3TN0A

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
293
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 70
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tn0A01
1ACZA 1BVKB 3DYOA 3LKQB 5KVDL 2DQHH 1XIWA 4R3SB 1RZ8A 4WJ5B 3O45B 3NIGE 4Z0XA 2X1QA 4AEIH 3SKNB 4X4ZA 1QFHA 3AROA 4UBDC 4Y4FA 4CJ0A 3BPCA 3OXSA 3ARFD 5F1IB 4QGTA 4KH2A 2I07A 4Y8DC 1C16A 1IM3B 4HUVA 3W0WE 3O3UN 3K80A 1CDIA 5GZND 3K8KA 3PWPD 4NNYB 4YUEH 4Q7DA 2JJTA 4XHJD 1GPOH 2IANE 3CFDA 4HKZB 1MI5B 5IMKA 4B7IA 2DKSA 2IPKB 1L6ZA 1N5AA 4P2QD 1EZVX 2ATPB 3VWJD 4YQXL 2HMID 2DS4A 3DSNA 3WLBB 5E94A 1VSCA 1OAQH 2NZ9D 4MAYB 2BDNH 1PSKL 1QSVA 2R1XB 3ZKNC 1YN6A 3T04D 5EC2B 2R15A 4K23L 3C09B 1PLGH 5DC9B 5KVMC 3BH8B 2QKIA 3LMJH 5FM5M 4PREB 4Q6IC 1F02I 1X7QB 1QFWL 1N6QH 1CGWA 1G7IA 3MLWH 1H3TA 4FFWD 1MJUL 1UC6A 4HMEA 2DQFA 4N9GB 3BQUB 5DD0L 2JB6A 4OT1H 5JIPA 3JV4A 5I1LA 1RZKH 1JI1A 3LS5H 1EJOH 4P4KC 1AGDA 4JVWA 3C5ZC 3MRDA 3EO9H 2GEEA 1E28A 4NQCD 3AXLB 4PJCB 3QCVL 1OLLA 1F4YH 1CQKA 3FQWB 3DO7A 3HE7D 2RQ8A 1HQRB 4OTXH 1F4HA 2LQRA 3MUJA 4JJ5B 4FZEL 4OUUB 1EBAA 2ZPKL 5EIQA 4BH8B 5IW6A 4WI9A 5K9KB 2AV7A 2G5BA 2PO6C 3FZUD 4ZAKA 1R3IL 1RPQA 2Z9TA 1W0VA 2K3TA 1S9VB 5C0BB 2OJEB 1A1MA 3MV7D 4BQ9A 5HDLA 5CZKA 4JFOA 5IWLA 1DBAH 5T5FH 2Y5TB 3V5DA 4RAVB 3L6FB 4OI8A 2MCPL 4R97B 3ROLA 2HT4C 3IVKA 3RPIA 2QQLL 1OW0C 1S5HB 3SN6N 2OR9H 4JKKA 1A14H 1DBJH 3BPNC 5FHAH 3MJ9H 4Z7WA 1OGTB 1F42A 4WWKD 5KSBF 5HHMB 2P8MA 3BAEL 4G42B 4L4TE 4YDVB 3SDAB 2Y23A 4HWBL 1E4KC 4MX7A 2NX5E 3QULA 2IAND 5INDB 4XH2B 1G9NL 4NGHH 5EUOA 2DI8A 2A6JA 3MRKA 4H1LB 4KI5D 3VRJB 4ELKB 2DQGH 4UV7H 3NPZB 2UV3A 3HLAA 2CIIB 2GCYB 5DMIH 4QO1A 5K33A 3GMMB 5CSZA 1HH9A 3T4YB 4F8TA 2WV3A 4A6YA 4HIIB 3WV0A 4HKJA 6FABH 5CJOL 4UILH 5BVPL 3WFBH 4KKCC 1IVLA 3IAQA 4KVNL 4MA3B 4P46C 4FQ2H 1NC2A 5IJKC 4PREA 5ACLA 1JPSL 3HMXL 3QDGD 1B6DA 4QRTA 5EUKB 1IFHL 3NIDE 5GGSA 1T21A 3BPCB 3I85A 5JHLH 1AH1A 4BA8A 4Z76A 1IGYB 1SY6A 4QTIH 1TTUA 4Q9CA 4LLUB 5CJBA 3MC0A 3V4VH 3ILQC 4PJGB 1IC4H 1KB5H 1PKQE 4YH6A 2FECI 1FC2D 3RI5F 3VH8A 4MCZB 4PRHD 4WO4B 4N8VB 1MCOL 4C56B 4ELMF 1BBJA 4KK6C 3FQTA 3OJDB 3KNBB 5CCKL 4UIMA 1DVFA 3VXMA 2KDGA 5EU3A 1TJIH 3QG6A 5J11C 2OR8A 1XGYH 3NCMA 1FFNB 2OYPA 4IOIA 3PL6A 4N90D 5M94B 3U46B 5D1ZB 5JA9A 1ZWIA 4I2XA 5F21B 4F58L 4EUPA 3Q2CA 3LDBC 4GFTB 4M43L 4NWTH 1AY1H 1OAUH 5KG9B 3EYVA 2NXZB 3VDCA 4K71B 1TVHA 4X5WB 4ZUSB 5JUEH 5FA3B 2PXYB 3CSBA 4KHXL 3CMGA 5DRZA 4PGEA 4PJGE 5DJ2A 2VZUA 4GKZA 5ANMB 1IRAY 4Y19A 4M6NL 3PGFL 3KPOB 2PXYC 1UWEL 3QRFM 4F8QA 5LGKA 1RZKL 5DD5H 4D9QE 4E42B 2GTWB 5D1QC 2VLRB 3RNKB 1NEUA 3BIKB 3DOSA 4Y88A 3FRUA 4JRXA 4D3CH 3D48R 2V2XB 3CH8A 4OUUA 1IQDA 3GJFB 4GQ9H 1TNMA 3OPZH 3HZYB 5IF0B 1WBXB 3ARZA 3B2VH 4OZGE 1KG0A 2VQTA 4JR9H 4LL9A 5EZJA 4XVJH 1MY5A 2OJZH 3FT4B 5DTFA 4ACPA 4LF3A 4TSCL 1VEOA 2CDGB 5EA0L 2WLYA 2BFVL 5FYJU 1RUPH 4G6ML 1NANH 2YD6A 1E6JL 3NCBB 2DOCA 2ZOLA 3OB0H 4R2GB 1KFAH 1A0QL 2O5XL 2VNCA 3ULVL 4XCFL 5IK3A 5CS7A 1GPOL 2FJHA 1SVZA 4ZD3L 1MCPL 4NQEA 1CE6B 1FBIL 2IJ0C 1FFNA 2D7TH 3KJ4C 1M1SA 4OFVA 1AO7E 1D6VL 4GRLC 4FTVA 5B4MC 2MOVA 2PYFB 3UX9B 4E41A 4EDWL 4AM0B 43CAB 3R06A 4TNWK 3VFNA 4LCIH 3SO3B 3RIAK 1TVHB 2VITA 3VXQA 1TNNA 1IGFL 3MLZL 1F8TL 1UADC 4JHBA 4WHYH 2I9TA 1D5IH 3VXNA 2P5WD 1G6RH 1I1AB 3HCVA 3VFTB 5KSAB 4JJHA 3MV7B 4U6VL 1NGWA 2VWEC 1S3KL 1NFIA 4R4FL 3TV3H 5D96B 2R2BB 5TDOA 1QUNA 3QJHA 4TSBL 5E08L 1B9ZA 5DMGC 3TESA 1JHLH 3E6FA 3MRLA 5I8CA 5DO2D 3G08B 4MA1C 4P2OC 2C3VB 3N1MC 5CEZL 1FZKB 4OZGF 3SDDD 3EFFA 2OSLB 2FJFB 3LHPL 2KPNA 3WE6B 5L9DH 1CDHA 4ZFOA 3VH8B 1WUNT 1FL3A 4JLRA 2B0SH 1V7MH 3SE4C 1NEZB 3D39B 1XGRB 3HMXH 3BGAA 3L3HB 1ZEAL 4LSTL 4H0IA 1EXUA 1ACYL 2AGJH 1P9MA 1EHNA 1FNSL 1H5BC 3UPRB 3LV3B 2D7QA 1RK0B 5CGTA 4QLRA 1M7DA 2DJ4A 1FG2A 4JDVB 2WBWB 2MWCA 3HFMH 3GNML 2BVPB 1OVZA 1DDHA 1MFCH 4PLJC 1YNKL 4JG1H 1ZLSL 1RHHB 5B3JF 5C07B 5DJYB 4NRYB 4FQHA 3WFEL 5E2UH 1IAOB 2XPGB 4R26H 3ZYOA 3LDBB 2HFEB 4LSVL 2XQBL 3CVHH 4Y7MA 3LVEA 3ARQA 1AY1L 1HNFA 3LD8C 5KS9B 4HGKC 5EO0A 2NXZC 5F7EH 4YUEL 1LK3L 4MA8L 1R3LA 1JZ8A 1HHIA 3TGXA 2EDQA 1OP3H 3M07A 2WBJD 1P7QB 2QTEA 1S7TB 4NC1C 3RTQD 4PIRF 3ARXA 4PGBA 3BVNB 5ADPL 4X9HA 4OB5H 1TETH 2X4RA 1JBJA 4N0CD 4ODBD 1A3RL 3K74B 3LRGA 5CJ5A 5FV2A 1BAFH 1QYGH 1G9NC 1S9YA 2B4CH 4TNVF 4K94H 3CUPA 4NUJB 4PLKD 2VR9A 2WMPA 1JNHB 2AI0H 5DD3L 2B20A 3PWPA 1NAMH 1OAYL 4H26A 3C8KB 5D7IE 4WVRA 3V0AC 5JXEA 4N8PA 4NT6B 5DD1H 4XP9L 4LVNC 5ESQB 3V79C 2XG5A 2GKIA 3LQAH 5JOFB 2BSTB 4JFQA 2UY7A 1G9MH 5DJDA 2R1YB 3PQYA 2OJEA 4N0UE 2DWEA 1KC5L 1RZFH 4NN7C 1JNNH 3BGMA 3QIWA 4Y89A 5E8NA 5BQ7A 3IYLW 4MDIA 4R6UA 5FO9B 4F7TA 5F6IC 1KCGC 3CSPA 2VSDA 4HJJL 4OBRA 4OGAD 5D7LE 1UEYA 2R9HD 1VA9A 3MGTA 1ZS8B 5DURD 2EIDA 3VG9B 2GJ6D 4YLQT 1X5AA 4XPBH 4CUCA 6FABL 4PGCB 1FFPB 4PP1D 4ZXBC 4LSQH 4O9HL 4HGMA 1VESA 3EDDA 3PV7A 3MJ7A 3QIWD 5EU5B 2APXA 2IAMA 4F9LA 2K7QA 1HN1A 4HUXA 5B38A 4U1JB 3MYJA 5DD6A 5DHVH 4P9ML 5F6HJ 3QH3B 4OGXH 3UTPD 3ARFC 5K9OA 1DN0A 3TO2A 4JPKL 4HFUL 3UBXI 2ZKHL 2BXYA 4XT1C 2OXGA 1DJSA 4LVHB 1INEH 3BYTA 4IRJA 