3TN0A

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
293
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 70
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tn0A01
1WAAA 1XGPA 3ZDXF 2DYPA 1JF1B 2ZJSH 1RZ7H 2X05A 4L3CB 1RZJC 5LCVL 1K8DA 1FV1B 2X70B 1F45A 2D0FA 1QFOA 4YHNA 1H0DB 5DR5H 1XCTA 4G42B 4XVTL 3TYFA 4RWYL 4GRLA 4TN9A 5ITFB 5CP7A 1KXTB 4JFQB 5E6ZA 1HH6A 5JOEA 3OR7A 1HDMA 1MCSA 3T4YA 4LLQA 1W0VA 5HDLA 1D9KA 3GEWB 1B6DA 4FQXA 2GHWB 3PWJB 5DS8A 4DN4L 5D70H 1LVEA 3ME0A 4OGXL 2CK2A 3TVMB 3I02B 1MRCL 4M7LT 1ONQA 4QRRE 1G9NC 1M6OB 5C1MB 3O6KH 4J1UB 2FGWH 1NLDH 4LASL 1H3PH 4LU5H 5SX5K 1P2CA 3DARA 3A67H 3HHRB 4G6KL 4OBSA 2DBJA 1NEZA 1VCAA 1UJ3C 3D18A 2LQRA 3F65A 4JRYA 2IQAB 4K3GA 4E41B 1DQML 3LCYA 4G8IA 4MAUH 4TVPD 2C3VB 3RHWF 4NIKB 5KSAA 3DV4A 3T3PF 3LKOB 2ERJC 3OJDB 2J8UB 2GEEA 1G84A 2X4PA 1BD2B 4P2OA 4OFIA 3T3ME 1W8OA 1MRDL 1E4KA 2QADC 2EDBA 4F58L 1CT8B 1NAKL 2OM5A 2PETA 4ETYA 5I8OH 3QUZC 5IB4A 1ZOXA 1T3FA 1INQB 2DOCA 1NGXB 2FJFB 4R0LC 2HFGL 2VDPL 1JNHA 3RL2B 4JFDB 1ZWIA 5ILTH 3K46A 4MJIE 2D2OA 5DQDH 3KPMA 5ICXA 5EA0L 3V4PL 1N5YH 1JJUA 3P77A 2P45B 4UQ2A 3P11H 4KQ4L 3DOSA 1VDGA 2XTJC 5T1MA 3TBYB 4Z8FL 5F7DA 2EKJA 2VOTA 5D96C 3TPUE 5JO5A 4G3YH 4JM2F 2ZUXA 3EBAA 1F11B 3GMMA 4RISH 1YPZA 1YZZA 5DGRA 5FB8A 1Z0MA 1B3JA 2R29L 1KNOB 4U1NB 2GIYA 4F7EA 2OK0L 1KT2A 4Q0XH 4O2EB 4JGMA 2D3VA 3IETB 1U8QA 3L5WB 5F44A 2VABA 1OGTB 5HGBA 1OARL 4OUUA 4RX4D 3RVWC 1BQLL 5JORA 4NM4H 1J18A 1G7QA 5DJDB 2HVKA 3FT3A 1TCRB 5BS0D 3V5DA 3VXPA 3QDME 2CJUL 3CSPA 2R23B 3UEZA 4JFXB 1PYWA 4PY7B 2CO6B 1T22B 1S7XA 4U1GB 1DANU 2P5WE 3OJ2C 3ZTJH 3EHBD 4DOHB 5J3HD 3LDBB 1X5JA 3VXMB 5KAQF 3ZKMC 3IU3B 5IMMB 5E56A 4DN3H 1K5NB 5DJXB 1ACYL 3VFUB 4WW2B 5KVEL 3O6MH 2XI9A 3M17B 4OZHF 2RFXB 5EOQH 2F5BL 3TGXA 3SE3C 3WS3A 1Z9LA 3X11A 3E0GA 4EOWH 2YBRB 3EOYG 2R1WB 5E0QA 5EG6C 2Z35B 1NFIA 5BZWB 3KYMB 3ARBC 3VXRB 2X9XA 3GSUB 3G04B 3UDWA 4U1IA 5KVMC 1V7ML 3FN0L 5GZND 4OI7A 1J1XL 1LO0L 4ZS7H 3QDJB 2Q6WB 4C56D 4QRPE 1ITCA 1IQWH 3PWPE 1T04B 1T2QL 2YD8A 5MI0B 1U92B 4PB0L 4RMSA 4MGXA 4P46C 3O4LD 5EORL 2GUOA 2HH0H 2JKXA 1XF4B 5JDSA 2EYTA 4OFVA 2FYYB 5F9WC 3EOTL 1MJ8L 1W2KT 1A6UH 4Z18A 2X1XR 2N4IA 4WW2A 5EDXA 5IB2B 4ODBD 1KBGH 5E94A 4PJXA 4N0UE 1XIWB 4JGUA 5ICYA 1AI1H 1E4WH 2PW1B 4YXKH 5EO1B 1IGCL 3SDYH 1M05B 4APQB 1NCDL 1S7XB 3RVUD 4XBGB 1I3GH 2Z9TA 3EJZD 4F37F 1X4ZA 4DCQB 1MH5B 5IW6B 1AGBB 4Z7UA 1FN4B 4AEIL 1V3JA 2VLJE 1MY7A 2EIZA 4IMKC 3SE9H 4EN3D 1PDKA 4OV5A 4XCEA 2ZUUA 1KG0A 4MAYC 1SQ2N 2JK5A 2P49B 1FC2D 3MRPB 2H32H 4KH2A 3CXHK 3HC0B 4PJFF 3B43A 4S1QH 3JV5A 4JCMA 4XPTH 5DMGD 1C16A 3ALXA 3L3HB 1DQTA 2AK4E 1A6ZA 2G2RA 5D6CA 3CLEL 3OAYK 4IS6B 5KVGL 4EEEA 2AP2A 4QRPD 2WINB 3GBML 4LEXL 4ZPVB 1RZIB 1Q38A 3KYOB 3MRDA 3HG1B 4JY5H 3GSOB 5CBAA 5AZEL 1XF2B 3MV7E 5DYOB 4LP4A 2HJFA 1HHHB 4KK5D 4ETQB 5DEGA 4EDWH 4WO4B 4I13B 4PJ5A 3B5HA 4N1HB 4XPGL 4Z0XB 2HKFL 3GB7A 4PREA 4R26H 4YQXH 2WBKA 1JPST 4E0RA 3LSOB 5CD5D 2DWEB 4ZO6A 1EO5A 5I1HL 5JZ7C 4MYWB 4R3SA 2GTZA 2FJFA 2VZTA 4ODTL 4Y1AD 5E00A 1NSNL 3GZKA 3VWKA 1AHWC 4UOW0 1DQLL 5MEOA 1JCKA 3MNWB 3QB7C 2VDQL 3U4EB 2Z8SA 2FL5A 1U6AH 1KJ2H 3PQYD 3MV01 4XH2B 5D1XB 2VAAB 3MNWA 1X4YA 4KU1A 3WFBH 4M4RA 5TJWK 1KIQA 2YPVL 1JZ3A 2BERA 5E1HB 1MCCA 4CAGA 5GHWH 4YPGA 1C08A 4E5XA 4KY1H 4KHXL 3W39B 3HPJA 5HBBA 1BD2E 2AKRA 1AGCA 1IM9D 2J8HA 3QZWB 4MMXC 3KPRE 3AXLA 4KRPB 2UY7A 2AV7B 4KFZC 3WFHB 4CJ0A 4Y2DC 4G9DB 1D6EA 4M8VA 4YPJA 4U1GC 1LE5A 4PJIE 3ES6A 2IBZY 3OXSA 3N1MC 5H2BA 1J5OL 1FRGL 1LP9A 5C07B 3LMJL 5JPNB 1A4KA 4WO4A 4ELMF 5L88H 3TWCL 3EOAB 1WWAX 2RHEA 4KMTH 4XZUB 1HHHA 4ETQA 4L1HA 3TZVC 2MSPA 4X9FA 1D6VH 4FQXB 3KYOA 4JKMA 3GRWA 2HJKA 2OXGA 3FONA 1X6NA 4NC1E 1T0MB 3FMGH 2NTFA 3RVTD 3QXDA 2GJZA 2XZAH 3S96B 2OZ4A 4UV7L 4Y1AE 2AK1L 4MXWL 4OKVA 3ARYA 3HC3L 1I8MA 1XCTB 3HNSL 5ACMA 3EO1B 2R0KH 3HRZB 4XNZC 4OV5B 4MA8L 2JB6A 5J9PB 1TJGL 3NGBC 3BDYH 3OAYH 3C09B 4Y4HA 3QO1B 3WNKA 4QXGL 4E41E 5CJOL 1MI5E 1OAZH 2BJMH 2E8YA 4O51A 5HHQA 3ZT6A 4X4XB 3BOVA 5HI5D 3O6FA 1MAML 5GISH 2VLKE 3IKCB 3WKNA 4HKZB 3LKSA 5DI8B 1EJOL 3MLVL 1YECH 4RFNB 4Q0XL 4YDLC 2F53A 3T0AA 1U8PA 4EBQL 2BVPA 1KTLB 2OZ4L 4LQFL 3D48R 3NCEB 2JELL 5D9SB 4D3CH 3ARDC 1T83A 4X5WA 1F4XL 2IPTL 3X13A 2VKWA 2JCCE 3HC4L 4OD3L 4XHJC 1SY6L 3G5ZB 4FFVC 4HIEA 4XNMA 1AR1C 1M7XA 3PIQB 5A3IC 3WD5H 2NX5E 1JFQH 5D7JA 1HHJB 2YS4A 2Y7QB 1FP5A 2AEPL 2Z0BA 4TULL 3IXAB 5T3XH 4Z7WB 1HEZB 5CMAB 2DAVA 5GGRY 4IRJB 3CX5K 5EO0A 1A9BA 4N0CC 3O9WA 2WUCL 4PJDF 3TM6A 4JQXA 5AG9A 1OLLA 4KKBC 5F1OB 4JHBA 4P4KA 4KTEL 5GS1C 4H8WC 4EXKA 3WJLC 5C7XL 2P5ED 4Y5VC 15C8H 5IESH 3VXSA 4JRXD 2DQHL 2F54D 3MRQB 4NN6B 4ZUTB 3HE6A 4JFZL 4YFDB 5DMIL 5EU7E 5IQ7L 4JM2B 3TO4A 3RPIA 2F54A 1JHTA 1F90H 1M7DA 3QUXC 3UYOD 5MEPA 3PE9A 3MA7A 3O41B 3BPOC 1RVFL 3HZVA 1YNTA 4JFXA 4LSTH 3FO0L 3QCUH 3GBLA 3VCLA 2ZOKB 3LOWA 4ZUWA 1FCGA 2BSRB 3MJ6A 3MLWH 5HYJE 4ESKA 2YD1A 3MGTA 1NC2B 4PJ9B 4TRPH 4AG4H 1I1AB 2Y36L 4EVNB 4L4TB 5DJDA 2P1YA 1KCVH 2IJ0C 1PX4A 3FB8B 3VXMD 4NNYA 1FSKC 1JYXA 4UB0L 1WIPA 2FO1A 2DLEA 