3TN0A

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
293
structure length
293
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tn0A01
2IADA 1M1SA 1JYXA 1NDGA 2VN7A 3C6SA 2Q20A 5IVOA 4ZAKD 4M61A 2EEDA 4MCZA 1AGFA 2IH1B 4NZJA 4X5WB 3KS0J 2OS7A 2JCCB 5T1KD 5I73B 3ZKXB 5EUOE 2L4OA 3BUTA 4MNQE 5D8JH 3ARED 2D31A 4K9EH 3MJ8A 5DRZB 3TH2T 4YHMH 3UCRA 2FIKB 1G6RB 1UCBL 1U8IB 3QXWA 5D5MF 3WLWD 3ARBB 3LRHA 2BNQE 4IOFD 3VFPB 4I2XB 4JKMA 3VD3A 5JPNB 2HP4A 4JFFB 3HE7C 1ZLWH 5FHAH 5E2JA 1D5BA 2WW8A 3IT8D 1SYVB 3L1OL 2GSIB 4QEGA 2XTJC 3FRPG 1KN4L 3CPLA 3G9AB 4HS6A 4P57A 3QUKB 5I1JH 4BELD 5IVNA 1BD2B 3O4LB 3E8UL 4JFQA 2YPLB 2W60A 1G84A 3KYMB 4MA1C 1SJEA 3H9SD 3LKSA 1SEQH 1MCOL 4LF3B 4R4BA 5CGTA 4X4YA 1KTLA 3ALXA 3F7YB 1IAMA 1LILA 2Y07H 2YRZA 3NPZB 4GJTB 5IROC 4TVSa 2XZZA 2PO6D 4XPFH 2O93L 1E4KC 4WU5B 1JWSB 2EYTA 2NY2D 2OTWB 2YMXH 4FQCH 4RISL 1U6AL 1WV7T 4Q9CA 5IP4A 3HI6L 4M7LL 2JIXB 3DMMD 3PIQB 1GGIH 3MBEA 4AZ8A 4PJHA 4PJ8C 5EPMB 4AIZB 4GAGL 1OOAA 4JLRA 3RY6C 3FO1A 1P2CB 2PKDA 5J89A 5EZLA 3VFRA 3FHAA 2NQCA 3BHBA 5EOCL 4OB5H 2KZWA 1C7SA 2MQ3A 4AL8H 5KVEH 1CU4H 1WBYB 4PLJD 4R7NB 4HIIA 2NY4D 1BBDL 5GGTA 4TSAL 3ARVA 3BP7A 4CMHC 3BPLB 3DGCR 3MV7B 1G9ML 5IMKB 3WFDH 1HHGB 1X5XA 4PJEE 1DUYA 1XF5A 1JN6B 3VFWA 2H8PA 1QRNE 2OTUB 3CU1A 2LE9A 1VHPA 1BVLA 4GKSA 3TBYA 5AYQA 3D6GA 4UT7H 5IBTH 2H1PL 5IB1B 5F21B 3ZE1F 1QNZH 1S7XB 5I1HH 2FX7H 5ILTH 3UTTD 1ZS8A 3RL1B 1LDPH 4K55A 3IJYB 4KU1A 8FABA 1H0DB 3DHJA 1UM6L 4OT1H 4PLNC 3S98A 1KPVB 4WV1C 2GSGA 5K9QI 4X6CB 2M26A 2Q86B 1AFVL 1T7ZA 5DUMH 4D8PA 5MEND 2DQEL 4WJ5A 1KT2A 1A47A 4LCCA 1GZPA 1T03L 3JXAA 5D5MA 4OCWH 4Z7OE 2VDMH 2O5XH 4M48L 1F11A 3G5ZA 3C9NB 1OQXA 3TBWB 3OB0K 1TENA 5D1QB 2ZJSL 2EO9A 4OF5A 4DN3L 3AS1A 4V1DA 2WBKA 2CK2A 5EO9A 1FNHA 5EBLB 3VH8A 4NNPL 1JPTH 3V5DB 1IT9L 2YA1A 2LTQC 5C0JB 4WFFD 2YEZA 3QWOB 2DMKA 1UXWB 2X41A 1D5MA 2UZXB 3CVHB 4I0PD 1YJDC 2N7AA 1QLRA 5IB3B 3VFGL 3W2DH 5L2KD 2HFGH 3BE1L 2RFXB 3E6FB 4L3EB 5DMKB 1QR1A 3ZDXF 3QI9A 1C1EL 3QUYC 4OI7A 3EO1B 2YPVH 5K59E 1B4JL 1PLGH 3EOTH 1EX0A 4MGXA 5HHOA 4UI2A 4XNZC 5C6TH 5T1DL 5EA0H 4HWEH 3RVWC 4JJ5A 1FLRH 4W4OC 5HBBA 4PV8A 3KPSA 3NN8B 4KMQA 5IESH 3K74B 4HWZB 5C8JA 1H5BA 4P9HH 3MTRA 3QRFM 4ZD3L 5DQDH 4XXDB 5I0DA 1A1NA 2XZQH 1XAUA 2CRMA 3SOBL 5DO2D 1CD9B 2CDGA 2O5YH 2XRAH 2OR9L 3MZGB 4HK3J 3DUUB 1MJ8H 3I3BA 5HI4C 4ODSH 1T0NB 4G9FD 1ZT4B 3WIHL 5E6ZA 3IAQA 4RWYH 4PRAA 1T2QL 4NO3B 1IGFH 3EFFA 1MNUL 2X4QA 3B9VA 3ES6A 1KJVB 1TZIA 3EJJX 3KG5A 3O3BB 4PRHE 5I8KH 2EH8L 4GKZB 4RFOL 5D7LB 3I6GB 5MEQB 1M6OA 2B2XL 3DXAB 4JFZH 3L9RA 4LHUG 3EO0A 3MNVB 4DKFL 3MLVL 1T4KA 4K7PY 4K23H 3TVMA 4MD5A 4BM7A 2F19H 3OHXB 5C6PB 4F9LA 3VRIB 4ODTL 1CD1A 2HT4C 1NJ9A 3P0YH 4R2GD 2R0LH 5HGGS 1HNGA 3V0WL 2YD9A 4HPOH 4F7MB 1T1YA 2PUQT 4RA0C 3HNVH 4RDQF 2ZCLL 4NOFA 5T5NF 3TPUA 3RWIB 3DV4A 2NPLX 4EI5C 3DV6B 4FZ8H 1QHOA 4HIHB 4Y4HA 2GITA 2VQ1B 4XCFH 4XBPB 2B1HH 4BH7B 2AEWA 5FUCE 4NCC1 4ONOA 4D2NA 3ETBF 4OCLC 5ADPL 3NABH 5DHYA 4YDIL 2ZCHL 3RWJB 4LFHG 3O3EB 4OSUH 4WY7L 4U1NA 2BX5A 1OAQH 5HHPB 4P49A 4YGVB 4KI5C 3MLXL 1YUHA 2KZ1B 3CDFA 1FGVH 1EEZA 5KANI 2X4SB 2HFFB 1VERA 1EZVY 1KCVL 1FFPB 2ITDA 3MODL 4M5ZL 3U4BL 3DETC 4A6YH 1U8NB 1JRHI 5JW4N 1FPTL 1I9RH 3OL2A 4XBGA 4M7KH 5DMIL 3BGFB 3JWDC 4DGYH 3CSBA 5HGBB 3CUPA 4QOKA 2EDKA 3QULA 4KK6D 4PJCF 3IFNH 3VRJB 4CU8A 5GRVK 5D2NB 5BO1H 1DVFA 2O26U 5C9JA 4W68A 2VLME 1P7KB 1MFAH 5DFVC 1TDQA 2GHWB 1QSFB 1ORSB 3SCMC 4KWUA 4PJDF 4JQXA 3HE6C 2AAVA 1VFAB 2ADIB 5DF0A 4UT6H 2W9DL 4N0UB 3V95A 5D70L 3TT3H 3QHFL 2P5ED 1HINL 5EO1B 1V7MH 4KHXH 3FFCB 1EFQA 4LCYA 3WFCL 3H0TA 5BS0A 2NLJA 1A2YA 2JK5B 1HXMB 4P2RE 4P5TA 1KSRA 5E94A 4G6AC 1Z3GH 4LAQH 4Z7WB 2QSVA 3TH4T 3RWFA 5FB8A 1IEHA 4QRRB 1OD9A 1KGCD 3QH3B 1J05B 4YBLC 5FK9B 4O51B 1KB5H 2VN4A 1U36A 1R0AL 2B4CL 1J87A 4G8GA 5BOZG 3N1PC 2UYLA 1CTNA 4LLVB 4YGAB 4NRXB 3RNKA 3BP6A 5BV7B 4PR5B 5C0RL 2AI0L 2NY6D 3RWEB 2CLVB 4YX2H 3QJFB 4NN7C 1AH1A 1NMBL 2XY2A 4GRWE 3TNNA 3KYOB 4NKMB 3VXUD 1FNGA 3CFJB 4KY1H 3VXSB 1VADB 1X4YA 4MQTB 2MPAH 3QJHB 5F70A 5D9SA 1F90L 2JE8A 3QG6A 3W11C 4L5FL 4YDJB 1C5BH 4CVUA 1EFXA 2ZUWA 1MVUA 5DK2A 4LSTH 3FQUB 1AKJA 1ED3B 3V6ZB 1X5IA 3LPWA 2NY7L 4GG8A 4MJ6A 4MXQD 2E9IA 5IEKA 1IGML 2MTPA 1L7IL 3DYPA 1MCFA 4W6XB 1MIEH 3DUSA 2V2TA 2UY7A 2A6JA 1SM3L 4POZC 5CSGA 4P2QB 1FYTB 2JB5H 5TE4L 3T0EA 3U30C 5C0AD 2VISA 1G0YR 3CD4A 4EZMA 2XACC 4ZFOB 1TITA 2VRAA 2Z8SA 4PJCA 1DBMH 2FRGP 2DQCL 4PDCE 5ITBH 1TZHB 2BNRB 4XPAH 3GIZH 5I16B 4TVPE 4WHYH 1DQML 1IGYB 4QXTA 4FFYL 4PJDA 3V8CA 1IM9B 2ZNXA 2CLRA 1Z2KA 2UWEB 1UJ3B 4O5LL 3GKWH 1ES0A 3CFIC 3MACH 5IWLC 4Z77A 3GSVA 4Y5XA 1JYVA 3SDCB 3N85H 4GW5B 4XCYB 1XF2B 1X7QA 3VCLA 1T1ZB 5F7DB 4NQDE 5C0BE 4DCQA 2Z93A 3ZKXC 4C59B 1N6QH 5I1GL 5IVXF 1Q1JH 2F53E 1B0GA 3BYYA 5CINL 1GH7A 2X89D 3PWVB 4O2EB 4E41D 2V9TA 5A2JH 4Z0XA 3VE0B 1MCWW 3WDHA 4KRMB 1T20A 4R4FL 5SWZB 3OAYH 4DJMA 3KLHD 5ESVB 3BIBX 3CH1A 1MQKH 3JSSA 4XZUB 3MRIA 3O4OC 1B2WH 3WIHA 3T4YB 5IOPB 4GXVL 1A6AB 2PYFA 3QDMA 4PRIA 4E0RB 4RFNC 3MR9A 1KLFA 5GZNC 4X6EB 