3TN0A

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
293
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tn0A01
3FRUB 3SJVD 5DYOA 4F80A 1WLHA 2VWEC 3P30H 4DW2L 3AY4A 5J12C 2V17H 3QEQB 1HHKA 4MA1C 4PGDB 3VXTA 3GMLA 4NZTL 5C0FB 2C3HA 3HC4H 1GCFA 1NBVH 2WUBL 2C1PB 1SM3L 4BZ2L 2BFVL 4OGAD 1JWSA 3AU1A 4XVUD 2IADA 2QQKL 4Z0BL 3V5KA 3TBSA 1QVOA 1R0AH 2NZIA 4OFVA 2BVTA 3GSRB 3QEHA 4HWBL 4PB0L 5H2BB 3C5SA 1LO0L 3ARTA 2YMXL 1PLGL 4MNQA 3NA9H 1YEFL 3O3BB 5F7EH 4EVNA 4OM1H 4AH2A 3O0RH 4KFZC 4LLDA 4P3DB 1RIHL 1R24B 3REVA 1VGEH 4CAGA 1AE6L 3OL2A 1AC0A 3LKQA 2EDNA 3DVNB 4G59A 4ZXBC 4JKMA 2DOCA 3QFJD 2PTTB 1JNJA 3SDXB 2WM0A 3HZYB 2O5YH 2FR4B 1DBJL 1TJIH 4JRYB 5EBMA 1ED3A 4OJFH 3GSNA 4QHKI 1MHPH 1NCUA 4ZUVA 3FHAA 4U49A 4K3EL 4H1LB 4MAYB 3RKDC 5DD5L 2VLRB 2YA0A 3WUZA 2BSTA 3QG7L 1SBSH 3AB0C 5IJKC 1SJXA 4JJHA 4LSPH 1MF2H 4JY4A 3QUZA 5F7WC 3KLDA 3D39B 2V2XB 4NN6B 5DMYA 3L7EA 2JJTC 3MO1B 3ZT5A 1BEYH 4X80H 5HHNA 3UPAA 4NO5A 4OAWA 3N1FC 1RZGB 1UVQB 4K2UL 2AJYL 5FGCB 2UV3A 4U7SA 1G7MA 3OKOB 4G5ZL 3UTTA 4LNRA 1F58H 2CDEB 1P9MC 1YC8A 5JW5B 1A5FH 2N56A 4HFWB 3GNML 3WNMA 1UB6A 4A2LA 3N9GL 2XA3A 5FKPA 5JPMB 2P1YA 5MENE 3ARGD 1LWRA 1HH6A 1T2JA 3QIUC 3MXVL 3PWPE 2FNBA 1Z9LA 3VGGA 1UACL 5K9KA 2OI9B 4TSBH 4GMTH 4MA8L 3HZMA 1Z3GH 4MXQA 4XC3H 1JE6A 3C6LB 1MIEH 1J12A 1GIGL 3DSNA 1P4IH 3NIGF 3EYQC 4M6ML 3VFTB 3V5HA 1HYRC 2NR6D 2F5BL 3QEUA 1QD0A 1BQHG 4XP5L 2JB6B 4O5LL 3ZYIA 2V7NB 4HCRL 3PE9A 1IT9H 3BKJH 5EBLB 3GIZH 1EHXA 1V8HA 4F33B 6CGTA 2UVEA 2YK1L 3BSZH 1ZHKA 4KRLB 4PJ7F 2R69L 5FB8B 2X4OA 5I15H 4LEOB 5CZXC 4PRBA 3BUYA 3T1FA 4O4YL 3WFBH 4CVUA 2WY3A 3MLXL 3IKKA 1QHOA 1JF1B 5DR5L 2YD3A 5JA9A 2AV7B 4XP1H 3TO4D 3H8NA 4NRXB 3KXFB 4F2MB 1GL4B 4WCYL 5GZOC 2O61A 3DECA 1VDGA 1KN4H 5C0BE 4KKBC 4NRYA 4WHTB 2YUVA 1D5BB 2CRZA 1LD9A 5BVPH 4R96B 4O9HH 3O4LA 1CFSB 2NY6C 3OPZH 1WAAF 1JZ5A 2VXTL 5I73B 3P4NB 5L8LB 4PJ9B 1BF8A 2XWJB 3TA3C 3BKCL 1XIWC 3SKNB 1EFXD 3BKML 3FQNB 1LP9A 4K7PH 3SCMD 3BQUA 5JQ6H 3DXAE 4L3CA 3BW9A 1SYSA 3DIFB 2DLGA 2IJ0C 5H94B 3NBNA 1IC5H 5HGBA 3TCXA 5KSVA 4WI4A 4M7ZB 3TZVB 4PV9B 2AJSH 2K7QA 4DEPB 3QUMA 1T1XB 2VDLH 1MQKH 3ZYJA 3PGDA 1F3RB 1W8OA 1OD7A 5I9QC 2J8UE 2VXQL 4HKZB 4X5LA 4L29A 3BISA 1AI1H 1JHKL 3VXRA 3RVTD 4BUHA 4Z7NE 2IGFH 2JCCB 4DGIL 3QDMA 3K8LA 1B0RB 3JV4B 1F2XK 4GRLC 1FAIL 4Q6IB 1QUNA 1UYWL 3MLYL 1ND0A 3UYPA 4FOMA 1FYTA 2BDNL 4XBGB 3I3DA 4F57L 3WO4B 4AIOA 2UYLB 1V7MH 3LRSB 4RGNB 4LSSL 1D5IH 1CFVH 5HYSB 4PLKC 3CNKA 4DN3L 4K3HA 4RMRA 2CDFB 1A7NL 1EK3A 1KB9K 1A9EB 4CMHB 5SWSB 2DM7A 4P57B 4KI5F 1Z0NA 1MCNA 2JIXA 4LOUD 4HJGA 1TZGL 4R3SB 5AZ2H 5TQ2H 1JPST 2X41A 2A73A 4UT9H 1PJ9A 4WIQA 3I2CH 4MS8C 1ZA3A 1HIML 3VXRD 2PYEB 4P2QB 4KK5D 2LQRA 1N0XL 3VXSE 4GBXD 5BZDB 2MHAB 2VL4A 4IOIA 4XMLH 2XNAA 1M1SA 3QUKB 5FO8A 4EUPA 1AP2A 3TBYA 1QR1B 1KLGB 1VGKA 3G6AB 3VFMA 4WFGD 4M8QB 5CP3A 4F8QA 5LWYL 1FYTD 1GGBL 3BP4B 5TPWH 2X6MA 2QLVB 1GGIL 1AD0B 3FAXA 4R2GD 5HY9B 4PJ7B 3E6HB 3QXAA 4YAQB 4JGMA 4IIQA 1M7IA 2IBZY 1S7VA 2W9EL 4NUJB 4Y88A 3A6CH 1A6TA 1QZ1A 3V6FB 4J4PC 2EZ0C 4YHOL 1S9XA 1H0DA 1PEZA 1TIUA 2E9BA 3MNWB 4FQQB 2AV1A 4E41D 4PJGE 4OCWH 5DURD 4X9BA 3QDGB 4UZGA 1A6WL 3BP6A 4MVBD 5F1OB 3ARPA 4P9MH 3JSSA 3KGRA 3O41B 4LIQL 4YPGA 4EDWH 1B0GA 2MQCA 1S7TB 4WWKC 3VE0B 2IPTH 1IZJA 3C5ZB 3VD3A 3FN3A 1E28A 4FFEX 4APQA 5HYQA 4EUPG 1K4CA 4LLMB 2WBJB 3X13B 12E8L 3T3MF 3WEXA 3MV7D 4KJPD 5EOCH 2EDDA 4OQTA 4H20H 3C8KB 4L3EA 1DQDH 5CP7A 2R2EA 5B3JE 3CU1A 3QQNA 1LDSA 4J3VA 1BFVH 1FRGH 2BK8A 3HUJF 3WNNA 3UTSE 1QSEB 2VLKD 4ONHB 1HDMB 4LLAA 3NCMA 4WEUD 4PJDF 5GGUA 1QFWH 4HLJA 1J10A 4LBEA 4BZYA 3MRGA 4PP2A 3SDAA 5EFIB 4I3RH 1JRHL 3RWEB 1CGSL 3H9YA 4LASL 5INDA 4URTB 1OVZA 1FLTX 3FB8B 2ARJQ 3U36B 1C5BH 4XWOD 5DD1L 1HQRA 1E6OH 2EE6A 1GPOL 4WO4A 5ESVA 2EH8L 1A1OB 4LEXH 2BCKB 1U91B 4MGXA 1JNHB 1P4BL 4Z95H 3IDXH 2PUQT 3W39A 3IU4H 3MTRA 4ETQB 3B9KB 1YNLL 3WL9A 2DQJH 2J88L 2AAVA 1QKZL 4S0UC 1R3IH 3MRPA 5JZ7C 3MLRH 1FG2A 5ALCH 3SE4A 1EAPB 1W72B 4HIIB 3KR3L 3O11B 3RWDB 1U9KA 5CJXC 2BX5A 4FQLH 3VDCA 5E1AA 4JN2B 1IL1A 3MBEC 5DGRA 4WV1C 1Q9LB 1VERA 1WEJL 4JFPB 1EJ6A 1IKNA 5CJ8A 1FC1A 1ORQB 1MJ7L 3CVIH 3QUXA 1FIGL 4ERSL 1CGYA 5A2JH 3CFJB 4U1KA 3TT1H 1QFUL 4WHDA 2CKBB 3G6JE 5DC4B 4NNXB 1GJIA 1ONQA 1G9NL 3HI6L 4KUCF 3GMQB 2OR7A 4JJ5A 3HR5A 5I1LB 3WXVL 4Y16D 2WV3A 3BWUC 2NTFB 4EI6B 1EZVY 4NZDA 1X5XA 1JPGA 1BWMA 3KPRB 2X9XA 5KOVC 1HINL 5DFVD 4UUJA 2ICEB 3JVGC 4HWNA 1R3JB 2XQYG 1NMAH 4JFDA 1JHTA 4XPAL 4RFEA 1VKXB 1KTDA 5MEOB 3BIKA 3NFNB 2P46B 5EU6A 3P73B 1CD9B 2XTLA 3DUHA 2X4RB 5EZJB 5IOPB 1Q0XH 1FVEB 3MX0A 5FYKD 5EUOA 1NQBA 1WQVT 4OD2B 1J5OL 5DXWA 5E9DA 4OLXH 1AXSA 1WZ1H 1CE6B 4XNUH 3TWCL 2VAAB 4HWUA 2J8HA 2WQRA 1DVFB 1M7DA 1EO8H 3BGAA 1PG7H 2QTEA 2VERN 2VN7A 5KBNC 4X6DA 5C0IA 4Z0XA 4DAGL 1YDPB 3DOSA 3E2HA 4KRMB 1S9VA 1CG9A 3CSYA 1FZJB 3MYZA 5HJ3B 1DBAL 2IAND 2LAGB 3IVKA 1JWUB 1T5WA 2AGJL 4KTEL 4J3UA 1E4XH 2HVKB 3DRQA 4D94A 3NAAL 4XWGH 3UDWA 5SX4H 4TPRH 1YY9D 3HUJB 4Y4KA 3LEXA 4Z7WE 3OAYH 4HWEL 3LPFA 3GM0A 2F19H 5F9JB 3NH7L 4PJDB 