3X11A

Crystal structure of hla-b*57:01.i80n.l82r.r83g
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRNARGYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x11A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3x11A01
3VGEA 1UCTA 3ZL4H 4OF5A 3OB0K 5IB1A 2X4TB 3GI8H 1IAII 4R4ND 2EKSB 3F7PC 3QDMB 2MCPH 4G7VL 3P40A 4X80L 5L2JA 1FL6A 1NGXA 1ETZA 15C8L 3OKKA 1MOEA 1EAJA 1R6VA 5IFJB 5MEPA 4Z7QE 3VMOA 5T3XL 3T09A 2D7TH 5I8CB 3VWKA 4AIXA 5D93B 1WBYA 4BM7A 2PF6A 2X10A 3LH2L 4RCAA 3QDME 2VLKD 4JO1H 4PGCB 4MHHG 5DJ0A 1P4BL 3QUZA 5HGAB 1SVZA 1ZHKA 5KSAD 4XNXH 4BFBD 3P77B 4HF5L 4W81A 5EOCJ 4GSDL 5I1IH 1FCGA 3BD5A 4JHWL 5KVGL 3IRPX 3CXHK 5TE4L 2D9QB 1U8IA 2EIEA 3O2VL 4U1SB 4AL8L 1BM3L 1AQKH 4LLVA 4LLYA 1QTYT 5L6YH 1KCSH 1GPOH 1OY3B 1MHCA 3Q6GH 2ZPKH 3KS0J 5JIIA 4JKPL 1EPFA 4ZTPL 1E28B 4G8GB 3FQWB 2QQNH 4GKZA 4WUUD 4X9BA 4FFWD 2FX9L 3BPLC 1UXSA 3MLSH 1S7XA 5I8KL 1MJ7L 2EDWA 2IAMC 2NY2D 4XMKH 4ZPVA 2DLGA 4KMTH 4CVUA 5HYSG 3GDBA 3ETBF 1OP3H 2Z93B 4WGVB 3N1GC 3FT2A 3WFBL 2KUTA 1K8DB 2P8LA 3L3DA 5LQBH 4YEEA 3LKSB 2ADIA 2CDGB 1WZ1H 2PTUA 4RDQF 4ZUTA 2G9HA 4XPGH 1IGYA 4NZRH 1N5AA 4E9LA 5CEXA 3EIFA 3PWPE 3O3BB 3DVNA 3BP6B 4Q6IA 4X4YB 3JWDL 5A2JH 1A5FL 2DWEA 4UV4L 2A1WL 5TE6L 3SDDC 4LSQH 3EOTH 2OCFD 4CN4A 5BZWA 4K94H 4ERSH 3MNWB 2DWDB 4UIMB 3CDGB 4FQQB 5JHDE 1KFAL 2P5ED 2P45B 4WI3A 5E6YA 4UILL 2DD8H 1J05B 4G3YH 1P1ZB 4UOW0 2CLRB 1MF2L 3G5YB 2CGRH 1KJMB 3O9WA 2M26A 4JDVB 2VLRD 1A1MA 2EICA 4X6DF 4LP4A 3BESR 2VITB 2QEJA 3NIDF 3GGWA 1HHHB 2C5DC 3HMWH 3VGFA 1ZSDB 2IFFH 4LOUC 2MCG1 1U8LA 5DVOA 1MI5D 4HWBH 1W72H 1RURL 3E6FA 1EAPA 4X6EB 3OWEA 1F11B 5IKCB 4MD0A 2EDRA 2FX8H 1WC7A 5GS2D 2WY3A 3OKDA 2I9LA 3NABL 1OAUL 1RK0A 3LV3B 4EUPA 2R2EB 3FB8B 1Z9OA 4Q9BA 1B4JL 2GJ6D 3DIFA 4FFVC 4ZFOB 1GC1H 4CMHB 2EYSA 4U31A 5DJ2A 3QUKB 1DL7H 3VI4F 2VDKL 1HZHL 3MGTA 3VXRB 4QCIA 2N7BA 3ILPA 4OKVB 2VO5A 2CMRH 1H3XA 5DFWH 4OF0A 2Z8SA 1RZJH 2UYLB 1QFHA 3B9EA 3SQOH 3DARA 3PUCA 3OGCA 3RTQD 5A3ID 5I76B 1XIWA 3DXAE 3RGVB 4WFFE 5GGVH 4HGWA 5GHWL 1ZMYA 3MLWH 4QRPB 4OQTA 3QNXA 4MX7B 2F58H 2HLAB 1TCMA 1DUZA 1S7RB 4I2XB 3UTPE 1TZHA 4PR5B 1YQ2A 3T0EC 2E6PA 3UC0L 3TJEH 2NY4D 1J86A 2VR5A 1S7VA 4H25A 1EK3A 5CBAB 4WWID 1S9WB 2A83A 3VGDA 4WWKA 3DRQB 1E27A 4U3XA 4P48A 1A2YB 1QFWH 2B4CL 4MS8A 3EUUA 4L8BB 1XEDA 3OXSB 4RZCA 3PP3K 1H0DB 4OCXL 1IGTA 3L3JB 5JDJA 3VXMD 1FBIL 3FB7A 4ZOBA 5C1MB 4JFFB 2YSSA 3TO4D 4R97B 4C57C 1MLBB 2R15A 4Y1AA 4OV5A 5DHYB 4YDVA 1IARB 3IGAB 4U1KA 4G43A 4GXUM 3S34L 5FKPA 4MD5B 1B3JA 2OYPA 1U3HB 4JY6A 1VERA 4PB9L 4KJWD 4NNXA 2NW3A 2QSCH 4M7LT 3V8OA 1IGML 3TIEA 4L5FH 2M8XA 2H41A 5I30H 4UDUA 3X14B 1BVKA 3T3ME 4WFGE 5F9DC 5HHQA 1NBQA 4JFFE 2EDKA 3DX9B 3A6OA 2QADD 1KLGA 1D5MA 5B3NA 3PHQA 2R0WH 5J13B 4L8CB 2P8MB 5K33A 3ET9F 4M48H 4RWYH 1HKFA 4NJAH 1PYWB 2DM2A 5KW9H 3VE0A 1YEHH 3O3AB 3OAYK 1GOFA 5FM5O 4WV1A 2BNQA 2AKRB 3FT3A 1MCRA 1WT5C 3CX2A 3ULSB 1WJ3A 3EJJX 5AYUH 2GTZB 1QUNA 4M6ML 2OX5A 5DQ9A 3G9AB 5IB4B 3QXDB 3IDXH 1J1XL 2E27L 3WNPA 3D25B 2V5RA 4PDCE 4NN5B 1U0QA 1RIVL 5DMGD 1K8IA 3BIBX 2W9DH 3RZWA 4EZMA 5SWSB 1P5VA 4PBWD 3VFTB 1KEMH 2Q76B 5DVMA 2DS4A 4PY7A 4CVZA 1ZHBA 5TDPB 1LP9F 3ZSSA 4GMSH 2YD5A 3ARDD 4CDGC 4PV9B 3OKEA 4YDKH 1F90H 3QEUA 3HI6L 4O2FA 4I9WD 4L1HA 3UAJD 2YD8A 3RNQB 5K9JL 4Y16A 3AMLA 1NMAH 1XF4A 4P99A 1HYRC 1T7VA 1NFDE 3O2DH 3QRGL 3T4YB 3QXVA 1P4LB 1SEBA 3SKJL 3BSZL 3P0YL 5I1AA 3WL9B 5E6IC 4HJJH 1NC4B 2W91A 4WCYL 4Y8DC 5MHSE 4NHUA 1ZV5A 5T3ZH 4WI7A 4GKSA 1HQRA 3KPPA 3MLYH 2ERJC 1L7IH 3LQAL 3UPRB 2NW2B 5I2IA 2HRPL 4NP4H 1X5KA 3O4LB 3AB0C 5IEKB 1TMCB 3U0TA 2B0SL 1GGUA 3HN3A 4RISH 1YJDC 3CK0H 2FNBA 1JBJA 4OM0H 4Z0BH 4AH2B 3S9DB 5C08B 3EOAA 3VXTB 3O11B 2DQFA 5ICYA 4Q0XH 1QBBA 4K7FA 1GVIA 1ZGLP 3C60C 5GGRY 2X4SA 3T2NL 1KCRL 2A9NL 3O3DA 3RWGB 3WYRA 2CK0H 1YDPA 3BHBB 1Q94A 4R0LC 1P7KB 4GMTL 1UFUA 4PG9B 5JNYB 1QSFB 2GITB 3P0VH 5C08E 2XZAH 4NKOB 1K4DB 2FEDD 4QXGL 4WW2F 3LZFL 4KXZI 3IT8D 2BDNL 2H9GA 3MLUH 3AFLA 1QPPA 3I6KA 4HGMA 4NO5B 1YUHB 4OUUA 1UZ8B 5FO7A 1FG2A 4Z7UF 1IC4L 2Q7YA 3IAQA 5TFSH 2XTJE 25C8L 3GMNA 3V4UH 1IKFL 1QSFE 5KSAA 2XG4A 4F2MA 4PRNA 1JNNL 5H35B 2HAZA 3IU4L 4QTHA 5TF0A 1INDL 4L29A 3SDCB 3RIAF 4D9LL 5HD8D 3MNZB 4OTXH 3RWJB 1IGIH 3GSRA 1IAMA 5D70H 4WI5A 2B2XL 5BQ7B 5DMJB 3U36B 5MP6H 4G80A 3W39A 1HH9B 4HUUB 3BMVA 3VFSB 4LSSL 5HYJD 5GJTL 5CZKA 5C0AD 1EVUA 4EJ1C 5JQ6L 2HFEA 1Q1JL 4MZ3A 4HKBA 3BX7C 3MA9L 1ADQL 2HFGH 1TTGA 1CGYA 3RIFK 2YEZA 1CICC 5DF0A 4OM1L 3CH8A 4GXVH 3ARFD 5DHVH 1D5IH 5K93A 4LDLB 3MV8E 1EERB 5KN5B 3NAAL 4MXQC 1ADQA 2VE6B 4XNZC 3T2PA 3HUJB 3WUWB 1QHOA 4P2OC 1IL1B 4NRYB 2ZOLB 3FN0H 3I2CL 4BSWA 3O41A 4JKMA 4HJGB 1RUKL 4LVEA 4PJAA 5IB5B 4LKCB 2WWMD 5INCA 1CT8A 1KNOB 4Y8AA 5FIEA 3QQ3A 4GLRH 1M7XA 3TJHA 3K1KC 5L2KA 1VGKA 2Q87A 5C09D 3U4BL 4AEHL 4FQHB 1AIFA 1SM3H 1TJIL 4XBGA 2OM5A 3GMLA 5IVNA 3RL2A 2P7TB 5I1KH 1EA9C 2VDQL 1B0RA 4FQXC 1UWXK 5IOPB 1BF8A 4F7CB 5DGRA 5IESL 3KG5A 1J8HB 5LGHH 3BEWA 2ZOKB 1KIQA 3EYUH 3PGDA 5A40E 2BCKA 1AKJB 5DJZB 4H20H 5TGBB 3THMH 1QR1B 5DRZA 3WS6C 1I7ZA 4M7LH 