1MF2L 4OCNC 1LEIB 4K3DH 4P46A 4RGND 5FYKL 2OJZL 4PRPB 1FL6A 2R2HB 3ESUF 4XP6H 3HNSH 3WDIA 1JPGB 3V4VL 4LSUH 3O3AB 3U0TB 1A6TB 4JDTH 1J1XH 4NIKB 2EZ0D 4U0QB 4M4RA 2CO7B 1Q9WB 1RUPL 5C08E 1U93A 4HIXL 2AJVL 2VJXA 1XF3B 2MCG1 1BZ7B 4FMKA 2JJSC 1CYGA 2QQKH 3CJJA 2VLRD 3GHEL 3IDMA 5E5MB 3BAEL 3L5IA 1YC7A 1S5IH 1J0JA 4D0CA 3LV3B 1P4IH 1NC4B 1J1PH 3U9UA 3BQUD 3BP4B 3C87A 1Y6NR 1A5FH 4K94L 3D3VB 3KLAB 3WNPA 5J56B 2YA0A 4M1GL 3MRCA 1VFBA 4F7TA 2KQNA 1RURL 2VLJB 3G04A 4BSWA 1KJ2B 5ICYA 4BH8B 1O7SA 3W0WA 3QNZA 4O2CA 4U0RB 3ECBA 5FYJE 3BT2H 2CIKB 1VEMA 1Q9OB 4DUVA 2RIKA 1MRCL 3P4NB 5TDPA 5JOEA 4XMKL 4G6MH 2CKNA 3K4AA 4KH2A 3SDYH 5LXGL 2W38A 1INEH 1IC5H 1CDGA 3BWAA 4NQCE 2HRPH 3WLBA 5B8CA 1ZK9A 1UB6B 2BXYA 1ZTXH 4M6MH 1K5NA 3IDYB 3MRBA 3FB8A 3DVNA 1BX2A 5EOTB 5IVXA 1L4IA 5MERB 2FLBT 2F58L 3DVFA 4KTDL 2B1AL 4HULB 3MGOA 1WVZA 2WBWB 4NWUH 1KIPB 3G08B 5GS2D 4F37F 4ETYA 5J13C 3MV8A 4QO1A 1J12A 3MRPB 1ACYL 5ID0A 5FGRA 3RX8A 1GHFL 4PD4K 1IL1A 2AQ1A 5DHVH 1FN4B 1SMOA 3MPCA 3RVUD 2BOCB 1CG9A 1MFBL 4RX4D 4BUHA 4R9HA 5D1QC 4EVNA 1S78C 3T1FB 3VU2A 1ZHBA 4OZFH 4HQQH 4U7MA 1RZGB 2BSTA 5DJ8A 5D96B 3HZVA 3T0AA 5BJTB 3H9HA 1JNHA 1VENA 3ZT6A 3EFDH 2I9TB 3CZFB 5JQ6H 5DQ9A 3GRWH 4AMKL 3Q6FB 5TH2A 3RKDD 4HUNB 3CSYB 5I17A 1JFQH 1I3GH 4WFGD 4UTAL 4JFPB 5E6IB 4OIIH 4ZUTA 5MENB 5MI0B 2DD8L 1NFIB 2FLRT 4KRPD 1EVTC 4L8BB 4QRSB 1BQHG 1WEJH 4UUJB 4WVRA 4NZUL 1FIGH 3P9MA 1S7VB 2WV3A 4ZNEE 4F7PB 2H32B 1IJ9A 2R56H 3WN5B 4J1UB 2VH5L 4XP9H 1H3VA 2DJ4A 4XX1G 2X7LA 3UTSA 3LEVL 3EO0B 4KXZI 3M1BA 1IAKA 5DK3A 1YEEH 4WO4C 3MRHA 5HI5C 1FVCB 3MRGB 2Y5EA 3FRUB 1HHHB 1HOCA 1L9MA 4APQB 1DEEB 3WUWB 4ISVA 3O2WL 1CFQA 3MRMA 4KTEL 1J9CT 3O9WD 4PY8I 1FP5A 2BVEA 3BP5B 1OGAE 4I0PB 3V9FA 1QFPA 5E2TH 1RUAL 2BNUB 3QDJE 2IQAA 3KS0H 1JHTA 5DVOA 1AP2A 4NRYB 1OTSC 5D6DA 4PGBA 1JE6A 3MRRA 4Z6AT 4LLMB 5CD3B 5BCAA 2EYRA 1MI5D 4PGJA 4QRPD 4YHLH 3WXVL 1JGVH 5H2BB 4OFYA 4XRCA 5D2LE 2YXFA 4LLQB 1UB5B 1NUFA 1FRGH 1UADC 4L9LA 2YA2A 1MEXL 3D0VB 1CFNA 3ILQD 2B39A 4BKLB 5J0BA 3EYUL 1KYOJ 1Y6MR 4KKLD 3ZYZA 2I5YH 4GO6B 1NCDL 3VRLE 3WS6C 1LEKB 4MNQD 4JRYE 2CSPA 3VXOA 4JAMB 4JKPH 3IDUA 5SWSE 3ARGA 4X80L 3HMWL 4WU7A 4Y16C 5DUBB 4QRQB 3X12B 4XBGB 4KQ3L 1INQA 7FABH 4NC0B 1CXEA 3PHQB 3ULUL 2BSSB 3OR6B 4KKBD 2FWOA 2EDBA 2BNQD 2Y5TB 2A1WH 4MAUH 2GI7A 4Z95H 3C60C 4W6WB 1YDPA 4W6YB 1IARB 2NR6D 1KJMA 1ZHKB 4JN1L 3I6LE 2C7UA 4MVBD 4U1HB 1FYHB 1D9KD 3IU3A 4ODVL 4LVEA 5D72H 1HCVA 3RTQB 5FO8B 4PRDB 5CJ8A 4NWTH 4LPVA 1I8KA 5JUEL 1YN6B 1WZ1H 3WFZA 1ZV5A 3TJEL 4FQJL 3HAEG 3SGDI 3F7PC 1RZJL 2BFVL 2XA3A 3Q5TA 2ED7A 3UAJC 1I8MB 3U79A 1R5WB 1K8DA 1GGUA 4DOHB 1QHPA 3QEUA 5DK0A 5BS0B 2IPUK 5J12B 3CDGA 3FO2B 2NXYB 2EKSA 5D7SH 3N0PB 3KWWA 4HAFA 3NCBB 3GI9L 3UPCA 5IT2H 4DGIH 4HMEA 4XC3L 4DAGL 1L6ZA 3BGFC 4MNHB 4YPGA 3ISWA 2A6KA 3WIFA 5F3HB 3O81A 4U49A 4X7SH 4MAYA 5EH1A 5D2NC 5FA4B 4HBQA 4UILL 4XWGL 5GGRY 1MCRA 2A0LD 1GL4B 5DRWA 3BD3A 3C6LD 1EGJA 3REWA 1D6EA 1HEZB 3S5LG 5GS1B 5K93A 4JFXB 5GGTH 2X9XA 1T1WA 4MA8H 4JPKL 4Q9RL 2OYPA 2FX8H 4J8RB 4YHNA 4L8SC 4HS3B 5FHBH 1ACZA 4NNYB 4DEPB 3TNMA 2GAZA 4OZIB 4RZCA 4OCYH 1ODAA 3ARZA 4EDXB 2JJTC 2IAMD 5EUOA 1UACH 1CXFA 4HF5H 5JLZA 4FQIL 3VXMB 1JF1A 4MNGB 4U1KB 1QOKA 2B7DT 3ARTA 1VFMA 1OSZB 1R3IH 2GJZA 2R4SH 1AO7D 3U1SH 1V3KA 2HG5B 2Y6SD 4HKJB 5DMYA 5GRVL 3E3QA 3O6FD 3BIKA 3PDDA 4U3XA 1EEUA 5SX5H 5JZ7D 3MNWB 3WYRA 1YYLL 5BV7C 4F58L 5DD6B 4W81A 3GBNL 2C3WA 3AU1B 3LS4H 4M1CC 3S36L 2E7LC 2BJMH 1KJ3H 3TIEB 4JG1L 4OGXL 3GMQB 2P8MA 3QWQB 4XVSH 2ESVA 3PV6A 1PKQA 4YHIA 1J10A 2HFEB 5C92A 3H7BA 1RJYA 1GXEA 5B39G 4XVTL 1BIHA 2Z35B 3V7AE 4QXTB 1AQKL 3TA3B 1INDH 1QBAA 3MRDA 3D2UA 3KPRB 2H2PC 1Z0NA 4JPWH 3TO2A 2VDRH 4PBWD 3O11B 4P2OA 2WBJA 3RZCB 5JXEA 5F7KC 1F97A 1U8PB 5I30H 2NY3C 5DJAB 5ENWA 4R0LB 3MCLH 1MWAA 5C71A 5K9QG 1I9IH 1AHWC 3VFVA 4PGDB 5IFHH 5IHUH 2QSCL 5FEBA 1G6VK 2DBLH 3ZKMD 3ULUF 5I1DA 1MHPL 4JN2B 1WCBB 2R23A 4JCMA 4KKAD 5MP6H 4P3DB 2HVJB 3FHQA 3UYPA 1YYML 4ZSOB 4AQOA 1DN0B 4PRIB 4I18A 1FORL 3SJVE 1JZ3A 3IJSA 1FNEA 1KTDA 4ZUUB 3S96A 1QRNA 3O2VH 4PRBA 1OAXL 2XWBA 3D39A 3FQTB 5HPOA 1UJ3C 2FSEA 1JHKL 3TZVD 4JO3L 3HMXL 3H3PH 5GS0H 3TT1L 1Q94B 3V6FB 1N0XL 3ZT7A 3ZTJG 4LVHC 5A3ID 4N1CA 2YXMA 3O41B 3OAUH 4ZO6A 2YN3A 5E8DH 1TZGH 1NBYB 3GSOA 5CHNA 3P77B 2B5IB 1H3PL 5IJVA 5FYLL 3H2WA 4BK5A 1C7TA 3DIFB 5GS3A 4P23A 3SDAA 5D7JB 3U7YL 2PF6A 1CR9H 5SX4H 1T80A 1I9JH 4FP8H 4KKCD 4XNMA 1X5ZA 3D25B 2DQDL 1DUZA 2YUVA 4P5MB 3TYGH 3PGFH 5I1LA 2X5PA 1CFVH 4K2UH 3OSKA 5C0NC 2AJSL 4YDVA 5KSBE 1IMHC 2J3SA 4TSBL 3BSZH 4CL7A 4QNPF 5LQBL 5J57B 2W65B 5BW7A 2FD6H 5FGSA 2UVFA 5EFIA 4OI9A 5IV2A 3UO1H 4XMLH 1YEHL 4R6UA 3VXPB 4I3SL 3PQYA 3Q2CA 1A22B 2OX5A 1TIUA 1VEOA 1GGTA 3RGHA 1F58L 1LWRA 1KLGA 1P4BL 4PJXE 1IBGL 5F89B 4NQEB 1EMTL 1E28B 4JR9L 4RMTA 4HJJL 1CGVA 2O61B 3G5YA 5L88L 1YNKL 3OF6D 3HB3C 3MRBB 1OTTC 5ACZA 3WLWC 2YSSB 4L8DA 3CXHJ 3UJJL 2CXGA 4OZHB 1UCBH 1SEBB 2XTJE 3MOQA 4Q6IC 5FYKE 1S7WB 3LSOB 4WFEE 1NLBL 3N9GL 1KCKA 1Q8MA 5DWUL 1IKNA 1Q72L 1HHKA 5FA3B 3L1OH 5J3HD 1VA9A 1KN4H 