2B0SH 3D85D 4I8DA 2CDEA 3RWIA 3GMRA 1HKLL 4XP5L 3K2UL 3MA7B 1KT2B 1XCQA 3CGTA 1MPAH 3U30B 1G7PB 3O6ML 4YAQB 3CXDH 5HHOB 1JHTB 1TETH 1PY9A 1QBMH 4K71C 4LLUA 4ORZC 4LL9A 5F9DC 5FB8B 3LN4A 3EDFA 1OGAB 3EJJX 4OD1L 4H25A 4XCYB 4XVSH 3MLTA 5EU4A 2ADFH 4N90D 4WFHD 5GGSY 3V5HB 4HLZH 4JHAL 3HB3D 4MAYA 1WTGT 2G60L 4OJFH 4RQQA 2C26A 3QH3B 4YDIL 5BS0E 3P77B 2XFXB 3PL6B 5C2BH 5IMOB 5E5UB 3VD3A 1INEH 4GQ9L 1TVBB 2A6KB 4NHCL 2R0WH 5FYJU 5TQ2H 2W60B 4CNIB 12E8L 5FGBA 4OZGF 4M93B 2ICWB 4MA8H 2ENSA 3K4AA 3BKYL 3BP5B 4PRPB 4KK6D 5IG7B 4OCNC 5JIKA 3QA3B 1T0NA 3RWHB 3DRQA 3T4AB 4YH6A 1MIEL 3DUSB 3UBXA 2C7UA 4HXAH 4S10A 3OB0K 1CN4A 4GAGH 1BZ7A 4K2UL 3DRTB 4WV1A 1FIGH 1YN6B 1UJ3B 4NQEA 1EHXA 3PWNB 1D3CA 3FB7A 4KI5D 3GIVB 2EDXA 4P5TD 1E4WL 1FO0A 3IT8D 1GPOH 1F4WL 3HMWH 1UXSA 4U3XA 5KSAB 1XGQB 1KLGB 4P2QA 3SDDC 5BVPH 4U1MB 1KTRL 3H8NA 3OJVC 1KJ2B 3QDMD 1ZT7B 2BC4B 1OAYH 1U3JA 1UA6H 3EO9L 1IKFH 4P5MA 3RP1A 2M1KA 3FQWB 2AAVA 5HHQB 4YWGH 3TEUA 2DD8L 1ZHKA 3TN0C 1OB1A 3MRFB 1QSFA 1JPSL 3GRWH 1EZVY 4FXGB 4U0RC 3QO1A 2ED8A 2G5BB 4NUJA 4WHYH 3ZYJA 4TTGA 1N6QL 3BESR 5TE6H 4XX1G 5HHMA 3F7PC 4PGEA 3QEGH 4PG2C 2NCMA 4X7SH 1DE4A 4Z76B 4OKVB 4MB3A 1J0KA 5FHBH 4PRBA 2VYRE 2FHFA 5DMIH 1QFWI 1W0VB 4Q6IB 2ARJB 4Q6IA 1QRKA 1MCOH 5E2WH 2VDRH 3U0PB 3K3QA 2Q8BH 5H37H 5FO8A 3TYFB 3L9RA 2YN3A 3GHEL 3KPQB 2Q1EA 2X42A 2X10A 1S8DA 4NGHL 5F1KC 5C0IB 5IJKC 2IAMC 2Z31C 4ACPA 2EH7H 4BQCA 4KI5E 5DUML 1A5FL 2E9JA 1MIML 4NO0A 5F9AC 1UWXK 4Y1AB 4PGDA 4XP4L 3PV7A 4YO0B 5J89A 2VC2H 4P48A 3H2WA 1VPOL 3C60C 3ZDXE 5T1KA 3FFCB 2A6IB 3SDXF 4RMWA 3ZTNH 3QQ9D 3WD5L 1AGCB 1JHLH 1YDPB 3MC0A 4ZNEA 3WFDH 3G5VA 3PQYB 4MA1B 2ID5A 3IFOA 4MX7A 4YPGB 1MFNA 2EE6A 5J6HB 4LLDB 2APVA 5J1AA 4G7YH 2A38A 5KN5A 6CGTA 1TNNA 2E9WA 5D70L 1CGWA 1TZHA 1QBBA 4KKLD 1PLGL 3KPRB 3QJHA 1TVHA 3B5TA 1H3WM 3GJFH 4DKDC 3HFML 1FQ9C 3ILPB 5L88L 4U4BA 3I3BA 3L3DA 2NYYD 4RA0C 3VWKB 2FGWL 2C7UB 4L8BB 1P5UA 3UBXB 4PRDB 3C60A 3T4AA 3M1BA 3ZDYF 2JCCB 2KPNA 1MFAL 5TF1L 4ZYKB 3C8HA 5EZOH 4F7CB 5DUPL 4E0RB 1PGRB 4PBWD 3WMSA 2E7LA 1QR1A 2GJ6A 1VFBA 2X09A 5BRZA 4YHKL 5I9QB 3QCTH 2GCYA 3MV7D 1XF2A 1XGRB 3D25A 2R2BB 1D5IL 2QQNH 1E28A 4K3EL 1GCFA 3V5HA 1CDJA 4HFWB 4OLYH 4JEGB 1A6ZB 3V6OE 1HHIA 5BVPL 1AE6L 2AJVL 4GRLC 4QYOB 3KLAB 1VADB 4P49A 1FORH 2XRAL 4PJCE 4KTEH 3BPCA 5CJQH 2W38A 3QPXH 1NLBH 4MQ7A 3DVGB 4LLMA 3FOMB 3H9SB 5ANME 1RULH 1HSAB 4NQEE 1RUKL 1TZGL 2VH5L 4R90L 1AXTH 2R1YB 5EO9A 1EFQA 4XRCB 5D5MA 2VLKB 4K9EH 1M71A 4Z7UB 4ZSOB 4H26A 1I4FA 1CXKA 2B5IC 3SGKA 3AS3A 2NLJB 2AQ3A 2K7PA 3HE7A 2GY5A 3AAZA 4A6YL 4P2QD 4BSVB 3I6GA 1KFAH 4DZBA 4GMTH 4M9OA 1YNTB 5GSRB 4MVBA 2NZ9C 1IGTB 1L6ZA 1WFNA 1S78C 3FB6A 5B39A 1F2XK 2MFNA 5HDOA 4NHCH 2QJDA 5L2KE 1U3HD 2VXTL 4HH9A 4D0BB 3WSQH 1CGXA 3K1KC 1T6WA 2EH8L 1VA9A 1Q1JH 1CG9A 2IPKB 4FQIH 5C0BD 4ZUTA 3BEWB 3CFDB 3QIBC 1DQJB 1KOAA 4HS3A 3G6JE 2YSSB 3KPNB 4MLSA 4XNUH 5IFAH 1U8OA 2YKLL 2P5WD 2HT3C 3SHSA 3ZYIA 5I1DA 4ZOBA 5I0DA 3CDFA 2YZ1A 3HE7C 3VWJD 4HWEH 3ZL4L 1BQHB 1KCSH 2FIKA 5IOPA 4OM1L 4GW1A 5E6IB 1BREA 3FRPA 3IDYC 4JM4L 2OQJA 4WI7A 5BS0B 3V6OA 1IEBA 4MDJA 4NO3A 1QKZH 5FOBB 4YBLC 5EFIB 1B0RB 2HFFA 2FECL 2EECA 3CU7A 1HHJA 4CMMB 3X3GL 4JPKL 4J8RA 1NFIB 1OTSC 5BZWA 5I1GL 3UJJL 1PG7H 1SYVA 1DSFH 1BM3H 1ETZA 2H32B 2XG4A 3T04D 5DWUH 1ZT4B 5IFHH 3MNZB 4PRPE 4X6BA 1RI8A 3DJ9A 1P7HL 2R4RL 1N4XL 3ZKQD 5C70A 2IQ9L 5DC0A 1SYSB 1Z2KA 2IG2H 3MUJA 1TMCB 3MRRA 1FLRL 3GJEA 3VFUA 4G6MH 1SY6A 5TDOB 2LTQC 1PQZB 2BVPB 5IQ7H 2ZSWB 3HLAA 1G7IA 4PJ9D 3T1FB 1LP9F 4LVHC 4V1DB 3UMTA 3X12B 4X80L 1KACB 5F7KC 4HKZA 4XPFL 4OIIH 3VGBA 1I7RB 4F9PC 1I85A 4Y4KA 4LCIL 4M7KL 3B3IB 2DJSA 2ENYA 3OKOB 1A7NH 2I07A 4KDTA 4N8CH 1CQKA 1DBKH 2C1PA 1J8HE 4XP1L 1B9ZA 1KEMH 3C2AL 4R2GC 1JZ8A 3KLSA 1NUGA 3QPQC 3FQNB 4KK8D 4GKSA 1Q94B 1G6RL 3VFPA 5E5MB 5E2UL 5KW9H 2C3HA 1DFBL 3IS0X 3V6ZB 1F11A 1IGIH 3MGOA 3T09A 3ZT7A 2A0LD 1HQRA 3QEGL 4ZDHA 1YUHB 2M8XA 1JI1A 5C9JA 4NQXA 3I6KA 2VLJD 4ODHL 4UAOC 3IFLL 1HYSD 4K2UH 1BVKB 1VFMA 4IDJH 3OKLB 4W81A 1AGEB 4O02L 1QO3A 4U1KA 5C2BL 3O8XA 3G9VA 5D7JD 1CGUA 4D8PB 3VRIA 3OXSB 1S9VA 1IAIH 4NC0B 3VRLF 5GIRB 3OKNB 5JTWA 4JQVA 1G7MA 3EGSB 4TUOA 1NFDE 3M07A 3OAUL 4I3RH 7FABH 4F15C 4JZJA 1C08B 4E5XB 5I30H 4L5FL 4JY6B 3SEPA 1A3LL 3N1FC 4OF5A 4OZFB 1NL0L 3FFCE 1I8IA 3QIUA 3GBMH 4LEXH 5FYJD 4KV5E 2ZCHH 1JNLH 4JFOB 3QG7H 4M6MH 4QRPB 4XH2A 5SWZD 2PKDA 3CSGA 1A21A 5I1KL 3ULVL 2NXZD 1JMZA 1ORQB 1RZ8A 5GS1A 3QIUB 3EKCA 4AK1A 3VI3F 1WIUA 3C6LC 3LB6D 5DTFB 4BH7A 4P23B 1JTOA 1NBYB 1UACL 4GXUM 2IQAA 3NGBB 4GSDL 4P0DA 1FZJB 2CKBB 5C9KA 5F93C 1U42A 3EGSA 3PWUB 5TQ2L 5GIRA 4JFPA 3OWEA 3BH8B 5HYIA 4HS8L 1YY8B 3LSOA 2P44B 1JPSH 1ONQB 2EXWD 1ZGLM 3ILQD 2X4UB 2GSIA 1B4JL 4PJIA 3BQUA 2MJWA 1QOKA 2R69H 3EYSH 3K1DA 5IGXL 1K4CA 4L4VD 4YHZL 4J23A 4R7NA 1DP0A 1YNLH 5D7KE 3TH4T 3HZKB 4GG6E 1YUHA 1AFVH 4PY8I 4FTVD 1CGVA 3P3YA 1KCUH 3JBG7 3IDIA 2YK1H 5E70A 1OM3H 2HLFC 1A7BA 1MCFA 3MRPA 4KMQA 4TOYH 1AJ7L 2VXSH 2H45A 3L1OH 3MV8D 1IM9B 5CKGA 8CGTA 1U8IA 2UWEA 1KPVA 3FFCD 4WCYL 2W0FA 4YZFF 3T0XA 