1MH5B 1F3RB 4I3GA 1AE6L 2HT4C 4OSUH 3LHPH 4Y19A 1T4KB 5CINH 4WFED 4D8PA 1FYHB 4K9EC 4YXKH 5D7IE 1J8HE 1J1PL 5KTEL 3ULVH 1HXYB 4I0KA 1QNZL 2B5IC 3MUJA 5SWZB 3C8KA 3QIWB 3M17B 5EU4B 3QQ4A 5GGSB 4M1DL 5IBTL 3PXHA 2IALB 3LN4B 1INEL 1RJLB 1UB5A 3L7FA 4QT5A 1QRNA 1UWGL 2X4RA 3VFNB 1T0MA 3PL6B 4WJ5A 1T03H 4XP9L 2AK4E 4LRNH 4L4VE 4PREA 4FFZH 4PRAB 3EYVA 4XCNB 2OZ4A 3NA9L 5GPRA 4I8DA 2UWEF 5FUZL 3L1OH 1ZHNB 3TPKA 3DVGB 1P4IH 2VXUH 3DMMA 4PRIE 3CFCH 4YC2C 1CL7I 1B2WL 5EU6B 3BT2L 4Q97A 1OLZA 4K8RC 4LMQI 3QO1B 1H15A 4WTZA 1DZBA 1ZGLB 3DXAA 4UBDC 5HI3D 4L8SA 1JPTH 5MEOB 5LBSH 4JRYD 3O8XC 3RY6C 1R3HB 4FNLL 4JFDE 1DVFA 1R5VA 2VWEC 3CZFB 3QDJA 5ADOH 1EHLH 4GRLD 4PJ9D 1I75A 3W0WB 4MQ7A 2FX7L 5CBEA 5ESVB 5E99L 4QNPE 2AEQL 3V5DA 3NCMA 3QEQE 4ODTL 3QULB 1U92A 4KI5C 4NNYA 4TNWK 1FH5L 3MOQA 3LVEA 1C16B 3EJYC 3KYKH 4LIQE 2YKLH 4ELKA 2VL5B 1GAFL 4YHPA 3W0WE 1T7ZA 5C86A 3RVUD 4K71B 4A6YB 5JW5B 2QQQA 4HQQL 3WO4C 4D9RD 3RWCA 3QEGL 3OKLA 1H8SA 1FJ1B 3ME0A 1XR8B 1MCFA 2X1WL 4MNQA 4I5BB 1N59B 4MAYD 4U1LA 4MWFB 3EYQD 4PGZA 5CMAB 5I74B 5D1XB 5DJ8B 3MLXH 4PG2C 1OQXA 4KUZL 2NY5L 2X4UA 5D1ZC 5IQ7H 4UTBH 1X5LA 1F45A 3LQZB 4G8FA 5LAXA 3SJVB 1GIGL 4V1DB 4EDXB 1S7WA 3O6ML 2GK0B 2YPLE 2WIIA 4AM0B 3GSUA 3KWWB 3WKNA 1A14L 4BELD 2ADGB 4U1JB 2Q8AL 4HKJA 1IGFL 1MVUA 5ID0B 2ADFL 1CLOH 1IGCH 4Y5XA 4KKAC 4PJFB 5GZOD 5F3BB 2AI0L 2CDFA 2DQTH 3V7MA 2OTUA 3RWIA 1JF1B 3QNYB 1QBLL 1L0XA 1DBKL 4MMZC 2QQKL 4XP5L 3I3BA 4GO6B 4LQ1A 4LSDA 3QSKB 3AVEA 3G6DH 2VDRH 4X9GA 1NCCL 1IC7L 2CSPA 3UXFA 1KF9B 4OBSA 4F80A 5HXMA 4O51A 5E4IA 2ZG3A 2YK1L 5J0BA 5HDBF 2H26A 3PWUB 2WINB 1WIPA 3WS3B 1MIML 5I1LB 3WJLA 3JUYA 3QXAA 2E7MA 4OD1L 4MCZA 5C0CE 1NFDA 1WF5A 3WHE0 1I7TB 3LDBB 1NPUA 1NL0H 1UB6B 1FFOB 1QFUH 1FORL 1WFOA 4M8QB 5CHNA 5I1HL 3BN3B 5IGXL 1QBMH 4QO1A 1AO7D 3B8SA 1FGVH 2BVQB 2IH3A 1P7QD 3MFGB 1U2HA 1DQLH 4L4JA 4CADA 1KB5A 1QSZA 3S4SG 3TZVA 2NNAB 3LAFA 1YNTA 1T3FB 4XH2B 3HC3H 1YYML 4NCC1 3MOBL 1NDGA 4MVBD 5IB1B 2EH8L 2ATKB 1PQZA 3QXTA 1K3IA 4P3WA 1FL6B 1MFBL 1ETZB 2XN9B 1UVQA 3MCG1 3X17A 4MLIA 2PUQT 1WZKA 3LKQA 5T33L 1KJVB 3SKOA 3STBA 3ULUD 5BV7C 3HZMA 3A6CL 4MZ2A 1S9YB 1KCVL 3GBNL 4P23D 4AG4L 3JWOL 5CKGA 2RHEA 4EDWL 3OPZH 2IADB 4NQTA 5DJ0B 5J1AB 3UZQA 2DQCL 2DB8A 1I8LA 5C07B 5HHME 4Z7VF 3LIZH 4S1DD 2O61A 3FT4B 4Q2ZA 2PTTA 5AD0A 3FTGB 4UOW1 4KDTA 1U8IB 5DUPH 4FZ8L 5F96H 1VGEL 2HWZH 3W9DB 5CWSA 1CLZL 4OJFL 1A6VH 5IJKA 1D3CA 5C07E 5T3XE 2N56A 3PJSA 1BZ9B 2CIKA 3HG1E 1YECH 3QFJA 2XWJB 1A6AA 3OKNA 4U7MA 5FYKU 1R5WB 1UXSB 1S7XB 1NMBH 4FQPA 4ZPVB 1MCOL 4PJCA 1D5BA 4AMKL 4RX4D 3UYRL 5K59E 3J8F7 5DFVC 4POZC 3FT2B 4PLJD 3PV6A 3L3DB 3I6LD 2OMBA 5ICZB 3VG9B 4PUBL 4TOYH 1T2QH 1NSNL 1W0WA 3BKJL 4GW5A 5CP3H 3WD5H 4ZUTB 3AY4C 3G5VB 3MV8A 1IGYB 1N5AB 4P57B 3WFZA 5CEXB 4APQB 3RZCC 5ISZB 4Q6IB 4S10A 4QRRD 3CU1A 2GTWB 5LGJB 3QUMA 4M9OA 3O6LL 4N8CH 2PYFB 5BZWB 4X6DB 5D7LB 3FCTA 1UJ3B 4MXWL 3ARQA 1Z2KA 2BK8A 2LVEA 4JFQA 5ISZE 1VFBB 5EBMA 1Q0XH 1JCKA 3WFEL 4N8VA 5FCSH 5B3JF 5I1DB 4TULL 1OAZH 4R9HA 3RBGA 1JRHH 4X6DE 3B4NA 3H3BC 4YH6A 5SX5K 5D7LE 4R4FL 2IAND 4G9FE 4U7SA 1FO0H 4C4KT 2NY7H 2ITDA 2WM0A 1HIMH 3F6LA 3DO3A 1EJOH 1R3KA 1A7PL 4H1LB 5C8JB 3R4DA 1NCWL 5D7KE 3QDGE 1C12B 1FNEA 2FWOA 4G5ZH 4HK0A 4LARL 1FZKA 4I0PA 1GOHA 4R2GC 4F33A 4LLWA 3BZFA 4MQXC 3NZHH 3UBXI 3DWTA 3PF2A 3CZJA 2NY6C 4HFWB 1N5YH 1EO5A 5EZIL 2CDEA 3ZKSD 3RKDC 3OJ2C 3QISA 3NBNA 3OKDB 2H1PL 3FQRA 3V4PL 2YD9A 5AZ2H 3GRWH 4ZXBD 1CFVL 3TPUB 4OUOA 3S37L 2JLLA 3WLBA 3NH7H 2F53B 2BNRE 4NQSA 1GGBL 3QAZB 1UM5L 2X1OA 1I1AD 3MGTB 3EDEA 1C08A 1EVTC 4QCIB 5IVXE 4R26L 1JPSL 4I18B 5I8EA 4HX1A 1LO2L 4YHML 4BKLA 4UT7L 2W1NA 1NFIA 5FDYA 4L4VA 1ED3A 2HT3C 2F53E 4YUEH 4NGHL 4NQVA 5CGMA 1XIWB 3TF7A 4NN6B 1P6AB 1G6RA 3MV9E 4TN9A 5EFIA 4YDLC 2W38A 4OLEA 3QNXB 3VFPA 4P46B 4EI5D 1DUZB 3NZ8B 4JPVH 4OD3L 1QSEB 2W0KA 1TZHB 5I1GL 4IRSD 2V2WA 4EOWH 5E9DB 2DM3A 3RWFA 1G7LB 1OPGL 1YPZE 1N2RA 4OZFG 3VFGL 1LEIA 4KV5F 3RVXC 4HPYH 4WWKB 4X6BB 3CC5A 3AM8A 4Y2DC 1AY1L 1HDMB 4JN2A 1UYWH 2JTDA 1E27B 3RUGA 2BSRA 1S7UA 4E42A 2D3VA 3CH1A 1T22A 5MEND 5C0BD 3V6OE 4YHLL 3VD3A 1IGTB 2G60L 5E9DE 1D5ZB 4UTAH 3QEQA 4JRWA 1JVKA 1YN6A 3NMEA 3FB7B 3A6BH 2AQ2A 2YSSB 1IC5H 1I9RH 3KLHC 3U1SL 1G9NH 4OV5B 5GRZA 1XAUA 4YQXL 3NGBB 2X4NB 3RUGF 3LKRA 4G43B 5HYQA 4WEMB 3OX8A 1NAMA 3EFDH 4NNXB 3PIQB 2ICES 1LO0H 4UDUB 4WTWA 5JHLH 3O45A 1N7ML 3DROB 1BVKB 1PKQE 2VXVH 5J6HB 4LMQE 3GMPA 3B5TA 4WEBL 4RIRB 5D1QC 4DCQA 1S7SA 1KLGB 4PJGA 4NKDA 3UO1H 1KCUL 4HAGA 1LWRA 5JPNA 5JO5A 1XGPA 1KN4L 5EG6C 3LSOB 3ZYZA 3SCMB 3VXUA 4JFED 5IT2L 5EWIL 4XWGH 1YEIL 2QHLA 5DR5H 3GMMB 2DI9A 1RIUH 2LVCA 5ETUA 2OR9L 1GZPA 2APXA 2RQ8A 1RK1A 2AJYL 4IRZH 1Z0MA 2YD4A 2ZUQC 3H6JA 4X98A 2BNQB 3S36X 3FT3B 4P4KC 1I3GH 4JPWH 1LP9B 3V52L 4JDTL 5JQHC 5FYKL 2AJVH 7FABL 3HZYA 2KPNA 5GJSL 5T1KD 4LU5L 5KBNC 5T3ZD 1JTOA 4DGYL 1FFNB 3OB0H 1P5UA 3KR3L 1F02I 3BH8A 3EAKA 4J3TA 1LP9E 1IZJA 1FGNH 1NJ9A 4K7PL 3VWJB 4H1LG 2V2TA 1DFBL 2F8XC 3GKZA 1SEQH 4O2FB 3ARGA 1F3DJ 4N0CC 2MCPL 3STZA 3F7QA 1XF4B 4WNQB 3FAWA 2FL5A 