1QBMH 3CVHH 2DMBA 3MJGX 3EBAA 3VFGH 3NTCL 4AENA 2JJSC 3IDJB 2DQDL 4QCIB 5CJBA 3WIHH 1RZFH 1VADA 1T2QH 1UCTA 4IJ3B 4J3TA 5HHXL 3X14B 4MCZA 1XF2B 4BYHA 1XGRA 1KCGC 5C0CB 4N0FB 2QQLH 2R0ZL 5EN2B 2XPGA 4GXUN 5IM7B 5I0DA 4BH8B 2BHYA 3V0WH 4AIZA 2WANA 5F89A 1UKQA 5F8RC 4POUB 1ORSB 2BVQA 5JO5B 4YBQD 3I6GB 1IAKB 4ORGA 3FTGA 4UMGA 4M4RA 4HPOH 3MRNA 4P46C 4FXKA 3WJJC 3KPSD 2APFA 4YBLB 1HILB 2YRZA 3HZVB 1FQ9C 2R2BA 3CK0H 2P44B 4P3CL 1KEMH 1OLZA 5KZCB 2W0FB 1AR1C 1PY9A 3MRJA 4KZEL 1IGFL 1MOEA 3EUUA 4QWWD 1NANI 4FQ2L 5GRZA 3DLQR 1OP3H 5F7KC 4Y4FB 1XF1A 1A7PH 3S96A 2ESVE 5EUKA 3GMPB 3ZHLA 1OF2A 3JV6B 1RPQA 1X5AA 3MBXL 4FFZL 5DVOA 5AYUL 4L9LB 3TT3H 5FM4A 5BS0D 5BOPA 2JJWA 4P23B 3NPSB 4NGHH 1Q1JL 2CDGB 2ZJSL 1FFPB 5EIQA 5ESAB 3MGTA 4DW2H 4YZFE 4ODWB 2W9DL 2EXYC 4HV8A 3VA6A 4K7PX 5DUBB 5HYJE 3EOYG 4NZTH 3DV4A 3LD8B 3KS0H 3ARFD 3T0EE 1WZLA 2FECI 2YPKB 4IS6A 2VDKL 4P4KA 3IJSB 2WUBH 3K46A 1SM3H 2EDBA 3QA3B 4BZ2H 2BFVH 1U8LB 1KPUB 2YUZA 3OKMB 1I4FA 1JWMB 4D0BA 5JPNB 4JGJA 2QQKH 2P5ED 4Z0BH 3S5LA 5D2LF 2C3GA 5GS1C 2WP3T 3U7YL 3GEWB 3BOVA 4HWBH 4LCCB 4PB0H 5I1IL 1CGTA 1LO0H 3WDHA 3FQRA 1CDUA 2I9TA 2ATPA 2HT2C 3VXPB 2EIBA 2YMXH 1PLGH 5CSGA 3TBTA 4J3XA 1YEFH 3SN6N 2GJ6B 2ZSVA 1RD6A 3AVEA 4NFCA 1RIHH 5E0QA 4U31A 2IAMB 4PJHF 1KTRL 3LB6D 1CBVL 1G9EA 1WBZA 3OKYA 1AE6H 1P69B 2KBGA 2VLMD 4LHUD 3PP4L 1ADQA 3ULSA 5DJ6B 3OXSA 4HFUL 1KV3A 3O6ML 5E4EB 2H32H 4GH7B 1XR8A 4F15C 5MENA 1DBJH 4PD4K 4EQ3A 1CF8L 3QWOA 5ISZB 2IALA 5L6YL 3P9WB 5F9OL 1FIEA 2R4SL 2VWEE 3UROR 5F3BA 3D87B 3DPBA 4K3EH 4XNZC 5DD5H 1H3WM 1QSZA 2JJUA 2JK5B 1V7NL 2MFNA 3QG7H 4OCMC 1GOGA 4U1SA 1G9NC 3S5LG 3RGVA 3SJVB 1TZHA 4RNRB 3LKNB 1ZVSB 3CJJA 3ZE1E 3MJ8B 3U4AA 3W82A 3OHXA 3MV01 5D2NB 4K2UH 3RGHA 2AJYH 5E2WL 4G5ZH 1PFCA 3R06B 5J7CC 5GRVL 1P6AB 2EKJA 5DA0B 3RPKA 3GNMH 3UZVB 1R3HB 3N9GH 4HS3A 2FH8A 4XVSH 1XGQA 3BMVA 5L8JB 5JOFA 5GRVK 1G7PA 4S11A 3MXVH 4WI3A 2EE9A 3TN0D 3QO0A 1N7ML 3VRJB 5ID0A 5EULV 4HJ0C 4BKLA 1A4KB 3S97C 1UACH 1S8DA 1K8DA 4MA8H 1BD2E 1JZ4A 4NM4L 3H7LA 4U05A 1GIGH 4JEGB 3QFJB 4M6MH 5HDLA 1BJ1J 3QIWA 1MWAB 3HMXA 1A2YA 2F5BH 4NDMA 4W4OA 4QT5A 3OG6B 4XP5H 3BD5A 1WCBA 4O5LH 1ZANL 4HCRH 1CXEA 4PY7A 1R3LA 3IGAA 4PLOB 4DN4L 1TVBA 4YNYB 4LKCA 2YK1H 3AU1B 1OAXL 3DXAA 2R69H 4FA8A 2HLAA 5FGRA 4Z7QF 4L8SA 2R2CA 3QEHB 3BRGC 3MRQA 2EO1A 3C5SB 4O4YH 1WCQA 3RJDA 3QNXA 3MLXH 3N1MC 3O6LL 1DR9A 2QL1A 1L7IL 5D2LB 2J8UA 4M43L 5DR5H 4XPFL 5E8DL 1EUUA 1W0WA 2D4FA 4BQCA 1IAIL 4GXVH 4OM0H 4WCYH 1YQVL 3GK8L 4FQ1L 4QO1A 2DD8L 4HS8L 4PJHB 5CHNA 1DTUA 4PV8A 3WO3B 3L3IA 1GZPA 1HWGB 5DHYB 5GGTL 4ZNCD 3QXWA 4KDTA 4K94L 3ARGB 4Y5YC 2VXTH 5EIIB 2YD7A 1NC2A 4NN6C 1QEWB 1QACA 2Y36L 3BKCH 3BKMH 4ZAKC 3H9SE 2VIRB 3IU3B 4NM8L 3G5XA 1ZLUH 3HB3D 2WWKO 4I18B 4MSWA 4LRIC 3HG1D 3BKYL 5DJZA 5IVZB 2BSTB 3MLTA 3EO0A 3FMGL 1HHJA 1HCVA 4G6JL 4NIKB 1I1AD 4Q0XL 1NDGB 3WKNA 4YDLB 3S98A 1Y0LB 1BQHB 5HHNB 4NO5B 1TPXB 1YEGL 2VXQH 3ZE2E 1MI5E 3H6JA 3VFUA 5JLZA 1JHKH 4S1RL 1YMMD 3VXSA 5DDHB 3OV6A 4DGIH 2ZCHL 1KYOJ 4JFHD 3AFLA 2HLFD 3KNBB 5C6PB 2OI9C 1FAIH 1SEBB 1UYWH 3TO2B 4HGWA 2YN3A 3C6LC 3L3KA 3MLYH 3MZTA 3DX7A 2BDNH 1HH6B 3D0VB 4F57H 5IBLD 4K8RH 3UPRB 2HT4D 5CINL 4LSSH 1H8NA 2IQ9L 3I75A 4QRPE 5F97E 4EZMA 2V6HA 2O5XH 1DP0A 4DN3H 1ITBB 2K9UA 1A7NH 3BP5A 3QDAA 1DDHB 1UM6L 3TO4B 3HZMB 3LOWA 1QFWM 3D85A 5IV2B 3GMRA 3V2AR 2Q1EA 1FNGA 1TZGH 4PJGA 5K9QG 5JW3H 1EUTA 3RL1B 4JRXD 4G42A 1OTUD 1HIMH 3VXSD 5J1TC 3HRZB 1N0XH 5C0GB 5C2BL 3FQUA 4DK6A 3KPQA 4LPVA 3L5WB 5ICZA 5I75B 1W72L 1EFXB 4RBPK 1U36A 1YMHA 2MQ3A 3SCMB 5KVDL 1H3GA 4XCFL 5BJTB 3P9LA 5LWYH 1GGBH 2DL9A 4K23L 3T1FB 1FFQA 1T03L 1GGIH 3QNYA 1TQCB 4G8GD 3VGHA 1DANT 1GGYA 2W9EH 3KDMA 2DYPD 3UTSA 1R5WB 3ZO0A 3D85D 2X4TA 1XCTB 1Q94B 1FGNH 4PJ9C 2CKBL 2GAZA 3QULA 5EO1A 4L8CA 4P5MA 4YHOH 2GFBA 2NMSA 3PGCB 4HBCH 1E27A 2CJUL 1A6WH 4RSVA 4JFZL 4LIQH 2EYRA 4DEPC 5JA8B 1WBYB 4N0CD 4D0CB 3AAZB 4QNPF 5IMMA 5HHQB 3LQZB 1BOGA 3IFOA 5A1AA 1NGWB 1RZJL 4HX1A 3CDFA 4L3CB 1E4KC 3BW9B 3T2OA 1S7QB 1OGAE 4HKXA 3CPLA 2ENYA 12E8H 5F7DB 2R1XA 3X11A 2ADGA 1Q9KB 3UJIL 4YHZL 3QXVA 3X3GH 4K71B 5EO0A 4GKZA 1CFNB 5E8OA 3LV3B 5C70A 1OGTB 3RIFK 3BD4A 3VWJD 5E7BA 1KGCD 4N9GA 4PRAA 3OR7B 3WO4C 3VXRB 3V4PL 3L3GA 3C2AL 4RGNC 1T80A 4GBXB 1MVUB 1U3HD 2EIEA 4IRJA 3TJEL 3GSXA 4CMHC 1JRHH 1CGSH 4I5BB 1ND0B 4YGVB 1FYTB 4LASH 1NFDE 2X7LA 3EKCA 4HPYL 4GMSL 4TRPL 4GKNA 4R2GB 2A6JB 5DD1H 3G6JA 5K9QI 2BNRE 4MB3A 4J8RA 1JJUA 2ZG1A 5HBBA 2BXZA 2HJKB 3GJFB 3O6FA 4KY1L 1GPOH 1KCSL 3EDEA 3KHOA 2EH8H 2FL5B 5EZOL 3V6ZB 4X6CE 4I0PD 1P4BH 5EOTA 4AQ1B 2Y1VA 4HJGB 4ODSL 1YNLH 3VXQA 2R9HD 1XH3B 4HQQL 4E41B 4F7PB 1TTUA 3IDGA 2J88H 1F2QA 4HKBA 1QKZH 5DURB 3I9GL 4WU5A 3HMWH 2N7AA 1OD9A 3RTQA 4OI8A 3KR3H 4RZCB 1BX2A 3FQWA 4IRJD 4GLRI 2NPLX 1GH7A 3MV11 2CR3A 3VGAB 2XNAB 4ODVL 5FO8B 4EUPB 1AP2B 3TBYB 4HHAA 1ZHLB 4GW4A 5FYJU 1WEJH 3ARED 3G5VA 4JHAL 3CXDL 1MJ7H 3MV7B 4RDQF 1FIGH 4ERSH 4F3FA 3FB7A 4U6YA 1G1CA 1QFUH 3QXAB 4CADA 5IEHB 4IIQB 4UV4L 1INEL 3IDIA 1S7VB 5IB2B 4H26A 3O8XD 5I74B 1MNUL 1G9NH 