5DJ8B 1E6JL 1SBSH 3EYVB 1YMMD 5GS0D 5IW6A 3H9SE 2EO1A 5C07D 3FN3A 3D69B 5ALBH 4K3DH 4I48A 4LCCC 4BQBA 4FQJL 4D3CL 1SBBA 3B9AA 4I2XE 5HGDB 5GSVB 3MR9B 1OTTD 4HPOL 2ICES 3G08B 3RY6A 3KPRD 1CFNB 2PW1A 5L6YL 2EXWC 4NQSA 1S5HB 1DFBH 1HYRC 3S3PA 2JE8A 2DIBA 4ZUVA 4NKOB 2P47B 4S1DD 2ARJQ 4FQPA 3MFFA 4KROB 2HN7A 5FUOH 3F58L 2EYTB 1X3DA 2WY3A 2YRPA 3QAZB 3QIWD 5I73B 4GMTL 2L4OA 5JHLL 1XGYL 2W92A 3WIHL 1A6WH 4N68A 5GGQL 4LVOB 2AJSL 3IDUA 3QDJA 4O02H 4P9HL 2NXZC 4MDJB 4NO3B 2Q6WA 5C0CD 1DLHB 3WJLA 2VXQL 3QI9C 4EIGB 2F8VA 2ITDB 2C3XA 1KEGH 2FGZA 2JJUA 2VLRB 3AROA 4PB9H 4ZUUB 2VZ1A 2Z35A 3B2UD 4RGMB 4I3SL 3VI3E 3TN0A 4M5YH 5EULV 4PJ5D 4PD4K 1FLTX 2BDNH 4CVWA 3FRPG 4WW2F 1IC4H 4RMUA 1BFTA 4N0CA 2NX5D 4HK0B 1RUML 3JUYA 2LV4A 3M17A 1NCDH 9CGTA 4NKQB 1CG9B 1T0PB 3I6LE 5ANMB 5JNYA 1KEML 5IFHL 1RIHH 3SE9L 1YYMH 5I74C 3RPKA 3C08L 2IG2L 3FB6B 2D9CA 5GSRA 2O5YL 1HYSC 1XMWA 1FZKA 2D31B 4XWOC 1ZKAA 1EGJA 1G0DA 5EU6D 4LSUH 5GRUH 3Q5YA 1CLYL 2VE6B 4WWKC 2GI7A 3BPNC 4XGZA 5D72L 3I84A 5A2KH 4OUUB 3Q2CA 4JREC 2ICCA 3AMKA 4WFEE 1A64A 1O5DT 3IJHB 4RGOL 5BCAA 4NSKA 5CEZL 5L9DL 2ZKHH 4DEPC 3DI2B 3EO0B 3G6JB 1JIBA 3BD4A 4JY5L 3BIKA 1J8HB 3KLAA 4HMCA 3BXNB 4JPVH 4G8GA 3MMEA 3BKJL 3DGGB 1MQKH 4MLIA 1S7WA 3ALPA 4R6UA 1HHGB 1I9IL 3ULUD 4M7ZC 1G6RH 4PJEB 4PLKD 3LMJH 3QDGD 4LNVA 3QUKB 5MERA 4YHYC 4Z7VF 5IM7A 32C2B 4JM4H 1VFBB 2AXJA 5CSZB 5E8OB 2WWKT 3U6RA 1L7TH 4LKCB 1X4XA 4IMKA 3HUJF 5SWSB 1JGLL 1NMCC 4ODHH 2UWEF 3WNNA 3C5ZB 4JLRA 4M6OH 5E03A 3VE0A 1CICD 3BIBX 3FRUA 4YHPB 3RNKA 4DKAA 5MHSD 5F88A 2R4SH 4HZAA 3CH8A 2HA1A 3MACH 3U46B 3BP4A 5IB4B 4MZ2A 4OD2A 3K81A 4DW2H 4F2MB 1AD0A 1HCVA 5EC2A 3LDBC 5HHOD 2X4QB 3TBVA 3DYOA 5KG9A 5CCKL 4GG8B 4NQED 1FNEA 5GRYA 1R3KB 3D0VA 1R3IL 2OSLA 5CEXB 2MKLC 3QUMB 2J8UA 4J4PC 4JKPL 3BSZH 3ARRA 3LKOA 1TETL 5KN5B 1GZQA 1VEMA 3QRGL 3AS2A 3NMEA 3ARBA 4BZYA 1DQQA 4TTDD 5I1AA 5JXAL 5E9DA 1NCAH 5JR1H 1XGTB 4NKIL 2XACC 3VG0L 3X17A 3CDCA 4P59L 5D93C 4V3DB 5JOFA 4XPFH 4K7FA 4YDLB 4Z5RA 2ZSVA 5DFWH 1RJYA 2BNUB 5FDWA 4KMTL 4KVNH 1RD6A 3GJFB 3QIBD 4TRPL 2CQVA 4HKJA 2WK2A 3PGFL 2E7CA 1NGQL 1YMMA 3QIBA 3QP3A 5K9KA 3IFLH 4PRIA 3O11A 3NCCB 4QHKJ 4UIKL 5J12C 1S78D 2X44D 3BX7C 4D9RD 3OGCB 3X3FL 4JO4L 4LSSH 5I9QC 1P7QA 1QR4A 3HI5H 5FOJA 5D1QD 1NBZA 4C54A 4LPUA 2RBLA 3GI8H 5B21A 1Z5LA 3MODL 3C5JA 3CLFH 3LH2L 4BELD 2XTJE 4GG6B 4NZUL 5HHOE 5C0AA 3TIEA 4CBPA 1CTNA 1HZHH 1WBXB 3HG1D 2X70A 2D7TL 3S7GA 43C9B 1OGAE 3F6IA 4QTIH 3EYUH 4ONGH 1NFDB 1IMHC 4FXGA 1LHZA 4AMKH 5IIEB 4N0RA 1QRND 2A2QT 4HJ0D 5INCA 4QRUA 1T2JA 3LEXA 3KJ6H 1IGYA 3LN5B 5J1SC 4MSWB 4DKFL 1K85A 4TQEH 3O8XD 4OT1H 1K4DB 5JW5B 4GG6F 1UM6L 4J3OC 2E7BA 1MCOL 3DBXB 1CD0A 2HMID 3PL6C 2JF1A 1MFEL 3FO9B 2EDWA 1GRWA 5F8RC 3A0OA 3O2DH 4WHTA 2B1HH 4NZDA 3MOBH 3UAJD 1E27A 1MWAA 3PWNA 1Q9LA 1FNEB 3STZA 1EXUA 4QXTA 5F3HB 5J57B 2ZUVA 5FCUL 2DTML 5FF6A 3S37X 5IWLA 2NYYC 3T1WA 1J0HA 4U6HB 5I16B 5HGHA 1MCKA 5C71A 1FZMB 25C8L 3MOAH 3U46A 1R3HA 4UTBL 3LD8C 5F88B 3GMQB 2VZOA 3R06B 3MYJB 4YR6B 2CGRH 3UAJC 3TJEH 4KKLC 5CD3B 1LD9A 4MA7L 1P53A 4M1CD 2WP3O 2X9YA 4XMLL 1IAII 1W72L 3C6SB 5DJ2A 3CPLA 5IVXF 4FQCH 4MD0B 4V3EB 4WTZG 4HJJH 4NRZA 4OIAA 3ECBB 4OLZH 5HPMB 3VGGA 4WVRA 5CIPH 2C1OB 5JIPA 1B0GB 3U82B 3OZ9H 3RBGA 3MV8B 4HQQH 5F7YC 3STLB 4G3YL 1B2WL 1CDYA 2AQ1A 2VRAA 1EEQA 4OLXL 5TE6L 1D5MA 3RGVC 2NY6D 1OF2A 4POZD 4WUUB 5L9DH 1GGUA 1WZLA 3G6JA 4Y2OA 3RWFB 5KS9E 4JKWA 3SE8L 4P4KD 1KC5L 4G9FB 3RUGB 2DI8A 3QNZA 2Z91A 4Y4HD 3DMMC 3QEQD 3S37L 2E7MA 2X7LA 2IANA 4UT6H 3VH8B 2XTLA 1TDQA 4A2LA 4PRID 3S97C 3HI6L 3PGFH 2Z8WC 5I15H 5F1NB 3LV3A 3C5SB 3MLRH 2NR6C 3QXAB 1XH3A 2EEDA 1QSFD 2FX9L 5T5NF 4POYA 3HZMA 4YWGL 1TTFA 4OJFL 1A5FH 1MCBA 2VXVH 3AUVA 1ZA6B 3NTCH 1I8KB 1NUNB 5D7LA 3UTTA 2ADFL 1UA6L 3EO9H 2P24B 1ADQA 4JPIA 1TJIL 4OZ4A 3QDMA 4A6YB 2Y5EA 5F7NC 5JNYB 1AXSA 2CDFA 4UUJB 5DDHA 1MI5A 4Z8FH 1BLNB 1JUFA 1RJLA 2H26B 3OKDB 4EIZC 3GRWL 2SEBA 3MRNB 3LQZA 4LVNC 3DO3A 1NJ9B 3U9UA 1WZKA 3MJ7A 3H9SD 4M5YL 3KS0H 4OGZA 1JTPA 3D9AL 1XF1A 5GGTA 4U1LB 3ARVA 1BQSA 5FYLH 4Y5XC 1MHHA 4M5ZH 1MIEH 4X6DE 3LS5L 4KAQL 3KHQA 1KB5B 2Q3ZA 2D7QA 5ESAB 5H8DA 1RZJH 3RL1A 4MHHG 3ZE2F 1AO7E 4HWBA 3QULB 2R29H 1BOGA 1RZKH 1OT2A 2NY5C 5C0BB 1HILA 4KK6C 5INDB 3TIDA 2X4RA 3K4ZA 4X5WB 1INDH 4NRYA 4XPTL 1CDGA 4WU7B 1MCLA 3TBWA 2BY2A 4M6OL 5EH1A 5AUMB 2F53B 4Z7WF 4NT6B 1MLCA 3LKQA 5F1IB 2NY6C 4O9HL 1PAMA 3S5LA 2HG5B 1HXMA 3SN6N 3MR9A 3IKCA 1I7UB 4PRHE 2XN9B 1URLA 3QUXB 2DIAA 2FX7H 2VH5H 2EYSB 3MCG1 4WGVB 5I8EB 5KJRH 3TT3H 4F33B 4BM7A 3LHPL 4I5BA 2FJGA 1HXMB 2P48B 1L7IH 2WQ8A 5D72H 3VFWB 1IGFH 4AIXA 4ZPTB 4P3CL 3C2SA 1HOCA 3SE4C 4NT6A 4JG0L 3HRZA 3TBWB 1U8IB 1MFAH 4G8GD 5TF1H 2VNCA 1T21B 2XQYG 4PP2B 2FR4A 4Z7UE 5CEZH 4MJ6B 3DECA 3Q5TA 1HILB 2HRPL 4TVPL 1BBDL 4PJEE 3FONB 4UZGA 1JPFB 4KJWC 1A7OH 1BJ1H 3KWWB 4YDVA 1YEIL 1D5XB 1LEGB 2DKUA 5DRNA 5C0CA 4I77H 4Q2ZA 1LO3H 4Q9RH 1KB5A 3P4MB 5M7QA 5JUEH 5I15L 4FQLL 4K9EC 1JF5A 3MRHB 1XFPA 1FFNB 1N3NA 3W0WE 1ZS8A 1F3JA 4ZTPH 2PXYB 1C12B 1HNGA 1FZOB 5I19H 4OCSL 4QHUB 3KGRA 