1EJOL 3MBED 5I8EB 1IAII 2XZCH 1KBGL 3E8UH 3F8UB 1CFSB 3RVTD 3MREB 4G8IA 4OBRA 4JVUA 5FYJH 3KYNA 4LVOC 1G9EA 2NY2C 4IRJA 1MCOH 5E99L 3ZKNC 5IR1A 4G8FA 2R1XA 3IDYC 3IFPA 3DMMC 2X10A 4XH2B 1FZJB 3SGEH 1K2DB 1DJSA 2E3VA 4RISH 2YWYA 1FZOB 5ISZE 3HI6H 4JGJA 4M7LH 4PB9L 1Q0YL 2OZ4L 4QT5A 4ZUTB 4GAGH 3T77A 4HIEA 1ETZA 5TF0A 2V17L 1NDMB 2BMKB 1JP5A 4X7TB 1JBJA 3STLB 2NY4C 5IF0B 2YKLL 2H6PB 5EOCH 5DJYA 2NX5E 2ITCA 2DB8A 1AE6L 1LO2H 1BJ8A 4Y7MA 1BBDH 4TSAH 4NKOB 4XHJD 5KANG 1JF6A 2YUZA 5LAXA 5GGSB 3FMGL 1G9MH 3ROOB 1KC5L 4PY7B 1AGBB 2F54E 3CIQA 5EC1A 4ZUVB 2C3VB 4L29A 4H5SB 5T3XE 5ANME 2HT3D 1S8DA 3DOSA 5FDWA 3NCFB 3EKCA 4O4YL 3DI3B 4NFDA 4O9HH 5TDNA 2FDBP 3KLDA 3MRJA 4JM2D 5E6IC 1JUFA 5ICZA 3KPMA 1SQ2N 5EU5B 5MI0C 2ORBL 4X98B 5IB4A 4RGOH 4ZYKA 3GZKA 2DWDB 2WY3A 4V1DD 4YQXL 3W81A 1AFVH 1PG7L 3MGTB 2DQEH 4FZEL 3OKYA 3UTQB 3DWTA 1A7NL 4EUPA 1FVEB 3MRNA 4U1SA 3WN5C 3OBAA 4KK8C 1T03H 4LVNC 4LBEB 2YC1B 3G6JB 4YXLL 1E4XL 3OZ9L 4M48H 4QTHB 3KGRA 5CMAB 1KIRA 3UBXB 3HZKA 5EBWB 5CJ5A 4MB5A 5GHWL 2XNAA 2IAND 4APQC 5EU6B 3IDJA 3QI9D 4YDKL 4DN3H 5C09B 1CL7L 4BQBA 5JIIA 3L3DA 4N0CA 4ZFFA 4NNPH 1MRFH 3ZYJA 4I0PC 5F44A 1IT9H 3JWOC 2GJ6E 3WO4C 1H9VA 3BGAA 5KZCB 5IGXL 3KPSD 2BOBB 3D18A 4JRXA 3FN3A 2XFXA 3B9KA 3ZL4L 3DURA 5F9WB 2WAHA 5ERWB 4G80B 3VFGH 4F15B 3L3OA 2BDNL 1DQJA 1D5XA 1FG2A 4Z7UE 3BE1H 1N6VA 3PP3H 4NZTL 5EUKB 1UM5L 4HUUA 4DVBB 5ADOL 1B4JH 3OGCB 4S1QL 4D3CL 5KSAA 5CJQL 3QXAB 3FONA 5T1DH 3FO9A 1TCRA 1JIBA 4Z7NF 1N64L 5H37H 2Y36L 1TVDA 4HGKC 3IKCA 1FL5B 4ZD3H 3BXNB 2J88H 5HHQB 1VEPA 2G75B 3HMXA 4JFHD 2CR3A 5JDSB 3PWJA 1QBLH 3OKOA 5JHDE 1KELL 2DQHL 3WIHH 5HDOA 4X5XA 5HY9B 1S7UA 1T2QH 3QDGA 3SKUD 4G42B 2BHYA 1MNUH 3LIZL 4X4XB 3GJFH 1GC1C 2N1KA 3O0RL 4PJ5B 2X4NB 3ZDYF 1S9YB 3RTQC 2FGWH 1C08A 3GMLB 2EH8H 4NN5B 3HI1B 1LO5A 3VXRA 4RFOH 1JTOA 4FQXA 2B2XH 3QEGL 2HMIC 3S4SA 5JO5B 4Y4HD 4PJ7F 1FSKB 4DKFH 4PP1D 3MLVH 1H15A 2P4AB 4K9EC 4RMWA 2H26A 5J12C 5HTSA 1YPZE 4ODTH 1X5JA 4G5ZL 5EUOB 3FQRA 4IOIB 4MNQB 5FF6B 2APBA 5F7HA 4AQ1B 1IGTB 5CEYB 3NACL 1PSKL 1X5HA 3WD5L 4UNUA 4YXKL 3V0WH 5CZXD 1CE6B 3NVQA 3X14A 2ZCLH 1SMAA 5DHXB 5AAMA 2FX9L 4HAGA 2BNQB 3QUXB 3PWLB 3IXTA 5EU4A 3UTPD 1Q9LA 4YHPA 4WUUA 1I8LA 3FB6B 4CJ1A 3OXRA 5HYSA 5FM4A 3QUML 3HC0B 3JV0A 3DSFL 3BN3B 4F7EB 4KI5E 3GBML 5ACMA 1I1RA 4YDIH 2ZCHH 3MFFA 5DJZA 4LCWA 2N56A 4PS4L 3RHWK 43C9B 4NQDA 1FNSH 4WY7H 4QOKD 1S7RA 2FGZA 2EDQA 4HV8A 1JK8A 4YPJA 5F3BB 2Y7QB 5C07A 1J8HA 3MLXH 4JG0L 1DVFD 1QFWL 3ARUA 5DA0B 3W5MA 2ZWLT 1NCCH 2XWJA 1UM4L 3OMZA 4NQSB 4XNQB 3FAWA 1AXSB 3DBXB 4P4KB 2XPGB 1ZT7B 3NFPA 1KCVH 5CBAA 1Z9SA 3MODH 3IF1A 4NFCA 4M5ZH 3U4BH 5J9PB 1WSST 3MNZB 4FXGA 1T1XB 4N90D 4PFEA 1LE9A 1FPTH 1LO3H 5E8PA 1I1FA 2LU7A 2Z4QA 1RMFL 5DMIH 2X1XR 3KXFA 3ARFB 1BP3B 4P5TD 4Q9BA 3Q3GA 5D6CA 3P11L 1CD0A 2YHGA 4PRNB 4QHNA 5FCUL 4FTVA 4R3SB 3TFKC 5E2WL 4U1MA 3GMRB 3RJQB 3I84A 2CIIA 4HUWA 1DLFL 1MLCB 3CLEL 1VGKB 2YBRA 4PJEB 4MDJA 4G8GD 5FGBA 2OZ4A 1F3JA 2W9DH 5D70H 3QIWB 3QHFH 4PJ9A 1I3RA 1HINH 2F8OA 3WV0A 5DYOA 3IDNB 3T4AB 3WFCH 4PJ7A 1CGYA 3WNLA 2VDOL 4OD3L 2AXJA 4I9WD 5CEZL 3TBTA 3RZCC 3LQZA 4PJFE 1RJCA 2DQTL 1ZAGA 4WTWA 5INCB 3AB0B 35C8L 1S7TA 2NY6C 2A9NL 3LKQA 5CHNB 1R0AH 1I4FB 2B4CH 1DTUA 3FT4B 1A6ZB 1GGCL 1EFXD 4DQOL 1J18A 5B38B 1AKJD 1XGRA 1R3HA 2IC2A 5C0RH 1CDHA 2AI0H 3HR5A 2JB6A 1WTGT 1RJZB 4FQLL 1U95A 1NMBH 4ELME 1EVUA 3CU7A 5DC4B 3VFUB 5KSVB 3T0ED 4NQCA 2E5EA 5A16A 1W8OA 3BZEA 4LL9A 2BVOA 3MUGB 4L5FH 1IGIL 2F74B 2NY5L 2SEBA 4O58L 4O02L 1FE8L 3T2NL 3WNKA 3S9DB 1FC2D 4LNRA 1YMME 2QQNL 3C5ZB 1BQUA 1DE4B 3FB5B 2NY7H 2VL5B 1IGMH 4KJPD 1L7IH 4UMGA 2BCKB 1RULL 2B5IC 1SM3H 1QSZA 2WIMA 5TE4H 5J4MA 1BBJB 5D7JC 4Y19E 2A83A 2VITB 3FRPA 5KSUA 1SJHB 1X44A 2PW1B 3ARDB 2VE6A 4OGAD 2GCYA 4ZPVB 4L4TE 4HMCA 1BFOA 1W72L 1W0YT 1QPXA 2DQCH 1T66C 3LQAL 1JV5A 1UG9A 2ZSVA 2XOTA 2MHAB 4N9GB 1PQZA 4Z7QE 4WNQA 1M7IA 3UDWC 5BQ7A 2X4UA 1DQMH 1X5YA 3T2PA 5LGHL 4FFYH 2ZG3A 2Z31B 1WBXA 3RUGF 3BUYB 3GMNA 4O5LH 5E2VL 5JOPD 1YY8A 2G9HA 1EUTA 5HHNB 3MYJA 4O2FB 1VDGA 3KDMA 1ZWIB 1KTRL 2DQIL 4BZ2L 5MEPB 4P46D 5FYLE 2R1YB 4GLRH 1FFQA 1HKLL 2DLTA 5I1GH 3S37X 3QT2A 4PGCB 4PRHB 5CINH 1UVQA 4M43H 1OW0A 4I2XE 4Y2DA 1IRAY 2BVTA 4R4FH 4CN4A 1OT2A 5I74C 4EXKA 4PTUB 3L7EA 4RFEB 3EGSA 5DRNA 4ODUB 4B50A 1FV1A 5IFAH 1A3LL 4Z9KB 5KS9F 1OLLA 4RGNC 4GXVH 1G7QA 5GZOD 1X6NA 2YPLE 3VXQA 3W9EB 3RGVA 3WL9A 1JGEB 2XY1A 4H25A 1MF2H 3KPNB 3MCG1 5FYKH 3VWKB 3KPOA 5IMLB 1A7OH 3TIDB 2EZ0C 1NUDA 2GK0B 4UT9L 4U6TA 5E03A 1LNUB 4Y1AE 1ITCA 3RWDA 3GSUB 3V4VH 5JW4M 5CGYD 3EOAA 1I8IB 5IW1A 5E4EC 1DQLL 3SKNA 4EIZC 5FKAA 3WKML 3V4PL 3X3FL 1RUPH 2AJVH 2N4IA 3W0WD 2OMNA 1IZKA 3PDOA 3SEPA 3GHEH 5ICXA 5BRZA 4Y0GA 3B6SB 3BAEH 3AM8C 1ZGLM 5IFJA 1EAJA 1N5AA 4P2CG 5DEFB 4OLVL 4UBDD 2JF1A 4HUXB 2EDHA 3P4OB 3T3PF 2IG2L 4CVXA 4PJAE 1I1AA 3AXLA 3HS0B 5MHSE 3W5NA 1YMHA 4F3FA 1T83A 4K94H 1J5OL 1R5IB 1RURH 1MH5A 3HTLX 3BDXA 3LKPA 1HDMB 3M8OL 2CRYA 5DVMA 3UC0L 4LSVH 5SWSA 2AS5M 2ENSA 5EIIA 3U6RB 1MCDA 4MQ7A 5DJCB 3SKMA 1DANT 2AGJL 1SYSA 