1QSFA

Structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQADGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I HLA-A
publication title Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qsfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1qsfA01
1G0XA 4U6XA 3P30H 3RVXC 2N7BA 4OAWB 4PRAB 1YQVH 2FGWL 4JRYB 1CN4A 2BZDA 4KVCH 4N0CD 4PG9A 1B0GB 2FB4L 5IFHL 4LKXA 3ZSSA 1T0NA 2Z91B 3X14A 3BIBX 5GRUH 5LBSH 3ULSA 3V6FA 1WJ3A 4X6EB 3GMRB 4D3CL 4OD2A 3EW3B 2JJWA 3UZVB 1AQKH 3MLXL 3SCMA 1UEYA 2NYYD 1MAJA 1T89C 3TH4T 2P8MA 4JFFD 1K4DA 5C0BB 2WLZA 4RNRB 1QP1A 3TBWA 3RWEA 5DA4A 2DLIA 4P3CL 2OL3L 1I1RA 4M5YH 2AEQL 2JJVA 2PW1A 3P40A 3UTTB 4JJ5A 1KJMB 5CEZE 2H41A 1Q0YH 4ETYA 2CUHA 1NCUA 2J5LB 2VWEE 4RRPG 4NQXA 2B0SH 3ARBA 3FO0H 1WBYA 4FNLH 2NY6D 4MA3A 2IWGA 1U8QA 4WUKL 1P7HL 3IJSB 1QSFD 1T22B 2ZPKL 3M07A 5IMLA 4MQ7A 1RAMA 1U91B 5BMFH 3A67H 4HWBA 2G9HA 1HHJB 2VXTH 4TSCH 4HC1H 2R56H 3HE6A 3JTSB 5FEBA 3AREC 1EHXA 4LGPB 3B2VL 1GGBL 3P3YA 4Z9KB 1KLGA 4XZUB 3U0PA 2DN7A 1FNSH 3EJYD 1A6WL 1MHEA 1E6OH 1UQSA 5D1XA 4MLIA 2I07B 3L3IB 3MLTA 4PJFF 3VD4A 2K7QA 1DLFL 3D25B 3T3ME 5F7WC 1QACA 4DVRL 1I3UA 3RTQB 4Y16C 3PGFL 3GJEA 4PJEE 5J3HC 3RBGA 3KVQA 4I0PB 4ZXBA 2QQLL 4PV9A 3DVIA 4RISL 4FZEH 3M45A 4FXLA 1CD1A 2OK0H 1EAPB 4PD4J 4PJ9B 3UTSB 1R3JA 3QHZH 4UNTA 1G9EA 4PJIB 2ARJQ 2NY1C 4NC1E 3EYFA 4NN5B 1MI5A 4WHYG 5I1AA 3DUUA 4GO6B 3ZLQC 2XZAL 3WHE1 1RUPH 1FZOA 4RMTA 1I75A 5LWYH 2G5BA 4Q9BA 3QXVA 3SOBL 1S3KL 4G9FA 4PJ5E 1HNGA 5ESQB 2R0ZH 4QRRB 1JZ6A 3QQ4A 4XCNB 4S1DD 4RMWA 3BP5A 3H9YA 4MJ2A 1SHMA 4LVNC 4KJQC 4OLZL 4OCYL 1F3JB 2DYPD 5HHXL 1OP3K 1QSZA 3GSNB 1QLFB 4YQXH 1A6UL 5IFJB 2ZNXA 4KK8C 4HFUL 5B22A 3H7BB 5JNYA 1KT2A 2HRPL 4Z0BH 4WI8A 4IOIA 2ATKB 3DGGA 1WZ1L 4F3FA 1QUNA 1A2YA 3QEHB 4JFHD 2ESVD 1X9QA 2Q1EA 1HXYA 5DEGB 5FYJH 4YHZH 2VJXA 3MRPA 4WU5A 1J11A 1S7SB 2VLKB 4I18B 1XT5A 4UAOC 1NAMA 4OV5B 1A6AB 1DE4A 5D5MB 4O2FB 4ODSL 4PB0H 4PY7A 1CT8B 1ZLWH 7FABL 4YDIH 5BO1L 1QBML 1F00I 3T8XA 4XHQA 3RWJB 4JY5L 2VDPH 1F4YL 4JKPH 1CIUA 5I9QB 3G5ZA 3CDYA 3K0WA 1B88A 3HZYA 3X12B 1OB1A 1S7QA 2W91A 4TSBH 5JUEH 3IFPB 1KCRL 4Z5RB 3WEXB 3P0YH 5C9JB 4HMDA 5IF0B 2HFEA 4NKDA 5AAMA 5LGHL 3QUZB 1TMCA 1UC6A 5FK9A 1YEKH 2Z8RA 3IFNL 5HSFA 4R97B 2OXGA 4XP6L 3BZFB 1TTUA 2PYFA 5B3JF 1SJEA 4JFFA 1NLDL 2RIKA 4I8DA 3BD5A 2XTJB 4HUVB 5I1CL 1NGZA 4M6ML 3V6ZB 3SPVA 1H5BB 4YHNA 4UIMB 3MFFB 3CFIC 3JWDL 3DMMC 3W5MA 3MLSL 1CE1H 4QF1B 1E27B 5T1LB 1CG9B 3QUKB 5B39A 2BSTB 1SY6L 5JW4N 3PP4H 4ZO8A 2XN9B 2UY6A 3HAEH 4XMLL 2QADB 3QDJE 1JZ8A 1X7QA 3L95B 1KPVA 1W2KT 3A0OA 1WWAX 4WTZG 1OSPH 2YC1A 3IDGB 1QSFA 3EZJB 4JFPA 4WGVB 5T3XD 4Z7WF 4C59B 3LRGA 4CMMB 3NCYP 5BS0B 1PG7W 2G60L 1HN1A 2W9LA 3PJSB 4LRIA 1XIWB 1Z0NA 5C2BL 3LV3B 3PIQB 2A6JA 4P5TC 3F7VB 4K2UL 3QI9D 2AVGA 3X3GH 2F53E 3I3DA 4U1IA 3VE0B 3QXAA 4X6FB 2WLYA 4P57B 4WI5A 2JB6A 4HIIA 3FQXA 4MJIE 1UVQB 5E56A 2R2BB 3BKCL 5FYJU 2IBGA 4AMKL 4OGXL 5IIEA 5GGQH 2FZ3B 1W72B 1FZJA 1OTSC 3LQZB 1WEJH 4R3SB 4YUEH 1I9IH 1A1OB 1DVFC 3MJ9A 3SE8L 3ZT7A 1QFWH 1YEFL 2QQKH 4GMTH 4GXUN 4D0BA 1GZQB 4NRZB 1A1MB 3SGKC 3RGVB 4CKVX 4ONGL 1KGCD 5I6XC 3WJLC 5DO2D 1J10A 1L0QA 1EJOL 4J8RB 1D5MA 3INUH 5JXAL 3CCHA 2A6DA 3PWPE 1AKJD 4U6XB 2NY7L 1S7TB 4DGIH 3GRWH 3MZGB 4PG9B 1KIRB 4S0TD 4WY7H 5J56B 2DYPA 2X1PA 1X5ZA 4LKXB 4PR5B 1OAZH 5GRXG 4KTYA 3HPJA 4NCC1 4TNVK 4E0RA 4KMLB 3ULSB 3V6FB 5IGXL 4LOUD 3JVGC 4GRLA 1NCNA 3U1SH 4U1GC 1JV5A 1G84A 4WFGE 2H2PC 1OT2A 4K8RH 3VI4F 3QFDB 2FGWH 2ESVA 4MNGA 3RWEB 5JXEC 1CXEA 2NPLX 2PW1B 1XGUB 2C4FU 5FA4A 2FB4H 5IVZA 4YDLB 4JJ5B 1CL7I 1E4JA 2JJSC 5GPRA 5JQHC 2WM0A 4RIRB 2F9BT 4YHYB 1R5IB 4NQXB 4D3CH 3NA4A 1LP9A 3C5ZD 3GB7A 2X9WA 3MLXH 4LP4A 3BQUC 1MAML 4UNUA 2JCCE 3RUGF 2F19L 3SDCA 4XCYA 3DO7A 1EERB 3FO9A 3VGFA 3G6JE 5L8KB 5IMLB 4L8SC 1UM6L 1WVZA 4MQ7B 1P1ZA 3TPUA 2N4IA 3PDOA 1NCCL 1RZKL 2G9HB 1LQSR 1TFHA 1T4KA 4WFHD 4DZBA 1AGDA 3KDMB 1WWCA 3UCRA 2EE3A 1KLGB 3ARQA 5D7SL 3ARGD 4KV5E 1XR8A 1ZVYA 5HGAB 1MHEB 3FZUD 1UQSB 4WUKH 2KZWA 4XWOC 4ENED 3MRLA 2C1OA 4GLRI 1WZMA 4XH2A 4L8DA 5L8JB 3OB8A 2Z35B 4IRSA 4ODHL 4JFDE 3TIEB 3HS0A 4P5KB 2Z31B 2BNRA 1KN2H 2ZKHL 1NBVL 3RA7L 1OM3L 1NQBA 2HFTA 1ERNA 1D6VH 1LDPL 3OXSB 1ZT4B 2ICES 1YECH 4PRIA 4L4TE 4PV9B 4JB9L 4JPVL 2UZIH 1CD1B 3W39A 3EOBA 2P42B 1R3JB 3KYOA 3IDMB 4XNYL 3D3VD 3MRFA 3TP4A 5KANI 2F8OA 1MI5B 4B7IA 5I1AB 3DUUB 4OGAC 4R4ND 5BV7C 4M6AA 4DVRH 1DANU 1FZOB 4RGNB 3PGFH 3U2SA 2G5BB 2AJUL 3EYVA 3HI1A 4KRNA 3RIAF 5FYJE 3HB3C 1HXMA 5D1QD 3PL6C 3W0WD 5IR1B 3LDBB 2O5YH 2P5WE 3BP5B 2OTPA 3GNML 4QHUB 1WIUA 5DEFA 2FGZA 4NPYA 3EYSL 5KW9L 4MDIA 1KENH 4FQHA 2APTA 3QI9A 5C0AB 4KK9C 1IGIH 3OSKA 5H37H 2XZAH 2IFFL 1UXWA 5JNYB 1KT2B 1NL0H 4PLJC 4ZS7H 3W9DA 1G9MH 2FSEA 4FQLH 4J3TA 3V8OA 4IOIB 3DGGB 2NXYB 4F3FB 4FFVC 4HCRL 4X6CA 4RSVA 1MJUL 1BJ8A 4OLZH 3MLVL 1U8KA 2KKQA 1CCZA 5ACLA 1JF1A 2NY4C 3MRPB 4WU5B 2GK0A 4HJGA 3OKMA 3OPZL 2IEPA 4QRSA 1IILE 2ZCKH 4HFUH 3TT1H 2EXWD 1DE4B 2PO6A 5E24E 4PY7B 5ESVA 4ZUSA 1KELL 1WZ1H 4EBQH 4U1MA 3GIVA 5HHMD 4FQJL 1REIA 4ZTOH 1URLA 5HDBE 3UYPA 