3OKDA 5TQ0H 3BDBA 2G5RA 1NEUA 3FMGL 4MJID 2YN5A 5EU5B 2VAAA 3WUWG 4DGIH 1G6VK 4N0CD 4O2FA 5IBUB 4D9QE 2VLJA 4KGJA 4QOKA 1FVDA 1UC6A 1BECA 3TNNB 4OQTL 5E8DL 3U4EA 3IB4A 3W9EB 1MRFH 4HGWA 5GRJL 2OL3L 1CE1H 1Q9KA 3CSBA 3OAZK 1ZAGA 3QIWC 3KVQA 4Y5XB 5IMLA 3SKMA 4LSSL 1BEYL 2QR0A 4O2CB 4X8JA 3BKCL 2VDLL 1L8JA 2DQFA 4ZO9A 1DBAH 2YWYA 3LQAL 4UTAH 2P5WA 3CZFA 4L8SC 4QRTA 4JQIH 4G8EB 1RFDH 5EIVA 5DD0L 1E4JA 3FO1A 3RWFA 4NO0D 1OF2B 2HJFB 3HI5L 5CUSH 3TO2A 1FO0L 1KB9J 2ATPB 4ZFOA 3OG6B 5FGSA 2FATL 2WINA 1SEBB 5HD8C 2OTPA 1UH2A 2QL1A 5EB9A 5GS0C 3RHWK 3MLZL 3EDDA 4IOFD 1H15B 2DLFL 5KSVA 1C16B 1I1RA 2MNUA 3IDNB 3VG9B 5TE4L 3HC0A 4LLVA 4R4BA 1NGWA 4LLYB 2A9NL 5D2LB 1GAFL 4MNGA 5MHSE 1U8MA 1RHFA 4PYHA 4LHUG 4HEME 5CEYA 5FYKH 4N5ED 2XA8H 3ZE2E 2FEDD 4PGBA 1MEXH 3UTQA 1XEDA 4GW5B 5KS9B 1KJMA 2HYMA 5H35A 1S7VB 5I1LB 1BAFL 4HLJA 4U6HA 2BVTA 4H20L 4OIIL 4PG9B 5MI0C 2F19H 4OKDA 4I0PA 4PGCB 3TZVD 5SV4A 4W4OC 5TDNB 5HJ3B 4XPGH 3CFBA 5KBNC 5E6IC 3N1QC 4IRSA 4YHIA 4XNUL 2EDFA 1R5VA 2R2HA 3MOBL 3UTOA 2APFA 1K3IA 2DLIA 1IVLA 2ILLA 5AD0A 1UVQB 2HVJB 2VL5B 3W11C 5JW4N 1U8LB 2ESVA 2WAHA 4L8DB 1AXIB 2ZG3A 2OXHA 4ZFGH 1PG7L 4I3GA 5IB5A 3ZE1E 5I1HH 2H32A 4NQTA 5I1CL 4OZHA 2QKIB 4XMLH 1FGVH 2GFBA 5T3XL 5KVFH 4UILH 5JLZB 1N64H 4UT7L 3LIZH 5BS0A 4PJDE 1NAMB 4AYFA 1YPZE 2UUDH 2Z8VC 1EEZB 4XXDB 3DLQR 3VXRA 3AREC 5IW1A 4GXVH 4PRNB 4M48L 2YBRA 3V0WL 4DGYH 4L9LC 3GSVB 4YHLH 5A2FA 2JELH 4PJBB 4RAUA 5C09A 1OL0A 4HK3J 1V7NH 5EUKA 1XGUA 1VGKB 1YECL 4XVJL 4ZS6D 2V2TB 3QEQB 2PR4H 1YQVL 5D7JC 1JPTH 4JRXA 1T5XA 1RZGB 3VXMA 3DNKA 2B1AH 1CYGA 1A6TB 4PRIB 4HJGB 4PGJA 2EDYA 1H5BB 1T1ZB 3DX8B 5J6GB 4KK5C 4O4YH 4ZS6C 2F15A 4LPWA 4DZBB 2J4WH 2R23A 3I6GB 2F54E 4GRMA 3E1F1 3DURA 4D9QD 4O5LH 1NUDA 5B3JF 4S1SH 1G7QB 3GSXA 4P57B 4WUKH 4H1LG 4N90E 2WIMA 3W81A 5KZCB 5FFLA 1JVKA 1G7HA 5ADOL 2IALB 2GITA 3R0MA 5ENWA 3RVXD 2KZ1B 2FX7L 1R3LB 3PP3K 1HCFX 5J0BA 1QP1A 4O2EA 1UACH 2AJYL 4GSDH 4KVCH 3HUJB 5CEXA 2OSLB 5D93B 4GUPA 3UTPD 5E5RB 1VADA 2YRLA 4TNVK 3DTXA 1HXYB 4OFYA 4NQCE 1KIRB 4JG0H 5I8CB 5I71C 2DQUH 4I2XB 4LF3B 4QTHA 4ONFH 2BFVH 2IH3B 3VH8G 1SJEB 3BP4B 1HI6A 4YXLH 5B4MD 3WUWB 5HGAB 4BH8A 1RK0B 4XMKH 5AZ2L 3KPSA 4OCYH 4H5SB 1XR8B 4YNYB 2IPUK 3UBXI 2GJ6B 4M4PA 4L8CA 3ARFC 5D7IA 1IKNC 5FYKL 4F7CA 4NJ9H 2BRQA 2IPUG 5E6ID 4EOWL 4WI6A 3VXUE 1J1OL 2X1PA 5MERB 1JGDA 2XWTB 4CVXB 5DXWA 3C60B 1GGIL 4RAVB 1SJEA 4EQ2A 1S7WB 2VQTA 4XPBL 4XAKE 4EJ1C 1E0OB 1FL5B 4Z7WE 1UENA 2A1WH 1RZKL 3FO2A 2F53E 3KPRA 5BQ7A 3PDOB 4S2SA 5IROC 3EO0A 1ZGLP 2J2ZA 5K33A 3IJHA 3WIIH 3X14A 3CXDL 2Y1VA 5EOCJ 3WNMA 4NKMA 1R3LA 1SEQH 5ENWB 4WU5B 2BJML 5J6HA 3HE7D 3U2SA 3OX8B 1JYNA 4OCSH 5FGCB 4XCNA 4JRYB 1GIGL 2UY6A 4WFGD 4P57A 2LU7A 4XGZB 4URTB 1U8NA 3BP7B 3WNOA 4DAGH 1J86A 1MJ7H 4KQ4H 3LN9A 4CVZB 3BWUC 5IP4A 1S3KH 3V52L 5A2JH 2R15A 1MIMH 4FQ1H 2I60H 1Z9MA 5KJRL 5CZVH 4JREB 4OLUH 5EBMB 4Z78A 1XAUA 1FSKB 3A6CL 3ZKNC 1CXIA 2Q7YB 4PIRF 5J3HC 2VDNH 1MEXL 1JN6B 2Z92B 3E3QC 5FYKU 1JYVA 4IOIB 4XVUC 5FYJH 4X4YA 3BPOB 5D7SL 3W2DL 3BO8B 4LMQE 3VXUD 1NUFA 4U0RB 3CVHA 1EO8L 4NCDA 1DEDA 4PRNA 1TXKA 2PO6D 3N06B 1OQXA 3MJGX 4MCYA 4YK4B 4F7TB 5ITFA 1C8PA 1T20B 4ODWA 3GBNH 3NVQA 4Q9QH 3BGMA 3QWRD 4KUZH 4I3SH 1CXFA 5BVJB 4GAGL 3RZCC 4K7PL 4PJFE 1DLHA 3KLDA 4NQDB 5JLZA 3DYPA 4FZ8H 1FL6A 3BUYB 3IDMB 2QQKL 4ODSH 1DTUA 2NY1B 1GAFH 2VSDA 5EA0H 5K59F 1KYOK 2O5YH 1QTYT 4H1LB 4N9GB 1B4RA 2JJVA 1IGFL 1DLFL 5EZOL 1JI2A 3U4BH 4EI6B 3H0TB 1T7VA 2AK4B 3FQWA 1IAOB 1OPGH 5HI4D 4OF7A 1D5BA 5E7FA 3WFCH 2A9NH 2QSQA 4LGRB 4LVOC 3F58H 2MHAA 4WI5A 1X5HA 4MA3B 5D1QB 5FKPB 1WZ1H 1R5VB 2R2HB 4NBYB 1IZJA 4N8VA 3L3JB 4BJLA 1AGDA 4JQIL 4KGLA 4M48H 3AY4C 3FB7B 2DM3A 1NMCB 4PLOB 5MP6L 4R96A 4HX1A 5MENE 4KTDH 4KWUA 2OL3B 4KJWD 2BSSB 3D69A 3GGWB 2J8OA 1T1WA 3WS6A 4AH2B 4RBPH 1ACZA 3GMPB 5T1LA 1JWMB 3UTQB 3WHXB 4IIQA 1QVOA 4Z7VA 5J13C 3KHOA 3F7QA 3VFRB 1GGBH 5LAXA 5LXGL 1JRHL 3VGAB 2IADB 1A6VH 4FQQA 1OAYL 4YGVB 1NGWB 2A77H 1FCCA 4LLYA 3TJHA 2AXFA 1MJJB 1J0IA 1S9KC 4XBEH 2BOBA 2Y23A 1I9EA 4NGHH 1X44A 5KVEH 4XC3H 4L4VB 4YDJB 2R0LL 4XBPA 4XNZB 1DUZA 3MLTB 4CU6A 3WFDL 1RJZA 3D2UB 1I1FB 5DJZB 1GGCH 5TPWH 1GHFL 1J05B 2VJXA 3O2WL 3QHFH 5IQ9A 4PJIB 1J0ZA 2BXZA 1DDHB 3E3QE 4JDTL 4PJ9C 1RK1B 4PJBE 3FO1B 3LZFL 5B38G 2Z31D 3NCJH 2FLRT 4ZQKA 5C0FA 4QCIA 1WGOA 5IF0B 1N7ML 2YPLB 4GFTB 1YN7B 3S34L 3RWGA 2H6PB 2GK2A 2WP3T 3TZVB 1KIPA 5BXFA 1RUPH 5I1GH 4DVBA 1FZJA 3MGTB 5B8CB 1JPGB 1LEIB 2QBWA 5GJSL 1LO0H 5GGTH 4DVRL 1Z3GH 2VZVA 3KYNA 5TGBB 3FAXA 4FMKA 1N0XH 1SJHB 4B7LA 1MJ8H 3QIWA 1WLHA 3LRSB 3RWEA 4LLAA 3UZVB 1SJXA 2MMXA 3DVNA 5F7EH 4HXBH 2VQUA 1ND0A 4QHUA 1BVLA 4PGZA 1H8NA 2KKQA 1CI5A 2A1WL 4XB8A 2P8LB 3J8F7 2BNQD 3WLWD 1BJMA 3ET9F 4W68A 1ZS8B 5FKAA 4HCRA 3H9HA 3E6HB 1T1XB 2R4SL 3VJ6A 5F70A 3BIAX 4XCFL 5KVFL 3QNYB 2IFGA 5H94B 1X5XA 1X6LA 2HTLC 4LCIH 1UKTA 1HE7A 3DIFA 1WCBB 5CLWA 1AGEA 4GAJH 2BOCA 3EDEA 1ZV5A 4P5KA 1JFQL 4R0LA 5A16B 2K9UA 4NQXB 3ESVF 3FQXA 1A7QH 4H0GA 1CFVH 1RZFL 4HBCL 5SWZA 5GGSB 3EOBA 3QJFB 5L8JB 4XMKL 5AZ2H 5J06A 3L95B 4Y4FA 