3RUGA 2XWTB 3OKMA 3I75B 3QUZB 3U2SB 1XGPA 4HKZA 2OI9B 3VXTB 5CD5D 5LXGH 3DTXA 4UIKH 3L3HA 2BP3A 4PJBF 3SDXE 4YBHA 2EE6A 2YK1L 4N0YL 5IHZB 1H8NA 1SBSL 4Z78B 5T3XH 3SKOA 4C56E 5IEHB 2NY0B 4BZ1L 4IDJL 2F58H 4IHOA 4KTDH 2B1AH 5GIRA 4G6JL 4OKVB 3NIDE 2AJZA 1BQSA 3HG1E 2PTVA 3RVUC 4XB8A 1ACYH 2VAJA 3ZHLA 3TWCL 2QJDA 4DKDC 4WI4A 1GHFH 3U4EA 1G7MA 5KS9A 3SBWC 4L3CA 4P2RB 1T21A 4LP5A 2MCPL 1U8OA 4D0BA 1Z9LA 2Z92B 2MQ0A 5AZ2L 4KRLB 4MD0A 3A6CL 1MFBH 3KVQA 4X99A 3HRZB 5C0GA 3QDHA 4MJIA 1OGTB 1F4WL 1NCBL 4HK0A 5H94A 3IKKA 1N2RA 2AXGA 1S7QA 4OFIA 1MHHB 1ZVSB 5AWNL 4ZFZB 3VI4E 4CMMB 3Q5YA 2ICWA 1B4RA 2X4RB 5GGRA 3RKDC 1DR9A 4PUBL 4AH2B 4JM2B 1K8IA 3WNOA 3RI5K 3TO4B 3AVEA 3TF7A 5EZIL 5ITFB 5C2UB 4AMKH 1YZZA 4GRWB 2YOCA 4LHUA 4CN1A 2I25N 4KRPC 1NAML 3P9LB 1UKTA 3JBG7 4UTAH 3NGBB 4GG6F 2GFBA 4F15C 5H35A 1G7JB 3M07A 2DD8H 1KACB 1IKFL 1LEGA 5DJ2B 2Q6WA 1B0RB 1HH9A 1BOGB 1KFAL 2UY6A 5C0IA 5T3ZE 4NZUH 2FR4A 3A67L 1UKQA 1GOGA 1IC7L 1MCSA 3BO8B 3FQWB 5L7XL 2ICWJ 1YNTA 5E5UB 3IJHA 5KN5A 4P3CL 3VWJA 5KVDL 1WT5A 2VH5H 4GAYA 2IANB 1HH6A 1JI1A 3LEVH 4YZFF 3FQNA 3V5KA 2P5WA 1G7HB 1WBZA 3ME0A 1FZMA 2G5BA 4JPVL 2H26B 3EYQC 3O9WC 3WMSA 4UNVA 2DLFL 1KNOB 3WHE1 1QSEE 4HGWA 2BC4A 5E9DA 1QVOB 3O2WH 5DJ6A 3PWUA 2ZZUT 4KTEH 4Z8FH 1FO0B 1KTKE 4YK4B 4OFYD 1VKXA 2XG5A 5T5NG 4PJBA 1O5DT 1XCTB 4NUJA 5GRUL 1RUAH 3OJDA 4V2CB 1FZKA 2FEDD 2W07A 4PIRF 4ZMAT 4G9DB 4JFDA 3GI8L 4YR6A 1T89A 4X4ME 4NN5C 5HGHA 3I02A 1T2JA 2R0ZH 3QXDB 3ARGD 3GB7A 1JVKA 1QA9B 1IGCL 4HUVB 3WXVH 1UKSA 3OKNB 1BOYA 3CMGA 1ZXQA 2CLZB 4PP8C 3GSWA 1NBVL 4GUPA 3W9DA 3ILQC 5F1IA 5IBLD 5C0BB 2LAAA 2E8ZA 4QHKI 5A40E 4KKLC 4PTTB 3QZWB 2F53B 3DX6B 3TJHA 5GPRA 3T0XA 5GSVB 1HILB 2AVGA 4IRSA 2EO1A 3P4MB 3EOBB 1NCDH 5GISH 4PB0L 1DQDL 2OL3A 3QHTC 3QEHB 3ESVF 1S9WB 4H0GA 4RRPA 4KKBC 1S9KC 3QUXC 3HMWH 4X80H 1LHZA 2IQ9L 4E9LA 4KQ3H 4MVBC 5JW4Q 1D9KC 1NANH 1XR9B 3T3MF 4ZTOL 3ULUH 2HJFB 1ZE3C 1HI6B 2ED8A 1ZHLA 4JN1H 4GG6A 4IS6B 3ZE0F 5EBMA 3ZDZF 5F88A 4ONHA 2C1PA 4LK4A 2LQRA 3QNXA 1FAIL 4PLOB 4PP2A 5JUEH 1NGQL 1QYGL 4E42A 3IETB 4FQHA 5GGQL 3TJEH 3HRPA 5FOJA 4FQJH 4IRZL 5C08B 1A4JA 4OAWA 2ADGA 1RZJH 5DYOB 5ESQA 4CU6A 4QRUA 3BZFB 1UEYA 3BRDA 5DEGB 4N0FA 5DQJB 5GJSL 4DUXA 2PW2B 5D1XA 4MA3A 2X4OA 1GPOL 2PXYA 3NA9L 2PTTB 3QPXL 4MWFB 4XC3H 7CGTA 4DAGH 5F8QC 1M05B 2A0LC 4HC1L 3C6LC 3HLAA 1S5HA 3ARFC 5CP3H 1N7MH 3FN0L 4UILH 2IWGA 5KOVC 3HR5B 1TETL 1UJTA 2FATL 1KCUH 5B22A 2V7NB 1CICA 4UIMA 3I85A 2AJYL 5DRXB 4JPKH 4Q9RH 2IAMC 4EDWH 1L8JA 2HJKB 1GJIA 3VGGA 1V7NL 1FAKT 1G7IB 4YC2C 5CEXA 4X6DF 5IG7A 3MV9A 4FQIH 3RVVD 5EZJA 5IIEA 2ADJB 2ESVD 4I48A 2R29L 1J0ZA 2DLGA 4Z5RB 3HE7A 4ZO9A 3QRGL 5JZ7C 5DDHA 3BRGC 5HHMA 5I1IL 5HGAA 4QLRA 1XR8B 4S11A 2E7LE 4U1LB 3D2UD 1SBBA 2VQUA 1YYLH 4EUPH 4F58H 2K9UA 3M45A 3GBNH 3JTTB 3S36H 1JWMA 5I15H 3GIVA 4P2OD 4JG1H 1NGWA 4OGXH 2ZUXA 2GCYB 5FYKU 3T65A 5HYJE 1OM3L 4MHHI 2DQFB 5JR1L 1HHIB 2P7TA 5LVEA 2UUDH 1E4KA 3K8MA 1NAKL 4N9OB 1KIQB 2ZG1A 2R2BB 4NCDA 5DI8A 4XVTH 3VMPA 5TDOB 4MB4A 1QPPA 1AQKH 3OX8A 1U41A 3WCYA 4CNIA 2I9LA 4PJ8A 4I3GA 5D7IE 4D0DA 4LLUA 2DTML 1H8SA 3RY6A 1MHCA 2G9HB 3RL2A 1LD9A 3MYJB 5FKPA 5IVZA 5ISZA 3VFOA 3WEXB 3D39D 3RWGB 32C2A 1N3NA 1CE1L 4ZQKB 3TN0B 3ZKMC 3KNBB 1UWEL 3D48R 3ARDC 1RZ8A 2M8XA 4KKAC 2AEQL 1EXUA 1I7ZB 1T7YA 5CP7A 1XZ0B 2A74B 1MHPH 2V5YA 3HI5L 4OLZL 4LRIC 1CWVA 1NAMA 1QD0A 1UYWL 1YYMH 4WFHE 3TZVC 1NFDE 1DL7L 5DR5L 4LNVA 4P23D 3PV7A 1OAXH 5A3IC 4WV1A 4PJGF 5F93C 2DDQL 5BMFL 1JHKH 3F5WB 3HMXH 5JNYB 3TT1H 5C0DB 1N0XH 1OGAB 3IFOB 4JFEA 3Q6GL 4B0MM 4OM0L 3O6LL 3QDJB 4X6DA 3CAFA 1XGYL 5SWZE 2A6DB 5IW1B 1T3FB 3VGAC 3ZTNL 5E08H 2EIZB 1F13A 3PWPE 3T08A 1H3PH 4OF8A 1AC6A 3NZ8A 5FYLH 3WE6A 4RIRA 4KKCC 4JCLA 5BXFB 4U6HB 1F8TL 3L5WB 4XAWL 2P8PA 5D7KE 3PQYD 3U7YH 3VDCA 1LDSA 1QEWB 3U48A 4GRMA 2E27L 4JHAL 5D2LB 2IH3A 4F2MB 3CDYA 1A6VL 1KXTB 3OKEA 1PJ9A 1VGEL 3DRTA 2AJSH 4XC1L 1TXKA 4L4VA 2Q8BL 1LP9F 1CN4A 2GIYA 4GRLB 2NZIA 3K46A 5LQBH 2CKBL 4HUMB 4JRYB 3O3DA 2QEJA 5FGCE 2QLVB 5GRJL 4ETQB 3GJFB 4DWHA 3D0LA 2E7CA 3QUYA 3ULUD 2FEEI 1XIWB 2VLKA 2EXWC 1N8ZA 4LSPL 5J6HB 1P4BH 4RMQA 1IBGH 4X8JB 4XCNB 5EO0B 4BYHA 4JR9H 3OG6B 4YXHL 3LD8B 4W4OA 5F7NC 1FL3A 3QIBB 5LGJB 5L88H 1A7PL 1YNKH 3QIUA 5DD5L 4HS8L 2NW3A 3VJ6B 1A14L 3ZSSA 5CSZA 5F97E 5GGVL 3UJJH 4IRJD 1D3CA 2QKIA 3CNKA 2DM7A 1G6RL 5J3HC 5C0EA 5E8OB 3H9SE 5HJ3B 1NLBH 1NGPL 3OKKB 3N9GH 1P5VA 3NIGE 1FH5L 3BPNB 1G7MB 1UC6A 4JFOB 1Q72H 1O0VA 4L3CB 4JVPA 3T2OA 2YR3A 4WTZA 4NRZA 3HC3L 1EJOH 1MLBA 4YO0A 2HT2C 5DJ0B 3S7GA 1BVKA 4CRPA 4EN3A 5CJXA 5F9JB 1KBGH 3CFBA 5JHDA 4HFUL 4B7LA 2OI9C 4PJGA 4ELKA 3P0VL 2NY1B 2P48B 2MKWA 1DCLA 1S7QB 4XP4L 5E99H 4KJWC 4M7ZC 5EU7C 1FCGA 5EC2B 4NT6B 1PZ5A 1JGUH 4PYHA 5ETUA 2EDOA 3VGHA 2DTSA 3QQ4B 5DZLA 1TVBA 3C5SA 3CFDB 4JY5L 1AR2A 2R0KH 1JF5A 3WHE0 4PB9H 3VGDA 1Q0YH 1A21A 2JELL 4OF6A 5BVPL 2DLHA 4BFGA 2FH6A 4MDIB 4POYA 4NQXA 1U2HA 2R4RL 2V17H 4AG4L 3FB7B 4UB0L 1CLCA 3F7VB 2PYEA 2YKLH 2XKSA 4EI5A 4XHJC 1IGJB 3U36B 1AE6H 4JDZA 4WI7A 4HW6A 3MRFB 3SKJL 1F3DH 2F9BT 1LP9A 