3NZ8A 3SDYL 4J3SA 5J57B 1MJJB 1D6VH 4LSVH 5F1IA 3DRQA 3O6FB 1ZHLA 4OM1H 3OG6B 2YPVL 4ZYKB 4HZLB 1M7IA 3NFSL 1ULVA 3QIBB 3SCMC 3WJJA 3QT2A 4KXZI 4UDUB 1MCBA 2NW2B 1KBGH 1MEXL 3PWJA 3HCVB 2CDEB 1TETL 4YNYA 1KIQB 4ZPVA 1EUUA 3WHE0 3EDFA 3VWJB 3DXAD 2HKHH 1IC7H 2EIBA 3C8DA 3BUTA 3OAYH 4I13B 2J6EA 5BS0B 2WQ8A 3FONB 4XI5D 5BO1L 3GSWB 5D4QA 4PJEB 2WIMA 3FO9B 5GIRA 3MLVL 1YPZF 4NJAH 3UYOD 1ZK9A 4I8DA 1WZ1L 3JTTA 1YC7A 4HULB 3RVWC 1T66D 4DGYH 3VI4E 4XNUL 5IMLA 2DIJA 1XGPB 4XBGA 4OCRL 4PRDB 2QQNL 5C0EA 2OTUA 2D2OA 4RIRB 3ZDZF 4O02L 3LY6A 1UGNA 1A21A 2EXYD 4F7CA 1EA9C 1JRHH 3QISA 5ID0A 2EICA 2BC4A 5DXWA 3MRQB 3TWCL 3VWKC 4CMHB 5M7QA 3I6KA 3GB7A 4G6FB 1UWXK 3F58L 4LSRL 3VE0B 4ENED 1T5XA 1A4JA 1NUDA 2V9QA 3G6JB 4OKVB 1RK1A 4LSTH 4PJ7E 2D03L 1MLBA 2YA2A 4GW1B 5IV2B 4XNQA 4CMHC 1T1XB 4NDMB 3UBXG 2R8SL 1ZLWH 1Q72H 4GAGL 1DDHB 2A74A 3OL2A 4NP4L 1CXIA 3FQRA 4JGUA 1UEMA 2W0LA 3BDYL 4ZODA 5EORH 5TPWH 1VFAB 2ZP0T 3KAAA 4WTZG 5DJXB 2DIAA 4P23A 5EBWA 3FQUA 5HYSG 2AKRB 4R8WH 2X4TB 4OCYH 2WSKA 1FRGL 3GSUB 3CGTA 4Z8FL 1DR9A 1FL3B 3TBVB 2Z31A 4HS8H 5IQ9A 2HJFA 4WUUB 1U36A 1JGVH 1J0YA 1NFDA 1A9EB 3GK8L 5SX4H 5J6HA 3KPMA 3TV3L 5JDJA 1FYHB 3KS0H 4Z78B 1NGQL 1RQ5A 4YXHL 4JN1H 4XVUD 2YPLE 4KHXH 2CIIA 1MQ8A 3QQNA 4PP1C 5BOPA 1U95B 2HT3C 5GGTH 1NLBL 3BKCL 4E41D 4DVRH 1KUMA 2NY6B 3P11H 1TPXB 2FGWL 1EVUA 5CILH 2E6QA 3FOMB 1F4XH 2ZSVA 4ZUTB 1JL8A 4X99A 1Y6MR 4HPYH 2BNQA 4P2QE 3AREC 2BVUA 1DQDH 3PL6B 1XGYL 4MNQE 4QOKE 4Y0GA 3PNWB 4Z5RA 2HJLA 4MDJB 3OKMA 3HZMB 3BZEB 3NACH 3MLRH 5ICXB 4ISVA 4NQDB 2OM5A 2Z8RA 2NCMA 3T0WA 3RWFA 2D0HA 4YHML 4LSQL 3S36H 3BKMH 4X6CF 1DN0B 4WW2C 1WISA 4ZO7A 3V6BR 1U93A 4QGYA 4FA8A 1FO0H 1FLRH 4ZUVA 4P59L 3D85B 4DGYL 2PNDA 3OAUH 1S7RB 3SJVD 1FH5L 1C7TA 1YNTA 3QQ9D 5JR1H 3HNSH 5FKAB 3V6ZA 1UWGH 4KK9D 4JHZA 3OR6A 3O3EA 3DETC 1A4KA 1ZHBB 1HEZA 4ODXA 4RZCA 3S4SG 4ERSH 4S2SA 1XF5B 4RGNE 1F3DJ 4ZPVB 2BHZA 1VADA 4ZFFB 2X7LA 2DWEB 3GI8H 4ZOCA 4BFIA 5EZJB 2GJ6B 3QEHA 4IIQA 4J6RH 3IDJA 3I02B 3IU4L 5C8JB 4QXUH 3WCYA 1JN6A 1R3JB 2BY3A 5HGDB 4PLJD 4HW6A 3WUZA 3QXVA 1CDUA 4M1GL 5GGUB 4MJ5A 4HBCH 4WHDA 1YMMA 2NY4B 3LCYA 4JKPL 2AK4E 5HI5C 2Q86A 3TZVB 1QBMH 3RNKA 4DUWA 2HFTA 3LQAL 3QUMH 5E8PA 3QDMA 1MCWM 1U3ZA 3RTQA 4EOWH 1ZLWK 1GGIH 3MRNB 3EJZC 4Y2DB 3A6BH 1RK0A 5GZOC 3ULVD 1KELH 3MBEA 3QH3A 5K9OB 1ADQL 1A7BA 1K4DB 4KROD 4NO0B 2DQTL 1G7HA 2OR9L 4XPFH 5H35B 5TQ0H 1A4JB 3T3PF 1H3GA 2XA8L 3CXHK 3HPLB 3VMPA 4X7DC 5E24E 4FNLL 3LRSA 2CGRL 3L7EA 3PJSB 1AQKH 2V2XA 1AFVH 1CWVA 3U36B 2AV1B 3MNVB 2P46B 2XI9A 3H42H 4L8BA 1MRFL 4L4JA 2F19L 2GTWA 3O6KH 2VQ1A 4RDQG 5C08E 3MO1B 5JOEA 3B2UC 4CADA 3GDBA 3IS0X 4POZC 1CD9B 2X4TA 4GG6E 3CLEL 3CXDH 4OLXH 3V95A 4JZNA 3P4OA 5MEOB 1V3JA 3TLRA 1JPTH 1TQCB 2R29L 2HYMA 3LPGA 2X41A 1EEUA 1I8KB 1ZT7A 5BVPH 3P73A 3CIQA 3G04A 4TNWF 1QSFA 4AMKL 4I5BA 4QNPF 3PWPB 4TVPH 1J8HD 3NCJL 3P0GB 1YY9C 4F7MB 4P5TA 5B22A 3X11A 4DN4L 1FVEB 2VXVH 5IQ7H 2DQFB 5IJVB 2FCBA 1UA6H 2DIBA 4HS6B 5IFAL 1CGYA 3ZE0F 4YHIA 4QF1B 2VL4A 1MQKL 4AT6B 2QKIB 4UU9A 2DYPB 4KY1L 1EGJA 2C9AA 3LQAC 1GH7A 4G8IB 2DQCL 4KK5D 5SWZD 1KSRA 1B0GB 1FNGB 1AHWC 3L7FA 4PG2C 1QHPA 1DN2A 2VOTA 3IDJB 5BMFH 5FO8B 3PGFH 5C0CE 3C5ZA 4EUPG 5IKCA 2QL1A 3KXFD 5ESVA 5GS1B 5D1ZC 5KVEL 3V5HB 2Q3ZA 3HMXA 5GQBA 4NRYA 5I73B 3QDJA 4P57A 1A7OH 4U6XB 1U58B 2YN3A 2GSIB 3QXDA 3REVA 2XV6B 3ULUH 1D5IL 1UB6B 1S7RA 1ITBB 1FDLH 4X6FA 4MA7L 1YNTB 2UWEA 4N1HB 3B9KA 5FGCE 4L9DA 2EH8L 1PEZA 2VDNH 5TDPB 1XH3A 3FFCE 2DD8L 3GUTB 3L6FA 1YEIH 3QI9A 5CEXB 1P7KA 5LKNA 1EVTC 4I0PB 5CMAA 4I48B 5BW7C 5LVEA 1FV1A 3SQOL 4W68A 2RR3A 5FK9B 1FGVL 3AUVA 4IIQB 1A1MB 4MNGB 4BFIB 3ZKSD 1MHCA 3QXAA 4PJ5E 2DQUL 4NT6A 3EFFB 5AZEH 5CKAA 1J0HA 5DUBA 4XI5C 2DTSA 2EYRA 4TN9A 2QSCL 1KPUA 3FQNA 3WL9A 3G6JF 1EEYB 4XX1G 5HYFA 7FABL 1Q9WB 3V4UH 1NCBH 3SKMA 4HUXB 5B38B 1FNEB 3PNWA 1JGLL 1QACA 3TA3A 1I1YA 1RIHH 3QUMB 4I2XE 1SM3L 2R69L 4GXVH 3MLUH 3WN5A 1BQHG 2FYYB 5MEPA 3DX9A 5HYJD 1P84K 3FTGB 5I9QC 1AHWA 4OZFH 4W6WB 1IKNA 1WBYA 3EW3B 1H3UA 3VD9A 2VQUA 1F4XL 2Z35A 3VRIA 2ZJSL 3BWUC 4XCYB 4L8CB 3BO8A 1AGEA 2BCKA 2DLTA 4P4KA 5FYLH 4QWWC 1T03H 3L3KA 3GRWL 3O2VH 2JKXA 4J3VA 1PKQA 1I9RH 1BECA 2J8OA 2NXYB 5D2NE 5CP3H 1WWCA 4AT6A 3DV4A 4P2OD 1JPFA 1BVLA 2YXMA 5DMKA 2QQQA 2XIDA 2YK1L 5I1JL 4WHYG 3G5VA 1D5BA 3RUGA 2Q20A 2QR0A 5LXGH 4G43B 1E6OL 3BZDA 1E6JH 3BE1L 1LK2B 1UB5A 2HLFD 4J3XA 2DL9A 4Z7OE 4RBPH 5I17B 1CDCA 3V2AR 2YUZA 5DTFB 1T04A 2AI0L 3LKOB 1UZ8A 3PUCA 4LF3B 2PTUA 3MRCB 4JPVL 4UIMB 15C8L 3CFJA 1LO0H 3EO1A 3LKNA 4M1CC 1SMAA 1L7IL 4UQ3A 2ZUQC 2VLJB 2Z31B 4PRID 1IGML 1A9BB 3X3GL 4PS4L 1P6AB 1GZQB 1KTLB 3TBWA 5LCVL 1IKNC 3V6OE 3ECBA 5I1GL 3ZE1F 1KJVB 4LCCB 4KKBD 4LPVA 4YBHA 1MLCA 3QUYA 5DK2A 4MJIB 3RIAF 4X5LA 3O8XA 4QT5A 5BOZG 4RFOH 1ZVHA 2I25N 4MA3A 3MFFB 1YPZA 3GSVA 2RFXB 3DJ9A 3HNVH 5DUBB 4ZFGH 2BHUA 2G60L 3ZSTA 2X09A 4MAYD 3VE0A 4OCWH 4WO4C 1NCWL 1DQJA 2ICEA 4N0FA 5F6IB 1U3HD 5DDHB 1JFQH 1EFXA 4FFVD 3TFKD 2DI7A 2K7PA 1J5OL 3IFNL 3OGCA 5I30L 4ZUUB 4JFXA 2DJSA 2Q8AL 2X05A 5FHAL 3MRRA 3G5YB 1AQDA 