLA 4L9LC 1M6OA 2HN7A 4NT6A 3MROA 1HYRC 3JVGA 1NAMH 3P9MA 2H26A 2OI9A 1WBZA 1A1MA 2CIKA 2VLRA 2DYPA 3LKNA 4NNXA 2FIKA 4LCCC 3GMMA 4PJCA 5EU4A 3ERYA 1S7UA 3QFJA 1KPRA 3MREA 4V3DB 1A9EA 1K5NA 3KPSA 5D7IA 3ILQC 5HHNA 5IB5A 5L2JA 1NANH 1FO0H 3KWWA 4F7MA 4QRPA 3GSQA 2YEZA 2NW3A 1HOCA 3AM8A 2X4RA 1N59A 3FT2A 1S7QA 5AD0A 3MRQA 1S7WA
chains in the Genus database with same CATH superfamily
3KPPA 4X6FA 3FFCA 3VXSA 5ENWA 5HHOA 5IVXA 3QULA 4U1JA 1KCGC 5EUOA 1QR1A 4ZUWA 3LN4A 4U1HA 2P5EA 2YPKA 4PR5A 2VE6A 3I6LD 4FFEX 3L9RA 4PRPA 2E7LE 3VRJA 4PP8C 1I7UA 4WU5A 5MEQA 1T1YA 3VRIA 1AGBA 2CLZA 3AU1A 3MRCA 3V5DA 4NNYA 5IEKA 4WWKC 5EU5A 5BRZA 3GSVA 3M1BA 1G6RH 1YN6A 3TVMA 1RJYA 3E2HA 4HUWA 3RUGA 4F7CA 4PJEA 4JFFA 3TBYA 3T8XA 3HUJA 3MR9A 3HPJA 4L8CA 4QRTA 1S8DA 3MRNA 4PRNA 3V5HA 2MHAA 1S7RA 5L2KA 4N0FA 2A83A 4BKWA 5IB3A 1ZS8A 1T1WA 5F1IA 1HHGA 3TN0A 3WS3A 3P4OA 4JQXA 1ZHBA 1A1OA 1AKJA 1RK0A 2JCCA 1JHTA 4PJ9A 1T80A 2GITA 1M05A 1ED3A 1T22A 5GSVA 3JTSA 1SYSA 4Y4HA 3P4NA 2GT9A 4LCWA 1T20A 2BSTA 4NO2A 2NX5A 3LKPA 4U1MA 3BH9A 3ILPA 1ZT7A 3PWUA 3RTQA 3MV9A 5BXFA 3D3VA 2Q7YA 3FT3A 2VLJA 5HGAA 1S7XA 4U1SA 4N5EA 4PG2A 3W39A 3L3HA 4U6XA 3VXOA 3D18A 1DE4A 3OV6A 3LKOA 1Z5LA 2AK4A 3GIVA 1T1XA 3PQYA 5C0EA 3QDJA 5MENA 3W0WA 5E8PA 4XXCA 5D5MA 4S0UC 1MHCA 4U1KA 5BS0A 2HJKA 1MHEA 4GKNA 5SWSA 3LV3A 5FDWA 3QUXA 2VAAA 3S6CA 4JO8A 3X11A 5GSRA 4F7PA 5IEHA 2O5NA 4PRBA 1I7RA 3CPLA 1HSAA 3JTTA 3KXFA 2BNRA 5IROA 3DMMA 4QRUA 3BP4A 5SWZA 3DX8A 3HE6A 2CLVA 4ZAKA 5MEOA 4LCYA 1FZKA 3PABA 4PV8A 5ISZA 1XR8A 4JFQA 4ZUTA 1QSEA 4NO3A 3TBTA 4APQA 2NYKA 4IHOA 3VH8A 1HHHA 4O2EA 1JE6A 3VFVA 3NFNA 3O8XA 3TA3A 3O4LA 4PG9A 1A9BA 4MX7A 1CD1A 4U1IA 3UTQA 3DBXA 1I1FA 1LQVA 3QUKA 4O2CA 1JGEA 3ARDA 2HJLA 2BVOA 4D0CA 4ZFZA 3O3EA 3P4MA 3UBXA 1LEKA 4G8GA 2IA1A 1C16A 4L3CA 3D25A 3MRJA 5HYJA 5HGHA 1N2RA 2XFXA 2ZSWA 3MRMA 1T0NA 1VGKA 4UQ2A 3VXRA 1ZVSA 5F1NA 1UXSA 5FA4A 3ES6A 3VFPA 3ARFA 1T7XA 1W72A 1T21A 4V3EB 3GMNA 3VFUA 1R3HA 1WBXA 2AV1A 2CLRA 3KPQA 3SDXA 5IB1A 3KPRA 4HS3A 5C07A 3BP7A 1OSZA 1FFNA 1I7TA 1QRNA 2X4QA 3FRUA 4CVZA 3FT4A 4PJ5A 1WBYA 1JF1A 1N3NA 1XH3A 3QFDA 4JFEA 5FA3A 5C0DA 4G42A 5B39A 1KPVA 5INDA 3WUWA 4NQVA 4FTVA 3TBSA 1NEZA 4IRJA 3FONA 1VACA 1KJ2H 3LKSA 5IB2A 4IIQC 4I4WA 3QUZA 4PRAA 2VLLA 3MRLA 4PRDA 2F54A 3SKMA 5C0IA 4MJ6A 4N0UA 4U1NA 4WO4A 1MWAH 3SKOA 3RWGA 1ONQA 1AO7A 3I6KA 4L8SC 1ZHNA 3ARGA 5E8OA 4D0BA 3WS6A 3ROOA 3MYJA 2X70A 3VFWA 2X4NA 2YPLA 3MRFA 2FO4A 3MRHA 3OXSA 3SDDA 4JFPA 4JFDA 2H6PA 3CDGA 4ZUVA 1DUYA 4PGDA 3RZCA 1B0GA 1AGDA 4O2FA 4Y2DA 1T7YA 3RGVC 3VJ6A 2ZOLA 3QUYA 3D2UA 3QZWA 3SDCA 3VFSA 3LN5A 3IXAA 1CE6A 2BVQA 3L3IA 1FZMA 3SCMA 2BVPA 4K7FA 1HHKA 1YDPA 3WLBA 4Y4KA 2ZOKA 3ECBA 1QEWA 5HHPA 3PWNA 3VFNA 2FZ3A 1AGCA 4QRQA 3QDMA 3HG1A 4UQ3A 1G7PA 3O3AA 2FWOA 4WDIA 2GAZA 3TBVA 3VCLA 3LKRA 4L8DA 1S7VA 2GTZA 1OGAA 1BIIA 1HHJA 3CH1A 3L3GA 3MGOA 3MA7A 1L8JA 3SDAA 3HAEA 3MRRA 2X4PA 2ZSVA 5IB4A 3UPRA 1QSFA 5EOTA 3V5KA 3E3QA 4EN3C 1GZPA 5J1AA 3TIEA 4I48A 2PO6A 1S9WA 4K71B 1QLFA 1I4FA 1QQDA 1VADA 3D39A 5J6HA 2PYEA 3KYOA 4PJIA 5ACZA 1LK2A 3MRBA 4QOKA 2FYYA 3JTCA 3MRPA 4GUPA 1I1YA 3TZVC 1AGEA 3RWDA 1BZ9A 2GJ6A 1FZOA 1OF2A 3DXAA 3CVHA 3BZFA 5DEGA 1INQA 1JFMA 3P77A 3BWAA 4PJ7A 3HLAA 1ZT4A 5C0JA 3L3DA 3CCHA 4HKJA 4NHUE 4HUUA 3QQ3A 4NO5A 4MS8A 3M17A 3PWJA 1CG9A 3ARBA 3GJFA 4L4VA 4PRHA 2BSRA 3CZFA 3MRKA 2GUOA 4MJIA 3KYNA 1X7QA 1U58A 4L29A 3VWKA 4NQCA 1T7WA 5D9SA 4PRIA 4PJDA 4NQDA 5MEPA 1TMCA 3VWJA 3L3JA 3MRIA 3FOMA 1RK1A 4PGEA 1YN7A 5C08A 2ESVA 1JPFA 3BEWA 3KPLA 3MV8A 3TIDA 3U0PA 1A6ZA 1ZHKA 1B3JA 3GMRA 3PWLA 3TFKA 5E9DA 5E00A 5EU3A 4NQXA 1HSBA 2GTWA 4PDCE 4N8VA 5H94A 3P9LA 2WY3A 1KTLA 5HHMA 3VXMA 4F7EA 3QDGA 1EFXA 4F7TA 5D2LA 4PJFA 4E0RA 4Z76A 5D2NA 1FFPA 3TJHA 4PJXA 3VXPA 4WUUA 4IRSA 1EEZA 1XR9A 1DUZA 1ZAGA 4MXQA 4PJAA 1RJZA 1DDHA 4MVBA 5HGBA 1GZQA 4MNGA 4Y16A 1UQSA 4JQVA 1T7VA 2F74A 3FQWA 3GMOA 4QRSA 3RWJA 1OGTA 1S7SA 3HCVA 4JFOA 3SPVA 5C0CA 4N0CA 3O9WA 5EO0A 4G8IA 1BQHA 3C8KA 2CKBH 1P1ZA 1PQZA 3BO8A 4CVXA 3KLAA 5INCA 1W0VA 5C9JA 3TF7A 3TO4A 4JRXA 3TBWA 2V2XA 3FQUA 3RL2A 3GSXA 3GMPA 4ONOA 1T0MA 4D0DA 4G43A 4MJ5A 1XZ0A 1A1NA 1BD2A 1SYVA 3E6FA 5FKPA 2P5WA 3DX7A 3X12A 3TPUE 5EFIA 4ELMA 5EO1A 2BCKA 5C09A 1P7QA 3GSWA 5DDHA 3VXUA 4U1LA 2AKRA 3BUYA 3BHBA 2C7UA 5D7JC 2HLAA 3GMQA 3UTSA 1Q94A 2OL3H 3B6SA 4EUPA 1JGDA 3RWFA 4HUXA 3T1FA 3PWVA 4NO0A 5HGDA 3RWCA 3VFTA 5C0BA 3QQ4A 4LHUA 4PV9A 1MI5A 1T7ZA 5HHQA 3H9SA 4QRRA 4MNQA 1IM9A 3UTTA 3KPNA 1LP9A 2X4UA 3QI9A 1QVOA 5C0FA 1S9XA 2F53A 4PGCA 1I1AA 1FFOA 1JUFA 3FQNA 3P73A 3VXNA 5MERA 