4DKEL 3BGFB 4U1JA 2K3TA 2YD7A 1K8IB 1UCTA 3DMMD 4DUXA 5DJ6A 4OM0H 4UAOB 4JAMB 1PZ5A 2AJUH 3VGHA 4GH7B 5HSFA 1U8PB 3S36X 4YGAB 3S35H 3V0AC 3AU1A 2DL2A 3PG2A 2Y07L 3RNQB 1XR9B 2WV3A 2FJGB 1OWRM 2G9HA 3WXWL 3B3IA 4F33A 3MOQA 5C0EB 5DRZB 1S7SA 3BAEH 5DRZA 2BRRH 3JVGA 1OOAA 4PJCB 1I7RA 3QQ4B 1T7WA 4JRYE 1W0YT 3HUJE 4M5ZL 3S35X 3ZL4H 2MQCA 1H3GA 1ZTXL 5JIHA 5D2NB 4JY4A 1TLKA 3ZKXB 2OLDA 5BMFH 2I5YH 4KUZL 1SY6H 2OI9C 4HBQA 4MA7H 4G6FD 2IAND 4FZ8L 3UP1A 2PTUA 3P30H 1DVFB 4J4PA 1FFQA 5GGVH 1SYSA 4MS8D 4NM8L 5KW9L 1NDGB 1FLRH 3QXDB 3BP6B 3RZCB 4G8FA 1V8HA 1OW0A 3QYCA 4JO1H 1G9ML 1IGML 5EN2A 1I1YB 2RB8A 1J1PH 2VR9A 2DQIL 3OZ9L 5B3NA 2O61B 3JVGC 4MJIA 3P2TA 1DN0A 4A6YH 4LSPH 5JOPE 4M7LL 4M7KH 2HMIC 1YEGL 4QT5A 2BMKA 2BCKA 3H9HB 3TVMD 1LEKB 5SWSD 4UT6L 1PKQB 2J6EA 4LDLB 1INEL 3VU2A 1RSFA 4FFZH 5DD6B 1RUQH 3RDTC 3CMGA 2DJUA 3HPJB 1ND0B 2VUYA 25C8H 1RZKC 3VXSD 2XNAB 5DSCB 3HR5B 2CK0H 1CFTA 4XC1H 3LD8B 4EQ3A 3B8YA 5DHVH 5HHVH 4JKKA 4QKXB 2A77L 4KJPD 2WLZA 2GT9A 3NH7L 3QWOA 5GRXG 1B0WA 1MOEA 1ZA6A 4K3JH 2XZQH 3O81A 3A6CH 1LO5A 2XG5A 4TSBL 2XQBH 1JFMA 4QRSB 4Y8DC 2ZUQB 4OB5H 2BNRD 1OAQL 2MPAL 3QDJD 4C56B 1IM3A 1JGUL 2NLJA 3IXTA 5T3ZD 5D7KD 1J88A 3G6AB 4FQCL 3WFCL 4DVBB 3T0DA 4H26B 1DN2A 5DURD 3W9DB 1DBMH 4M7JL 3W5NA 5I8KH 5HYEA 4MD5B 2PTVA 3ARDD 1HSAA 1AP2A 3QNZB 5DRXB 1CF8L 1ZEAH 3DUHA 1NGPL 4KY1L 5ID1A 3C87A 1X5IA 1DDHA 3EZJB 3BRDA 1MHPH 4K8RH 4WUUA 4YIQA 3WCYA 3JZ7A 3VD9A 4EBQH 4JE4B 1FYTE 4OD1H 2FIRT 2IH1B 2NY0C 2PYED 3BZFA 4C4KO 1E4XL 4X6DA 1RZIA 4BZ2H 3E2HA 4L4VA 2OCFD 4MWFA 4OZHE 5IBLD 1TJHL 1JK8B 2G2RB 3BQUD 4RRPA 3V4VL 2DQDL 1E4XI 3QUZA 3B4NA 1RQ5A 2N1KA 4I0PD 3EYOB 1BWMA 5EIQA 5CSBA 1A7PL 1D6VL 3BWAB 3S4SB 1NH6A 2O5XL 4EI5A 4HAGA 3H42L 2KZWA 5HXMA 1DLFH 5C3TA 3C9NB 1KEGL 1FAKT 4RMRA 4ZOAA 3MCKB 3GMPA 5T1LB 3THMH 1C5BL 1AGBA 2AK1H 2LTQB 4OZGE 3BW9A 4P46B 3L3DB 1FVCA 2AEPH 3B5GA 4TULH 2OL3A 4LNRA 1X7QA 2ZCKH 1EJ6A 3LVEA 5I8OL 4HIJA 4QGTA 1JWSA 1E27B 1W0WA 1MCWM 3KJ4C 1E4KC 1GPOL 5JHDB 4N8VB 2V2XB 1R5IB 1XF3A 2VDOL 3UC0L 4JFZH 3GSRA 1U36A 4YDKL 2J88H 3O3EB 1JYWA 2YD5A 1F58H 4MA3A 4YFEA 3MV7A 3GSWA 2CRZA 1P1ZB 1BFOA 4WO4D 4XAWH 4WDIA 3IFOB 3UX9B 2PYFB 2YMXL 1Q9WB 2FYYA 3CC5A 1CFVL 3HB3C 4OGYL 1IAOA 4RMTA 3BKYH 4NQCA 1YC8A 4H1LA 4JQXC 3A67L 4G6KH 3PXHA 3V9FA 2VQ1A 4S1RH 5I2IB 2BMKB 3OAUH 4H88L 5GGQH 3GMLA 3CVHL 3MLSH 1FGNL 3LQAH 4CKVX 3WS6C 2Y06L 1S8DB 1WBXA 5DMKA 5K59E 4U1HA 1BF2A 1BHGA 4FQLH 1CFQA 2QSVA 4MCYB 1Z5LB 2R1WA 3SKOA 1U3ZA 3BEVB 1A3RH 4JPVL 5MEQB 4PJCF 3MRJB 3DROB 5FHAL 3WS3B 4ELMB 2OI9B 1P4IH 3AFLA 3B9KD 5ALCL 3ZKXC 4ZFGL 3CUPB 43CAA 1K5NA 1RIHL 2KQMA 3ARTA 4ZXBA 5IMMA 1JN6A 2V9TA 1M4KA 3IU3A 1IAIL 4B7IA 4LCWA 2XPGA 1ZHBB 5DJAB 2C4XA 4YHZH 1AKJD 3K0WA 3OMZA 4N1CA 5D2NA 3VXSE 3WO4B 3UO1L 1SJVA 4U6TA 1S9XB 1R0AL 2MCPH 5IMKA 2X41A 4ORGB 1L4IA 4CVZA 1JGVL 4S0SD 5C0EA 2HVKB 3FT3B 5FUZL 5F6IB 4P5MB 3WEXA 1LNUB 3HN3A 1CLZL 3JTSA 4PB9L 4S11A 2R8SH 4LCWD 1RULL 1CU4H 2KL6A 4J3UA 5FUOL 1K2DA 1FFOA 1MWAL 3I75B 4HIHA 3BE1H 1XGQA 3GO1H 4X6EA 1K6QL 1OM3L 3ZKSD 4Y4KC 1K8IA 5J12B 2XICA 3DETD 4OZFH 3HMWL 1JPTL 3L95A 1U9KA 4Y4FB 4W4OA 1CE6B 4P9MH 1NGZA 1UCBH 1E4XH 5E8NB 5EBLB 5CZKA 2AS5M 1IC5H 5FK9B 4KQ3L 4KZEL 3DMMA 4FN0A 5GGVL 1MPAL 4WHCA 2GSGA 4AZ8A 1X5AA 4UDUA 3J7HA 4R0LB 2PTTA 2EYRB 4FMFA 3DIFB 2VN7A 5L6YH 1CTOA 3QRFM 2ICWA 1FO0H 1JZ2A 4CNIA 4HUUA 4L9LB 1UG9A 4I4WA 5GGRB 4NBZB 5L2KB 2HT2C 1KPRA 3U0TA 1EHNA 1NLDL 1AI1L 5FKAB 2EYRA 1TPXC 1R3JA 4BQ9A 1R5WA 3IDGA 3ROOA 5KSBB 1INQA 3S9DB 2E27H 1ZLSH 3DGGA 5DHXB 3DVNB 2BHYA 1KIRA 2AABL 3KNBB 1R3IH 4P2RB 4I9WD 1ZGLB 3RA7L 2C4FU 3EAKA 2H2PC 5CGMA 1X5KA 4K8RL 1AQKH 2YC1B 2CDEB 3MGAA 1FFOB 4HIHB 4K3DL 4L8SA 2BDNL 5T5NG 2BP3A 3MUGB 2F53D 3MXVH 3UJIL 4Y4FC 4K71B 1LNUA 1AC0A 5C6TH 3SKNA 4HPOH 5J8OA 2GJJA 3DHMA 2VE6A 4QHMA 3TZVA 3VFSA 1OP3H 2BSRA 4QY8B 2ZOKA 3O6FD 5IMKB 4ONGL 1EGJH 1YMHB 2YUWA 5DUMH 2YPKB 1R24A 4I0KA 1FGVL 5MEPB 1RY7B 1BQLH 1RHHB 4WIQA 1RZGA 4JRXB 2F54B 1U8HB 2XA8L 1FAIL 2DF3A 4LSPL 3FT4A 1G9MH 1IGMH 1YMME 3PWJA 2AV1B 5C0DA 4RAUB 3FAWA 4PJBA 1W8NA 1PW3A 4PJAF 3WN5C 4FA8A 4IM8A 4WNQA 5HHME 5HY9B 5M95B 2Z4QB 2JIXB 4RISL 4PBVC 3TN0B 3PUCA 2VAJA 3BPNB 5I0ZA 1FRGH 4Y2DA 4WW1A 4YJZL 2Y9RT 3CFKA 3OF6D 5E2UH 5FO9B 1ITBB 2MKWA 2VERN 4IRJA 1TZGH 2HJLA 1UWGL 3VWKD 4R8WH 1JF1A 2MTPA 5DZLA 3PWVA 2GFBB 5HYQB 1G0YR 3V6BR 2VQ1B 2XKSA 4IDJL 2J4WL 1V7MH 1CGSL 5FA3B 5DEZA 4IRZL 5JXEC 4O4YL 3QEHB 4RIRB 3VI4E 2GJ6E 4U1SB 5GJTH 1Q9WA 2PYFA 3RUGF 4LRIC 3RZWA 1AGDB 1KCGC 2HKHL 1GZPB 3RKDD 4Q7DA 3QWQB 4NM8H 5AD0B 3MV7B 4OLZL 3REVB 1FNAA 3VXUB 1KTLA 1T6VN 4NO5A 4Y16B 1WK0A 1IEAA 2PO6B 1ACYH 1QRNE 3MRBB 3G08A 5C0JA 4AL8H 4IRJC 3VW3L 1VHPA 4Y7MA 5C08E 4MVBC 3SO3C 2AK4A 1KJ3H 3ZSSA 1F6FB 4EI6A 3PWPD 1MJUL 5BJTB 2A0LC 4OF0A 3BW9B 4P46A 5H35B 4F3FB 2Q7NA 1KJMB 2FX9H 5D7IE 4RFNC 3PWVB 2Z93B 5IVNA 4HAFA 3C2AH 4HHAA 3KJ6L 5FA4B 1U91B 4PJAA 1G7JA 2NY3D 4R4NC 5CEYB 3U1SL 3S4SA 5FO9A 3K8LA 3BISA 3HC4H 3SDAC 3SCMC 1IC7H 3UYPA 5DD5H 4OCXL 2BNRE 4NO2B 1EBPA 4YLQT 1FVEB 3WSQL 