3TN0A

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
293
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tn0A01
2IG2L 1BOGB 4H0IA 5CD3A 4TSBL 4ZTOH 1N26A 2CDFA 2GHWB 4HWUA 2ESVE 2DAVA 3GMPA 4NO5A 1DE4B 4G9FA 4BKLB 2A1WH 1S7RB 1QD0A 3VWJA 4JFZH 4PP1D 2AJSH 2NY6D 1FQ9C 1WBZB 3FHAA 4Z7UA 3JTTB 5DJ8A 5HDQL 4TUKH 5FM5O 3G04B 4XX1E 2G75A 3ZKND 2C9AA 3AROA 1NCTA 2AGJL 4XP9L 3FQTA 1OCWL 4KROB 4FQJH 1MIML 3K2UH 3JWNC 1K5NA 3OGCA 2WIIB 3L5HA 4GG6E 4NKIL 3DVGB 1MCJA 1SEBB 3S6CA 2JK5A 4S10A 3E6FB 3D0LB 4R2GC 2CIKB 4M5ZL 2PKDA 3NCCB 5DJAA 1YN7B 2AXFB 1X5ZA 4F57H 2DQUH 4OCXH 3WLWD 3HZMB 1EXUB 3FQUA 1FBIL 4YDJA 4L4JA 1G9MC 4F9PA 4X98B 4NN7C 4U4BA 1I8MA 3GJFB 5C8JA 1U3HB 4XPBL 4Y2DC 2X9XA 3BJ91 1YNKL 5DURD 2QHRH 3O45B 1MOEA 1IAIL 3AMLA 2AI0H 2D0GA 1OARH 4O2CA 3RQ3A 3W9DA 2FD6L 2R0WH 5HD8D 3CDGA 3I50L 5F96H 2XWJA 5J0BA 1Q9LB 2V2XB 1XF4A 4TNVF 4OCYH 5FO7A 3UTPE 3KYOB 2CPCA 3NTCL 3MNVB 1R3KA 3OKYA 4FQCL 5I0ZA 3MLSL 2HLAA 4O2FB 3WKMH 2F5BL 1NUGA 4LAJH 3GKWH 4XPFL 2QQNL 2XZAH 4YQXH 1V8HA 1NCCL 2C26A 3FL7A 3ZLQC 4P46A 1JPFB 5JDSA 4GRLC 5TGBA 2H9GA 3O6FB 3JWOH 1I9JL 2XFXA 3VXUE 2YPVH 3W9EB 1BIIA 2QQLL 4NQCD 1Q9KA 1RK1A 4HJGA 2F8VA 3T0VA 5CS7A 4PRBA 1GGBH 3LEVL 1LO0H 4YPGB 5HSFA 4DJMA 4G9DA 1JNHB 1E4XL 1K6QL 3FT2B 3CVHA 2ZCHL 4G80A 2GJJA 3QT2A 3SKUD 4QCIB 3VGGA 4PJXF 3KDMB 4R97C 5I1AB 1FNGA 3K0WA 1A6UL 4DUVA 2WWMC 1RZGA 1LP9F 4NUJA 3SDYL 4ZDHA 2IPUK 5C2BH 3GSOA 1EEYB 3SDDB 1U8PB 1PG7L 4ACPA 2R1YB 1CQKA 3EFDL 4PDCE 2UWEF 2NCMA 1L4IA 3IJSB 4LPXA 1XR9A 1OGTA 3P3YA 4XWGL 1MCOH 5FYKH 4J3XA 2YWZA 4ODWB 2PTTA 3WNMA 2M1KA 3O11B 4PB9H 1RUPL 2BOCB 3OAYH 5FO8B 2MPAH 3ZT6A 1T1YA 3IFLH 1IEBB 3KLDA 3ZKQD 1P7KA 3N1PC 2VZVA 5EBLA 1YDPB 3LSOA 1LO4L 1P2CB 2AV1A 2YPLD 4N8PA 1FFPA 3MRNA 1I1AB 4R2GD 4P48A 4YFLI 3NABL 5FYJL 4HBCH 4FQPA 1CCZA 4J8RB 5HHNA 4LPWA 1T4KB 5BOZG 4KK9C 4R0LB 1JTPA 4NRXB 4YZFF 2LAGB 4Y2DD 4WTZA 3RNQB 3MJ8B 4GMSH 1FNEB 2VXQH 4DQOL 2W9DH 1XGYH 4AK1A 1MCEA 4LQ1A 3VXMB 4R4BA 5CBEB 2B5IB 2VZSA 2GK0B 3DXAD 4B5EA 3RGHA 2J6EH 2L0DA 2VITA 3DUUB 4A2MA 2HH0H 3HUJF 1RUMH 1TQBB 2Q3ZA 5A16B 1NGXB 5B39B 3NIGF 4QRSA 4LCWB 4X0KB 5E5MB 3MROB 4K94C 3TZVA 1NGQH 2Q1EA 2YC1B 1LK2A 2W0FB 3WS6C 2P5ED 4NC1C 5HJ3B 2NY0C 1J7VR 1UM6H 2IADB 4E41E 1MRFL 4QXGH 4GRLD 3VGDA 4H5SB 4WHDA 3DVIA 2A9NL 3C6LC 2G5RA 1B0RB 1OL0A 4JFEA 3AM8C 3AREA 4U0QB 4Q2ZB 1FYTD 2DIJA 1RSFA 5C0BE 3DV4A 2AJYH 2X7LB 1FZKB 1KEML 4FHBD 1ZHBA 5F1IA 1AIFA 4N0CC 3LZFL 2XN9A 2Q8BL 4LLVA 1UC6A 3GJFH 4OGXL 4N8CL 2W38A 4M8QA 3KXFA 3HPLB 1P5UA 1RZJH 4Z77B 3RL2A 2PXYA 1HH6A 1SJHA 3OB8A 3QRFM 2WWMD 4MAYB 3CCHB 2ITCB 3JSSA 3ARDA 3D2UA 2F5AL 2YN3A 1HKFA 3IFOB 3UYRH 3T0DA 3WFDH 4GW1B 1UZ6F 4Y1AA 1G7PA 1XIWC 2EE9A 3MRCA 5HPOA 2EIEA 1DVFA 3OAZK 2I9LA 5F1NB 3OKDB 3QIUA 1I3RA 2C1PB 2VZ1A 5AUMA 4KDVA 3RWEB 5DWUH 4TULH 1KTDA 15C8H 1SBSH 4H25A 1L6XA 3BVNB 4XP4H 4Z8FH 1QFWH 1MJ8L 1T3FB 2ITDB 3UBXB 5JORB 1TJHL 3RU8L 3BUYB 4UT7L 4XBGB 3TESA 5C08A 1YN6B 2IH3B 1KPRA 1OAQH 2BRQA 4Y4FB 1ZLUH 3PL6A 5DSCA 4PJEA 1M71B 4PRPD 1RURH 4S1QL 4KK9D 4NQEE 2BNQB 3DVNB 3F7VB 1N2RB 4KQ3H 2QJDA 4I18A 4F3FA 2G9HA 4NO0D 2IALA 4WJ5B 5DUML 5C71A 2Q6WA 1V3JA 3GKZA 4HZLA 1RHHA 2A83B 5FM8A 2DLHA 5FYKU 1H8NA 3OR6A 3QG7H 4WEBH 3UJJL 4PBVC 5SX4H 2J8UA 4Z5RA 4EI5C 4U1GB 3OX8A 1IAOB 4LSVH 4JQIL 4LU5H 3DUHA 4M6NL 1U0QA 3GSUB 4YDIH 1E6JH 1T89A 4L4VA 4P2QD 1N64L 3W0WB 3OGOE 4OD2A 5DMJB 4DKEL 3ZDXE 2VWEC 1KN2H 1G1YA 1MRCH 5CD3B 3TH2T 2D7PA 4XNUL 5JOPD 4HIHA 4J23A 2CDFB 1WWCA 3GGWA 3QDGD 4OKDA 2NY0D 3GMPB 4NO5B 1Y6MR 4G9FB 3ULUH 1BF2A 4E9LA 3VWJB 5F7YC 5ESVB 5JNYA 4C83A 2KKQA 3C6LD 1CE1H 1C8PA 1S7WA 3O4LA 4Z7UB 4BK4A 5HXMA 5DJ8B 1GC1H 3ARTA 4ZPTA 5JIPA 3SO3B 1G9EA 4M1DH 5L8KB 5C07A 3A6CH 3BESR 2G75B 4OZIF 4OD3L 5E6YA 2J4WH 3GBLA 4N0CD 4ZFGL 4Z9KB 3FQTB 1FVCA 3K4AA 1S7SA 3MJ7A 1LD9A 2CLRA 1VFMA 1ZHNA 1K5NB 5T1LD 5C70A 3FCTA 4OV6F 3P11L 1NMBH 3WN5C 2IPUG 2PCPA 1A7RL 5KOMC 2JK5B 1D5IH 4RA0C 5HHOD 2V7NA 1OSZA 1MCPH 5F9WB 3MXWL 3D25B 3MNZA 2XNAA 5DJAB 5HI3C 2QR0A 3TJEH 4RDQF 1XIWD 5FGCB 2W1NA 3FQUB 4YDJB 1YEHL 2DQEH 4Y0GA 2NXZC 3F58L 4MAUH 5C8JB 5I1GH 2W9LA 5BVJA 4UILL 4DEPB 4MJ2A 3RNKA 4G5ZL 3OXSA 1B2WL 1KULA 2BVEA 3K4ZA 5TPWH 4YHML 5KVFL 1TMCA 2OP4H 4G8GD 5JQ6L 4LLMA 1TITA 4U2ZA 4J3OC 4OB5H 1OWRM 4JM2C 4O2CB 5I74C 3S37H 3W9DB 2XXMB 2DICA 4OCWH 4ZOBA 5CZXC 5LBSH 4LSUL 3HNTL 3CDGB 2DF3A 2VQ1A 4M1GL 1P4BL 5EORL 3U0TA 5IT2H 2XWJB 5I71B 4NJAH 1K4CA 1XF4B 3SE8H 1Z9LA 1M6OA 5FO7B 3AMKA 4YPJA 4YDKL 2Y5EA 1R3KB 4OD1H 4CUCA 1JWMA 1NCAL 1PGRB 4NM8L 2DOCA 2HLAB 3I9GL 3UJTL 5DVOA 4KGJA 3MCLH 4HXAL 1V7ML 4OLUH 5D2LB 4P46B 5AZ2L 1MQKL 5JDSB 1UJ3B 5TGBB 1OOAA 2P49B 2OR7A 2H9GB 5IQ7L 2XFXB 1BIIB 2K7PA 5HYEA 2AJVH 3QA3A 1Q9KB 3KYKL 1PX4A 1RK1B 4HJGB 4EI5D 1J8HD 1CXIA 2V5RA 4MD5A 4AEIL 4YE4H 4PRBB 4F7PA 2IBZY 4ZO7A 2AABL 4G9DB 4YEEA 1QFHA 2ARJB 5DMGC 3CVHB 2UZIH 5CP3H 5FHBH 4G80B 4I3RH 1FLRH 1FNGB 2E27H 3QUYC 1RZGB 4RCAA 4NUJB 4ZDHB 3GK8L 1I8LA 3GSOB 5HDLA 5KG9A 3MJ9L 1OAZL 1FO0L 1XR9B 1OGTB 3KPNA 1SY6H 3LEYH 3TO2A 