3HI6H 1YYML 3D3VD 3WXVH 5EU3B 3U30B 5T5NG 1IGTB 4XC1H 1A7RL 2VLKB 3BD3A 3FFCE 4N9OB 4FFWD 5F7UA 2ZUQB 1UXWA 2WINB 1GSMA 1HINH 5FGBC 1X5LA 5D7JD 4KJQC 3BH9B 4Z7WA 4YFEA 1AQDA 1BPVA 4WFHD 3T2NL 1TCRB 4JKPL 4XPAH 3RTQD 3BMWA 1TVDA 1MHHB 4CN6A 2A6IB 4MMZC 5B4MC 4GKSB 1D6VL 3HFML 4HUVB 3STZB 3WD5L 5FIEA 1YEIH 1J5OH 4XMPL 2FBJL 5INCA 1KJMA 4X99B 4APQB 1K4CB 4NQXB 3M1BA 4JM2D 3TWCH 1M4KA 3WEXB 1T20A 1OP5H 1F3JA 2GI7A 2YSSB 4DAGH 1EGJL 3OBAA 4OB5L 3MRKA 1AQKL 1OW0C 1DBAH 2Z4QB 3WYRA 1Z6JT 1EEZB 1H5BC 4QXGL 4KTEH 4OIIL 4HUKB 3IFPB 3HI1A 3NAAH 3GHEH 4HT1L 4O51B 4QHNB 3P2TA 5GRXG 4JFQB 5F88A 3MV9A 1JYVA 5FDWA 5FEBA 4HWEH 1CD1A 3IDYB 3RX8A 2FX9L 3MRHA 3B9KC 3NH7H 5B8CC 4YDKL 5DJ0B 5HHMD 3NTCH 4OZFB 4KI5C 2ZWLT 1IAMA 2DQDH 3MRRB 3OF6A 4TTGA 3GSWA 5C0AD 4IMLB 1QSFE 2ESVA 5JXEC 5L9DH 4Y16B 5HHXH 3NCBB 5KN5B 1D5ZB 3UZEA 4MNGB 3WL9B 1KNOB 4X5WA 4W81A 2R0ZH 1OP9A 4PRIE 4PPTA 2EH7L 2OYPA 4LCYB 1T6VN 3PL6A 4S0TD 5KSUB 4WNQA 4B41A 4H1LH 4HUNB 3CXHK 3JWOL 3RVXD 1ZVHA 4BA8A 3RIAK 3SPVB 4U7MA 1LNUA 3MV9D 4L8BA 4N1CA 1BLNA 1NC4A 4HGMA 3T0EA 3LHPL 3SGEH 3B3IA 5HDBF 2WUCL 4O02L 2R2HB 4P3CH 4U1KB 3ECBA 4MWFA 1JPTL 4HK0A 2ATKA 1XMWA 3OF6D 4NO3A 1IGFH 4KZEH 2PO6C 5CEYA 4FQ2H 3BYYA 1AGBB 3U0PB 2RGSA 1CTOA 1BZQK 2VABB 2PTVA 4KROC 2GQHA 2IANB 2VC2L 2ZOLA 1CZ8L 1BBDL 2OP4L 3DVGA 3MBXH 4FFZH 5AYUH 4PG9B 2WNGA 5KANG 3W9EB 5FUCC 5LQBL 1B6DA 1Q1JH 1JHTB 3H7BB 1DVFC 2ZJSH 1J8HD 2A9MH 1KTDB 1KTLA 4WHYH 1FFOB 5DMKA 4P5KB 2BXYA 1WIPA 1KCLA 1FJ1A 4JN1L 4OLYL 4LQFL 3VWKD 1U8QA 4NQTA 2YC1B 2V5YA 1MWAL 2VDKH 5JIPA 4JFED 2PETA 3P77B 2ZCLL 3U7YH 3E2HB 5KSAC 1RSFA 4Z7OE 2VISA 2BC4B 1FVDB 5I1IH 3VGEA 3V0AC 3SOBL 1T5WB 2BOCA 1WFNA 5JIHA 1U8IA 5CFHA 3DRQB 5L2KE 3MV8E 5IVXA 2GJZB 1CICC 4LIQE 2W9LA 3EOAA 4HIHA 5F7MC 4WUUD 3LEXB 2CLRB 2GJJA 4IJ3C 3ZE0F 1CBVH 4Y2DD 5D9SB 3KPSB 1EHNA 4G8IA 1T66D 4FTVD 1JF6A 4HFUH 1FH5L 4GAJL 1U8NA 2C26A 2CRYA 5TE4L 3O6MH 3VI3F 4Q2ZB 4LCIL 3I02A 5EOCJ 1NAML 2FIKB 5TQ0L 5L6YH 1XGRB 2ED7A 5F9OH 4ZXBA 4V1DD 2R4SH 1H9VA 1A1NA 2BMKA 5BS0B 1BD2A 2XPGB 4HIJA 3VRIA 1U3JA 4YBLC 1NFIA 4FXGA 1V7NH 5FV1L 4C54A 5F89B 5FM8A 3PP3K 4R0LB 1HHGA 4Y4FC 4FFVD 4ELMF 3NCCB 1WC7B 3ZKMC 5I1GL 4PGEA 2IWGA 3CMOL 4FXKB 4G7VH 2MTPA 3ARFB 2R2BB 5IJKA 3EZ8A 5E2WH 4XXDA 1MQ8A 3RJQB 1X5ZA 4HUWA 5TDPA 3BP7A 5FM5M 1KT2B 1BJMA 2JJTA 2P24B 4YBHA 5KANI 3GMNA 2P5EB 1A3LH 2F54D 3P0VL 4G9FE 2VQ1A 4OCLC 3IETA 5CSBA 3SGDH 4XBPB 5DD3L 4CU8A 1PBYA 1CXLA 1N7MH 1ZOXA 4Y19E 3PDDA 1P9MA 3EJZC 4LFHD 5TDOB 1DFBL 5I71C 3LZFL 1JHLL 3LD8C 1GGCL 3PHQB 4LFHG 1S7WA 5CJ5A 1RI8A 1UENA 1WVZA 4N0UE 4LGSB 4NM4H 2EKSA 2RJMA 4TNWF 2NW2A 4LHUB 3MGTB 3QIUA 4G3YL 3MOQA 3BZDA 4FFYL 2IH1A 2VNCA 3LS5L 4HV8B 1RJLA 3NCFB 1R5IB 2AXGA 3O4OB 3RKDD 4ENEC 4OKDA 5D7LE 4DOHE 5JOPE 2GSIA 3DRTA 2BNQE 1ZANH 2EE2A 4DN4H 4OZIE 3QT2A 2OBGA 1I4FB 1OAXH 3ILPB 2XKSA 4NN7B 2I9LB 4ZPVB 1YNKL 1EHLL 4HWZA 2MCPL 2P5WE 4QYOA 1S7RA 1MY5A 4HF5L 5CUSH 4N90E 4XH2B 4M7KH 1NCDL 2I9TB 3UJJL 3O6LH 1MFAL 3U4EA 1L7IH 1QPPA 2FEEI 3FQTB 4M43H 3OKDB 4Z7VF 4U3CA 3FFDA 1MI5A 2ZSVB 4XPFH 1QFPA 3CVHA 5E8DH 4HW6A 1IAIH 3F7VA 1YQVH 3W0WD 4OFKA 3WIHA 3GK8H 1QO3B 5C71A 2DD8H 3QNZB 4JGUA 4K9EL 1MUJB 4R9HA 3ULSB 3FO1B 2E9IA 2FATL 1SVCP 2BVPB 5A43C 1DE4A 2Q6WB 4LVOB 2XKUA 3JWOC 1P7KB 4U1IA 4FG6D 2DI9A 2X89D 3QEQE 3UYRL 5GGTH 1EBAA 4K94H 3HRPA 5CS7A 4BSJA 4TUJA 1I1FA 1QFWI 1BBJA 4QRPA 2NY5L 3TN0B 4LPTA 2Y36H 2P8PB 4RA3A 2CMRL 5GIRB 4HC1L 2GT9A 5F3BB 4NM8H 4FQJL 4M8VA 1ES0B 5D2NC 3BKYH 5FKAB 3TIDB 1V3MA 2FYYA 4NPYA 1J87A 3HS0B 4G6JH 4OGAC 4NKMB 4Q0XH 5DMIL 3CU7A 4KQ4L 5DK3A 1DJSA 4FQPA 3TA3A 1XIWA 1LVEA 3FOLA 4PREA 1YEGH 2XT1B 3EHBD 4JFXA 2P8MA 4U3XA 1ZKAA 4S1RH 2IBBA 4YDJB 2WWKT 1EERB 3ESUF 2ZCHH 1Y18B 1NBZB 2Z92B 4ELMB 5HSFA 1FC2D 1FNEA 1KJVB 2APWA 5DUML 1DQTA 3GSUA 3SDXE 4E42B 2B0SL 2VITB 3TBWB 2EDRA 3BVNB 2H8PB 2FJFA 4XHQA 4NQCD 4JRYE 5MI0C 4KKBD 5CINH 2IQ9H 5ID0B 3VFOA 3W2DL 2CLZB 4BKLB 5ICYA 4Y5VC 3FCTB 1ZT7B 4GRLA 4M7LL 2M1KA 1UM6H 1XGPA 3ZL4L 3O3EA 1D5XA 4BSWB 2VLRE 3S35L 2NY6D 1UJ3B 3RPIA 1CD8A 1MIML 3MLWL 4C56A 5ADOL 5IF0A 4IOFC 5HHVL 2YXMA 4U6TA 4PGJA 2NY0D 3D39E 4GRMA 1T3FA 3FB5A 5DS8B 1A2YB 2DBJA 3GJFK 2YUWA 3SDCC 3V5DA 1TTGA 2PKDA 2F58L 3QIBD 5DQ9B 4F37K 5C2BH 5F1IB 5FGCE 4CGTA 4HWBA 5KG9B 1TVBB 4BFIA 2YUXA 1DCLA 1W72H 3MRLB 2C7UA 4NJ9L 1BQSA 1RJZA 4JFFD 1RVFL 4Q6YA 4BH7B 5KVDH 2VR4A 3ARBD 3HG1B 4XCFH 4MS8A 4K23H 2X4NB 2RQ8A 3GDBA 4TYUA 2VN4A 4XPHH 1HHHA 3QNXB 2RHEA 1YEDB 1T03H 1QR4A 2DQCL 2WLYA 1I1AB 4NQDA 1T1YB 1FSKB 4CJ0A 5ID1A 3ARGC 1W0WB 4PRPE 1T1WB 2X9YA 1YMMB 2CKBH 2FLBT 2H32A 4C56D 1FZOA 3FT3A 4Z7VB 3LMJL 2PR4L 4OTXL 1BWWA 3UP1A 5EU5A 4I18C 3L3IB 5F1KC 4PLKD 2CJUH 2B1AL 1NFDA 4JFZH 3KS0J 1QQDB 3EOBA 1ZV5A 4J4PA 2BNRA 1HKLL 4JDVA 4JY5L 4WUKL 5T1KA 1TPXC 2EIZB 1CL7I 2NR6C 1RZJH 2W1NA 3EJYD 4MA7L 4Z78A 5C07D 5HXMA 4X6CA 4H88L 3ZDZF 2D3VA 3IDMA 2DQFB 4MS8D 3VMNA 4YHZH 3UJIH 4WW2F 3OX8A 3TCLB 2E8ZA 3U83A 4WWKA 4NQDD 4RIRA 2AK1L 2JF1A 5BVJB 4JQIL 4JRXB 3DETD 3VFUB 1OLLA 3KXFE 3V4PH 3Q1SL 3VXSB 