3FT2B 2VLLA 5HHOE 4X6DA 3KLSA 1AKJA 4Z7VF 1IMHC 3DO3A 3HZYB 3B4NA 2YWZA 4JPKL 3C87A 3F58L 3D85D 3U46A 1YY9D 5IVXF 2EDYA 2VB5A 3I9GL 4ODSH 4I9WD 4XTRC 4KZEL 4NKDB 3RBSA 1TMCB 4F8QA 3STLA 5BO1H 2XQYG 1QBMH 4F9LA 5FK9B 4KKLC 1TDQA 4A6YB 4JY5H 5I75C 1Q72H 1V7NL 2HJFA 1WLHA 4YBHA 1SJEB 3QXDA 3LQAH 4JFFB 3TVMA 3SEPA 4U6VH 5D7LD 4AJ0A 1N0LA 4YPJA 4IRJD 3RKDC 3NGBB 2GT9A 1KCRH 4NOBA 1J1OL 4G3YL 5C86A 1I3RA 3GMQA 3DJ9A 5LGHH 2ADIA 4KRLB 1QPXA 4MJ5B 2VQ1A 3IFNH 1ZKAA 5ICXA 3C5ZA 1A7BA 4DW2H 4HEPG 3ULUD 2NY6B 4U1HA 1NLDH 5JW4R 2YWYA 3MNWB 5CP3H 1OW0A 3WN5C 5J9PB 3P73B 2YC1B 1R3LA 1QSFB 1JPSH 3VA2C 4JFPB 2D7PA 4M6MH 4FABH 3V7AG 5GGTL 4XWGH 1K8IA 3JWDH 3MLSH 4HGMA 3RX7A 2OXHA 1B2WL 4X7DC 2NXZC 3T0VA 4MXVE 3UPAA 1F97A 1P69B 3H9SD 3L5XL 4ZFFA 3QUML 2B1HL 3LKQA 4U1IB 4PJGF 4AZ8A 3AXLB 3MOBH 2FIRT 1QRND 4DFIA 2V9QA 1VEOA 1LVEA 4JPWL 43CAB 2JB6B 1UWXH 5FOJA 2G60H 4HIIB 1LO3L 4LHUD 4HIHA 4PFEA 4KZDH 5A2LH 4RMRA 5JR1L 1X5GA 1P4LB 4K2UH 3WE6A 5EIQA 5E6IC 1XF1A 1AHWB 4ODUA 1RUAL 4P23A 5E2TL 4OLUL 2YRLA 1QD0A 3BIAX 4QY8A 1FYTD 4S0UC 3QUXC 3BKCH 4L1DA 4AMKH 1F4XH 2A6DB 1IM9A 3PGDA 4Y4FC 3V5KB 2E9BA 1AGBA 8FABA 2VDKH 3PWJB 1VA9A 1YEFH 4H26A 3EHBC 2DYPB 1KTLB 4LCWD 2CR6A 1LNUA 3ES6B 4KGLA 3HPJB 5D2LF 3L3KB 3QP3A 5CCKL 4HUUA 3A6CL 3S34L 5JXAH 1M71A 1RFDL 1VACA 2NY7H 1NH6A 4OB5H 2ESVB 4F80A 5IBTH 1TZHA 5FYKL 3MNZB 5EPMA 2GITA 3T0EE 1AQDB 3O4LA 4JQVA 5EIIA 3C5SA 1FZMB 3HZMA 1IVLA 3O11A 4AY0A 3MSPA 5I8CA 1N6QL 5IGXH 5EBLA 1LP9B 3GB7B 1FIGL 4QKXB 5IQ9A 1KV3A 4BSVA 5CEZD 2BERA 3DO7B 1G7HB 4IHOB 2AK1H 4Q9RL 1SYVA 1YQ2A 3QCVL 4XAWH 1P1ZB 3OGCA 3PDOB 4JVWA 1T66D 3SE9H 1EXUA 5HPOA 1J18A 1JYXA 2EDDA 1JRHL 4GKNB 5HI5D 4DVBA 3D85A 1T4KB 5DXWA 5DJXA 2FBJL 4DZBB 1AGDB 3IDYC 1MAMH 3DURA 1XR8B 2F19H 5GS2D 4ZNEE 1BQLL 1QG3A 3QH3A 1AY1H 3CVHL 3VWJD 4ZFZB 2C1OB 3E8UL 4XH2B 1I85C 1XF4A 4N5UA 1UM6H 4N9GA 3MRNB 2VZVA 1NCCH 1RZKH 4Y2DC 3W9EA 5F72S 2IAMA 4IRJA 3OB0K 4NIKB 4R4FH 2FJGA 1K4CA 3LZFL 4F7MA 3DBXB 4NN6C 1CR9L 1FVCB 3DSNA 1SM3H 2R2EB 3OTTA 5C0GB 1TZIA 3W39B 1F90L 2I26N 3EOBB 3GM0A 5TH2A 3CC5B 4OCLC 1L6XA 5J0BA 4F7PA 4NHUE 5KVEL 1MCQA 3RAJH 2EDXA 1U9KA 4ZUWA 3FKUS 1NBVH 4OTXL 3MOAL 3RA7H 4OBRA 1U3HD 2LFGA 2JKXA 3HI1B 1HXMB 2ENSA 1I9JL 1N5AA 1AP2B 2R0LL 1UH4A 4JB9H 4JPVH 5D1ZD 4RMQA 3N1MC 4XNYH 4ELMF 4GBXC 1CFBA 4FQHB 3QI9B 4UOW1 1ZOXA 3V4UL 2VXVL 4PJ5D 1BJMA 2EEDA 1AIFB 3I6KA 1NDMB 1OAKH 3W9DB 1QRNA 2FSEB 2AJUH 1JTOA 4X6CB 1K2DA 1MELA 3TJEH 3NFPA 4WW1B 3FO2A 1U8KB 1T21A 5JPMA 4JY6A 2X1WL 3EYSH 3WLWC 1JF1B 2EH7H 2GK0B 2NY0D 1JZ2A 2IFFH 2PO6B 4RMVA 4N68A 2XFXA 3VGEA 4ZUSB 3NBNA 1NUNB 1VENA 4HCRH 4U1MB 4XRCA 4M43L 1R3HB 2IADA 1MJUH 1HHGB 2HMID 5KSBA 4LLVA 3VU2A 1OWWA 5I1KL 2EICA 1RZGA 2VLLB 3MLVH 4X6DB 5J06A 1AKJB 1MOEA 3EOAA 1HQ4A 3HMXL 4TSAH 2W38A 3C60C 1X44A 3U46B 4C83A 2WBJC 1GGCH 4G80B 1J8HA 4MAYD 4QWWD 1MNUL 3STLB 2LAAA 1BEYL 4FQJH 4JFYA 4I48A 3WKML 3QO0A 5FM5M 5DC9B 5T5NG 4G6AD 3BPLB 4F8TA 2BK8A 1DZBA 5SWSE 4BELD 1S7XA 1WZKA 4ZAKD 5T1MA 4JPKH 1H8NA 3CAFA 5C09E 4PG2C 2FO4A 4HJJL 1I3RB 1EPFA 2FH8A 3GMQB 3I9GH 4KZEH 2VZ3A 3U0WH 2VDOL 1CYGA 4OUOA 2VQ1B 3C5ZB 1IBGL 1V7NH 1NFDB 4R7NB 2NW2B 5C92A 5FUOH 3ULVL 1T20B 3EDFA 4U1HB 3AB0B 4BK5A 5FDYA 1R3LB 4NNXB 3AM8C 5IMMA 3OKKB 1VFBB 4DUWA 1K6QH 4CMHB 3U4AA 4GAGL 3WUWB 4OQTL 3KPQB 3QDJD 5INCA 1CICC 1JTPA 2BVQB 4I0KA 2NTSP 4EN3D 3F65A 4OCSL 4PGEA 1HKLH 4OGYL 1MSPA 1YPZB 1ZVHA 1UM4L 1VERA 4ZFFB 2V9TA 2YRPA 2OZ4L 4PJFE 4KHTL 1RZJC 5GGTH 5A2FA 4HEME 3CZFB 1DUYA 4MSWB 4PJBF 4HIHB 1YEDA 2F53D 1B2WH 1PYWA 5FOBB 4G6FD 4LNVA 3SO3B 3JBG7 3WE6B 2VDML 3L5XH 4G43B 3VMNA 5JTWA 3WO4C 2B1HH 1IGTA 3WIFB 1NEZA 1HH9A 4J2XA 5IW1A 2EDRA 3D3VB 1CDYA 1FFOA 4PJEA 3QIUD 4QY8B 4JPWH 1AD9B 1BZ7A 2BNQE 1Y18B 4H8WC 1SVZA 2NY3D 2VSCA 1LO3H 5FA3A 1KJ3H 4LCCA 3VD3A 1U3HA 3G04A 1NCBL 5JR1H 3SKOA 4OF0A 4ZS6C 5D1QB 3W0WB 4APQD 1ZLVK 3VFTB 1PKOA 4H26B 1A6TB 1TIUA 5DD3L 1U8HA 5E2TH 5INDB 3RVUC 2DM2A 2ZUSA 3PV7A 3PWPD 5EWIL 4NGHL 4XVTL 3VFSA 5HBBA 1NSNL 5IWLA 2G75A 3U7WH 5CJQL 4YAQA 3LSOA 3EFFA 3TLRA 3UDWA 4LHUG 4UZGA 4MD5A 1C1EL 2VZ1A 3BMVA 5IQ7L 1VACB 1Q9WB 2I5YL 4NWTH 1IC5L 1JGLH 1CQKA 5BRZE 4J3OC 4Z95H 4U31A 1XEDA 2QSCL 4NO3A 3MLPA 4OM1H 3QG7H 2VDRL 4WRLA 3DI3B 5E99L 5EPMB 3PABB 3C5SB 1NBQA 3O11B 3OR7A 5C2UB 2PCPB 1NGPL 4WFGD 4UTAL 1YEHH 3A6CH 4WO4C 5EBLB 3G08A 3S34H 4HW6A 4TVPE 1OAYL 3VW3L 1IAII 5F1OB 1IC4L 4BSVB 5HHMB 3U4BL 3T08A 1INDL 1SYVB 2J2ZA 5EU7C 3B3IA 1MEXL 5FYKH 3I85A 5BOZG 3MRHA 5F1KC 1EXUB 4PJCB 5I2IA 3T0AA 2AXHA 4HPYH 3S96A 1Q9OB 3BHBA 4F37K 3D39A 4MXQA 3SGJC 1N6QH 3D85B 2OJZL 2P7TA 4DTGL 4CN1A 1FIGH 3SDAD 1T2QL 4UI2A 3EZ8A 5MHSE 2VUYA 4Y2OA 4WHTA 1TCRA 4MJ6A 5IV2A 1RZFL 3FRUA 3O2DA 2YN3A 4HGWB 1XF4B 3U48A 2VZSA 2ZUQB 5B3JE 1Z0MA 1T5XA 4XNZB 2R1YA 3WBDA 3O6FD 5LQBL 4AH2B 5D7LB 1I8KA 2PTUA 4IRJB 2I25N 2FJGB 2CMRL 3FCTB 5ALCL 1BBJB 1MJ8L 1K4CB 3N1QC 4IIQA 4F7MB 4XXCA 1P84K 3E6FA 2NW3A 4IOSD 3FONB 5EOCL 1BQLH 4LSDA 1IAOA 1TZIB 5F1IA 4JFOA 2J1KA 3MJGX 4JFDD 3JTCA 1MJ7L 5TH2B 3CVHH 4BH8B 3TA3D 1CU4L 2UYLA 