2PTTB 4CN1A 1BJMA 4YR6B 5HVGB 4QRQA 4NWUH 3SCMA 4ODSL 3LS5H 1T1YB 2DQFA 3OXRA 3BKCH 5JXEA 3FRUA 1P7KB 4NCC2 1DQMH 2V6HA 2VO5A 2VJXA 3BGFB 3KS0J 4WEMB 4IIQC 5E8PA 1ZLSH 5EBLB 1OTUC 3LSOB 3BIAX 4HWZB 1AQDA 4KHTH 2AV1B 4Q7DA 2X9YA 3BKML 2Z31C 1FFPB 1G9ML 2FLRT 3MRNB 4LQFL 2EZ0D 3SDAA 3U36A 1KC5L 2ADFH 4WFGE 1FGNL 3TPUA 2RAMA 5HI3D 1OAKH 3MBEB 1OF2A 5HHNB 1QP1A 2VB5A 3T1FA 2NXZD 1AXTH 3WFBH 1QUNA 4RAVA 2IAMA 4QOKD 4R4BB 4JM2D 3TC9A 5I1IH 1L7TH 1T1WA 3OJVC 5CZXD 2VITB 1ITCA 2YRLA 1KN4H 4OM0L 4MLSA 1I3VA 5T3XL 1WF5A 1IRAY 2AV7A 4Y5XA 2F53A 3F7QA 4HDIA 1C7TA 4QRSB 1IC5H 3C09B 5EO1A 2OTUA 4XC3L 3TZVB 1RZKH 4M6ML 4UT9H 5C1MB 5GZNC 1LK2B 5GJTL 4NNPH 4FQXC 5J12B 3BD3A 4HV8A 3WIIH 3Q3GA 1AD0A 2E8ZA 1Z6JT 3OR7A 1IQWL 1JRHH 4HX1A 4HULB 3DO7A 5C0NC 2OBGA 3FB5A 1DL7H 4P2RE 2AAVA 4JFEB 3AREB 1D6VL 2E7MA 4E5XA 5DFTA 5DFWH 1MHHA 3DV4B 1ZHBB 3BJLA 2BNQE 5F1IB 1AIFB 4NUGH 2XN9B 4PV8A 4QKXB 4LLVB 2HN7A 3S37X 6FABH 4POUB 5DMGD 4M8QB 3W81A 4N5UA 4XC1L 1NLDL 2ENYA 3KXFB 3ROOA 3RL2B 5LQBL 1N7ML 2P8LA 2PXYB 1HH6B 3OF6A 1SJHB 3QUYD 1GXEA 4MJ6A 3OAZH 5F89A 4GBXC 3ARDB 3D2UB 4HPOL 4QHUB 1AKJD 3DX9A 5CGYC 4R90L 4Y1AB 1G7PB 5GS2D 3MRCB 2OCFD 1DVFB 2O5YL 2EH7H 5J1AA 2I9LB 2HFGL 2NX5E 4MA7L 1C5CH 3QIUB 1I3RB 4CJ1A 1I9IH 1JZ3A 3L6FA 3MYJA 4HK3J 5AUMB 4WI2A 2BDNL 1KTDB 4H25B 4PRID 3AC0A 2DI9A 4R9HA 1WITA 2F8OA 4PJ5D 3UTSB 1OTUD 2VR5A 5GGVL 1RZFH 1QQDA 1J1XL 1NFDF 4O5LL 3AS2A 2Z31D 1P69B 5C08B 4EVNA 4TNVK 2JIXA 2CXGA 3EYFB 1KPRB 2YRPA 5DRXB 1K8DA 2APVA 2VZTA 3MQIA 3PL6B 5DSCB 4PJ9C 4PJEB 1SJVA 4HWBA 2NY4B 2EDOA 4D94A 3BZEA 1NCWH 3BOVA 5F8RC 3QNZA 3H2WA 4DAGH 1WWWX 2VDRL 1YYMH 2CJUH 5I1DA 2IWGA 3L3GA 32C2B 5FGRA 2A6DA 2VMFA 2G9HB 2FH8A 4F3FB 3Q6GH 1HZHH 2IALB 3A0OA 1XGQA 1IE5A 4Y19B 1ZVHA 5A2KH 2Q6WB 1KCKA 4HZLB 1RHHB 2BVYA 4IS6A 1NC4D 4HKXA 4FQ1H 1HINL 4KTYA 3U4BH 1GYAA 2NR6C 3QHFL 3OR6B 3VGAC 1HDMA 5TE6H 2J8UB 5FGCE 2FJHA 5FM5M 5DD3L 5E2VL 5GRXG 3OX8B 3MRGA 2BRRH 1FZOA 4Z7QF 1RMFL 4L4VB 5CZVH 4OD2B 2WP3T 5F7LB 4WFEE 4YHIA 4L4TB 1EJOH 5GZND 4FQXD 4FFEX 4HIHB 5BOPA 4A6YL 2QADB 3GGWB 1NMCB 4MA8L 2ICWA 5EA0H 1L0YA 3WFEL 2PR4H 5C0ND 1VSCA 4GUPA 5ILTL 5DC0A 5IB5A 5HGGS 4C83B 4IDJH 1P7QD 4BFIA 3TF7A 1S7WB 3O4LB 2DLIA 5B3NA 3LIZH 3SE4A 4ZPTB 4MVBD 5C07B 3BEVA 4BK5A 1UACL 1FZMA 4LSPH 2FLBT 12E8H 5I18H 2IPKA 4KMLB 1FVCB 4DKFL 2KUTA 1XF3A 3LCYA 1A4JA 4NQCA 4AM0A 3MJ7B 1CTOA 5F9OL 1MVUA 3B83A 5EUOA 1ZGLM 4FFYH 1ZHNB 3TBWA 4PTTB 4UNUA 1BGXL 3QWRD 3FCTB 5D2LE 3GDBA 4ELKA 4KDTC 2VDLH 2PCPB 4LCCC 5D9SA 3T08A 4GBXD 1CBVL 4J6RH 2V7NB 5HHPA 4JR9H 4XNMA 1OSZB 1OT2A 3K8KA 5CGYD 3OAUH 3MNZB 2XNAB 1S8DA 1RULL 4LSSH 3FQXA 3U0WL 2QR0B 5K33A 4LVNC 4XCCH 1UM5L 1P84J 2CRMA 3NA9H 3MLUH 4J3VA 2I60L 4PJDF 5BVJB 1CD9B 3RNKB 3PP4H 1R3IL 3OXSB 2FEEI 3IXTA 1TMCB 1U3ZA 1U42A 4Q9RH 4UT6L 4LLMB 1EMTL 4G7YH 1CE6A 3DECA 1AGCA 1Z2KA 4OF0A 3OZ9H 3AB0B 1FVEA 3S35L 1F4XL 3EGSA 3ULSA 2ZOKA 1IKFH 3MJ9A 1E4JA 4OLWL 5IHBA 1FPTH 1FO0A 2VQ1B 1DBMH 3AUVA 3U0TB 1CGSL 1UYWL 1YPZA 5F70A 1M6OB 5LGKA 4X7FC 2CO6B 1DBJH 2J8OA 4PJ9D 1PZUB 4XNZB 5CGMA 5KVEL 1JWMB 4NHCL 2YPLA 4S1SL 3FQWA 4P3WA 3A6OA 2VR9A 2O93L 2BFVL 4YUEL 3NA4A 4I9WD 2QHLA 4FOMA 4KUCF 1ZANL 3UXFA 5EB9A 4G6KL 3V52H 3GUTA 4BQBA 1CGYA 4EN3C 5IFHH 4R8WH 3RX5A 3CXHK 5HDBF 5IR1A 3K1DA 4AL8L 3WHE1 2NR6D 4Y2DA 2CGRH 3MLZH 3QA3B 4YAQA 4OIIH 4M4RA 7CGTA 1MCBA 1JNNH 4MD5B 5AWNH 1G0DA 4I8DA 1PY4A 4F7PB 3DXAA 3MOBL 4TSBH 4Z7NE 4H20L 2HKHL 1ZV5A 2LVEA 5JIKA 3VFNA 1MRDL 3HLAA 1PJ9A 4NZRL 4QGYA 3QIBC 3ULVF 2OL3L 4RGMC 1XAUA 2VLRD 1MCWM 3CMOL 3SGJC 4ODHL 2YD1A 5KG9B 2P5EA 5AYUH 1EAJA 3KPNB 2AGJH 3HC4L 1NDGA 3MA9L 1OCWH 3TH3T 2B4CL 3TO2B 1MJUH 4GRLA 1AGDA 3V4VL 4QRQB 4XNYL 3SCMB 2OK0L 2DQFB 1RUKL 3FRUB 1FYTA 3CFJA 4M7JL 3TT1L 1C5BL 2OZ4L 4FQ2L 4ZTPL 4NKIH 5E95B 1XR8A 5E8PB 5I0DA 1AQDB 2BNUA 2IQAA 4TUJA 4M5ZH 1J18A 5HGDA 3SDAB 1GZQA 5GPRA 1NBQA 3U36B 3T0BA 2VIRA 5IJVA 1ZKAA 4NFCA 1FBIH 2ADIA 1T1ZA 4D8PA 1OF2B 1BZQK 1D6EA 4KI1A 4PV9A 4XPBH 4OIAA 5DEFA 3T1FB 1YNKH 3KXFE 1U3YA 3QULA 4RAVB 5MI0C 1IAIH 4WRLA 3FO2B 4C56D 2IAMB 4BUGA 3S7GA 1HSAA 4K2UL 1P4IL 2FD6H 4HKBA 3B8SA 4X5XA 2Z92A 4ETYA 4KQ4L 4UU9A 3KPRE 1U6AL 1YY8A 1T1WB 2FBJL 3I50H 5IBUB 2ZWLT 5DC4B 1A9EA 3QXTA 1F4HA 1DN2A 2AV7B 2ZUWA 4Y5XB 3NTCH 2F53B 3I6KA 4HDIB 3ECBA 5EO1B 4IMLA 2OTUB 3QIWC 3MLSH 3UJIL 3MUZ1 4LGRB 5DA0B 4HV8B 4TOYL 1FH5L 2DIBA 2F5BH 5ITBH 3Q3GB 1B9ZA 3AS3A 4DOHB 4XPFH 2QQNH 3KLAA 4NKMA 1NCCH 3UTSE 4HX1B 1IBGH 3O3AA 3DO7B 1TTFA 4EN3D 4ZPVA 3FB5B 2Q3AA 1I9JH 2QQLH 4XCNA 1RJYA 25C8L 3BIKA 4E5XB 3V0AC 5CD5C 3RKPA 3RWIA 1MHHB 4NO0A 4RMWA 3LEVH 5ALBL 3U46A 4AIZA 4EUPG 1B6UA 2EYTA 1E4XH 4PV8B 2HN7B 4MB4A 3IRZA 2JJSC 4OZGB 1ZOXA 2VXUL 4JY6A 3ROOB 1IEAA 4Y19E 1A6UH 1JGEB 2P8LB 3SDYH 3ZMRA 3ZE0E 1JVKA 2RR3A 3QIBD 3W5NA 4P2QA 5F89B 2X4SA 2MMXA 1XZ0B 3DX9B 5HHVL 3FN3A 3AVEA 3WS6A 4XWGH 5LGJA 1ZA6A 1MJJB 3ZE1F 3QDGA 3KPLA 1KCVL 1RUPH 3W11C 4L4TE 2NY6B 3L6FB 3VXSD 3MYJB 3IAPA 3RIFF 3PQYD 4A6YA 2V9QA 3AM8A 3VMNA 1CD1A 2IBZX 2DM7A 2VZ3A 1DUZA 1LO4H 1OSPH 2LFGA 