3X11A

Crystal structure of hla-b*57:01.i80n.l82r.r83g
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRNARGYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x11A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3x11A01
3BP7A 5DMGD 4LARH 4UDTB 3BW9B 4B7LA 3FFDA 3KLHD 3MRDA 4ZS7L 1MNUL 2AXFB 2ITDB 3MV8A 4RGMB 4H26B 5TF0A 3V6OE 5EBWB 4RFEA 3VGHA 1PQZA 2ZNXA 2PCPB 3CUPB 1EHAA 2HFFB 5EUKB 4JFDD 2VISB 4P2CG 5JXED 1R3IL 1I7RA 4RGMC 5SWQB 3ARZA 1FJ1B 4OAWB 2A73A 1B0WA 3BEWA 4FZ8L 4FXGA 3VFMA 3X14B 3BO8B 1QR1B 1E6OL 2EDDA 5TE7H 3QXVA 1FL3B 4HHAA 3MOBH 1X4YA 1J8HE 2OZ4H 2NX5E 2JJSA 1FNAA 5F9OL 4UDUA 1I8KA 4XAKD 5CMAB 3TBWB 3DX8A 1G1CA 3FONB 1RZKH 1A7NH 3QSKB 4NGHL 2J2ZA 1A1OB 2UVFA 2J4WL 5C0BE 2ZZUT 1GL4B 3TO4B 1U3ZA 3FQXB 5IEHA 2EDKA 5J89A 1CDHA 3GBNH 3AY4C 3MRQB 3HS0B 4MQ7B 1V3KA 2RCSH 1G9NH 3GSQB 4YHOH 3TO4C 1LP9F 4U1JB 3QQ4B 5F9WB 1WEJH 3PL6D 4CN4A 2LTQC 1Q9KB 2HLFD 4OCSL 4R0LB 2ZSWA 1WFOA 3FRUB 4HWUA 2XWBA 5L2JA 5B22A 1OF2B 4G6KH 3UTPD 5CUSH 3BAEH 2RHEA 3QI9A 1EJOH 2DI7A 3VU2A 2R23A 3GKWL 5F9WC 3JV6B 4R0LC 4I4WA 3BDXA 2FECI 1MWAA 4XNXL 4CGTA 4KRPB 3FN3A 4QHLB 2I60H 3MLYH 3RAJH 2B7DT 1ZXQA 1Z9OA 3RX8A 5KS9B 1SVCP 4LPVA 4D0CA 1QBAA 3GSOA 4P5TD 5T1KD 2Q20A 1OW0A 3WL9A 4NKQB 3CNKA 3IDGB 2F5BH 3GSNL 1M6OA 1KC5H 5B39G 4Q9CA 4P23A 2EDRA 3IF1B 3JBG7 3WXVH 4KI1A 3HI6L 1AKJD 3PWNB 1ZGLM 1J0JA 2NY6B 4NZUH 3OJMB 5MP6L 4R7NB 4ZO9A 3OXRA 4HUKB 3BWAB 2VDRH 1ZHNB 3MACH 2HH0H 2FR4A 2Z91B 4LSPH 5BRZA 2BDNH 5D7IA 4Y88A 3T0EE 2M2DA 1CK0H 1MAJA 5L7XL 4P2QB 4X4ZA 3VJ6A 3WNNA 2NY6C 3BD3A 5DD0H 2E9BA 1YNTA 4QRUA 1CDBA 1KN2H 2A6IA 1MAML 5T3ZL 5DJDA 4OZGF 4N0YL 4XT1C 5F1OB 5CBEA 1AC6A 2Z92A 3MOAH 3TPKA 4M1GH 3MA9L 2FDBP 1JWUA 4M8QB 3TESA 2DQTL 2I24N 4Z7WE 5CSGA 3A0OA 2KPNA 5DHVH 2KQNA 1PLGH 5KTEL 1OT1A 4JKPH 4YEEA 5GGTL 3V6FB 5D1ZA 3MGAA 1RUKL 3RUGE 1MHCA 4D3CL 4WUUA 3RZWA 4W68A 1Q9WB 3N1QC 1OAKL 4JO2H 5DGQA 8FABA 2X89A 1IAMA 