3I6GA 1FZJA 3FQRA 3LKQA 4ZUSA 3O3DA 1B0RA 4X6CA 3REWA 4LNRA 3E6HA 1S7TA 1LD9A 3BXNA 2XPGA 3KPOA 3AREA 5B38A 3L3KA 1LEGA 2RFXA 2J8UA 3MRDA 4Z78A 3DTXA 1HHIA 3FQTA 3MGTA 5E8NA 5E6IC 2V2WA 4JRYA 3SJVA 3GSOA 2AXGA 1KJMA 2X4OA 2X4TA 3BGMA 3BZEA 3FQXA 3KPMA 5DEFA 3X14A 4MQ7A 1KPUA 2AV7A 4HUVA 4HX1A 1YPZA 3DX6A 4U6YA 3H9HA 3I0TA 4Z77A 3BEVA 3BH8A 4ZUUA 3GSUA 3O3BA 2CIIA 5C0AA 1ZHLA 4EI5A 4G59C 1TVHA 1AGFA 3MV7A 4PJGA 1KJ3H 3WL9A 5BJTA 4HWZA 3HE7A 3ROLA 3VFMA 1T1ZA 3IT8D 3FTGA 3GSRA 1LDPH 1P4LA 1E27A 3GSNH 4L4TA 5F9JA 1QO3A 3QEQA 3CC5A 2VABA 4NQEA 4L8BA 2BNQA 1K8DA 3RWEA 3PWPA 3RL1A 1N5AA 5IM7A 1KJVA 3MRGA 1E28A 3OX8A 4HV8A 2X4SA 5SWQA 1W0WA 1IM3A 3RWIA 3OXRA 1S9YA 5J6GA 1FG2A 4G9DA 4WW2C 3G08A 4E5XA 2VLKA 3H7BA 1JPGA 3BVNA 3BW9A 4CW1A 1TVBA 5JHDA 4PJ8A 1G7QA 2UWEA 4L3EA 4X6EA 4G59A 3B3IA 4X6DA 4PGBA 4PREA 2AXFA 2BSSA 3TO2A 5D7LA 1EXUA 3C9NA 4WU7A 4Y4FA 1EEYA 3GMLA 1KBGH 3RWHA 4NSKA 4PJHA 4G9FA 5C0GA 1ZT1A 4WJ5A 5F7DA 3VFRA 1UXWA 3VFOA 5EU6A 1ZSDA 4PJBA 4GKSA 3X13A 2D31A 3FOLA 4L9LC 1M6OA 2HN7A 4NT6A 3MROA 1HYRC 3JVGA 1NAMH 3P9MA 2H26A 2OI9A 1WBZA 1A1MA 2CIKA 2VLRA 2DYPA 3LKNA 4NNXA 2FIKA 4LCCC 3GMMA 4PJCA 5EU4A 3ERYA 1S7UA 3QFJA 1KPRA 3MREA 4V3DB 1A9EA 1K5NA 3KPSA 5D7IA 3ILQC 5HHNA 5IB5A 5L2JA 1NANH 1FO0H 3KWWA 4F7MA 4QRPA 3GSQA 2YEZA 2NW3A 1HOCA 3AM8A 2X4RA 1N59A 3FT2A 1S7QA 5AD0A 3MRQA 1S7WA
chains in the Genus database with same CATH topology
3KPPA 4X6FA 3FFCA 3VXSA 5ENWA 5HHOA 5IVXA 3QULA 4U1JA 1KCGC 5EUOA 1QR1A 4ZUWA 3LN4A 4U1HA 2P5EA 2YPKA 4PR5A 2VE6A 3I6LD 4FFEX 3L9RA 4PRPA 2E7LE 3VRJA 4PP8C 1I7UA 4WU5A 5MEQA 1T1YA 3VRIA 1AGBA 2CLZA 3AU1A 3MRCA 3V5DA 4NNYA 5IEKA 4WWKC 5EU5A 5BRZA 3GSVA 3M1BA 1G6RH 1YN6A 3TVMA 1RJYA 3E2HA 4HUWA 3RUGA 4F7CA 4PJEA 4JFFA 3TBYA 3T8XA 3HUJA 3MR9A 3HPJA 4L8CA 4QRTA 1S8DA 3MRNA 4PRNA 3V5HA 2MHAA 1S7RA 5L2KA 4N0FA 2A83A 5IB3A 1ZS8A 1T1WA 5F1IA 1HHGA 3TN0A 3WS3A 3P4OA 4JQXA 1ZHBA 1A1OA 1AKJA 1RK0A 2JCCA 1JHTA 4PJ9A 1T80A 2GITA 1M05A 1ED3A 1T22A 5GSVA 3JTSA 1SYSA 4Y4HA 3P4NA 2GT9A 4LCWA 1T20A 2BSTA 4NO2A 2NX5A 3LKPA 4U1MA 3BH9A 3ILPA 1ZT7A 3PWUA 3RTQA 3MV9A 5BXFA 3D3VA 2Q7YA 3FT3A 2VLJA 5HGAA 1S7XA 4U1SA 4N5EA 4PG2A 3W39A 3L3HA 4U6XA 3VXOA 3D18A 1DE4A 3OV6A 3LKOA 1Z5LA 2AK4A 3GIVA 1T1XA 3PQYA 5C0EA 3QDJA 5MENA 3W0WA 5E8PA 4XXCA 5D5MA 4S0UC 1MHCA 4U1KA 5BS0A 2HJKA 1MHEA 4GKNA 5SWSA 3LV3A 5FDWA 3QUXA 2VAAA 3S6CA 3X11A 5GSRA 4F7PA 5IEHA 4PRBA 1I7RA 3CPLA 1HSAA 3JTTA 3KXFA 2BNRA 5IROA 3DMMA 4QRUA 3BP4A 5SWZA 3DX8A 3HE6A 2CLVA 4ZAKA 5MEOA 4LCYA 1FZKA 3PABA 4PV8A 5ISZA 1XR8A 4JFQA 4ZUTA 1QSEA 4NO3A 3TBTA 4APQA 4IHOA 3VH8A 1HHHA 4O2EA 1JE6A 3VFVA 3NFNA 3O8XA 3TA3A 3O4LA 4PG9A 1A9BA 4MX7A 1CD1A 4U1IA 3UTQA 3DBXA 1I1FA 1LQVA 3QUKA 4O2CA 1JGEA 3ARDA 2HJLA 2BVOA 4D0CA 4ZFZA 3O3EA 3P4MA 3UBXA 1LEKA 4G8GA 1C16A 4L3CA 3D25A 3MRJA 5HYJA 5HGHA 1N2RA 2XFXA 2ZSWA 3MRMA 1T0NA 1VGKA 4UQ2A 3VXRA 1ZVSA 5F1NA 1UXSA 5FA4A 3ES6A 3VFPA 3ARFA 1T7XA 1W72A 1T21A 4V3EB 3GMNA 3VFUA 1R3HA 1WBXA 2AV1A 2CLRA 3KPQA 3SDXA 5IB1A 3KPRA 4HS3A 5C07A 3BP7A 1OSZA 1FFNA 1I7TA 1QRNA 2X4QA 3FRUA 4CVZA 3FT4A 4PJ5A 1WBYA 1JF1A 1N3NA 1XH3A 3QFDA 4JFEA 5FA3A 5C0DA 4G42A 5B39A 1KPVA 5INDA 3WUWA 4NQVA 4FTVA 3TBSA 1NEZA 4IRJA 3FONA 1VACA 1KJ2H 3LKSA 5IB2A 4IIQC 4I4WA 3QUZA 4PRAA 2VLLA 3MRLA 4PRDA 2F54A 3SKMA 5C0IA 4MJ6A 4N0UA 4U1NA 4WO4A 1MWAH 3SKOA 3RWGA 1ONQA 1AO7A 3I6KA 4L8SC 1ZHNA 3ARGA 5E8OA 4D0BA 3WS6A 3ROOA 3MYJA 2X70A 3VFWA 2X4NA 2YPLA 3MRFA 2FO4A 3MRHA 3OXSA 3SDDA 4JFPA 4JFDA 2H6PA 3CDGA 4ZUVA 1DUYA 4PGDA 3RZCA 1B0GA 1AGDA 4O2FA 4Y2DA 1T7YA 3RGVC 3VJ6A 2ZOLA 3QUYA 3D2UA 3QZWA 3SDCA 3VFSA 3LN5A 3IXAA 1CE6A 2BVQA 3L3IA 1FZMA 3SCMA 2BVPA 4K7FA 1HHKA 1YDPA 3WLBA 4Y4KA 2ZOKA 3ECBA 1QEWA 5HHPA 3PWNA 3VFNA 2FZ3A 1AGCA 4QRQA 3QDMA 3HG1A 4UQ3A 1G7PA 3O3AA 2FWOA 4WDIA 2GAZA 3TBVA 3VCLA 3LKRA 4L8DA 1S7VA 2GTZA 1OGAA 1BIIA 1HHJA 3CH1A 3L3GA 3MGOA 3MA7A 1L8JA 3SDAA 3HAEA 3MRRA 2X4PA 2ZSVA 5IB4A 3UPRA 1QSFA 5EOTA 3V5KA 3E3QA 4EN3C 1GZPA 5J1AA 3TIEA 4I48A 2PO6A 1S9WA 4K71B 1QLFA 1I4FA 1QQDA 1VADA 3D39A 5J6HA 2PYEA 3KYOA 4PJIA 5ACZA 1LK2A 3MRBA 4QOKA 2FYYA 3JTCA 3MRPA 4GUPA 1I1YA 3TZVC 1AGEA 3RWDA 1BZ9A 2GJ6A 1FZOA 1OF2A 3DXAA 3CVHA 3BZFA 5DEGA 1INQA 1JFMA 3P77A 3BWAA 4PJ7A 3HLAA 1ZT4A 5C0JA 3L3DA 3CCHA 4HKJA 4NHUE 4HUUA 3QQ3A 4NO5A 4MS8A 3M17A 3PWJA 1CG9A 3ARBA 3GJFA 4L4VA 4PRHA 2BSRA 3CZFA 3MRKA 2GUOA 4MJIA 3KYNA 1X7QA 1U58A 4L29A 3VWKA 4NQCA 1T7WA 5D9SA 4PRIA 4PJDA 4NQDA 5MEPA 1TMCA 3VWJA 3L3JA 3MRIA 3FOMA 1RK1A 4PGEA 1YN7A 5C08A 2ESVA 1JPFA 3BEWA 3KPLA 3MV8A 3TIDA 3U0PA 1A6ZA 1ZHKA 