4N0CA 4U1NA 1CWVA 1QQDB 3O4LE 2FHFA 2JJTC 5F9JB 1T0NA 1LGVA 4KRPC 2FWOA 4EVNB 1T7ZA 4JG0L 5FYJH 3TCXA 4CVUA 5C07E 3H9SD 1K8DB 1NKOA 1H15A 5T1LA 3WV0A 2DQDL 2E7LC 4Q9BA 3BZEB 1X5HA 1N6QL 3QNZB 2CUHA 5HHOA 3ARWA 4DQOH 3V6OC 5I1DB 1RI8A 3L3GB 5EBWA 2A6DB 4PJGE 5CJXC 2DQIL 1XGQB 1XIWA 3L3OA 4IS6B 4HKXB 3PF2A 3O0RL 1TVHA 5DYOA 4OGAC 1HDMB 1QLFA 5DURB 5GSVA 5D5MF 4G8GA 4J3WA 2FJHB 3ARGC 3EOTL 3P4OB 1FLTX 3RY5A 2BXYA 3MRGB 2GSIA 1IARB 1FZOB 4U0RC 2XRAH 1DN0A 3DWTA 4YHZL 4ORZC 1MF2L 5KJRL 3QIWD 4WU5A 4YHIB 2X1WL 1EZVY 3QDMD 5A2LH 4C57C 4HC1L 1MRFH 1QHPA 1T6VN 4MXVF 2YD9A 3IRPX 1BLNB 4GUPB 2B7DT 5DQDL 5IB5B 4NBZB 3BPNB 3GMLB 4BFIB 1EEZA 5CD5D 4L3CA 3HE7C 3BD5A 4TVPH 1BQHG 3LZFH 4K9EC 5MHSD 3BEVB 2Q8BH 1BFTA 1Y6KR 1FZMB 1GVIA 2WANA 3ARYA 4OGXH 1W0VA 3BH9A 4N8CH 2IPKB 2OI9C 4M03A 5DMIH 4AM0B 1XF3B 3V8OA 1A4JB 4NQCB 3SY0A 3JXAA 5EUOB 4LLQA 4EI5A 3TBWB 1J8HA 1UH3A 4ELKB 3FOLA 4AQOA 1ODAA 1W72H 1L0QA 2F5AH 5FV1L 5D9SB 4PJ7A 4KRLB 4XBEL 5HHPB 1QSFD 4RRPG 4XNMB 1VHPA 2YMXL 2X4UA 3JWDC 1S8DB 5GIRA 3LKOA 3DHJA 1T04A 1DBKH 2EDDA 5I2IB 4FQHA 1LHZA 3W11D 2FGZA 9CGTA 4DVRH 1B88A 3IXTB 4GRMB 4M9OA 5JW3L 1CE6B 1MJ8H 1ZLVK 4JHAL 1AGCB 1TJHH 4N0YL 1H8SA 1FV1A 4UT7H 4NOBA 3EGSB 3ULSB 2ZOKB 3BKYL 4AIOA 2VXTL 2XZQL 1FO0B 4KRPD 1JPTL 2XA8L 5FUCE 2GIYA 1KOAA 4WUUD 1YPZB 3PGDA 4S1QH 3WN5A 4UB0L 4QRPE 1NFKA 2YPLB 4R6UA 1I7TA 3FQWB 2VDQL 1AQKH 1MCSA 3FZUC 5FF6A 5T1KD 4R2GB 3PXJA 4IEFB 5DUMH 3UPCA 3GUTB 4NT6A 2R29L 5DHYA 1T1XA 3GI8L 4OTXL 4P5KA 4NN7B 5IR1B 3B5TA 3UJJH 3K46A 2QKIA 4Y2DB 4NO2A 4DUXA 4OGAD 5E1HB 4UINL 5F9AC 3QBTB 4YAQB 4JQIH 3ARGD 4KI5C 4M6NH 4QOKA 1V5JA 1N64H 4DKEH 1KYOK 4JM2A 5D1QC 3DXAB 3EDJA 1J0ZA 4AEHL 5GGRY 2VLJD 3VFNB 3G5VA 1Z9MA 4U1IA 3HLAB 1TTGA 1CLYL 3BSZL 3GMMA 2GTWA 2VDNL 3KPPA 3WFHA 2DLFL 1U8QB 1WEJH 2PW2A 3WIHL 1D3CA 2HT3C 4X9IA 5FUOL 2P5EB 4KHXL 4OD3H 1CXKA 3HE7D 5MEND 4ZFGH 1NDGB 1PY9A 3QH3A 4GRLB 1AGDB 1KUMA 3WNPA 5IESL 4QRRD 4DOHE 1S9VB 1FYTB 3CFJB 1CVRA 1N0XL 2B2XL 4P4RA 3TNNA 5FYLD 3PIQA 1XR8B 5EZOL 1A7RH 4K7PY 1BAFL 5GS1C 3DSFL 1IZKA 2BNUB 4NKQB 5KS9A 4TUJB 4QHMA 3L3DA 5CKGA 3MXWH 1GZQB 3DARA 5IJVB 1QVOA 1MREL 2PETA 2ADIB 1T1ZB 4R97B 1TENA 4D8PB 1D6EB 3QUYA 3MO1A 3F58H 4PV9B 4UILH 3U6RA 4OZGE 3IJHA 2F15A 5DEFB 4HH9A 1B2WH 5JPMA 5KVFH 1AKJA 5C0CE 5JQ6H 5ECJE 3MLYL 1O7VA 1IM3A 2ZOLA 4KMTL 3KJ4B 1UB5B 1HSAB 4KVCL 4MYWB 2RJMA 4HKBB 4HKJA 3DRTA 4X5XB 2Z92B 4UU9B 4LSUH 1NAML 3HNTH 1II4E 4NM4H 2R0KL 4M1GH 1P4BH 3GIVA 1LQVA 5EBMA 3QDAA 3L95A 5HY9A 1SEQH 4CBPA 1A9EB 2FHCA 1F6FB 4YDKH 4PRIA 3T0AA 3I6KB 2QSCL 3ECBB 1NCAH 4PJ5A 4IMLB 4NM8H 1IC1A 2JCCF 3I9GH 3UJTH 5FM4A 1MCCA 2Z31A 4JPVL 1C08A 4HXAH 3FZUD 4ZFZA 4X80L 4NKMB 3INUL 4L9LC 3AAZA 1MQKH 3O3AB 4PRPB 4D2NA 4ZPVB 3UTOA 3QPQC 5CSBA 5IQ7H 4MQ7B 4XCNB 3MLTA 2HJKA 3GRWA 3KYKH 1RJYB 5TFSL 3HNVL 2J3SA 3PDDA 4KZDH 4EBQL 4NO0B 4KI5D 3IDJA 5DJ0A 4AIZB 4M7LL 2AABH 2EYTB 1NC4A 4P2CG 4XVTL 5D1QD 4QNPF 1QO3A 3B6SA 4JY6B 1IEAB 2O5ZL 1IILE 1UA6L 4JO3L 4X9HA 5FCUL 4P2QB 2X4SB 4AEFA 3O8XC 1CFSA 3MJ9H 1OAZH 5AZEL 1G7LA 5B3JE 1FO0H 2WW8A 4FQXA 2HT3D 2IEPA 5LGJB 3QQ9C 1ZA6B 3PV6A 1RIVL 3QDGB 3KPLB 3TVMC 2NY0B 3NZ8A 3QDJE 3REVA 1BEYL 3BO8B 4ODSH 1P7QA 3C6LB 2AEIT 4A6YB 1CD1B 3EAKA 4MVBA 3RA7L 5C9JA 3LS4L 1DUZB 3FMGL 3GSWB 4RISL 4U1NB 4P5TC 4LGPB 3QHZL 3UMTA 4LQFH 3CDYA 5ADPH 1KC5H 1T0NB 3K1KC 1FGNH 2FWOB 4GT7A 1ETZA 2AKRA 4XTRC 4G6JH 2KZWA 1H15B 5T1LB 3QWRA 2ESVD 3VFSA 2D03L 4RMUA 1A0QL 4XHQA 4WNQA 4GBXA 1G1CA 2J5LC 5LAXB 5HHOB 1K8IA 5EBWB 2EIBA 3R4DA 3BH8A 3C5JA 3HI5L 1XIWB 1DLHA 2C4XA 3L3OB 4OM0H 3WDIA 1TVHB 5DYOB 4XCYA 3ZDYF 5T3XH 1QLFB 2Z91A 4G8GB 1OD9A 4WCYL 3VRIA 2GSIB 1DN0B 4FP8L 4OQTL 4XC3H 4ISVA 2ENSA 5GJTH 4WU5B 6CGTA 3NCMA 2FEEL 4TRPL 4QTHB 4K8RC 4DVBA 5J6GA 4NZDA 1IQWH 1NBYA 5FDWA 1KV3A 4PJ9A 4O4YL 2EICA 3QPQD 3W5MA 1GPOL 1D9KC 1D6VH 1EEZB 3VI4E 4L3CB 3TH4T 3B9AA 4G6FD 5I1CL 5BV7L 1KELL 1T7XA 3OKMA 4H8WL 1V05A 1W0VB 1YJDC 3BH9B 5HI5C 4GOSA 4XC1H 4ZSOE 1NLDH 4XX1G 1JN6B 3SY0B 4PJFA 3NMEA 1OVZA 5LQBH 1N7MH 4LLQB 4EI5B 1J8HB 4XBPB 1BJ8A 3RWHA 2D7MA 3FOLB 1CI5A 4EXPX 1FDLL 4CMMA 3G9AB 1JGUL 3PDGA 4HPOH 3KPQA 4PJ7B 1M7IA 3HC3H 4KU1A 1YY9C 4XCFL 3O8XD 4L3AA 4UV4L 4R90H 5C7XL 4HCRL 2R0LL 2X4UB 1MCWW 1DJSA 3NCFB 4OF5A 5GIRB 3LKOB 2O5YH 3QQ9D 2OM5A 1T04B 3DXAE 1ZLVH 3TVMD 5K9QI 4FQHB 2YUVA 3H3PL 1PFCA 2VLRA 1E4WH 2DRUA 2KL6A 1FFNA 1NPUA 4XHJC 3F12A 3HMWH 3UO1L 1U95A 4GLRI 4Y88A 4MNQE 3RUGA 5DT1H 5GGVH 2KZ1B 5IW1A 1FVDA 1FV1B 4O5LH 4P5TD 2X4PA 3T2OA 4XTRD 4FFVC 1RHFA 3PGDB 4UIMA 4KDTA 4L3EE 3WN5B 2VDRH 4LCCA 3MZGB 2EC9U 5FF6B 1OAYH 5M95B 5ENWA 2ICEA 2DQGL 3V79C 1NCBL 3LQZA 4Z95L 2CKBB 4NT6B 3SHSA 5DHYB 1T1XB 3ZYJA 4P5KB 2R4SL 3QHFH 2NXZB 2QKIB 4EUPA 4NO2B 5DD3H 5E2VH 1ORSB 3CSBA 4C56A 5IVXA 4QOKB 4Z7VF 4QHNA 3CDCA 3UAJC 1RMFH 4LCYB 3SDCC 3W2DL 3TCLB 4JM2B 3IFNH 2DQHL 5I74B 3MR9A 3QZWA 4LMQE 3CAFA 4A6YH 4K8RD 3G5VB 2NMSA 4JO4L 4MA8H 4X7EC 3WFEH 1QFPA 1NQBA 1B3JA 1WJ3A 3T65A 3GMMB 4DW2L 1NAMA 2GTWB 3KPPB 3N1GC 5DUBA 3KYAA 5ILTH 5LKNA 4P3CH 3CLEL 