1YMMD 3S5LG 4JLRA 3MQIA 3SDAA 1OQOA 4OZGA 4HXAH 4X99A 4C56E 3GFUA 1OM3H 3OR6B 4NHUB 2AEWA 5DZOA 1VADA 4GKSB 2IG2L 1BVZA 3KPPB 4BH7A 1ZA3A 1SJEA 2H3NA 2I27N 4HH9A 5DUBB 5E8NB 5I2IB 3KPRD 1X5FA 1X5XA 5GGSY 3MRNB 4OZGF 4NQDB 3U0TB 1BD2A 2OXGA 5DK2B 1A3RH 4C55A 3F7YB 1CD8A 1S5IH 1AC6A 2PCPB 3AU1A 1R3JA 2VOTA 5L6YL 3EOAB 1G7HA 4WW2B 2ZPKL 5ICYB 3PG2A 4K7FB 4M7JL 3ULUL 2X4PA 3WNLA 4NQDE 1WCQA 1NCAL 2OXHA 3DETC 4N90D 3W2DL 3M1BB 1I3VA 1Y6MR 1AD9A 2DKSA 3P4MA 4M7KH 2ID5A 5BRZD 2CH8A 2BOCB 2OL3L 3IFPA 4N0UB 1CZ8H 2J1KA 2YMXH 3EKCA 4HIIA 1G0YR 4KMTL 4XMKL 4YBLB 4ZS6D 4A2LA 2YPKA 3S3PA 2X70A 2QR0B 2IBBA 3IDNB 4PJEF 5HHXH 3I6KB 3FFCE 1LE9B 3QQ9D 5FCUH 1AXSA 4P23A 2WP3O 4XI5C 2VLKB 4Z7UE 1AGFB 3EW3B 3GMNB 5HHMA 2A9MH 5L8JB 3QCTL 3BYYA 1CXLA 2FIKA 2GAZB 1VFOA 2X4QA 5KSAB 2RCSH 3HI5L 4N0UE 2CKBL 3ULUF 4QTHB 4NZRL 1WBXB 3AMKA 4MJ5A 1QOKA 2DBJA 5H37G 3FB6A 4LSQL 3EOTL 1QG3A 4FXGA 1DQJB 3WHXA 3RIAK 3W39B 4ERSL 3RBSA 1NQBA 3DYOA 2QKIB 3SE4A 3SDXA 3QYCA 2DD8L 3OB8A 4WUUB 1T1YA 2CGRL 3MBEC 4NN7C 2OJEB 4L3ED 2HN7B 1CFNA 1EXUA 4OFYA 2DL9A 4F8QA 5IWLC 5ITBL 1U6AL 4Y4KC 3IDMA 1NBZA 4CMMB 1DANU 1RIHH 1DLHB 2Y06L 5I71B 3SDXF 3HMWL 3M8OH 4KKNA 4KQ3H 3DHMA 4XB7A 4F7EA 3OR7A 1X4YA 4WUUE 1I1YA 3PE9A 2IFFL 5IW1A 3RY5A 2HG5A 2FJFB 2FR4B 3H9HB 4HWBL 1EEYB 1BFSA 1W72L 3O41B 5BO1L 4QHKJ 1UM4H 2DDQH 2ESVD 4DZBA 4LLUA 2FX8L 1FN4B 1QACA 1RZ8A 4PP1D 1T6WA 2I60L 1R5IB 4LCYA 4G9DB 4XAWH 3TFKC 3DYPA 1CT8B 5IQ9A 4XCYB 3QQ3B 4UAOC 3MRJB 2JIXA 3OG4B 3ULVD 1VGKB 4I3RH 3NCFB 4WTXA 1GC1L 2FLBT 4HMDA 5KANI 1DL7L 3Q48A 3RL2B 3SDDD 3MA7A 3QJFB 4DK6A 4BZ1L 5JMOC 3BRGC 5IIEA 4LVOC 1P53A 3BEWB 1YMHA 4PV8B 2LABA 3CFEB 1RZJL 2ITCB 2VLRB 3IB4A 2Z31A 3PGDB 3ALPA 1EEZB 4D0DB 4G9FA 4O9HH 3SQOL 3ARBA 2P5EE 4LCIH 4DTGL 5DRZB 3N1FC 4ZAKA 2XZCH 5GGVL 1ROWA 2PO6A 4K3HA 2XKNA 5FECB 2F58L 3MUGA 1YEDA 5BJTA 2HT2D 5IR1A 1AC0A 2HLFC 2JB5L 3IETA 4F15B 4IMKA 2VLRE 5DZLA 4F57L 3PP3H 2UWEB 4HKXA 4FQ2L 1GXEA 4OLWH 1MPAL 4N9GA 1ZHLA 5CJXC 1UB5B 1M7DB 4LGPB 5GGTH 1MI5E 1XF2A 4WJ5B 4YAQA 2BNRA 1HKLH 4HLZH 4R8WH 3GJFA 4JG0H 1VACB 3EYVB 5AEAA 2UWEE 2W0LA 4FFVD 2PXYA 4XVTH 4LSPL 3DMMB 1KENL 4P5KA 2GJ6E 4N5UA 3FQTA 1NKRA 2DN7A 4L5FL 4WO4C 4WENB 5E1AA 5ESAB 4JAMA 3RTQB 5I30L 3X11B 4KFZC 4WIQA 2DKMA 3HB3D 5E8PB 3F62A 3LMJH 2VZOA 1R5VB 3OAYH 2ZUWA 5GRXG 3TYGH 4XNQA 4KK6D 2R0WL 4IRSA 4X6FB 5CEYB 4YHIB 5L8KB 2NY4B 2M2DA 1YPZA 4M48L 4RWYL 4HPOL 2DJSA 3MRMB 1K85A 4NJAL 1U92B 4NKIH 4NNYB 4KJQC 5FEBA 1YEHL 4AEFA 5BXFA 1OTTD 4JPKH 1X6NA 4ELKB 2X4OA 3G6AA 5C0BA 4YHPB 5E00A 1BZQK 1MRCH 2AK1H 3ARRA 3L3KA 4ETQA 1H3PH 1JGUH 3BQUC 2OTWA 3VXMB 3WIIL 5FO9B 3QI9A 1ORQA 4QRUA 3TO4B 3RWCB 4Y5YC 5CGTA 1XF1A 5E4EC 2GSGA 1CDUA 4LLQA 1KEML 1RJZB 1MEXH 1FNSL 3FO9B 1YQVL 4J2XA 1XF3B 4M4PA 3VXME 3MOAH 4YDKL 1F90L 1ZTXL 1MFEH 3RI5F 4RAVA 1NEZA 3OG6B 3ZKNC 1LDPH 3BZ4A 5DS8A 5F6IB 1KULA 4G8FB 3O2DL 4NQEE 3RVVC 4FQCH 4OGYH 1S7WB 1T5WA 2WIIB 1KYOK 2DJUA 5INDB 1VB9A 4KRPC 4HKJB 5E2UH 3TBYB 5F9WC 4RGNC 1XCQA 4PPTA 5FO8A 1MUJA 5T3ZL 4MJ2A 1S3KL 4LVHC 1P9MA 2D4FA 2BX5A 4R4BA 1W8NA 1L7IL 1CVSC 2CDFB 4IHOB 3FQUA 4UT6L 2WIMA 2F19H 4PGBB 1BIIB 1JP5A 4NP4L 2XRAH 1D9KC 5KAQG 1AHWB 2J2ZA 1OOAA 1NGWA 3I9GH 5F97E 3CK0L 2K7PA 1QQDA 5ILTL 4OM0L 4Z0BL 2NR6C 4ZQKB 2AJSH 3B8YA 2ED7A 4JM2D 3HE7C 1BWMA 3QP3A 3ARDB 1CE6A 4Q0XL 1G7QA 4Y4FD 2W65A 1CD0A 4QTIH 1DQDH 3TVMD 3QR2A 4NC1C 5JTWA 2CK0L 5DJAA 2R39A 1V3JA 2JB6B 2F74A 1YMMA 2XA3A 1WEJH 3T8XA 1OW0C 4QHLA 3IFOA 3ZE2F 4C56A 5CEZH 2EDBA 3V7AE 4CADB 3IS1X 2Z35B 3SBWA 5TFSL 1YN7B 4KKBD 3V4UL 3CUPA 3MV7A 1VFAB 5C70A 1QYGH 1QKZH 1OAYL 1RUAL 3B43A 1BREA 1PQZB 4P2RA 4QXWA 4H5SA 5DA0B 5EC1A 3JTTA 4OTXL 1IGIL 1LNUB 2HRLA 4Z7VB 1UVQB 3FO2B 3EJZC 3LKQB 2MMXA 5MP6L 1AJ7H 1J0IA 3SKOB 3RAJH 1CDIA 2EYTA 2MFNA 2I24N 1JZ2A 4U6XA 3NOIA 2E7LC 3WO3B 1VCAA 4U1NB 4H8WH 4MNHA 3Q2CA 5GRUL 1AR1C 3LPWA 4HCRA 1F8TH 4HS8H 4QRTA 3IJSB 5F1OB 2O61B 2EECA 4Q2ZB 4GXVL 5T1LA 1D5IL 2O5YH 5AD0B 3FFCA 4LGRB 5CAYB 4BZYA 2AXFB 4HUVA 3X13A 2J4WH 4L8DB 1F4HA 2AQ3A 3B2UD 2FECL 2VDOH 3MRIB 1FZMB 4EI6B 3RL1A 2NXZD 1JZ4A 1E4XI 2QHRL 5KG9A 1MCDA 1NANH 2N1KA 4TVPE 1PG7L 3OKNB 3I02B 2IPTH 3VXOA 1UWXH 1U8NA 4GW4B 4KDVA 5HYJB 1D5BB 5C0AB 5IF0A 3U9UA 1SM3L 5KZCD 1CLYL 3MREA 5I1KL 1BQLH 4DKAA 4KK9C 3ZHKA 2VAAA 1CFSA 4XC1H 2Y4SA 3EYUL 2ZUXA 1HEZA 4GKNA 5IW6A 3ARFB 4H20L 3MZGB 3GZKA 3P30H 3G6JF 1NMCB 1U2CA 4QHNA 3DX7B 2VZTA 4NFDA 3MUHL 2IAMA 4OSUL 3LHPL 5C9JB 1AGBB 4L3CB 3BWUC 3ULVL 4QKXB 3NN8A 4IIQB 1G0DA 4KMQA 2GFBB 4PD4K 1QHPA 1T1XB 4JCLA 5B38B 3FB5A 5D72H 1EBAA 2BERA 5EBMB 3T3PF 2GT9B 1TPXC 3ZKXC 5JMRA 1JGVH 2K7QA 2VLJA 5I19H 1T03L 2WBKA 5C09B 4FMKA 4LRNL 3V7AG 1BFOA 1HILA 1C5CH 3SDDA 1R3KB 1QFWM 3L1OL 4R96A 3SE8H 3WNKA 3DNKA 1P4IL 3C5ZC 2VXUL 4QOKD 3C5SB 3QUXD 1YY9C 4HK0B 4F33B 4I0PB 3N9GH 1N3NA 3FN3A 1L9MA 2XI9A 2XOTA 4M1GL 3X3GH 5DI8A 2FCBA 3KLDA 2CDEB 1QFWI 1WBZA 1JPTL 3FQRB 5CD5C 2CIIB 5LBSL 1M7IA 5AG9A 3QHFH 3BKML 3WLBB 1M71A 1EHLL 5ADOL 1TZIB 4JFPB 2R29L 4KKLD 3VFOB 1EBPA 3VFRA 3I50L 4X5LA 2PYED 1BFTA 1OL0A 