1B3JA 3GMRA 3PWLA 3TFKA 5E9DA 5E00A 5EU3A 4NQXA 1HSBA 2GTWA 4PDCE 4N8VA 5H94A 3P9LA 2WY3A 1KTLA 5HHMA 3VXMA 4F7EA 3QDGA 1EFXA 4F7TA 5D2LA 4PJFA 4E0RA 4Z76A 5D2NA 1FFPA 3TJHA 4PJXA 3VXPA 4WUUA 4IRSA 1EEZA 1XR9A 1DUZA 1ZAGA 4MXQA 4PJAA 1RJZA 1DDHA 4MVBA 5HGBA 1GZQA 4MNGA 4Y16A 1UQSA 4JQVA 1T7VA 2F74A 3FQWA 3GMOA 4QRSA 3RWJA 1OGTA 1S7SA 3HCVA 4JFOA 3SPVA 5C0CA 4N0CA 3O9WA 5EO0A 4G8IA 1BQHA 3C8KA 2CKBH 1P1ZA 1PQZA 3BO8A 4CVXA 3KLAA 5INCA 1W0VA 5C9JA 3TF7A 3TO4A 4JRXA 3TBWA 2V2XA 3FQUA 3RL2A 3GSXA 3GMPA 4ONOA 1T0MA 4D0DA 4G43A 4MJ5A 1XZ0A 1A1NA 1BD2A 1SYVA 3E6FA 5FKPA 2P5WA 3DX7A 3X12A 3TPUE 5EFIA 4ELMA 5EO1A 2BCKA 5C09A 1P7QA 3GSWA 5DDHA 3VXUA 4U1LA 2AKRA 3BUYA 3BHBA 2C7UA 5D7JC 2HLAA 3GMQA 3UTSA 1Q94A 2OL3H 3B6SA 4EUPA 1JGDA 3RWFA 4HUXA 3T1FA 3PWVA 4NO0A 5HGDA 3RWCA 3VFTA 5C0BA 3QQ4A 4LHUA 4PV9A 1MI5A 1T7ZA 5HHQA 3H9SA 4QRRA 4MNQA 1IM9A 3UTTA 3KPNA 1LP9A 2X4UA 3QI9A 1QVOA 5C0FA 1S9XA 2F53A 4PGCA 1I1AA 1FFOA 1JUFA 3FQNA 3P73A 3VXNA 5MERA 3I6GA 1FZJA 3FQRA 3LKQA 4ZUSA 3O3DA 1B0RA 4X6CA 3REWA 4LNRA 3E6HA 1S7TA 1LD9A 3BXNA 2XPGA 3KPOA 3AREA 5B38A 3L3KA 1LEGA 2RFXA 2J8UA 3MRDA 4Z78A 3DTXA 1HHIA 3FQTA 3MGTA 5E8NA 5E6IC 2V2WA 4JRYA 3SJVA 3GSOA 2AXGA 1KJMA 2X4OA 2X4TA 3BGMA 3BZEA 3FQXA 3KPMA 5DEFA 3X14A 4MQ7A 1KPUA 2AV7A 4HUVA 4HX1A 1YPZA 3DX6A 4U6YA 3H9HA 4Z77A 3BEVA 3BH8A 4ZUUA 3GSUA 3O3BA 2CIIA 5C0AA 1ZHLA 4EI5A 3WL9A 1TVHA 1AGFA 3MV7A 4PJGA 1KJ3H 5BJTA 4HWZA 3HE7A 3ROLA 3VFMA 1T1ZA 3IT8D 3FTGA 3GSRA 1LDPH 1P4LA 1E27A 3GSNH 4L4TA 5F9JA 1QO3A 3QEQA 3CC5A 2VABA 4NQEA 4L8BA 2BNQA 1K8DA 3RWEA 3PWPA 3RL1A 1N5AA 5IM7A 1KJVA 3MRGA 1E28A 3OX8A 4HV8A 2X4SA 5SWQA 1W0WA 1IM3A 3RWIA 3OXRA 1S9YA 5J6GA 1FG2A 4G9DA 4WW2C 3G08A 4E5XA 2VLKA 3H7BA 1JPGA 3BVNA 3BW9A 4CW1A 1TVBA 5JHDA 4PJ8A 1G7QA 2UWEA 4L3EA 4X6EA 4G59A 3B3IA 4X6DA 4PGBA 4PREA 2AXFA 2BSSA 3TO2A 5D7LA 1EXUA 3C9NA 4WU7A 4Y4FA 1EEYA 3GMLA 1KBGH 3RWHA 4NSKA 4PJHA 4G9FA 5C0GA 1ZT1A 4WJ5A 5F7DA 3VFRA 1UXWA 3VFOA 5EU6A 1ZSDA 4PJBA 4GKSA 3X13A 2D31A 3FOLA 4L9LC 1M6OA 2HN7A 4NT6A 3MROA 1HYRC 3JVGA 1NAMH 3P9MA 2H26A 2OI9A 1WBZA 1A1MA 2CIKA 2VLRA 2DYPA 3LKNA 4NNXA 2FIKA 4LCCC 3GMMA 4PJCA 5EU4A 3ERYA 1S7UA 3QFJA 1KPRA 3MREA 4V3DB 1A9EA 1K5NA 3KPSA 5D7IA 3ILQC 5HHNA 5IB5A 5L2JA 1NANH 1FO0H 3KWWA 4F7MA 4QRPA 3GSQA 2YEZA 2NW3A 1HOCA 3AM8A 2X4RA 1N59A 3FT2A 1S7QA 5AD0A 3MRQA 1S7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPP A;  4X6F A;  3FFC A;  3VXS A;  5ENW A;  5HHO A;  5IVX A;  3QUL A;  4U1J A;  1KCG C;  5EUO A;  1QR1 A;  4ZUW A;  3LN4 A;  4U1H A;  2P5E A;  2YPK A;  4PR5 A;  2VE6 A;  3I6L D;  4FFE X;  3L9R A;  4PRP A;  2E7L E;  3VRJ A;  4PP8 C;  1I7U A;  4WU5 A;  5MEQ A;  1T1Y A;  3VRI A;  1AGB A;  2CLZ A;  3AU1 A;  3MRC A;  3V5D A;  4NNY A;  5IEK A;  4WWK C;  5EU5 A;  5BRZ A;  3GSV A;  3M1B A;  1G6R H;  1YN6 A;  3TVM A;  1RJY A;  3E2H A;  4HUW A;  3RUG A;  4F7C A;  4PJE A;  4JFF A;  3TBY A;  3T8X A;  3HUJ A;  3MR9 A;  3HPJ A;  4L8C A;  4QRT A;  1S8D A;  3MRN A;  4PRN A;  3V5H A;  2MHA A;  1S7R A;  5L2K A;  4N0F A;  2A83 A;  5IB3 A;  1ZS8 A;  1T1W A;  5F1I A;  1HHG A;  3TN0 A;  3WS3 A;  3P4O A;  4JQX A;  1ZHB A;  1A1O A;  1AKJ A;  1RK0 A;  2JCC A;  1JHT A;  4PJ9 A;  1T80 A;  2GIT A;  1M05 A;  1ED3 A;  1T22 A;  5GSV A;  3JTS A;  1SYS A;  4Y4H A;  3P4N A;  2GT9 A;  4LCW A;  1T20 A;  2BST A;  4NO2 A;  2NX5 A;  3LKP A;  4U1M A;  3BH9 A;  3ILP A;  1ZT7 A;  3PWU A;  3RTQ A;  3MV9 A;  5BXF A;  3D3V A;  2Q7Y A;  3FT3 A;  2VLJ A;  5HGA A;  1S7X A;  4U1S A;  4N5E A;  4PG2 A;  3W39 A;  3L3H A;  4U6X A;  3VXO A;  3D18 A;  1DE4 A;  3OV6 A;  3LKO A;  1Z5L A;  2AK4 A;  3GIV A;  1T1X A;  3PQY A;  5C0E A;  3QDJ A;  5MEN A;  3W0W A;  5E8P A;  4XXC A;  5D5M A;  4S0U C;  1MHC A;  4U1K A;  5BS0 A;  2HJK A;  1MHE A;  4GKN A;  5SWS A;  3LV3 A;  5FDW A;  3QUX A;  2VAA A;  3S6C A;  3X11 A;  5GSR A;  4F7P A;  5IEH A;  4PRB A;  1I7R A;  3CPL A;  1HSA A;  3JTT A;  3KXF A;  2BNR A;  5IRO A;  3DMM A;  4QRU A;  3BP4 A;  5SWZ A;  3DX8 A;  3HE6 A;  2CLV A;  4ZAK A;  5MEO A;  4LCY A;  1FZK A;  3PAB A;  4PV8 A;  5ISZ A;  1XR8 A;  4JFQ A;  4ZUT A;  1QSE A;  4NO3 A;  3TBT A;  4APQ A;  4IHO A;  3VH8 A;  1HHH A;  4O2E A;  1JE6 A;  3VFV A;  3NFN A;  3O8X A;  3TA3 A;  3O4L A;  4PG9 A;  1A9B A;  4MX7 A;  1CD1 A;  4U1I A;  3UTQ A;  3DBX A;  1I1F A;  1LQV A;  3QUK A;  4O2C A;  1JGE A;  3ARD A;  2HJL A;  2BVO A;  4D0C A;  4ZFZ A;  3O3E A;  3P4M A;  3UBX A;  1LEK A;  4G8G A;  1C16 A;  4L3C A;  3D25 A;  3MRJ A;  5HYJ A;  5HGH A;  1N2R A;  2XFX A;  2ZSW A;  