2C9AA 4HQQL 1LK3H 3O6LL 5IFAL 4YC2B 4KJQD 1YJDC 3EOAA 4XZUA 4YIQB 2WQRA 2J7LA 1A4KB 1QA9A 3CJJA 4FQIL 3ULUL 2W65B 2FO4B 2HRLA 2P5EB 3X3FH 3FQRB 2VISB 5D2LF 5HHPA 1OAZL 5DRXA 4N0YH 5JMOC 3ES6B 4FQ2L 4QY8A 5D8JL 5FYLL 5J1TC 4J12A 2AKRB 3IXTB 5CGTA 1IM3B 3QFJE 3Q6FB 4Y5XA 3E6FA 4QWWD 4I0CC 4NC2B 1T80A 4LHUD 5LBSH 5MEND 3W9EA 4NQDE 1NC2D 4M43L 4R4FL 1EVUA 5GS1B 4XX1E 5IHLB 3R4DA 5I6XC 2GT9B 3DYMA 3BD5A 1Z6JT 1MREL 4BKLA 1U58A 3FHAA 3T2QA 4JZJC 3B9DA 3ARBD 3VWJC 1FL5A 2VDQH 3U7WL 3LQAC 3HR5A 4DK3A 5EU6E 1INDL 3FZUD 1YEKL 4GBXA 5DF0A 2IC2A 4XP9L 1P4LB 2HTKD 2NY4C 1JGDB 1KB5L 3ZMRA 3O9WC 3OKNA 1MFDH 1S9VB 4U6XB 2V17H 3ZHKA 1ADQH 4UT9H 1AD9B 1MLBA 1IAMA 5DLML 5C08D 4YHML 4NNPH 5EUOB 5DEGB 4N0UA 2VB5A 4Q9CA 2NZ9D 1UWXH 4EDWL 3I6KB 4QRRB 3B9KB 4U33A 3MA9L 1I1YA 1VB9A 3ZSTA 1HQRB 2DQJH 5E8NA 1NGZB 4H0IA 1A9EA 2X89A 1SEQL 3WE6B 5E5MA 5KOMC 4HW6A 2OMNA 3QG7L 4UNTA 4TSAH 3FQNA 4HCRL 4JPKH 1P4IL 3P9MA 2GYSA 5LWYL 3SJVB 3DVIA 1CICA 3DXAD 1OPGL 3CH1A 2VLRE 4PJIF 4I5BB 5E4IA 3L5IA 3QQ4A 4PJCA 1FNGA 2ORBL 2A6DB 1CD9B 2BSTB 4R97C 3I3DA 1OLZA 3MLSL 3BHBB 4GRMB 2PYEE 1GL4B 2DQCH 4K7PY 3PP3H 4JHAH 3V4PH 5IVZB 4H1LH 1I3RB 3RWJB 1BGXL 2D9QB 2DJ4A 1JE6A 4LGPB 2ZSWA 3T1FA 5KZCD 4Q9QL 3UPCA 4JZOA 5EBGA 4LSRH 43CAB 5BO1H 4JO2H 3M45A 5EUKB 3KPLB 1BBJB 1T1YA 3TIDB 4AQOA 3SKJH 3R8QA 1U95B 2HRPH 2ZNWA 3RY4A 4KV5F 2P8PB 2EIBA 4GAYB 1QBLH 3PGCA 2HFEA 2NY2D 3EYFA 4YFLF 5SWZB 3TJHD 5HYJB 2IWGA 1O0VA 1JTTA 2NXZB 1CFQB 3V7MA 1KLUB 3RL1B 4ZOEA 5T1DH 1UB5B 3O2DA 1WISA 5DEFA 4U6VH 1F3DJ 3VXOA 2H8PB 2VKXA 1UWEL 3GSNH 4CN6A 2NY7H 3MREA 1KYOJ 4S0UC 4LOUD 1QLRA 3QUYB 5DD1H 5GS0H 4EUPB 4U1LA 4FTVE 3TCXA 1EH9A 4DFHA 5IB5B 1JGEA 4OLXH 2EZ0C 4MJ5B 1MHCB 1MCHA 2D7OA 4KUCF 1HK6A 1BVLB 2YSSA 3KPNA 1Q8MA 2AJXL 3MRNA 2RFXA 5D6DC 1IAKB 2FZ3A 3C60D 5EPMA 4UQ3B 2OS7A 2AXGB 1T5WB 3CCHB 5B39G 3VXNA 5J4MA 2VTFA 3MRGA 4B5EA 4LEOA 5E1AA 3TCLA 3IFNH 3GSRB 3LKRA 3IFPB 3PHSA 4WI3A 3NCFB 4G7VH 3K8MA 4RDQG 3ZTJG 4MXQC 2AJUL 3VGFA 2XT1B 1CGSH 3MYZA 4G80B 2WW8A 3JTCA 1X9QA 1KN2H 1NC4D 4JFHD 3FT2A 3QXAA 3QQ3A 3HE7B 5I1LA 3LV3B 4HIXL 1EAJA 3NACL 1A6VL 2Q86A 4NZRH 1FIGL 1AGFA 5IVXA 4JRXE 3RWGB 2IBBA 1GOGA 2COQA 2VZUA 3IRZA 5DVNA 3HKFA 1T66C 4YUEH 5E6YA 1U8MB 1WF5A 3BH9A 3BWAA 1ORSA 2HAZA 1MFBL 4XPAH 3ALWA 5GGVY 4QF1A 4I18B 4XCFH 1NGYB 3ROLB 2XN9E 1P6FA 2CRMA 1UZ8A 3P4LA 4JFEE 1I7ZA 2NTSP 2N7AA 5HVWA 1RJZB 4J6RL 5JO5B 3SPVB 2EZ0D 3FOLB 4HFWA 8FABA 1DUZB 4HMDA 4UU9B 4XBPB 2BVYA 4PFEA 4PJGA 4BZ1L 3MV9B 4AJ0A 1XGRA 3D25B 3TO2B 3ECBA 3VXQA 4LOUC 1IC7L 4M7ZB 2BNRB 4DVRH 1IBGH 4RGND 4NQUA 3KXFA 5ID1B 1YNLL 1CDIA 3P9WB 1DBJH 2HWZH 1ZVYA 5D1ZD 3MNVA 3V0VB 4YEFA 1AGFB 2WLYA 5IVXB 5JQHC 1P6AB 2C4FT 3W9DA 2NY2C 4AH2A 2QSCH 3IDJA 3MROB 3TA3C 4AEEA 3SKMB 4C56A 4GKZA 4FOMA 1UM4H 5I76B 1FBIL 3S8WA 1KPUA 2YD9A 2QQQA 4I77L 4YE4L 1VKXB 2GQHA 4YHOH 3L3JA 4LVEA 1UJTA 1BD2A 1I8LC 4ZD3L 4LIQL 5DHVA 2DQTH 3D3VA 3LPFA 3U36B 2MQ3A 2VN4A 4RAHA 5EWIL 2C3VA 2VLJB 4AENA 2YA2A 5J1AB 3FQUB 3PV6B 3MV9A 1CWVA 3VFMB 4M43H 4E41A 4W70A 5KSAC 5DMJB 2DQHH 5DHYB 1PKQA 4OUOA 1UZ8B 1F3JB 4PJDA 1VESA 5DUBA 2W0LA 4LBEB 2F9BT 5C3LD 3GMNB 4ODUB 4WTXA 1ORSB 1N64L 5IWLC 4XP6L 1W72A 4AEHL 1DN0B 2G60H 3AREB 3IGAA 1LEGA 2X4SA 5EOCH 5F7FA 3TPUA 1NANI 3CFJB 3WDIA 3QT2A 5KTEL 1JPFA 5IHZA 3ULVF 4PS4H 1VGEH 4X5LA 2DQEH 1QEWA 4K23H 1P7QB 4X4YB 4JFQA 1BBJA 5ETUA 4OZIE 3JV6B 1U93B 3WL9B 1V05A 3TCLB 2EIEA 1QBML 5L8LB 1T5WA 3CCHA 3L5XH 2E7HA 3H7BA 3VFWA 3OKMA 1J0YA 1L7TL 5EU6A 5IHBA 1Y18A 3CX5J 5IB1A 4TVPE 3U30C 2YPLD 1JWUB 3BP7A 5HI3D 1L0YA 5IEHA 4PV8A 1QSED 2CKNA 5DK2B 4RCAA 3C5ZD 1A7RL 3MV8E 4U6VL 4WU5A 3HR6A 5AUMA 2FH6A 4NKMB 4D9LL 4WUUE 2DLHA 4JAMA 4RFOL 1FORL 2XRAH 1AIFB 1KLUA 1BF8A 5DJ6B 2YD2A 4LSDA 4JDVB 1R3KA 4YDKH 3RWDB 4BZ1H 5C07E 1QLFB 4LSQL 5AEAA 3ARGD 2P43B 4NQEB 3EYFB 3VA6A 5IJVA 5FEBA 4J6RH 4M3JA 4HUWB 2OR9H 5I1IL 2EEAA 4LAJH 3NPSC 4XHJD 5C09D 4QRRA 3KPLA 1UH4A 5EUOE 4MXQD 4UINL 4JZNA 3IAPA 3BP5A 4FRWA 1F4HA 3V0WH 3GSNB 3F7YA 4LDEB 3VWJA 3UO1H 1OSPH 1ZVSB 4KJQC 5IVZA 5F1SA 4LVNB 5CSZA 5E8OA 2O5XH 1C5CL 4WHYG 4OGYH 1YC7A 4XNYH 2ATKA 1XR8A 5DVLA 1Y6MR 5JW4Q 2YUVA 2V7HB 3L7EB 1B88A 5HYFA 1HINH 1A1MB 2EKSA 4XNQA 3RI5K 1ES0A 3MJ7B 2PW2B 4PV9B 1HHGA 3SCMD 2CXGA 3R8BB 3CH1B 3SDAD 1MI5B 1VACB 2OZ4H 4P9ML 2VIRA 3LN4B 3SJVD 3RAJL 4ZFOL 4ELKA 4GUPB 4FFEX 4OB5L 4KHTL 2LU4A 1LO4L 3QIWB 2IPTH 5I1JL 3BN9C 4TSAL 3KYNB 4MJ2A 3GMRB 4YBQD 4X6CB 1LEIA 5B8CA 3IJYB 3L3GB 2AEWA 3UJJH 3C5SA 1P69B 2V7NB 2OX5A 3RTQD 4DAGL 4FXLA 1DQLH 1MHPL 4N5EA 1GC1H 4P4RB 5MENA 1FZKB 3KPSD 2DBLH 4Z0BL 1IBGL 1MF2H 4DZ8A 5E8PB 3OKEB 4H8WL 2NX5B 4GKNB 4MXWH 4S1RL 1C5DB 1RURH 2FH8A 3D9AH 3QEQA 3WXVH 4XNXH 2JJWA 2YXMA 3MZTA 1OAXH 3SKUD 3TFKD 4L29B 1U3HA 4LCUA 4BA8A 5JXED 2Y5TB 3SKJL 5ADPH 1H5BC 3GNML 3V95A 1IC5L 1N59A 3V6FB 1U58B 2DQTL 1J5OH 3THML 4FQQB 2QQNL 2W91A 2IADA 2Y6SC 5DJ2B 4WWKA 3MRMA 4FTVB 4B53A 2PYEA 3NIFE 4JVWA 2YUZA 3C6SA 5L7XL 4RX4A 2D03H 3V5KB 5CMAA 5ICZA 1LD9B 4FQXC 1CLCA 3O45A 2DWDA 4JFFD 3WHE0 3Q6FA 4MHHI 3K74B 2CDGA 