2PW2B 1CXEA 1D9KD 4PS4L 5K93A 3WO4C 3DGGA 3MV11 1UACH 2X4QA 5IV2A 1R5WB 3ARSA 3NZHL 4APQC 3PG2A 4D0BA 5A2JH 2X2YA 4EN3A 3RIFK 4DFHA 5FYLL 3MLPA 4DKFH 3WDHA 5DA4A 5HI5D 5F9OH 2KBGA 4L8CA 3O2DL 1BGXH 1JPGA 3GO1L 4PRPE 5E8EA 4P4RB 3TNNB 3JWDL 4ZYKA 3PIQB 1CBVH 3A6BL 2FATH 1RY7B 5FA3A 2EC9T 3O6LL 4QHMB 5KS9B 3L3DB 4LVOC 3U0PA 3STZA 2PTVA 1RULH 3U0WH 1MSPA 4JHWH 1S9XA 1QVOB 1UM5H 5IB2B 3QUYB 3MO1B 3QIBA 2BC4A 3U6RB 1TXKA 3IJHB 1R3IH 4HH9B 2GK2A 2JELL 5JPMB 2A38A 5L6YL 4MD4A 1AKJB 1A7PL 1A3RL 3AGVA 5ESQA 1IM3B 2ZOLB 1EMTH 2BHUA 4XHJD 3SGJA 4GKZB 43CAA 1Q0YL 1JNLH 3VD5A 4HKJB 1FG2A 3DRTB 5D7IE 2LVCA 3NGBC 1F4XH 3S35H 1F02I 3V6FA 5CBAA 5JOPE 3GIVB 5HGHA 4KXZH 3NCEB 5EBMB 3VXSA 4NC1E 3TYFA 3PQYA 3L95B 1UWGL 1UYWH 3QDGE 5HY9B 4NP4H 1F90L 4FFVD 4PRIB 3QNYA 5CIPH 1A7QH 4OT1L 4UV7H 1EERB 5KVEH 2VAAA 4NHCH 5HGAB 4PJ5B 4S1SH 4HBQA 5INDA 1J87A 2BFVH 4YUEH 2Z31B 1C08B 1R5IB 1NUFA 4JQXC 1ZANH 2DYPD 4ZFZB 3H9SA 4G6KH 3FFDA 4OGYL 3AAZB 3C6SA 5GRYA 4AL8H 1X5YA 1J1PL 3MLTB 2HJKB 4Q97A 4S1DC 1BQHA 1W8OA 5HVFB 4EIZC 2WSKA 3IDJB 5DJ0B 4HF5L 3UAJD 3SDCD 3MOBH 5HHOE 1CS6A 1IC4L 1NC4B 5LCVL 1OM3L 3IAQA 4GG6F 1IC7L 3BP4A 2HKHH 1QO3B 3B6SB 4KAQL 4LKXB 3V2AR 3ARPA 1MRDH 1G6RL 2E5EA 2ZZUT 4U7KA 2H41A 4NZRH 2OL3H 3OKEA 2E7BA 4RRPA 3EBAA 1CL7I 3VH8A 4NQED 2Z9TA 1KNOA 3CMOH 1CFSB 2DM4A 3QIWA 4ODHH 4JHBA 4G8GE 4MXWL 1G7LB 4LLWA 2JLLA 4FQXB 3RWCA 3QDMA 4ZAKC 4K07A 3LN4A 5BVPL 4U1SA 3MA9H 4YNYA 2B4CH 3NZ8B 3REVB 1CQYA 4APQD 2CIIA 3V4VH 5IW3A 4XNYH 2OK0H 4M8VA 2G5BA 4PJHF 3VMPA 1P7QB 1RUKH 3L3JA 3BHBB 4M7JH 3TT1H 1C5BH 4D9QD 2OZ4H 4FQ2H 4ZTPH 1UEYA 5F7UA 4OFYD 3U7WL 2V5YA 4X9BA 2EYSA 4U1JA 3T3PF 4Q0XH 2ATPA 2EDHA 2FJFA 3RPIA 5I9QC 2JJSA 4U6HA 1ETZB 2AKRB 3ERYA 4ODBD 3HAEG 1I8KB 1FG9C 1ONQB 5C3LD 5IFJA 3C87A 2EDTA 4GBXB 5F6IC 4LDLB 1U9KA 1QSFA 4OF7A 1QBML 1K8IB 5L7XL 4RWYL 1P4IH 3BH8B 1CIDA 5EN2A 3C5JB 5HYFA 4KQ4H 1FCGA 1U6AH 2HVKA 1RFDH 2VWEE 4HCRA 5KVGL 1RUAL 4FABH 2Z91B 1FNSH 1BZ7A 3ULVH 3VRIB 4MWFA 5H94A 3RTQD 3UJIH 2WINA 4ISVB 3PHSA 3NIFF 1U8LA 1MFAL 1FH5H 1QFWM 2JJTA 5TDOA 4DVBB 1AC0A 5J6GB 1A6PA 4M62H 4WUUA 1I8IA 1NBYB 3G6JA 4XVUC 1FC1A 1MCKA 1H3TA 4PJ9B 3TIEA 1NLBL 2E7LA 3O41A 25C8H 1EX0A 3NAAL 3V6OA 5T1KA 3VFOA 1KIPA 1KTKE 3CD4A 5ALBH 3DNKA 5CJXA 4M7ZC 3DBXA 3RJQB 2H3NA 1JHTA 4NJ9H 1J8KA 3OKMB 3VXTA 2VXUH 1S3KL 1UB6A 2X42A 3HZYA 3VGAB 4PJFB 4X6EA 1CDBA 3ARGA 1OY3B 3AXLA 4CMMB 1PX3A 3GFUA 1YMME 3KWWA 1G84A 2VKWA 3KPQB 1M7IB 5HHVH 1NBZA 1R3LA 2FO1A 4QOKE 2KQNA 1FYHB 1UWEL 2VLJA 4ZAKD 1DQJA 5HHQA 3V4UL 2ZUYA 1I4FA 2YBRB 4DFIA 1QFUL 4PP8C 4W81A 4ESKA 4OZFG 5K9QG 1FRGL 5I8CA 4EXKA 2VLRB 4QF1A 1FFNB 3ILPA 3F12B 3D3VD 4CVZA 4J1UA 1UXSB 4RMTA 1U95B 5DFVC 3HE7A 5EFIA 3RUGB 1CDIA 5MENA 4G8IA 1MCRA 5IW1B 2R2EA 1D5ZA 1FVDB 2J88L 2X4PB 4JG0H 4Y4KC 2OI9A 3KPOA 4XP1L 1T7YA 4S1RL 3VFWB 2YN5A 4PGDA 2I07A 2DQDH 4AJ0A 4UIMB 4JDTL 5ALCL 1N6QH 1LO2L 3NCJL 5ETUA 3VMOA 5IUSA 4LCCB 2DJUA 4GFTB 3O2DA 4K23L 3RY4A 2N7AA 3T4AA 2DQIH 1FAKT 4PYGA 5ENWB 3RVVC 1L8JA 1M1SA 4H26A 3LQZB 1KB5H 4LVNB 4LNRA 4FQQA 3O0RH 5KS9E 2FR4A 3P0GB 4CU7A 2EO1A 4EUPB 3OJ2C 4ELMB 1BVKB 3EOTH 2NY2C 1CU4L 1DBAL 5LVEA 4C56B 5IVXB 4YXKL 1YNTA 3CFIC 4K8RL 4QHNB 4ZO9A 1MF2H 4DKDC 5KJRH 1CZ8L 3MR9B 5TQ2L 4DK3A 5DS8A 4HC1H 4TSCH 4WFGD 4XVUD 1PZ5A 4ORGA 3T65B 2M2DA 1NAMB 4DGIL 4R3SA 5HDOA 5DUBB 1UKTA 1XF5A 4UZGA 3NPZB 1HNGA 4PRIE 3TT3L 2JB5L 4Z7WE 1VGEL 3DGGB 1AXIB 2X4QB 4PJ5E 4LBEA 4D0BB 4EN3B 4Y16C 3MMEA 2VH5H 2Q20A 1G0YR 1JF6A 3W39A 3CJJA 3P73A 4L8CB 2RBLA 2ZNWA 1MWAA 1JPGB 4D0DA 3U2SA 4ZYKB 2W0PA 5FHAL 3LKQA 5KSAC 4XBEH 3SDXE 3TPKA 3L3IA 5D1QA 4GXVL 3VFUA 2B0SH 5T5NG 5EZJA 3T04D 3VG9C 1F4WH 3U0PB 3STZB 5CSZA 5EWIH 1GGUA 5FGSA 4FNLH 1S9XB 4MNGA 4JPWL 4JAMA 5I1HL 5IHZA 5J9PA 3QIBB 2BC4B 3UZQA 5JXAL 3ES6A 4RGMB 3GSRA 1G6RA 4MD4B 1ACYL 4P2RD 1UKSA 5ESQB 3D48R 5HVWA 43CAB 4JHAH 5DFVD 5IMMA 4N0YH 1FG2B 5ACMA 2C1OA 3VRLE 4AZ8A 1T7WA 4GW5A 2XZQH 3V6FB 5CBAB 4AQ1B 3QXUA 3THML 1JPTH 2XA8H 5HGHB 3VXSB 2ARWA 3PQYB 3AS0A 4Y4KD 1JZ4A 3UTZA 1NCNA 3QNYB 4QHKJ 2JKXA 4UB0H 4NZJA 4XNQA 3RWDA 2VAAB 1JBJA 5E8NA 4FMFA 5INDB 5GS1A 2VDQH 4JB9H 2Z8SA 3SE9L 3ALWA 3H9SB 3HCVA 3RVVD 1FNAA 3FFDB 5AAWA 2R29H 2ESVA 1L7IH 3C6SB 3OJMB 1CT8A 3GI8H 4OTXH 4MCYA 4XXDA 2NX5D 3TGXA 1QBAA 3B5HA 5FKAA 5E94A 1BQHB 1WTLA 1SYSA 4Q6IC 4UINH 1TNNA 4GXUM 3TN0C 5IB3A 3QQ3A 2VTFA 3WNKA 2NY2D 5I1EL 1KF9B 5MI0B 2D0FA 1WFTA 5F7DA 5BZWB 3RVWC 4LHQB 4X6CE 3JV5A 1SVCP 2PN5A 4PJCE 3BP4B 3IS1X 3V8CA 3WCYA 2OTWA 2ZSVA 1CLYH 3SJVD 3OKEB 1CG9A 3ZYIA 4PIRF 1QRKA 2DLFH 1JMXA 4NBYB 3WIHH 3R0NA 1KNOB 5EDXA 3QIWB 4Y5YC 5FUOH 5TF1L 1WZLA 4LLWB 3QUKA 3RWCB 3QDMB 2YD8A 3IDYC 4JLRA 4ZQKA 3LN4B 4U1SB 5DQJB 4RGOL 5CGTA 1QLEH 4Y8DC 4L9LA 2CIIB 1WISA 2VAJA 1K4DA 3BP7A 1EO7A 3GSVA 4Y16D 2G5BB 1T5WA 3L3JB 1S7VA 4WU7B 2P7TA 2RCSL 1FSKC 1N0XH 2B2XH 4ZUTA 5EZOH 1U92B 1BAFH 3DSFH 4U1JB 2X1OA 5KSAD 3BRDA 3MFGB 1HI6A 4O2EB 3DI3B 2EXWC 2ATPB 3GMNA 2FJFB 3RPIB 1M05A 3F5WA 4U6HB 4LLDA 1MREH 1W8NA 5ADOL 1ZT1B 2W9EL 4TQEL 5C86A 5FAAA 5IFJB 