5IT2L 3DGGB 3BZ4A 1JNNL 2BNQB 4XMPH 1MCJA 1HHGB 5BVJA 3RWIB 4GW5A 4QXWA 5I18L 4DAGH 5E1AA 1LO2L 4X6DB 5FYKL 4HF5H 4N1HB 1LEIB 1I9JL 4P9HL 1QFWI 2DL9A 3I3BA 3TLRA 3BOVA 3T2OA 1HNGA 5F93C 4APQD 3LPGA 2WSKA 3ES6A 3MJ8A 3QHFL 2YHGA 2G9HA 2AVGA 2IBGA 4MAYA 2X4SA 4KQ3L 3O3AB 3V5KB 4Y4HC 3PQYE 4PRIE 4FA8A 2CLVA 3D39E 4X6BA 3TJEL 3WYRA 5ISZA 1A0QL 1Q8MA 1DEDA 3BFOA 3UJJH 4ODVL 43CAB 5FKAA 1HKFA 4JZJA 4MD5B 2Z8SA 4ENEC 2C1PA 1A6AB 3CC5A 1LNUB 4WI7A 1CVRA 5CD3A 4G3YL 2AJYL 4PBWD 4XP4H 1HHIA 3P9MA 2AV1B 3BESR 3BZDA 1BJ1H 4DEPB 3TC9A 5D8JH 5FCUH 5I73B 2HLAB 5K93A 4HUUA 1MCNA 1RK1A 1EEZB 4FQCL 4OD2B 2H1PH 2NQCA 2FATH 5E6IB 1U91B 4XP6H 1EMTH 1GXEA 4G7YL 5DHXB 1U58B 1Q72L 3GHEH 4Y89A 2IQAA 3WNOA 4A6YA 5I73C 3SCMB 4M6NL 5DSCA 2JCCA 5T3XE 1H3PH 3CXDH 4MA3A 5E6IC 3SDYH 2OCFD 2FD6L 3HMWL 2GUOB 3DX7B 5EWIL 4Y1AA 4DN3H 2EH8H 3SCMC 3GSWB 5SWSE 2OR7A 1OY3B 1FNLA 1AGFA 3VWKD 1MCOL 4YZFF 5HTSA 3SDXE 3GI9H 1Y0LA 4G9FB 1JYWA 4HUMB 5I15L 1C16A 2WK2A 1JL8A 5E8PB 2AK4A 5GJTH 2XT1B 3CSBA 1Q38A 4WFFE 1HYSC 4CVXA 1TTGA 4FQLH 1Q9LB 1IILE 3ARDD 4A6YL 2IG2H 4NM4L 2BNRE 2C26A 4C56D 3LRSA 2QLVB 1OM3L 4KHXL 2E9IA 4FXKB 1NCDH 2COQA 2VERN 5ERWA 3JWOL 4AM0A 4NRYA 1FYTA 4HKXB 1HKLL 1UWGL 5FXCH 4V2CB 4PUBL 5CGMA 5DJCB 5HHMA 3UTTD 4F7MA 4H20L 4L8SA 1FSKB 1MI5B 2VLJA 4U3XA 3TT3L 4U49A 1IGIH 1VFBB 4Y2DC 5I1CH 4GMTL 4EDWH 1QLFA 5IQ7H 5T1LD 1IBGL 1D6VL 2X4QA 1A7RH 4JDVB 2KL6A 4FABL 1HH6B 1FZOB 4IIQB 3HE7A 3BIBX 1FSKC 1GC1L 2PTTA 1WZ1L 3T0XA 1RVFL 3C5SB 3TEUA 4RRPG 3QUXD 5JIIA 5INDA 4OBRA 5GSRB 4JEGB 3KJ4B 4UB0L 1REIA 2VDKL 4P4RB 1JNLL 1L7TH 4P4KD 4PJFF 2QQNH 3I6KB 3U0WL 3BHBA 5DMIH 1XR8B 2CK0H 2CIIB 3VFPA 4HC1A 1UQSA 2AEQL 3KJ4C 5D7JB 3S6CA 4BSVB 5AD0B 3RWDA 4LVOB 4NZRL 1YYLH 5IOPB 2VAAB 3EO9H 1CVSC 2BSRB 2QR0A 5ACZA 4MXQA 2K1MA 1NBZB 3DX6A 3EOBA 5D7JC 4GKSB 1JHKL 2LAGB 4PB0L 4KTEH 3QXAA 5I9QB 3SGJA 4ODUA 3MRJA 5IHBA 1YMMB 4ZYKB 4YLQT 4JY5H 2C4FU 4Z0XB 