5F7YC 2CRIA 3C2AH 4L4JA 5FCUL 4ZSOB 4R7DA 4OBRA 1H3TA 3QP3A 1VESA 3WN5C 3LDBC 5ERWA 5I16B 3TO4C 2W60B 2NY7H 3TVMC 3OXRA 3RWHA 1TJHL 2EEAA 4DZ8A 3E0GA 5F1NB 3WFHA 3DX7B 2C4FT 1VFMA 5T5NF 1ZT1A 5CJQL 4YHML 2E5EA 4GMSH 2EZ0D 4TRPH 2XA8L 4C57C 4G8GB 3GKWL 3I75B 3O2VL 4KY1H 1KCSH 4KWUA 4UOW1 4ZUUA 2X1XR 1MH5B 2DYPB 3MLUL 4U1LB 3TC9A 1IEBA 5EZOH 5L0QC 3D85B 3FFCA 3GZKA 1FNGB 2DJUA 2X5PA 3ABZA 4ODSH 5EO9A 3VXUD 4HQQH 5DQDL 3WNOA 4HCRA 3SCMC 1MCCA 4JQVA 2VKXA 3DV6B 5ANMB 2Y25A 4OV6F 4U33A 3DX8A 4F7MA 5J6HB 3FO0L 2R0KL 4I3SL 1TQCC 3WSQL 4ZODA 4NKOA 3UMTA 4JM2F 1S9YA 4K9EC 4ODVH 5FO9A 2NLJB 5D1XC 1YMHB 5D8JL 1U8OA 5IB1A 5FECA 4F7TB 4K07A 3RVTC 3DI3B 3P9LB 1OARL 4JHAH 3CXDH 3QQ3A 2G9HA 3TH2T 5FYKL 1JI2A 4WU7A 2OL3B 5IQ9B 2UZXB 1FORL 5CJXA 4RGNE 4UV4H 4PJXF 3HLAA 1INEH 2Y5TB 2NY5C 3MBEA 4WV1A 1MNUH 3AUVA 2YWZA 3EYFA 3VWJB 1YYMH 3T8XA 4YHLL 2X4TB 4RQQA 3MUY1 1FN4B 1WGOA 3LKSB 2QHLA 3QULB 2AJXH 3W9DA 3PXHA 1MCHA 4M7JL 3RWFB 4LHQB 2R15A 1U3HB 1J05A 1MELA 1NKRA 4LF3B 2NY1D 2X4UA 3N50A 4HK3N 1S3KL 3T2NH 5HPMA 4JKPH 4LOUC 1MLBB 2HFFA 2PYEE 3TJHC 2GTWA 3STBA 4Y0GA 4KMQA 4HSQA 5IMMB 1D6VH 3MROA 3HFMH 5C8JA 2R1YB 2G2RB 1BOGB 3WD5H 1J0HA 3EO1A 4G43A 4HX1B 4XMPH 2FBJH 4JG1L 4LPCA 3JVGA 4LPWA 4TVPD 4I0PB 2M8XA 4QRUA 2NTSP 4KKAC 4ZO9A 5TH2B 1KJ2L 1XF3B 2HG5A 2QSQA 3CFEB 4GKZB 5EA0H 1K2DB 4PJ7E 3GSVB 4PRIA 4CNIA 1EGJH 3VXNA 4WW2B 4N9GB 4OB5H 3GJEA 1YY8A 1AQKH 3REWA 1QLRB 3V7AG 4BM7A 3RY6C 4R2GC 4QXGH 5EZIH 4OIIH 4ZO6A 1JGUL 4IRJB 4ACPA 4EOWL 3T2QA 3GSXB 4HT1H 2FX7L 4R97C 3PWJA 4U4BA 3MC0A 4HEPG 4QRSA 3QDGE 3ZSTA 1D5MB 3AREB 2FX9H 3RZCD 4P4RA 1SJHB 5EU4A 1BVKA 4YDKH 3GUTB 4GKNB 1CFQB 1WFUA 3RA7L 4X8JA 2HJFB 4MD5B 4MVBC 4F9LC 3O8XB 1WAAE 1WWBX 3D3VB 1Y6NR 1FNAA 1IMHC 5EOTB 1WTLA 5DRWA 1JV5A 3D18B 1QLFB 3VGAC 3LKOA 4LVHB 2YN5A 3U2SB 2AEQH 3OJVC 5GSVA 1MHEB 4HKBB 2JJSA 3MNZA 5D7JB 3CH1A 1NDMB 4HH9B 1TDQA 3MA9L 4YR6A 2EH7H 4KJPC 1F11B 2VH5L 1NGQL 3RTQB 1BX2B 4ZFFB 3FQWB 2BVOA 3ARVA 3VI4F 1T6WA 1MCWM 3JWOH 3D69B 2YPLA 5GZND 2EDFA 5I74C 2R29H 5HGAA 2AP2A 1MLCB 1J0KA 3JZ7A 3MODL 1JYXA 3LHPH 4JM2B 3ME0A 2ZUQC 4HIEA 2XKNA 2WUCH 1KIQB 4O02H 1JPTH 2IH3A 4CADB 3OJMB 4ZUSA 3GRWL 1HZHL 2X05A 1JPFA 4CN4A 1LEGB 3L3JA 4KHTL 5EG6C 3VRLE 5IKCA 3BZ4B 2E7LC 1ZLWK 4P46A 3WJJA 1A64A 2B39A 2VC2H 4XWOC 4PJXB 5IEKA 3MV8A 1CZ8H 1FYHB 3FT2A 3F8UB 1BBDH 2OP4H 1N26A 3HCVA 3IJHA 1EEYA 4R4BA 4KI5E 1AQDB 5LQBH 4OCXL 5IWLC 4FRWA 3MXWL 4LKXB 2RFXB 2LABA 2G5RA 3RWIB 5HHMB 1KCVL 2YPLD 2NXZD 2PCPB 3BEWB 3QHTC 4JN1H 4OLYH 3I3EA 2ADJA 5C0AB 4LQFH 4WEMB 4PGZA 4P5TD 3C5JA 5GGQL 5DHXB 3M1BB 3BX7C 3C8DA 1LQSR 1MWAH 3IDUA 5C9JA 3H0TA 5HVGB 4GG6F 4ZQKA 1AKJD 3KAAA 2ZCLH 3FOMA 3QXUA 3LN4B 4DJMA 3IDYC 5IVXF 2GCYB 1T4KA 3MRKB 3K1KC 4NWTH 1CLZL 1PD6A 2MSPA 1YQ2A 3SOBH 3KPPB 3MV8D 4JZNB 4GXUM 3VG9B 1TQBC 1CDHA 1T0NA 3QJFA 5E8PB 1Q9WA 4GUPB 5F88B 3MV9B 4Y16C 5D6CB 3MREB 3LIZH 1IGIL 3B9VA 5GS1A 4J23A 3VXOA 3MRHB 1SBBA 1BJ8A 3TNMA 2D0HA 1CK0L 2HAZA 5DJYB 4HZLB 5DFVC 1FH5H 4GAJH 5ESQA 5TE4H 2J1KA 3GSWB 4LCIH 5D6DC 4IOSD 4GW1A 4JQXC 2VZ1A 4GW5A 5DJ8B 3PNWB 4YIQA 1NGYB 5FUCE 5DF0A 5TQ0H 4Y19A 3NN8B 1IAIM 3BGFB 2DF3A 3BWAA 4OCSL 5GS3A 4DQOL 2FJHB 3NZHL 3T3ME 4N0UA 4D8PB 2IMNA 4UU9B 3GFUA 3LVEA 4WNQB 1R5VB 1J8HB 1RY7B 4JPIA 5DJXB 3HR6A 1I1CA 3HI5H 5J1AB 4M4PA 2XFXA 2V5SA 1F6AA 3GMMB 3UBXA 1XF4A 1I9IL 5CZVL 5D7LA 1RJCA 2CIIA 1CQYA 5CGYC 5I1GH 3HUJE 3VWKB 4MX7B 3CMOH 2OTUA 1JZ8A 5BMFH 3BXNB 1ZTXL 3SKMB 4OZIA 4PGBA 4PJDE 3RL2B 3ECBB 2IQAA 2HKFL 1XR9A 4JFEB 1FGVL 1YY9C 2BHUA 5I66A 4NO3B 4OIBA 4R90L 3P0VH 3IYLW 5DD3H 3ZYOA 2GIYA 2HFEB 5TGBA 2VOTA 3DVGB 3T3PF 5TE6L 1VFUA 1YA5A 3DURB 2V2WB 5C0CE 1DFBH 4WUUB 3LZFH 1JHLH 1PZUB 3AXLA 1GGCH 5TDNA 4Y2DB 4XNQA 3FRUA 1U3ZA 2YXFA 1O7SA 2HFGL 4Y8DC 4ZFZA 2D7QA 4FTVB 4G3YH 4R4ND 3QEQA 4FFYH 3LS5H 4PGDA 2GW5A 1U8QB 3UBXG 2ZG2A 1OAYL 4ZFGL 5C0FA 1CXKA 4YBQC 1K9TA 2C1PA 2VXVL 2EECA 3ZTJH 4V1DB 4OD3L 2YR3A 1EHLH 1YNKH 5J12B 2MCPH 4YLQT 4JPWL 3GSRA 4NZRL 4K7FB 2VISB 3CFDB 2XV6B 4HF5H 4TNWK 4GG6B 1PZ5B 2BOCB 1NCDH 3UJJH 2EDHA 3JV5A 1MFAH 5IVXB 4NZJA 4QWWC 3EOAB 4P3DA 1R24A 1T2XA 3O6KL 3L7FB 4G8IB 3DVNA 4K9EH 1DN0B 3QI9D 1L6ZA 2FATH 2NY4D 3WMSA 1MRCL 3FQXA 2PTTA 4D9RD 5LVEA 5AZEL 3UAJC 1MCDA 3SDXA 1EIBA 3HZYA 4MCYB 5DHVB 2FR4A 3UYRH 2F54B 2NNAB 3LKPA 3LN5B 5KVGL 2F9BT 4JRYA 4MJIE 2A6DB 4NKIL 4R0LC 4BQ6A 5M94B 2NY5H 1QFHA 1UB5B 1U8PB 2CMRH 1G7QB 2ZP0T 4HC1H 3V4UL 1JRHI 3BPLB 4FQJH 1MAJA 4HJJL 2VLRA 3VRIB 1RZ8B 3ARFC 5E6ID 2C1OA 5CILL 4YQXL 4Y5YA 3U82B 4POYA 2V5RA 3D39A 2V2XA 3MO1A 1PKQB 4KQ4H 3T2PA 4AEHL 5I19L 2ZUXA 4ZAKA 3VFRA 2GJ6E 3MGOB 4PBXA 3NFSL 1RZGA 1UVQA 1NCWL 2X4PB 5E8NB 3BZEA 3AB0B 3BJLA 3OKOA 4XXDB 2CDEA 3QQ9C 2A77L 1WZKA 3DMMD 5E2TL 1NKOA 5TDPB 2OTPA 4FZ8L 1G0YR 3D48R 1IM9D 5DUMH 3VCLB 5KSBF 5JNYB 3QQ4B 5JPMA 3QHFL 2B0SH 4PS4L 4TTDD 4NC1C 4WI6A 3IETB 1DBKL 5CBAB 3KLSA 3VFWA 1F13A 1QRKA 4N0YL 3DJ9A 5ISZE 5HI5D 4X83A 1I3RB 3W2DH 3O4OC 4MMXC 5T3XD 4PRPA 4M7LH 2OI9A 4KAQL 3W81A 4X6BB 3ZL4H 4WTZA 3S35H 3C6LA 3W0WB 3FN0L 