4DKFL 2HT4D 2X1PA 3I75A 3HNTH 4OZHF 4MQTB 1P69B 1U8PA 4Y2OA 2BSED 2HH0L 4WFEE 1NLBH 2Y5TA 4HS3A 3ZT6A 1ED3B 1UACH 4YHYC 2VERN 1S9XA 4NQVB 4X9HA 4OD2A 1G6RB 2GKIA 2R0KL 5EFIB 3O6FC 2J6EL 1HK6A 4L4TD 2WBJC 3VFPB 3FL7A 3PDDA 4XCCH 1PSKH 3WFHB 1NGYA 4UI2A 1VDGA 3B9KD 4ODXA 4U6TA 1KPVB 2GSIA 2V2WB 4YDJA 4OF6A 1ZLSH 4XP1L 2HTKC 5J12C 1FNAA 1LEIB 1ITBB 2J6EA 4KV5E 5FF6B 2EXYC 3CC5B 4BSVA 4JRYB 3UBXA 3PDOA 3RUGB 1JZ6A 4U0RB 3MLXL 5D5ME 2WWKO 4HBQA 1FVCA 4PJ9B 5DD0H 5M95B 4UTBL 1KV3A 1T5XA 2P48B 3QG6A 3UPAA 2Y23A 1FIEA 3LEXA 3ILQC 5F7MC 4PJ5E 2AJ3B 4UQ3B 3ZSTA 1CDJA 4JRYE 3MJ8A 3T0EA 2CD0A 3RDTC 4NNPH 4GG6F 4PP2B 4NRZB 3OX8B 1IGCL 3SGDH 1C8PA 4UOJA 1RZKC 4BUHA 2CO6B 2DQTL 4KI5E 3O45B 4OAWB 1J88A 4BFEA 1QSVA 3GMPB 1OB1A 1HHKA 5LWYL 4N0FA 4JB9L 3G6DL 1P84J 1XGPB 5I16A 3C6LC 3ESVF 3HRZA 4MAYB 1N0XH 4LLDB 1UQSA 5ETUB 1GZPB 4CVXA 1JPFB 4OGAD 3ZDYF 4NQEA 3C87A 5B38G 2ED8A 5GS3A 1C5DA 2BOBA 4WI8A 4PS4L 1NL0L 3HZYB 5CZXC 5D8JH 1QBML 4WU5A 5ELIA 1FGVL 4EN3D 3DGGB 4KZEL 3BH8B 1DQLL 3E0GA 2RJMA 3OJVC 3R8BB 1A7RH 2FHBA 1NJ9B 3HC3L 2DQJH 5IMOB 4H0IA 3GSNL 2V2TB 3LN5A 4DQOH 2KQNA 4ZOAA 4RFEA 2F54A 4DN3H 3VXPA 1JHKL 1V7MH 5D93C 1WT5A 2BSTA 4P4RB 3ARGB 1EFXA 1NLDH 1ZLVK 1QLFA 4WW1A 4ZUUA 1A7NH 3UJIH 3GSNA 3T0VA 5KANG 2OLDA 4XBPB 3SDAB 2R1XA 3VFMA 4OZGB 1CTNA 5DVNA 3QIBC 4LHJB 2A0LC 4TUOA 4M1CC 5FUOH 4F7MA 3ABZA 3U7AA 1VADB 2JCCF 5BS0A 3L5WB 1MFAH 4BH7B 1TITA 1T7XA 1BGXH 1AO7B 3ARUA 1P7QB 5JOFA 2KBGA 15C8H 4N5EC 5DUPL 4MNGA 2DIAA 5F96L 1G7MB 1R3JB 3KPOA 2X89D 3LS4H 1A6VL 5JR1H 4Q9QL 5E6IA 4LF3B 2AGJH 4I4WA 4DW2L 2J5LB 5HVWA 1YJDL 5E1HB 4XPAH 3VXQA 1YECL 1FL3A 1P4BH 5EOCL 4G8IA 5IB2B 3CD4A 4U6HB 1T66C 4E41D 2XPGA 1NMBL 2C1PB 4JHWH 5IBLC 4LCUA 4HIIB 5TE4H 5CJ8A 5DMKB 3O2VH 1XF5B 2X70B 2FRGP 4PJEE 2H45A 1BM3H 5E95B 2YBRB 2Y9RT 1AXSB 4P23B 4CW1B 3PWVA 5K9KB 2EYRB 2IC2A 3RVWC 3EBAA 2OL3B 4TOYL 4JKPH 1T2QL 5EUKA 4HUXB 3C60A 2FIKB 3RPIB 5KSBF 1F3JA 4QXUL 3F12A 1UJTA 2BXYA 2B20A 1WWCA 4GLRI 2P5WA 4OLVL 4R0LA 5I1CH 3G04A 2V7NA 4YBHA 3EDKA 3FB6B 5I8KH 1MJ7H 1RPQA 3FAXA 3VGHA 4N8CL 3TC9A 3WHXB 4YIQB 2CKBB 2E7BA 2VDMH 5D6CB 3SDXB 3V0WH 3BP5A 4MAUL 3AS2A 5SX5H 3STLB 1MCJA 4Z7NF 4KRLB 3AAZA 5E94A 1Q0XL 1T1YB 2D03H 4TSBH 1OTUC 1X9QA 4P2QA 1BBJB 1WTGT 4GAGH 3MMEA 3IDMB 5D2NE 1NBZB 1ONQB 1H5BA 2MWCA 4RAUA 2H2SC 2OR7A 1FO0L 2E9IA 3X3FL 2XWTB 1A5FH 2VR4A 5HHOA 3ZDXF 3OHXA 2NY7L 4OGXH 3AREA 1HIML 3OR7B 4MDIA 1IT9H 1EJOL 3OJMB 3EOBA 3RQ3A 2HG5B 4BQ6A 1KFAH 1LO5A 1WSST 1KIPA 3VI3E 4YHNA 5FGSA 1ZLWK 2ZUVA 5E8OB 1XGYL 5GZND 4POZD 3VXRD 3NZHL 1MF2H 4J1UA 3R1GH 5KVEL 3HR5A 1RZ8B 4LCYB 4QRRB 1CICA 4OFKA 5IQ9B 2BFVL 1TTFA 5ALBH 3S35X 1U3YA 1W72B 2YD1A 3TBVB 3UTTD 5IMKA 2C7UB 3NH7L 4JQXC 4MXQA 3FKUS 4P2OA 2UZIL 3LRSA 4F37F 3VD7A 4QGYA 2JE8A 3RGVC 4EUPH 4QRRE 1JJUA 1RURH 1YMHB 1DJSA 4NQCA 5B4MC 1PGRB 2IANB 1A6TA 3ARBB 4ZO9A 5KS9E 5BW7C 5E5MA 3QPQD 1R3LA 5LVEA 3N85H 2XKNB 3SE9L 5DRWA 4WEUD 3MUGB 3JBG7 4JANA 5IR1B 3U0WL 2NPLX 3IDYB 4JPVL 2NY3C 43C9B 1ZT4B 3T0XA 3U7YH 2Z8RA 4HMCA 1HZHH 3HLAA 4XCFL 4FQXA 4IEFB 2VLMD 4OQTH 2XKUA 4HPYL 1HINH 2X42A 4UIKL 2HMIC 2P24A 1U3HD 5EU7E 2HFTA 2V5YA 4MQXD 1H3VA 5C71A 4O4YH 4WI6A 3KLAA 4U2ZA 3V0AC 4YAQB 3WS6A 4P5MA 3HE6D 4UTAL 1I1AB 1F5WA 4J3UA 3A6BL 4HZLA 5HPOA 1IC5L 1I9RL 4QYOA 1RHHA 1G9NL 5EZJA 4P5KB 4Y5VC 5CLWA 3FQTB 5ID1A 3EFDL 5J13C 1Z3GH 4CNIA 1CGSH 1FFPB 4ZFFB 5JHLL 1MWAA 2B4CH 3JUZA 4OCSL 5ICXB 3GJFK 4EI5B 4OCXH 4XNQB 3UO1L 2BHYA 1FBIH 2C4FT 4IRSB 5DRNA 5I66B 4YK4C 3MRRB 1B4RA 4XWGL 5FHAL 2HKFH 1N8ZB 5DR5L 1E6OL 1RIUL 1Q9LA 5DD3L 5SWSD 4NN5C 1XGUA 2BVYA 3G6AB 3TWCH 4ZDHA 5MENB 5C0BB 1I3GL 1IGMH 3MRCA 4HFUH 5T1DH 3MLTA 4FXKA 4BA8A 3K46A 3L3KB 4ETQB 5JPMB 4GXUN 1CK0L 1GYAA 2V6HA 3O8XA 3RY6A 2AJVL 3MROA 3QI9B 1ORQB 4HUNB 1HSAB 4LHUA 4QRUB 5F9OH 4XHJC 2XFXA 4NO0D 4IRJD 2DBLL 2C3GA 3I3DA 3WEXA 3PABA 3FFDB 3IKKA 5F89A 4D9QE 5MENE 3TZVC 2YWYA 1UWEH 3CFBB 4PJBE 1FGNL 5I75B 1UKQA 5LCVH 2R2HA 1K6QL 1J87A 5IM7A 1SEQL 2NY1D 1EO8L 3KXFD 5FYLD 4PJXF 1UM6H 3K2UL 4Q9RH 3O4LD 2E27H 3SO5A 4HUMB 1T5WB 1DUYA 1RIVH 2N4IA 2RFXB 3ZYOA 4YR6A 3SOBH 4C83A 3LN9A 2XG5A 1OM3L 4MJID 4J6RH 4OF3A 4NT6A 3K4AA 3KYNB 4S0TD 2FBJL 4POUB 1JGEA 1HSBB 4JFEE 4LCWD 3DTXB 4XVSH 4PRPE 3LOWA 3H3PH 5CEZD 1V7NH 5K9JH 3D0VA 5T1KB 5D1ZA 4RQQA 2V5TA 1V3LA 1A3RL 3RA7H 4TTDD 3ECBA 1S5IL 1JL8A 3SKJH 2XTJC 3E3QE 5IJKC 4F9PC 1NDMB 1RFDH 4WCYH 3UTSE 4Z18A 3U4EA 5DDHB 5T3ZE 1IQDB 5TPWL 2HRPH 1YMMB 4M7KL 3VXSD 4HXBH 4ENED 2CUMA 4QHLB 1QLRA 4RMUA 2LTQB 4N68A 4N0CD 2D4DA 4ONFH 1GSMA 1HHGA 3ZE2E 3UX9B 2FHFA 5FA3B 4YX2H 3Q0HA 1C7SA 5HHXL 3MJ7A 1KTRL 3SDCC 2IPUG 3EO0A 5FCUL 3DBXA 1KXQE 1UC6A 4XT1C 5T5FL 1I9JL 1KTKE 2A9ML 4CRPA 3R0NA 5LG1A 1EZVX 2F8OA 3KPRB 1KCRH 3T04D 1G9MC 4PJHA 4ISVB 5DEGB 3K1DA 4P2RB 5CJOH 4H5SB 3JTTB 4AQOA 1IVLA 5F1NB 2R23A 5FDWA 3W82A 5J3HD 4RFOH 3VMPA 2KDGA 3LZFH 3WIHL 2CQVA 2BDNH 3GM0A 4LRIC 4XPTH 3ROLA 5GSVB 4PJHF 3O3UN 2EDXA 1IC4H 1MHEB 4G6AC 1IEBB 3QIUD 1IKFH 4GAYA 4OZ4A 5JDSA 3NIGF 4QRTB 3OJDB 5GGUA 3UROR 5BRZB 1G9EA 4QHKI 5T1LB 