3MRM A;  1T0N A;  1VGK A;  4UQ2 A;  3VXR A;  1ZVS A;  5F1N A;  1UXS A;  5FA4 A;  3ES6 A;  3VFP A;  3ARF A;  1T7X A;  1W72 A;  1T21 A;  4V3E B;  3GMN A;  3VFU A;  1R3H A;  1WBX A;  2AV1 A;  2CLR A;  3KPQ A;  3SDX A;  5IB1 A;  3KPR A;  4HS3 A;  5C07 A;  3BP7 A;  1OSZ A;  1FFN A;  1I7T A;  1QRN A;  2X4Q A;  3FRU A;  4CVZ A;  3FT4 A;  4PJ5 A;  1WBY A;  1JF1 A;  1N3N A;  1XH3 A;  3QFD A;  4JFE A;  5FA3 A;  5C0D A;  4G42 A;  5B39 A;  1KPV A;  5IND A;  3WUW A;  4NQV A;  4FTV A;  3TBS A;  1NEZ A;  4IRJ A;  3FON A;  1VAC A;  1KJ2 H;  3LKS A;  5IB2 A;  4IIQ C;  4I4W A;  3QUZ A;  4PRA A;  2VLL A;  3MRL A;  4PRD A;  2F54 A;  3SKM A;  5C0I A;  4MJ6 A;  4N0U A;  4U1N A;  4WO4 A;  1MWA H;  3SKO A;  3RWG A;  1ONQ A;  1AO7 A;  3I6K A;  4L8S C;  1ZHN A;  3ARG A;  5E8O A;  4D0B A;  3WS6 A;  3ROO A;  3MYJ A;  2X70 A;  3VFW A;  2X4N A;  2YPL A;  3MRF A;  2FO4 A;  3MRH A;  3OXS A;  3SDD A;  4JFP A;  4JFD A;  2H6P A;  3CDG A;  4ZUV A;  1DUY A;  4PGD A;  3RZC A;  1B0G A;  1AGD A;  4O2F A;  4Y2D A;  1T7Y A;  3RGV C;  3VJ6 A;  2ZOL A;  3QUY A;  3D2U A;  3QZW A;  3SDC A;  3VFS A;  3LN5 A;  3IXA A;  1CE6 A;  2BVQ A;  3L3I A;  1FZM A;  3SCM A;  2BVP A;  4K7F A;  1HHK A;  1YDP A;  3WLB A;  4Y4K A;  2ZOK A;  3ECB A;  1QEW A;  5HHP A;  3PWN A;  3VFN A;  2FZ3 A;  1AGC A;  4QRQ A;  3QDM A;  3HG1 A;  4UQ3 A;  1G7P A;  3O3A A;  2FWO A;  4WDI A;  2GAZ A;  3TBV A;  3VCL A;  3LKR A;  4L8D A;  1S7V A;  2GTZ A;  1OGA A;  1BII A;  1HHJ A;  3CH1 A;  3L3G A;  3MGO A;  3MA7 A;  1L8J A;  3SDA A;  3HAE A;  3MRR A;  2X4P A;  2ZSV A;  5IB4 A;  3UPR A;  1QSF A;  5EOT A;  3V5K A;  3E3Q A;  4EN3 C;  1GZP A;  5J1A A;  3TIE A;  4I48 A;  2PO6 A;  1S9W A;  4K71 B;  1QLF A;  1I4F A;  1QQD A;  1VAD A;  3D39 A;  5J6H A;  2PYE A;  3KYO A;  4PJI A;  5ACZ A;  1LK2 A;  3MRB A;  4QOK A;  2FYY A;  3JTC A;  3MRP A;  4GUP A;  1I1Y A;  3TZV C;  1AGE A;  3RWD A;  1BZ9 A;  2GJ6 A;  1FZO A;  1OF2 A;  3DXA A;  3CVH A;  3BZF A;  5DEG A;  1INQ A;  1JFM A;  3P77 A;  3BWA A;  4PJ7 A;  3HLA A;  1ZT4 A;  5C0J A;  3L3D A;  3CCH A;  4HKJ A;  4NHU E;  4HUU A;  3QQ3 A;  4NO5 A;  4MS8 A;  3M17 A;  3PWJ A;  1CG9 A;  3ARB A;  3GJF A;  4L4V A;  4PRH A;  2BSR A;  3CZF A;  3MRK A;  2GUO A;  4MJI A;  3KYN A;  1X7Q A;  1U58 A;  4L29 A;  3VWK A;  4NQC A;  1T7W A;  5D9S A;  4PRI A;  4PJD A;  4NQD A;  5MEP A;  1TMC A;  3VWJ A;  3L3J A;  3MRI A;  3FOM A;  1RK1 A;  4PGE A;  1YN7 A;  5C08 A;  2ESV A;  1JPF A;  3BEW A;  3KPL A;  3MV8 A;  3TID A;  3U0P A;  1A6Z A;  1ZHK A;  1B3J A;  3GMR A;  3PWL A;  3TFK A;  5E9D A;  5E00 A;  5EU3 A;  4NQX A;  1HSB A;  2GTW A;  4PDC E;  4N8V A;  5H94 A;  3P9L A;  2WY3 A;  1KTL A;  5HHM A;  3VXM A;  4F7E A;  3QDG A;  1EFX A;  4F7T A;  5D2L A;  4PJF A;  4E0R A;  4Z76 A;  5D2N A;  1FFP A;  3TJH A;  4PJX A;  3VXP A;  4WUU A;  4IRS A;  1EEZ A;  1XR9 A;  1DUZ A;  1ZAG A;  4MXQ A;  4PJA A;  1RJZ A;  1DDH A;  4MVB A;  5HGB A;  1GZQ A;  4MNG A;  4Y16 A;  1UQS A;  4JQV A;  1T7V A;  2F74 A;  3FQW A;  3GMO A;  4QRS A;  3RWJ A;  1OGT A;  1S7S A;  3HCV A;  4JFO A;  3SPV A;  5C0C A;  4N0C A;  3O9W A;  5EO0 A;  4G8I A;  1BQH A;  3C8K A;  2CKB H;  1P1Z A;  1PQZ A;  3BO8 A;  4CVX A;  3KLA A;  5INC A;  1W0V A;  5C9J A;  3TF7 A;  3TO4 A;  4JRX A;  3TBW A;  2V2X A;  3FQU A;  3RL2 A;  3GSX A;  3GMP A;  4ONO A;  1T0M A;  4D0D A;  4G43 A;  4MJ5 A;  1XZ0 A;  1A1N A;  1BD2 A;  1SYV A;  3E6F A;  5FKP A;  2P5W A;  3DX7 A;  3X12 A;  3TPU E;  5EFI A;  4ELM A;  5EO1 A;  2BCK A;  5C09 A;  1P7Q A;  3GSW A;  5DDH A;  3VXU A;  4U1L A;  2AKR A;  3BUY A;  3BHB A;  2C7U A;  5D7J C;  2HLA A;  3GMQ A;  3UTS A;  1Q94 A;  2OL3 H;  3B6S A;  4EUP A;  1JGD A;  3RWF A;  4HUX A;  3T1F A;  3PWV A;  4NO0 A;  5HGD A;  3RWC A;  3VFT A;  5C0B A;  3QQ4 A;  4LHU A;  4PV9 A;  1MI5 A;  1T7Z A;  5HHQ A;  3H9S A;  4QRR A;  4MNQ A;  1IM9 A;  3UTT A;  3KPN A;  1LP9 A;  2X4U A;  3QI9 A;  1QVO A;  5C0F A;  1S9X A;  2F53 A;  4PGC A;  1I1A A;  1FFO A;  1JUF A;  3FQN A;  3P73 A;  3VXN A;  5MER A;  3I6G A;  1FZJ A;  3FQR A;  3LKQ A;  4ZUS A;  3O3D A;  1B0R A;  4X6C A;  3REW A;  4LNR A;  3E6H A;  1S7T A;  1LD9 A;  3BXN A;  2XPG A;  3KPO A;  3ARE A;  5B38 A;  3L3K A;  1LEG A;  2RFX A;  2J8U A;  3MRD A;  4Z78 A;  3DTX A;  1HHI A;  3FQT A;  3MGT A;  5E8N A;  5E6I C;  2V2W A;  4JRY A;  3SJV A;  3GSO A;  2AXG A;  1KJM A;  2X4O A;  2X4T A;  3BGM A;  3BZE A;  3FQX A;  3KPM A;  5DEF A;  3X14 A;  4MQ7 A;  1KPU A;  2AV7 A;  4HUV A;  4HX1 A;  1YPZ A;  3DX6 A;  4U6Y A;  3H9H A;  4Z77 A;  3BEV