3GJFH 1MIMH 2NW2B 3MLWH 1HXMA 5ADOH 4OFDA 1KULA 5HHVH 1A1MA 3SJVE 3RVUC 2L4OA 2IFFL 4NN7C 4XT1C 3WFEL 2XWTB 4YHKL 3E3QC 2IH1B 4ZAKD 3OGCB 4J3SA 1F4AA 2VSDA 3T65B 2V7NA 5ETUB 2F58H 5D2NE 5EBLA 1KCKA 4QRRD 1IGCL 3DWTA 1IFHL 1M71A 5CSZB 4NJ9H 5H37H 3K8MA 3WHE1 4KK8D 1RVFH 4WGVB 5FB8A 4MQSB 1RZ7H 4B0MM 1U2CA 4LEOA 2W0PA 2LU4A 3OZ9L 5I76B 4K3DL 4LVOC 4O2EB 2DQCH 2R0LL 3U4EB 1JF1A 2WWMD 4O2CB 4Q9BA 4WY7L 2AV7A 3S37L 4FZEL 4PRPD 2OL3L 1FL3B 4NRXA 3KXFA 4F2MA 4WHYG 1QSVA 3RWCB 5J13B 4NFDA 3T77A 1C8PA 4WTZG 2NXYC 1P84K 3WLBA 3LMJH 1JCKA 1XGTB 2NX5D 2PR4H 1D5BA 4X7CC 4NT6B 4OTXH 1ZLVH 4R96A 3QFJE 3F58L 4U1IB 1OWRM 1CFSA 2DN7A 1RFDH 2BVYA 4JZOB 4A2MA 3RVWC 4NQCB 2FZ3B 3PDGA 4PJ9A 1HKLH 1BBJB 4JY5H 2XWJA 4WUKH 1BZ7B 3SKNA 3DHMA 1C12A 4X98B 2XOTA 1LO3L 5F7HA 1MCPL 5C08D 4MA7H 1V3LA 3MJ9L 3DIFA 4H88H 4RX4A 5H94A 1JF5A 4UB0H 5T3ZD 2NY6B 4YO0B 1KIRB 4PV9A 4Q9QL 3MCLL 1T1XA 2YD6A 2NY0B 5D2LE 4I13B 1CS6A 1ETZB 4HKZA 2UWEF 4JQIH 3VGDA 2RIKA 1FHGA 4RWYL 1E4KA 2P8MB 5FF6B 3Q1SH 3NVQA 4PD4J 3QIBB 5FCUH 5HYFA 1DUZB 4OUUB 1RK0B 3EYSL 3JV4A 1FNEB 3FN9A 1BMGA 1OAKL 4PG2C 4PJHE 2HTKD 4JFFB 1C16A 1CGXA 1UJ3C 3O3UN 1TJHH 3H3KA 1ACYL 1S7UB 3ARBB 4XBGA 4MXWH 1KUMA 4I48B 5LGKA 4YHMH 1DBBL 2UYLA 1NBYB 3B5TA 3OGOE 4ONGL 4AM0B 2XA8H 5HYSA 5KSBB 3VFOB 3GKWH 3O2VH 5ICYB 3ESVF 2CDFA 3GKZA 1BVLA 1A9EA 4P57A 2AJ3B 2I07B 3MLUH 1D5XB 3ARXA 3BDBA 4OZFH 4C56B 4LLQB 5IF0B 5KTEL 4R3SA 3L9RB 3I3BA 2P4AB 5E5MB 4GRMB 1WFOA 1T3FB 3FO9A 4YGAB 2PYEA 1NANH 4QRQB 1LE9A 1NGPL 2K1MA 1NEZA 5DD0L 3QUYC 3FO0H 4PFEA 5BZDA 1I1AC 2E6QA 2R0KH 4I3SH 3WSQH 2MHAA 4OI7A 3V52L 4N8VB 1MPAL 4IDLA 3QUKA 1LDPL 1QR1A 4M02A 3PUCA 1Q8MA 4OZ4A 5D8JH 1RJZB 3TPKA 1WICA 3G6AA 4PJAF 5C07B 5K9OB 4LDLB 4OFYA 4M8QA 4BK5A 5DO2D 4FMKA 6FABH 5FYKH 3TFKD 1HHHB 4WW1B 1AD0A 2HN7B 5HY9A 2HLFC 3G5ZB 4PJ7A 1Y6MR 1FORH 3E6HA 4YAQA 4HEME 4NQDB 1L0YA 1NUFA 4NUJA 3FO2A 5HYSG 3QSKB 5ADPL 4YHLH 2XN9A 2YA2A 3V6FA 5IBLC 2DTSA 1EJOL 3ALWA 2YD8A 2HT4C 1XZ0A 3E6FB 4M7JH 3VGBA 1BZ9B 3MNWA 4FQQA 4B5EA 2HH0L 3QDGA 1HQ4A 1S7TA 3EOBB 1I9RL 1IAOB 4N5EA 3VE0A 1NEZG 4D9LL 4QXTB 1WAAA 4Z78B 1OTUC 3WJLC 5FGBA 4JG1H 4LLMA 2Q76B 2WBJA 1G7IB 3X13A 4ZYKB 3WBDA 3D2UD 1CLOL 1KJ2H 4OF7A 3C8KA 3VXUB 4WWKB 4RIRB 1FV1A 4Z7QE 1XT5A 2VZ3A 4OQ1A 1LQVA 4MJ6A 2XN9D 2LE9A 1AFVL 3EFFB 4QTIH 2VUOA 3M8OL 3CFKB 4ONHA 1HDMA 1JGUH 2YRPA 5FHAL 3CAFA 3G08B 3QBTB 4M6OL 4POZC 4EOWH 2UWEB 3C60D 1L0QA 1A9BB 5AG8A 5EFIA 1OCWL 4PR5A 3RWHB 3RWEA 3WFHB 2DMCA 5GHWL 3TNNB 3K81A 3FB8A 1OW0A 3U36A 1H5BA 4LL9A 3RA7H 2D7PA 4NQED 4YUEH 1AXIB 1FZKB 4ZUUB 4KJQD 3EFDL 1JNHA 4N0CC 1UZ8B 2PTUA 1JIBA 4UINL 4ETQA 3LKRA 3B9KA 5EO9B 5B8CA 1A8JH 1KJ3L 3IJYB 4R8WL 1FDLL 3SGDI 3DX6B 2NY1B 3MA9H 3MNVB 4UQ2B 2CO7B 1EAPA 1W72A 2I24N 1NGQH 2VH5H 3OB0H 2D9CA 4WI7A 3DX8B 5JXEA 3O11A 3VXRE 3RWDA 4S0SD 1NH6A 4IM8A 4JN2A 1JFMA 5FO9B 3DX9B 3VWJC 3MRDB 2EO9A 2EDJA 1Q9LA 4JFPA 1ORQA 3QQ3B 4WFGE 1U3HC 3RDTC 3CFJA 4F58L 3FT4B 3O81A 1SYVB 4PJAB 2CKBA 3BDYL 4M9OA 3GRWH 1HZHH 4NNXA 1G0DA 5F72S 3D25B 3T0XA 3GMQA 3VD4A 3T8XB 5I1LA 4KHTH 4XX1E 1TFHA 3ISWA 2NTFA 4OSUL 4EI6A 1I7TA 4GS7C 4YXHL 3W9DB 2XTJD 2ARJA 1V5JA 1ZS8B 1J05B 1WV7T 4E41E 2ICEA 4I0PC 2PO6A 1R3JA 4D0DB 2X4UB 4OCXH 3MXWH 2HFFB 3RZCB 4CMMB 1VKXA 2ARWA 2XI9A 5MEOA 3NFNA 3HZKB 3P73A 2YD2A 1KCVH 2X4RA 2Z8SA 3MROB 5EZJA 5IOPA 5E6YA 5D4QA 1PAMA 1BFSA 1PY4A 3CDGB 1WSST 1T0MB 3FL7A 4Z77B 1KTKE 4QRUB 2VAAA 1AGEB 1YC7A 4YHNB 1DVFA 2QR0B 3MV7E 2LVCA 4KH2A 5EC1B 1DEEB 3BGMB 3OG4B 1YDPA 5E5RB 3VXNB 4BQBA 1CLZH 5E7FA 2PN5A 1JWUA 4HMCA 1OL0A 2D7OA 2HVKA 2VLKE 2CLVB 5EWIL 2WLZA 3O8XC 3UPCA 1FPTL 5GS0D 3HUJA 2VDNL 3Q6FB 2PO6D 2NCMA 1IGIH 5KSAA 2EDXA 4LMQE 4WRLA 5IK3B 4FFWC 4LVHC 3BPCA 1GZQB 3BPNC 1N64L 4KROD 4ZDHA 1RZIB 4PJFF 2E7LE 5HD8D 3WLWC 2WIMA 4C59B 5D7JC 4QCIA 2DKUA 1CICA 1X5JA 1A7OL 4HXAL 1TZIB 4G6KH 3X14A 2H26B 4QNPE 1XGUA 1XF2A 5J4MA 1F6LL 4OCSH 3V0VB 5BW7C 4DQOH 5C0CA 3S4SB 4N0FA 5CKGA 3KPLA 5IM7A 5EN2A 3NZHH 2CUMA 3CH1B 4BH8A 4BJLA 3GBNL 4JM2C 1QRND 2X2YA 5FYJD 4TUOA 3OWEA 3D6GA 4U1MB 1ORSA 2BVOB 5JO5A 3I6GA 2YPLB 1IAKA 2NXZB 1CD0A 5C1MB 1LEIB 1N5AB 1I9IH 5CZVH 3VH8B 3WDJA 4I4WA 5KSAD 1CDJA 4P5TB 2IEPA 3HZVA 1WJ3A 1XGYL 3UTZB 1SVZA 1ZTXH 3SDDD 5B39A 4TOYL 1QPXA 2HKFH 1AKJB 1FGVH 4ZUSB 1REIA 3LAFA 4R90H 1CICD 4Y4FA 1I8MB 3KPOA 3P4MA 1WWCA 3SQOL 3GMPA 1YEJL 3F6LA 3MV8B 2YD5A 3QEGL 3FT2B 4PP8C 2G75A 4DCQB 4MNGE 3HCVB 1CDGA 1MEXL 2AQ3A 5TE6H 1HHIA 4NP4L 1TJGH 4YFDB 1EEYB 2E6PA 4JKLA 5L8KB 3ERYA 2CDGA 1NEUA 2MKLC 4OI9A 2ICWB 1JZ3A 1MRDL 5ESAA 2APVA 2VMFA 4KUZL 4A6YB 1WT5A 2BRQA 5FYKE 4KHXL 4NFBA 3O3AB 4NZUL 5DUBA 3VFNB 3L3OA 4MJIA 1OAYH 4ZFGH 5JOEA 1EGJA 3RVXC 4PY8J 2YPKA 5DFTA 1U8HB 3VG9C 1H15B 3IJSA 3C2SA 4E0RB 2VXVH 4LP5A 3QA3A 3OKMA 1U8LA 1KPUA 2EDKA 3ARWA 4ZQKB 5A40E 3FOMB 5B39G 4OD3H 4AEEA 2F74A 2E8YA 3WIIL 2QSCL 2ZOKA 4JPWH 1T4KB 3MRIB 4DKEL 4NZRH 4RMWA 2V9QA 2F15A 3ZMRA 1CIDA 3LEYL 3VXPA 2IANE 4KTDL 1NUDA 3TF7C 1LILA 4EDXB 1D6EB 1YUHB 5HYIA 2ORBL 2GJ6A 2DRUA 3QJFB 2Y7QB 4KVCL 1CL7L 2VJXA 3O6KH 