4JFFD 2R2CA 5C0AB 2HFGL 2DLIA 5HGAA 4HF5L 2XICA 4ETQB 3G08A 4OD3H 2X4SB 1E4XL 4HDIA 1NANI 1T22B 5EBGA 1CK0L 1RU9H 5IBUG 4U3CA 5T1KA 2BSSB 4K3EH 4PY7A 5I1CH 4IMLB 4Q2ZA 5FK9A 1R6VA 5MEQA 2I9LA 2NTFA 5IP4A 1WC7A 4PRNA 1OT1A 1XGQA 3QUYD 2Y1VA 4YNYB 2NY5H 2ADGB 1OSZA 2DMCA 4FQXB 1SY6L 4NZUL 4HJ0D 3A67H 4M6ML 1A7RH 3F5WB 4H25B 3UTSA 3C5SB 4J4PA 4GKNB 4HKZA 5JIKA 3C2SA 3KLDA 2NNAA 3C60C 4UT7H 4LVNB 4PRIA 2XWTB 4KAQH 4XP4H 2F54A 4JO3H 3OKEB 3QUKA 4XNUH 3ZKXB 2FEEL 4KTDH 4OAWA 3K1DA 4Y5XA 3IAGC 3VWJC 3SOBL 4HWEH 4UAOC 1YZZA 4JVPA 2GI7A 1T1YA 1I7UB 3RWDB 1X5LA 3BI9X 1K8DA 3PDDA 3GSUA 1LNUB 5ITBH 3NACL 4P5TC 3TN0D 2VDKH 5A2KH 1GJIA 1QOKA 3OG4B 4RMRA 5AD0B 3E2HA 1HINL 1QSEE 3KLHC 3GM0A 4DWHA 4MNGE 1F6AA 3VFSA 1XR8B 1Q9OB 4UBDD 5CEZH 3T3MF 1WK0A 3MRLB 5I8CB 4X6CE 4HWBH 1IM3A 1JPSH 5HYJA 3ULVF 2W38A 1CXKA 4HUVB 4U1GC 2YD2A 1J8HA 3ARYA 3C9NA 3FFCB 3CFEB 2FZ3A 4MNHA 4NO0D 1QLFA 3L3OA 4GRMA 4DCQB 1UXWB 2HTKC 5D5MA 2ZSVB 3O45A 1G1CA 1XZ0B 2BNRE 2PCPB 5E8EB 5C0GB 4JFYA 3LSOA 5IK3B 3VFUB 3GJFH 5ILTL 5CBEA 3IU3B 3GKWL 5FOJA 3MYZA 5GGRY 3S36X 5FGRA 1XF2A 4RQQB 1P7HL 3TF7C 3CVIH 3D2UA 4U33A 3GIZL 3H9SE 3TO4D 5E2JA 1RZIB 5TFSH 5IMKB 1ZHKA 3B8SA 3QEQD 4NN5C 1IBGH 5CILL 5DR5L 3T1FB 1LK2A 1RZGA 2IADB 4X7TA 5D7JA 3R8QA 4K55A 3LKSA 2XZAL 2Z93A 2ADIA 1G7PA 4U7MA 1XIWD 4DJMA 5ALCL 3RDTB 4WHTA 2IFFH 4NKMA 4OD1L 2D7TL 5C0ND 1UENA 4XP1L 3RWHA 4HUWA 4HFWB 2VRAA 3TYFB 5BV7C 3VGGA 1WC7B 1T20B 4PRNB 1F58H 2PN5A 1MAMH 3AY4C 2X4QA 3L5HA 4DKAA 4K9EL 3ULUC 2ZUVA 3QNXB 3LRHA 1FFQA 3W39A 1OM3L 3PWPE 2R0ZL 2H1PL 2MKLC 3KDMB 4KZEH 4YBLC 2AJYL 4WV1A 1WT5A 1EAPB 1ZVSA 4QHKJ 2AP2A 5IB3A 1AI1L 3T65A 3KYAA 2J4WL 5C2BL 2PO6D 4U7KA 2HJKB 4GW5A 3S8WA 4MJ5B 4PJAE 4PJDB 4Y19D 5KVFH 1I8IB 4PJHA 4OV6F 2F74A 5E2WL 2PYEB 4JY5L 4N0FB 5FM5O 1ZLUH 2XN9B 5EZOH 4MA7H 3QEHB 3U7AA 4M61B 1W72L 3D87B 4HJGA 5B3JE 3P77A 2HTLD 3HAEA 2EE2A 4MCYA 1C08B 1NL0H 3NZHL 2UZIL 4Y5VB 2P47B 2P7TA 1B88A 3HPJB 3NMEA 5B8CC 1D6EB 4MDIB 4K8RH 3E8UH 3GI9L 3ARSA 4PLNC 4XMKH 4WEMB 1NMBH 1CZ8L 2Y06H 4FFEX 3DBXA 1BWMA 3MV9A 4YPGA 3GIZH 1FDLL 4W4OC 5L2KB 3VXMB 2Z92B 1GGTA 4G42A 4YDVA 35C8L 1HE7A 3SKOA 1F3DH 3MPCA 1AIFA 3OKNB 4NQSA 3V8OA 3PGDA 2FJGA 4QRUA 2VN7A 3BRDA 4XWGH 4L1HA 1F90H 3MREB 2D0FA 1E4XI 3LIZH 3X12B 5LWYH 5L9DL 3CUPB 3O4LD 2YUXA 3QI9D 1A7QH 1I1FB 1R24A 3K7UA 3BE1H 5F9AC 4Y5YC 1WFOA 1CVRA 4NHUA 4H0GA 2C26A 1UVQA 3GJFK 3TF7A 1UYWH 1JK8B 2CMRL 4CMMB 1RUAH 4Y4HB 3WO3B 2ZKHH 4KPHH 5B21A 5J7CC 3GSOB 5SWSE 3QZWB 2JK5B 4TPRL 4DCQA 4RAHA 3AS1A 4UB0L 3CXDL 4GAGH 4M48H 2BOCA 5FO9A 1IGIL 3H3PH 5DA0B 5FYJE 4E42A 3ZE0E 4ZG1A 2OK0L 1KTDA 2VE6B 5E2VH 4HD9A 3NBNA 3QWQB 2IPKA 4U1NA 2E7MA 2BVQB 1RAMA 4RAVA 3BXNB 3FT3B 4HJGB 4E41E 4PJ5D 2V2WB 5HHQB 1XGTA 2QSVA 5JIIA 1UH2A 1YMMD 3K0WA 4NQEE 3W2DH 3PP4L 4YPJA 4OB5L 4LPYA 2ZUTA 1EAJA 3TN0B 1FNEA 1TIUA 3GEWB 5E99L 1SEBB 2O5YH 5CD5C 3V0WH 4Q9QL 2X4OA 4IRSA 3QP3A 1N0XH 2CPCA 3KGRA 5I8KH 3C60D 3MNWA 4L9LB 1PG7W 5SX5H 1ORQB 3UAJC 3G9AB 3BWAB 2EDLA 3AU1B 2X4QB 5B39A 2JB5H 3QNXA 4I0PA 1HSAA 4NCC1 1U8HA 4OD3L 1WCQA 4X5WA 3VDAA 2AXGA 5FA4A 4U2ZA 1RU9L 1LO0L 4GRLB 2YD7A 3DYMA 3SJVB 3RZCD 3RL2B 5FYJD 1NAKL 3MFGB 3D18B 5HY9B 1DBBL 2D0GA 1UZ8B 2GJZB 2K1MA 4X6FB 4JO4H 4KUCD 1KELL 3VFVB 2R23B 3NGBC 5CLTA 4HC1L 2DQEL 1H3VA 2OP4L 3D3VD 5L2KA 3ULUL 2X4UA 4JRXB 1JJUA 4F33A 1I7TB 1UM5H 3TYGL 3QEQB 1B4RA 3VGDA 2OTWB 3GMOB 3D2UB 4Y19E 4GXUN 2C4FT 1AGFB 1BGXL 1D3CA 4RFOL 4NCC2 4JY5H 1JN6B 3BT2H 1T5WB 3RWCA 3DHJA 4M5YL 5HYSB 2A73A 5IHZB 4KJYB 3EOAB 5E2TH 3O2WL 1Y0LA 5D2LA 1L7TH 3CX5J 2R2HB 2FLRT 4DKEL 5CUSL 1KLGA 4TULH 5C0DA 3RDTA 5E8OB 2NY0D 3O8XD 4PY8I 3S96A 5BZWA 1RURL 1LP9B 4ELME 2ZOLB 1WEJL 2FATL 1S9XA 3N1QC 3VFWB 3IDYC 4YZFF 5D5MF 4H25A 1QKZL 3TN0A 4RMSA 1U2CA 4PFEA 1M4KA 3BQUC 2B5IC 4D0DB 1I3RA 1UJ3B 4HWZB 3ECBB 3RWIB 3VXNB 4MXQD 3PGDB 2J8UA 3VXPB 1BREA 2DLGA 4XP9H 4YK4B 3PABA 4CL7A 4G80A 3KWWB 4MXWL 4BQ6A 1FL6A 1A7NL 4ZAKD 1U8KA 1ZA6B 5DRXB 3VW3L 4QRQB 4WWID 5EU6B 1CD8A 4AM0A 4D9LL 4RGND 3VCLB 1CXLA 4FZ8L 4E5XB 4UOJA 2R1WA 4QEGA 2VQ1B 4K7PY 5CGMA 2DQCH 3GI8L 4HXAH 4CN1A 35C8H 4ZFZB 1BF2A 1WJ3A 4PTTB 1ETZA 2HKFL 3P9MB 3AMKA 4KWUA 2OTPA 3DGGB 5CFHA 1ZEAH 4PJ9C 4HEME 1FSKB 5D2NB 1AP2A 2GUOA 4FQIL 3EZJB 3IDGA 5IB4B 5A3IC 3QIUC 3MGOB 1OARL 3TVMD 4C55A 3MCLL 1JNHA 5IFHL 3CZFA 3AY4A 4FQXD 1BP3B 5E5MA 3MCKB 1A1NA 3GHBH 2QBWA 2JB6B 4YBQD 1RHHA 5MI0B 3QG6B 3FL7A 4P9HL 5EU3B 1MF2L 4MX7B 1IM9B 4BKLA 3VXSA 4XRCB 3CLFH 1VEMA 4F57H 2R2HA 1JV5B 2F54E 5MERB 4O02H 4Q0XL 5C92A 1LDPH 1EV2E 4NC0B 3SGJA 5D7LB 1GGBL 1QSZA 4HLZG 4OQ1A 4JQVC 5FAAA 4IDJL 2GY7B 2V2WA 5HHQA 5DHVB 2MCPH 1Z9MA 4OLUL 3K8MA 4ZXBB 2CRIA 4Y19B 3GSWA 5KOMC 3NH7H 3BT2L 1CYGA 5ANMA 2VZVA 1OTTD 2O61A 1MREL 3ARBC 4M5YH 1A4KB 5I71B 4FQCL 5C9JB 4QRTB 4JRXE 4ZAKB 3AB0B 4JFEA 1AGBB 4OZHE 3GSNB 3QJFB 4KZDL 2AJVH 5L2KD 2WWKO 2YK1H 3EGSB 2FD6H 3SKUD 1YJDH 3ULVC 2XY2A 3JVGC 1CF8L 4YBQC 3S3PA 2FHFA 3BN9C 3OKYA 4JFDB 1X5ZA 5JOFA 5KSVA 2AXGB 5EOQH 4LQFH 5K9JH 2LVCA 5A2LH 1YDPB 4HKBA 4IRJB 1T83C 2OSLA 4G6JH 