2BRRH 4D9LH 3AS0A 1RIHL 4ZYKA 4LNVA 3M8OL 4HUVB 5CIPA 2B2XH 2Z4QB 2EXWD 4NBXB 4DEPB 5AG8A 5CD3A 2H6PA 4N90E 3T2OA 5C0FB 5JQ6H 3H0TA 12E8L 1Q1JH 5KSVB 5BRZE 1JYXA 5HHVH 1UM4L 1ADQH 2DDQL 3L6FA 1X4ZA 4K55A 5KG9B 1DDHA 2AQ1A 2HVKA 1QO3A 1JRHI 1S9VA 4KQ4L 4XAWL 1OCWL 1JGDA 1NC2A 4NZTL 3KYMA 1U8NB 2BHZA 4XCEA 1Q9KA 1F6AB 1D6EA 1ZE3C 4XC3L 3RFZC 4JGMA 4PRBA 1H8OA 3G6JB 4YBQD 1GHFH 4NZDA 4DUXA 3MREB 2NY0C 5KOVC 1QVOA 5C3LD 1N26A 3D3VA 3MGOA 1I7UA 4L3EB 5HI5C 1CFSB 3MYJA 5ENWB 3RU8L 5IMLB 1W8OA 5SWZD 3BPOC 4ZFOL 2C3VA 1SBSH 2IBZX 2P8PA 1OSPH 5I73C 3H9YA 3L3GB 3UTQB 1T1WA 4O9HL 3IU3B 5GIRB 1WISA 3QIWC 3G6JE 3WCYA 2XTLA 2XZCL 4QHNB 1MRFL 1RVFL 5GISH 1BF2A 4Y4KD 1Q9WA 2IAMB 3HS0B 4L3EE 3VCLA 4KKCD 3U4BH 4F7TA 4X0KA 3BKCH 4Z5RA 3PL6C 3CPLB 2ESVB 2VDQH 3EFFA 3ZE1F 5K9OA 4ZOEA 5IVOA 2O26U 1OLLA 4P2YA 3FB5B 1OAKH 4NFCA 5IEHB 3T3PE 3RWEA 1CFTA 3CSGA 4OLWL 4MHHI 1KEGL 3AY4A 2AERT 4M4RA 5GGTL 1A7QL 4LEOA 1HKLL 3RZCA 3MRGB 4JG0L 1PY4A 3CU7A 1MLCA 1HILB 2E9BA 1AE6H 2ESVE 1MJJB 3SDDB 4R96B 1J1PH 2G5BA 3IJHA 2ADJB 4K7PY 4XHQA 3LKOA 2W9EL 3ULVE 4EIGB 3GI9H 2OZ4H 5E08H 2A2QT 2D0HA 3JV6B 5DI8B 3WFCH 3C5JB 4OZHB 1INEH 1WBZB 2R56H 1RUML 2DM7A 5C0GB 3Q3GA 3D5OF 4F3FA 4R7DA 1UWGH 1EV2E 1I7RA 2YXFA 1OTSD 2IQ9L 3LMJL 3TYGL 4GBXD 4MXVF 4FTVA 5CSGA 3PQYA 4ZSOE 5FUZH 1TCRA 3WFDL 1PX4A 1DQTA 1BZ7B 1CXHA 1VEOA 1CGXA 4MJ6A 4JKLA 3BT2H 4JPKL 1A6PA 4F8TA 3L9RB 1QLEL 4PLKC 5DQJB 4IJ3C 1HOCB 4HHAA 1IAKA 3ZTNL 1U8MB 1T1ZA 4KHTH 1MRCL 2AK1L 2MTPA 1S9XB 4U7KA 1JGUL 4NQUA 1GH7A 3DUSA 4OIIL 4CN6A 5GS0C 1SMAA 2HYMA 4PRDA 3D85D 5D1XC 5IV2A 7CGTA 3KPLA 5E99H 1DN0B 1RU9H 2GSIB 4YDJB 1IJ9A 1MEXL 1NFKA 4ODTH 5EUOF 4NPYA 1FH5H 1R24A 1KT2A 1OF2A 3SY0B 4IMLA 3D69A 3U30B 4HUKB 3MOAL 1GAFH 2W07A 3F7VA 3HAEA 1G84A 3TN0D 4EKXA 1MFEL 4M02A 5T1MA 1FG9C 3H9SD 3AS3A 2H32B 1FVCB 1TVHA 4HV8A 2VKXA 4YWGL 3ZTJH 1T5XB 2A73A 2I07A 5FHBH 4FQCL 4OGYL 3HTLX 3G9VA 5TE7H 1MY7A 5E2UL 2DIBA 4X6CF 4Z7WE 1OSZA 1IILE 4GG6E 2D7OA 35C8H 5DK0A 3GBLA 3D18A 2J8HA 4Y2DA 4G6MH 3K80A 4XTRC 2DQEH 1A64A 2XRAL 4OQ1A 1KCGC 3NVQA 3I9GL 4XPBH 3H3KA 1MCLA 1X5HA 2AJSL 1JPST 1JHTB 1ULVA 4PJBA 5FYLL 1A14H 5JZ7C 3HRZB 2Q8AH 1YC7A 5L9DH 5DHXB 2IH1B 2ADFH 3BIKA 1JIBA 4QTIL 1DQDL 2EH7L 4PY8I 2NX5D 4JFXA 1S7TB 4LAQH 5J57B 5EO0B 1J0YA 3QUYC 1WEJL 1JNLH 4JJHA 2BOBB 2QQKH 4XP5H 1B0GB 3B3IA 3V95A 3QA3A 4KMLB 5D1QA 4DKEL 4TSCH 4X4ZA 4WU5B 4ODHH 1JYWA 2GJJA 1NCCH 1CDCA 4CAGA 1H8NA 1VKXB 4L9LB 5F7DA 3IXAA 2YK1H 6FABH 2VLLB 3VWKD 4LCWA 4RGND 1MIMH 1FZOB 1QYGL 1Q9OA 8FABB 4P4KA 4EQ3A 1LE5A 1K4CA 2X1XR 2A6IA 2JCCB 1KB5H 3T0AA 4WW1B 4KZDH 3QUZD 3OKMA 2D7PA 4AK1A 1MNUL 3CFDA 4P5TC 5IGXH 3GSNB 4ODBD 3MLZH 3VFMB 2HFFA 2W0FA 2R1XB 1AJ7L 4KJPD 4M5ZH 2PTVA 1KJ2A 4MB3A 2A38A 2CO7B 4Y4FB 2BC4A 5D2LF 3TVMB 4H8WL 5DRXA 2JCCE 5BS0B 3ROOB 1YYMH 4MA1C 1TJGH 2XQYK 1F8TL 4HS8L 2VKWA 3CLFH 5C0ND 5HI4C 4PJ8C 3K74B 2EH8H 5GGVY 4N0CA 2NLJA 1AXTH 4JQVC 2HJFB 1CD1B 2O5YL 4NC1E 4ODUA 4J23A 4MYWB 5DD6A 2ARJB 2X5PA 4HG4K 1MFBH 5SWQA 2CLZA 4MNGB 1II4E 5T33H 1FRGH 2J4WL 2R2BA 4QWWD 2D31B 3V0VA 4YFLF 2XWBA 3RIFF 1SYVA 1MCPL 3MFFA 4MA7L 4OB5L 1L0YA 1KCVH 4OKDA 3GBNH 4AG4H 1A1NA 4Y89A 2R4SH 5EZOH 4HIEB 2ERJB 3H9ZA 3BPNC 4MCYA 4CN1A 1J0JA 4HJ0D 4EIZC 2IPTL 4JFHD 3VG9C 4XVJL 5KSBB 4DKDC 3C9NB 4LCUB 1YY8A 5FXCH 3PGCA 5CGYC 3MRDA 3BZEB 1B88A 5TQ0H 3P4OA 4U1MB 1VGEH 4APQC 2HTLC 5J1SC 1WCBB 1BQLL 1IAIH 4OJFH 4XC1L 3F5WA 5EUKB 2WW8A 5KSBE 3CDYA 4M6NH 4I48A 1QEWA 1UJ3C 4R0LB 2DTSA 2ZUYA 5DJYA 4ZAKC 3JWDC 2DRUA 1I1RA 3O9WD 4Q9CA 1FZJA 4BQ9A 1WGOA 5GRVL 5C7XH 2ZKHL 1Z9LA 4QF1A 3BP5B 2G75A 2GY5A 2NXZB 1T80A 4KK8D 5D72L 3QUMH 3GHEH 4QY8A 4Z8FL 3C6SA 5DYOA 1SVCP 4F9LC 1U3ZA 1JGVL 1QFPA 5HJ3B 1J18A 5HGDA 5I19L 4UINH 3CMGA 4OZIE 5DO2D 5DHVA 1OGAA 5ADPL 1TQCC 4PJDE 5HHOB 3ZDXE 1C5CL 2FSEA 2MQ0A 3O6LH 1E4WH 3WE6A 3EDDA 1GGYA 2VQ1A 2WSKA 4B53A 4F58L 1ORSA 1LO5B 1KIPB 1X5GA 4MXWH 5L88L 3N9GL 4S1SH 4J1UB 3TBTB 3X3GL 3BD4A 2F8VA 3MBEA 2YR3A 5FA4A 2WAHA 2AP2A 3NIFE 5IWLA 3IYLW 4Y4KA 3GSWB 4I18C 2NCMA 3RVTC 4XXCC 3MLRL 1PBYA 1XIWD 4LLMA 1JUFA 1NCDH 5GXBB 4P2OB 5GS1C 4AT6B 3T1FB 5E8DH 1NCWH 3HNTL 3DHJA 4E5XA 4HC1L 4ZOCA 1TQBB 3MNVA 5KVDH 2HJLB 3HNSH 2VABA 5DEFA 3V6OC 1JF5A 4U6VL 4YNYA 1OD7A 5EZIH 1UACL 4J3OC 1ZANL 4WWKD 3TFKA 1T21B 5E5MB 1CF8H 5B21A 3D0LB 3FOMB 2DYPA 4MS8D 4ELMA 1MQKL 4TNWF 1PSKL 1TVBA 2MHAB 2MKWA 1ES0A 3TH3T 1ZLSL 1G6RH 4Y1AD 3V6ZB 1JPSH 1FYTA 3C5ZD 1YY9D 2OSLA 2AVGA 2P24B 3PWJB 2OBGA 3U46B 2B4CC 2AJXH 3NGBC 4QOKE 4YGVA 3KLAB 3ZHDA 4NGHH 3LKNA 3GMQB 3BUTA 5K9QG 2BMKA 4P5MB 5J9PB 5LKNA 3KPSE 1LO4L 4ZSOA 1G7JA 2ZUTA 2PYEB 4OFIA 2VH5H 3DURB 2NQCA 1A21A 1RUQH 5FGRA 4Z0XB 2D9CA 1MY5A 1RHHB 1P2CA 2DI8A 1YNKL 2B5IB 1J10A 4XWOC 1OPGH 5ID1B 4OFVA 32C2B 3VFUA 2Z8VC 2WZPD 3SCMC 4O02H 2MJWA 1AY1H 1BOGA 3NPSB 4OLZL 5D96C 5CJXA 4P49A 4L4TB 1ACYL 1KTDB 1NAMH 4YHLH 3RWHB 2FJHA 4FRWA 4QXTA 5MI0C 4W70A 1KC5H 1KJ3H 2Y6SC 4K07A 1NBVH 3B9VA 4LDEB 3QWRA 4PJIF 1HH6A 3QDAA 4ZTOH 4YQXH 4W6XB 1N0XL 1Z9SA 1MHHA 4L4TE 1KIRA 4ZUVB 3H9SA 3BO8A 4ZDHB 4RSVA 