4BFEA 3ULUF 1ZA3A 5TE4H 3ARFC 4G7VL 3D9AL 5DJZA 3BKJL 2IAND 3O8XA 3CXHJ 3MLYH 1QSFB 3DYPA 2P8MA 4KMTH 4KV5E 4ZMAT 3IKKA 1PQZA 4LKCA 4TNWF 2E6JA 3C2SA 1EIBA 1YEKL 5EN2B 2OYPA 3O6ML 1X5FA 3TVMA 3IDUA 2HVKB 3JTCA 4X9FA 5E8DL 2R0KH 4NKDA 1KPVA 2P24A 1X5LA 2Z4QA 1IKNC 1W2KT 3WS3A 3BIBX 2IH1A 1BZ7B 2QSCH 1KB9J 3G08B 3FO9B 1J12A 4MWFB 5H94B 3I2CL 2FH6A 2WINB 4LVHC 3RAJH 4JPVH 4P5TA 1U8LB 2X4OA 3CSYA 1C16A 2P44B 5TDOB 4PJAA 4KRPB 3RUGE 1P84K 3INUH 2G60L 5HVHC 4WUUB 5KAQF 1I8IB 3G6JB 5DJXA 1S9YA 4NQTA 5DLML 4PRAA 4V1DD 2FYYA 3P4MA 3TIEB 2E8YA 3BE1L 3H3KA 3O41B 4LSTL 3G6DL 2CO7B 5TFSH 3HNVH 5I16A 2GEEA 4JFQA 5T1KB 3VFOB 1KIPB 2LQRA 3TN0D 4EBQH 1KSRA 5GGSY 4M7LH 1I9EA 3QUML 3DBXB 3RVWD 2H3NB 3HRPA 4XT1C 1JHTB 1BFVL 4XVTH 5J11C 5ERWB 1A6ZA 1Z3GL 1BD2D 3VXTB 1Q0XL 4ZO6A 1ADQH 2CK2A 3DYMA 3NACL 5EU6D 2XG5A 5C0JA 1MH5A 1UB6B 3HZYB 2BOBA 2O5ZH 1UA6H 4X6EB 4JO3H 4YX2L 3ARGB 1W0YT 3UC0L 3CFBA 3AXLB 4U0RB 3KWWB 2UZYB 3MRHA 4GKSA 4ELME 5AZEH 4UTAH 1NBZB 3BYTA 5IVXE 4C56E 1A6AA 3WLBA 4HFWA 4PJXE 3P0YL 1RIVH 2VLJB 4MQTB 1AR1C 1F97A 1DQJB 1LWRA 1VFBA 4Y89A 5HHQB 1I4FB 1LP9E 2NY7L 1BEYH 5J57B 4W70A 1OP5H 4DWHA 2IC2A 2PYED 2D7TL 5I8CB 5D6CA 1IL1A 4F7TA 1ZS8A 4QF1B 1D9KA 2CK0H 2YUZA 4NQSA 3ILPB 5FXCH 3RA7H 2UWEE 5F1SA 4CVZB 3LS4H 4J1UB 3FMGH 4AMKL 3P9LA 5BO1L 3HE7B 5EFIB 4OKVA 1FP5A 1VGKA 4RISH 5MENB 2W0LA 3QHZH 4G8IB 2R2EB 1JK8B 2HKFL 1RD6A 1AGBA 1QBLL 2ICWJ 4HUWA 2BSED 1AO7D 1N4XL 1MAML 1IJ9A 1YEEL 4FRWA 4JPKL 4PTUA 4QRRB 2OI9B 3WL9A 3KPOB 4KGLA 2X44D 4MSWA 1NGWA 3KGRA 2D03H 2EIDA 1UM4L 3LKSA 2EH8L 2I07B 4PGDB 4DGYL 3S96A 1MLBA 3FQRB 4TVPE 3ABZA 5ETUB 4N9OB 3ARFD 2A6IB 3DUSA 1VPOL 4B50A 4WI7A 3T4AB 4RFOL 5J06A 5L88L 5EBGA 3NOIA 4H26B 5EOQL 3LQAH 4LNRB 4FQQB 1EDQA 2G2RA 3DROA 2FR4B 4YZFE 5A40E 5FA4A 1KBGL 4MD0A 4WCYH 5F7EL 3N85L 4EKXA 5IKCA 1YNTB 4FN0A 4FP8H 4ONFL 4OQTH 4YHLL 2N56A 2YK1L 4HS8L 2YHGA 1CFBA 4TRPH 1WTGT 3QCTL 5DS8B 4Y4HC 3HUJE 4NRZA 1GRWA 4K7FA 1HCFX 2QEJA 4O4YH 1PZ5B 3NIGE 5D1ZC 3H9ZA 4ZUVA 4R3SB 3EOYG 1T2QL 4Z18A 3MUGA 1GPOH 2A74A 3VXSE 3MOAL 3PQYE 1XF5B 5CILL 1ZXQA 4JN1L 4YC2C 5EOTA 4Q9QL 8FABA 2DYPA 5I1CH 4LBEB 5BV7H 1KELH 5E2TL 4H8WH 4P9HL 4M3JA 3KPRD 3MMEB 3W39B 4DZBA 2QTEA 1UADC 4Z7UF 1T2XA 1MWAB 1Q9OA 2XYCA 3BGMA 1DQTA 3LKQB 4U1HA 5D7LE 3SDCA 3GIZH 4XCFH 3HAEA 4UV4H 3L3IB 5D1QB 5JZ7D 1RZIA 3LOWA 1QSEE 3VFUB 1H3PL 5C6PB 4HCRH 4HIIA 4JPIB 2R0LH 5EZJB 3VFPA 4BA8A 4U33A 5CSZB 3G04A 4HGKC 2APBA 4MNGB 1WAAA 2V2WA 3DURA 1G7JB 4JAMB 3IGAA 2YA0A 1HYSC 5IHZB 3H3PH 5J9PB 3JV6A 5CJOL 3ES6B 1JF1A 4NQEA 1MCIA 3GSRB 1G6RB 4XAWL 1ZEAH 3OMZA 3PHOB 3P4LA 2VISA 3UO1H 5HTSA 1UVQA 4P57A 4HS3A 5IMMB 3WNOA 1N0LA 4APQA 3E6FA 2C1OB 4GW5B 1CLZL 1DP0A 3HE6C 3ARXA 3OG4B 3QDME 4CU8A 2EDJA 4XB7A 1WZ1L 3UTZB 4H1LG 1ULVA 5DMKA 3ZDZF 5EOCL 2FDBP 4OFYA 4XNQB 2Y72A 5HYSG 4EDXA 3RWDB 2F19L 2HJFA 3LPGA 3MLWL 4YFDB 5E8NB 3M45A 5GS1B 2H1PL 1DEEA 1F6LL 5CEZD 3O45A 5GRUH 2DQGH 5SWSD 1RVFL 1NCBH 5MHSE 3HCVB 4LF3A 5KOVC 4WW2C 1YEJL 2ESVB 4I1NB 1S5IL 3ARRA 1CT8B 2R4SH 4MCYB 3WJJC 3MYZA 2K7QA 4GQPH 2Y23A 1S7TA 5FKAB 3QXVA 1SYSB 4I5BA 5I1KL 2ZJSL 3F6LA 5IB3B 3QQ3B 1RU9L 4POYA 5F71A 5F7DB 5FO9B 1HQ4A 3EDDA 3U30C 4KDWA 1IAIM 5C0FA 4JM4L 2DQHH 1PSKL 1QSFE 1WUNT 1CLCA 3TO4C 2X4TB 5DGRA 5FUCC 2MQCA 2OTWB 4HZAA 4Y4HD 5CMAB 4JO4H 2ZSVB 1JGLL 2WUBL 2HRLA 1CG9B 5IIEA 3DX7B 5D1ZD 1DBBL 1OPGL 3RTQA 1YC8A 4PS4H 1BWMA 4O51A 5HYJE 3HI6L 1I1FA 1T66C 4W6YB 5IWLC 3QUKB 2HRPL 4OZFA 4JQXA 3NZHH 4GRWB 3LRSA 4ZQKB 3H9YA 1I3GL 1KTRL 4L9LB 4M7LT 1K4DB 3BP7B 3QI9C 2H2SD 3GSVB 3O2DH 1T5WB 1S7VB 4WUUE 5I1AA 2P7TB 3GO1H 1FIEA 4ZUTB 1UJTA 4OZIE 2E7LE 1A22B 3A6BH 1WCBA 3VXQA 4G6FB 4JO1L 5C0GA 1HI6B 4PG2C 4OLVH 3GMNB 3F5WB 1J86A 1YEGH 3QFJD 3QUMA 1MUJA 3B3IA 2X40A 1MFCL 1HYSD 3O11A 4G3YH 1ZA3B 2JELH 5D71H 1A7PH 5DJZB 1A3RH 3O8XB 4PRHE 2N4IA 2P8MB 3OKKA 2X89D 4LKCB 1PQZB 5I75C 5T3ZE 5GGQL 1Q0YH 3FT4A 1SM3L 4ZAKA 4V2CB 1RIHL 4AY0A 1P2CA 3TVMB 4NKDB 1KPVB 3RY6C 5I8OL 3HE6D 5MEPA 2Z4QB 3WS3B 1F90H 3WXVL 4Z7NF 2IH1B 3D3VA 3ZZ1A 3BUTA 3IDIA 4J12A 4NRXA 5GGTA 3CVHL 4P5TB 3PGFL 2X4OB 2COQA 4YBHA 1UCBL 3JWOC 3CSYB 1C16B 4PJAB 2KQMA 4GKNA 5C6TL 3MFFA 5MENE 4ODVL 5DJXB 3GB7B 1KLFA 1S9YB 1GGIL 1CF8L 1U8OA 2IPTL 1VA9A 4PRAB 2Y06L 3LDBC 2FYYB 4ETQA 2AJUL 1TFHA 4ZO8A 1J1PH 2AK4E 4QRRE 5TQ0L 5ICYA 1DQLL 2J5LB 5I16B 4JFQB 5GS0L 3GM8A 3MV9E 1QFWI 5EG6C 2HFTA 3REWA 4HF5H 5GISL 4X0KA 1RV6X 1UZ8A 3MROA 1IC4H 5LCVH 1OM3H 3EO9H 1IC7H 1P1ZA 1A6ZB 2DM2A 4P0DA 5J89A 4NFDA 5C0JB 4KAQH 3TO4D 1G6RH 1MH5B 5HJ3A 2BOBB 3GI9L 4ERSL 5T33L 3SGKC 4IRJC 4DCQA 4J3UA 3CFBB 1AFVH 3DSNA 3LN9A 3HG1D 4QRPD 4ZD3L 3MRHB 4GKSB 3LN5A 1T66D 1A6AB 4BSJA 2HYMA 4HFWB 2MTPA 4EOWL 3TP4A 1HHJA 5SX4I 4QTIL 3QI9D 5D6CB 1IL1B 4R7DA 4F7TB 1ZS8B 2VDKL 1D9KB 4NQSB 3ESVF 2P43B 5C9KA 3PWVA 4WDIA 3CIQA 4K3EL 3U7WH 3P9LB 3TJHC 3PV7A 4OKVB 4RIRA 1VGKB 3GJFK 1MCQA 3MBXL 1A3LL 1AGBB 2V17L 4HUWB 4GS7C 3B5GA 4PTUB 3WL9B 4EEEA 1DCLA 1MCDA 3PDOA 3PGCA 1NGWB 4MSWB 4FMKA 4JFYA 3WJLC 3OKDA 4G8FA 1Z9OA 3S96B 1MLBB 1P4LB 3RL1A 