2OMNA 4I2XB 5DT1H 4LPXA 4ZNEA 5DC0A 3BGFC 1MRCH 1TVHB 1AGDA 5ESQB 3FONB 5DRXB 1Z9SA 3ZHDA 5JDJA 4NNYB 5DLML 4MJID 4PRNB 4PJFB 5KVGH 3GGWB 2Y6SD 2EC9T 4NKIH 3PJSA 1A4JA 5ISZA 2Z31D 1GRWA 1U92B 2XXCB 1RUQH 2D9QB 3V4UH 3VWKC 1CXIA 3MUZ1 4FQCL 4HJJH 4D2NA 4NKQB 1WZMA 2JK5A 4N0UB 2DS4A 4F15B 5CILH 4LVNB 4YQXH 3SJVA 2J12B 3DGGB 4RNRA 4QHKJ 1NSNL 1ZVSA 4PLJD 4W4NA 1N59A 2XFXB 4AEHH 3MJ8A 4JY6A 2QV2A 2CIIB 3MLSL 3NFSH 2BY1A 5D2NA 1QLEL 3TV3L 4ZTPL 1NCWH 5CGTA 3KPSE 5J89A 3RNQB 3EDFA 4G6FD 3R06A 2A77H 1X4YA 3KLAA 5E2TH 4ODHH 3CZFB 1IEHA 1R3HA 2ZUWA 3R4DA 1U2HA 1S5IL 4Y2DC 4FMFA 4PS4H 5EOQL 1DBKH 2FD6L 4M93B 1AJ7L 1T66C 4G8FB 1IM3B 1OAZL 5BO1L 3VRJA 1VFBB 4N0YH 2FGZA 5FOBB 4GLRH 2CIKA 3SGKC 5IHZB 4KAQH 3AXLB 5BS0E 4X9HA 2DLFL 1FO0L 2XWBA 4YDIH 1P4LA 3FN0H 3QI9B 2WP3O 2NY4B 2EC9U 4ZFZB 2DQTL 2IFFH 3QFJA 5LG1A 3WFEH 4YHKH 4V2CB 1MWAA 3T0DA 4Y5VA 2BHZA 2CR6A 3UYOD 1GAFL 1J0JA 3MRMA 3B5HA 1IEAB 1I1YB 1T7XA 1K8IB 5D1ZC 1HEZB 1IGCH 4JANB 4YNYA 4FFVC 1IFHH 1VENA 5IESH 9CGTA 3T0WA 3VDAA 3IXTB 5F6HI 1EEUA 2P5EE 2MNUA 3L95B 5HDBE 5E6IB 3MJ7B 3OZ9H 5IGXH 2EDLA 5DUPL 4JG0L 4K3DH 4QTHA 2R0LH 1A6AB 5D2LA 3U1SL 1JTOA 4OGZA 3MLPA 4WY7H 3QZWB 3S37H 4YEEA 4JB9L 4FZEH 3BRFA 2OL3H 1J1OL 4JFOB 5BZWB 5C7XL 2QQNL 5C6TH 1EHAA 4NC1E 3VW3L 4AK1A 2VLME 2C9AA 4UILL 5IB4B 1NAMA 3BPLC 3FQXB 4PJHA 1U95B 3DMMB 3F58H 1IM9B 5DHYA 3RWGA 4CVZB 1HN1A 3LKPB 1IZKA 3ARGA 5D7SL 5EIIA 1XFPA 5LGHL 3QRGL 2A9NH 1QEWA 4IOFD 1JGLL 2ICCA 1LO3H 2VIRA 3IU3A 1MCPH 3B8YA 4B50A 4OT1L 5GGSY 4I18A 3MJ9H 3Q6GL 1J8KA 5IVZA 2C1OB 3E3QE 3SDCD 3L3DA 4NN5B 4Q9QH 4NJAL 4Y5YB 3MCLH 4Y2OA 4YDVB 2R0WL 1NDGA 1Y0LA 1BQHA 3OAZK 4GSDL 1R6VA 4ZAKB 3VFRB 5DSCB 5DK2B 5DDHA 1CCZA 2OZ4L 3BZEB 2AJUL 3EYSH 4QRRB 5KS9A 4KC3B 3KNBA 1OAKH 5HTSA 1SEBA 3TO2A 3ZE0E 3OTTA 3X12B 1ACYH 2H6PB 2HJLA 1D9KD 3D0VA 3UPRA 1DBBH 5FYLD 3FRPA 2HVJA 3VFWB 4U3HA 3MRBB 4ONGH 3ZT7A 2XG5A 4FG6C 3VI3E 5J6GA 4PRPB 1DDHA 15C8L 3TO4A 3LSOB 2R23A 1CR9L 5IV2A 2JB5L 1SQ2N 3TVMA 2OQJB 4MYWB 32C2B 3TYFB 3QYCA 1LEKB 2CPCA 3STLB 2NW3A 4N8PA 1HXMB 5CEXB 5KTEH 1KG0B 1A1MB 2NX5B 5AUMB 5GGVL 3RL1A 3MFFB 1MCJA 1NGPH 3HRZA 5DD0H 5C0GA 4K3JH 5CD3B 5GGRB 4I77L 3V52H 2FCBA 3S6CA 3L5WA 3IF1B 4JKWA 1MPAH 1EFXA 1LDPH 1M71B 4ELME 1TXKA 3SCMA 3EHBC 5C08B 3M45A 5J13C 5BJTA 5IR1A 5LBSL 2HRLA 2E3VA 4JPVL 5DD6B 3P4LA 5CCKL 5D5MF 2FGWL 4MD0B 2YD9A 4YHIB 4TVPL 2QJDA 3FRPG 4Q7DA 1S9WB 1R5WA 5ADPH 2XY1A 1XCTA 3TVMD 1Q94A 2OXGA 4W6XB 4Y4HD 1EJOH 3T77B 1RIUL 5I1KL 1CXHA 3WLBB 4TSCL 1MFNA 3PGCA 2HH0H 4WFEE 2OM5A 2RAMA 2A1WL 2P7TA 5IHBA 1II4E 2DQUL 2CK0H 4RFOL 4ZTOL 1OAUL 4HC1A 3GBLA 1KB5L 1WBYA 4D0CA 3ZTJG 3AAZA 1N5YL 3JUYA 1I9RH 4BZ1L 5HHQA 2NY0C 2VZTA 3LQZA 4JO3L 3T0VA 4D9LH 1C12B 1NGWA 1S7QA 4YXKL 3NFPB 4XNMA 1JFQL 2P42B 3QIBC 5F7DA 2ID5A 4M62L 5I8EB 3S36H 1Q9KA 3HG1E 3RVVC 1CLOH 4F7CA 4EXPX 2L7UA 1ROWA 3B2VL 3TJHA 2XQBL 1CFNA 3LV3A 1OGTA 1YEKL 3ARBC 4KGLA 5D1XD 3OR7A 4H25A 1AFVH 4NUGL 4D3CL 3OKNB 1YMME 3M8OH 4GBXA 1MVUA 3RBGA 1GHFL 5FHAH 2AEPL 4QOKD 4Z7VE 4M6OH 1ZGLM 4JFHE 2FB4L 1CLYL 3H3PL 1RU9L 1ZSDB 3DROB 1C16B 1OCWH 4I5BA 4YGVA 5GHWH 3MUGB 3VRLF 2X4QA 3RY6A 2A6JA 1JUFB 2HJKA 3GJFA 3UZQA 4MA3B 2ILLA 1BVLB 4WI5A 5KVFL 2FL5A 3V6ZA 4EXKA 4XB7A 3EFDH 4IRSC 2ZUUA 3V95A 2EYTA 3TJHD 5JW4R 2ERJC 1XH3A 3VD7A 1KJ3H 4E41A 1P7HL 4F7PA 3EJYC 4R8WH 4S2SB 3FO9B 4MVBA 3HNSH 4F9LA 3QG6A 1LE9B 4JRXE 2ED8A 4Z5RB 2KQNA 1NEZB 3WFDL 2DLIA 4RZCA 1KIPB 4KKAD 1UEMA 4ZSOE 2DM4A 1JPSL 5HHOD 5HDOA 3M17B 1RUKL 4O58L 4OZ4B 3DETC 1ZHLA 4IMKC 3SEPA 1P1ZB 2CK2A 5T1DL 4UQ3A 3MV7A 4RRPA 5DTFA 3D2UB 2R1WB 2JE8A 4F58H 3ULVD 2D0FA 5IEHA 3BDYH 5IB2A 4G8GE 3FO2B 3EGSB 2OJEA 4XB8A 5EU3A 4JLRB 2XN9B 2VXUL 4OLUL 1IGTA 4XX1G 5D5MB 2B5IB 4L1HA 4OSUH 2VLKA 4YXHH 5J9PA 5SWZD 1XZ0B 2V7HB 5SV3A 2WINA 4RGOL 1UJTA 1DL7L 2UUDK 3DUSB 4RAVB 3C60B 3GBML 5ACLA 3BH9A 4XVJL 3RIFF 5ACMA 5ANME 4LSTL 5T5FL 1HQ4B 1TNNA 1TCRA 1MHHA 2A6IA 2E7LA 4DZBA 4GKSA 4UOJA 5H37G 4HUVA 3STZA 4HBQA 1UZ6F 4NQEB 3NIFF 5BQ7B 1ZT4A 4X99A 3RWJB 5FGSA 1IJ9A 3G5YA 1UM4L 4NQXA 4A6YL 4IRZL 5IWLA 2NYYD 2CO6B 3JWDL 4LHJB 1HI6A 1QBAA 2DB8A 1JL8A 4RRPG 1AO7D 1V3KA 1NCAL 2BY2A 4ZUWB 2YSSA 2PXYD 1FV1B 2QHRH 3GSQA 4MJ6B 5MERB 3ALXA 5FA3B 1DQQA 3LRGA 3C09B 4P9HL 1KGCE 2Z4QA 3VU2A 1EEZA 4GO6B 1QA9B 2C3XA 3IFPA 2OSLA 3Q5YA 1KACB 4O51A 4QHNA 1FPTH 1U6AL 4PP1D 4JFQA 2VDNH 1FFRA 1RIVL 2GSGB 2H9GB 4PR5B 2EIDA 5C09D 1RURL 2FRGP 4RCAA 1KYOK 4PJ5D 4TSAL 1N64H 4OZGF 1HSBB 5DJ0A 3GSOB 4EIGB 1H5BB 3WNLA 4OZFA 3QWRD 4P2OD 2HMID 3N1QC 3MRRA 3CSBA 5T1LD 5J3HC 2NY1C 3BEVA 2AJZB 2BVUA 4IMLA 4OF6A 4CVXB 4MD4A 1A7OH 4JCLA 4Y16A 4HXAH 3SGJC 5B3NA 5KN5A 1D5ZA 3LKRB 5EIVA 2XTJB 3RU8L 5DHVH 4MNGA 5B8CB 1I7ZB 1KNOA 1IILE 4JZJC 3I6LD 5IUSA 3ZDZE 3GBNH 4LCYA 3ARDD 5D6DA 4JQXA 4HUMB 5KSUA 4CL7A 4UBDD 4GQ9L 2Z9TA 1AY1L 3OKKA 4IDJL 3SPVA 1CIUA 4WI8A 4OCNC 3O3DA 4HKJB 5EBGA 1XGYH 1A6ZB 2R2HA 4X7DC 2O93L 4TOYH 1BIHA 2Z8RA 4PJ8C 2ITCA 4OZFG 1AGBA 4XP9L 3U0PA 1QBBA 2VABA 3RZCC 3NGBB 4P4KC 2IANA 3D3VE 3SQOH 1I7TB 3ETBF 1YEJH 2LTQC 