3UTTE 2D7TL 2CUMA 4ZUSB 4S0SD 3UZVB 2OJEA 2Z9TA 5TGBA 3MLTA 3LAFA 43CAA 3FMGH 1JMXA 3MO1A 3MA9L 1NUGA 1KC5H 2BY2A 2VUYA 3BEVA 4KRNA 5GRXG 1RIUL 3NA4A 4WHYG 1QFWI 2YUWA 5MENE 4JM2C 3GSNL 1CXIA 1B6UA 1U8JB 1YQVL 2AJ3B 3QR2A 2QSTA 4G7VL 4OLXL 4KDTA 3BOVA 3LEYL 3LKOB 2R39A 3OR7B 5I9QB 2ORBH 4NQVA 2KH2B 2W0FA 1XGQA 4M8QB 2FJHA 4CW1A 3B5TA 4YQXH 4N0CD 1EO7A 1PG7H 1CLYL 2CDEB 4FZEH 3GUTB 1ZLVK 1A7NH 3BYTA 4OBSA 3NCEB 4AEEA 5T3ZH 1U58A 3PDGA 4JRXD 1IQWL 4JGMA 3B9KD 4YXLH 1E4XH 1CTOA 1A9EA 1GOFA 3OZ9H 4WFFE 3AROA 3GGWA 3QO1A 5CKGA 3QI9C 2BRQA 5ALBL 1P7QB 2FZ3B 4LPYA 5DMGD 1I7UB 4PJIB 5GHWH 4OI8A 3LN9A 4YDKH 1RK0B 3INUL 1CL7H 1I9EA 5EOQL 2XG4A 3SCMA 5L2KE 3HE6A 5KSAD 4OM1L 2LFGA 1PY9A 1H5BC 1MCQA 3DO7B 5IB2A 4DZBB 5IGXH 4Y4FA 1UH3A 1U3HA 5EZOL 1R3LA 2ZPKL 4TQEL 1ZEAL 4AYFA 3X13A 3ZL4H 2JLLA 5GS0C 3SJVB 3F7QA 1MUJB 3HAEA 2JCCF 4PGEB 4WW1A 3H3KA 1ZA3B 4XPTL 5E00A 2BDNH 1CLOL 1ZHLB 5T1LA 5IKCA 3QFJA 5DTFA 1NSNH 4NZTH 5CJBA 1UM5H 4JY6B 4FNLL 4NN6B 1F45A 5ADOH 4D3CH 5CJQH 4EQ3A 5C70A 3TBVA 2C5DC 4PG9B 2F5BL 4G9FE 1N64H 2OQJA 5I2IA 2Y36H 3J8F7 4AT6A 4ODWA 4Q97A 2P8LA 2CJUL 1YEKL 4OZ4A 4FQXD 3S5LA 4LPUA 4F9LC 3FL7A 4KJYA 2VDNH 1IM3B 3F12A 2BVPB 4UDTA 1OPGL 3OXSB 3FT2A 3BKCL 1A1MB 1KELH 5C0CE 2DQHH 2ED9A 3JV6A 1FNFA 1N26A 4JPIA 4MJ5A 3R1GL 1JRHL 1NEZA 3TYFB 4BK4A 3QQ9D 3LIZH 5KSBB 4LU5L 1MJJB 3RU8L 3NBNA 3DVGB 5E70A 4BSVA 5DSCB 5EN2A 4NO5A 1HHJB 2UV3A 4PP1C 3SE4A 4QCIA 4DOHE 5J6GA 3QEGH 3ILPB 3LZFL 4HJ0D 1BGXL 2C1OB 1UCTA 4OUUB 4PJXB 2PETA 5C3LD 3BJ91 3OTTA 2EYSB 4G5ZH 5CEXB 4I8DA 5FOBA 5CZXC 4G7YL 3EYFB 3VI3F 3QEQA 3NACH 4LCWD 2CKBA 1PSKH 3WD5H 4YXKH 3SY0A 3MRLA 3KJ6H 3ZLQC 4ODHL 2IALA 4HZLA 4X9BA 1D5ZA 1J8HD 2I07B 2XTJB 4Y4KA 5C07D 4J3OC 3V79C 4TNWK 2PR4H 1QO3B 1CQYA 3L7FA 4UV7L 2OSLA 4MZ2A 1AI1H 4YLQT 3P9WB 4IJ3B 4R7DB 4S1DD 2IH1A 3QUMH 5IB5B 2JCCA 1ADQL 1ZLWK 1OTUC 4I0CC 5KVFL 3DSFH 1CXKA 3C08L 3GBMH 4AEFA 1I7RA 3LMJL 4OZGE 5CJOL 4G6FD 3ARWA 4X6CF 1DVFC 3KXFD 4PS4H 2IBZX 3MUZ1 3BPOC 5DRZA 3O2DL 4XXCA 5J06A 2FIKA 1G6RA 2XA8L 3TM6A 1SY6L 4JG0H 4FTVD 1F4AA 4XVJL 3DRQB 4QHLB 3ARBA 4X5LA 4IIQB 3VFPA 2QSQA 4I2XA 5JPNA 4JFFA 2QADD 1SYVA 2VLLB 2GSIA 4XGZB 3RI5F 1W0VB 5I71B 3QUKA 1OAKH 4LARL 4PJ9D 5GQBA 1BD2A 1P4LB 3O4LA 3A6OA 2YPLA 1RMFH 3PL6B 3KYMA 2VZTA 3LDBC 2P5EE 2WUCL 1YEFL 2NX5B 4LF3A 2BVUA 3F7YA 3P11H 1AGCB 2ENYA 5FCUH 1WFOA 3PNWB 3K0WA 2VDKL 4WU5A 1JWSA 2OTWA 4HWBL 4NBZB 4ZOEA 1KULA 1AQDB 1I7TB 4BQ8A 2QL1A 3CLEH 3RVXC 2JJSA 2LABA 2F54B 4U2YA 5E7FA 1KGCE 3GEWB 4R4ND 2JIXA 5H8DA 5I19L 4YE4L 3PIQA 1AGDB 1K4CB 4X6BB 5EPMA 4AIZA 3EDJA 1A0QL 4MLSA 1P6FA 5ANMB 4C4KT 4RAUB 4Y5YB 3U0PB 1JFMA 1P2CA 2G60L 2XT1B 2VDOH 4OD3H 2ZUQB 1EAPB 5CEZH 1QLFB 1F4YL 2VZ1A 4LASL 5GGUB 4TUJB 1GAFL 2H2SD 1WBYA 2DQTH 2DQJL 4NJAL 4R7NA 3I9GH 3VXUE 1IEBB 1Q9KB 1OCWH 5ELIA 35C8H 3TN0C 3MV7A 5IMKA 1AD9B 1HHGA 3REVB 1N4XL 5F96L 1JN6A 4RIRB 2GT9B 4DQOH 5EORL 3RWHB 2OTUA 1MCKA 1WJ3A 2YN5A 1T7XA 3K3QA 5IB1A 3KPLB 3H8NA 4FQLH 4MLIA 1S7XA 1E27B 3RL1A 2HH0L 1XGUB 3IJYA 3DRTB 4J3SA 3QA3B 1RHFA 1H0DA 1CVSC 2LTQB 1YN7B 2YRLA 1KPVA 4ERSL 5GXBB 3GM0A 2Q86A 4X6CA 5HYEA 1IGIH 2LVEA 1KCRH 4O58H 2GJ6B 1NGXB 3PUCA 4KJPC 3DECA 4WWKB 5C0AE 3T2NH 3MZTA 3MRKB 2QQNH 1JNLH 4ZS7L 4FFWD 4HHAB 4M03A 4DKAA 1U8KB 2FL5B 1RULH 2HLFD 1M7DB 3HG1A 2DYPB 3C9NA 3TBWA 4XNZB 4Z7UB 4Z7VE 5D1QA 3S3PA 4OGAC 2HLAB 2NYYD 4LLYB 5KVMC 4H8WL 4P59L 1IC1A 3FZUC 5INDB 3S6CA 5EBLA 4LKCB 1W0WB 1W72H 4ZFOL 3V5DA 5C0JA 4GKNB 3LQAH 2L7JA 3QWOA 3T0BA 2X44D 1UXWA 4RWHA 3CVHA 2J6EL 4Y2DD 4QTIH 5LGHH 4XNYL 3U7AA 4ZODA 3WSQL 3A6BL 4YIQB 4E41E 4AEHL 4YO0B 2VC2L 5E2VH 3F65A 3EYSL 2RFXA 3E6FA 4K71C 5DMKA 4P46C 5AAWA 1XIWC 1EEYB 3EO1A 5F1KC 1GIGL 2X1OA 4CDGC 1BVZA 4NYLA 1HCFX 4OLYL 3RGVD 4ONFL 1FHGA 4BZ2H 3TBSB 1EHLL 1XH3B 3LD8C 1DFBL 4LIQL 3NN8A 2ATPB 4HWZA 4RGNE 1NC2B 3SGJC 4XXDA 2DRUA 2XYCA 2Q8AH 1CGXA 3AGVA 5GZOC 2C3XA 4R96B 2Y23A 4FS0A 1OWRM 4MA7L 4OLUL 3MLWL 1A3LH 2VB5A 3IAGC 3DUUA 2LV4A 1LQVA 1T0NA 1T6WA 1ZT4A 1YPZB 4NBXB 3RFZC 4H20L 2XICA 3IGAA 4NO3A 2FO4B 1NPUA 4U31A 1WK0A 3CMOL 5BRZD 3KHOA 1KJVA 5CGYC 4HCRL 3O3BA 1AIFB 3EHBD 2VLRE 4GKZA 1PKOA 2NY1C 4LEXL 3WS3B 5D7LA 3I6GA 5MEQA 3MCKB 1K4DB 3DXAA 4RAVB 1CS6A 1MAML 2DM4A 3MNVA 4X4MA 3WKMH 3V4PH 3U46B 3X3FH 2VZOA 1EO5A 3OHXA 1V3LA 3NFNB 3ROLB 3VRIA 4Z7WF 4YUEL 4MSWB 2R2EB 1FNAA 1MFDL 3R8BB 2Q1EA 5B8CC 3IDXL 1MREH 2Y72A 4OLVH 5K9JL 3PE9A 4F7MA 1NEUA 3WS6A 1C5DB 1G9NH 2IG2H 3HPLB 2W91A 8CGTA 1UGNA 4B41A 3RWIA 3DV6A 4HIHA 2VQ1A 1J5OH 1RZIB 2CDFB 4XBPA 4L9DA 4BH7A 3M8OH 1KJ2L 3DROB 4JREC 3UC0H 1JYWA 4NHUE 2AGJH 2VXUH 4JZOB 3ZE2E 4PV9B 3RWJA 3O3EA 3O2DA 1KXVC 3RA7H 1LK3L 1WFTA 3V6OE 3D9AL 1SY6A 2YK1H 5HHPA 1HZHL 3IDGB 4YGVA 1U8LB 2R69L 1SBSH 5J1AB 5D4QA 4MJID 1PVHA 2X1QA 3RDTB 1BJ1J 5HYSG 1LO4H 1WGOA 2XTLA 2X4SA 2HFFA 1G0DA 1WUNT 1D5IL 2X4TB 2ZKHL 4BZ1H 4IDJH 1FFPA 4LMQI 4UOW1 1JNJA 4DKEL 3MLUH 3C2AL 2WIIB 1I75A 4X7EC 2OK0L 1U8NA 4G6JH 3JV4B 1N59B 5HD8D 3TWCH 5CEZD 2X2YA 5HGBA 3QZWG 1T0PB 4LHUD 3ULVL 2WP3O 5D2NA 3A6CH 4PJFB 