3IXAB 3OGOE 4PJIA 1WAAE 5IFJA 3F5WA 4JE4B 5L7XH 4PRAB 3TO4B 5KS9E 1A1OB 1FG9C 2VR5A 3X17A 1FYTA 1OP9A 3IGAB 5B38G 5E8OA 2H26A 1JWUB 3EOYG 5MENB 3SCMD 4O58L 1H3XA 3DETD 4NQEB 4O2CB 1J1OH 3EDEA 1Z9OA 2A6DA 2WAHA 4KRPD 1FQ9C 2R2EA 4JY4B 2V2TB 3QUML 4U1IA 2EE9A 3VXSB 3QQ9C 3SGKC 1NGXA 4JDZB 1CGTA 5EFIA 2WUBH 3FB8A 4XNXH 3MGTB 5HDBF 3MOAL 1DBMH 4JZOA 2ATPA 2E6JA 1CGXA 1R3KB 1VFBA 4FABL 1DBAL 4N5EA 3D0VA 3ILPA 3C5ZB 1KYOK 3FRPA 5H94A 3HRPA 5I2IA 2ESVE 5M95B 3IU4H 2X1XR 4NQSB 4HFWA 2VYRE 4PJBE 3TYFA 1CFTB 1HSBA 3LZFH 5F7FA 3W5NA 2C1OB 4EI6B 3QO1B 4L4TD 5FCUH 4WCYH 1AFVL 2R0KH 5HJ3A 3U30B 5GRZA 5HBBA 1UWXH 2R39A 4GW5B 3WIHA 4U1LA 1MHEA 1XCTB 2PW2A 3OQ3B 5C08B 3MRPB 1UYWL 4NDMA 5FKPB 2ZNXA 3L5WA 3HHRB 1QR4A 4NIKB 3T1WA 4M62H 3RY6A 1EEYA 3MRIA 2DWDA 3QNYB 3MV7E 3QFJE 4ODWA 5EBLA 2ICWA 1LO4L 5E03A 4OI7A 5CIPB 2VDMH 4I0PD 1SBBA 5L2KE 4F7EB 4MD4A 4K94C 2ZUYA 4PJ8D 5LWYL 2VDQL 1U8JB 2GFBA 2VUOA 4XPGL 3UTPE 3U9PL 4YIQB 1X5HA 1FORH 1MFBH 3LN9A 1VFMA 4K3EL 4LPXA 1YYLL 4EUPH 4G6AD 2HG5B 2OI9B 1E27A 2J6EL 5FYLE 1X5IA 1IMHC 4NQVB 3QXDB 2Y06L 4RA3A 2CD0A 2NY0C 3O8XC 5I74C 5ISZD 4CJ1A 4QRPE 5FB8B 4KMTH 3FOMA 4LSUL 4ZTOL 3MUGA 4MQ7B 4MJ2A 2OZ4H 5J1AB 2FX8H 3ARWA 4W4OA 2XN9E 2IH1A 2AJZB 4DUVA 1UKSA 5DUMH 2PR4L 3L95A 3P3YA 3QI9B 1AGEB 3WKML 3RVVC 5HVGB 5C09A 2P24B 3UO1L 1NQBA 5C71A 1VGKA 4Z8FH 2HJKA 1FAIH 3HNVL 3MACH 4NQDA 2GK2A 2DDQH 4YHYC 4X8JB 3QIUA 1GC1H 2Z91A 1DLHA 1OGAD 1UJTA 4LCWB 4WU5A 4WW2B 4PJBB 5F89B 5C2BH 5CJQL 2FEDC 1N4XL 4KK9C 2CK0L 1PG7H 2YRLA 3EYUH 2VSCA 2N1KA 4WENB 1JGDB 1BVZA 5LGJB 3RIFF 2Y6SC 2EKJA 4UT6L 1NEZA 4XPFL 3HE6C 4RMTA 3CPLA 2W0KA 5E6ID 3W0WD 2APWA 4U6VH 5IIEB 4X4XA 4XAKE 2VZ3A 4NO3A 1A6WL 2J3SA 2P8LB 2ZG1A 4LAQL 4KVCH 2Y36H 2DF3A 1I9IH 2AEIT 3MNWB 1TPXC 1GZPB 5DD5L 4J12A 1TDQA 1G7JA 2AEPH 1XR9A 5EOTA 1CICD 2BCKB 3UMTA 1OPGL 5JXEC 3IFPA 3H9SD 4P2QB 1F00I 3LKPA 5CEYB 3ESUF 1Y18B 3BP4A 5HGDA 4RX4D 2ED7A 1KLFA 1U8QB 2DB8A 4U6HB 5J6GA 1NGWB 4LIQL 5JMOC 4XB8A 1F90L 3S3JA 3MXVH 4JN2B 1IBGL 2EDDA 3CAFA 3DVIA 3EHBD 4P48A 4P5KA 4NZDA 4YXKH 5CBAA 2VDML 1LP9F 4UOW0 1FNSH 4XC1H 4D0DA 3TFKA 3JWOC 4ISVB 1HNGA 1IGJA 1KULA 2GITB 3MRNA 4D9QD 3SGEH 3LN4B 2B0SL 4U1MB 1PG7X 4DN3L 4OZIF 3RL1B 4R7NB 1LEIA 4KDWA 3TT1L 2YOCA 3LQMA 4B41A 4X98A 3O3BA 3AC0A 2CR3A 1Q72L 5F72S 1G84A 4OZHB 1T7VA 3ZTNL 1JZ7A 3DRTA 4ZUVB 1YNLL 1ZLVH 2IG2L 1JWSA 4CGTA 3U4AA 3GSOA 5IHZA 1DQTA 1UZ6F 5T3XD 1KIRA 5FYJL 1MCPH 4PD4J 3RWJB 1ZXQA 3EO9L 5DSCA 5ETUA 1SJEA 2IQAB 2R0ZH 3O2DA 1ZTXL 1IZKA 3ESVF 4LLWB 4MMZC 2EDYA 4Q9RL 3BOVA 3P0VL 4G9FB 3GM8A 2NTFB 5C0JA 4RZCB 4M62L 5BS0A 1VADB 2XZCH 3F7QA 1YEFL 4YC2C 3OKDA 4BZ2H 3F8UB 1MJUH 1BM3H 2F54B 1CFNB 4J4PC 3GSVB 1BOGA 5DWUH 1RJZB 1DLHB 3RI5K 2YEZA 4ZUTA 3MMEA 4RRPG 4BQCA 4HCRA 1DZBA 2DD8H 3WFDH 2NX5B 5FO7A 4WGWB 1K9TA 4OFKA 4RFEB 2MMXA 4L4TB 2OMBA 2BHYA 4QKXB 4KVCL 4YAQB 4YR6A 3KPQA 5ID1B 5I2IB 4F80A 4G7VH 3LN5B 1JIBA 1HOCA 4BZYA 3V52L 1KV3A 3B3IA 2JIXA 5F7HA 5FECA 4XTRD 3HB3D 1MCNA 4NC1E 1Q9LB 1PX3A 5C0IA 5C0NC 2BSRA 4FHBD 1QRNA 3NAAH 4NKDA 5GSVB 5TDNA 4TTDD 1T2QL 1EFXD 4JO4L 3MNZB 2V5YA 1IEBB 3KR3H 4X6BA 1NCCH 4XMLH 1XCQA 2DQJL 4NRZA 3G04B 4NBYB 4A2LA 1UZ6E 4O2EA 4RGOH 4PG2A 2NR6D 5F7MC 1HXMA 2OBGA 4JHAL 4OGXL 1OTSD 2BP3A 3WDIA 3UTTB 4UUJB 4KK6D 1P4LA 5A16A 4KJYA 1ZSDA 2JJUA 2HVKA 4EN3D 4WIQA 1MVUB 1WCBA 5HTSA 4OFDA 4HEPG 3KHOA 4WW2F 3G5VB 5CWSA 4LKCB 1JWSB 3ROOA 4YGVB 3R0NA 4Y4KC 1BBDH 4WNQB 4BH7B 5HPMB 4BFEA 2X40A 1CIDA 2FD6L 2ADIB 2ORBH 1OQOA 3GZKA 5IJVA 3G5ZA 2DBLH 2VLJE 1VGEL 3K4DA 2FIKB 2R0WH 4Q97A 3MJ9L 2FGZA 4OT1L 3T2QA 5IV2A 2W60B 5DRWA 2DLFH 2CUMA 4U6TA 3U9UB 4TUKL 5AZ2L 5DHVA 3CC5A 2VWEE 2FB4L 4TTDC 4P5KB 5EU6D 3L7FB 5GS1C 1SQ2N 2FH6A 5C6WH 5FO8A 4HZLA 2ARWA 2NXYD 2G9HA 1YEIL 5I8OH 1MI5E 5SWZB 2AKRA 4MD5A 3G5XA 1J8HE 5C09D 3D6GA 2IMNA 5ISZB 4OQTL 4KROB 4HF5H 3O3BB 4I77L 3ISWA 1OHQA 4YHZH 4Z9KB 2W92A 5DJYA 3U4BL 2X1PA 3FRPG 3SBWC 4OFIA 2UZIH 1S5IH 1UB6A 4BH8A 4J3TA 1J1OL 4JPWH 4LCUA 1C08A 1IGJB 5I1EH 3FO9A 5GIRB 3VD5A 4N0CC 4ODXB 1Q1JL 1O5DT 2H8PA 1YUHA 3IKCA 1AE6L 1HXYB 4LLMB 4CDGC 1CL7I 3S5LG 1V05A 2BY1A 2VAAA 4C83B 4P59H 3RIFK 5I0DA 1Z2KA 1FZMA 3OXRB 4I48A 5BMFL 3IETA 1K85A 1KNOB 3ZL4H 4G6JL 5JQ6L 3VXTA 4JM2F 4DKFH 5LJYH 4NQED 2D31A 4ONGL 3KXFB 5FUCC 3IFLH 1T7WA 1JCKA 2UWEF 5FYKL 2XKNA 4FQPA 4PV8A 5DD0H 1HYSC 4R0LB 4XPGH 1NCDH 2X9WA 1AGCB 4XCYA 1KJ2A 2V2TA 4HWNA 3TBSB 1IZJA 4Q0XH 4UOW1 5GGTA 4OD2B 1JF1B 3IRZA 1IEHA 4XC3H 1SYVA 3VG0H 1RUAL 1BZQK 2KL6A 4QY8B 3K2UH 1G7HB 2CXKA 3MV7A 3B9VA 3QCVH 5JW4N 5DQ9B 1DBML 1L0YA 5ACZB 3BEWB 4I18B 3VXRE 2OL3H 5FYLD 4FXGB 1CU4H 3NABL 1HKLH 5GISH 2IPUG 5SWSB 3GBLA 4OBSA 1BQHA 3GMQA 3VFNB 1V5JA 4JR9L 3ELAT 3ZDYF 3RNQB 5GS0D 1F4AA 4TVPE 2XA3A 4LPWA 1YN7A 3FOLB 3KVQA 4G7YH 5ECJE 4L8SA 4WCYL 1F8TH 3ZT6A 4XC1L 4U1SB 3GSXA 3MRMA 3H0TB 2MHAA 5D1XA 1G6RL 1C1EL 2R2BA 5C0JB 4W6YB 1IGFH 4HWEL 1TLKA 5C8JA 3OGCB 5C0CB 1X5JA 3TFKC 4GAYA 2FBOJ 1N3NA 1I8KA 1ZT7B 2H32H 3VXME 2VJXA 5T33L 1JZ6A 1MUJA 1U0QA 1MH5A 2V7NA 3GSNH 1YEEH 1NGPH 3MMEB 1BZ7B 3GIVA 