1F6AB 1OTUC 5C0ND 2O26U 4I18C 3GMOA 1PEZA 4Y19D 3HAEH 5FYLE 5FM8A 5J7CC 2VR5A 4HX1B 2ZPKL 1YJDH 3MUZ1 5LG1A 2WMPA 2O93L 5IT2L 3X13B 1BFSA 3MLYL 4L8DA 4D0DB 2EE3A 2VZ3A 2XXMB 5KSBF 5JZ7D 1CZ8H 5E99L 3NFSL 4LSQH 5F3BB 1R0AH 3FO9A 3QHFL 1NC4B 4G43A 1S5HA 3WFBL 1N6UA 1K6QH 2EDJA 1GZPA 4LVHB 5JW5A 3O6FC 5TDNA 3CXHJ 5KVDH 5FM5M 1K4DA 2QV2A 4K3EH 4PJ5E 1JBJA 1AO7A 4JG1H 2FWOA 4YXHL 3LN5A 3W0WB 4S0TD 3BJLA 3QEHA 4MMZC 4RIRA 3SE4A 4OAWA 5FHAH 1FJ1A 1S7UA 1P7KB 3BZEA 5IIEA 3HRPA 2VXUH 5EZIL 1JF6A 3JXAA 4XNYL 3OR6B 3BZDA 4NPYB 3O3AB 5DURB 1RUAH 2W0FB 1NBVH 4LDOB 4WRLA 3EUUA 2UWEB 3GK8L 1JV5A 4XWGH 3EO1A 3MBXL 4J3SA 5HHXL 3Q3GA 1D9KD 4NYLB 1YEDB 3PP4L 4AEFA 4LIQE 3MV9E 1LO3L 4GW4A 1T4KA 1PSKH 2Y5TA 3N85L 5EU3A 1BD2D 5C0JB 1U6AL 5EUOF 4ZFFA 1MFCL 1WAAF 1YYLH 4RA3A 1U8HA 2AJZA 5CUSL 1F2QA 3BQUB 1KELH 5F7EL 4AIZB 5IVXE 2X4UA 4K7PX 1RHHA 5C07A 1Q1JL 3QIBB 5K9KB 1KTKE 1GGIH 3OKEA 1RIUL 2R0ZL 5DQ9A 1CS6A 1EO7A 3R1GL 3NA9L 1QFWL 5JIIA 4LHJB 4ZTPL 2DBLL 4RDQF 3MXWH 3U0WL 4RRPG 1CDHA 2CKBA 4R2GB 3W39A 4QOKE 5IMLB 4FFWC 1KC5H 4M1DL 2WZPD 2OR7A 3KDMB 1CE1L 1NMAH 1DQQB 1U2HA 3X14B 2NY0B 4RMQA 3CFKB 4R4ND 3TNNA 3WKML 4C59B 5D2LE 5GZNC 1LK3L 3MJ8B 3H3PH 1CIUA 4U31A 2UV3A 4LRIA 4XP1H 3PABA 3H6JA 2Q3AA 1NANH 1V3LA 4U7KA 2AV1A 2OTUB 5DZOA 5C0DB 1DQMH 1ES0B 5F71A 3S3JA 2BRRL 4QGYA 2X89D 2VDNL 3RDTA 1N3NB 5ACZA 4HD9A 3I3EA 1U0QA 3C8KB 1FFNA 3LPWA 3MFGB 2B4CH 3MJ9H 1RPQA 4O9HH 3ZKMD 2VDPH 4IMLA 3WJJC 4L8CB 3QDGB 4U1KB 3RKDC 4GAJL 1QO3B 4BK4A 4Q2ZB 4LHUB 5F8QC 5MENB 4BH8B 3QUKA 1MJUH 1F8TH 5C08A 1MRCH 4YDVB 1IARB 5I17B 4MXVE 1GGTA 5AYUH 5EC1A 2CRIA 5C0NC 1YYML 1CE6A 3SGEI 2BNQA 3RVWD 1HH9A 3RWDA 2H1PH 3TBTB 4E42A 3PWLA 2AEIT 4P99A 4R7DB 1FH5L 2Y6SD 1CCZA 3BPLB 3SBWC 5T33L 4WEBL 4UMGA 5FECB 4PYGA 3D1MC 4UTAL 5DR5L 4L4VE 5I18H 1ZT1A 1QHPA 3P4NA 3OKOA 3SGJC 1QLEH 2LVEA 3ROOB 5KSBA 3FN9A 2CKBH 1R3JB 4XNQB 3TLRA 2B0SL 5IB1B 3TFKC 3SGDI 4XBGA 4WI4A 4LK4A 4HUVA 5I19L 1VFAA 2P5EE 4I4WB 5GGRA 4HXBL 4NN6C 4OGXH 2BVQB 2X4OB 1PQZA 3QEQE 1A22B 4HMEA 5E94B 4JZNB 3UTZA 1U93A 1XGUB 2APXA 3HAEA 4TUKH 3BMWA 1XIWD 4KJYA 5IJVB 2ZG1A 5IHZB 2GUOB 3T3PE 3BEVA 2F5AL 4X7SL 3U1SH 4ISVA 1GGBL 2L0DA 3S4SG 4J8RB 3TPUB 2R2EA 3ZT5A 2FHCA 1N6QH 1BBDH 3NIDF 1H3PL 1AXTL 3BN9D 1F5WA 4MAUL 4RGNC 2OQJB 4DFIA 1NBQA 3GMLB 4HS6A 3Q6GH 3UROR 4BYHA 5I2IA 2OJEA 2BSED 5DVKA 3BQUC 3DXAA 3SDAB 3IDXH 4HC1H 3NCYP 3BGAA 4NCC1 4NQCB 4IIQC 2X4TB 3MO1A 5T5FH 2SEBB 3U48A 4CUCA 2J8UE 1Q0YL 4HPYL 1U8LA 2ESVB 1ZHNA 5KOVC 3H7BB 4N1EA 4CU7A 2B8OT 2K7QA 4JFEA 2HT2D 3GSWB 3T8XB 2GAZA 1YQVH 4F58H 1QACA 3MLZH 1MRDH 2H3NB 3QDMB 3EOTH 3QEUB 4NKIH 4A6YA 1EIBA 2ZPKH 3WL9A 4IRSB 5ETUB 1S7QA 5HJ3A 3WHE1 3NAAL 2QADB 3HS0A 3D0LA 1JWSB 3GSQB 5SWSE 3VXME 4PGCA 3VXPB 2BZDA 3QCTL 3DROA 5HVFB 2ERJB 4WFED 5ITBL 3S88L 3PJSA 4PJ7B 5KS9A 4U1HB 12E8H 4NJAL 3AREA 5ID0A 2HFTA 5B3JE 1CK0L 1W72B 4PPTA 2VDMH 1WEJH 4PTTA 2CR6A 4EI5B 5C2UB 3H9SA 3BJ91 3L3IA 3GHBH 1PJ9A 5JHLH 2QTEA 4YHMH 4X0KA 5TE7H 3BSZL 4F7MB 2DTMH 4NDMA 4C58B 1WFUA 3VXQB 2VLLA 4M6NL 3WNPA 5DHYA 3RDTD 1SEBA 1A6PA 3LH2H 3HZKA 4MCZB 1UB6A 3P4OB 1E28B 5D2NE 2IH1A 1P1ZA 1FH5H 2IF7A 4CVUA 3O0RH 3D5OF 2E7LC 1KB9K 3JV0A 3BKJH 1WWWX 4RFEA 2AGJL 2WBJC 3REWB 4NUGH 4QRTB 4XP4H 5JHDA 3VMOA 4ZAKA 1W0WB 2X40A 4NJ9L 3QNXA 1FG9C 4UIKH 5IFJB 2VR4A 1X5GA 2DQFB 1WFOA 4R4FH 3ARSA 3GMQA 4DWHA 4IHOB 1T3FB 3ETBF 5DA0B 5ERWB 1OP5H 1I3GL 2CKBL 4JHZA 1NBYA 2UZIL 1YEKH 4QRSA 3C9NA 3TV3L 1LO5B 3KPPB 1TVHB 2B4CL 1IGCH 3CFEB 3QJHB 3RY5A 3SDYL 3HZYB 3CLFL 2W07A 3QWOB 5J13B 2B1HL 3RX5A 3MODH 4QOKB 2MQ0A 2XTJB 3IFPA 3SDCD 1AHWB 2VO5A 1ED3B 4WTWA 4RFEB 1A4JA 3TA3A 1WSST 3V4VH 1F58L 2I9TB 2XXCB 1NDMB 1WQVT 1F8TL 4WI9A 2CIKA 2OJZL 3OHXB 5EPMB 3WDJA 2VLMD 1GVIA 3PP4H 3FTGA 5AAMA 4UDTB 5KVDL 1HWGB 1YDPA 2CUIA 4NWUH 2C3GA 3TPKA 2A6IA 5BV7B 4P5TA 5FDYA 1I7ZB 4NCC2 1KENL 1WT5C 2VLLB 2UWEE 1NBVL 4WO4C 4QRUB 3AY4A 1G7LA 4OI9A 4YO0A 2BCKB 3NA4A 1C5BH 3TP4A 3MREB 2OTWB 3U79A 3ULVD 2FBOJ 2D7PA 5C0IA 3WIFA 4ENED 3OKLA 5I1CH 2O61A 4XWGL 3GBNL 3N50A 5DS8B 2XKNA 1OWWA 1JGUH 3WFEL 4KXZH 3GDBA 1IE5A 4ALAH 3QDGE 5IHUL 2R39A 5EN2B 1F3RB 1L9NA 1MFCH 2F5BH 3FT2B 4WEMB 3QO0B 3QQNA 5LWYH 2P7TB 1MCPL 3OSKA 4YX2H 3OXRA 1PSKL 3D0LB 2ZCLH 3ULVH 4Z9KB 1S7QB 4PP2A 4XBEL 4ZO7A 4ZTOH 5BV7C 1ZLVH 5E08L 3DPBA 2IANE 2FBJL 1K8DB 4PR5A 5CJXA 2QEJA 4DGVH 3VXNB 2C1PB 4PJ8C 4ZPTA 1CFTB 4HK3N 4Z7QF 1IAIM 1QFHA 3WLWC 1KIUA 1UQSA 4IJ3C 1NGPH 5LGJB 5DD6A 3BHBA 1ZHKB 5EZIH 3WNLA 5EOCL 1WC7A 2NY0D 2B1AL 1MAJA 4OCMC 3QFJA 3I85A 1QSEA 3X12A 1BIIA 5EBWA 3LKQB 4U7SA 4Y8AA 2FLBT 5F1IA 4JDZA 4CDGC 2FSEB 4X7FC 4HKXA 4AT6B 4N8PA 2R2EB 1FO0B 1EFXB 3EYQC 4FFYL 4OLYL 4UIMA 5HYJA 3P0YL 2YPLE 2CD0A 3PGCB 1ZXQA 3BP6A 1AD0B 3OPZH 2GK0A 4TVSa 3VA2C 1IL1A 5IESL 5D71L 3B9KA 1Q0YH 4KKCC 3I9GH 2LVCA 3C8DA 2NY5H 1F4YH 2VDOH 2IEPA 3UC0H 1MELA 4ZMAT 3ZYOA 2UZXB 5FAAA 1IEBB 4Y5VB 1FIEA 5IKCB 5I75C 5CKAA 3RKPA 4JJHA 4IOSD 4POUB 4LKCA 3VJ6B 1I3RA 5IOPB 1CLZH 1QSEB 2X9WA 3E6HA 3MJ9L 1GXEA 2DDQH 4OIBA 3HNSH 3DV6B 3D85B 3QH3A 2AI0H 3T0EC 