3RHWF 3MRCB 4WO4A 1XFPA 1N7MH 2EXYD 4J4PC 4KRNA 5JW3H 3VWJC 4BJLA 3GB7B 4JRXD 2C3HA 4RA0C 2J8UE 4Y16D 4IS6A 1KCUH 4Z7WA 4JZJC 5F6HI 3W11D 1FCCA 4PJXB 2P1YA 5IT2H 1ZLVH 1G0XA 2ICEB 3HCVA 3VFVA 4LPTA 1FV1A 3EYOA 2DQJL 5IB3A 3CGTA 3BH9A 2R2HB 4DQOL 3P9LB 5CJBA 4XNMB 1A8JH 5CKAA 3R06A 5IK3A 3V52H 2Q6WB 3QDHA 4NC0B 4BH8A 3V4VH 3BQUA 5FYKH 2BVPB 3WO4B 3UJTH 3UJIL 3QZWB 1KG0B 4RGMB 2UV3A 4FG6D 4UV7H 2DLHA 4LU5H 4Y5YA 1NEUA 5B39B 2BY2A 5FUOL 1E6JL 4NT6B 3MLPA 4K7PH 2NX5A 3GMRB 4MA3A 1MFAL 1JGEB 3LQAC 1NAKL 1LK2A 1U36A 5HGGS 1OVZA 4V2BA 4WW2C 3VGGA 5C6WH 3QFDB 1BGXL 5AZEH 2WQRA 1BVLB 1REIA 4LSRH 4EN3B 1HQ4B 2GCYB 1LDSA 1U95A 1I8KB 1XZ0A 1K3ZA 4FN0A 2AXGB 5MERB 5EO1A 1XR9A 3PHOB 3LS4L 4N1HB 4BQ8A 4I13B 1UADC 5JR1L 3ZHLA 3T1WA 1XGTA 2AGJL 1VSCA 4G42B 2LE9A 3H7BB 3TH2T 1A9BA 3U4EB 4XPAL 2IG2H 4TUKL 4R7NA 5EOTA 1PZ5A 1FNHA 4C4KO 4I77H 4QLRA 3D9AL 3IKCA 3FRPG 4O2EA 3TCLA 1D9KA 1VFUA 5HPMB 3EZJB 1IAOA 3ZE0F 1NUFA 1HHGB 3FZUD 2BY0A 4PRHA 1J5OH 1OGTA 3K8KA 2DQUH 3BEVA 1L9NA 3DBXB 1JFQH 2YC1A 1FP5A 1JWMA 3HE7A 3LEYH 2V2XB 1QZ1A 1WICA 4M7JH 3ULUH 1NANI 3V5HA 1CYGA 2ZNWA 3FHQA 1ZS8B 4JVPA 1NCAH 4PJHB 3GSOA 3DX8A 2ZP0T 3VJ6B 3W2DH 5I1CL 3GSXA 3ARVA 3CCHA 3W9EA 1BJ1H 2OL3H 1OW0A 2FJGB 3GSQA 4TUJA 5HDLA 2DQIL 2R23B 4FFWC 4QHMA 4J8RB 2AXHA 3REVB 1T04B 1F58H 2OTPA 2JELL 2NY2C 2VDML 3V0WL 43CAB 4YZFF 4G8GE 3CNKA 2A74B 3TYFB 5I71C 3KPQA 1L7TL 1ZT7A 4M61A 3EYSL 2D03L 4GAYB 2VL4A 4HAFA 4TSBL 3QCTH 4P9HC 4JN1L 3HI5H 1DANT 4E41B 2CKBH 2ICCA 4GAGL 3PWPD 4BUGA 1W0YT 2A6KA 3TO2A 1R0AL 1ZLWH 1PKOA 3LPFA 3P73A 3BPCB 3BP4A 2EDNA 3TBWB 4OGXL 3TJHD 4R3SB 2Y7QB 2AV7A 5L2KD 1IT9L 4X5WA 3GSVB 5CD3B 5EC2A 4U1GB 5CJ5A 2RAMA 2E7LA 1LMKA 1FDLH 3CIQA 4AEIL 3QXWA 3GNML 3L6FB 3R1GL 4ODWA 1DDHB 3KYAA 3RVWD 3VXNA 2YD6A 4PJ7A 2J12B 3NACH 5CP7B 1S9VB 4H0GA 3S36H 5ITBH 1U6AH 5ALBL 2BRQA 1GZQB 1IM3A 1KLUA 3TNNA 2Y06H 4X4XA 4HWZB 3OXRB 5F3HA 3O4OB 3U6RA 3T77B 3F65A 3MXVH 1ZVSA 1QVOB 4Y19D 4PJ7F 1IM9D 3QZWG 2WUBL 2Z9TA 3MYJB 5BO1H 4K3GA 1DCLA 5HVHB 1OP5K 1ZGLM 4IOIA 1JN6B 5B39G 4UT9L 2P8PB 1I4FB 4OZIA 2EDJA 2I60H 4LFHD 4PJDA 3ELAT 4EVNB 2H8PA 3MBXL 5I8OL 1XCTB 1UZ6F 4FOMA 3VRIB 3N85L 1QRND 2DAVA 5JORA 1X5IA 4QEGA 1DBAH 4WU7B 5E8EA 2CRMA 4F7TB 4NQXA 1U8OB 4JO2L 1WWWX 3U7YL 4DOHB 5DJ6B 2DQGH 3EFFB 1DE4A 3B6SB 3TT3L 5K9OB 3HZKA 4BZ1H 4OQTL 3GJEA 3DMMD 3SEPA 1HINL 5FK9A 1CFTB 3UTTB 1VEPA 4O4YL 4LEOB 5ERWA 4DTGH 3DXAD 3RZCB 4P9ML 4FFYH 4DOHE 1MLCB 1CFQA 3VXRE 2UY6A 4NO2A 3IDJA 1CXKA 3RTQC 5A3IC 4S0UC 1DVFD 3WNMA 3QDJD 4JHZA 3UTPD 2G5BB 2FO4A 2JB5H 3IJHB 5C3TA 1UCBL 5C6PB 5DJDB 1C1EL 4UQ2A 3UTTE 3GJFH 4LNRB 3VDAA 1BQHA 1MCBA 3EO9H 4F57H 1Z3GL 2XY2A 1CGSL 4FQ2H 3T0DA 2NY4C 5GGRA 1AH1A 1AFVL 1TETH 3HPLB 4QRPE 1MPAH 4KU1A 3GRWA 4F3FB 1D5XA 4HBCH 3MR9A 1I7RB 3R8QA 4I2XE 4Z77A 2EZ0C 1GJIA 2QTEA 4MXVE 5ANMB 5DQDH 2FO1A 3MC0A 4GS7B 3D39A 2HKFL 4LSPH 1HYSD 3QNZB 3C5ZA 4P59H 4Z78B 1KENH 3SGDI 3TO4C 4MJ6B 2NY3D 3V6FA 1Y6NR 5IHZA 4JM4H 2DM4A 3TWCL 4MNQD 4Q7DA 1IAKB 4HFUL 5FM4A 5T1DL 1T1ZB 5EUOB 3KPSA 4KJWC 1I8MB 3HKFA 3HE6B 5ANME 4WDIA 2QJDA 4LASH 4ZFZB 3REWB 2VLME 3NFPA 2R4RH 2FZ3B 5F9OL 5EIIA 5IHLB 4JY5L 3AS1A 4WHTA 5KSUA 4D0CA 2OI9B 2QADC 5FOBA 5F6IC 2C4FU 4HPOH 1UWEL 1ZK9A 2BNUB 3BXNA 4ZUWB 2DQDH 1R24B 1KT2B 3EHBD 1OF2B 2R1YA 3GMOB 4O00A 3RX7A 5LCVL 4AIZB 3GK8H 4MLSA 4FQIL 2NXYC 3MJGX 3HAEB 4X6CB 5HHNB 1T89C 3DX6B 2NY5C 3S98A 4TQEH 4B7IA 2JJTC 1UM6L 4Q9RL 3WIIH 1JE6A 2I07B 3O6FA 3OAUH 5JLZA 2WBJA 1FC2D 1A9EB 3IDIB 4ZUSA 5HYSA 3SOBL 3MRQB 1BJMA 1AHWC 5DMGC 4GRWB 5C0IA 2ZSVA 4J6RL 1FNSH 4D3CH 1YEJH 2EC8A 1YQVH 4LBEA 2PW2B 4DVBA 4X5XA 5J1TC 1NCNA 3T65B 4Y2DB 2AJZA 1A4KB 5I17B 5BVPH 2EDEA 1ZTXH 4XVSL 3ARDC 4JRXA 2J8UA 3H3PL 3SKNA 1V7NL 2ZUUA 4NO0B 3L95B 4IRJB 5SWSE 3RGHA 3UAJC 1KCLA 1T20B 3RA7L 2MNUA 4XRCA 2JK5A 4BFIA 3LEVH 3DUHA 5F70A 4JFZL 5E6ZA 3GIVA 1EFQA 3ALXA 1RFDL 3RDTA 3BIKB 2FIRT 1S3KH 3KPNA 3I6GB 3TZVD 4D0BB 2NY1B 4X8JA 4UT6H 4JZOA 4U0QB 3KXFB 1AGCB 1GL4B 2WK2A 3KNBB 4HXBL 2ZCLH 1HI6A 2ED9A 3B3IB 3MZTA 3LB6D 1X4XA 1FPTH 3KPMA 1I9IL 4ONFL 5ILTH 5MEQA 3MTRA 4YX2L 1TVDA 4MJIB 3C6LA 2XKSA 3NCJL 1WIUA 3JTSB 3ZZ1A 3LKPA 2QSTA 3E2HB 3IXAB 4GAFB 3KXFE 3O4LE 4LCWB 2P46B 4GUPB 2ZUQB 2BSSA 5HGHA 1RJYA 4P4KB 3DV6A 1U58A 5D2LB 4HLZG 4RMSA 5EDXA 1K4CB 4K3DL 3T08A 1MJ8H 3FQXB 4WUKL 5CJOL 1LQSR 1OT1A 3FO1A 5DT1H 5KOMC 4DGIH 4RFOL 2HFFB 2W0FB 1BECA 4W4OC 2X4TA 1KJ2B 4S2SB 4IOFD 1MREH 2FEDC 3QDMA 4XPTL 3PWNA 3LPGA 5CEZE 5D2LE 3JWOC 4OLUH 4R90H 1RMFL 4BK5A 2PW1A 5C2BL 3WLWD 1CXIA 4CUCA 2E6QA 5E0QA 4Z7QF 4YXLH 3VXSB 2IPKA 1OAYH 1RUAH 3N50A 1J1OL 1H5BC 3QFJD 2BRRL 3VW3L 3SKUD 2NLJB 2JF1A 5DD6B 3S3SA 5SWQB 4PGCA 3AREC 1F4WH 5HD8C 4POYA 2R2BB 5HGAA 1NUGA 3QIBA 3P77A 2XWBB 4PGDA 2VUYA 1SYVB 2D2OA 3VXSE 3ZDZE 2ICWB 5HHVL 1KGCD 2YRLA 1A1NB 2DLTA 5GRUH 1IKNC 2I5YL 2P42B 4U1SA 4Y88A 2MSPA 3KLSA 4MCYB 4PYHA 3BYTA 5A1AA 5FGBC 3MV8D 4HIJA 1CVRA 1CBVL 3PGCB 1E28A 3ARFC 4G8GA 3FQWA 4MSWB 2I9TA 4WI9A 4N5EA 1GHFL 2YOCA 1NMCC 3ZKMD 3QIUB 3C8DA 4QHUB 1IFHL 2YRPA 1U8JA 3SKMB 3BJ91 