3GI8H 2NMSA 4F7PB 1JMZA 2O5ZL 3BDBA 5B8CA 2FR4A 3VI3F 3ZYJA 5D2NB 1EBAA 3QEQE 4ZUWB 1X4YA 3LKOB 4L4TD 1HINL 1T1XA 3TZVD 5ID1A 5CP7A 4DKFL 1NDGA 3LZFH 3OKEA 1N5AB 1CR9H 4TYUA 5DK3A 3QDJA 2CH8A 3H3PL 5EUKA 4KAQL 1F90H 4EN3A 5GS1C 4W70A 4LPXA 3P9LB 2EEBA 3H9SB 3QXTA 2MNUA 3FN3A 1N59A 2ADGA 1FFRA 3K1DA 2J8UF 2X09A 1JK8B 2X4OA 4LKCA 25C8L 4TNVF 5E6YA 43C9B 4ERSL 3I6KB 3O2VL 2XIDA 1QRNB 4MA8H 2P5WD 1TNNA 1FQ9C 1I9JH 3WS6C 3CXHJ 4HMEA 3B9KD 2R0LH 1WCBA 4LHUB 4OZGE 3RNQA 5F9WB 4O9HH 1BVZA 1NEZG 1T21B 3MNVB 1RZ8A 1FLTX 4JY6B 3O8XC 1CK0L 2EC9T 3FFCA 3IU4L 2VXVH 3LMJL 4MJIA 3DHJA 3CFEA 2XFXB 1NAKL 4JKMA 2RR3A 1FYTB 3QRGL 1BPVA 3QFJE 4P2QA 3ORJA 5FYKU 4OF8A 2IADB 1Z6JT 5KSBB 2EE9A 4HKZA 3ULVC 3X17A 4RQQA 3EOAB 3O9WD 5AD0B 3GKZA 4CN4A 2AEIT 3MLZH 5DJ2A 3TN0D 1UG9A 3KGRA 5J13B 4APQA 2XT1B 4JE4B 2J8HA 4C83B 3SDXF 3MUJA 4LCWB 4EXKA 3O4OB 4OV6F 4Z7UA 4L8BB 2V2TA 3CSGA 3UJIL 2EYTA 1QVOA 3T3PF 4M43H 1KCSL 2DQGL 4JFYB 1GGUA 4WCYL 5I1KH 1IC7L 3QO0B 3CDFA 3MLWL 4MB5A 1OP5K 2DLGA 4MS8A 2RAMA 1LEGA 1DLHB 1MNUH 3MUGA 1K5NA 2DLFL 1QA9A 4JN2B 2ENYA 2NX5E 1ZLSH 2ERJC 4MDJB 4HC1A 2LE9A 4LSUL 4WWID 3RUGE 1JFMA 2O61A 5IVOA 2WIIA 1QQDB 5IMMB 5KANG 4HJJH 4P46D 1N6VA 4C4KO 2DI8A 1FL5A 4FQXA 4GXVL 1J0IA 2JCCA 5INCB 2VDOH 3IDXH 5IHUH 3VFUA 5IM7A 2CR3A 3DVFA 5DRXA 2B5IB 3KPPA 5DJ8A 5HVHB 3G6AB 2DQTH 4DWHA 4HLJA 2ZCHL 3CH1B 1IBGH 4M61A 4NQEA 3MROA 1ACYL 1FLRL 3GHEL 4PP1C 3U9UA 5A2JH 1UJ3B 3IFOA 3NIGF 2VL5A 4QTHA 3O6FA 3V8CA 4GAGH 4OQTH 1WFTA 3BEVA 5HTSA 3ZZ1A 1YEDB 1PYWB 4OCSH 4RAVA 4OGYH 4JJHA 3PF2A 1KJVB 3TFKA 5JOEA 2HJKA 4DK3A 2BY2A 1HHKA 2OZ4H 1NEZB 2PUQT 4OQ1A 5ITFB 3SKNB 1DEEA 1AD0A 4KY1L 1UWGL 1JNLL 1FFOB 2FWOB 2XA8L 1I7UA 1BZ7B 3IFLL 5D7JA 5E2JA 3QNXA 4L4TA 3ARYA 5FA3B 1S9XB 1VCAA 4TTDD 3TZVA 2AABH 1KULA 3VRIA 1WAAF 4LCCB 1F3DH 3VDAA 3BZDA 1U3HB 4GKZA 3SKOB 3N85L 4G6JL 2VDMH 5D1ZB 1FIEA 2R8SL 4K8RD 3RDTA 4EI6A 1CDIA 5EU5A 4IMLB 3NCJH 3FQRB 3VG9C 3VFSB 3DV4A 4K7PX 2WK2A 3S3JA 4PJ5B 1I4FB 4YAQB 3ILPB 2P5WA 5C6TL 5JPNA 5DVKA 1NCBH 3ROOA 3BUTA 3MRGA 1YN7A 4NO3B 4N0YL 2E7HA 3NMEA 3MGOB 2D9QB 3WHE0 5DD3H 4POZD 3B9VA 4UILH 4JG1L 5D8JL 3OR7B 2NY0B 5EWIH 4XVTH 4DQOL 1JVKA 5C3LD 2NLJB 4Y8AA 3G08B 1Q94B 2P24B 3ME0A 4BSWB 1C1EH 1G0DA 1IGCH 5IQ7H 3T0ED 3HHRB 2I5YH 5HHVH 1IC5H 1YNTB 2GAZA 2XY1A 3MUHL 5GGRA 1OARH 3B3IB 3LS4L 5E99H 4WI2A 4Z78A 1JWUB 4XVJL 4NN7B 4PJXE 5EZLA 5I2IB 2XTLA 3TN0A 1TXKA 5CS7A 2CRIA 5ENWA 3BHBB 4M00A 2C3GA 4OM0L 2L7UA 2YMXH 2YPKA 3IDNA 4MAYB 3WL9A 1OAYH 5EC2A 4YLQT 5HHOA 3VW3H 4MX7A 1IC4H 1W72L 3K46A 5HD8C 5EOCJ 3T0WA 4Q58C 5D6DA 1A7PL 4MJ6B 1MEXH 3SE3A 1JF6A 2ZZUT 2JIXD 3RGHA 2J5LC 1FG9C 1I8KB 2X1XR 3HAEA 4ZAKB 2YBRB 4WI7A 1BJ1H 2YD5A 3TYFA 4Z7QF 2DWEB 1MFAH 4DTGH 2HVKB 2LQRA 2WWKT 4G9DA 1T2QH 5HVWA 3QUYA 2R1WA 1IAOB 5EZIL 1WTLA 1RZFH 2UYLB 3QULB 5K9QI 5C0NC 3MV01 5B8CB 3T0DA 5T1DL 2FR4B 5LQBH 3PV6A 3JZ7A 1XGRB 3IAQA 5FV2A 5DD0L 2CMRH 2NNAB 1T1WA 5ID1B 3HZKB 5CP7B 3CPLB 5A16A 1NDGB 1F6LL 3QDJB 2OI9A 3NIDF 3TF7C 1KTKE 4EN3B 1MJ7H 4DN3L 1CLOL 2YZ8A 4GG6B 1CU4H 2FLBT 3HNSL 5D93B 4KH2A 2VR5A 4PJGE 3OF6A 2X4OB 3QWQB 1C5BL 4NO0D 1EHNA 4TQEL 5DD6B 4PRPA 4I0PC 4HKXA 3QQ9D 1A9EA 4KK5C 2N56A 2OMBA 2X6MA 2XA3A 3FL7A 1QBBA 4KAQH 4TVSa 1KNOA 4PJ9C 2F53B 1ZANL 1RZ8B 3H6JA 3VXUE 4GFTB 4G6FB 4NN5C 5DUML 5IBLD 2FLRT 2W0KA 4LARH 2ZSVA 2Z93B 2BDNL 1OVZA 4LP5A 3S97C 3GRWA 3CFEB 1KBGL 1G7QA 1OP3H 1PZUB 3QIUB 5MEOA 5CAYB 5I71B 4U1KB 1T80A 2DQJH 4PGDB 2NY3B 1A3QA 2DQHL 1KCLA 3TIDA 2V17H 4FFWD 1TNMA 2FX9L 2B39A 4QRTA 1CK0H 3O45A 1BFSA 4NJAL 4EDXA 4P2RE 3IU4H 4APQB 1P7QA 2YXFA 4NNPL 5FM8A 1ITCA 5D2LE 4NM8H 1S5HB 3PWPB 2EYTB 3QRGH 3CXDL 2K9UA 5KS9E 3MV7D 1VFUA 1F3RB 2W0LA 4YDJA 3PHQA 4G8EA 3JSSA 3OG6B 1A6VH 3MBED 4L3AA 4PJHF 4I18C 3I6GB 3MV9D 5SX4H 2HTLC 1YJDL 1DL7L 1LK2A 3U7AA 1LEGB 3WFBL 3I50L 3C9NA 4LSPL 3PG2A 4HKJA 5FECA 1OGTA 4X9GA 3G9AB 2DQGH 4WCYH 4RFNC 5I9QC 4XPAL 5C09D 2VXUL 3UYRL 3T0EA 2O61B 4Y5XC 2WIIB 4JKLA 5J11B 3BH8B 4UV7L 4D8PA 4Q9CA 1PSKH 4OCRL 1RK0B 4B50A 4MNQE 1FL5B 3HUJA 2GUOA 3KG5A 2JCCB 3VFUB 4KDTA 5DRXB 3KPPB 5DJ8B 1LK3L 3G6JB 3AS3A 2I9TA 5GSRA 4LSUH 4M61B 1BVKA 4U6HA 3KLHC 3SDAB 1M7IB 5D7KD 5IG7B 5ALBL 3ZE2E 1MWAL 1U3YA 2XTJC 3U9UB 2CIIB 5E08L 1JTTA 3HAEG 2EXYC 3IFOB 4PGZA 3DLQR 4LPVA 2DDQL 1H5BC 3MR9B 4CDHA 4QTHB 2JIXA 5I1JH 3O6FB 3LEVL 5GRJL 1DN2A 3CUPB 3LAFA 4HDIA 5IUSA 3F7RA 4RAVB 2ZCHH 4U1LB 3L6FA 4G8GE 3DVNB 2QADC 5EFIB 3V7MA 2V2WA 4PY8I 3JV5A 1ACYH 3LKNA 4UDUB 5J1AB 1X5YA 4JFDB 1BQSA 3TA3B 1DEEB 3D0LA 4UDTA 1INEL 1AD0B 2VKXA 2DQEL 1I7UB 4L4TB 2HYMA 3TZVB 1XIWC 3VFRB 2EYRA 4A6YL 4GKZB 1G1CA 4NHUA 3KWWA 2BNQD 5HHQA 2DBJA 3DVGA 4KY1H 1UWGH 4ZUUB 5T33L 2XA8H 1RSFA 3RY6A 3IFLH 3E0GA 4NO0A 2P5WB 3JV4B 3L5HA 4P2OD 5JPNB 4JCMA 3N85H 3REVA 4G6JH 3MRGB 4QNPE 1YN7B 4JEGB 3B9KB 1DUZA 4C56E 1HYSD 3CFJA 1BZQK 3FQNA 4XNQB 3T0BA 1MCKA 3SJVA 4LF3A 1DQML 1CTOA 1G7IA 4YDKL 4S1RL 2YZ1A 3RGVC 1T0MB 1OAUL 1U8NB 2R15A 5DMGC 5BRZD 3BW9B 3N9GH 5HGHB 2DJ4A 3BDYL 3TC9A 1I1YA 1OAQL 5C6TH 3MGAA 5F21B 3ARFD 5E9DE 3P2TA 1U8JB 5B21A 