1R5IA 4APQB 2AJSL 2FWOA 1PDKA 3HI1B 2W9EH 2R2EB 2WWMD 4F2MB 1FP5A 1U42A 4AIOA 1N2RA 4LAQH 3DMMB 1PY9A 4R4ND 4PRPD 5IR1A 3CXHJ 4TUOB 2L7UA 2EXWD 5GRVK 4EN3C 3RUGF 1LO2H 1GZPA 3CDYA 3ERYA 4E9LA 2CUIA 1A7PL 3VD7A 3GKWH 1J87A 1UCBH 4MS8D 2YPLA 2R1YA 5FA4B 4JB9H 1V7ML 1FYTE 4IOIB 4P46D 2VUYA 3JSSA 4M8QB 5EB9A 4M7KH 1WWBX 1NGYB 5D5ME 3RY5A 4HK0A 2CDFA 5EC1B 3SY0B 4ODWB 2XY1A 3AS3A 1I4FA 4UINL 1FE8H 4GUPA 1NUGA 3ME0A 2CLVB 4KKNA 3WS6C 1HEZB 4NN7B 4URTB 5DJ2B 2FIKA 2J5LC 3CDFA 3VG0L 4JM4L 5F7LB 3RZCA 5DQDH 3LZFL 1W0WA 2JCCA 4ONOA 3DV6B 5E95B 3EFDH 3ALWA 2GITA 2EH7L 1GRWA 5DMKB 4KRNA 1V3LA 1CLOL 4PGBB 5E6IC 2LTQC 3U4EA 3BP7A 4XTRC 4WWKC 2RIKA 4PP2A 1JF6A 1QRKA 3QHZH 2RB8A 2AS5M 1OD9A 3AGVA 4WI3A 2Y5EA 2ITDA 1INQA 2IH3B 5DEZA 5HHXH 2EDEA 1YUHB 3PV6B 5HHOA 1XEDA 2B5IB 1PGRB 3UJTH 1PKOA 4WY7L 1K3ZA 5T1KB 1A6UH 2JF1A 3P4LA 1MFDL 4WRLA 5JZ7D 4V1DD 4I0CC 3DGCR 4X4ME 4WO4A 2F5AL 1BOYA 5KAQF 2J88L 1TVBA 4R2GD 5IESH 1AD9B 4HUMB 3MLWL 5CBEB 2DTMH 4NZTL 2HG5A 2OI9A 3K4ZA 4KPHL 4EI5D 2J12B 3RX8A 2EDFA 4XH2A 4BQ8A 3PGCA 3IDNB 4G5ZL 3CH1B 3D25A 3HZKA 3RA7L 3TJHD 4ZSOB 3VXMD 4TSAH 3O6FD 2GJ6E 3FT2B 3SGEI 5HI4C 4NQUA 2ENYA 3EDKA 5SWQB 3LIZL 2O61B 2A83B 43CAA 1G7LA 4PGCA 4C56E 4MGXA 3BJLA 1I1AD 1MFCL 1JPTL 4YDLC 4XC3L 3OKKB 4NKOA 2PYFA 3V52H 2KZWA 4Z7UB 2W1NA 12E8L 4HGWA 1MSPA 4J23A 3B3IB 4UNTA 2JIXB 5AYUL 3IJHB 1KCVL 3DBXB 3T0BA 4CU6A 1BZ9B 1WITA 4N8CL 4H0HB 4EUPB 5TDPA 3A6CL 5DD1L 4OGYL 3IAPA 2A2QT 5D6DA 1MRCH 3I6GB 3Q5TA 4G8GD 2EECA 3GSXB 4OZ4B 5J1TC 4KRMB 4UTAH 1KCLA 1QSEB 1FN4B 2XTLA 3V5KB 5IB2B 4Y4KA 2Q7NA 3WFHA 3EHBC 3KNBA 5FHBL 4I9WE 3OF6A 3FONA 1JPGA 4H26B 2W65B 1M05B 3MRCA 2H32B 5FGSA 3S34H 5I6XB 4KQ3L 2C5DC 3MGOA 3MV9D 1LDPL 3M1BB 3GFUA 5T3XL 3ETBF 5E4EB 2NQCA 1U3HA 2PYEA 3LPFA 2F74B 3MLSH 3V6OA 1CICC 1KLUA 4JZJA 3PHQB 5D71L 2PKDA 3Q3GA 5EO1B 1B0GA 1FNGA 2FHBA 1QSED 3NPSC 2IANA 4LHQB 5J3HD 5JTWA 4FXKB 5I8EA 5T3ZE 2BJMH 2HT3D 3UROR 4KI5C 3V7AE 1AD9A 4TUOA 1NDGB 3B9AA 1EGJH 3BSZL 1CE1L 4X98B 2HVJB 2G2RB 3VJ6B 3SDXE 5F7NC 1CD1B 5F71A 1QBLL 3ZYJA 4GMSH 2YBRB 3BRFA 4QRRB 2JB5L 4KROC 1BX2A 4S1DD 4WUUE 1U92A 3OAZH 1U8MA 3ARDD 3OAYK 2WBJB 4YEEA 5ALBH 5F1SA 3C6SB 1QZ1A 3QRGL 4GG6A 2CKNA 2XZQH 2VITB 3VXQB 2LFGA 3DUSA 3S5LB 5D2NA 2P1YA 1JPFB 3PWLB 1T83A 3NFSH 4HUUB 4QHNB 5EZOL 5HI5D 1U41A 4PJ7A 3S4SA 3FB6B 1NC4D 5CGYD 1PD6A 1T0MA 3MROB 1S7XB 1T0NA 1BZ9A 2MPAL 2A74B 4KJWD 3OBAA 5I1AB 4Z78A 5JMRA 5GXBB 3SY0A 1OCWH 1HIMH 5CZXD 2IG2H 3WJLC 1ADQA 2LU4A 5HHNB 3OJDA 1P4IL 4AQ1B 2RHEA 4HKBB 4ZS7H 1C5CL 1G0YR 3QG7L 2IQAA 2YA1A 1KIQA 1C5DB 2EEDA 3J7HA 1NCDL 4UZGA 1FZOA 1N6VA 1MCRA 5C0BA 5CAYB 4M7JL 1QA9B 9CGTA 5IR1B 1HZHH 2NW3B 4V1DE 3MLXL 5A3ID 4JQVA 4KK8C 5JNYB 2VXQH 4QHMB 1WFTA 1KCKA 4MJID 4WUUD 5EPMA 3TC9A 5JQ6H 4XGZB 4PJEE 4ODTH 4X9FA 1UG9A 3H7BB 3SDXF 4HHAB 4NPYA 1CLYH 4KI1A 3T2NH 3MSPA 4XPAL 1BGXH 3F7RA 4Y4HD 5F7UA 4OM0L 1OY3B 3DX7B 3WO4B 3R4DA 1CFTA 1HSBB 4HKJB 3MJ8A 3JTCA 5HYSA 3C6LA 4NJ9L 4DZ8A 1K8DB 2VLRA 3MUY1 4J8RB 3MYJB 5DD6B 1T89A 1A2YA 3KG5A 2J5LB 4KJQC 1NCTA 1HCVA 2YD5A 4YHPA 3I6LE 3OKKA 5IHUL 3K81A 1S7UB 2Z0BA 3CDCA 4XAWL 1FRGH 2W60A 3L9RA 5DGRA 5KSUA 4NOFA 4RCAA 2X44D 4EKXA 2LAGB 3O3EB 4JRYE 2XQYG 1N64L 2NY4C 4MXQC 2ILLA 3C5JB 1BQHB 4PJHB 5E0QA 3ROOB 2NMSA 1G7MB 4LP5A 3QEGH 1V8HA 4APQD 3SE8H 2IBZY 2R69H 2ADGA 3L3HA 4OCXH 4MXWH 2DLEA 3DI3B 5HGBB 2NW2A 1MCFA 1YEJH 1T1ZA 2AQ2A 3THMH 1TVBB 5D8JH 4Z7NE 3WBDA 4ZYKA 2O26U 3BP6B 1I3GH 1Z6JT 3GO1L 1KJMB 4ZFGL 5D70L 4H1LA 3RBSA 2A9MH 5E70A 4P0DA 1P4BH 1B0RA 4ZFZA 1KCUH 4DN4H 5ITFA 1T0MB 3N9GH 3CFCL 1WWAX 4BSVB 4F7TB 4NQCA 3G5ZB 2WUCL 4XWOD 4O9HH 3BH9A 3WNLA 4WY7H 1P1ZB 1MIMH 2C3WA 5E00A 2BNQB 4LDLB 1Z0MA 4APQA 3QDJD 1EFXB 1PFCA 3PQYD 3MLYL 5DVOA 1Y0LB 1M6OB 1YECH 4LEXH 4U1JA 4QXGL 3BGFB 4U05A 4ZUWA 4NKIH 1G0XA 4D3CL 4PJ5A 5D7SH 5IROC 2HKHL 1NFDE 4P4RA 2IMMA 3BGFC 2QHRH 2ARJA 3ZDYE 4A6YB 3MO1A 1QBML 4PRPB 2OZ4L 4MXVF 2L7JA 5JW3L 4WFED 2XTJD 5I66B 1RJYB 2MQ3A 4BK5A 4AH2B 2IQ9L 5ENWB 1WVZA 5I8OL 4OQTA 3LSOB 4MD5B 1VPOH 4PJAA 4QRQA 5I1GH 4XB7A 1CBVL 5DJXA 2C3XA 4W70A 5I16A 3WLWD 1J0JA 1OLZA 3H2WA 5DJ8A 4NN5B 1NJ9A 1J9CT 1TZGL 4YX2H 2FLBT 1U3HB 4JO1L 1AE6H 3BO8B 2W9DL 5C0CD 2QADD 3TA3D 2VDPH 3TNNB 1VDGA 4S2SB 2D03H 1MCEA 2OQJB 3MA9L 3P9LB 1LO3H 4DW2L 1N0XL 1SYVB 4IOSD 4Y4FD 1BFTA 1D5XB 3FCTB 1ONQA 1C16B 4QHUB 4EOWL 5HHXL 3MTRA 4P5MA 5GJSH 5IBLC 3VFGH 4X6EB 2ADJA 3BP5B 1BJ1J 1TJGH 3SQBA 1CL7H 2D7PA 2ERJC 5IT2H 1IKFL 3IJSB 5E6YA 4WHTB 1YEEL 4Z7VA 5HVWA 5J6GB 3T8XA 3EOAA 3B6SA 3H9YA 1TZIA 5CZVH 3SDAC 4UV7L 1FC1A 1S8DB 3X13B 4PRDA 3GO1H 3TVMC 3FFCD 2E27H 4LCYB 2D4DA 1TXKA 2ZSWB 3GKZA 3SKJL 3QIUD 3MJ8B 2DQEH 3TPUA 4IRZL 1DTUA 1IL1A 4MD0A 1DE4B 5L88L 2XQYK 5KSBA 4PJ9D 2A9NL 1NGYA 1HQ4B 4ZXBD 5DMGD 1HH6B 2FNBA 2VISA 4YHKH 5C0GA 1RI8A 4A2MA 4KRPB 3P2TA 4HWBA 1I8IA 5IUSA 2PO6A 2YRZA 1IEBA 5D1XD 2BK8A 4UT7L 4XAWH 4X6CA 4X8XA 4XMPH 1PYWB 3GMLA 1KYOJ 2F8OA 5F3BB 3BPOB 5HYJE 4PJ9B 5I75B 3QUXA 1A64A 3TCLA 4GW4B 5DFTA 3B5TA 4M93B 1Z5LA 4P9HH 1JGVL 1QFOA 4LEOA 3DVGB 4I3RL 