A;  3BH8 A;  4ZUU A;  3GSU A;  3O3B A;  2CII A;  5C0A A;  1ZHL A;  4EI5 A;  3WL9 A;  1TVH A;  1AGF A;  3MV7 A;  4PJG A;  1KJ3 H;  5BJT A;  4HWZ A;  3HE7 A;  3ROL A;  3VFM A;  1T1Z A;  3IT8 D;  3FTG A;  3GSR A;  1LDP H;  1P4L A;  1E27 A;  3GSN H;  4L4T A;  5F9J A;  1QO3 A;  3QEQ A;  3CC5 A;  2VAB A;  4NQE A;  4L8B A;  2BNQ A;  1K8D A;  3RWE A;  3PWP A;  3RL1 A;  1N5A A;  5IM7 A;  1KJV A;  3MRG A;  1E28 A;  3OX8 A;  4HV8 A;  2X4S A;  5SWQ A;  1W0W A;  1IM3 A;  3RWI A;  3OXR A;  1S9Y A;  5J6G A;  1FG2 A;  4G9D A;  4WW2 C;  3G08 A;  4E5X A;  2VLK A;  3H7B A;  1JPG A;  3BVN A;  3BW9 A;  4CW1 A;  1TVB A;  5JHD A;  4PJ8 A;  1G7Q A;  2UWE A;  4L3E A;  4X6E A;  4G59 A;  3B3I A;  4X6D A;  4PGB A;  4PRE A;  2AXF A;  2BSS A;  3TO2 A;  5D7L A;  1EXU A;  3C9N A;  4WU7 A;  4Y4F A;  1EEY A;  3GML A;  1KBG H;  3RWH A;  4NSK A;  4PJH A;  4G9F A;  5C0G A;  1ZT1 A;  4WJ5 A;  5F7D A;  3VFR A;  1UXW A;  3VFO A;  5EU6 A;  1ZSD A;  4PJB A;  4GKS A;  3X13 A;  2D31 A;  3FOL A;  4L9L C;  1M6O A;  2HN7 A;  4NT6 A;  3MRO A;  1HYR C;  3JVG A;  1NAM H;  3P9M A;  2H26 A;  2OI9 A;  1WBZ A;  1A1M A;  2CIK A;  2VLR A;  2DYP A;  3LKN A;  4NNX A;  2FIK A;  4LCC C;  3GMM A;  4PJC A;  5EU4 A;  3ERY A;  1S7U A;  3QFJ A;  1KPR A;  3MRE A;  4V3D B;  1A9E A;  1K5N A;  3KPS A;  5D7I A;  3ILQ C;  5HHN A;  5IB5 A;  5L2J A;  1NAN H;  1FO0 H;  3KWW A;  4F7M A;  4QRP A;  3GSQ A;  2YEZ A;  2NW3 A;  1HOC A;  3AM8 A;  2X4R A;  1N59 A;  3FT2 A;  1S7Q A;  5AD0 A;  3MRQ A;  1S7W A; 
#chains in the Genus database with same CATH topology
 3KPP A;  4X6F A;  3FFC A;  3VXS A;  5ENW A;  5HHO A;  5IVX A;  3QUL A;  4U1J A;  1KCG C;  5EUO A;  1QR1 A;  4ZUW A;  3LN4 A;  4U1H A;  2P5E A;  2YPK A;  4PR5 A;  2VE6 A;  3I6L D;  4FFE X;  3L9R A;  4PRP A;  2E7L E;  3VRJ A;  4PP8 C;  1I7U A;  4WU5 A;  5MEQ A;  1T1Y A;  3VRI A;  1AGB A;  2CLZ A;  3AU1 A;  3MRC A;  3V5D A;  4NNY A;  5IEK A;  4WWK C;  5EU5 A;  5BRZ A;  3GSV A;  3M1B A;  1G6R H;  1YN6 A;  3TVM A;  1RJY A;  3E2H A;  4HUW A;  3RUG A;  4F7C A;  4PJE A;  4JFF A;  3TBY A;  3T8X A;  3HUJ A;  3MR9 A;  3HPJ A;  4L8C A;  4QRT A;  1S8D A;  3MRN A;  4PRN A;  3V5H A;  2MHA A;  1S7R A;  5L2K A;  4N0F A;  2A83 A;  4BKW A;  5IB3 A;  1ZS8 A;  1T1W A;  5F1I A;  1HHG A;  3TN0 A;  3WS3 A;  3P4O A;  4JQX A;  1ZHB A;  1A1O A;  1AKJ A;  1RK0 A;  2JCC A;  1JHT A;  4PJ9 A;  1T80 A;  2GIT A;  1M05 A;  1ED3 A;  1T22 A;  5GSV A;  3JTS A;  1SYS A;  4Y4H A;  3P4N A;  2GT9 A;  4LCW A;  1T20 A;  2BST A;  4NO2 A;  2NX5 A;  3LKP A;  4U1M A;  3BH9 A;  3ILP A;  1ZT7 A;  3PWU A;  3RTQ A;  3MV9 A;  5BXF A;  3D3V A;  2Q7Y A;  3FT3 A;  2VLJ A;  5HGA A;  1S7X A;  4U1S A;  4N5E A;  4PG2 A;  3W39 A;  3L3H A;  4U6X A;  3VXO A;  3D18 A;  1DE4 A;  3OV6 A;  3LKO A;  1Z5L A;  2AK4 A;  3GIV A;  1T1X A;  3PQY A;  5C0E A;  3QDJ A;  5MEN A;  3W0W A;  5E8P A;  4XXC A;  5D5M A;  4S0U C;  1MHC A;  4U1K A;  5BS0 A;  2HJK A;  1MHE A;  4GKN A;  5SWS A;  3LV3 A;  5FDW A;  3QUX A;  2VAA A;  3S6C A;  4JO8 A;  3X11 A;  5GSR A;  4F7P A;  5IEH A;  2O5N A;  4PRB A;  1I7R A;  3CPL A;  1HSA A;  3JTT A;  3KXF A;  2BNR A;  5IRO A;  3DMM A;  4QRU A;  3BP4 A;  5SWZ A;  3DX8 A;  3HE6 A;  2CLV A;  4ZAK A;  5MEO A;  4LCY A;  1FZK A;  3PAB A;  4PV8 A;  5ISZ A;  1XR8 A;  4JFQ A;  4ZUT A;  1QSE A;  4NO3 A;  3TBT A;  4APQ A;  2NYK A;  4IHO A;  3VH8 A;  1HHH A;  4O2E A;  1JE6 A;  3VFV A;  3NFN A;  3O8X A;  3TA3 A;  3O4L A;  4PG9 A;  1A9B A;  4MX7 A;  1CD1 A;  4U1I A;  3UTQ A;  3DBX A;  1I1F A;  1LQV A;  3QUK A;  4O2C A;  1JGE A;  3ARD A;  2HJL A;  2BVO A;  4D0C A;  4ZFZ A;  3O3E A;  3P4M A;  3UBX A;  1LEK A;  4G8G A;  2IA1 A;  1C16 A;  4L3C A;  3D25 A;  3MRJ A;  5HYJ A;  5HGH A;  1N2R A;  2XFX A;  2ZSW A;  3MRM A;  1T0N A;  1VGK A;  4UQ2 A;  3VXR A;  1ZVS A;  5F1N A;  1UXS A;  5FA4 A;  3ES6 A;  3VFP A;  3ARF A;  1T7X A;  1W72 A;  1T21 A;  4V3E B;  3GMN A;  3VFU A;  1R3H A;  1WBX A;  2AV1 A;  2CLR A;  3KPQ A;  3SDX A;  5IB1 A;  3KPR A;  4HS3 A;  5C07 A;  3BP7 A;  1OSZ A;  1FFN A;  1I7T A;  1QRN A;  2X4Q A;  3FRU A;  4CVZ A;  3FT4 A;  4PJ5 A;  1WBY A;  1JF1 A;  1N3N A;  1XH3 A;  3QFD A;  4JFE A;  5FA3 A;  5C0D A;  4G42 A;  5B39 A;  1KPV A;  5IND A;  3WUW A;  4NQV A;  4FTV A;  3TBS A;  1NEZ A;  4IRJ A;  3FON A;  1VAC A;  1KJ2 H;  3LKS A;  5IB2 A;  4IIQ C;  4I4W A;  3QUZ A;  4PRA A;  2VLL A;  3MRL A;  4PRD A;  2F54 A;  3SKM A;  5C0I A;  4MJ6 A;  4N0U A;  4U1N A;  4WO4 A;  1MWA H;  3SKO A;  3RWG A;  1ONQ A;  1AO7 A;  3I6K A;  4L8S C;  1ZHN