1G0YR 4YJZL 4N0YH 3C5JB 4X4YA 1K8DB 1EDQA 1LE9B 5GGSY 3O9WB 4LLYA 4V1DE 1BD2E 3OKOA 4HUKB 3VXOA 4U7SA 4JG1H 5AYUL 5A3ID 3TN0B 4TVPD 3VD5A 1RZIB 5I74C 2EE2A 3O3DB 1JGEB 4UIKL 4F7EA 2FX8L 3IDNB 3SCMC 3GUTA 3TJHA 3WL9B 1Q9LA 5EC2B 2WV3A 4KUZL 4YIQB 3S35H 1V3JA 2IPKA 5EUOA 1CDBA 3LS4H 5L88H 2H2SD 2PF6A 2B7DT 1X5XA 2CGRL 2YD1A 3GSOA 4AIXA 4EQ3A 3HAEB 4YHYC 2Q86B 1CGXA 1RIUL 4L3CB 2X5PA 3ARBC 5MHSD 3H42L 5JOFB 2R1WB 2Q7YA 1W72H 1GPOH 4JGUA 3RY5A 5SWSA 5TE4H 1A7PH 1QFHA 5DT1L 4ZDHA 2VDLL 2Y7QA 5C09A 3HZVA 3HE6C 3IYLW 4NP4L 4HMCA 2YPVH 3ZL4L 1XGYL 3DETC 3C2AH 4IS6A 5A16B 3ROLA 4M9PA 1FAIL 1KFAL 1KTDA 3BD3A 4P46B 4HV8A 3VG0L 1CLZL 2OI9B 2X10A 1A6PA 3CFCL 5D1XC 3BP7A 1L9NA 4G42A 5JLZA 1JL8A 1A7OH 4KKAC 3QHTC 4MJ4A 4XP1L 2FECL 5T1DH 5F7MC 4K3GA 2Y25A 2OX5A 5T1KD 4QT5B 2QR0B 1UA6H 5DF0A 4EUPH 4ZXBC 1FE8H 1GC1C 5E00A 4PJBE 2AK4D 3HCVB 1CLOH 5AZ2L 3GMMB 2ZJSL 1IKNA 3BI9X 3P4MA 2ZSVB 3I02B 5FHBH 5TDPA 4LSVL 4URTB 4QHKJ 5LCVL 4TQEH 4YX2L 1CGWA 1G7QB 3OAUH 1HE7A 5FGRA 3QCTL 1D5ZA 1OF2A 2GHWB 2R2HB 1FVEA 1TQCB 3TIDB 2VZUA 2DQUL 2LAGB 4PJ8D 5CJ8A 1HOCA 1ZANH 4I13B 1XGQA 1ETZA 3PHOB 1PX4A 2XG5A 3VXNB 4QHMA 5DJ6A 4JM2A 3O45B 5I1DA 1T03L 5IOPA 2HH0H 3KLAA 3ZTNH 3QFJD 1TZGH 2E6QA 2WQRA 4EVNB 4F37F 1A3LH 1DTUA 1KBGH 2NXYC 3UTSE 4GQ9L 3BN3B 3Q5OA 4L4VE 1OTUD 2IF7A 3X11A 3FB7A 5DWUL 1QEWA 4YDJB 4P2OA 4G8EB 3GSUA 2FX9H 1MCWW 1PEZA 4AT6A 5GRVK 1FNEA 4DGYL 3FTGB 4U0RC 2H8PB 2NTFB 5HHNB 3CD4A 4OJFH 5T3XL 2FCBA 2JF1A 4O2EA 4PLKC 5FECB 2DBLH 3CXDH 1OPGL 5GGVY 5BRZA 1TETL 3FOMA 4QHNA 4PYHA 2H32H 1A7RL 3T0EB 3ARFA 4EJ1C 1LO5A 3F7PC 3QNZB 3WV0A 4XP5H 3MRQA 4HIEB 2Y36H 5FO7B 5HYSA 4NHCL 1YJDH 1DL7H 4AEEA 2NX5D 3MBXL 1HEZA 4PV8A 4M8QA 3I50H 5E8EA 1RU9H 1D9KD 3QIBA 4I4WA 2ICWI 3BKML 1RUQL 3NACL 4H1LB 4OZHE 5F7LB 2BOBA 3QJHA 4GKOA 2FO1A 4LAJH 4XPAH 2NYYC 4L9LA 1BVKB 2VLKE 4U6HB 3AMKA 4I1NB 5F9OL 5E2VL 2QKIB 5C0EA 2ADFL 3NGBC 3BO8A 3IDUA 4UV7H 4D9QE 4Y4HD 4OCRH 2FHBA 2JIXB 2R39A 4R26L 2XV6B 4HDIB 3I6LE 4LDLB 1M05A 4DAGL 1Q1JL 1LK3H 2MFNA 2OR9L 3TESA 2D4DA 3TV3L 2FRGP 2HKFL 2XKNA 4F7TA 2XNAA 1MWAH 2C4XA 4UDTB 1YYLL 2Z0BA 1BOYA 5F9AC 1AGEA 3HRZA 2GSGA 1SJHA 2DRUA 4XC3L 3MLRL 5GRJH 4WJ5B 1WSST 3D87B 4LRIC 4M02A 2C7UA 4M48H 5MEQA 1X5FA 2EYRB 2YD9A 4OIIH 6CGTA 4NHUB 3B8YA 3KWWB 2VIRA 3HMWH 3BD4A 3QEQA 2DL9A 3GK8L 2DQDL 1HH6B 1DCLA 1DQTA 2DQEH 2MKLC 3BFOA 2VZOA 5DRWA 3O2WH 2A83A 4F33B 3UP1A 3U4EB 5T1KA 4NO0B 2FH6A 1QNZL 4X4XA 2R4RL 4A6YH 5CJ5A 2H9GA 5KVDH 3REVB 2W9EL 1X5LA 1CI5A 1WBXA 3CFJB 4FQCL 4HCRA 1U95B 3TO4A 1YEEH 4LF3B 2J8OA 4HHAB 4K3JL 4TUJB 2VITA 4MHHI 1P2CA 1L9MA 3KYKL 5L2JB 1SEQH 3MRMA 3EYQC 4NKOA 2WBWB 3QWOA 4OZGA 2XWJA 4ZUTA 1I1YB 4PDCE 1XR9A 4GAJL 1FH5L 4PJDA 3LKRA 4NO2A 5JIIA 5F3HA 3QEUA 1PDKA 4S1DC 3CMOL 5TF1L 2C4FT 4X4YB 4PJ8A 4KKBD 4UOW0 4AK1A 1W0YT 1DQMH 5LVEA 4S1RH 2D7TH 4YXHL 4GSDL 1AFVL 3L1OH 3BGFB 1XGTA 4GAYA 1FGVL 2HT2D 2XZCL 1H3WM 4GRLC 3MQIA 3K8MA 5C0IA 3GUTB 4Z0XB 4CJ1A 3BPCB 5EULV 1MRFL 1QSEA 3MV7B 2YUZA 5D71H 1D6EB 5D72H 4F15B 2WUBL 4ALAH 4JRXE 4AIOA 1MHPL 5AYUH 3MBEB 1PG7X 3Q2CA 3STZA 3NZHL 3R06A 3MV9B 3BSZL 3OJMB 4XT1C 4UIKH 3UEZA 3EFDH 1PAMA 3QWRA 4ZNCD 2MQ3A 2OJEA 3SDCC 4HWEH 5JDSB 2Q7YB 1MCRA 5DRZA 3FQUB 1F58L 4LSTH 4ZDHB 2PYEE 2Y7QB 3CGTA 5HYSG 5CBEA 5C09B 2CGRH 2CJUL 3HZVB 4O2CA 3VFVA 1G1YA 1RIUH 1U58B 2QSQA 4U7KA 5SX4I 4MCZB 3DYMA 2BVEA 3H42H 1PGRB 3BGMB 1KTDB 2P45B 1D9KA 1I1FA 3P4NB 4ZFOB 4HV8B 3U79A 5GGTA 5CD5D 1VEMA 5DQDL 3O0RH 1SBSL 1JHLL 3OB0H 4ZODA 3L3DB 5JLZB 2EDBA 5DT1H 3LB6D 3P0VL 2IANE 2VDLH 3L9RB 2VERN 4D9LL 4IRSC 5JO5A 2HTKD 3U0TA 1DANT 2D7MA 1FRGL 3AUVA 1DN0A 2WUCH 5D7IE 5F96L 3ZL4H 1LHZA 5IW6B 1FAIH 1KFAH 3RI5K 3KYMB 3VG0H 3CFCH 3DIFA 4YC2B 3FHAA 4RAHA 3QB7C 2FIKA 1JHTA 1HZHH 1L7TL 2DJSA 4PJFB 1ONQA 1PY9A 3P4MB 1I8IA 5TDPB 1ED3B 3LRSA 2H45A 2ITDA 1JPGA 4BKLA 4DN4L 2FEDD 4LK4A 1UACL 5EU6D 1NGYB 1OF2B 1AJ7L 4H88L 3VXUD 1ORQA 1J1XL 2ZG2A 2A6IA 3LKPA 4X6BA 1IM3B 1H3PL 1ETZB 1Q38A 5AZ2H 4LCYA 2ZJSH 3CH8A 3P4OB 3HI6H 1ZA3A 3QI9C 5I1DB 4NT6A 2X4TA 3KLAB 2Q8AL 1EUTA 4LSVH 3CSYB 2BNQB 5F8RC 1UKQA 1OT1A 2R2CA 2IQAA 4CJ0A 4NC0B 4P2RD 2PR4L 3FB7B 3ARWA 2ZP0T 4P2OB 4N1HB 3GSUB 5GGSA 4KQ3L 3BOVA 1A14L 4CGTA 1BF8A 1QFPA 4X9HA 3VH8A 2Q20A 1T03H 3Q1SL 1MCOL 3ULUL 4XMKL 3NCCB 1GCFA 5HDOA 5KTEL 2PO6C 3HR6A 2QHLA 1FNGA 4LCUB 1ZVSA 1KCGC 5JA8B 3RVXD 3OBAA 5DO2C 1BIIA 1M7DA 4X5XA 5BRZB 2AI0L 3FOMB 4XP9L 2YD8A 2GTZA 4R0LB 3ARFB 5LGJA 1WTGT 5D5MF 3MRQB 4DGYH 4DCQB 3G6DH 5HYSB 1FL3B 2Z8WC 4WHCA 5ERWB 2VKWA 1HEZB 4PV8B 4OKVA 1W0VA 1ZAGA 3ARVA 5T3XH 4JZOA 3VXMA 3EUUA 4F9LC 1OPGH 2DLTA 3BESR 5F7FA 4HIXL 3RWFA 1NFIB 4L9LB 3U82B 3BPLC 4QXGH 3TVMC 1A7RH 2AXFB 1A9BB 4MNQD 4PTTA 4PJXA 1Y0LA 5KSUB 4JO1H 2XWTA 2W65A 4NHCH 1N8ZA 3E6HB 3MBXH 3WNOA 1VFAA 3CVHA 1J0KA 4LAQL 4OCMC 3CFDA 2IALB 1PKQE 3A6BL 1RUQH 3NACH 5BJTA 1ZHKA 3VWKD 3C5ZC 2QSTA 3P4LA 4LFHD 3AS1A 2OM5A 5EA0H 5E2VH 2M8XA 3AB0C 4JRWA 1EGJH 5HJ3A 3ZTJH 1OW0C 2ADFH 3ARED 4NKMA 2XNAB 2YA1A 4CVZA 5C0FA 5K9JL 1BQHG 4CMHC 5DJ0A 2CKBB 5J1TC 2GSGB 1SJHB 2DL2A 4G8GD 