4KK8D 1JUFB 3FKUS 3MR9A 4OGZA 5ITBL 5IQ9B 1YEKL 3B8YA 4GBXB 4AIZA 2H6PA 4V1DA 3BQUD 1UQSA 4DZBA 3T0DA 2APBA 4ONHB 2F5BH 4JFDA 3D25B 4Q6YA 5IB4A 1VCAA 3TP4A 4LCWD 5FO7B 4GG8B 4LCIL 1EBPA 1OAXL 4DGVL 2BRRH 2X7LB 4XZUB 3ZSSA 2IQ9H 2APVA 1YYLH 4EJ1C 2JJSA 1CVSC 2FBJH 3BH9B 5TE7H 2OK0H 2FO4B 1FFOB 4RFNC 4WFGE 1OL0A 3ES6B 3VWKA 2F15A 3LS4H 4PRAA 2SEBB 4HXAL 4HG4J 1IAMA 1H15A 3QAZB 4OKVA 1JGLH 5EH1A 4GS7B 2OL3L 2G60H 3PIQB 4N9GA 4Y4HC 3CDGB 1T7ZA 5SWQA 2FX9H 4EBQL 3DTXA 2IH3A 3ZYZA 3RWJA 3QCTH 3KYOB 1NSNH 2FL5A 3HG1B 4MSWB 5I18H 5E08H 1MI5D 1ZGLB 4NO0A 2DYPD 1MIML 1OARH 3LEVL 1RMFL 3MRJA 4LP4A 5TPWL 3HE6A 1G7MA 4YFEA 4POYA 1MIEH 1LE9B 3HI5H 5EBMB 4L3AA 4JG0L 1V3MA 1KIUA 2NY3B 4HX1B 5F8QC 1ACYH 1NPUA 4HPOL 4JQIH 5KOVC 1BFVH 4X0KB 1OGAB 4Y16C 5JW4Q 3PXHA 1QBAA 3S9DB 4O51A 2VKWA 4PJIB 2IBBA 4D9RD 1EHLL 2F53A 1XIWC 2BNRD 4F57L 2PTTB 4R90L 2YSSB 3B43A 5ANME 1BFSA 1VERA 2GUOB 3EYSH 3RVTC 2QEJA 3E2HB 2VAAB 3EYQD 4W81A 4X7SH 1T5WA 1GOFA 5T1MA 5C70A 1F4WL 2WY3A 5IBTL 5DO2C 3MV9B 1AXSB 4YO0A 1B2WH 2J8HA 4N5UA 1XF3A 4YR6B 5ID1A 3TO4C 5C0EB 4GBXA 5EO9B 1IAOA 2ICWJ 1BD2E 5A1AA 3IJSA 4ZSOE 3TYGH 3TBTA 4PBVC 4I3RH 3BMVA 5DJCA 1CXHA 3FQXA 5ICYA 1QPPA 5DR5H 1AR1D 1DLFL 4JDVA 1I7RA 3MXWH 4I1NB 5HPMA 3LPWA 1DQML 4R4BB 1K2DB 2NW3A 2A6DB 4H8WL 3OKOB 3JUZA 1BFOB 5IIEA 1YQVL 3O6LL 3MNZA 4JFPA 2AK1L 3SJVA 5GJTL 5TQ0L 5D7JD 4TVPL 3FJTA 3U9UA 5CUSH 5DF0A 3NIFF 5C6TL 2W91A 2UYLB 4P2CG 3TJEL 3UJIH 1R3KA 1RUQH 1VFBB 3DROA 3WHXB 5I6XC 4F7PB 2WINB 2FB4H 1D7FA 1MJ7H 4KI5E 2EDHA 1YY8B 1ZOXA 2R0LL 3VXUB 4U49A 3V0WL 4ODHH 4JRWA 4K7FB 1ES0A 4MZ2A 4V3DB 3SKJH 5DRNA 2EIEA 3HTLX 4X6DA 5JO5B 2ZCHL 1QBBA 1KIPB 4HLJA 4KJQD 4LRNH 1QA9A 5E99H 3OXRA 1A6UL 1Q38A 3IFLL 3MUHL 2CK2A 5BRZD 4EDXB 2WUBL 3IKCB 4JFOB 2DQIH 3EOBB 4F15B 1U91B 4M1DH 4ZDHA 2HT2C 4L8DB 4N1EA 1R5WB 3C2AL 5I1DA 4NNXB 5SX4I 1UXWA 5D5MB 4MQXC 3D39D 3VWJA 1S9XB 1GHFL 1TZGH 1AO7A 4HX1A 2CXGA 5F88B 4OFYD 5B4MD 1X5GA 4JO1H 1DVFB 5D70H 1KJ3L 4ZOAA 3BVNA 1KJVA 1HDMB 2N4IA 3EJYC 1U8JA 1CDGA 1UCTA 2X70B 1JYNA 4G8FA 3C5SA 2G9HB 2PR4H 1ZTXH 1VEPA 3RU8H 3DNKA 1X6LA 1OTUD 1X5KA 1E28B 1GC1C 1MWAL 3MCLH 4HKXB 1KB5L 3FN0L 5JHDA 3PIQA 1ND0A 1U8MB 3O6ML 3QEGL 1A6PA 3LQZA 4TRPL 4NHCL 3VDBA 4QY8A 1SVCP 1F4WH 4JCLA 3OHXB 3VRIB 4FNLH 1II4E 2Q76A 3B9DA 1CFBA 5DEGA 2Z31C 1FCGA 3QFJD 3CFEA 1T5XB 4BZ1H 4H8WH 4U6YA 3WSQL 2AERT 3MRFA 4L3CA 1N59B 1HK6A 5C0RH 4CBPA 5T1DH 4ZO9A 2CO6B 5EIIB 1UKQA 1GGIL 4M8VA 1D5MA 2VDQH 1BVLB 2WM0A 4XP5L 5JZ7C 4PJCE 3HRZB 4P4KD 3UCRA 5DJAA 3VGHA 1NLBH 5KVDH 4P2YA 4R7NA 1RZIA 4RMVA 1TJHL 3W11D 2N7AA 4N68A 2JJVA 3TVMB 4IMLA 3KPOA 3MV01 3TCXA 3O11A 3ARGA 1JNLH 5IGXH 1KOAA 5DYOA 4MJ4A 1YJDL 3MOBH 2EDTA 2P5WE 4LNRA 3STZA 2XOTA 5HHMA 1T3FA 4EEEA 4TSBH 4QHMA 5EPMB 4G8IA 1HZHL 2YKLL 4PGDA 2J8UF 4NRZB 5D1QA 4N0YL 5D7LA 1CFSA 3H9HA 3QSKB 4LFHD 4RGOL 3U46A 3ARGD 3TA3B 1AKJB 3CZJA 2IPTH 5DJZA 1BVKA 2J88H 3C5JA 5EU7C 3GHEL 3KXFE 1U93B 2EC9T 1U58A 4JREB 4JHWL 2BRRL 2BVQA 2H41A 3MX0A 3CSYA 3TT1H 5AWNL 4HK3N 2BZDA 4WV1B 5CJQH 3JV0A 5D7IB 1ZGLA 1JGUL 4FFZL 2D4FA 4PJXF 4UNUA 4OCMC 1R3HA 1LNUA 4OIAA 4M5ZL 5IOPB 3K46A 2ZSWA 4ERSL 2AJZA 2IPUK 3VFRA 3X3FH 3RU8L 4DFHA 1HHHB 4YAQA 4QNPE 1DLFH 4XAKD 3OKOA 2UVEA 4H20L 3U79A 4Z76B 4S10A 3QUZC 1RZ8B 3VFTA 1ES0B 1I1AA 4PJCA 4S1RH 1N59A 3WXVL 4HBCL 4LCWA 1VKXB 2X2YA 2P5EB 2VLKB 1OP3K 3MRGA 1I1AC 4NKDB 4OLWH 2B7DT 1OAXH 4HPYL 4HAFA 5ISZE 1MELA 5CJOH 2E9WA 3NFPB 2XNAB 3C08L 1MREH 2FHCA 1QFUH 3BDXA 4JAMB 1K8IB 3BKCH 2EKSB 5T3ZL 5AAWA 5HHOB 4PJAF 1G7IB 5ETUB 3SEPA 1XF2B 1X7QA 4HPOH 4JQIL 4ODVL 5A2IH 2JK5A 5D93B 4LGRB 4XNZB 5CHNA 2A9ML 3A6OA 5JW4M 5JXAH 4UU9B 1CGUA 3BISA 4U1IB 5ILTH 4JY4A 3V0VB 3U4BH 2BVTA 3ABZA 4LGPB 4NM4H 4I77H 1HDMA 3CJJA 1QLEL 4LOUD 4JKMA 4YE4L 1E27B 4FTVD 4HQQL 5KAQG 4HJ0C 4MAUL 1IT9L 4Z7VE 3X12A 3OB8A 3PWNB 3QIWB 4U3XA 1QRNB 3D85D 4I4WB 4P4RB 1RIUH 4FQIH 2ID5A 5FUZL 4JY6A 2RJMA 5IMOA 4JQXC 4RWHA 4ZUWB 2C1OA 4EI6A 3STZB 4FQJH 2NX5D 4YHOL 4I9WD 1HOCB 4WFGD 4AJ0A 4FFWC 5F93C 5HHOE 1W2KT 1HQ4A 4U7SA 3VI4F 1P7QD 5TE6H 3TIEB 3Q5OA 2RCSH 1V3KA 3T0EB 1S9VA 4GMSL 4YXKL 3G6DL 1FZJA 1KIPA 4OCYL 4X4YB 1OF2B 3FB7B 4XP4L 1B3JA 3O3AB 3UJJL 4RAUA 2Q7YB 3T77B 2FX7L 3RDTC 5AG8A 4HAGA 4L8BB 1WF5A 1YMMB 3ZE2E 5IWLC 2E3VA 2AXFA 2VN4A 1L0QA 5CP3A 4MS8A 4L8DA 3ZKMD 1DBKL 1BJMA 4G80B 2H26B 4XHJC 5D7KE 4KC3B 3WXWH 4FG6D 3QDGE 3QPQC 4JANA 1QEWB 3L3GA 5F96H 3IDNA 4PTUA 4PLOB 3NIDF 3NA4A 5JHLL 1C7SA 3QIBA 5DT1L 4L4VA 3ULVE 5BS0D 1GIGH 4KQ3H 1JNLL 1RHFA 5F3HB 1W8NA 3OMZA 3QG7H 1C5CH 2X4OB 3RBGA 4WI5A 4XBEL 3Q1SL 2IADA 1NGZB 1OTSC 4X7TB 1QD0A 3CSGA 2HFGH 3FQTB 4PRHE 2NPLX 2Q86B 2HWZL 3U6RA 5C1MB 3QNZB 4LKCA 3HMWL 2HN7B 3B6SB 3HNTL 5F1KC 4P2RB 3F7YA 1FO0A 4IRZH 4GRWE 5IMLB 3L95B 4QTHA 1U6AH 5CBAB 2P5WB 4OLXL 4JN2A 1NH6A 1XF5A 4UDTA 1CXEA 1BHGA 4LEOB 5EU5A 4TPRH 5EUOB 1GOHA 2Y07H 4G9FE 4TNVK 5MEOA 5EIIA 3O6KL 3U0PB 4HIEA 4XBPB 4K8RD 5C07D 3TBSA 3VI3F 1REIA 1PQZB 5DJZB 2FZ3B 4MNHB 4WU7B 3E6FB 4LCUB 3QHFH 3W81A 1UFUA 2KQMA 2ESVA 2IAMC 3BHBB 4U6XA 1B90A 