3RIFK 5FXCH 1P7KA 4HWBA 2Q3ZA 1DBBL 2VSCA 1QSFA 4WFGE 1F4WH 1NCBH 1ORSA 2OQJB 1RK1B 2GY5A 2R0WH 2ZCKL 5AWNH 1VFAA 2ADIA 1MAJA 2UWEF 4N0UA 2AXFB 3VWJD 4U1GB 1I1CA 5EO1A 4PUBH 4F33B 1SVZA 2DBJA 2V5TA 3FFCA 2IMMA 5KJRL 4YFLI 4AIOA 5EZIH 2P5WD 3OG4B 2JK5A 1EUUA 1HXMA 4ELMB 1T5XB 3IVKB 1NAMH 4KQ4L 3JV6B 3RNQB 1Q0XL 4Z7WA 4MHHG 3MLPA 4QRRA 5E9DD 3C8KB 3CVIL 3HUJE 3QH3A 1J05A 25C8L 1YQ2A 5FK9A 4O51A 3GMMB 4YH6A 4AENB 3A67H 4NN6C 5IMMB 1UWXH 3SQBA 4LFHD 4S2SB 4LLVA 4NRXA 3TGXA 1DBAL 1YMMB 1TJGL 2C4XA 4OF7A 4P3CH 4TUKL 4HIJB 5D6DC 4LEOB 3EO9L 4PR5A 5KVDH 5DURD 3RWEA 1Z0MA 2CLVA 3QJFA 4JFDD 1TVHB 4ESKA 2MJWA 1RZKL 4NO0B 1L6XA 3X17A 3KYOA 4JPVH 1CXLA 4NKMA 5GRWA 4U6XB 3PWNB 2DLFH 2P1YA 3CFJA 4Y19B 1VADA 4GXUN 3VXSA 2DN7A 3CFCL 5IK3B 2Z91B 4I3RL 1I3VA 1K6QL 4IMKA 2FEDC 4L4TB 4YDJA 1MI5E 4K3GA 5FECB 4QRPE 3UTZB 4LLDB 4PBVC 1RUKL 2COQA 4M9OA 5GRUH 2HTLD 3FQUA 3V6ZA 1QSVA 1F6AB 1TNNA 4XPHL 5ESAB 3GI8H 4IRSD 2G2RB 4UDUB 2X9YA 5IHLB 3EJYD 4WGVB 1NMAL 5KVGL 1AR1D 1NGZB 4CKVX 5IQ7L 4P2QA 1FYTA 5IBLC 1ZGLB 3JUYA 4RMSA 2XZAL 5JORB 4N8VB 1CBVL 1IGCH 5B3JE 3UJIL 1I7RB 4C83B 1NBVH 4JQIH 4ZFOA 3P30L 4KK9D 4JDVB 3CZJA 1T04B 3DGGB 4J4PD 4QY8B 4G43B 2ERJC 4D9QD 1TZHA 2BNRA 3O4OB 2J6EA 3VFNB 3BJLA 1CVRA 5I16A 2BSRB 1IGYA 2YD7A 4RFNB 4N5EC 2MQCA 1DQDH 1IM9A 3GBLA 2UWEA 4D9RD 1UJ3A 3V2AR 3OAYK 3SDCA 3RJDA 2IFFL 4GW5A 4XCYA 1ZVYA 1XF2A 2D3VA 5FCSH 4IJ3C 4ZTOH 2E9JA 1T1ZA 5GRZA 5F7DA 3K8KA 5BOPA 1QBML 5D1XD 3D1MC 4PPTA 1A3QA 3THML 1OP9A 2PXYD 3PWVA 4O2EA 4Y1AB 3VE0A 1FAIH 2W9EH 5SWZA 5DFTA 1QYGH 1R3JB 3UJTL 3K1KC 1KEGH 1BZ9B 5ESVA 3K80A 5GGQH 1RU9L 1T7WA 4HG4K 4XZUA 5JPMB 4GW1B 4N0RA 4IRZH 3ULVF 5E24E 4IIQC 5EBGA 2D7PA 3T4YA 5IOPA 1A6AA 1DQTA 4E0RA 4CVZB 2XN9D 3EDEA 4X6EA 1CICD 1DEDA 2VXTL 1LEIA 5GJSH 3VFTB 5I71C 3BZ4B 4HCRA 4PRPA 4K94C 3H6JA 2R2HA 2PN5A 2D9CA 3NA9H 5KOMC 3QPXH 4PJAB 3PL6C 1JPGA 4HC1H 3MV9D 3O3AA 3U0TA 1A6TA 4JQVC 3QO0B 3KHQA 5A43C 3L3GB 4JJHA 5HVHC 1Q9WA 3HE7D 4QKXB 4WI2A 5JMOC 1TETH 5F7FA 3MRQB 1XF3A 1XFPA 5HHMD 2FATH 1BZ7A 3G5XA 5IMOB 5CZKA 1U8MB 1AO7E 2AJYH 5E5MA 3H3BC 5DD3L 1TQCC 3BEWB 3UX9B 3RVVC 3SDXB 2N7BA 4Y5YC 3VFMB 2M2DA 4ODXB 2DMBA 3LV3A 5I1EH 4XPFL 3G6AB 1NC4A 1V7NH 3K2MC 3BP4A 1AGEB 2ZUQC 3LKRB 5J13B 3D3VA 4C56B 4Z0BL 3KLAA 1J7VR 3NIFF 1UA6L 1UZ6F 2L7UA 2R29H 2VLJA 1KJ2A 3QRGH 4QGYA 4BH8A 2WLZA 5I1IH 4M02A 4UZGA 5B21A 4GKOA 1ND0B 2CIKA 3HG1B 1Q9OA 1MIML 3P4NA 4NM8L 1UWGL 2WQRA 4MQXC 1MOEA 2V5RA 4XMPH 4OCRL 5DLML 1UB6A 1OM3H 3G6DL 5JR1H 4Q6YA 1NAKH 3NCYP 5EOTA 5HDBE 5MERA 3MMEB 3GNMH 4F8QA 3JTCA 2AK1L 3ZKQD 4KC3B 4UAOB 5IBTL 1KIPA 3G08A 1IFHL 2DKSA 4MX7B 2DOCA 2IPUG 4WWKC 1ZLSL 4M4PA 5L9DL 1CGWA 3MRPA 4QYOB 2Q76B 3BW9B 4OT1L 4FQQB 2H9GB 3IYLW 1FN4A 4NYLB 1RUML 1XF4B 3AY4A 2BOCA 2JKXA 3HAEH 4PY8J 1P84K 3P73B 4X7CC 2EIBA 2IBZY 3T1FA 2Y06L 4JFED 1UWEH 4WO4B 5JA8B 5IUSA 1RZGA 2AEQH 5BJTA 2AK4D 4QXGL 3DX7B 2VABB 5HGDB 2MKLC 4LGPB 4RNRB 3CZFA 2I9TA 4TOYL 4OLZH 4P23C 5AG8A 3Q6FA 1UYWH 1J0KA 3GSQB 4M6OL 3CSYA 4XNXL 4JFPA 5E6IA 1QSEB 1DL7H 5DR5H 1KLUB 3IGAB 5IW6B 5MENA 5GJTH 1NFIA 4FQ2L 4RQQB 1OD7A 1BMGA 2DDQH 4L8BA 4QRSA 4UUJA 4R90L 2Q7NA 1UQSB 3F7RA 3WJJC 3SDDB 1S7VA 4NJ9L 3Q6GH 2ZOKB 4OM0H 2AQ2A 3VMNA 4F7PA 3O6LH 2VL4A 4HKXB 5CILL 2H32A 1IAIL 1HYSD 3WN5A 4U1IB 5TQ2L 4J1UA 1XGYH 5C0CD 4L4VD 4XB7A 5DD1L 5HYQB 1R24B 4TNWF 1DSFL 1E4JA 1IAOB 1FVCA 3MRGA 1ZSDB 3FRUA 1HHHA 3EOTL 4APQA 1F8TH 1ZLUH 1DEEA 3PHOB 3WUWA 4XAWH 4NCC2 12E8H 3QUYD 4MMZC 2VLKD 3BI9X 4GW4B 2E27H 3QAZB 4JHAH 2IBGA 1ONQB 4YJZL 3BP5A 3P3YA 5SWQB 1BF2A 1A6VH 2ZOLB 2VIRB 1VGEH 1PYWB 4I0PA 3U83A 2Q7YB 5I0ZA 2R8SL 3AAZB 2BNUA 1HXYB 1NLDL 1FVDB 4XC1H 2EDRA 3MBXL 4Y16B 2Q8BH 3MA7B 3QIUD 5I1AB 4UOW0 1OAYH 4NRYA 2CKBH 3ULUC 3F62A 1N5YL 3C60B 4LLMA 5CD3A 5GRJH 3GMOB 1PEWA 3BVNB 1BM3L 2YD6A 4OZIF 2DLEA 2EIEA 4LSPH 5H2BA 3WHXB 2A2QT 4GBXD 4LLQA 5D1ZB 1UB5A 3BD5A 1FGNL 1CDYA 3K4DA 3D0VA 1JGDB 4EN3D 5FO9B 4BKLA 1A7PH 3V7AG 1ZMYA 5DD5H 4HS8H 1RZJC 1A14H 1LEKA 4PJHE 5GGVH 4JAMA 3KYAA 3FT3B 1G6RH 4ZS6C 5DUBA 2ARWA 3C8DA 1FQ9C 2QHLA 4QRQA 3BGMB 3L95B 3X12A 3BKJL 1NGPH 3PHQA 2BSSA 3OR6A 1FH5H 3MROB 2Y5TA 3RIAK 4G3YL 1BQLL 3D85B 3HNVL 1ZHKA 3HC3H 3MJ7B 4U1HA 2D4DA 5EU7E 3RTQA 3UMTA 4HFUH 2A73B 3P0VH 3VG9B 5FO8A 4PRDA 2BY1A 4RRPG 1YN6A 2PYED 4NSKB 1ZANL 4M7LT 4EI5D 4XP4H 2GUOB 3ZHKA 2EDDA 5DMJB 4MXVF 1OP5H 1QP1A 3ZTJH 5GS2H 4L8SB 1I8MA 1NKOA 3RDTC 2ZUSA 1R5WA 1NKRA 3B3IB 3FO2A 1OAQL 3KLSA 5E6YA 5LCVL 5IW3A 2E9WA 2JELH 4RBPH 5HHVL 3KJ4C 4GAJL 1JHLL 1OL0A 1U3JA 2A77L 5AEAA 4MNHA 2R1WB 2R4RH 4AG4H 3NCJL 5F3HA 1EH9A 3PXHA 4HLZG 5D5ME 5FA4A 2OM5A 2HFTA 4OUOA 5AG9A 1L0QA 5HPMB 3SKJH 4DK3A 5BZDB 1HEZA 2D7TH 4IBLT 5GS1A 3B5HA 4JFXA 1UFUA 5E8EB 4TTGA 3CFEB 3RPIB 3MA9H 1RIUH 4V1DE 4J8RA 4ZG1A 4U1GC 5E95B 1PZUB 4HS3A 1GSMA 3GSNH 4HJGB 5SX5K 3EDFA 4NNYA 3BH9B 3EBAA 4WHDA 4OZIA 4EDXA 4GQPH 4G8EB 3CX5J 4G7VH 5HYJB 4OLXH 4I77L 4Y88A 3VXMA 3QSKB 4MNGA 3E2HB 4U1KA 1OSZA 1A6WH 1WAAE 3MLSL 5CFHA 2HG5A 4HKJA 5T5FL 2IANE 3LN5B 2NXZD 2RR3A 1CLYH 1MHEA 5D7IB 4JZJB 