3KYNA 4WWKA 4L1HA 3C6LA 3SN6N 1A6ZB 2C7UB 4DAGH 2EC8A 5MEQB 5LKNA 1MCFA 1KACB 3WKNA 3C2SA 5CILL 2ICEA 3IKCA 5E4IA 4LPYA 4HFWA 3Q6FA 4GW5A 4JKKA 2HKFH 3TV3H 3FZUC 2CLZA 4YK4B 4Y16D 5KVFL 3UPRA 5DYOB 2QQNH 3QEQB 1YYLH 5HGGS 1F8TL 4AEFA 4Z7NE 4UB0L 3IGAB 2A83B 4JFQA 2P5EE 4XC3H 3MLRH 3MJ6A 2X9YA 5T1KB 4Z8FH 2DS4A 4X4XB 4NQTA 3RVWD 1VB9A 2NY1D 3HNVL 1GVIA 4XX1E 1YNKL 2H9GB 3SO3C 5DSCA 5ITBL 3O81A 4WIQA 1HCFX 2QJDA 3KHQA 5CEZL 4P23C 1JWMA 3GK8H 3H7LA 3HFML 4LSSH 4KJQD 3QWOB 4C56D 4MCYA 1ZLVH 5EZOL 1QNZH 2H26B 2XWJB 4OZGB 5LJYH 2R4RH 4LMQE 5EN2A 5TDNB 3LKRB 4NO2B 3U36B 3QQ3A 5F3HB 3VXUA 4M6NH 3RL1B 2F74A 4FQCH 4KK8D 1KJ2B 4HT1L 2Q76B 2LU7A 4PJ8B 4M6OL 3PWLA 1I7RA 1KTRL 4E5XA 1LD9A 3V2AR 1CGVA 3V5DA 2EKSA 1T7XA 1JGVL 1QHPA 1A4KA 3QFJB 5E9DD 1QZ1A 3BUYA 3GJFK 5C0IB 4JHZA 3GI9L 5FKPA 4HUXB 3FT4A 2APXA 2DTMH 3QZWG 1JPST 4MZ2A 1JJUA 2BJML 2A38A 4XHJC 2YRZA 4P2RA 1P7KB 4EDWL 4ZTPH 4QHLA 4JQVC 1S9YA 2O93L 1AFVH 3WXVL 4FQQA 3O6MH 1U92B 3R06B 2XZCH 1CL7L 2CO7B 1JCKA 2EXWC 4UV4L 5KS9A 5IB3A 4V3DB 1A02N 4TUKH 4X99B 3S98A 3B2UC 5GXBB 3FN0H 1MRFH 1FPTL 3RZWA 2WUBH 4CADA 1CVSC 5BXFB 2OMNA 2PETA 4O2CB 4HKBB 2VAAA 4QRUA 3TBTA 3VFVB 5C0JA 5FFLA 4BQ9A 3NPZB 4NKIH 4KI5C 1BFVH 1BQHB 2VISA 1C12A 3BSZH 3C6SA 3L5IA 3CJJA 4PRHE 2NX5B 5CSGA 2MJWA 2Y1VA 4YXLL 4M7KL 3VFOA 1D9KB 1I1FB 3RUGB 5EORL 1BZ9A 1DQQB 3F12A 4NNYA 4OQTA 3R8QA 2ZUQC 4WFED 2DLEA 1KCKA 5CSBA 3RZCA 5JO5B 3JV6B 3DMMD 2IAMC 1DN0B 2V7NB 4IRJC 4ZQKA 1JNJA 4TTGA 4KJPC 2PXYA 5BZDB 5I15L 5ETUB 2OZ4A 4Y4HB 3C09C 5C7XL 1UZ6F 3OQ3B 5DK0A 4JY4B 1C5DA 1HQRB 4GRWF 3K7UA 1E4XI 3DXAE 5DQDH 1SBSH 1JHLH 3VWKA 5T3ZE 1EO8L 4LHJB 4YHKL 2FIKB 3P0VH 4RFOL 4D9LH 1A1NB 3EDJA 4XBEL 5IT2L 1I8IB 4KPHL 2L0DA 3W11D 3K80A 5C0RH 5I30L 4BKLB 3LCYA 3WUZA 3MJ8A 3CDCA 4P5TD 3UBXA 4JPIA 4HXAL 4ODWB 2COQA 3G5XB 1KG0A 3IXAB 2A6IB 3FQTA 1NCWL 1KYOJ 2X41A 2J3SA 1E6JL 4LCYB 5KAQG 4U0QB 1AI1L 1L7TH 3O2DL 2Z4QB 1ZA3B 1JIBA 1Z3GH 4JQIH 4NT6B 5EC1A 1CTNA 1MF2L 1T1ZB 3GIZL 3VA6A 2YXMA 4DN4H 4L8CA 3IVKA 1U93A 1MFCL 2DD8L 1OP9A 2IQAB 5TGBA 4PLOB 3VCLA 1OTSD 4CNIB 1AJ7H 4XAKE 4H88H 4JFEE 3LPGA 1DVFD 4NQCA 2ICWA 4OT1L 3SKJL 5F9WC 4RWYL 1NBZB 1H3PH 3U6RA 3QZWB 1GXEA 1GOHA 5GGSB 5FDWB 1NBYB 1RUML 1U8OB 2ARJB 3HN3A 5T3XE 1VADB 2Q8AH 4OLXL 1OSZA 4L4VD 2WWMD 2VXQL 4P9MH 4Y5YA 3L7EA 3Q5YA 4N8VG 1A3RL 3BZ4A 1M7DB 4X8XA 4GG8B 4I2XA 2PR4H 1HI6B 2NY5C 2R23B 1NMCB 5FXCH 5HVGB 3V6BR 2GTZB 1FFNA 1KXQE 2K1MA 5I18H 1WICA 1A14H 4R96B 2AEPH 3QA3A 5FIEA 3BEWA 5LGJB 1R3IL 4M5ZL 3ZKMC 3Q1SH 5J13C 3ULUH 15C8H 1N0XL 5KTEH 4Y5VA 3FB8A 2ZOLA 5DJAA 2X44D 5L2KE 3KXFE 4JZOB 4KJYA 4PJAA 1OP5H 4ZUVA 4G7YL 4P3DA 5E8NB 2AI0H 4XP9H 1FSKC 32C2A 4OSUL 1Z9SA 4Z7VB 4F7CA 1XH3A 4V1DA 4ELKA 1BD2A 4PJXB 2Y5TA 1Y0LB 4L4JA 4I3RL 2XWTB 2W65B 5TQ0H 1FNFA 3WFDL 5CWSA 2B4CC 1ZGLA 4LLWB 4HXBL 3EOYG 1KIQA 5BJTB 4WUUE 3E3QA 4HIXH 3FAWA 4LVEA 2BVYA 4NZTL 5GRUL 4D9QD 3CLFH 1X5IA 2OQJA 1F42A 4XGZB 5C07E 4MB3A 4ZOAA 2VWEC 1IC1A 3FB6B 4D9RE 4LMQI 3I6LD 1T66C 5DJ0B 4PRAA 4M4PA 3KYNB 3I84A 5I16A 2MOVA 4MQXD 2CDFA 5HI5C 4XWOD 1B0GA 1BHGA 1MHHA 3LKSA 3S4SB 2Z91A 2ICEB 3QO1B 4HFWB 1JF5A 3Q6FB 4GW5B 3OG4B 4X6EA 2DM7A 2CLZB 4GMSL 4QXTB 3UPRB 1H3TA 2NCMA 3DX7A 3DRQA 5K9JH 5IB2B 2CLRA 4RNRA 1GHFL 1MVFA 4K7PL 1NFDE 1UB6B 2BX5A 2UWEE 2DQCL 4FP8L 3A67L 5CILH 4HC1L 2R56L 4OGAD 5GGUB 3X13B 3L7FA 2EIDA 2PKDA 1HWGB 1J8KA 4PJGB 4KRPC 5KVFH 1JWMB 1KOAA 4Y0GA 3BZEB 3EYUL 4LCIL 3HB3D 1E6OL 4MGXA 3PL6D 2J88L 2VLJE 3L3HB 1T22A 1T1YB 1YPZE 4MCYB 4LCCC 1U91A 1U3HC 5EN2B 4K3EH 2CUMA 1HHJA 4N8VB 5EU6B 3VXUB 5FHAL 5ITBH 4U49A 1S8DA 5LXGH 1KC5L 3HG1E 4IJ3B 1H15B 2EKSB 2OK0L 4W4OA 1ES0B 3TM6A 5IWLC 1A4KB 1QPPA 2HRLA 3BUYB 3UDWC 1KB9J 2BRQA 3D25A 3S88L 2NY4D 1JZ5A 1RUPL 3RTQA 4O51A 4PUBL 3D3VE 5LWYL 1TVBA 2BVTA 4NFBA 1U36A 2MQ0A 4P2RB 5L6YH 2VABA 3FOLA 4M6OH 5FUCC 3ABZA 3QSKB 3FB5A 3RPIB 1S9YB 3IKKA 5D2LB 3UTSA 1JGVH 4P48A 4PJIA 2Z8VC 4MA1B 1MFNA 5KS9B 3GI9H 1JYWA 3GSWA 4OZ4A 4RDQG 2ILLA 2X89A 2VL4A 4JRXD 3RWHB 1M4KA 1HHHB 2BJMH 4MQSB 2HMIC 1B4JL 3RFZC 5DFVD 4EDWH 1CIDA 2EIBA 4CADB 1IQDB 4XTRD 4QRUB 3TBTB 1VFMA 4NN7C 4QRRA 4XCNA 3VRJA 3WXVH 4O4YL 4MXQC 1LP9F 1C12B 1CL7H 3C6SB 4UV4H 1G7LA 1CXLA 4DKEL 1QLFA 4E9LA 2PW2A 2YSSB 4JO4L 4FMFA 3VFOB 4DOHE 1FC2D 5IFJA 2D0GA 2PYED 4FTVD 2E9IA 3H7BA 4CBPA 4HJ0C 2ED9A 1FPTH 3F12B 5KJRL 5ICZB 3GBNL 5LAXA 3BIKB 4G6AC 3OAZK 1NFKA 5CGTA 4MNQB 2VDPL 4ZQKB 4PYGA 1EFXD 4OZHA 5KSAA 4IIQC 4XXCC 2E9JA 5DK0B 3KJ4C 4M7KH 4HH8A 2IAND 1C5DB 2VLKA 1W8OA 5EORH 4OV5A 3P0YL 1ZV5A 3VWKB 4PJCE 4D2NA 1QLEL 2I60L 3QDGD 3EJZC 1RQ5A 1U3JA 1CT8A 1JNNL 1U2HA 5B8CC 4RRPA 2E8ZA 1YEKL 1WT5A 4ODTL 3AREB 4GLRH 4P4KD 4MHHG 1OCWL 3MJ8B 2CO6B 1WISA 4G8GB 4QYOA 4HULB 3FQTB 4EN3C 5BVJA 3RP1A 1T7ZA 1FG2B 5JDJA 3QUZA 4RFOH 5IT2H 4KPHH 4Y16B 1JPFB 5JA9A 1KUMA 4YR6A 3UZEA 1UH2A 1U93B 3IVKB 1HSAB 2XRAH 3VCLB 2R69L 5EO1B 5DGRA 4PTUA 2ICWB 2ATPB 1JGDB 4XNXL 3V6ZA 1R0AL 5DC4B 1NCWH 2P46B 1WITA 1E6JH 3H8NA 4UIMA 4OLVH 1DBKL 3TNMB 5CSZB 1BLNB 5HYIA 5FYLH 1ZS8A 4G6ML 1QTYT 5H8DA 1E27A 1CD9B 