1TETL 5L7XH 3DUSB 2YS4A 3VFMA 3A67L 3VG0L 4PLKC 4KI5E 4XI5C 1XH3A 2XY2A 3UBXA 4PJEF 1MFEH 4G42A 2G2RB 3H3BC 3DROB 5KVGH 3QWOA 1RJLB 5FA4B 1A6VL 4P2RA 4AENA 2OTPA 4MNGE 4LIQE 4MD0B 4XZUB 3R8BB 3QJFA 4JREC 4GMTL 4Y5VC 5IKCB 3LKPA 4ZFFA 1XGPB 2BNRD 4DN4H 3SKJL 4M93C 3ROLA 3X3GL 1IGFH 4NRZB 4Y4KA 2J8UF 2PO6C 4LMQI 1E28A 3LMJL 1GAFL 1NLBH 3NN8A 5HYIA 3FO0L 4ZUVB 4EZMA 3RP1A 2FX7L 2NW3A 2YD7A 1IZJA 3MUGB 2A74B 1G9NL 2MCG1 2CR6A 3MGAA 3PWLA 3NAAH 3ARZA 5C0CD 3IVKA 4KJYA 1CGTA 1G7MA 8FABB 3T3ME 2DYPB 1NGPL 5ISZD 1RZJC 1XGRB 4P49A 4MA1C 2P8PA 4QXTA 3RKDC 3MRRA 2NX5A 5GRJL 1S3KH 1YA5A 2AXGA 1HKLL 4IDLA 4DZBB 1OD7A 4KC3B 2FX9L 3BGAA 4IRJD 1HHKB 1Q9OB 3BGMB 5ESVA 4U1HB 3SDCB 1BQUA 5TH2A 5FYKD 3MRKA 3HAEB 2XI9A 1RZIB 2XWTA 4HIIB 1UWEH 3VFPB 5I15L 2VABA 3ZL4L 2V2WB 3DURB 3SJVA 3IGAB 5JMOC 3FQNA 3JV6B 3AY4C 4I48A 1JF1B 4NQEB 3HNSH 1BWWA 4B53A 3QO1A 2NZIA 2VISB 3C5ZC 3WO4B 1UVQB 4CNIA 3RPKA 4P57B 4HS3B 3TJHD 4WTWA 4LEXL 1AI1H 4LGSB 4APQB 2J88H 1DQDL 3VFRA 2IFFL 3UYPA 1EBPA 4Y16A 4UTBL 5E7FA 4XP1H 3D25A 1CTNA 3HR5A 4GRWE 1YC7A 1BBDL 4D0CA 1GZPA 3MA7A 4JDTH 3B9DA 5DMKB 5ALCH 3GHBL 2H8PA 3GBMH 4IHOA 1QYGL 3O3EA 3NCJH 3RI5F 4EDXB 2HJFB 1TQCC 5KSAA 3S4SG 4K23H 4ZXBC 1NFDE 3QNXA 1DEEB 1INQA 5D93C 35C8L 3V5DA 4LVOB 3KVQA 4PLKD 4XI5D 4LF3B 4OLZL 2NY5L 3QDJD 1A3QA 4KTDL 1S7TB 2IANA 4I5BB 2V5MA 1CU4H 4YXKH 4K8RH 3ZTJH 1HQ4B 3CLFL 4X6DA 4PR5A 5C0FB 4OI9A 1PKQE 4TVSa 1RZ7L 5TQ2H 2V9TA 5H8DA 2Q87A 1Q72L 4JKKA 1XCQA 3NGBB 1R0AL 4YHOL 5ITFA 2D7OA 3BQUC 2FJGA 2YD2A 2C3VA 4RMVA 2PO6D 1GC1C 4DGIH 5D2LA 4HGMA 1UJ3A 5IIEB 3BWAA 3RTQB 3T2QA 2BVTA 1SYVA 4O51B 1I1FB 3WHXA 1ZGLB 2KDGA 4U3CA 3T1WA 1AY1L 4OZFB 3S88H 2ICES 3LRSB 4OBRA 4F7EA 3G5YA 4Y2OA 4V1DA 1JUFA 2ARJA 2XKSA 1CXFA 3RKDD 5BMFH 1BIHA 1FN4A 4PJAE 3IF1A 5AG9A 4P5MA 5DVKA 4Q6IA 1A64A 1FNFA 3P4NA 2GITA 4OF3A 3TN0A 1N5YL 5I73C 2LU3A 2X41A 2X1PA 4S2SA 5FHAH 2A77L 3MRPA 1WCBB 4YDVA 3VXQB 3L5XL 5C0GB 3C8HA 5TE7L 3V0WL 1BD2A 4JY5L 5EU6A 1JRHI 1DQQA 3QUMB 1T03L 1MUJB 4JPWH 3B3IB 5I1HH 5JXAH 5JW4R 4YR6A 3PJSA 1ACYH 2DTMH 3OKKB 4Y5YA 4NIKB 3ARQA 4N1HB 1SMOA 3C5ZD 3FT4B 4ZAKB 4F7MA 5E2WL 1FIGL 3WD5L 3OKNB 4HWZA 1F3RB 3V7MA 4PJDE 5C92A 1BF8A 2PYEA 2Z8WC 1TCMA 5MEPB 3ZKSD 1LNUA 5T5FH 3D3VB 3MBEA 4FFZL 1QACA 3IDIB 3FAXA 2XACC 2J12B 1ZAGA 2VYRE 4ZXBD 1AO7A 4P99A 1A1MA 1OAUL 4GKNB 4PY8J 3MFFB 5I9QB 4XNXL 3RWGA 3UROR 4Z0BL 1KIRA 1U8OB 4ETQB 3L7FA 4R4FL 5IVZA 1A02N 3ARFA 1B0WA 4X9GA 5ICYB 5F6IB 5I1EH 2D7NA 2X4NA 5HBBA 3REWB 2AJSL 2VR4A 1UZ8B 4MNQD 4XMPL 1LILA 4NQDD 1VESA 1MAJA 1P1ZB 4OV5A 2HA1A 4CJ0A 4TUKL 3RX8A 1CK0L 2BK8A 1IKNA 4DCQB 3BQUD 2AJ3A 2DQTL 4HLZH 4MZ2A 4CRPA 3NFPA 4L3ED 3LN5B 5TF1H 4CN6A 5EUKA 3IS0X 3PABA 4JVWA 3LQMA 3PWNA 3STBA 1HHJB 3ULVE 4X6FA 1I7RA 3WHE0 3N9GL 5IHLB 1GGYA 4R7DB 2RCSH 4LPVA 1VB9A 1EK3A 3Q1SL 3PWVB 4WDIB 1F4YL 3M8OL 5IGXL 5GRVK 2APXA 2GJ6E 1PBYA 3S34L 5LG1A 3PWPD 3EJJX 1S7UA 4M7ZB 4RIRB 2Y07L 1K3IA 4QHUA 1QSZA 3KPRA 4OCSL 4H1LA 5CEYA 4J7RA 5I8EA 1D5BA 3MRMA 2CRYA 5HYSA 5ADOH 3PDOB 3PGCB 4Q9CA 5K59F 4GXUN 4CGTA 3DHMA 2W9EH 4TQEH 2WLYA 4F9LA 4JFYB 1TVBA 4G8FB 5ACLA 2RGSA 2W60A 3RL1B 3WBDA 4G7VH 3D9AH 1IGJA 2PYFB 2H2PC 2VN7A 3VFMB 1YEKH 2DWEA 3KPMA 1XH3B 3O6MH 3VDBA 4TTDC 3UTSA 4BM7A 5E8DH 4G42B 3VI3F 2IMNA 2QBWA 3DGCR 3IXAB 1I7UA 3QWOB 5SX5H 3GKWL 3EYFA 2XZAL 4P2RB 2ZP0T 3IDNA 5DRXA 1RZKC 4AENB 1X5IA 4J2XA 1WAAE 3QJFB 3BN3B 1ERNA 2FRGP 3SBWC 2YPVL 3PWJB 3LKPB 4JGUA 4ZFFB 8CGTA 1PDKA 4RZCA 2Y7QA 3R0MA 1ZSDA 2LE9A 3MRDA 2BY3A 1DSFL 32C2A 3ROLB 5B21A 5IVNA 1U41A 2G60H 1YUHA 4Y4KB 4F8QA 4Y19A 1E28B 5B3JF 1E0OB 3NN8B 4NCC1 3BE1H 4LSTH 2NW3B 3MV8D 2A9ML 3PWLB 1HHIA 4D9QE 3IVKB 4KJYB 4ZUSA 1G7MB 3L5WA 1PVHA 5SWSA 3QUMH 2HT2C 3NVQA 1BFVH 2P8PB 4QXTB 3OSKA 3HTLX 1Z3GH 3MRRB 5KSBB 1Q0XH 2NX5B 1U8JA 4YHKL 4L4TA 1JGDA 3VXRD 2AXGB 2EDYA 1LDSA 3V9FA 4YX2H 1QNZL 2NY2B 2VKXA 3UC0H 3Q5OA 3OKOB 2MPAL 4IOFC 1NGZA 2BCKA 3IFLL 4EDWL 3I84A 5TH2B 3MRKB 1NDMA 2XWTB 3P0YH 1A47A 3JVGC 3OHXA 1FL5B 5INCA 4R7NA 4Y4HA 1KCSL 2ATKA 2XZCL 2VABB 5EUOF 1CICC 3SJVB 2NY7H 4RGNC 4S0UC 4MB3A 4HWBL 4UQ2B 3FQNB 5D1ZA 4CKVX 3LB6C 4I48B 3FB8A 3BDXA 4LDEB 3FRPG 3N1QC 2FECI 4PTTA 3QO1B 4AMKH 4PJGA 5BO1H 2J1KA 5E4EC 4CNIB 5C0EA 4PJIA 3DRQA 4GMSL 4KTEL 2HKFH 1QBLH 1N4XH 3VFRB 1MAMH 4JPKH 4Y16B 1MHPH 4HH8A 1MCLA 3HR5B 5E08L 4D0CB 1GZPB 1UM4H 3MA7B 4DGYH 1QFOA 4DUWA 1V3LA 2H8PB 4IHOB 5KZCB 3O3EB 2HH0L 3KPSE 1T0PB 3C08L 5JTWA 4WFHE 5LWYL 5KSAB 1VPOH 5GHWL 1EO5A 2H2PD 3QNXB 4LHUD 1INQB 4D9LL 4R4NC 1A7OH 3V5DB 3VG9B 5L88H 5CJQL 3QFJA 4LL9A 4B7LA 5EOQH 2BY0A 1YPZF 3ZKXC 1JWSA 3MRFA 4TTDD 3VI4F 4RAHA 5JUEL 3TFKC 4FTVD 2EC8A 2GCYA 1KBGH 2GSGA 1UM6L 1FNLA 2IANB 1YEDA 2X89A 5F7EH 1CR9L 3N85H 5JOEA 4WI5A 4ONFH 4YHLH 1JI2A 1Y18A 2YK1H 4WO4C 4X6DB 4Y8AA 4HS8H 4PR5B 3CGTA 1F58L 2Q7NA 1XCQB 3QCTH 2AJYL 4J4PC 4WI6A 1I7ZA 2CDEB 4KFZC 5D5ME 3LKNA 5ITFB 3HMXA 5SWQA 2Q7YA 3BAEL 2FJGB 2C3VB 2Q86A 5IFAH 3HC0A 1T2QH 1N8ZB 4KVNL 2XTLA 3MOAH 1BM3L 1YECL 1IAII 4FQLL 5CILH 2P46B 3BWAB 5FK9A 4JO2H 4JN1H 4Q9QH 