5E8NB 3MNWA 4J3WA 2BERA 4Y4FD 1U3HD 2NY3B 1WIUA 5DMGC 5ABDE 1DN2A 2APVA 5DD6A 1IQWH 3AU1A 4WUKL 3TIEA 4KKNA 1AHWB 4YBQC 3GMQA 1BAFL 4G6AD 1F5WA 5ALBH 1RIVL 3KPSE 4KK5C 3TFKA 2D0HA 5KSAC 4ORZC 3NOIA 4M3JA 5JW5B 5T1LD 1YY9C 5TE6L 2ARJB 3INUH 2HFEA 5EOQH 5LG1A 3MLRL 4JO1L 4YX2L 1OAUL 4OM1H 1NBZB 2Z35A 4OLWL 3TA3A 2X4PB 3UXFA 1JMZA 3KPRA 4X4ZA 2FHBA 1FIEA 2ZPKH 4DN4L 4TQEH 3ZE1E 1ZEAH 4P3WA 1FG9C 3VA2C 4EXPX 1NFDB 3O11A 4LVHB 3BH8A 2P46B 4CADB 5KW9L 3RZCA 1ZVHA 4GMSL 4HD9A 4XPTH 1GRWA 1U8PA 1C5BL 1CLOH 2NZ9D 2JTDA 4JFYB 4Q2ZB 4YHOL 5DJAA 5DVNA 1CGUA 4R0LA 3IXAB 3MUHL 2OTPA 4PGDA 4OZHF 4JFHE 3NH7L 5JTWA 1VSCA 2F5BH 3GK8L 3K8LA 4JN2A 1WCBA 1HKFA 1CFTB 3PWPB 5CBEB 2VXSL 4P3DA 2HVJA 4ZSOA 4EKXA 4WCYL 1DN0A 3B2VH 2CJUH 1LQSR 1YEKH 4ZUUA 3NTCL 5CIPB 3FQTA 5C9KA 4QRTB 1OPGH 5ITBL 3SQOL 2E7BA 3TPUE 3QQ9C 3V6FA 1Q94A 3BKCH 1RVFL 4KVNH 3S8WA 3O41A 3P4LA 1WZKA 5CGMA 3R1GH 4NM4L 1JRHH 4X9HA 4ZAKB 3LHPH 4LU5H 1U8HB 3QEQD 4YNYB 4ZUWB 1JWUB 1NBYA 4N8CL 4OV6F 5T1KB 1QRKA 3P77A 2XQBL 5FGCB 1EGJL 4HJ0C 4J3VA 3AREB 2VDQL 3G5XB 4Y4KD 1UZ8B 3DIFA 5D7JA 3ZDXE 1JNNL 3LZFH 1BGXH 4YHYB 1Q1JL 3D25A 3U9PL 4OLEA 3TLRA 5I1KL 3OKLB 4P5MA 3HFMH 2VXQL 3UEZA 3UTPE 3E1F1 4G7YH 1JZ8A 4Q6IB 1HQ4B 3B9DA 2DMCA 2W65A 2RCSH 4P0DA 5C3TA 3L3JB 4ODHH 4OD2B 4I5BB 4S1DC 3VXPA 2RB8A 4MJ2A 3ARBD 3H9SB 4UV7H 4QOKE 5LWYL 4K3DL 4RMUA 5FDYA 4JFFD 1JPST 5JIHA 4L4JA 3VDBA 5F89A 4HUKB 4NQEA 4LSRH 2PO6B 1E28A 1JL8A 4LVOB 2NY2B 1ADQH 3HZYB 3FFDB 5KVFH 3RPKA 2CXKA 1WICA 5TF1H 2O61A 3C08H 1BD2D 3O4LD 4JDTL 3LMJH 5CJOH 3N1QC 3DMMB 1HQRA 2YSSA 4N90E 3SE8L 3ABZA 4ZOCA 2H3NB 2XA8H 1IEAB 4OZHA 1SY6H 2QADC 1SEBA 2XN9B 4XVJH 2QQKL 1KCGC 4FG6D 3G6JF 1S7WA 3LSOA 5FGBC 2HTKD 3W39B 5JDJA 4FFEX 4FABL 4PJ9C 1O7VA 5FA3A 2E6PA 2NY4B 2JIXD 1DBKH 1J1PL 4LARH 4M5YL 5I8EA 5C86A 2EH7H 1NCWL 1DBJL 3CC5B 4K3JL 1CFSA 4G8GE 1QACA 3HPJB 3MREA 4J7RA 4LP4A 3K81A 2A6IB 2AV1B 1MWAL 1YEFH 1B9ZA 1HSBB 1OP3H 3RY4A 3NCMA 4W4NA 1R3KB 5E2UL 3UTTB 4I9WE 2VDKH 4M93B 4XH2A 1FZJA 3FOMB 1K2DA 4WTZG 1NQBA 1ZA6B 1E4WH 3MV7D 1MFNA 2J1KA 1KPUB 1FZOA 4UAOC 2V2WB 4RMRA 5CS7A 1A0QH 2AJXL 3O8XD 3PP4L 1C5CL 3L3KB 5I1CL 2FECI 3VFSB 2G60H 1NDMA 2BMKA 4X7TA 15C8L 2H2SC 3STLA 2RBLA 5IF0A 5LGKA 3SPVA 4JB9L 2H6PA 3NZHH 1F4YH 4LASH 2GKIA 1U8QB 2GYSA 1GAFH 1Y18B 4LVNB 5AUMB 2ADFL 4NKOA 1M71B 4V3EB 1B3JA 5GGSA 1T22B 3T0EE 3ROOA 1JGLL 4PY7A 1N4XH 5F96H 1AGBA 5TPWL 4ZUVA 2C3VA 5EORH 3RBSA 4H5SA 4UQ3B 4DZ8B 5BZWB 3OB8A 4PJCE 2ZUTA 4OGYH 1G7LB 1GGYA 2DWEB 5HI3D 1L7TH 5D1QD 5DXWA 5EU5A 3WO4B 1E6OL 4X98A 4CGTA 4H1LB 4ERSH 2DWDA 4PJDE 5L2KB 2HJLB 1MJUL 2B0SL 3MGTA 1C12B 1PFCA 3SDDC 1DZBA 4OFPA 4RMVA 3GMPB 3R0MA 4JE4B 3UTQA 3CGTA 3V5HB 1FVEA 3GSXB 1I3GL 3L6FB 3OAZH 1J0YA 2HLFC 1RD6A 4LBEA 4ZS7H 2YC1A 1KIUA 3G6JA 2NYYC 3QQ3B 4QTHA 5CMAA 1XEDA 5EUOF 3RWCB 3UBXA 1U42A 5EBWA 3FN9A 1RHHB 2K3TA 4F80A 5EU6A 1UXSB 4L3ED 1VPOL 5K33A 4H8WH 2AK4B 2XQYK 5C09A 1F4XL 4P59H 1H3WM 3QAZC 3PP3K 1GZQB 5JOPE 3N50A 1OW0C 2VAAB 4G9FB 4YHKL 5LBSL 1WIPA 3QDME 2W0KA 3F58L 2BOBA 2CK0L 5I8CB 2V9RA 1P7HL 1X4XA 1XF1A 2AEPL 2J6EH 4YEEA 5IBUG 4XNYH 5ERWA 3FCTB 4G80A 5KG9A 2XV6B 2VSDA 3A6BH 3HA0A 5K9OA 1RAMA 3EYSH 5EUKA 2NTFB 5C0CB 4DVBA 1GIGH 3OGCA 4OLYH 2VXVL 4ONFH 5D1ZC 3QXAA 1S9XA 3S36X 3C8HA 3DLQR 1EHLH 1T0MB 1DFBH 4LIQH 1LMKA 2ATKB 4WW2B 4ALAL 3PGCB 4D9LH 3GJFK 1FL5A 4LLWB 4R2GB 3BXNA 5HHQA 1SJVA 5D7LD 5EWIL 5TFSL 3WFHB 2G75A 3QXTA 1OARL 5MEOB 3DXAD 1G7PB 1P69B 4MA7H 3OKDB 3MLWH 4OLUH 1FJ1B 1MQ8A 5JDSA 3K1DA 4M8VA 2HVKA 4YAQB 4JHBA 4K7PL 1G0XA 1JCKA 4H20H 4I4WB 5HY9A 1BLNB 2I5YL 4PREB 3EHBC 4G42A 4ZDHB 4FFZL 2EXYD 2OBGA 3CMOH 4X4XA 3AS0A 3W0WE 4PJ5A 2X4NA 4MS8C 1S9YA 3CFKB 3FTGB 4HCRH 4XTRD 5F1SA 4PJEF 3GMLA 3IAPA 4Z76B 5ID1B 3HI1A 3VG9C 4LEXH 7FABL 5L2JB 2VR9A 1DQQB 3C5JB 3KPPB 3BDBA 4GBXB 2A1WL 5JO5A 1F2QA 4J23A 1U9KA 3MXVL 4NDMB 5J11C 3ORJA 4TUOB 2DKMA 1NEZG 3E6HB 5F9OL 4YUEH 1A1OB 4IOIA 5IVXE 1EHNA 4MNQA 5FF6A 4OZGB 1BQHB 1IGTA 3IDXH 5CEYA 1OF2B 2VZVA 5FO7B 5K9JH 1FDLL 2ICEB 5L8JB 1TJIL 4V2BA 1CE6A 2FJGB 4Q7DA 3OJ2C 3V4UL 3LEXB 3RP1A 1DDHA 2BNQA 3QUXA 5DJXB 3PWLA 1MHEB 1I1YB 5D7SL 4Z7OF 5FV2A 4MVBA 4N68A 2YWZA 2XKNB 3HZMB 4Y5VB 4OF0A 4QF1B 4LGRB 3FB6A 1KJ2H 3HC0A 5FUZL 1QKZL 2BHUA 1P9MC 3ARRA 4F7EA 4N5UA 2VZUA 4R97C 4KXZH 4LRNL 1KPRB 43C9A 2P5EB 2YUXA 2BK8A 1DLHB 3GJEB 3D9AH 4KDWA 5I75C 5F3BA 2Y7QA 4F57L 2R69H 4XPGL 1MCWM 3E2HC 4NQSA 4XNQA 4NPYB 1QUNA 1KN2L 3X11B 1QSFD 4B7IA 1AXSA 3DBXA 4P4KA 4XWOD 5F7UA 2XPGA 1ZT7A 5IQ9B 2ZKHH 1D5IH 5DD0L 1YECL 4HG4J 4DKEH 3C2AH 1HYRC 1A3RL 5J9PA 2OK0H 3MNZA 3BH8B 4QHMB 1T1XA 3BPCB 4JZJC 4PJIE 4WHTB 5K59F 3FFCD 3L3IB 3R0NA 4JO2L 4V3DB 4QHUB 3DX9B 3U1SL 3ULVH 2NY6B 3ARFA 3KPQB 1I85A 4PRNA 3UTSE 4R3SA 4WDIB 1HSAB 1MY7A 4QRRD 3GMRA 1JZ7A 5A2KH 1DBBH 3VXUB 3ALWA 1MLCA 4PYGA 1VGKA 4PJEA 1IILE 4HX1B 5EG6C 4C57C 3QIWA 3EW3B 3IDNA 3T4AA 5KJRH 1PX3A 3PJSB 1J11A 1NFKA 3I6KB 3ZYIA 3ZHDA 5F71A 4KQ4H 3CLFL 3LN4B 1Q0XH 4TYUA 3VXSD 3F6IA 3CVIH 4YDLC 5INCA 25C8H 5M7QA 3SE3C 3ARQA 3SO5A 1QQDB 1I4FA 