4XTRC 3FJTA 1U8OB 3ABZA 1A1OB 3NN8B 1EPFA 4L3EA 4ONHB 5EU4B 3AU1B 1EHAA 1A3QA 3BEWA 4TSCL 2PXYD 3SJVA 5JW3H 1J8HA 3RWEB 4V1DD 4OZ4B 1I9JH 4YE4H 15C8L 4R7DA 1SHMA 3B83A 5K9QG 3BRGC 4O58H 3PWLB 5CIPA 1EZVX 5GS2H 1EDQA 1H8SA 4L4JA 2EO9A 3CK0L 5D1XC 3HPLB 1A9EB 5F9OH 4AIOA 1JPGA 4IRSC 3ELAT 1KJVB 3T77A 3G5YA 2XKNB 3RIAK 3SCMA 1RURL 3I6LD 4LPCA 4MVBD 1L0QA 3VH8A 4KKNA 4OI8A 4PRPD 1IQDB 4OD3H 1KCKA 3TJEL 3HZVB 3RUGA 3O41A 1AD9A 1KCRH 1LP9E 3MQIA 3VI4F 1F4XH 3MOAL 5ADPL 1G7LB 4KRNA 3UPAA 2NQCA 1J05A 4OCLC 3N0PB 3NABH 1P4LA 4P5TB 2WM0A 4AL8L 3VW3H 3VFNB 3L7FA 3LY6A 3OHXA 2CIKB 3FL7A 4HZLB 3KPOB 3QBTB 1BQUA 4NRZB 4PJFA 3TA3B 1H3XA 2UVEA 3P30L 5IVOA 4PRHA 4KHTH 3O3DA 1AHWA 1A7QL 4Z77A 4KKAC 5TGBA 5DD3L 3HZYA 2H9GA 5TE7L 3G5XA 5GJSH 3T65B 1FBIH 3VFRA 1H3UA 3G9AB 1QVOB 4H8WH 2Z93A 4Z7VB 3MYJA 5DZNA 2WBJB 2YEZA 5T3XD 5ERWA 3OTTA 3L3OB 5F7LB 1ZANH 5BJTA 1EMTH 3MJ9A 2Q8AH 2CUHA 4XVUD 2QQLL 1T83C 4PRAB 1T7YA 4PP8C 2XZCH 5HYSA 4PLJC 1BEYH 3EFFA 3JWOH 1AJ7H 3MRBA 2FO4A 2P5EA 3SQBA 2W65A 3QIUD 1QQDB 5GRJH 4XI5C 3UTSD 4RFOH 2MHAB 5CZXC 1CVRA 4ZFFB 3WFEH 5I1KH 3O9WD 3G5VB 2ICWJ 3PNWA 3PQYA 4MX7B 4PJ7E 4N9OB 5ESQA 3WLBA 1QYGL 1A7RH 2BK8A 4MSWA 3WIHA 2LU3A 3H0TA 1PKQE 4U7MA 5SX4H 4KK9C 1DQDH 4HT1L 1PEWA 5HHNA 5TQ0L 1SM3H 5DD0H 2PUQT 3GHBL 4NYLA 4Y88A 5HYQA 1NFDA 2I5YL 5LAXB 2N7BA 2H2PD 4PTTB 5ILTL 1KENH 3O3AA 4ERSH 4OQ1A 3WHXA 5C0AB 3V79C 3ZE1F 4WW1B 4GG6A 2XIDA 3O6KL 3PJSB 4PJ7A 5I1EL 3UJIH 1U41A 3JV4B 3QCVH 2WWMD 2GJZB 3S96A 2CSPA 2Z4QA 4PP1C 1MRFL 2ARJA 2DMKA 3QFDB 3TESA 1UZ6E 4LQFH 1YNKL 3PXJA 4HSQA 5TFSH 4JJ5B 4PRHD 3KYAA 4E41D 1UM5H 2H3NA 3BFOA 4XNXL 5D6DA 2GSIB 1A47A 1MNUH 4GAFB 3RU8L 1N8ZA 4Z78B 1YMMB 2G5BA 1ZHNB 4HXAL 1CL7I 4RWYH 4RGNB 3SDCA 3BH8A 5E8EB 3GJFA 1CBVH 5FDWB 1OARH 4ZAKC 4PUBL 2FX8L 1EX0A 5D4QA 4BFGA 2WBJA 2MOVA 4NNPL 5AYQA 3ZZ1A 4HS6B 4L8SB 2EH7L 2B2XL 4Y4KD 3UZQA 5D1XA 5BVJA 1NAKH 3DHJA 3MRMB 4KROD 5CJBA 4NFDA 2EE9A 3PGDB 3ZYZA 1F3DH 2DQJL 3O3DB 3GIVA 1I8IB 2JIXA 1BIHA 3SQOH 3KPOA 1IKNA 4WNQB 5HY9A 2LE9A 4WV1B 3U7WH 5EC2B 3TBVB 5DFTA 5E00B 3VGDA 1P9MA 4XXCC 4LFHD 3DSFH 3BZ4A 4FP8H 4UOW1 2ARWA 4HUMB 4UI2A 4CVXA 5IHUH 4ALAL 3QA3A 3RWHA 3SDXE 5LCVH 1UXWB 2VLKD 2FJHA 1KPRB 4P3WA 4NZJA 4Z0XA 2YPKA 1VFAB 4M1DH 4PJ5B 5DT1L 3B9KC 3L3KA 3P73A 4HULB 3WUWA 4BUHA 5D71H 3MRLB 1ZT1B 4ZDHB 1OQOA 4LF3A 5EBLA 1MREH 3E8UH 1VERA 4JO1L 4WFFE 5CWSB 1DVFD 4N5UA 4XCCH 3VWKC 3HUJA 1ZLUH 4Q9BA 1ZGLA 3EFDH 1QSFE 3RZCD 2CMRL 2OP4L 4WGWB 1EEUA 3EDKA 3FO2B 3HI1B 4Z7NF 3KNBA 4DN3L 5E4EC 4OCXH 5LGKA 3DGCR 5I17A 4L4TA 4M7JH 3UZEA 4PG2A 1TTGA 1A1MA 2EKSB 3BKCH 1ZE3C 4U6YA 5DFVC 3D85A 3L3KB 5FUCE 4ORGA 2ADIB 4DJMA 3CSYA 1RUQL 4ZFZB 3QDGA 3JTTA 5B38A 4Y5YC 4L9LA 1OW0C 1H5BA 1T1ZA 4JN2B 1A6TA 4X9HA 3R1GH 2DICA 4UBDC 3GHEH 3C8KA 3D2UD 1OD7A 4R90H 3QG6B 1XIWA 5ESVB 4I1NB 3RPIB 2V5SA 5IROA 2R9HC 3EYUL 5ANMA 5HGAA 4UDUB 5I6XB 2VDRL 2DLTA 3VXSB 2FEEL 2OTUA 2OI9A 2ZCLL 5I75B 3NZHL 1Z0NA 4HUWA 4I2XA 2CO7B 2BY0A 4WEBH 4GMSL 3FB5A 1SYVB 5HHXH 1OP5K 3N85H 1EFXA 4ZNCD 6FABH 2P8MB 4X7TA 1P84J 4HCRH 4N5EC 1AIFA 4AQ1B 4G6AD 1UM6H 4X7DC 4HUXB 4RBPK 5DJ0B 3S5LG 3P11L 5J11C 2P4AB 2GITB 3GSNL 5T5FL 4JDZB 3D39A 1BIIB 4LAQH 2BY3A 4OM1H 1NLBL 4IOFC 3P9LB 4APQD 1DBML 5HD8D 3PIQA 1VEOA 1X5FA 1JWUA 3ARDB 2Y72A 3RGHA 1AE6H 2AJVH 1KB5H 1QFWH 4Z7VE 1NCAL 1DQDL 3EZ8A 4HS3B 2HN7B 4YXLL 2VLME 4UTBH 2NY1D 5T3ZE 3OKMB 3DX8A 5J6GA 1BFOB 1N8ZB 1UVQA 4JG1L 5C92A 4NKOA 4PR5B 5DJXA 5JQ6L 3P0YH 1TJHH 4K94C 4EN3B 1AH1A 3GUTB 4Z7NE 4LSRL 2V2XA 3VGEA 2BX5A 5DI8A 1LDPL 3VRLE 1PYWB 2ZUYA 2V5TA 4I0PB 3BE1L 3FCTA 3T0VA 1TQBC 5MEQA 1HN1A 2ZWLT 3AAZB 5ISZA 4HIIA 4W6WB 1QZ1A 4O00A 4WUKL 5DJ8A 1G9NH 2VLKA 3E3QA 3EJYD 4V2BA 4HWBH 1OGTA 1LMKA 1VPOH 2HLAA 3GI8L 2VWEC 5IJKA 4LBEA 5D7SH 1DCLA 3BVNA 3W2DH 4M93C 2IGFH 3SGDH 5FCUH 4FHBD 1GIGH 2FWOB 5ESQB 1AO7B 2JB5H 3WLBB 5ACLA 1KJ2L 4L3EE 4WDIB 3BZFB 3LEYH 1FL3A 1FNFA 2I9TA 5BW7A 4QHLB 4YEEA 4G43B 3MRCB 4XCCL 5CZVL 2H1PL 4FQ1L 4YHIB 1MSPA 3T2OA 5DHVB 1Z9SA 1EERB 2O5ZH 1ZLWH 1SMOA 1NAML 4BSJA 4D0CB 5AYUL 4P59H 1CL7H 1BGXH 1PBYA 2VDML 4JFPB 5LKNA 1T7ZA 2FCBA 4MD5A 5I76A 1NMBH 1AR2A 3WFHA 3GMOB 4EI5D 2KUTA 5TH2B 4PRDA 1Y0LB 3NACH 3PHOB 2DWDB 2DMBA 2AVGA 3ILPA 4X9GA 5ICZB 2H9GB 2WIIA 2FB4H 5HVHC 1UGNA 5E2TH 4JQVC 2H2SC 4JO4H 3IS1X 1N7MH 1QNZL 3NFNB 4BSWA 1WTLA 4PJFB 4OZFA 1MCEA 2ADJA 3VMNA 5JMRA 2EEBA 5DSCA 1JZ4A 1UB6B 3P4OA 4LCUB 1WAAE 3F12A 4HPYH 1FE8H 3VXRE 5I1EH 2ED7A 3FOLA 3VFNA 3CFCL 5FGRA 2AEQH 2D7MA 5TF0A 3O2VH 2PXYA 2VWEE 4R3SB 3TWCH 4NDMB 2DLGA 1LEKA 1ZMYA 2W9EL 4QF1B 1HWHB 4KZDL 3MRHA 2DWEA 4L3ED 4QT5B 1M6OA 4AMKL 4OLUL 3GB7B 3L3IB 1SM3L 3D87B 3P4MA 1L0XA 2R8SL 4M02A 1MJ7L 1CIDA 1BVKA 2E6JA 3A6OA 3JWNC 2EC9U 3G6AA 4KHXH 3G5YB 2V7NA 3QXWA 1D9KB 1GGCL 5TPWL 5T3ZL 3GM0A 1X5LA 4HGWB 3BN3B 3OR7B 1NCNA 2OJZH 1HH6B 1OAUL 3VFPB 4PRBB 3W5MA 4TPRH 1FVDB 1FNSH 2FEDC 1ULVA 2DQGH 2CIIB 4L3CA 2NW2B 4JFEB 1HOCB 4JCLA 3VFGH 4UQ3A 4JR9L 5I71B 5HDBF 2XNAA 5K9JL 4EKXA 4ODTH 1P4BL 1CXHA 1QSFB 1AC6A 1JGEB 3OAZH 4Y4KB 1EHLL 1JHKL