1SYVB 2P5WE 3D3VE 3L3KA 4HEME 3WHXB 2V5TA 4F7CA 3QQ4A 3IAGC 1MCNA 2HT2D 5E2TH 5IB4B 5MEOA 4F7EB 3ZKMC 1MPAL 3D69A 3G5YB 5ANMA 4P9HH 4LHUG 4V1DB 4WW2A 1JUFB 5ABDE 1EHLL 3WJJA 2C4FU 3FB6A 1FN4B 3RDTC 1GIGL 1UCTA 3IF1B 4P5MB 4HJJL 3KNBA 4Q6IB 5CAYB 1J0JA 3P4NB 2GITB 3TN0B 3QUZC 4S2SB 3IJYA 3TNMB 4LPYA 5B38G 4IOFD 3MRPB 5E4IA 4YDVB 5DWUL 4XPHL 1H3PH 3X11A 1BD2B 5EU6B 3V5KA 4XP4L 1DQQB 3G5ZA 4I3SH 2D0HA 4P3DA 5E2UL 2C5DC 1CICD 3O9WC 4NYLA 5CJOH 4RGND 2CXKA 4NNYA 3PJSB 3HG1A 4QRPA 3FJTA 3VXNA 4Y5YB 1X4YA 1ZT7A 4YGVA 1N5AA 5IWLA 1E4XI 4R96A 2GUOA 4F7MB 3IDYB 1SVZA 3C8KA 1CLZH 4F15C 2PYEB 3RVUC 2XZZA 2CMRH 1LNUB 1WZ1H 4YGAB 4WY7L 1I9RL 2B1AL 2P45B 5EOCH 1FSKB 3KG5A 5I1LB 1B6DA 5JO5A 5MERA 2D9QB 4WEBL 3MLWH 4YBLC 1WT5C 1YMMD 2H1PH 4KKCC 2F54E 4LU5L 2MKWA 3OJDB 4KY1H 4PG2A 1AO7B 4OJFH 3FO2A 1RVFH 1A1MB 1P6AB 4R4ND 4MZ3A 3RWGB 3MOQA 1J5OL 1OWWA 1YEJH 1S5IH 4JZJC 1KIRB 4AIXA 4U7SA 5KSVA 1QTYT 2X09A 2WNGA 3L7FB 3N50A 3TFKD 2C4FT 5I1KH 5IVZB 3ARFB 7FABL 1EA9C 4UQ3A 2E6QA 2X4NB 1CFVL 1X4ZA 4JM4H 4W6WB 1PSKH 4WO4D 1A2YA 5BS0E 2JF1A 4OV5B 3EO1A 3CFKA 2JE8A 4P59L 4J4PD 3P9MA 4XP5H 3RY6A 2L7UA 1JGLH 3QEQD 2WUBH 1UEMA 4C58B 3TLRA 2AJ3B 2BJML 1X6NA 1DBBH 3FT3A 2Q76A 1OPGH 3NFPB 2BNRA 1DEDA 1NANH 3HI6H 1BECA 2VRAA 3BP5A 4LVHB 5CUSL 3DX8B 5EUKB 3PABB 2D3VA 4LAQL 1I3GH 3PWNB 4I18C 5HVHB 5EC2A 2CSPA 4X6FB 3ZKMD 4F33A 5DDHB 1I7RB 4OZGA 3DETC 2AXJA 4QHKI 3TJEL 2C7UA 1HHHA 3GJEA 3RDTD 5C0CA 4JDZA 1MQ8A 1WVZA 3HZVA 1JGEA 4ZOAA 1EPFA 3QUZD 3GZKA 4MXQC 4X4MA 4JO1H 1D5MA 1S7UB 1KCUL 1ZWIA 4PGCA 3TIDA 5J11B 4MB5A 3KPRB 1KEGL 1XZ0A 4H1LB 5CEYB 5I8EB 1D5BB 3VD4A 3MRMB 5F9DC 5HYSB 3QFDA 1MJJA 1VFOA 2K3TA 1MFCH 3S4SA 1FFOA 4BQ8A 3SGKA 3OB0K 4IRJA 5KSBE 3ET9F 1TVBB 5I1JL 3O9WD 2W60B 5CSGA 4NJAL 1IGJB 4BSVA 3FFCE 5I30L 1IGTA 4BQ9A 1H3UA 3CFEA 4OD1L 2DWEB 3KPMB 4X6BA 3QCUL 4HS6A 3DTXA 2FEDC 3S8WA 5H37H 3RIAF 5F9JA 5I8OH 1I7UB 4JEGB 1U3JA 5SV3A 3RVUD 3WXVH 3CUPA 3IDNB 1QRND 4W4OC 3SJVE 1HNFA 4JY4B 1FL6A 2BVQA 4ONOA 2WMPA 3NCBB 3MLXL 3TJHA 4PGJA 2AJVL 1MNUL 4RZCB 2Y7QB 3CVHH 1S7XA 1JGVL 1ZSDB 3TA3C 3MRDB 4KKCD 2AERT 5C6TH 3DPBA 4ODVH 1YUHB 3HS0A 3EZ8A 1CF8H 1NMAL 2IPTH 4U6XA 2Y06H 2UZIL 4F37F 4JVUA 3WJLA 4GO6B 1LDPL 2BSTA 5TQ0H 1WWAX 4K94L 4LHJB 1DQLH 2JCCE 4G6MH 1I1RA 4YXLH 1HHIB 3EYVA 5GS0H 1WV7T 4ZUSB 3P4OA 3L5WB 5GISH 4XMKL 1Q1JL 5SWSB 1FGVH 3I3BA 5FCSH 5F7HA 4NKOA 4N5EC 4WW1A 2ERJC 1QPPA 3QDJA 4LLYA 1U8JB 3LKRA 3U4EA 2EDNA 2OLDA 1JGDB 4IRSC 3GI9H 2BZDA 4ERSH 1RJCA 5T33H 3VD3A 2R4RL 2JJUA 1BREA 1H3XA 5GRZA 1Y6NR 2P1YA 3HHRB 1CDJA 4Y5VA 1NGZB 2BCKB 4MA3A 4ZD3H 1BLNA 2IANE 5TDNA 1IQDB 3GMLA 1XFPA 1H3GA 1JE6A 2GI7A 1A5FL 1NDMB 1M7DB 3OHXB 2X1XR 5INCB 3E0GA 4R7NB 4X6DE 4Y4HB 1T7VA 2ATKB 3X14A 4EOWH 2PO6A 4ODUA 3SPVA 5D1ZB 4OCLC 2VDKH 3FB8B 3DETD 4PJ7F 4N1CA 5BW7C 2R39A 4YFLF 4OF6A 1HOCA 3CVIL 4YC2B 4PJGB 1MIEL 5C0EB 3QAZC 4NFBA 1I85C 4PJIB 3EUUA 4MXQD 3DRQB 3MBXH 4MMXC 1A3LH 2V17H 2GW5A 3CSGA 1B4RA 1JYXA 2FGWL 1A1NA 5HPMA 1AJ7H 1QLRA 1Z9SA 1L7TL 3O3DA 4NZUL 4V1DE 5I2IA 5C3TA 1MI5D 2VXSL 2DKUA 4UOW1 4ZNEA 4ZS7H 3A67H 3I3DA 3SGEH 3V7AG 4JFOA 3VG0H 1Z0NA 4GRMA 4NQUA 2OXGA 3QFJB 5H2BA 2Q8AL 4G43A 1KJVA 2DIAA 4LSDA 5KVDH 1JWSB 3BYYA 1QG3A 3NIDF 2FEDD 3MRFB 4NNPL 4ZFOL 1BD2E 5EU6E 1KCRH 1A6VH 2GCYB 3AY4A 1BJ1H 2GSGB 4V2BA 1JRHL 2NLJA 5DK2A 3VXOA 1YEDB 4GMTH 1HWGB 4G59A 3C5ZA 1Y18B 3E2HC 3K2MC 2VERN 5KVMC 2X70A 4U05A 1L0XA 3SKJH 1T0MA 3X3GH 2C3XA 4WIQA 3TA3D 3HE6B 4RWHA 1I7ZB 4ZSOA 4NUGL 4K55A 4MX7B 3LKNB 5SWQB 2Q7YB 2IGFL 3LMJH 1GAFH 5TDPA 6FABL 2Q86B 3FO0H 3HC0B 5A2FA 4RSVA 5D96C 1G9NH 2PYEE 3S36L 3QSKB 4LOUC 3MRLA 4JM2F 1F3DH 4NCDA 5FK9B 4YJZL 4H1LH 3P77A 1NC2D 4ZXBA 1JTTA 4TN9A 3L3KB 4F7CB 3QQ4B 4PJHB 2ICWI 3OG6B 5A2IH 3KHQA 5MEOB 4N5ED 4C59B 3D69B 5ANMB 2IG2H 5GRJH 4CDGC 4WW2B 4NPYA 5JHDD 1AO7E 4TSAL 2EDXA 1HKLH 1QA9A 3FB6B 1ORQA 1KB9K 2BY1A 4IRSD 5IB1A 3VE0A 3KNBB 2EXYC 4BZ1L 1DANT 2EECA 1OHQA 1I9IL 2C3GA 2APFA 3IJYB 2DI7A 4MNQA 3U30B 1U8QA 4NQDA 1C12A 3X11B 5HDQH 4JFPB 3V5KB 3MNWA 3TO4B 1F5WA 3G5ZB 4HT1L 1JZ8A 4JG1L 1MVFA 2L7JA 4P3DB 4XP9H 3ZE2E 4X4XB 4NYLB 4LRNL 5IG7A 2UUDK 4NNYB 4L3EA 2BVOB 3HG1B 4QRPB 4LFHD 4LP5A 1MIMH 2QSVA 3VXNB 1RK0A 1T22A 1KLUA 5KS9F 1S9VA 1KT2A 4U6VL 1ZT7B 4YGVB 1N5AB 3I6GA 4DAGL 4R96B 1F6AA 2GUOB 5FYJD 3X13A 4LEXH 3SOBL 3SGDH 3MRBA 3PWUA 3UZEA 2CKBL 1DQDH 2YXMA 1MHEA 1A8JH 2EDRA 3EJZC 3C8KB 4JFFD 4UTBH 4JKPL 5DD1L 1HZHL 3QI9B 2FBOJ 1BBDH 4ZS6C 5JW5A 3ETBF 1S9WA 3QXAA 3GHBH 2EDKA 4FQ1L 1QYGH 2OQJA 2E9IA 5JO5B 3O2VL 5MERB 3PWPA 2OS7A 4OQ1A 43C9A 3LHPL 2WZPD 35C8H 1UG9A 4I3GA 4LASL 4U1KA 2XV6B 2D4DA 1BBJA 3E3QC 3QWQB 1UB5A 2VLKE 1KENL 4K3DL 4OLZH 2EE2A 4PD4K 2VUOA 3RZCC 2NY5H 5AD0A 3WE6A 1EJOL 2GFBB 5KSVB 4C4KT 4KTDH 4R26L 1H5BC 3Q0HA 2I24N 3MACL 4KPHL 4UQ3B 4LCUA 5I75B 1NFIA 3CLFH 4LLUA 3BPCA 1CFTA 4LFHG 2GY7B 1RZ7H 4UNTA 3IU4L 4FQCH 4DZ8B 1Q72H 1A2YB 2OR9L 4M3KB 2VL4A 1R0AH 3EO1B 3CFKB 5L8LB 4YHOH 2WWKO 1U8MA 3P9MB 4MCZA 2O5XL 4XVJL 5A1AA 2JJWA 3MX0A 4Z7VE 5KTEL 4UAOC 4PRPA 3MLRL 4AG4L 