3DOSA 5H94A 1SBSL 1HCFX 1YNLL 2QHRH 3PWPA 1OSPL 4FABH 2Z93A 4OCLC 1PG7H 5H2BB 4E0RB 1JWSB 4G6AD 3HUJE 1K8DA 1G1CA 5DJYB 5DLML 2NYYC 3KGRA 5F1KC 3LKSA 5GISL 1A3LH 3UMTA 3JV5A 5JHDA 3DVIA 4X7DC 4P3DA 2EKJA 3X12B 1N6QH 3OKOB 4RGOL 4K23L 1MSPA 3BKCL 5F7EL 4PJAF 1CLYH 3CXDH 3WDJA 4G7YH 2G75B 2V5MA 1OAKL 4MDJB 3RWDB 4GG8B 3C6SB 3HI1B 4I0PD 3SQBA 4DUWA 2DWDA 1M6OA 1DLFH 2Y72A 3CDGA 1JHLL 4O58H 1OGAB 3LS5L 1DR9A 3VD4A 2FSEB 2W0PA 3PP4H 3VH8B 1IM9A 2VQ1B 1KJMA 3BN9D 5F7KC 1QFOA 4JDVA 2NZ9C 4JPIB 2VITA 2XA8H 5L0QC 3GI9L 2OZ4L 5E08L 2ZCHH 5FA4B 3WFCL 4U3HA 5D9SA 5GRVK 2R56L 1ZSDA 5A16A 4Y4KB 3P4NA 4L4VD 4R6UA 3AXLB 4X6EA 1F11A 5GQBA 5SWZE 1AI1L 5IKCA 4LLMB 2VISA 1JUFB 3WXVH 2GUOB 3BDYL 2R2EA 3VRLF 4E5XB 1UXWA 4J7RA 2MQCA 1MCHA 4KC3B 3SE3C 4M1GH 4GRMA 2EIDA 3QUKA 4IBLT 4KHTL 1MELA 4XPFH 1FHGA 1EHXA 3BKMH 4OKVA 5HI3C 4V3EB 3EGSA 3QPXH 4JO4L 3CFIC 3CAFA 4ELMB 4PGJA 2V17H 4RMRA 2R29H 1AP2A 4JQXA 1TVBB 4U0RC 5EU6E 3I50H 5DD5H 2BHUA 1AGDA 3QEQD 4GRLC 1RU9L 4PJ9C 4DKFH 1ES0B 4XB8A 5I76A 3RGVA 4G59A 3ARYA 2ATPA 1FYTB 4M7ZC 1JGLL 4MX7A 4LVOB 1N64H 2HLAA 2HH0H 1S7RA 4PR5A 2MPAL 3IDGB 5BW7A 5CBAA 4GBXB 2QQLH 2R0KH 5HDQL 3BW9B 2J6EH 5FHBL 3RVUC 5BOZG 5TE7L 1WAAE 2WLYA 2FLRT 5D7JC 4D94A 2VDLL 1A2YA 2H32H 1BBDL 3N0PB 1J7VR 3VXUD 1ZVYA 3OXSA 4XP1H 35C8L 3WUWG 4ZMAT 3L3JA 4PJIB 1GGTA 4G6ML 4JFFA 2DQEL 4MAYC 1MLBA 3GIZH 5DHYA 1I1FA 4PLKD 2X41A 3EYQC 3LD8C 3IGAA 3PWLB 4MD5A 3D85B 3CX5K 4XPBL 2XV6B 3G08A 4AIOA 3X14A 1G7PA 3J7HA 4KTYA 4C58B 5L9DL 4Y5VA 3L3IA 1MAKA 3TN0B 1HNGA 1FNGB 1CGUA 2X09A 3H9SB 4GOSA 4L8CA 2APWA 2P8MA 5HBBA 4F7PA 5FYKD 3SJVE 4LAQL 4V1DE 1LVEA 1JNLL 3VGBA 1A4JA 3IVKB 1URLA 3O3AA 3ARGD 3RHWK 1NGZB 4TSCL 5LWYH 1ZA6B 2AKRA 3FN9A 4JB9H 4ODHL 3RPKA 3ULSA 4Q74A 3VDCA 4PJFE 4U49A 5BVJB 5F9JB 2CJUH 1UENA 3HCVB 2GTZA 1SY6L 2VN4A 1Y18B 1F6LL 3SDAD 1FV1B 6FABL 3VD5A 5IB4A 5DC9B 1CU4H 3VH8G 4DJMA 1J12A 3VD9A 1ZWIB 3D25A 3MRFB 1SJHA 4MJ4A 5C0CD 1IEAA 3MODH 4LQFH 1U8QA 5IK3B 3HMXA 2Q76A 1KB5L 4HSQA 4NJ9H 3TA3C 2H2PD 4BH8B 1JZ8A 2VIRB 1ND0B 1SY6A 4KZDL 4PS4H 4X7TB 5HYFA 4RMWA 1M05A 4PV9A 3MLZL 1XGQB 1BD2D 4M5ZL 1JPGB 3CSYB 4Y5YB 4KZEH 3L3HB 5E4EB 4HWEH 1KB9K 1MCIA 2PR4H 1AGEB 1NFDF 2NX5B 3JV4B 1U93A 3GSNH 1FVDA 1P4LA 1TJGL 5M7QA 1LK2B 3CLFL 1JHKH 5JXEC 3L7EA 1JTTA 1KOAA 4U1HA 1NC4A 5EZLA 1AXTL 2J5LC 5L2JB 4MVBC 4RFNB 1TFHA 1NGXB 3QUYD 1U95B 4KAQL 3OKKB 2VSCA 1XZ0B 1VENA 5MEPB 1FRGL 5TH2A 3UPRA 1XR9B 4EQ2A 3VWKB 1TMCA 1WBYB 5JOPD 4RGNB 1XGTB 4DZ8A 2D7NA 2W59A 3S6CA 2R4SL 5EZOL 1PZ5B 4CL7A 5HHMD 4AH2A 2DKUA 3QUZB 5IHUH 5C08A 2XN9E 1ZHKB 5AAMA 3VXTA 2E8YA 3O11A 3TCLB 4J3VA 1D9KB 1CI5A 3ARTA 1IAOB 4S1DC 3ZE0E 5HYIA 4ZO6A 1Q0YL 4M9PA 3RWGA 4PRHB 5TQ0L 5T5NG 3B2VL 1VEMA 3BEVB 3QG7L 4LLVB 4LLYB 1P7KA 5F93C 1IAIL 5JIPA 3HE7B 5H8DA 5JNYA 1QSFA 4Q9QH 1MHCB 4F9PA 4LPYA 4DW2H 4NKOA 2Q1EA 3V5HB 5D2NC 5I6XC 1YJDH 2WWKT 5IG7A 4M6NL 2IBGA 4GKZB 5EOCH 1PEWA 3GSXB 1QRKA 1UZ8A 4OFYD 4TUJB 3GSQB 1OARH 5J56B 4MB5A 2ZG2A 4K94C 2EDYA 5EBLA 5C7XL 2L0DA 5IJVA 2CXKA 1S9KC 4YZFE 3SDCA 5EBGA 2P8LB 3KS0H 3KPQB 3MNZA 4UB0H 3BE1L 3RWJA 1ZT7B 1RQ5A 4M61B 3QUML 3GHEL 2ADIB 5BQ7A 4ODVL 4PLJC 3U36A 4M03A 1HH9A 3VFSA 2G9HB 4QXUH 4PJCF 4UINL 4OLVH 3TO2B 3DVNB 4Y4HC 2DWEB 1UH3A 2VZ3A 3BP4B 2DMKA 4ACPA 2JIXD 2FD6H 1E4WL 2AV7B 1VFMA 3ZT5A 3QXUA 4X5WB 1FQ9C 4LRIA 4JFHE 4MAUH 5CGYD 4NWTL 4ZNCD 4S1SL 2VE6A 4NRXA 3DSNA 3HUJA 4PJ7B 5J6GA 1IL1A 2ZOLA 3O9WB 1FNFA 4HKZA 3NFNA 1A1MB 2Z31D 1KLUB 2YD2A 4G9FD 4HJGA 3TNNB 3ARBD 3NIDE 4X4XB 3GGWB 3X3FH 1GC1C 1DBBL 2AJUL 3OBAA 1CCZA 4ZAKD 5F3HB 5IB5A 3U6RB 1NCDL 2PO6D 4LKCA 1KNOA 5E8DL 1U8LB 3MJ9A 3NA4A 5KVDL 3IAGC 3E6FB 1S78D 5EU7C 5JIHA 1EAPB 3HNSL 1XGYH 4HIHA 1RZJC 5KVEH 4MD0B 1WC7B 5ALCL 1ZAGA 3B9DA 2YXMA 3L5XL 2I9LB 1RK0B 2BFVH 2VJXA 4EUPB 1CF8L 4F7CA 3MV01 4JR9L 3DIFB 5D7IA 1J8HA 4TRPL 2ZOKA 1T0NA 3HPJA 1H3WM 2BNRD 5E8EB 4ZXBC 2DIJA 3AROA 2EYSB 1BFVH 5DJ2B 1AKJA 5DJZA 2UZIH 1FIGL 3VI4E 1QR1A 5BOPA 3ARXA 1G6RL 4JREB 4Z6AT 3QHZH 1I1AC 2PXYD 1NCTA 3ILPB 1N4XH 5FK9B 3TPUE 2E8ZA 4LPUA 2LU7A 2AK4A 4YLQT 1HHIA 4BQBA 1HXYA 2AJXL 1A6UL 2F9BT 3H8NA 2GI7A 3QIWA 5EU4A 3OGCB 4JHAH 4HGWB 2XQBL 1EIBA 1AR2A 3SE9H 4YO0A 3I84A 2UZYB 2VH5L 3LN4A 4PRIA 1RUQL 1RJLA 3U0WH 3RVTD 2D0FA 3VFNA 3PL6A 4KI1A 4UQ2B 2R9HD 4H25B 1S7VB 1SMOA 4LL9A 5CLTA 4EI5C 1BQHB 4PRAA 4XCFH 1FNLA 2A83B 3DI2B 3S4SA 4O02L 5JUEH 1F13A 4UIKH 1WWBX 1ZHNA 4K9EH 3ZKXB 4JFDA 5LXGH 3DVGA 3DVFA 4LIQL 3MR9B 4M6OH 5EU6A 3RX5A 1QSEE 3NCCB 1NAML 1GGIH 4RZCB 3QO1A 4OCYL 1KC5L 1KJ3L 3QI9D 1NBVL 3DLQR 1MWAH 3D39B 4Y1AB 4C54A 4RDQG 5MEOA 4FQ1H 1ODAA 3C5ZB 1R3HA 5IFHH 1INQA 4YDVB 4ZTOL 4U1KB 5FKPB 4JY6B 3W0WA 3UDWC 2NW3B 2VXQH 4QNPF 5ESVA 3KVQA 3TIEB 4DGVH 3U9PH 3WDIA 5JW3L 3QULA 5HHQB 4OCSH 5I75C 1WAAA 4FA8A 4CBPA 4Y1AE 5EIIB 2VL5A 1PVHA 2AW2A 4K8RH 1WFNA 4D0CB 1D5MB 3PHQB 1YEEH 2O5XH 5IFAL 5FOBB 5EPMA 5FHAH 4A6YA 3P11L 5JW5A 4DFIA 1E6OH 2DLFH 4ORZC 5DD3H 2R1YB 3VE0B 3S88L 4KK5D 4WV1B 5ABDE 3ES6A 1FJ1A 1XR8A 3F58H 4PJGF 5HVFB 4YHYB 3MLVL 5C0JA 2ORBH 2UUDK 1CK0H 3V4VL 