A;  3ARG A;  5E8O A;  4D0B A;  3WS6 A;  3ROO A;  3MYJ A;  2X70 A;  3VFW A;  2X4N A;  2YPL A;  3MRF A;  2FO4 A;  3MRH A;  3OXS A;  3SDD A;  4JFP A;  4JFD A;  2H6P A;  3CDG A;  4ZUV A;  1DUY A;  4PGD A;  3RZC A;  1B0G A;  1AGD A;  4O2F A;  4Y2D A;  1T7Y A;  3RGV C;  3VJ6 A;  2ZOL A;  3QUY A;  3D2U A;  3QZW A;  3SDC A;  3VFS A;  3LN5 A;  3IXA A;  1CE6 A;  2BVQ A;  3L3I A;  1FZM A;  3SCM A;  2BVP A;  4K7F A;  1HHK A;  1YDP A;  3WLB A;  4Y4K A;  2ZOK A;  3ECB A;  1QEW A;  5HHP A;  3PWN A;  3VFN A;  2FZ3 A;  1AGC A;  4QRQ A;  3QDM A;  3HG1 A;  4UQ3 A;  1G7P A;  3O3A A;  2FWO A;  4WDI A;  2GAZ A;  3TBV A;  3VCL A;  3LKR A;  4L8D A;  1S7V A;  2GTZ A;  1OGA A;  1BII A;  1HHJ A;  3CH1 A;  3L3G A;  3MGO A;  3MA7 A;  1L8J A;  3SDA A;  3HAE A;  3MRR A;  2X4P A;  2ZSV A;  5IB4 A;  3UPR A;  1QSF A;  5EOT A;  3V5K A;  3E3Q A;  4EN3 C;  1GZP A;  5J1A A;  3TIE A;  4I48 A;  2PO6 A;  1S9W A;  4K71 B;  1QLF A;  1I4F A;  1QQD A;  1VAD A;  3D39 A;  5J6H A;  2PYE A;  3KYO A;  4PJI A;  5ACZ A;  1LK2 A;  3MRB A;  4QOK A;  2FYY A;  3JTC A;  3MRP A;  4GUP A;  1I1Y A;  3TZV C;  1AGE A;  3RWD A;  1BZ9 A;  2GJ6 A;  1FZO A;  1OF2 A;  3DXA A;  3CVH A;  3BZF A;  5DEG A;  1INQ A;  1JFM A;  3P77 A;  3BWA A;  4PJ7 A;  3HLA A;  1ZT4 A;  5C0J A;  3L3D A;  3CCH A;  4HKJ A;  4NHU E;  4HUU A;  3QQ3 A;  4NO5 A;  4MS8 A;  3M17 A;  3PWJ A;  1CG9 A;  3ARB A;  3GJF A;  4L4V A;  4PRH A;  2BSR A;  3CZF A;  3MRK A;  2GUO A;  4MJI A;  3KYN A;  1X7Q A;  1U58 A;  4L29 A;  3VWK A;  4NQC A;  1T7W A;  5D9S A;  4PRI A;  4PJD A;  4NQD A;  5MEP A;  1TMC A;  3VWJ A;  3L3J A;  3MRI A;  3FOM A;  1RK1 A;  4PGE A;  1YN7 A;  5C08 A;  2ESV A;  1JPF A;  3BEW A;  3KPL A;  3MV8 A;  3TID A;  3U0P A;  1A6Z A;  1ZHK A;  1B3J A;  3GMR A;  3PWL A;  3TFK A;  5E9D A;  5E00 A;  5EU3 A;  4NQX A;  1HSB A;  2GTW A;  4PDC E;  4N8V A;  5H94 A;  3P9L A;  2WY3 A;  1KTL A;  5HHM A;  3VXM A;  4F7E A;  3QDG A;  1EFX A;  4F7T A;  5D2L A;  4PJF A;  4E0R A;  4Z76 A;  5D2N A;  1FFP A;  3TJH A;  4PJX A;  3VXP A;  4WUU A;  4IRS A;  1EEZ A;  1XR9 A;  1DUZ A;  1ZAG A;  4MXQ A;  4PJA A;  1RJZ A;  1DDH A;  4MVB A;  5HGB A;  1GZQ A;  4MNG A;  4Y16 A;  1UQS A;  4JQV A;  1T7V A;  2F74 A;  3FQW A;  3GMO A;  4QRS A;  3RWJ A;  1OGT A;  1S7S A;  3HCV A;  4JFO A;  3SPV A;  5C0C A;  4N0C A;  3O9W A;  5EO0 A;  4G8I A;  1BQH A;  3C8K A;  2CKB H;  1P1Z A;  1PQZ A;  3BO8 A;  4CVX A;  3KLA A;  5INC A;  1W0V A;  5C9J A;  3TF7 A;  3TO4 A;  4JRX A;  3TBW A;  2V2X A;  3FQU A;  3RL2 A;  3GSX A;  3GMP A;  4ONO A;  1T0M A;  4D0D A;  4G43 A;  4MJ5 A;  1XZ0 A;  1A1N A;  1BD2 A;  1SYV A;  3E6F A;  5FKP A;  2P5W A;  3DX7 A;  3X12 A;  3TPU E;  5EFI A;  4ELM A;  5EO1 A;  2BCK A;  5C09 A;  1P7Q A;  3GSW A;  5DDH A;  3VXU A;  4U1L A;  2AKR A;  3BUY A;  3BHB A;  2C7U A;  5D7J C;  2HLA A;  3GMQ A;  3UTS A;  1Q94 A;  2OL3 H;  3B6S A;  4EUP A;  1JGD A;  3RWF A;  4HUX A;  3T1F A;  3PWV A;  4NO0 A;  5HGD A;  3RWC A;  3VFT A;  5C0B A;  3QQ4 A;  4LHU A;  4PV9 A;  1MI5 A;  1T7Z A;  5HHQ A;  3H9S A;  4QRR A;  4MNQ A;  1IM9 A;  3UTT A;  3KPN A;  1LP9 A;  2X4U A;  3QI9 A;  1QVO A;  5C0F A;  1S9X A;  2F53 A;  4PGC A;  1I1A A;  1FFO A;  1JUF A;  3FQN A;  3P73 A;  3VXN A;  5MER A;  3I6G A;  1FZJ A;  3FQR A;  3LKQ A;  4ZUS A;  3O3D A;  1B0R A;  4X6C A;  3REW A;  4LNR A;  3E6H A;  1S7T A;  1LD9 A;  3BXN A;  2XPG A;  3KPO A;  3ARE A;  5B38 A;  3L3K A;  1LEG A;  2RFX A;  2J8U A;  3MRD A;  4Z78 A;  3DTX A;  1HHI A;  3FQT A;  3MGT A;  5E8N A;  5E6I C;  2V2W A;  4JRY A;  3SJV A;  3GSO A;  2AXG A;  1KJM A;  2X4O A;  2X4T A;  3BGM A;  3BZE A;  3FQX A;  3KPM A;  5DEF A;  3X14 A;  4MQ7 A;  1KPU A;  2AV7 A;  4HUV A;  4HX1 A;  1YPZ A;  3DX6 A;  4U6Y A;  3H9H A;  3I0T A;  4Z77 A;  3BEV A;  3BH8 A;  4ZUU A;  3GSU A;  3O3B A;  2CII A;  5C0A A;  1ZHL A;  4EI5 A;  4G59 C;  1TVH A;  1AGF A;  3MV7 A;  4PJG A;  1KJ3 H;  3WL9 A;  5BJT A;  4HWZ A;  3HE7 A;  3ROL A;  3VFM A;  1T1Z A;  3IT8 D;  3FTG A;  3GSR A;  1LDP H;  1P4L A;  1E27 A;  3GSN H;  4L4T A;  5F9J A;  1QO3 A;  3QEQ A;  3CC5 A;  2VAB A;  4NQE A;  4L8B A;  2BNQ A;  1K8D A;  3RWE A;  3PWP A;  3RL1 A;  1N5A A;  5IM7 A;  1KJV A;  3MRG A;  1E28 A;  3OX8 A;  4HV8 A;  2X4S A;  5SWQ A;  1W0W A;  1IM3 A;  3RWI A;  3OXR A;  1S9Y A;  5J6G A;  1FG2 A;  4G9D A;  4WW2 C;  3G08 A;  4E5X A;  2VLK A;  3H7B A;  1JPG A;  3BVN A;  3BW9 A;  4CW1 A;  1TVB A;  5JHD A;  4PJ8 A;  1G7Q A;  2UWE A;  4L3E A;  4X6E A;  4G59 A;  3B3I A;  4X6D A;  4PGB A;  4PRE A;  2AXF A;  2BSS