5LXGL 3FT3B 2Q76B 4TVPD 4MQ7A 3MZTA 2BNRB 4ODTL 4FFYL 4LOUD 3TWCL 3BP5B 4NN5C 3GHEL 1C1EL 1AY1H 1A6WL 2N7BA 4UOJA 2MQ3A 1K6QH 5EC2B 3FRPA 1WIPA 4F33B 2ZCHH 4UBDC 3LDBB 3MV8A 4JE4B 3VGBA 2C7UB 2HTLC 1HHHB 3GJEB 1EJ6A 3GSXA 5CJ8A 1N5YH 5C0CB 4JDZB 2DB8A 1CGWA 2EXYD 3HZVB 5CP3A 3NA9L 5ISZB 2A77H 3OB0H 3WFCL 3JUYA 3ARVA 1D5MB 1PG7H 1ZWIB 2EDQA 3L5XH 4PGCB 4Q9RL 5TE7H 3TIDB 3V0WH 5D7IA 4JY5H 1F3JB 3EFDH 5CEZE 3STLA 3VXRA 1JPSL 5SWSE 2W0KA 1O5DT 3QFDB 3BRGC 5BXFA 1HK6A 3S4SB 1FFOB 4YHNA 4IRJB 3K80A 1FZJA 1YEFL 2WQ8A 3BO8A 5JMRA 1I1YA 4BSVB 1SY6A 3C6LA 3T4YA 1IGTB 3CFEB 1TPXB 4QRUA 2PF6A 5E2WH 3GSWA 1FIGH 4X83A 3WD5H 4X6BB 4HS6B 3DTXB 5IM7A 1NCDL 1F00I 3EJZD 2V5SA 1VACA 3FTGA 4RQQA 5FKPA 3NABH 3GRWL 3T0XA 3CUPB 4ZS6D 2GAZA 3MCKA 4M6AA 4FFZH 2Y5TA 1V7NL 3O81A 1FL6B 1F45A 2XWBA 2DL2A 1NJ9B 2BVQB 3MLZL 1J9CT 3I02A 1WFOA 5D7LD 4OIIL 5LAXA 1S7XB 3VA2C 1QSED 1JHKL 1OAUH 3BMVA 4XNXH 2VL5A 4GS7B 1DLFL 3HS0B 4Z0BH 4PJIE 1MAKA 4U6XB 1J88A 4HMCA 3RZCD 1VFUA 4R4FH 2I26N 2BSTB 4HIXL 4RBPK 3MRJB 5JHLL 3V0VA 3EYVB 4LHUA 2VDOL 1QBBA 4U1LA 4XMPH 1A21A 2BXZA 4NKOB 2AQ2A 5EU7E 4WW1B 3QDJB 3I85A 4LLYB 1X44A 3LKRB 3U4EB 5AYUL 4FTVA 4QTHA 5B38A 5KBNC 1CK0H 3QFJE 3Q48A 1EVUA 5E8OA 3O3BA 5CCKL 1A4KB 1H0DA 1MJUL 3VJ6A 4ZFOA 4JREB 2DQTH 4N8VG 5C0AE 3SBWA 2JIXD 4Y5VB 1P7HL 1MFBL 4MA3B 2A9NH 5L0QC 2R1XA 5CZKA 5TDNB 4ALAL 4OBSA 3TYGL 4M93B 2HP4A 1KEMH 3LAFA 4PJFF 2NXYC 3X14B 4KV5F 5I76A 2GYSA 4JRXD 2PO6B 1PEZA 4ODUB 2MQ0A 3N9GH 4L9DA 3S98A 3SPVB 4UBDD 1J0HA 1JN6A 2OJEA 4KWUA 2HTLD 3Q1SH 4RFNC 4GAGL 1JIBA 1HOCB 4CW1A 1F4YH 3M8OH 3RWFA 5IGXH 4XBPA 3S34H 5E24E 2BSSA 3T77A 2I25N 2Y07H 3N0PB 5IMLA 3MJGX 3QJHB 4MA1B 5E99L 4OCSH 3WEXA 2XTJC 4CMHC 1SHMA 4PJHE 1A1NB 5HPMB 3UTTE 1QLRB 3O3DB 3DLQR 3G6AA 5ANME 1CD8A 4KKAC 5FUZL 4YEFA 5D1XC 3RUGF 3T3PE 3BN9C 4JFOB 3QO0A 5HYJD 2DD8L 2JTDA 1NSNL 5E7BA 5H2BB 1CN4A 3JVGA 1FFRA 3TBVA 3EYSL 4G43B 1KJVB 3JV0A 1CICA 4BSWA 3RU8H 2NW2A 5ITBL 3CFCL 2ZCLL 5AG8A 3B9KC 4X7DC 2NLJB 5GGVY 5DK2B 3VXOB 1IBGL 3DYOA 1T83C 3C5ZB 3AU1A 3KYMA 5T1MA 5JA9A 3HG1E 2X70B 1PG7X 1DSFH 1T0MB 1WK0A 3G5XA 4DGVL 1I75A 5EU3A 2AEWA 4ZSOB 2DL9A 4ELMF 4HWNA 1IM9D 2CKBA 5TDPB 5IVXF 4JVPA 1MJ7L 1IT9L 2XY1A 2A9MH 3MPCA 1YMMA 3MRLB 1TQCB 3NIFE 3P77B 1QKZL 4PRHD 4ZXBB 1ORSA 2Y9RT 5IK3B 5T3ZD 5D93B 2PNDA 4HUMB 4LCYA 4BUHA 1YEIL 4OM1L 1AR2A 3I75A 3TCLA 4D3CL 3KJ4C 4YHKH 4KXZI 4NPYB 4JGJA 4DTGL 4XNUH 3TFKA 1QA9B 3ZTNL 1CYGA 1ORQB 4CDHA 4UUJA 3VE0B 5IB1B 1QNZH 5D8JL 3K8MA 5FYJU 2X4RA 3JTSB 4PJBA 5GJSL 1OLLA 2X10A 4M6OL 3QEGL 4EDWH 4MNQB 4NNXB 4WO4A 4NQDB 4GQ9L 2UUDH 1C12B 3MNWB 4J4PA 1OSPL 4HK0B 4HQQL 1KCSH 1Y0LA 2XZCH 3QEQA 2JJVA 3CX5J 1R5WA 5LGHL 2NXYD 3BQUB 4HWBH 4NZTL 4Q6YA 5IG7B 4JFXA 4Z76A 4L3EB 1UWXH 3H8NA 3CPLA 2AK4D 3TBYA 5DRNA 4OUOA 1RK0B 1T22B 1KLUB 2ZUUA 4QLRA 3WUWG 3L7EB 3P11H 1KT2B 3MV9D 3BZFA 4PUBL 4L8SC 3I6GB 1F6AB 5EC1A 3RIAK 3X13B 2BNRE 4KTEH 3MRBB 3PWUB 3T2NL 1MHEB 4IMKC 4I0CC 1QR1A 3K3QA 2XA3A 2XTJD 3RDTA 2DLEA 5E08H 4RDQG 5JW5B 1S9WB 1C7SA 3U79A 1YEHH 3GMQA 3QXAB 5DUPL 5IB2A 3H0TA 4JCMA 2OQJB 3QUZA 5I73B 3C08H 1CFNA 3PWPB 4KKAD 4RMSA 5D1XD 5LWYH 4G5ZH 43C9B 5GHWH 4WHYG 4YHMH 4D9LH 3BN9D 4U1KB 4LP4A 5CJQH 2HFEA 1BBJB 2XRAL 4GKZA 4XVSL 5F88A 3D85D 5ISZE 4F37K 4X4ME 1GHFL 2VE6A 3MSPA 5T3XD 3BFOA 4WI9A 2RHEA 3ZO0A 5AD0B 3WE6B 5JUEH 3OPZL 3O9WA 5EORH 3B9KD 5E1AA 1CR9H 4LCUB 1NFIB 4LLUB 4Z7WA 3BPCB 1CFTB 5DZOA 2ZG2A 1MFNA 3BX7C 5HGAA 4IIQA 4N0UE 5FYKE 3D39D 5EU5A 1F58H 1JTOA 1KIQA 5GQBA 4JFHD 1WBXA 3DV6B 4TVPL 5DD5L 5A43C 1U8MB 2PW1A 2L4OA 1R5IA 3SO5A 1WGOA 3BAEH 4MCZB 1QRNA 2YSSA 4LCIL 1V7MH 4Q58C 4I0KA 5AZ2H 2HFFA 4KVNH 3FOMA 5DMIL 2VSDA 1BM3H 1YECH 4FQLH 5EPMA 4JN2A 5BJTA 3PXHA 3SDXA 1WT5A 4QEGA 1Q9WA 4LRIC 4HJ0C 1W72L 2CLVA 2APTA 1NKRA 3QB7C 4AEIH 4J3SA 5KW9L 1MPAH 3HN3A 1XF2A 1ZHLA 1EHLH 4JZJA 1GIGH 3MV8B 4LKXA 4HJJH 1IAKA 3TV3L 3GSXB 1DBKL 3EYQC 4OSUL 3GK8H 3L9RA 4NRYA 4XB8A 4XPHH 4DVRL 5D7IB 3P0VL 1WQVT 3STLB 3VXRB 2H45A 4WGWB 5E2UH 5BXFB 4YHNB 5J13C 1N3NA 1FZJB 4Z78A 5FDYA 1I1YB 4ZUUA 4UI2A 3BHBA 3T4YB 5DEGA 5DRWA 1RIUL 1TLKA 1EO8L 2UZXB 2A73A 4QRUB 3KHOA 1BQSA 2AW2A 5IM7B 1AQKL 3BKMH 4K3JL 3BW9A 1G9MH 2ED7A 4OZHB 3QPXL 2YD4A 5J1SC 3FTGB 1VACB 4M48L 4RQQB 5FKPB 1IGML 4WY7H 1I9RH 2B1AH 2GAZB 1I8KA 3MCKB 1IGYA 3B43A 3MODL 1ONQA 2Y5TB 4HUUB 2XWBB 2Y36L 2HT4C 2GKIA 2ORBL 4MXQA 3FN0L 4X6CA 3WDJA 5DVLA 3I02B 4X7SL 2IQ9L 4RBPH 4PJCA 1TVDA 4U3XA 3L5JA 3VDAA 2VL5B 4JKLA 1J5OH 4HWEL 4YHYC 2ZPKL 1MI5A 4WV1C 3D87B 1JHLL 2OMBA 7FABH 3V0VB 1CD0A 4LHUB 2MCPL 1CFVH 2WBKA 2FL5A 4U1LB 1WEJL 2VC2L 3G6JF 4ZNEE 5BRZD 4M6MH 2AK1L 5K9KA 4P59H 4FTVB 4MMZC 5C0DA 5B38B 1KJ2L 1HCVA 5HI4C 1IMHC 4E42A 5E8OB 3O3BB 4W4OA 1H0DB 1K2DA 2BJMH 1LO3L 5L2JA 4ZFOB 3VJ6B 4QXUL 3B9EA 1KACB 2NTFA 2R1XB 2B4CC 3OGCB 5CUSH 3VCLA 1UGNA 3BXNA 3TA3A 1AP2A 2XKNA 4LAQH 2MFNA 4HJ0D 3KJ6L 2B8OT 5GGUA 2EZ0C 5I76B 2O26U 5BCAA 5E70A 1U2HA 2FCBA 1AE6L 2R2HA 4KK6C 4C4KO 1YQ2A 4H0HB 2OJEB 3S5LG 1NC2A 1I8MB 1X5AA 2SEBA 4CW1B 3RWFB 3F7PC 2BSSB 3T77B