5DQ9B 4I5BA 2YPLA 3NCEB 1JMXA 1N59A 1WITA 3UJTL 4MWFA 3E3QC 5AWNH 5DFTA 1DP0A 2WBJB 4W68A 4XMLH 2EEDA 4UV7L 3QWQB 2DBLH 1K8IB 4QRQA 5D1XA 3HR6A 3Q5YA 5HYSB 2BNQE 1F4YH 1KPRA 3HZVA 4GQPH 4PY7B 4CVZB 1ZHBB 3SJVA 5E24E 3OQ3B 5J12B 4NSKA 2WQ8A 5CCKL 4EDXA 1K6QH 1J0KA 3OKEB 3PNWA 3QEUB 3KWWA 1MQ8A 3IJYA 4JRXB 1JZ3A 4URTB 3DI3B 4Y16B 1A02N 5AZEL 5ID0A 3SPVA 1FL5A 2EO9A 1EO8H 4LSRL 1ERNA 3K2UH 5F3BA 3Q5OA 4JG1H 1HWHB 1SEBB 2ZJSH 4XRCB 2JK5B 3HHRB 4EUPG 4BFIB 1JF1A 3QNYA 5I1AB 1WLHA 3K7UA 4C56D 3WNOA 2LTQC 4UMGA 5C0CA 3KJ6H 3MYZA 1HQRB 4XVUD 2FBJH 1F2QA 3BUYA 4X8JB 4XNYH 1BOYA 4I77L 4M43H 2UZXB 2VZUA 1S8DA 3MV7D 2NTFA 3GHBH 4S11A 4NM8L 1F00I 1HI6B 4KGJA 4KDWA 3PWUA 4P2RD 3WS3A 5MEQB 3ERYA 3H42L 1J5OL 4NHUE 2DQUL 3C6LB 1YEKH 4V3DB 1JFQL 3LKPB 3LEYL 2ZUSA 2DQFB 3DECA 1UB6A 1FFOA 4M8QA 5F8RC 4FZEH 2X4SB 2VRAA 2BSSB 2DL2A 2BVQA 3V5KA 5HGHB 3O3DB 1YDPB 1IAIM 1Q94B 5TPWH 4L1DA 4UU9A 3QUYA 2NNAA 4XH2A 5D4QA 1CG9A 3V6BR 5T1LD 4QRSA 4BQCA 2AV1A 1S7QA 1F58L 1WFTA 3FFCD 2H9GB 4ZS6C 2ATKA 3PWNB 4OUUB 5FO7B 1FG2B 2IGFH 1LD9A 2C3XA 2VYRE 4ODSH 1LEKA 2Q7YB 4BZ2L 3KJ4B 5T5FH 3QQ9C 3PDGA 3IFNH 1I9JH 2XN9A 2PW1B 4DEPC 2Q3ZA 4M62H 5F7FA 2APFA 1KJVA 5A2FA 2IJ0C 4CU6A 4F2MB 2IPKB 4PRNB 4RAHA 3INUL 4L29B 1S9YA 3LY6A 2X6MA 1KUMA 3GSRB 2IADA 2VLKE 4P5TA 5J1AA 4G80B 5C07A 3WIHH 1DQQA 3QIBB 4KHXL 4PGDB 3FT4A 2HFEB 3HG1A 4HKBB 3FTGA 1FDLL 4HS6A 3F6IA 5CIPH 1ZVHA 4OZFA 3NACL 2YEZB 3P3YA 3W9DA 3S36L 4NCDA 1RAMA 3C08H 4FP8L 4PJ8A 5BV7H 2B1AH 1UH4A 4HIJB 4JQVA 1BZ9A 5IW3A 1OP5H 2VQUA 2I9TB 2XWJA 3VRJA 1NBYA 1K2DA 3QRFM 3C09C 3U82B 3MXVL 3UZVB 1RULL 2IAMD 1R5WA 2FGWL 4BSWB 3DUUA 12E8H 1PLGH 2EDLA 1U8JB 5SV3A 4PJAB 5H94B 3PWPB 5K59F 1O7SA 3TT1L 4KQ4H 1OCWH 5INCB 2BP3A 4LEXH 2YZ8A 4NZTH 4PP1C 5EULV 5ICZA 5L2KB 2VLJD 5JHDB 1DBAL 4XC3H 3P4LA 3D1MC 4P3DB 1AIFB 2KZWA 2A6JA 3ULVC 4XBGB 3G5VA 4P57A 4PJAE 3GMLB 3JWNC 2DQGL 5ISZA 4APQA 1B0RB 2YN5A 4HZAA 4YHKH 1PDKA 4JY4A 2GTWA 5LGJA 2RR3A 3RU8H 2HKHH 5SX4H 2PYFA 1KIQB 2L4OA 4X6DA 4XNUH 5L2KE 5D7LA 1M6OB 2C1OA 2BCKB 1IE5A 3ARPA 1UJ3A 3S97C 1I7ZB 4FFYL 1MRFH 1RVFH 1T6VN 4JKWA 1VFBA 3QDGA 4Y19B 1IMHC 5I1DA 1E4XH 3O0RL 1IM9B 4D8PB 1NCBH 1KACB 2FH6A 4ZO8A 4AENA 1U8HA 4LSUH 3C8KB 2HT2C 3M07A 3EO9L 3QQ4B 3E6HA 4LOUD 2R69L 1BQSA 5AYQA 4BSJA 4TNVF 5D9SB 1TETL 4H1LA 1KEGH 4F9LA 5C8JA 3L7FB 4QT5B 5A16B 1QRNB 4Y19E 4HBCL 2X4RB 1A7QH 1T0MB 1C12A 3T2QA 3P4NB 5DC0A 4PREB 1PFCA 1NGPL 2VISB 5DQDL 3OV6A 4HFWA 3UZEA 5TJWK 5IVXA 2Q86A 1E4KC 2G5RA 3S5LA 2OK0L 2R0LL 3VRLE 4P59L 1TZGL 1UXWB 3TPUA 1FLTX 2D7MA 2W9EH 2WUCL 1J9CT 1QRNE 4GJTB 4JM4L 2F53A 1H15B 4GRMB 3BGMA 4OIBA 4KROC 3DXAB 5CJQL 4L8SB 3MV9A 1RUMH 2IQAA 2BXZA 2VXTH 4LASL 5IVXF 1VESA 2IQ9H 3EGSB 3U30C 4I18A 1DVFB 2R4RL 3QDJB 4X83A 3TNMA 3JXAA 1RUPL 4MQ7B 1VA9A 3HB3C 1AP2B 4XXCA 5CBEB 1AGDB 3TLRA 3V5DB 5GS1A 4KK6C 2APTA 3WFDH 2DQDL 3V8CA 2VZVA 4O5LH 2ATPB 2NTSP 4WHDA 3GK8L 3T0ED 1QLEH 3UJJH 4P46A 3K81A 3V6OA 5C0EA 3QDJE 3NZ8A 1QSEA 1OTTC 4LAJH 3ZTNH 2G2RA 3C2AL 3BRFA 5E9DA 4TQEL 2XNAA 5I1EH 1G7LA 1VPOH 1YPZF 1CL7L 3OAUL 3PHSA 4X6BA 4OIIH 5DVKA 2EE9A 4H0HB 1HDMA 3HAEH 2EZ0D 3OL2A 3OKLB 5HYEA 2NY3B 4DK3A 4WY7L 4D3CL 5I9QC 1YEJL 4MNQB 1CN4A 1D5ZA 4U1LB 1HXMA 1PKQA 5BVPL 5L8LB 2ZCKL 2OP4H 1X5AA 1I1FB 2Z92A 4NCC2 2X4NA 2X4UB 4GRWH 4JFYA 4NQED 4YWGH 2LAGB 5C0DA 5LAXB 5HY9A 3PIQA 1MIEH 3G08B 3O6KH 4MNQE 1G7PB 3GSUB 3LEVL 3DROA 4K3EH 5J6HA 1MVUB 4Y5VB 3L3IB 4RIRA 1I1CA 4Y5XB 4LHQB 3LSOA 2P49B 1OWRM 2CR6A 3SCMA 4F7PB 3MRKA 5D7SH 2OTUB 3CFJA 3RWIB 2BZDA 4L9LC 2F54D 1T0PB 3GMMA 2NXYD 2IMNA 2XZQL 1A4JB 2ZCLL 1DBJH 1EFXD 1FPTL 1EEUA 4D2NA 2VNCA 3S8WA 4S1QH 3FONA 5EIVA 5KVFL 4OV6F 1LP9A 4YK4B 5FYLH 1ZEAH 4O51B 3BDXA 2CUHA 3D2UA 5EORL 5HDBE 3U2SA 4JM2C 4JCMA 2H26B 1SJHB 5B8CC 4UZGA 3QXAB 1FFNA 3SGEH 2EH7H 1IEAB 4Y4FC 4MCZB 5BS0D 1NFDB 1U8QB 1MJ8L 4LFHG 2CRZA 4OT1H 4J4PA 3TVMC 4YXHL 3VWJA 3SGKC 5DT1L 1M05B 5CHNB 1MRDL 4DGIL 3CXHJ 3VGAC 3BMWA 4DKEH 5F88A 3V9FA 3MGAA 2IH3B 1HN1A 4JZJA 1OAXL 4I9WE 1MREL 4DFHA 1KB5B 3CDCA 4PY8J 4WNQA 3TZVB 4OLUL 2GYSA 1YNTB 4R90L 4G8EA 1P84K 3GEWB 1U93B 4NYLA 1FVDB 4I0CC 2K9UA 5E6ID 5F7WC 1OAQH 5E2JA 4YXLL 3MRPA 1KELL 1NDGB 3OF6A 4UDTA 1KJ2H 4KKBC 5FUCE 3L7EB 4JO3H 4U1IA 2UVEA 4U1HB 1JK8A 5EZLB 3OR6A 4WTZG 1M1SA 1MNUH 1F4WL 4HCRL 4CU7A 2EEBA 3O81A 5DUBA 5TH2B 5E8NA 3HZMB 3I3EA 3MRNA 4JKKA 5DXWA 4NQDA 4DZ8B 1JTPA 1X5ZA 5DK2A 1YYLH 3QWOA 1BJ8A 3F7YA 5DGQA 2PCPA 4X7SH 3UCRA 3A67H 4Z7VE 5FB8A 2IMMA 3C60D 1EUUA 4WW2A 4WHYH 2AEIT 2Y5EA 2PTTB 3NCBB 1MJUH 2P5WD 4TTGA 3ARZA 4FHBD 1JI2A 4Z7UA 2XTJB 4EXPX 3M1BA 5CWSB 9CGTA 5LJYH 4ONGL 1MCPH 4MA7H 4OB5H 2BOCA 2J7LA 4N0UA 3B5HA 3PJSB 2CIKB 3B2UC 4GKOA 4LCCC 1LK3H 5IG7B 4FABL 4TVPD 2QR0A 1LEGA 3IDNA 3QFJB 1LE9A 1A6AB 3ZTJG 2NXZC 2VLKA 1AGFA 4DUVA 2YUWA 4P2QD 5FV1L 4XVJH 4PTUA 1A3LL 5F7LB 5CSZA 4OLYH 4PJCB 2GAZA 1N6QL 5EBLB 5IJVB 5HHOD 1IQWH 1WBXA 1X44A 3CXDL 4G7YL 3ARED 3QFJE 3PV6B 2B1HH 3T0WA 1A47A 1EJ6A 2VUOA 3SN6N 4GW5B 1W0WB 1DQJA 1CE1H 1JZ7A 1DLFL 2QKIA 3DSFH 4O58L 3WNNA 4PJCE 3MV8B 1DQMH