1CG9A 3GIZH 2LABA 1OSZB 2RQ8A 4XCEB 4AEIH 4X0KA 1MFCH 2DD8H 5B3NA 1WF5A 5I71C 4EKXA 1CGUA 1YDPA 3BZ4B 3IDGA 3LH2H 5FCSH 4OT1H 4C56B 3H9SE 3EHBD 4NUJA 4RWYH 4LRNH 5M94B 5D9SB 4FQ2L 1OLZA 4XI5C 4X7TB 4CMMA 4ZO6A 1OY3B 1RUMH 3BRDA 3QA3B 3CSPA 3BEWB 4WTWA 2F8VA 5F7UA 4H0IA 4APQC 4UT7L 3F7VA 2ZOLB 1RI8A 4YUEL 5GHWL 3VE0A 3W2DL 2IFGA 2A6KA 2D7NA 5E9DB 4X6FA 2IMNA 1VKXB 4X6DF 1X4ZA 4LLMA 2R4SH 1RV6X 4PD4K 4FQ1L 3NZ8B 1XH3B 4V1DB 4ELKB 1BD2B 1E4WL 1R3IH 3INUL 1KCVH 4M5ZH 4G6KL 4UAOB 1N0XH 2FZ3A 4MS8C 1W72A 2DAVA 1WUNT 3QCUH 4R3SA 2ZOKA 1ZGLB 1A1OA 1U8IA 4WY7L 4M7LH 1OAZL 1A1MA 4LLDA 4JRXA 1MQKH 1TENA 4F58L 4LCWE 2AXGA 2OQJB 4D0DA 5J11C 4I3RH 4TRPH 3WFDH 4K8RL 1S7TA 4FQXC 2YPLE 1UZ8B 4OI8A 4HXBH 1KIRA 5I16B 1RHHA 1FYHB 2CDFB 4LL9A 1DDHB 4BYHA 4PR5A 4U2YA 3DUSB 1MHHB 3LKSB 5C8JB 4NZTH 1CGTA 4Y2DD 4EUPA 4U2ZA 3DX7B 3DRQB 5EOQL 3DX8A 3E2HA 2CLRB 1EHLL 4XC1L 2BFVH 3O6FC 3QFDA 3DMMB 5DEZA 4NUGL 4QTIL 1XGUA 4ZYKA 4MA7L 1EFXA 1NC4A 3IU3A 3TFKC 4G8FB 4H20H 4RIRA 2IANA 1R5IA 2W60B 3L7FB 1S5IH 2E8YA 2AQ1A 1MPAL 4GMSH 2P5ED 2DQIL 3RIFF 5D7IA 5DTFB 4PJ7E 3RWCA 1ORSB 3FQWA 2J7LA 3S35X 1GHFH 5D7JC 1BAFL 2Y9RT 1H0DB 4K7PH 2VQTA 3S36X 3PP3H 4PJBB 2YUXA 3TZVC 4P4KA 4MVBA 4LLUA 2H3NB 1IZKA 2DQCH 1IGFL 4FP8H 5FB8A 2X4RB 4P5TB 4GS7C 4WI4A 4WTZA 4R4BA 2ZWLT 1KN2L 3JWOL 1D6VL 2AJXL 2D9CA 1EEZB 1S8DB 1YECL 2DMCA 3KDMA 5DMKB 3RDTC 3T0XA 3EYUH 1T5WA 2B1AH 4LCIH 2UZIL 3F5WA 3KPOB 5HGAA 5F9JA 2J88H 2QHRH 4Y1AE 2MQCA 3LD8C 2WAHA 3CDGA 2Z35A 3BKYH 3L3GA 3WLWD 5DJYB 3TIEA 4P5KA 2Z31A 4O51B 5FHAH 2QBWA 2W92A 5H2BB 1DVFB 1TVBB 1CFNB 3OXSA 1ZT4A 3NH7L 5DHXB 2CK2A 3HC0A 1YN6A 2VABB 1KC5H 3FOLB 2R0KL 4IDJL 3FB5B 1J05A 3B6SA 2O5YL 2H32A 1N5YL 3IDMA 3QNYA 4R9HA 2BXZA 2MMXA 1KENL 4L4VB 1FVDB 3GSWB 4OZ4B 1IGIL 2AKRB 3S88H 3DSFH 4PUBH 2W59A 2OYPA 3D9AL 1NL0L 4ZS7L 5F7KC 5HGBB 1G9ML 3GSVA 4FQLL 1XF5B 1IAIL 2WBJD 1C7SA 1MIEL 3MO1B 4RWHA 3V6OE 1CFSB 1S7VA 3BMWA 3VRJB 3TN0C 5IR1A 2VXSL 4QHUA 3H9ZA 4BK4A 2VH5L 1XZ0A 2E7BA 2W9DH 4U1GB 1G7LB 3K8KA 5ANME 4HF5H 2PW2B 5C0AA 2IH3B 5GQBA 4KGJA 2ZCKL 3TT1L 3LN5B 3JUYA 4P9HL 5AUMB 2CRZA 3PQYD 3P77A 4BQ6A 3HKFA 5B38A 5IJKA 1F11B 5D6DC 1B4JH 3SE3C 4YE4H 4EBQL 3L3JA 5LAXB 4PRHD 2BRRL 4ZTOL 1FBIH 4KDVA 4KI5F 4HS3B 5D96B 4O4YH 1H3VA 1JNHB 4W6XB 5IK3A 1SYSB 4OZHB 5KSAB 4NZRH 4DKEH 1MWAA 1CZ8L 4JO4H 1CXKA 1NAMH 1PLGL 4WTXA 3QUYC 1YMME 4L8SB 5KJRH 3GBNH 4FXGA 4FZ8H 2X05A 4YH6A 2Y4SA 3T09A 1UB5B 1Q72L 3FT2A 3DXAD 5FAAA 1AXSB 3LQAL 4YO0A 4U6VL 5T3ZD 2P4AB 4EIGB 5FYLE 4QYOB 4N0CA 2OI9C 4HGKC 3V0WH 4EUPG 4W4NA 1ZT1B 4Y4KD 5BVJB 1QLEH 2I60H 1JN6A 1JNNH 1Z9LA 5E70A 4A6YA 1I9EA 4ODTH 3IRZA 4DW2L 1OCWH 4YR6B 4JHWL 4ORGA 1CDUA 4LGRB 4IDLA 1ZXQA 2W1NA 5J6GA 4PTUB 1JPSL 4FABL 2QSVA 1P6FA 1JUFA 3MXWH 3BYYA 1ZLUK 1J0ZA 4XWGL 3OX8B 4UT6L 4TULL 5E8PA 1ZS8B 4MJ5A 1TVDA 4HSQA 5BV7B 4OFKA 2P5EA 3L3OA 4XAKD 4JFED 1WFOA 4KRMB 4X0KB 2R69H 4ZS6D 3MNWA 5J9PA 3PL6B 1YDPB 3MOBL 3P73A 4GG6E 4X80L 3IJYB 4ZFOL 3WD5L 1UYWL 4TTDC 4NUJB 4XNXH 5CEYB 1BX2B 1R3KA 1R0AH 3OKNA 3V5HA 4WNQA 1DBKH 3JV0A 4PGBB 3RVUD 2EH8H 4OF3A 3QG6A 4G6MH 4P4RB 1BECA 4KZDL 5D6CB 4K8RC 3LEYL 5I1IL 1KB5H 2GY7B 1EEYA 4HG4J 5KSBF 1NC2D 2A6KB 3AXLA 4YZFE 5DD1H 1O7SA 4LLMB 4BUHA 4FQ2H 43CAA 2NY4B 3GSQA 3JTTB 4WU7B 3ETBF 5L2KD 3KXFD 1F4XL 3GZKA 2VN4A 5F89A 4WO4D 4UT7H 1P4LA 4POZC 3TPKA 5F6IC 3WLBA 2VDKL 3D2UD 2ZOKB 3MA9H 1AHWA 2XZQL 1S78D 1U8IB 5GHWH 3W2DH 5HXMA 1RD6A 3IT8D 1Y6KR 4ESKA 3MLUH 1EO5A 5KSVA 4LLDB 5CZXD 5I0ZA 1L0XA 3T0EC 4JRXB 1MAKA 4FQ1H 2AXGB 1E4WH 3VGDA 2ARWA 1D5IL 4G6KH 4D0DB 1MLCA 3CZJA 2OTWA 4WUUD 3V5KA 5AYQA 4MAUH 4E41E 4YHPA 4OB5L 1T83A 3PWJA 4J3UA 5IBTL 4KDTC 1RHHB 5KVGL 4WI6A 5I75B 1KTLA 5B38G 1ZHNA 3ES6A 5C07D 2BVPB 4LQ1A 1F5WA 3L3KA 4LASH 4D9RD 2ITCA 4TUOB 1QBLL 2PYEB 3BWAB 4EUPB 4F58H 2P8PB 3MREB 1VFOA 1WZLA 1NGXB 3LN4B 3AU1B 3DX8B 5HDLA 3E2HB 2V9RA 2EIEA 4PRHA 1YC7A 2AK1L 5TQ2H 2BY1A 2V2XA 3UAJC 4OGZA 3MNZA 4XAWL 4ZYKB 3ESUF 1AQDA 3KPLB 2MCPL 1EFXB 3SE9L 3QBTB 1NC4B 3IU3B 1FZMA 1UZ6E 3HE7D 5IBUG 5I19H 1HCVA 1ZA6A 4WHDA 2VC2H 1S7RA 2IANB 4GRWE 5L0QC 4OBSA 3EDEA 3QDGB 1Q8MA 5D7IB 5EOQH 4XBPB 3RWCB 1EHLH 3MRKA 4XC1H 3FQWB 1AY1L 1G7HA 4IHOA 2CRYA 1QKZL 3HNTL 1A7NL 4NUGH 5F70A 4QTIH 4P4KB 3AS0A 4LLUB 4TVPL 5GRYA 4MA7H 5FB8B 3V4PL 4R4BB 3VD7A 3SDDD 2X4PB 1G9MC 4R4FL 5FO9B 4GKNA 1EFQA 1MPAH 4Y4KA 2VLJD 1CDCA 2KBGA 1IQWH 2DQIH 3CX2A 3NCEB 4PJEF 1B6UA 1T5WB 1SM3L 1CGYA 3F5WB 3RY6C 5F9JB 1BAFH 1UKTA 1Z9MA 3KYAA 4ZFZA 4G9FE 1E4KA 3MRNA 1IGFH 3CDGB 4H1LH 4YHML 3L3GB 3RAJL 2OBGA 3O8XD 3KPRE 4NQDE 2X40A 3QQ9C 4K9EH 3HG1D 2D03L 5GISL 4ISVB 3JWOH 1WIPA 2AJXH 3HC0B 4PS4L 1YN6B 1MFEL 3DBXA 5D4QA 1J05B 1FVCA 3B6SB 2R2EA 5C0GA 4AG4H 2H32B 2A77L 2CKBL 3S7GA 3CC5A 4XX1G 3O3EA 3QNYB 3RWGA 4NKQB 2CLVA 2R29H 3QQNA 4XVSH 1P5UA 4HBCH 4K7FB 1OAKL 4YXKH 1NPUA 3GSVB 3NH7H 4GW1A 4XCFL 4FFWC 2R0KH 4IDJH 1PJ9A 4UQ3A 3RNKA 1AP2A 1S7VB 3TJEL 2IBBA 1S9VA 3CFBA 3LQAC 1D7FA 2V7HB 1N5YH 4FG6C 1XZ0B 2EH7L 3OV6A 3TJHC 1B6DA 3DOSA 3P77B 3I2CH 5B38B 1AIFA 3D9AH 1NDMA 4F15C 1LMKA 4MLSA 