2CSPA 3HE6B 3RGVC 1EDQA 5I0ZA 4P3DA 1IGTA 1WZ1H 1A7QL 3F6IA 1P5UA 3O2DL 2Q8BH 4BELD 4LBEB 5JQHC 4U31A 4O58H 4MSWA 1CK0H 3VH8G 3STLA 1FZOB 3DYPA 2GFBB 4TQEH 3V6OC 3EDJA 1A6ZA 1LO3L 4OLVL 4POUB 4RSVA 2W0PA 3FMGH 2ZCHH 5ESQA 4M3KB 4YZFE 2NZIA 4MB3A 3N1GC 1MFDH 1QHOA 1H15B 3Q48A 2VXVL 3WMSA 4J3UA 3A67L 3B2UD 5CP7A 1QFUL 4K07A 2O5YL 1FV1B 4U1HA 5SV4A 3TBVA 4M61A 5AAMA 2ENSA 3QO0B 4ESKA 1WAAF 2WANA 4NKQB 1P84J 3W5MA 5HD8C 3O6MH 4MNQD 4QOKD 1RUQL 4FS0A 4L29B 4M4RA 1B4JL 3UYRH 3RFZC 1RV6X 4OF3A 1S78C 3VXTB 2V17H 4PV9A 5D2LE 3DUSB 3S5LA 7CGTA 4B53A 5FYKE 4BQBA 1I9RL 1D6EA 5CHNB 1A5FH 4Y1AB 1XT5A 2AGJL 5DJCB 3KPLA 1PKQB 1Q0YH 5MP6L 5KSUB 2KH2B 3GBMH 3HC0B 4NBXB 4X9GA 5I19H 4QYOB 5E9DB 1BJ8A 2KQNA 1FGVH 5ADOL 4KKAD 2Z8VC 2E5EA 3LEVH 4O00A 1MCIA 4JO3L 4U0RB 4KDTA 1ZHLB 4X6BB 1JTOA 2EC9U 4IOFC 1MY7A 2EEBA 4NFDA 3WNNA 1PVHA 1P5VA 1ZAGA 1MOEA 5MHSD 2IGFL 2MFNA 1PEWA 4YDKH 4R90H 1JE6A 3VXUE 1SY6H 4J3OC 4NZUH 4DAGH 4XWGL 3IJYA 5JNYA 5DVKA 4RA0C 2W9EL 5E2VL 1JYVA 5A16B 7FABH 3HUJB 1IAKB 4DVBA 1L8JA 4EDXA 2B2XH 2XKSA 3CCHB 5HSFA 1DBKH 5IW1A 4S1SH 4LLVA 4HIJA 2YRPA 5EZIH 3D3VB 3VFOA 3WFEH 3QUYB 1HKFA 5H2BB 4U6HA 3M17A 3UZEA 4QRPB 5IBTH 5EC2A 3I6GA 1IILE 4PRHA 4DZ8B 1SHMA 2EEAA 1XAUA 1XGPA 4XBGB 4XMKL 3A6CH 5F88A 2OTUB 3BIKA 1GIGL 3ZYIA 4K3JH 1R3JA 4ONFH 3I75B 2MPAH 1FORL 1MFBL 4KKBC 4EQ2A 3AVEA 1D9KD 3KPTA 3WNKA 1A47A 3TO4A 1P2CB 2AEQH 3BMWA 4GH7B 4WUKH 5JR1L 3HAEB 1IAIM 4FZ8H 4HIXL 4H20H 1W0YT 1BD2B 4N0UA 4M7ZC 4OF7A 5EU4A 1BWWA 4ZMAT 4YDIL 3ULSB 4UDTB 3FN0H 1W72A 2GT9A 4IJ3C 6CGTA 3QFJB 3O4OC 3VXUD 2YD4A 1OD7A 1AI1H 2HLFC 4OLUH 1EGJL 1ZLUK 2BRQA 4NO2A 3CFBA 3NFNB 4GLRI 3JV5A 3SKMB 1MNUH 5I66A 3PWVB 2BJML 2P44B 1OGAE 3MRHB 2V5SA 4PUBL 1YN7B 3FOLA 1D9KA 5LCVH 4N0YH 3E3QE 3UC0H 1CFNA 2F5AH 3EYFB 3TBYA 5I8KL 3HB3C 3GMNA 4M03A 1Q0YL 5MP6H 5I17A 1ORSB 4K23H 4KUZH 3UZVB 5J6HB 1GVIA 4U1GB 4YK4C 3EJZD 4P23C 4XMPL 2FEDD 2ITDB 4M6NH 1INQB 4XPBL 2EZ0D 2R4SH 3INUH 1FYTD 1UT9A 4HKXA 4RNRA 3BPLC 4RRPA 5HHVH 3PP4H 5MEQB 5K9JL 4XZUA 1QNZL 2V9TA 2IFFL 4UIKL 1JPGB 5DHXB 1FFPA 4O4YL 2A1WH 3SDAA 3BUYA 3E2HC 4NWTL 3VFGL 1JHTA 1N64H 2HRPH 2PUQT 1YEDA 3QDME 1M7XA 2XKNB 3PDOB 5DHYA 2JJSC 5IVZB 5BQ7B 5DK2B 1TCMA 3N06B 2GJJA 3BKJL 1MCLA 3D0VB 3AFLA 2BVOB 4ENEC 3E6HA 1MLBB 1S7TA 4Q58C 25C8L 4ORGB 2ZZUT 5I73C 1TFHA 4M8QA 4FFYL 4FOMA 3DTXB 2BERA 1NGXB 5I75C 5DQJB 3MA7A 4F9PA 5JA8B 2R4RL 4KXZH 1D9KC 3VRJA 2QQKL 2ZOKA 1RIUL 3ZHKA 3QUXC 4D9LH 3VA6A 2Q1EA 4WTXA 1BMGA 4XNXL 4NZRL 1G7LB 4WFFE 5K9KA 1CD1A 3KJ4B 2YWYA 1JI2A 3HG1D 3SGKA 3TH2T 4JFDE 3LEXB 4PRPE 4I0PC 5DFVD 2XTJE 2DN7A 4PJGF 4OTXL 1CD0A 4G7VL 5GRJH 3WFBL 4OZIA 3RVXD 2W9LA 5EA0H 5CWSB 4KHTH 3ALPA 4OCRH 3VA2C 2F19H 5BRZA 2HFFA 4F3FA 5CCKH 5IB1A 3VGAC 4JQXA 4XWOC 1JMZA 3PDGA 1KCSL 2ATKA 1BIIB 5D72H 5BXFB 5DS8B 2PTVA 3OTTA 1TQCC 3T09A 4Z7WF 4LRNL 3VFWA 3WDHA 3DUUA 4UB0H 3MLTB 4NFCA 5TF0A 4YHNB 1TENA 1IGIH 3OF6D 5BCAA 1U3JA 3X11B 1KCVH 1DSFH 5GS0H 1G6RA 3D69A 3BGMB 4AL8L 1I1RA 2XKUA 3C6SA 4XMLL 2EIZB 5DQ9A 4KVNH 2QSCH 2NY7H 1FL6B 1IT9H 2R0LH 4OUOA 3ULUF 1FO0L 2IAMB 4LARH 1U8HB 2MNUA 2GCYA 3VD4A 2UUDK 4LVHC 4IRSD 4WEBH 4UTBL 4L4VE 2CDFB 5EC1A 1Q94A 1JGEB 3N9GL 1AR1C 4LMQE 1NC4A 4GW4A 4WU5B 1F3JA 1AHWB 4DN3H 4O51B 25C8H 4MQTB 1TZHA 4JRYB 2PW1A 1LO2L 3MLRL 3TA3C 4NWUL 3UTSE 3CFBB 3NFNA 5DT1H 5DI8A 4F37F 3KPNB 1IC5L 3RWEA 5J8OA 5DMYA 2FATH 1HILB 4FQ2L 1HWGB 1RUKH 4HC1A 3FB6A 5ESAA 3IETB 1W72B 2GT9B 3P11L 3SDCA 5GHWL 4PJEA 1P69B 2YN5A 3FHAA 4LLVB 4GS7C 3KPRD 2LABA 2Q6WB 4BJLA 3EOTL 2W65A 3OAUL 1T89C 1BZ7A 3GIVB 5JHDE 1T1YB 1YYML 4OCSH 2QQKH 3BN9D 1MPAL 1AJ7H 1MAKA 3U0TB 5IW3A 2F53D 3HE6D 5ICYB 3K2UL 1EZVY 1NFDB 3KPPB 2Y6SD 5IB5A 3RGVD 2OL3B 1T66C 4YDKL 2NY2D 3GK8H 1SYSB 1IC1A 4XP6L 4KRLB 3BUYB 2VTFA 2X10A 4DOHB 2ZCLH 4HG4K 1RUPL 1E4WL 2BSED 4BKLB 2DYPA 2EDKA 4V2BA 1NKRA 2C1PB 1A9BA 3U6RB 2X4PB 1X3DA 3LAFA 5DFWH 2AQ3A 2J8UB 3VXPA 3NH7L 3FQRB 5J12C 1J88A 4IDJH 1BOGB 1N8ZA 1FL5B 1I3VA 2CMRH 3MJ9A 3PWUA 4GUPB 1KF9B 1MAJA 1KB5B 3FO2B 5IEKB 4P3CL 1KPUB 3FQNB 3BX7C 4Z7UF 5B3NA 5T5FL 4NOBA 5GS1A 2K9UA 3OKMB 2ZOKB 4M6OL 4RQQA 1S7SB 4OLYH 2QSQA 3QEUA 1JZ2A 1WZKA 1QEWA 3HUJF 3L3GB 1M71B 1M6OA 2UVFA 1D9KB 2HLAB 4UMGA 5C0CA 3FN9A 4PTTA 3P4OB 1RZKC 3MBED 4MVBC 2EZ0C 3B9KB 2J2ZA 3I50L 5IEHA 2NYYC 1L9MA 1JWMB 4WWKB 1KN4L 1S7QB 3UJJH 3W9EB 4Y5XC 4ODTL 2FWOB 3BPLB 1HH6A 2M1KA 3S35H 1J12A 3VXSD 4QRRE 4ZQKA 5TFSL 3SJVE 2D3VA 2H32A 4BM7A 3QWRD 3HS0B 3OR6B 1FCCA 3P77B 4PJ8B 5SV3A 5J4MA 3JZ7A 4PJDF 5HGBA 4UT9L 4X4XB 2P5WA 3QI9C 5KVGH 3HZVB 3KPRA 2N7BA 4XPTL 3U0WL 4UT6H 3T4AA 3PGCB 5DLMH 4DK3A 1D5ZB 3NCYS 3CFIC 5ITFB 2O5XH 3TBWB 1DBBH 4GMTH 4NHUB 2NTSP 2PF6A 3JWOH 1XGUB 3KYMB 1YY8A 1UXSB 1Q9LA 1ZA3A 5C0IB 5J13C 1DL7H 5GSRA 3BESR 1CXFA 1E4XH 3L7EB 3K4AA 4E41B 4GRLD 4EIZC 2XRAH 4MLIA 3QFDA 4RMQA 3NOIA 1A6ZB 4A6YH 1VACA 3U2SB 4JPIB 1GCFA 3BP7B 3U1SL 5KW9H 3PP3K 5A40E 4OZHF 3IS1X 3QULB 3A0OA 1YEGH 3WFHB 3S35X 1K3IA 4BZ1L 4WU7A 4Y4KB 2J6EH 3STBA 4Z7UE 5KVEH 3NCEB 3ARBD 4WFHD 5C0AA 1AQDB 1A7OL 4KAQL 3DUHA 1TJGL 