1UWEL 3PWUB 2ARJB 2QSTA 3P30L 3QEGH 2W91A 3AS3A 5GGVY 1I3UA 1MEXH 4PG9A 4UV7L 3BH8B 4NP4H 4JFYB 3W9EA 2PO6B 4F7EB 2HYMA 1UCBL 1Z5LB 3H7BA 1LO5A 3BHBB 5I1DB 4WFHE 4LQ1A 1FFOA 4KROB 1MRDH 3RNKB 4P5KA 4TUKL 4KUZH 3P40A 4ZMAT 1KJ2A 1RUPL 2QBWA 2RCSL 4KHXH 4NZUH 5EC2A 3NCYP 4MNHA 3H9HB 1W0VA 2YC1A 3K4AA 5IW1B 4PJBF 4WWID 1QBLH 5GZNC 2VDML 3VGFA 3NA9L 1JNLL 4LCUB 3P77A 1T7YA 3BDXA 3WIIH 2QSCH 4DKEH 2BC4A 1FVDA 5CGYD 1QRNB 4EI5D 4RDQG 2UZYB 4LMQI 3LEYH 4KTDH 4R7NB 2YD4A 4GAYB 4PJXE 4C58B 2GJZA 1CE1L 2ORBH 2CLRA 1CL7H 5DA4A 5DEZA 4HD9A 1NBQA 1UGNA 3V7MA 5J11B 4ZS7H 5KSAB 5D9SA 3KPSA 3BPCB 4ZDHB 1MHPL 3SDDB 5HHME 5DMGD 4X5XB 3RIAF 3N06B 1CICB 4Q2ZA 1N0LA 5DLMH 4OZGB 5D7KD 5C0AE 3KG5A 2FIKA 2AQ2A 1XGUB 2NXZC 4HDIB 4GOSA 4C4KT 3T4YB 1X6LA 1FG9C 1ZHBB 5CLTA 3KPLB 5BS0A 5E2UL 4FQCH 4P5TC 4PJIF 4TUOB 2R8SL 3LEVL 3HNVL 5T3XL 1HYSD 4R0LA 1NSNH 2MOVA 4KZDL 5DJDB 2P8LA 5KOMC 1WC7A 2XG4A 2DJ4A 3RI5K 3VD9A 1AGCB 3MLSH 4I4WB 1YEEL 3MV9E 3GRWA 2B2XL 4FQXD 1QLEH 1DLHB 3TV3H 3ARFA 4M3KB 4ZTPH 4U6HB 4JM4L 1VSCA 5DGQA 5B39B 4PGCB 4QRTA 1MCOL 1KT2A 2P24A 3W5NA 3B4NA 2P5EA 1YPZA 1S5IH 5EOQH 3KPOB 4Y1AD 4JDTL 2XZQL 2FD6H 3P4MB 4XBPA 1AJ7H 1M05B 2JTDA 3KPMA 1MRFL 1VPOL 1OAZH 3PWNB 1U58A 5BO1H 1BIIB 4M1CD 2G75B 3JWDC 2RB8A 1HHIB 5E00B 5TDOA 1AIFB 3UAJD 4OGYL 3JTSB 1BAFL 3PHQA 2DLFH 5EBWA 5EH1A 5D1QD 2MMXA 4XGZB 2GK0B 3QRFM 3QPXL 4LHUA 5BCAA 4P9HC 1J8HE 4J3WA 4O2FB 2DQTH 4KU1A 5IJVA 1ZGLA 3IAGC 4NO0A 1R5IA 4XNYL 3NOIA 5B38B 3L3OB 1UQSA 5JHDD 1O0VA 5I71B 1GAFH 4MJIB 1CFBA 3NCJL 3VI4E 3S36X 1JGVL 1CT8B 2Z31B 5E56A 3MLVL 3ILPA 1CVRA 1BHGA 4X0KB 2I9LA 2IG2L 4JFEE 4ZPVA 1ODAA 2F74B 5FM5O 2ZOKB 3E3QA 4XH2A 2Q7YB 5CWSB 5DUPH 4MQ7B 4JG0H 3UEZA 3FQTA 4KXZH 3U1SH 3QQ9D 3OKDA 4MQTB 1OSPL 3V79C 4JB9H 1WBXA 3LN9A 5T3ZL 3AS1A 5HVWA 1J1OH 1UFUA 4P2QD 5C7XH 4WUUE 4XTRD 5LCVL 2QQNH 1OSZB 1QO3A 3QNZA 4M1GL 1MUJA 3FO1A 2YBRB 3VW3H 4G6FB 4UILH 1VACB 2RR3A 5FOJA 2BVPA 2AXFA 2Q6WA 4LHUG 3KWWB 1AGDB 4FTVE 5TFSL 4NO0D 1P7KA 3CX5J 4U1GC 5JQ6L 1WWWX 1PSKL 3UC0L 2MCG1 4LVNC 5D7SH 5JTWA 5CEZD 3AS2A 5JHLL 5LGHH 3QRGH 3PJSB 1A4JB 4J3OC 4R4NC 3TN0A 1P2CB 2P8PA 1JGLH 4P2RD 4XCCL 5GIRA 3RVUD 2EDQA 4XPBL 5BRZE 4V1DE 4HIXL 4OT1H 1ES0A 3OAZH 1DQML 5FKAA 4DWHA 3HAEH 3WCYA 5M95B 3TIDA 5I17B 3U7WL 3UO1L 3HS0A 4GG6E 2FO1A 4NKMA 2R0WH 5CBEA 4W68A 4X4XB 1N59B 4DTGL 4GSDH 4LDOB 5IVXE 4PJIB 3HN3A 5KS9F 1A6UL 4JY6B 1S9KC 1HK6A 4M93C 1T89C 4YDJA 2OZ4H 4HG4J 5KW9L 5LKNA 2AJUH 1Y18A 1NBZA 2Z92A 3A6OA 4RISL 4YE4L 4ELMA 3KLAB 2FHBA 1KJVA 4UNUA 4NKDB 4E42A 3KVQA 2VITA 3TBWA 3BVNA 2H8PA 2HT3D 1Q9OB 3TIEB 2F54E 4HK3J 3ZT6A 2VDOL 3QI9C 2NY4C 5ITFB 4ELKB 2DMKA 4MJ5B 2NXYD 5JMOC 2C3VB 1RZKL 2VE6B 5TQ2L 1EMTL 4E9LA 2CLZA 3FCTA 5IBUB 2CIKB 1ZT7A 4ZFOB 3I2CL 15C8H 3F7PC 4BSWA 2AJVL 4PBWD 1CR9H 2JB5H 2XWBB 1UJ3A 3D1MC 1P4LB 3RVWD 3I50L 3PIQB 1MREL 5IFAL 4P99A 5MI0B 2YKLL 5GGVH 1PKQE 1UEYA 4I1NB 5DS8A 4XNXL 1B4JL 4Y5VB 5E6IC 5F71A 4L4TD 5DQ9A 5F1IA 3MRMB 5DMJB 5KG9A 4I77H 3T4AB 1CDCA 3MRLA 4AJ0A 1OB1A 4G80B 3EOTL 4BH7A 2Q87A 3HG1A 5LBSH 3MJ6A 4LCWD 2AVGA 2J2ZA 2X4NA 3EYVA 4DFHA 2FSEA 3SDCB 4G9DA 1G6VK 1YEDA 4Y5XC 3QUYA 4QTHB 5CCKH 3DBXB 3GIVB 1I1AA 2FGWH 3DMMC 3LY6A 3ES6B 1T1YA 2D7NA 2OCFD 1UWGL 4TVPH 2DL2A 4MLIA 4TTDC 2LU7A 1NLDL 3QH3B 5DEGB 1T1WA 3P0GB 4QHUA 5ABDE 4NQVA 1YMMA 3ILQC 4ODUB 5E24E 5HGDB 3W0WE 2UVFA 4Z7VA 5HI5C 5I1KH 4WFED 1NAMB 3T3PE 1H3UA 3HHRB 3VXMD 2A1WH 3RWGB 4I9WD 4RFOH 2DQUH 4ZTOH 4NN5C 1OAUH 1T7WA 1BP3B 1KB5H 1D9KB 1QQDA 5FXCH 1N5YH 43C9B 4BZ1H 4JO3H 2EIZA 1CFTB 2B20A 3WE6B 4JHWL 2QEJA 2OX5A 1JFQH 2DQFA 4OLWL 5A16B 1WIOA 4M62H 4ODTL 1GVIA 3L3DB 3TCLA 3QUYD 3B2VH 2XQBH 4QHMA 1MAML 3BN9C 2VLLA 3CSPA 4KK8C 3DUUB 1ZWIB 1YEKH 5BVJA 4XPTL 4JRXA 5FDYA 3WUWG 4JKKA 3WJLA 2QQQA 3QB7C 1F97A 3QCVL 4NUGH 4D3CH 1UXSB 4ZSOA 2VLJD 4N8CL 5ILTL 4U1JB 43CAA 2OXHA 2WWMC 1GHFH 3DO3A 2AEPH 5KS9B 4XHJC 5I16A 2FB4H 2W60A 1CLYH 2ADIB 3H3PH 4DK3A 3ULVF 3B6SB 1RU9H 5F1NA 1NAKL 4WVRA 2HJLB 1QP1A 5JR1L 2O26U 4S1SL 2OMBA 4F37F 2GK2A 4NQCE 2HVJB 4X6FA 4WHCA 2E6JA 3Q48A 1KENL 2DQJL 2Z35A 4G8GA 4BQ9A 3WN5B 3MMEB 3LDBB 4GQPH 5J6GB 1VEMA 2ZZUT 2DI7A 5KVFH 5C0DB 1MH5A 2DYPA 4U1LA 2R23B 3TVMB 1PYWA 5FK9B 4Y4HB 5E6ZA 4NBYB 3GM8A 2NW3B 2CQVA 3WNKA 1J18A 4LLWB 8FABB 4RMSA 1WIUA 2FX8L 3DV6A 5ANMA 2A6KA 4U0QB 1X5YA 1FFNB 5L0QB 3PHOB 5J6HA 3R0MA 3DVIA 3K74B 4N0CA 1KELL 1NL0L 5IBTL 3TM6A 1JPSH 3THML 2BZDA 1BFOB 3BIAX 5JW4Q 1MFBL 2NLJA 1PG7X 3HPJB 1RUKH 5E4IA 4O58H 1SHMA 4F7TA 3B5GA 5IR1B 4JFFE 3PWLB 1ZA6B 5T1DH 2OL3A 2X42A 5IQ9A 5L88L 4OZHF 3TEUA 1Z0MA 3ARSA 3NABL 4M5YL 3FB6B 3D9AL 5DJAB 4UDUB 2HTKC 2JLLA 2Y5TA 3MLZL 4POZD 5KSBE 3S88L 4MZ3A 5C0RL 4YFLI 5D1XB 3VWJA 2UUDH 1FN4A 3PQYD 4OLUH 3LKSA 1I7RB 3RWFA 1U3HA 2Z93B 3IFLL 3RDTA 4C56E 1YJDL 4QOKB 1Q0XL 4RGOH 5E94B 4OV5B 1DL7H 3P11L 4MDIB 4LF3A 3GBMH 1GGUA 3O2DL 4XVJH 2P7TB 4OLXL 4LSTH 5T5FH 3FAWA 5E5UB 3ARYA 1MFDL 1MLBA 25C8L 1YZZA 3CLFL 5GS0L 3MJ9A 3K80A 5DC9B 4HAFA 4E5XB 2OJZL 3DVFA 1G7HB 2R1YA 3OR6B 2G2RA 1KLFA 3IXAB 5GGRY 1IKFL 