A;  3TO2 A;  5D7L A;  1EXU A;  3C9N A;  4WU7 A;  4Y4F A;  1EEY A;  3GML A;  1KBG H;  3RWH A;  4NSK A;  4PJH A;  4G9F A;  5C0G A;  1ZT1 A;  4WJ5 A;  5F7D A;  3VFR A;  1UXW A;  3VFO A;  5EU6 A;  1ZSD A;  4PJB A;  4GKS A;  3X13 A;  2D31 A;  3FOL A;  4L9L C;  1M6O A;  2HN7 A;  4NT6 A;  3MRO A;  1HYR C;  3JVG A;  1NAM H;  3P9M A;  2H26 A;  2OI9 A;  1WBZ A;  1A1M A;  2CIK A;  2VLR A;  2DYP A;  3LKN A;  4NNX A;  2FIK A;  4LCC C;  3GMM A;  4PJC A;  5EU4 A;  3ERY A;  1S7U A;  3QFJ A;  1KPR A;  3MRE A;  4V3D B;  1A9E A;  1K5N A;  3KPS A;  5D7I A;  3ILQ C;  5HHN A;  5IB5 A;  5L2J A;  1NAN H;  1FO0 H;  3KWW A;  4F7M A;  4QRP A;  3GSQ A;  2YEZ A;  2NW3 A;  1HOC A;  3AM8 A;  2X4R A;  1N59 A;  3FT2 A;  1S7Q A;  5AD0 A;  3MRQ A;  1S7W A; 
#chains in the Genus database with same CATH homology
 3KPP A;  4X6F A;  3FFC A;  3VXS A;  5ENW A;  5HHO A;  5IVX A;  3QUL A;  4U1J A;  1KCG C;  5EUO A;  1QR1 A;  4ZUW A;  3LN4 A;  4U1H A;  2P5E A;  2YPK A;  4PR5 A;  2VE6 A;  3I6L D;  4FFE X;  3L9R A;  4PRP A;  2E7L E;  3VRJ A;  4PP8 C;  1I7U A;  4WU5 A;  5MEQ A;  1T1Y A;  3VRI A;  1AGB A;  2CLZ A;  3AU1 A;  3MRC A;  3V5D A;  4NNY A;  5IEK A;  4WWK C;  5EU5 A;  5BRZ A;  3GSV A;  3M1B A;  1G6R H;  1YN6 A;  3TVM A;  1RJY A;  3E2H A;  4HUW A;  3RUG A;  4F7C A;  4PJE A;  4JFF A;  3TBY A;  3T8X A;  3HUJ A;  3MR9 A;  3HPJ A;  4L8C A;  4QRT A;  1S8D A;  3MRN A;  4PRN A;  3V5H A;  2MHA A;  1S7R A;  5L2K A;  4N0F A;  2A83 A;  5IB3 A;  1ZS8 A;  1T1W A;  5F1I A;  1HHG A;  3TN0 A;  3WS3 A;  3P4O A;  4JQX A;  1ZHB A;  1A1O A;  1AKJ A;  1RK0 A;  2JCC A;  1JHT A;  4PJ9 A;  1T80 A;  2GIT A;  1M05 A;  1ED3 A;  1T22 A;  5GSV A;  3JTS A;  1SYS A;  4Y4H A;  3P4N A;  2GT9 A;  4LCW A;  1T20 A;  2BST A;  4NO2 A;  2NX5 A;  3LKP A;  4U1M A;  3BH9 A;  3ILP A;  1ZT7 A;  3PWU A;  3RTQ A;  3MV9 A;  5BXF A;  3D3V A;  2Q7Y A;  3FT3 A;  2VLJ A;  5HGA A;  1S7X A;  4U1S A;  4N5E A;  4PG2 A;  3W39 A;  3L3H A;  4U6X A;  3VXO A;  3D18 A;  1DE4 A;  3OV6 A;  3LKO A;  1Z5L A;  2AK4 A;  3GIV A;  1T1X A;  3PQY A;  5C0E A;  3QDJ A;  5MEN A;  3W0W A;  5E8P A;  4XXC A;  5D5M A;  4S0U C;  1MHC A;  4U1K A;  5BS0 A;  2HJK A;  1MHE A;  4GKN A;  5SWS A;  3LV3 A;  5FDW A;  3QUX A;  2VAA A;  3S6C A;  3X11 A;  5GSR A;  4F7P A;  5IEH A;  4PRB A;  1I7R A;  3CPL A;  1HSA A;  3JTT A;  3KXF A;  2BNR A;  5IRO A;  3DMM A;  4QRU A;  3BP4 A;  5SWZ A;  3DX8 A;  3HE6 A;  2CLV A;  4ZAK A;  5MEO A;  4LCY A;  1FZK A;  3PAB A;  4PV8 A;  5ISZ A;  1XR8 A;  4JFQ A;  4ZUT A;  1QSE A;  4NO3 A;  3TBT A;  4APQ A;  4IHO A;  3VH8 A;  1HHH A;  4O2E A;  1JE6 A;  3VFV A;  3NFN A;  3O8X A;  3TA3 A;  3O4L A;  4PG9 A;  1A9B A;  4MX7 A;  1CD1 A;  4U1I A;  3UTQ A;  3DBX A;  1I1F A;  1LQV A;  3QUK A;  4O2C A;  1JGE A;  3ARD A;  2HJL A;  2BVO A;  4D0C A;  4ZFZ A;  3O3E A;  3P4M A;  3UBX A;  1LEK A;  4G8G A;  1C16 A;  4L3C A;  3D25 A;  3MRJ A;  5HYJ A;  5HGH A;  1N2R A;  2XFX A;  2ZSW A;  3MRM A;  1T0N A;  1VGK A;  4UQ2 A;  3VXR A;  1ZVS A;  5F1N A;  1UXS A;  5FA4 A;  3ES6 A;  3VFP A;  3ARF A;  1T7X A;  1W72 A;  1T21 A;  4V3E B;  3GMN A;  3VFU A;  1R3H A;  1WBX A;  2AV1 A;  2CLR A;  3KPQ A;  3SDX A;  5IB1 A;  3KPR A;  4HS3 A;  5C07 A;  3BP7 A;  1OSZ A;  1FFN A;  1I7T A;  1QRN A;  2X4Q A;  3FRU A;  4CVZ A;  3FT4 A;  4PJ5 A;  1WBY A;  1JF1 A;  1N3N A;  1XH3 A;  3QFD A;  4JFE A;  5FA3 A;  5C0D A;  4G42 A;  5B39 A;  1KPV A;  5IND A;  3WUW A;  4NQV A;  4FTV A;  3TBS A;  1NEZ A;  4IRJ A;  3FON A;  1VAC A;  1KJ2 H;  3LKS A;  5IB2 A;  4IIQ C;  4I4W A;  3QUZ A;  4PRA A;  2VLL A;  3MRL A;  4PRD A;  2F54 A;  3SKM A;  5C0I A;  4MJ6 A;  4N0U A;  4U1N A;  4WO4 A;  1MWA H;  3SKO A;  3RWG A;  1ONQ A;  1AO7 A;  3I6K A;  4L8S C;  1ZHN A;  3ARG A;  5E8O A;  4D0B A;  3WS6 A;  3ROO A;  3MYJ A;  2X70 A;  3VFW A;  2X4N A;  2YPL A;  3MRF A;  2FO4 A;  3MRH A;  3OXS A;  3SDD A;  4JFP A;  4JFD A;  2H6P A;  3CDG A;  4ZUV A;  1DUY A;  4PGD A;  3RZC A;  1B0G A;  1AGD A;  4O2F A;  4Y2D A;  1T7Y A;  3RGV C;  3VJ6 A;  2ZOL A;  3QUY A;  3D2U A;  3QZW A;  3SDC A;  3VFS A;  3LN5 A;  3IXA A;  1CE6 A;  2BVQ A;  3L3I A;  1FZM A;  3SCM A;  2BVP A;  4K7F A;  1HHK A;  1YDP A;  3WLB A;  4Y4K A;  2ZOK A;  3ECB A;  1QEW A;  5HHP A;  3PWN A;  3VFN A;  2FZ3 A;  1AGC A;  4QRQ A;  3QDM A;  3HG1 A;  4UQ3 A;  1G7P A;  3O3A A;  2FWO A;  4WDI A;  2GAZ A;  3TBV A;  3VCL A;  3LKR A;  4L8D A;  1S7V A;  2GTZ A;  1OGA A;  1BII A;  1HHJ A;  3CH1 A;  3L3G A;  3MGO A;  3MA7 A;  1L8J A;  3SDA A;  3HAE A;  3MRR A;  2X4P A;  2ZSV