1T2QH 3CZFB 1KB5A 3FO2A 4F9LC 5IEKA 1Q1JH 3D39A 3HC3H 4HS3B 1ED3B 5KSAD 5ACZA 3G5XB 1S7QA 1CDYA 2I60L 5T5NF 5JOPD 5CJXA 4JREC 2FRGP 3L3JA 4IOFD 4KY1H 4LGSB 4PJHF 2R56H 3QPXL 1FAKT 3I3DA 2H2SC 5CIPA 3DXAE 1W0VB 4HCRL 3N1FC 5ESAB 1K4DA 1MJ7L 5E2UL 3WN5B 4S1DC 5C09E 3QUZD 2NY6D 3NPSB 1U9KA 1UM4H 4Y2DC 4X6EA 3SDXB 4M1GH 4P5MB 3L5WB 5EWIH 1IGCL 1MLCB 2VZSA 4NM8H 2A6KA 4NQCE 5TQ2L 4PBXA 1ZHKB 3UYRL 1KACB 3SCMA 1ITCA 3WJJC 3IVKB 4G8EA 4OF6A 2MTPA 2EYTA 1KNOA 4YGVA 4L3EB 1KJ2L 1J1XL 1KEGL 4XVTL 1W8OA 4HJJH 3QHZL 3BKJH 4JN1L 3RX5A 3MXVL 2H9GB 2YZ1A 5D71H 2P49B 3OWEA 4NUGH 5EU4B 3N85H 3REWB 2ZPKH 4OZ4A 3RKPA 4ZO8A 2VABB 1I7UA 3RWDA 1VGEH 4ORGA 3WKMH 5IW6B 1K6QH 2ORBL 3CVHB 2XWJB 5TH2A 1FPTL 1T0NB 4OD1H 3S97C 5I1HH 3BZFA 5EUKA 2PYEE 3MNVA 4F37K 2ZG3A 4U1LB 3E1F1 3VGAB 4Z7OF 5KANI 3GMPA 4R96B 5F7DB 4DKEH 2EYSA 1G0DA 4JKLA 5HGGS 1KCSH 3S88H 1XF1A 3MBXL 3HE7A 5KW9L 4D94A 1QYGL 5SWSA 3CPLB 1DQLH 3MV8D 4M93C 1Q0XL 4HV8A 1I9JH 1CCZA 3MZTA 1FYTB 4JPIA 1ORSA 5CEZE 3RWGB 5ABDE 1LGVA 1J05B 2E9IA 5JPMA 3LHPH 2H3NA 1MAML 3TBYB 1JUFA 1JV5A 2XACC 3DVGA 3MR9B 2MHAB 4I0KA 1J1PH 1IARB 4PJXE 4OKDA 5INDA 2Z91B 4WW2A 3FN3A 4DK6A 4M00A 2BMKB 1CS6A 1CTNA 4FQ1H 3AS0A 4JKPH 2DDQL 3MCKA 1RZJH 3BDBA 4GQPH 2B1AH 2R1XA 4NO2B 3U0WH 2JELH 2A77L 4OJFL 4ELMA 5F9JB 4OGAC 5KTEH 3T4YA 5DLML 1I85C 2QJDA 1A3RH 3EZ8A 3GNMH 4J8RA 4LLQB 5FV1L 4Z95H 3ZKXC 4MQ7A 3ULSA 2OCFD 3QQ3B 4OZFB 5D7LD 4HUWB 5I30H 1T1XA 1A6VH 3IKKA 4L3ED 1BD2A 2D7OA 3MRKB 3P9MA 1I7RB 4WGVB 5E1AB 3SGDI 4PGZA 1NBZA 1FE8L 4FMKA 5BV7B 4IEFB 1FH5H 3EYVB 1BQSA 4OZGA 3B9KC 4A6YL 3FFDA 3KLAB 3KPSA 3WEXA 1CLYL 1JWMA 4WWKA 4LASL 1KEML 4NZJA 2JTDA 3WFCH 1GXEA 2NY3C 1TVDA 3NCYP 3GRWA 3B4NA 4MQXD 1WIOA 3FQWA 3T65B 3L3IA 1CLOH 3DO7B 5IB3B 1B2WL 5T3XE 1WBZB 4QRSB 1QTYT 2F8XC 3QHTC 4QF1A 4F7EA 1UVQB 2E7BA 1A6TA 4J6RL 5JIHA 3RNQA 3VFUA 1OWWA 2HAZA 2YZ8A 4GRWB 3DI2B 3UTTA 4G7YL 3P9LA 5J12B 1HYSD 5EZLB 5I15H 5MEND 4PJGA 1WICA 1N2RB 1RURH 4WTWA 5AZEL 3MBXH 1AD0B 5DJ0A 5FIEA 3TIDA 1JRHI 1UH4A 3L1OL 2AK4A 4JDTH 4AG4L 2J4WH 2AABH 4HBQA 5D6CB 1BFOA 1QLRB 1TTGA 3O0RL 3MLTA 5MERA 4S1RL 1Y18A 3BP4B 4HQQH 1U8OA 3EJYD 3EYOB 2FEEI 1KCRL 3L3KB 4M7LH 5DS8A 1I85A 5D6DC 5K59F 5DUML 3LN4A 5E9DD 5IROA 3GJEA 3JV4B 5I1LB 3E6HB 3R8BB 5FGBC 3LS4L 3PHOB 1VHPA 2H3NB 1MI5A 3QWRA 2GYSA 3SDDB 4LOUC 2FJGB 4QRUB 3HLAB 3H42L 2PXYA 4WI8A 1BQLL 4CKVX 3FQUB 3OR7B 5I74B 5DVNA 1KIRB 5J3HC 3SDDC 3H9ZA 2OX5A 4LK4A 4YBLB 4XVJL 3BW9B 5SWZE 4IM8A 1MQKH 3IDXH 1B6UA 3BHBA 3GHEH 1OP5K 1MCKA 4JLRB 2I9TB 3IT8D 3UBXA 4YWGL 3V7MA 1TZHB 1E4WH 2FJFA 4FQQB 1B0RB 2ZUQB 4MJ6B 5E56A 3U9PH 5IOPA 3P4MA 5DUPL 3FAXA 4EI5B 5HYQB 4G8GA 3S7GA 1HIML 1QRNE 1DFBL 5JPMB 5IG7A 4M5ZH 3N0PB 4Y4KD 1MWAA 3JWOL 4AENA 2BY0A 1HHKB 3VRLE 4AEHH 2GJ6A 4OCSL 5CEYA 1AGFA 5F9WC 1TITA 2I5YH 5AYQA 1AXTH 4HXBL 3WFCL 1XGTB 4XPHH 4WI2A 3RQ3A 3UO1H 3KLHD 3RTQB 5C07A 1DQJB 2ICEB 3UZQA 1U8NB 1MCWW 4YHNA 1I9JL 3E0GA 3PP3H 4JPWL 4ODHL 4D0BB 5I15L 4NQTA 3QPQD 4K3GA 3DWTA 1PQZA 1DE4A 1OM3H 5FDYA 3G6AB 4PG9A 5BZDB 2BVYA 4JHAH 3UTTE 4OZFA 5C0RL 5L0QC 1NMAL 1OSPH 3OJVC 1R3LB 1HH9B 1WCBB 2WZPD 3S35L 1SBSH 5IEHB 4D2NA 3OXSB 3ARBB 5I16B 3U7YL 4NQXA 4S0SD 2BSSA 2GAZA 3WFZA 1MCDA 5GJSL 3BJ91 3MRHA 5JORA 1J5OH 4Z7UA 1LO5A 1NFKA 3UP1A 2H2PD 3K8LA 4L3CB 3CFKB 1FHGA 1FIGH 2PW2B 4Q9QH 3CX5K 4YIQA 1J05A 2CKBA 3OZ9L 3TH3T 1DVFD 1QNZH 3T4AB 5IVXE 1MFEL 4XNYH 3RPIB 3S3SA 1PAMA 3JV6B 2YD9A 5JLZA 3H3BC 2AJXH 4J1UB 3FT3A 4IMKC 2ZNWA 4PJ8A 1T80A 2EDWA 5C0AD 1S9WB 5FGBA 2DQIL 4UTAL 3G6DH 3WS3B 1IL1B 2E9BA 3TPUB 4TOYL 2SEBA 2R56L 3IDUA 3QPXH 4LSSL 5IVZA 1RULH 3IF1B 4MNQA 4QOKA 2ZCKH 1SEBA 5GGVL 2XWTA 1FAIL 1D5ZA 1FNAA 3EYOA 5IMMB 4DFIA 1DCLA 1N7MH 4FZEH 1XR8A 3IRPX 1F6AB 2YWZA 4C56D 4C4KO 1VFOA 5FA3A 4JPVH 3DURB 1UKTA 1CLCA 5ESVB 2DM2A 4JRXD 2DQDL 5D9SA 5DZLA 2EDOA 4HH9B 2H45A 5KVFL 3SDDA 5EBLB 1Y6KR 4K94L 2AABL 2I9LB 2Q76B 3GGWB 3PWNA 5BJTB 3R06B 5DD3H 3BKML 2YPKB 4MVBD 4XBEH 4QRRA 5LGJA 4DW2H 2XA8H 3TCLB 2VXTL 3QNZA 3D1MC 3VI3E 1GL4B 1DQMH 1AGCA 3H3PL 5TJWK 1SJEB 3SE4A 4K7FA 3BW9A 4GLRH 4JFFB 3PWVA 5IF0A 5GS3A 3P0YH 1H5BA 1P9MC 1EK3A 4MA8H 1E4KA 5F6HI 5HXMA 1UM6L 3CLFL 4GG8A 4MB5A 1KB9J 3AM8C 4KMLB 4I3SH 3O4LE 4KKCD 4H5SB 3WFDL 1MVUA 1PW3A 1MPAH 1DUYA 2A1WL 3JTTB 5C0BD 1KENL 3TT3H 4HS3A 1FZMB 1A7NH 3HC3L 4NKMB 3NFPA 5I1DB 4MVBA 4JAMA 1WGOA 2AXFB 5KZCD 3JTSA 5DQDL 3I3BA 2BC4B 4ZPTB 1ZKAA 2C7UA 1LO5B 5KVGL 1ODAA 1DEEA 3X3FL 2JJTC 2UZXB 4CVZA 5C0FB 5KG9A 1J0IA 4UNVA 5HYEA 2AJVL 4FQJL 3SDAD 1MIEL 3BEVA 4I18A 2HRLA 1MWAB 2HRPL 5INCA 1HSAB 3V6FB 1CLZL 3HR5A 1EFQA 4M1DL 4AENB 4Q74A 4OCWL 4KDVA 1MCOH 5CP7B 1RFDH 4GW1A 4X9BA 2H2SD 3QYCA 4NP4H 1WIPA 5E5MB 1IC4L 3RHWK 3T2NL 5EFIB 3ZHDA 5F1NB 3NTCL 3LEXA 3FT2A 4F2MA 4D0BA 1TQBB 3V7AG 4Z77B 3WIIH 1MF2H 4PJ7F 4HV8B 1WTGT 2YPKA 5TDOB 5FFLA 1C5BL 3WLWC 1KXVC 5JORB 3JWDL 3T0EA 2ZCKL 3FO1B 1BD2D 5J13B 3QRGH 2EYSB 1MJJA 1G7PB 1U95A 4L5FH 3V4PH 2FBJL 3EJJX 1LE5A 4RISH 3J8F7 1L7IH 4OIIH 2VXUH 4QYOA 3M8OL 5E9DA 3SGDH 5BXFA 2VDNL 3TVMA 3ZT5A 4OLWL 1YDPA