2X70B 3HPLB 4XXCC 5F70A 4G8EB 1S7SB 4U2YA 4XNMB 5C07E 3UTQB 4I0PA 1UM4H 4A6YH 4IRZH 2NZ9D 5TH2A 3VFVB 4F7CB 1E4XL 1I8KB 1ZGLP 1XF3A 3JWDH 3CFEA 5GISL 1NCAH 1K2DA 1X9QA 3GSVA 2COQA 4TPRL 2YWYA 1RZKC 3T04D 4NQDE 1IRAY 3WIFA 4XCEB 4WW2A 4EQ2A 5DO2C 1QLRA 3Q0HA 4H25B 4P9HH 3TFKC 5H8DA 1HH9B 1KPVB 2XZZA 5I8CB 3HE7C 3KYNA 4LAQL 5DK0B 3RDTD 2PF6A 3CCHA 1M7XA 5HHOB 3OAYK 5FYJL 1IE5A 1MSPA 1U6AH 1DANU 1G7JB 2ZPKL 1RIVH 1D5MA 3AREA 4OKVA 1NUGA 1RURH 4EN3C 4CBPA 1H8OA 1SJHA 4TSAH 2X4QB 5FFLA 3GUTA 1CFQA 4D9QD 1M6OB 2HJFA 4MD5A 1IC1A 4QEGA 3O8XA 4R97B 3V0WL 2DAVA 1U3YA 3D3VA 2IBZX 4PRHD 4U2ZA 1H3VA 3RU8H 3D18A 1QLFA 5SWZB 2EYTB 4NRZB 4F9PC 5IG7B 3U2SA 5I18L 4HUUB 3VXUE 1MHEA 1JYNA 1P7QD 4JDZB 5D7JA 4ZOEA 1U93B 1NDMA 4HH9A 4XP4L 1LGVA 2XYCA 3QG6B 1F11A 4TNVK 3CK0L 4ZFFA 5GJTL 3CFBA 1RUML 3QDJD 3D69A 3KYOB 4CJ1A 1AY1H 4IDJH 1G7LA 2UWEE 5BW7A 4I3GA 5FUOL 1MLCA 2CXGA 2B5IC 3OAUL 2F53D 4UQ3B 4JM2A 4N0RA 5DTFB 4LSUL 1KIQA 4L4VD 1OP3K 1AO7B 1CDIA 3C60C 3SBWC 4X7SL 2PXYB 1LEGA 3DARA 4XP9H 2OJEB 4NGHL 4OZHB 3BZ4A 1KLUA 1RUAL 1SJEA 1UWEH 5MEPB 4PJXA 5J9PB 4UAOB 1Y6KR 1L4IA 3WLWD 4UV7H 1PGRB 4QY8B 2FO4B 2X9WA 1I75A 1UCBH 4LKXA 5C09B 2RFXA 1NLBL 4PJ5B 1FNSL 2OTWB 4DZBB 3RWIA 5HHMA 4TUKH 4P2OB 4PJCA 2PCPA 1FCGA 3BEWA 3KPNB 5T1LB 1RUPH 3V6OC 2Q3ZA 5CD5D 3C09C 5C0AA 1ZT4B 2RCSH 3ROOB 2JKXA 4YXLL 3G5YB 1SEQL 1E0OB 5DJ2A 4KGJA 5D96B 1RJYB 4TVPE 1CDBA 3DO7B 1HI6B 2VDMH 3BESR 1JNLH 2X1QA 4X4YB 3LN4A 4PJAE 4HH8A 4P49A 2GCYA 3GSQB 3V7AE 1DQQB 3ARDB 5MHSD 2AGJH 3KPPA 1HKFA 1WISA 2OSLB 1JZ7A 4JZNA 3ELAT 3C6SB 1CE1H 5E8PA 2CUHA 4GUPA 2W65B 5D6CA 3MREA 1EDQA 2XTJC 5EPMA 3U6RA 4XCNA 5DJYA 4X4MA 4ETYA 4HZLA 3TF7A 2YOCA 1TQBB 3BEVB 1T04B 5ICXA 4MD4B 5DJ8A 3PNWA 4KKLD 1NGYA 5DI8A 4OUOA 2J6EL 4AEIL 3NN8A 4MNQD 1EZVX 2JCCF 4LP4A 1GXEA 2FJHA 4M6AA 5E2UH 1YECL 1MCFA 3OJ2C 4D8PA 2R8SH 4UU9A 2J5LC 3LEVH 4RGMC 3HNVH 1R5VA 4LAJH 1J8HA 5T3XH 5DJXA 3A67L 3FKUS 4Z8FL 2BSSB 2KKQA 5J1AA 3GI9L 4MAUL 3GMMA 3OKKB 4L5FL 4KZDH 4NQSA 1JGEA 1YJDC 3MCG1 3NGBC 3VWKA 2APXA 4XVSL 4MX7A 1YEEH 4ZS6D 2B2XH 1BREA 4FHBD 4MXVF 1YPZF 3O3DB 2VSCA 2EICA 3BXNA 3SKMA 1KC5L 4JM4H 1OPGL 3RL2A 1G9ML 5GS0C 2XZCL 1MCOH 4JFEA 3U7AA 3OMZA 1WTGT 4NQUA 5BXFA 5JORB 2ITCB 2A74A 2HA1A 2KPNA 3VJ6B 3F7QA 3N0PB 2O5ZL 4JDTH 2XZQH 4EI5B 5IIEB 5HD8C 1MRFH 2HFEA 3QUZD 1VPOH 5C6WH 3WV0A 3WS3B 2XZAL 4BELD 4ZOAA 4ZUTA 3DURA 2V2WA 2YD1A 4WUUA 4OGYH 5F21B 1BAFH 4J7RA 4Y2DA 4LSRL 5FO7A 1YN6B 1LO5B 2PW2B 3QPXH 4ZFOL 3UTTD 4FTVA 4U6VL 1EO5A 2VDRL 5I30L 2YPLE 2W9DH 1KJ2B 1KXQE 4XNYH 3SGKA 5F9WB 5EC2B 1UH2A 4MNHB 3NCJH 4RAUB 1W0VB 3ARUA 4PTUB 4ZOCA 5GGSA 1JGVH 2A38A 4BFBD 1PW3A 2WSKA 5I1EL 3TPUE 5BRZA 3MLVH 1K5NB 4V1DA 2BP3A 2IG2H 4G7YL 5J11C 3EDKA 1JZ6A 5JW4N 4K7FA 3CFDA 4MXQD 1CN4A 4GXVL 4OM0L 2CH8A 4GG6A 1PZ5A 4XZUB 3SDDC 4NSKB 5HGGS 2YRLA 1A02N 5ALBL 3U9UB 5D1ZA 2V9TA 1MCBA 1OSPH 3SY0B 5T3ZH 3ULUD 2DWEB 4L8DB 3QAZB 3SKOA 4WFFE 3L7FA 4MB4A 5LCVH 4JAMA 4FQXB 1TMCA 4M1GH 3PP4H 2P45B 1DN0A 1CTNA 4LGRB 3BFOA 4X6EA 5TFSH 5DHVA 4MCYA 4LNVA 5EORL 5AAMA 1PSKH 2F54A 3UC0H 3O45B 2IFGA 2NNAA 1PVHA 3LN5A 4ONFL 1CF8H 5ECJE 4Y1AB 5JHLH 2A6DA 1BOYA 1N4XL 1ZLUK 1ZEAL 2X4SB 1UB5A 3K4ZA 4I0KA 5BRZD 1U8PA 5K59F 1G7QA 4XCCH 4XPBH 4HIXH 5FYLL 1RZ8A 2EDTA 1DQMH 5HVHB 5D1QB 2K3TA 1UG9A 1S5HB 4HGKC 3U7WH 3UO1H 3P9MB 1PKQA 1A14L 5D1ZD 4DTGH 3O4LD 2P8LB 1A6UH 3MGOA 1DUYB 2Z91B 5JHDB 4I2XE 2BJML 2X4PA 5E8NA 4K8RL 5KW9H 4KRNA 4Z7UF 4YE4H 4QRTB 4RISH 1N2RB 4JO4L 4V3EB 1OTSD 1C5CL 4XAKD 2O5XL 2R39A 4NNPL 3BQUD 4KKCD 3VCLA 1YPZB 5JNYA 3QQ4A 5CBAA 4X7TB 2VDOH 4PJFE 1X3DA 3KPMB 5IROC 1U58B 1RZKH 4Z6AT 5JW3L 1EMTH 1I3RA 4ODXB 2D31B 5I1AA 4LK4A 5HDQL 4YFLF 4X6BA 2AJVH 2Y6SC 5EBWB 3W0WA 5D70L 5LAXB 2Z31C 2BNUB 3I50H 3QDMD 4V2BA 1MREH 1FVCB 5IFAH 2XWTA 3IRPX 1AD9A 5IJVB 2YKLH 1ZGLB 4NO0B 3TH3T 4XNXH 1B4JH 2X89A 3PHSA 3OGCA 4P2YA 1UQSB 3T65A 5ETUA 2QKIB 3EZJB 4PLJC 1X4XA 2ZUYA 1G6RB 5CSZA 4PTTA 4P2RB 1HNFA 3EOTH 4M00A 3S3JA 3MCKA 1FGNL 5I76A 2JIXD 5H35B 4O2EA 1P6FA 3V8CA 3ZKND 2DJSA 4K55A 4O2CA 1UWGH 4HBCL 3F5WB 1WBXB 2HRPL 1FL3A 3DYOA 1NLDH 5GQBA 3RWCA 4FQ1H 1E4JA 4HS8H 4CW1B 5A2KH 2DIAA 4KDWA 1XGTA 4NT6A 2AXFB 3PV7A 5LGJA 4QHLB 5GRWA 3SO3B 4D9RE 1WFTA 4JZOA 1PDKA 3PWVB 4NQCA 4FS0A 2FZ3A 2JJVA 5CIPB 3X3GL 1N3NB 3PF2A 3JTTB 1BZ7A 2NXYB 2ITDA 3TESA 4X98A 3U46A 4JHWH 1G9MC 1ITCA 4PIRF 2YA1A 5DZNA 5AEAA 4OLWH 4ODTH 5SV4A 5F3HB 3R0NA 3FMGH 4YO0A 1KIRA 3I84A 5GJSL 1T22A 4G6AD 1MAMH 3MRCA 5CBEB 3IDNB 3QPQD 4J6RL 1LK3L 1KBGL 1ETZA 5IB3B 4XPTH 2FWOA 5FF6A 3QCVH 4L4TB 1FE8L 2AKRB 1KF9B 3QIBA 1DUZA 4OUUA 4N8CH 3QDHA 1RK0A 5ILTH 3BPOB 1X5IA 4V3DB 1MJUL 4JQVC 1NGZB 1IQDA 4HUXB 4XMKL 4JHBA 4APQD 4JFFA 1N6QL 1S7UA 3ARBA 3L6FB 1NAKH 4Y89A 4LCWB 1FL6B 4PUBL 4Z7UB 4I48A 1MJ8L 5F7FA 4S1SH 4BSVA 5JR1H 2H2PD 4M03A 1FO0A 1NBYA 1P53A 4L3ED 4AM0A 5HHPB 5KSBA 1KENH 3RHWF 3PABB 5T3XE 3HMWL 4PRDB 1NGXB 5CZKA 2AJ3A 2I07A 4UDTB 4XI5D 3ULVL 1XCQB 3EYOA 1JVKA 4LLQA 3UTPD 4EBQL 3ARRA 1Q38A 3L9RA 4JR9L 2PW1B 4H5SA 5E5MA 2FX8H 3ALPA 3SDAD