2VDRL 5DHVA 4AEIH 5C0AB 5T1MB 3FT4A 4U7KA 1A6ZA 1DBAH 3WFBL 1T89C 5GSRB 1TJGH 4TUKH 5B38A 4ZXBD 2VNCA 4NKDB 3EO9H 1Z5LB 4NNXB 4DTGL 1RJZA 4MCYB 1RZKH 1SHMA 2FBJH 4I13B 4LSDA 4Z7VB 1X6LA 4TULL 4NC1E 3VFUA 1Z9MA 1FYTD 4P2QD 4HXAL 3LKNB 5KSVA 3SGDH 3CFCH 3LQAC 2V7HB 3T8XB 2HTLC 3GRWA 3G5VB 4MB3A 3MUGA 1FO0L 4BQ6A 2F74A 5MP6L 4BQ9A 1LE5B 4IRSC 1RUKH 4UQ2B 3O6KL 3EJYC 4ZAKC 3C5ZA 2BNRD 4XCEB 1DE4A 3FB5A 1AR1C 1MCPL 4XPHH 2GTZB 2VL5A 4LGSB 2BCKA 4TVPL 3ARXA 1NMAH 5KVGH 4E41B 4YWGL 4HBCL 3AREC 5L6YL 4BZYA 5IQ7H 3OAUL 1BBJA 2XZAH 3JVGC 1H3UA 1DANU 3RIAF 2VITA 1CBVH 4J4PC 3UJIH 1YEGL 4F7CB 2DICA 3SDCD 3S35L 1SJHA 2PW1A 4YHYC 3P40A 3ARDA 1XGTB 1P84J 1QG3A 1HQRB 3P30H 4ZPVA 4IOFC 3WFEL 2DKUA 5I74B 3GM8A 1B88A 5K9KB 4JKWA 1T5WB 1QTYT 2MHAA 4N9GA 4RGNB 1CR9L 3MSPA 3OGOE 1VESA 3S34L 4U7SA 2Z31A 3EAKA 2XXMB 1PG7X 3SO3B 1UT9A 1S9VB 2VQTA 3BUYA 3CXDL 3PGFL 5FAAA 3UZEA 3MOAL 4TTDD 1T2XA 5HHNA 3OPZL 2IFFH 4O2FA 4KMLB 1TQBC 3WDJA 5CZVL 5D1XC 1ZT1B 2V5SA 1ZWIA 2PO6C 5JW3L 1GVIA 5MEPA 5C0ND 1QBMH 2R1YA 1FFOB 4PRPD 5TQ0L 5E4EB 4PRHA 4PGCA 4GS7C 1KB9K 2VLRB 3THMH 5JIPA 5B39B 4HH9B 5JXAL 1MCNA 1RJLB 1MCBA 1U6AH 4PTUA 3UJTH 4RFEA 4ODUA 1RU9H 3BQUB 1CICC 3DYMA 2WWMD 2OMBA 2EC9U 4HKBB 2HKFL 3W9EA 1G9NC 1JGEA 4PLJC 2AKRB 3KPNA 2VXTH 4A6YB 3SPVB 3VWKA 3HB3D 5IMLA 1JJUA 2FJFB 3TIDA 3E3QE 2GQHA 2UZIL 2GK0A 1OTTD 3EZJB 2X6MA 1MJ7L 1NC4D 1LNUA 3GSUA 4O00A 3HCVB 4JM2F 1I8IA 3BRFA 4DGVL 3D3VD 2QTEA 4LCUB 1WC7B 2VLJD 4GRWF 2XZCL 4M93C 3OF6A 2H1PH 2ESVE 1PKQE 4NHUB 5DC0A 5FYJL 1JTTA 3B6SA 3TCLB 5DD3H 5DEFA 4HT1L 2D7NA 2QR0B 1UM6H 4AY0A 4HUXA 4X6FB 3P4OA 5E5RB 5KTEL 2DS4A 3HS0A 3ZKND 1WAAF 4FFVD 5DS8B 4Z0BH 4NZDA 5IM7B 3VGFA 2LAGB 1FCCA 1UA6H 1A02N 1R5IA 5C2BL 3FOLB 1HDMA 4H26B 1KB5B 1RIHL 1ROWA 3U6RA 5DJCA 2P24B 2XWTA 2EDXA 1MIMH 3I75A 4NM8H 3QUZA 3U2SA 1UWGH 2ZJSH 4W70A 3VXTA 2OI9A 2VERN 3ULVD 3DSNA 2FO1A 1LO2L 1UH4A 3RQ3A 4KDVA 4OCRH 5DLMH 5IHZA 5HHOD 3G6DH 2ZSWB 2Z8RA 3JTSB 3Q1SL 4Z78A 4FRWA 4UV4L 5IEHA 3FQXB 3GSNB 4OV5B 3ULSB 3O8XB 3I3DA 2AK1H 3D39E 4KRPB 4GXUM 3R06B 4OKVA 1IFHH 4O9HL 5KG9B 1ZLSH 5C0FB 5HVWA 2HN7B 3PABB 5L9DH 3QHZL 5K9OB 1C1EH 4EOWL 2NNAB 4RGOL 1CK0L 4P2RA 2Z92A 5E6ID 1RUMH 3NCYS 1EEQA 1S9XB 3HRZA 4PBXA 3HUJB 1CT8B 2FEEL 5BVJB 1OGTA 1MAKA 2Y06H 1J0HA 5DO2C 3EJZD 3HHRB 1R5VB 1NCTA 1MHHA 1ZVSA 4ZFZA 4CMMA 3EYVB 3O9WB 3VGEA 4HLJA 3V8OA 2X4RA 1J1OL 4QXGH 4NKIL 4KK8D 3SOBH 4AH2A 4JM2A 5CUSL 1FLTX 3TO4A 4TOYH 2OR9H 4OTXL 5ITFA 1WQVT 3TVMD 2HVKB 1YEDB 4M6OH 4XCCL 3P9LA 4XNXH 5T33L 4Q9QL 4C58B 4S1SL 3BDYL 4APQD 3D69B 1A8JH 1G7JA 3HC4L 1MRFL 5DJ2A 4FQ2H 3VMOA 5JQHC 1B0RA 2VDLL 3EZ8A 3QFDB 4QHKJ 5I66B 1BOGA 1VACB 4R26L 2RGSA 1HYSC 4R90H 3TH3T 1PY4A 1KOAA 1MI5B 4QRPB 1IQDB 4NJ9H 3PQYE 3WBDA 3BO8A 3VXNB 3FQWA 1WAAA 5CILH 1IAIH 4OIAA 5TQ2H 3UBXI 4WW2C 2IANA 5DD1H 5EU3B 3BKYL 4M7JL 2WUBL 2WINB 1G7HA 2Y9RT 4QWWD 5JOFB 1DSFH 4R2GC 4R8WL 1IC4L 2DL2A 3I2CL 3IDIB 1KNOA 3N1GC 2DJUA 1QVOA 3PG2A 3WNMA 5DUPL 3CXHK 1FO0A 2F15A 3B8YA 2GTWB 2YZ8A 3QIUC 1XCTA 4YHZL 1C16B 3ULUE 1A7RL 2J88L 2R8SH 2J8OA 1NLDH 1HN1A 1AD0B 1DDHB 4FQ1L 2IPKA 2Z0BA 3MBXH 4G9DA 4GT7A 4ORGB 4K7FB 4JANB 1D9KB 1QBLL 3ZYOA 1N5YH 4PLKD 1KEML 1AXIB 3STZB 4DVRL 4JZNB 3QXDA 4PGZA 4GBXC 1QA9A 4HUVA 3MJGX 1BM3H 3OKNA 5ADPH 2CLZA 4F9PA 2BVQB 2C4FT 4EN3C 5CJXC 4OD1L 5C0BA 2FGWL 3M17B 1FGNH 4PTTA 4XNUL 4AM0B 3QZWA 2F53A 3DX6A 5GSVA 1HILA 1LK2A 3RTQD 3X3GL 4U6YB 4Y8AA 3MOBL 3T1WA 2YRPA 2WZPD 3LH2L 3P4MA 3EOBA 1J8KA 4UINL 1D6VL 3QEHA 2HMID 4TNVK 1S9WA 1YEIL 2AV7B 4U1JB 3BIAX 4KMTL 4KK6C 3LRSB 5IJKC 3QNYB 3BKJH 4HPYL 2KL6A 5BS0D 1XR9A 1A9BB 4Y5VC 2HJFA 3L5XL 1FFNB 1HI6A 1BQLH 2NXYD 4G3YH 3C6LB 3BESR 4IS6A 3QG7L 4QNPE 2FNBA 4ONGL 1RFDL 2X70B 3CCHB 4U05A 1ZANH 1XT5A 3PGDB 3IETA 5SV4A 3NPSB 2EDTA 4X0KB 2IAMB 5C08A 4HDIB 4DW2L 1OHQA 5F9DC 1WITA 5F72S 3BZFA 2LU4A 2FYYB 2E9BA 4ZPTB 4YC2B 1JPSL 1AO7B 1FNSL 2W1NA 5DEGA 5DQJA 5LCVH 2PW2A 4HFWB 5EB9A 5HHVH 4WI8A 1D7FA 4KDTC 4GAJH 3V0VB 5D93B 1JHLH 3O6FB 5J1TC 1NCCL 2PTTA 4MWFA 1QFUL 2A77H 3DX8B 4X7FC 1U3YA 5E7BA 1M05A 3NCJH 1KENL 3LOWA 5DHVB 3VXMD 1II4E 3BN9D 5E1AB 1CF8L 1JPFB 2V2XB 2YPKB 3B8SA 2ZUYA 1LO3L 1SJXA 4EI6B 1NGYB 3MV11 2V7NA 4OZFB 3U7WL 5DRXA 2GEEA 5I6XC 3ZMRA 2HJKA 1F90H 4K8RL 1G7IA 3H42L 4PG2A 4I77H 3TFKD 4MXQC 4JRXE 2BHZA 2ADJA 4JY4B 4IMLB 2NXZC 1ORQB 4XVUD 3MLSH 4Z5RA 2NW2B 1U91A 2UUDK 4Y4FC 1U3HC 4MD4B 1IZJA 5T5FH 4UU9B 1XR8A 1CLZL 3TV3L 4U1LA 3TA3D 3QCVL 4E5XB 1E0OB 1P5UA 3P2TA 1ZGLP 1EO8L 3KPRD 3EDDA 1P6AB 4PD4J 1WZLA 4TPRL 5D2LF 2P47B 4OKDA 3GSRB 1U92B 3JTTA 4IDLA 1X4ZA 4WUKH 5HVFB 1BAFH 4JKLA 4WEMB 3RZCD 2KBGA 1RIVH 4P9HC 4BFIB 2DQFA 1TTGA 1HHIA 4MJ4A 2AABL 3VRLF 3GO1L 1KIQA 5TE6H 5I76B 2IPTL 2R2BA 3MLRH 4JO1H 1OAUH 3TZVB 5TDOA 4FOMA 4OLWH 5EOCJ 3IS0X 5JMRA 1RZ7L 1TMCB 2OL3L 4DN4H 5FM8A 3EYOB 1FBIL 3QDGE 4OJFL 2NZ9C 2PCPB 3QDMD 4PRID 5KW9H 4GMSH 3WEXA 3RWGA 4YHOH 4P4RB 4M9PA 3VXRE 4ZQKA 1BIIB 4ZXBB 3VGAB 2YD5A 1ZHNB 3TN0A 3KNBA 3KLHC 4ZNEA 2IADB 1HWGB 4YFDB 1NDGB 3C6SB 1I7ZA 5F7EL 2EC8A 4M61B 2ICCA