1IAIH 1OLLA 3L3JB 1MIEH 4PGJA 1FJ1A 3OJDB 3KPTA 2VXSH 4WW1A 3BDXA 3KXFA 5L2KA 3N06B 2VH5H 5IK3B 1EGJA 1YA5A 4TSAL 1MWAB 2X4UB 4P9HH 4X7FC 1HSBA 5IBUB 3JWDC 1GGCL 5D70L 5KN5A 4RBPK 1KJ2L 4FXGB 3IJHB 5DQJA 1R3HA 2BRRH 3S9DB 1F4WL 1HHGA 2Y06H 4P59H 5ABDE 1VESA 1PKQB 3CVIH 2Q6WA 2Y6SC 3WFCL 1XCQA 4YO0B 1CZ8H 3MLYL 1IT9L 3ZYIA 2GTWA 1PLGH 6FABL 5DI8A 2E3VA 4U1JA 1PD6A 4G80A 3LQMA 1JN6B 3U0WL 4Y2DB 2BHZA 1INQA 1TTGA 5FGCE 5FUOL 4BH7B 4XNMA 4H25A 4ORGB 4PB9L 1AO7E 4OIAA 1IKFL 1WFNA 1MCWM 3VFWA 5J6GB 3TGXA 1JUFB 2HAZA 4YC2C 1K6QL 1JPTL 3PNWA 3D6GA 3HE7A 1RUKL 5GS0H 5E8PB 2SEBA 1IKNC 1NUFA 5DZLA 3WIHH 4HWNA 3QAZB 4AQOA 1I3GL 1HKLL 2P5EB 3L3OB 1LO2L 1XMWA 1NFDA 4R7NA 1HYRC 2NW2A 3QJFA 4LEXL 4JHWH 2UWEA 4WVRA 1T20A 1UEMA 2BHUA 1Q9KA 4NNXA 4N0UE 1R3KB 3EGSA 3OKKA 1VFBA 5HDQL 3OKNB 3V5HB 4WNQB 1EAJA 3SDDA 5K9KB 4JM2C 3WUWA 3KPQA 4TULH 4UT6H 3ARDD 3F7YA 3QDME 3QG6B 2BVQA 1EH9A 2VLJA 2XG4A 5I1LB 1YPZA 3ARGA 1EEYB 2CIKB 1D3CA 4FQIL 1CDJA 4X80H 3WD5H 1UYWH 1TCMA 5CJXA 4P2OC 1ZT7B 4OFDA 3CZFA 3ALWA 3GSQB 1HILA 4MSWA 1HYSC 3HG1A 5HGDB 1KJ3L 1I1AD 4Z7UF 5F89B 3LEYH 5I1IH 2KPNA 5FOBA 3VXRE 3WLBB 3UTOA 4B41A 4G43A 3WIFA 2GI7A 4EZMA 5I73C 3D3VA 2AW2A 3MRCB 5KSVB 1AD9A 5IKCA 4MNGE 3ARFC 1Y18A 3U7WL 2EC9U 5DQ9A 3ZDZF 3NVQA 5GZND 3DGCR 4M1GL 1J5OH 2Z92A 5CHNB 1MLCB 2OTWB 1FDLL 2WBJB 1CXFA 4IM8A 4NWTL 5DR5L 5EO0A 1EA9C 4YHPB 1JGLL 5D1QA 3QIBC 5C0BD 4Z95L 1Y6MR 3MV8E 3W0WA 2XZQH 1LO4L 3QG7L 4OM1L 5DZOA 5HD8D 4QCIB 3VFTA 3DV6A 1A6TA 1RZKC 4OD3L 2X4SA 5E8OA 1ZHNB 3SGDI 3V52L 3PWVA 4L9LC 5INDA 4GQPH 2ITCB 2VZTA 3PQYB 1YEHL 3TPUE 2YPLD 4W6YB 1D5IH 4N90E 1ND0B 2HT3C 4JREC 4KHXH 3AC0A 4QXWA 1Q9WA 4PRHB 3ZTJG 2JCCF 1TTFA 3ZE1E 4Y7MA 2QEJA 1RJZA 5JORB 4J3VA 2V2XB 5KVGH 5M7QA 4JQXA 3PABA 3VDCA 3NFNB 1IGML 5C0ND 1YYML 4UQ2A 1ZA6B 3OL2A 4HPYL 1S7RB 2PCPA 5KOMC 1ACZA 1QBLH 5ECJE 2ZUTA 2D31B 2NZ9D 4UU9B 5F6HI 1EZVY 3QHFL 2BNRE 3MRKB 5HHMA 4KV5F 4RZCB 3OAYH 4HUMB 4V3EB 1II4E 1YMHA 1I8LA 4PRNA 3DXAB 3K81A 2MCPH 2AJYH 3MACL 4PJCA 1QOKA 1XGPA 1X5AA 1Q9OA 5C08E 1SJVA 4Q6IA 1XAUA 4Y4KB 5I1GH 1GOGA 4K7PY 1UFUA 4YFDB 4DJMA 1KN4L 1LE5B 1M7XA 4WI3A 3NIFF 1QKZH 3HNTH 2HLFD 1G6RB 1A7NH 4HGWA 3GI8L 3UTZB 1MREL 4DK6A 4OFYD 4TVPH 1RVFH 3V4PH 3BGAA 4AH2A 5D7LA 3TWCL 1ITBB 3WO4B 4Y19E 2MKWA 3FCTA 1BBJA 3TO4C 5JHDD 4Y1AD 3R0MA 1H8OA 3FONA 1KEGL 5E6ZA 3HLAB 3K4DA 4TOYL 4CAGA 1P6AB 1IL1A 4BH8A 3O3EB 3RVTC 4JFEB 3RWGB 2CLVB 3MFGB 3T4AA 1KEMH 1HKFA 1T7WA 4YHMH 4DUVA 5D2NA 1E28A 3LKOA 4F9PA 3WUWG 2D03H 5GISH 4MA8L 2BXYA 4GW1B 4PJ8C 4PS4H 1MFEH 3GJFH 4UQ3B 1LEIB 3LS5L 3M8OH 3RNKB 5BOPA 3N50A 1S9VB 4XPFL 3ARDA 3WXWL 1M6OB 1YNLL 1PG7H 3CFBB 2VQUA 4O9HL 2A77H 2CKBH 5CMAB 3P9LA 3H9SA 2RBLA 5DHVH 1NC2B 1JK8A 43C9A 2KL6A 4WEUD 5BCAA 2L7JA 1OTUC 2HTLD 5DUBB 3MOQA 2A74A 4XCFH 1RIHL 4NQVB 1EBPA 2FX7L 5I76B 1FJ1B 4N8CL 3VGGA 4LHUA 1PZ5B 3OXRA 4JVUA 5L2KB 3KXFB 1I1AA 4LPUA 5HDBF 4WO4B 3MNVA 3MLZL 2ZUWA 3D2UB 2RCSL 3IDIB 4BM7A 5GJTL 5TFSL 1HSBB 3BX7C 1A7QH 1NKRA 4Z6AT 3MRDA 2NZIA 5KN5B 1FYTA 3RX5A 5DK2B 5DQJB 1CGSH 2F15A 1KSRA 4JZJA 4KDWA 1P4IL 3SKUD 1NMBL 2Q6WB 2UUDK 1GGIH 1WWBX 4WUUB 5GRWA 1XCQB 5AD0A 4R2GD 1YMMD 4RAUB 5GGVL 1ODAA 3MV7E 3R0NA 1NANI 3KLHD 1D9KC 4FHBD 1G9NH 3LHPH 2GTWB 4YFLF 3CSBA 3SBWA 2EXYD 5DI8B 4LCWA 4U1JB 3T77B 4OZIF 1P5VA 4L8BA 5D70H 5JW4M 4D0CB 1CBVH 5C07B 1KJ2H 1DFBL 3ELAT 3MV9E 1ZLSL 2BVOA 1F4WH 2YPLA 1INQB 4M62L 5FYLD 4LSRL 1IEBB 4ODXB 3RVVD 3WFCH 4XNMB 4H25B 3DRTA 1CXIA 2V5TA 1NMAH 2VR4A 3MLYH 2O5XL 1IT9H 3VFWB 1MCNA 4ZD3L 6FABH 4R90H 1NEUA 4HS6A 3GMNB 3PNWB 3HE7B 1DLHA 2SEBB 2YA2A 3IDXL 5IHUL 4JN2A 4KC3B 4MDJA 2DQTL 3VXSE 3I3EA 4MXVF 3QJFB 2UWEB 1GL4B 4PB9H 4X9FA 2NQCA 1Q9KB 1IKFH 5E1AB 1QQDA 3ARTA 3OHXA 5IB4B 2EDHA 5GS1B 5D7KE 3EGSB 2X4NA 1JPTH 3SDDB 4OF7A 1RUKH 3F7YB 4PJ7A 1KPRB 2AV7B 4PP2B 1CS6A 1I3GH 1CDHA 1LO2H 2VLJB 3G6AA 3PGCA 3CH1A 2KH2B 4GXUM 3ARGB 4LEXH 1KIPB 4P5MB 4HS8L 3VWJA 3EJJX 1UJ3A 4XXDA 4YHLL 4OFYA 4CU8A 5BW7A 5CIPH 5HDQH 2BY0A 2XICA 4U6TA 3O8XB 3QR2A 1HILB 3HG1B 1OQOA 4M8VA 2XQBL 1C5CH 2AABL 3TBVB 5SWZE 1MCJA 2XY2A 1KJVA 4YEEA 5E4EB 5A43C 4XNUL 2OR8A 1DBBL 3SKNA 4M3JA 5ITFA 1JGUH 4FQIH 2OP4L 1BQUA 3NOIA 1NMCC 5TE7H 2FWOA 1CF8L 3NCJL 5HPMA 3GMOB 3QPXL 5J7CC 5IKCB 4JO3L 2E9WA 5HHPB 2FJHB 5DQ9B 1EEQA 1S9XA 2P44B 3O4LE 2Z92B 1IZJA 1WFUA 3SCMD 5DJZB 3VJ6B 5EO0B 1FO0B 5DZNA 1H3UA 5D1ZA 1IFHL 4LVOB 3DV6B 2HT2C 2X4SB 5E8OB 4JANA 2G2RA 3CXHK 4OKDA 4UILL 5ID0A 3ECBA 3PWVB 2VDQH 4IMLA 3FQRA 5AEAA 1FORH 4K71C 4PJ5A 1I4FA 4L29B 3BT2H 3V6OA 4E41D 3ILPA 4M1GH 5F1NA 4UTBL 4J6RH 3ARBD 1IGCL 1UKSA 3ISWA 3LN9A 1FDLH 1R5WB 5HHVL 3HUJF 4FFYL 5DR5H 1RULL 4NZDA 4ZOCA 3BPOB 2IPUK 1RJZB 1OARL 2F5AL 1LO4H 4DOHB 3MGOA 2ERJB 2C1PB 4OD3H 4HBQA 2GW5A 4UQ2B 3V52H 2JB5L 3U30B 1LGVA 3HE6D 3IS0X 2YMXL 2NLJA 1Q94A 2P24A 4KJWD 4BSWA 2CDEB 4NM4L 1DR9A 1YNTA 4WWKC 3ZKXB 2B8OT 2E7LE 3C6LC 1YMHB 5D1XD 4J4PD 1JWUA 4PRNB 1Q0XH 1T04A 3K1KC 3QDAA 5T5FL 1IGMH 4C4KT 1YYMH 1XGPB 2JJTA 3FFDB 4KMTL 4Q6IB 5C3TA 1V3LA 1MFAL 3V4VL 1UWEH 4MAYA 2C3VB 1G7MA 1QLRA 