A;  5IB4 A;  3UPR A;  1QSF A;  5EOT A;  3V5K A;  3E3Q A;  4EN3 C;  1GZP A;  5J1A A;  3TIE A;  4I48 A;  2PO6 A;  1S9W A;  4K71 B;  1QLF A;  1I4F A;  1QQD A;  1VAD A;  3D39 A;  5J6H A;  2PYE A;  3KYO A;  4PJI A;  5ACZ A;  1LK2 A;  3MRB A;  4QOK A;  2FYY A;  3JTC A;  3MRP A;  4GUP A;  1I1Y A;  3TZV C;  1AGE A;  3RWD A;  1BZ9 A;  2GJ6 A;  1FZO A;  1OF2 A;  3DXA A;  3CVH A;  3BZF A;  5DEG A;  1INQ A;  1JFM A;  3P77 A;  3BWA A;  4PJ7 A;  3HLA A;  1ZT4 A;  5C0J A;  3L3D A;  3CCH A;  4HKJ A;  4NHU E;  4HUU A;  3QQ3 A;  4NO5 A;  4MS8 A;  3M17 A;  3PWJ A;  1CG9 A;  3ARB A;  3GJF A;  4L4V A;  4PRH A;  2BSR A;  3CZF A;  3MRK A;  2GUO A;  4MJI A;  3KYN A;  1X7Q A;  1U58 A;  4L29 A;  3VWK A;  4NQC A;  1T7W A;  5D9S A;  4PRI A;  4PJD A;  4NQD A;  5MEP A;  1TMC A;  3VWJ A;  3L3J A;  3MRI A;  3FOM A;  1RK1 A;  4PGE A;  1YN7 A;  5C08 A;  2ESV A;  1JPF A;  3BEW A;  3KPL A;  3MV8 A;  3TID A;  3U0P A;  1A6Z A;  1ZHK A;  1B3J A;  3GMR A;  3PWL A;  3TFK A;  5E9D A;  5E00 A;  5EU3 A;  4NQX A;  1HSB A;  2GTW A;  4PDC E;  4N8V A;  5H94 A;  3P9L A;  2WY3 A;  1KTL A;  5HHM A;  3VXM A;  4F7E A;  3QDG A;  1EFX A;  4F7T A;  5D2L A;  4PJF A;  4E0R A;  4Z76 A;  5D2N A;  1FFP A;  3TJH A;  4PJX A;  3VXP A;  4WUU A;  4IRS A;  1EEZ A;  1XR9 A;  1DUZ A;  1ZAG A;  4MXQ A;  4PJA A;  1RJZ A;  1DDH A;  4MVB A;  5HGB A;  1GZQ A;  4MNG A;  4Y16 A;  1UQS A;  4JQV A;  1T7V A;  2F74 A;  3FQW A;  3GMO A;  4QRS A;  3RWJ A;  1OGT A;  1S7S A;  3HCV A;  4JFO A;  3SPV A;  5C0C A;  4N0C A;  3O9W A;  5EO0 A;  4G8I A;  1BQH A;  3C8K A;  2CKB H;  1P1Z A;  1PQZ A;  3BO8 A;  4CVX A;  3KLA A;  5INC A;  1W0V A;  5C9J A;  3TF7 A;  3TO4 A;  4JRX A;  3TBW A;  2V2X A;  3FQU A;  3RL2 A;  3GSX A;  3GMP A;  4ONO A;  1T0M A;  4D0D A;  4G43 A;  4MJ5 A;  1XZ0 A;  1A1N A;  1BD2 A;  1SYV A;  3E6F A;  5FKP A;  2P5W A;  3DX7 A;  3X12 A;  3TPU E;  5EFI A;  4ELM A;  5EO1 A;  2BCK A;  5C09 A;  1P7Q A;  3GSW A;  5DDH A;  3VXU A;  4U1L A;  2AKR A;  3BUY A;  3BHB A;  2C7U A;  5D7J C;  2HLA A;  3GMQ A;  3UTS A;  1Q94 A;  2OL3 H;  3B6S A;  4EUP A;  1JGD A;  3RWF A;  4HUX A;  3T1F A;  3PWV A;  4NO0 A;  5HGD A;  3RWC A;  3VFT A;  5C0B A;  3QQ4 A;  4LHU A;  4PV9 A;  1MI5 A;  1T7Z A;  5HHQ A;  3H9S A;  4QRR A;  4MNQ A;  1IM9 A;  3UTT A;  3KPN A;  1LP9 A;  2X4U A;  3QI9 A;  1QVO A;  5C0F A;  1S9X A;  2F53 A;  4PGC A;  1I1A A;  1FFO A;  1JUF A;  3FQN A;  3P73 A;  3VXN A;  5MER A;  3I6G A;  1FZJ A;  3FQR A;  3LKQ A;  4ZUS A;  3O3D A;  1B0R A;  4X6C A;  3REW A;  4LNR A;  3E6H A;  1S7T A;  1LD9 A;  3BXN A;  2XPG A;  3KPO A;  3ARE A;  5B38 A;  3L3K A;  1LEG A;  2RFX A;  2J8U A;  3MRD A;  4Z78 A;  3DTX A;  1HHI A;  3FQT A;  3MGT A;  5E8N A;  5E6I C;  2V2W A;  4JRY A;  3SJV A;  3GSO A;  2AXG A;  1KJM A;  2X4O A;  2X4T A;  3BGM A;  3BZE A;  3FQX A;  3KPM A;  5DEF A;  3X14 A;  4MQ7 A;  1KPU A;  2AV7 A;  4HUV A;  4HX1 A;  1YPZ A;  3DX6 A;  4U6Y A;  3H9H A;  4Z77 A;  3BEV A;  3BH8 A;  4ZUU A;  3GSU A;  3O3B A;  2CII A;  5C0A A;  1ZHL A;  4EI5 A;  3WL9 A;  1TVH A;  1AGF A;  3MV7 A;  4PJG A;  1KJ3 H;  5BJT A;  4HWZ A;  3HE7 A;  3ROL A;  3VFM A;  1T1Z A;  3IT8 D;  3FTG A;  3GSR A;  1LDP H;  1P4L A;  1E27 A;  3GSN H;  4L4T A;  5F9J A;  1QO3 A;  3QEQ A;  3CC5 A;  2VAB A;  4NQE A;  4L8B A;  2BNQ A;  1K8D A;  3RWE A;  3PWP A;  3RL1 A;  1N5A A;  5IM7 A;  1KJV A;  3MRG A;  1E28 A;  3OX8 A;  4HV8 A;  2X4S A;  5SWQ A;  1W0W A;  1IM3 A;  3RWI A;  3OXR A;  1S9Y A;  5J6G A;  1FG2 A;  4G9D A;  4WW2 C;  3G08 A;  4E5X A;  2VLK A;  3H7B A;  1JPG A;  3BVN A;  3BW9 A;  4CW1 A;  1TVB A;  5JHD A;  4PJ8 A;  1G7Q A;  2UWE A;  4L3E A;  4X6E A;  4G59 A;  3B3I A;  4X6D A;  4PGB A;  4PRE A;  2AXF A;  2BSS A;  3TO2 A;  5D7L A;  1EXU A;  3C9N A;  4WU7 A;  4Y4F A;  1EEY A;  3GML A;  1KBG H;  3RWH A;  4NSK A;  4PJH A;  4G9F A;  5C0G A;  1ZT1 A;  4WJ5 A;  5F7D A;  3VFR A;  1UXW A;  3VFO A;  5EU6 A;  1ZSD A;  4PJB A;  4GKS A;  3X13 A;  2D31 A;  3FOL A;  4L9L C;  1M6O A;  2HN7 A;  4NT6 A;  3MRO A;  1HYR C;  3JVG A;  1NAM H;  3P9M A;  2H26 A;  2OI9 A;  1WBZ A;  1A1M A;  2CIK A;  2VLR A;  2DYP A;  3LKN A;  4NNX A;  2FIK A;  4LCC C;  3GMM A;  4PJC A;  5EU4 A;  3ERY A;  1S7U A;  3QFJ A;  1KPR A;  3MRE A;  4V3D B;  1A9E A;  1K5N A;  3KPS A;  5D7I A;  3ILQ C;  5HHN A;  5IB5 A;  5L2J A;  1NAN H;  1FO0 H;  3KWW A;  4F7M A;  4QRP A;  3GSQ A;  2YEZ A;  2NW3 A;  1HOC A;  3AM8 A;  2X4R A;  1N59 A;  3FT2 A;  1S7Q A;  5AD0 A;  3MRQ A;  1S7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...