4ZXBD 3QHFH 2XXCB 2HTKC 3OMZA 1HDMA 2AV1B 2IBZY 5FF6A 3MV11 4ZSOB 5DMJB 3EIFA 3NA9H 3MACH 3U9PH 1MI5D 4HIJB 2ZG1A 3D18A 4ZAKA 2YBRA 3ILQD 2VTFA 1NCDL 1FL6A 2DIAA 5IB1A 2DWEA 1NUDA 4XPBL 2HVKA 4G9FD 1KN4H 2NY2C 3HC3H 5FGBA 5DC0A 3SY0B 3KPRD 4NQDD 1IL1B 4NWUH 3QULA 1MREH 5F88B 3T4AB 1EX0A 1RZ7L 4JFXB 1E28B 3TWCH 3ZYZA 1XGRA 5BQ7A 1K3IA 4X83A 2YD4A 4Z7WE 2NNAA 2WINA 4GUPA 3HZKA 1AH1A 3CPLA 4HPOL 4IJ3C 2X7LB 1MCHA 3ARDB 1KEGH 4X98B 4TOYH 4WV1A 2IG2H 4GG6A 4NQSB 1S9WA 2DKUA 4JR9L 2AK4E 4LARL 2AGJL 3DNKA 4M1CC 1I7TA 5DD6A 4FXKA 2A74B 2DQJL 3LS5H 3VXQB 3DROA 2FYYB 4PLKD 4XPFH 4ZG1A 3N1GC 3WXWH 1YNLH 2V17L 3OXRB 2F53A 1I1AB 1X5HA 4A2MA 1J8HE 3LPWA 4MA1C 5E5MA 1FZKA 5ACMA 4W68A 4JO2L 2E6PA 2Z93A 4UBDC 5EUOF 1FFQA 3MRDB 4I5BB 2OS7A 3QIUA 3GMLA 4NM8L 1UH3A 3DI2B 2FJFA 1RIHH 4U1KA 1UJTA 2FX7H 4K94H 1YY8A 2ED8A 5E0QA 4PGDA 5HI4D 4N8CH 2Y07H 4HWZB 4PGCA 3C8DA 4JZJB 5FKAA 3S6CA 1T2JA 3FT3A 1A6VL 3OAZH 2BVUA 3GHBL 5MI0C 2RCSH 1D5XA 3N1PC 5GJTH 5TFSH 4LQFL 4H5SA 2F54E 1S5HA 3RZCC 1EVUA 3PWPA 2ZCLL 4PBVC 2BVOB 3ZKSD 4YBLC 4E41A 4Q0XH 3LVEA 2YPLB 1OTTC 2PXYC 1P4IH 4MD4A 1NMBH 5DMIH 4K3DL 3NCFB 5IVNA 5GIRA 5HY9B 3DRTB 5GGVH 3VDBA 3VI4E 4PREB 3I6GA 1SMAA 3EO0B 1PSKL 3Q5TA 3VWKC 4HS6B 5TDOB 2F8XC 5K33A 5DS8A 3DHMA 1DFBH 2AJVL 2HFFA 3CK0L 1B3JA 1KPUB 1AO7D 3MODH 1LQVA 4M62H 1PQZA 4LSRH 1MIML 1SEBB 4S2SA 1JP5A 1D5BB 3FMGH 2O5XH 3OHXB 4ZD3H 3MJ7B 3BH8A 3WHXA 4J4PA 1IGJA 2X1OA 1RK0A 2X4NB 1PEWA 4LSQL 5I66B 5I1JL 4BJLA 1ZE3C 5I0DA 4KROC 4PJ7B 3R4DA 5FM4A 3B8SA 1RJLA 3G6JA 3PGCB 1FCGA 4O58L 1F3DJ 3SDAA 1M7IA 1DBAL 3ARZA 5IG7A 5JHLL 1UM5H 4JAMB 2CIIA 3VWJB 4IMKA 3QDMD 4XXDB 5FCUL 3RVWC 3MR9A 3REWB 4JM2F 2GJ6E 1I1CA 3CUPA 3EYQD 5JHDB 4Y1AB 4U1LA 3DVNA 5EFIA 3UROR 4Y5YC 1AR1C 5A1AA 2A0LD 4UDUA 4HS8H 5J1AA 4JFDA 1WC7B 3EBAA 3KPRA 4NQDA 3ZSTA 3TA3A 2H6PB 1RJCA 4PBXA 4YHLH 4NQUA 5HPMB 1EMTL 2ICWJ 3VXRD 4ZO7A 1F4AA 1EZVX 2XQBH 5FUCE 4GRLD 4G8IB 1U6AL 3MXVH 4Y5VC 3B9EA 3VFRA 4JVPA 4M1DL 4KK6C 3KR3L 1W0WA 5IJVA 4ZOBA 4XNUH 1DBBH 1LWRA 2OP4H 2LTQB 3DX9B 4JANB 4ZUUA 2G2RB 3F62A 5ID0B 3ECBB 1CF8H 3QPXH 4JO3H 5EG6C 4LLQA 4KWUA 3N9GL 3MV8D 1ZWIB 5F1NB 1ULVA 1JZ4A 5ADPL 4PP8C 3JV4A 5BV7L 1N64H 2YD6A 5DUPL 1L7IL 3DTXB 1EO7A 3B9KA 3D39E 5ANMB 3SDCD 5AZEL 4GKSB 4N8PA 5J57B 4XNQA 1IFHH 2EZ0C 4J3SA 4RFNB 3E3QC 2MCG1 4N90D 2X42A 1T0MA 3ZYOA 4QO1A 4WEBH 4Y5XB 2LU4A 1U8NA 3MGTB 3WJJA 1RY7B 3BW9A 4Z76B 5HGHA 2I27N 1BJ1J 2UY7A 4UTBH 4ZPVA 2HJLB 4FA8A 1CLYL 4FFYH 3RWDB 1RULH 2GKIA 4O5LL 1U8JA 3S35L 1YEIH 1MRDL 2F5AH 3S36L 3C5JA 4AIZA 1K8DA 2UZYB 5AAWA 5L88L 4Z7VE 2RB8A 1T04B 1LE9A 3O9WA 4R2GB 1YMMB 5EO9A 2V5YA 4IRSD 2OLDA 4WW2A 3R1GH 2JB5H 1FHGA 5KBNC 2BNRD 1RZIA 2DF3A 5IVXE 3O3DA 1JGEA 2GSIB 3D1MC 2JLLA 4PRID 1G7MB 1QLRB 4NM4H 3R8BB 3STBA 1FNHA 4YIQA 1GPOL 3O6LL 1HDMB 5FF6B 1LEKA 3WSQL 5TE4L 3QEGH 3EDDA 3QIWD 1J88A 5C08D 3GEWB 2DI9A 1OOAA 5T5FH 3BAEL 3D18B 1KIUA 5DLML 2Q86A 4LEOA 2YPVL 4L3CA 1FL6B 3C2AL 1IEAB 2WANA 4HLZH 4KMTH 4KXZI 5IB1B 5IHZA 5JZ7C 3V4VH 5IMOA 1ADQL 2Z8SA 5JOFA 2P43B 2OTUB 3G5YA 3GKWL 1AO7A 3W11C 4Y19D 1A7OL 1JHKL 3DWTA 1KB5A 3UTQA 5BQ7B 4UINH 1UA6L 1NCDH 3SDYL 2WINB 4JDVB 4GUPB 4XPBH 4NCDA 1FE8L 3FFCE 4P46A 2RGSA 5E94A 3MRRB 4N0RA 4W4OC 5ELIA 4WV1B 5MENE 4OZGF 5EZJA 4TNWF 1S9WB 4PJDF 5CKAA 4P2QE 5CBAB 4N0UA 5F7YC 4G7VH 1GGYA 5FHBL 1RZ7H 3RTQC 5SX5K 1MCSA 4QT5A 1G7PA 5ADOL 2QR0A 1I7TB 2ZNWA 3D69A 3QDMA 3WFHA 2PO6D 3OAUL 4FXKB 3DUHA 2AS5M 1B0WA 4HPOH 3DROB 4FRWA 5C0DB 4Q2ZB 1MHCB 1S7WA 3HCVA 4OLWL 4Z7UE 5EU6E 2EDEA 5L8LB 5E5MB 1FZKB 3GMMA 3ZE0F 4DEPB 1RIVL 2WWMC 4JR9H 3B83A 2HH0L 3I02A 4QRPE 5EDXA 3ZTNL 1TZGL 3F8UB 2AGJH 3VD9A 3H3KA 1A3LL 1QBAA 1RPQA 3GMLB 2FJFB 1T0NB 5ISZE 1YY8B 2R2HA 3X14B 3VXRA 3ZDZE 1DBML 4PGCB 1GAFL 2MHAA 2Y5EA 3TH2T 5I74B 1ZSDA 5FKAB 1AR2A 3BN9C 4OD2B 4AL8L 3PHOA 3SCMB 3VXNA 4N5ED 2AJ3A 3FT3B 4JO2H 2P8MB 3TVMD 1K4DB 1D5XB 3TBWB 4EVNA 4BZYA 4H5SB 4NC2B 4OJFL 5IFHH 4IOFC 1ROWA 3JXAA 2DBLL 2GIYA 1CVRA 4J12A 5GSVA 3BRGC 2KQMA 4U4BA 3THML 4E41B 5KG9A 5D96C 5GS0D 1JFQL 3WO3B 3MV8A 1J86A 1TQBB 3ARBB 4MD4B 5KSAC 1WBYB 2XXMB 5GIRB 4HH9A 4V2BA 1B4RA 4MA3B 1AE6L 3GHBH 5KOVC 4BFBD 4XP5L 2Y36L 1U8QB 3FTGA 4JDZA 4P3CH 2H8PA 2NTFA 2R9HD 4LQFH 5HHNA 2OL3H 2AEQH 4NQEE 1RU9L 5DS8B 1N2RA 2HFFB 1E4XL 1WT5C 3IF1A 3HE6B 2ZCLH 2GFBA 3KPNA 2YUWA 5J12B 4YWGL 1PQZB 2EDTA 4D94A 3T65A 4S2SB 3P9MA 4K3DH 3SQOL 3U0PB 1L6ZA 3QNZA 1G6VK 1NGQL 1TPXB 4HIEA 4MQXC 1BWMA 4GRWB 5D1XB 4X7SL 5FO7A 3WHXB 2C3HA 5EU4A 1IGJB 2ZPKH 2EIZA 3MLTB 4LGSB 4LIQL 1J0JA 3VXSD 4XB7A 2AJVH 2D0HA 3QUZC 3CK0H 4H1LA 4R97C 1RJLB 3GJEB 3B2VH 1GGBH 1MIMH 1ZLUH 5B39G 4ZXBB 2DIJA 4HUWA 2QKIA 3NIFE 1VGKA 1A6WH 2W07A 3QIWA 5C08A 4P23D 1OQXA 4OLEA 4LSQH 3EYFB 5J4MA 1KLUA 1DLFH 1V05A 4ZNEA 5F71A 1FN4A 1GZPA 4M48L 3RHWK 4OIIL 3QPQC 3Q48A 1IM9D 4ETQA 4O58H 4G9FB 1DBAH 2QQLH 5GZOD 3E1F1 4RISH 3QQ4B 5JHLH 3HMWL 3KPRB 2ZUVA 4NQDB 3VGAB 4KKCC 2UZXB 4Y19A 5FCUH 2DI7A 5SWZD 3O2WL 4YBQC 1N26A 2B20A 4WJ5A 3IB4A 4C54A 5KVDL 3SOBH 1S3KH 1I7ZA 3IS1X 1W0WB 1A2YB 1F6FB 2YD7A 5IJVB</