3PWPD 1G84A 3C6LB 3LCYA 1M7DA 3BPCB 3QUMA 4ZXBA 4NQCB 1ZHBA 4TNVK 4I3RL 1ZVSB 2V5YA 3WJJC 1JTTA 4FXLA 4CVWA 4HC1L 5I9QC 2H8PA 1T5WA 2IFFH 3OJVC 1A6ZB 3MUJA 5EU4A 2ZCLH 5IB1B 3C6LC 5IROA 4YHNB 5E9DE 2C1OA 5E5MA 4JDTH 1R3KA 4L9DA 4XB8A 1NGYA 2DBJA 1IGYB 1KJ2H 1TNNA 3EYOB 2F54D 3VXRB 2NY1B 1IAKB 3UBXG 1T2QH 3HCVA 1Z5LA 2VXVH 2EXYD 2ZKHH 4PGDA 5I8CA 1S8DB 5EU3A 5AEAA 3DXAE 1A5FH 3I02A 2CDEB 5E2UH 1D5XA 2HT2C 2OLDA 3GB7A 3MRIA 4WEUD 5C0GA 2BJMH 1KIPB 3QEGL 4CAGA 3P3YA 2F74B 5HDLA 2GJ6B 3V5HA 1L0XA 1MVUB 1O5DT 4JHAL 4FQQB 1T0MB 5EOTA 3NA9H 2N1KA 1I7TA 2V9TA 3GK8L 4XAWH 4JFFD 2B1AL 5F7WC 1E6JH 2DD8L 4LGRB 4H8WH 4M9OA 2A77L 5IFJA 2N7AA 4GBXD 4AYFA 2EDTA 5F7MC 5A16B 1UCTA 1F4WH 2X9XA 2EH7H 1KYOJ 1GGTA 3GIZH 5DVOA 2GFBB 5K9OA 4GW4B 5MHSD 4KVCL 4LSDA 3KHQA 5JOFA 5LQBH 2E7HA 1C1EH 4WRLA 2D03H 3S8WA 5SX5H 4WTWA 1P5VA 4X9IA 2DI9A 2HFEB 3OKOB 3C8KB 3C87A 4NKIH 4PTUB 4N68A 1H3TA 3MBEA 3OB0H 3W2DL 4QHKI 4QTIL 1NSNL 2YKLH 1XCQB 3WHE1 1T0NB 4D9QE 3WE6B 3T0VA 1AD0A 3F6LA 4KY1L 1BLNA 1BECA 2EYTA 4TUKH 4NP4H 4FP8L 1QRND 3PWUB 4RMRA 1JZ4A 3N1FC 4N8CL 4MJ2A 5LGJB 1NDMB 2BVOA 3HNTL 2N7BA 5F89A 1A8JH 5HJ3B 5HGGS 3QISA 5C3LD 4N0UB 1DLHA 5D9SB 2IANE 2W9EH 1F8TL 1G7MA 1BFOA 1JPSH 2GJJA 2ARJQ 2DQGL 3V2AR 3CX5K 2FJGA 2NYYD 3E6HA 4B53A 1H3WM 1BREA 3DV4B 4GG6E 3HG1D 1RJYB 5C0RH 4XVJH 1D5MA 2O5ZH 4MNHA 2A0LD 5JPMB 3GUTB 1UZ8B 5BV7B 3THMH 1LILA 4PJ5B 1FFRA 2V2XA 3AREB 3GRWH 2XNAA 4XNMA 2Z31A 3VD3A 3SBWC 5ACLA 5C0DA 3ARYA 4FN0A 4QRSB 3NCYP 1ED3B 5A2IH 3G5VA 3AY4A 3U6RB 1RU9L 2DIAA 3MODH 4EBQL 2ZUUA 3TVMA 2VLKD 1NEZB 3LS5L 5BV7C 4R3SB 3EOYG 5JHDB 3AREC 3AGVA 1C5CL 4A2LA 3RU8H 3UC0L 4Z7WF 5FGRA 5DJ6B 2ORBL 4PRHB 1QFOA 1VDGA 1OSZB 3RUGF 1FG2B 3PDDA 5DUBA 2X09A 3B8YA 4I48B 4Y7MA 5KAQF 2ED8A 2BVTA 3MLRL 4S0UC 2P42B 3TZVD 4JFPA 3VG9B 1IFHL 1MCEA 3D9AL 1XF3A 5FYJD 3QWQB 5HHPB 4DCQA 2DQJL 3L3IA 4JZNA 1X4ZA 3MRGA 1ZOXA 4Z7OE 5FYJU 2VDNH 4I77H 4KJQC 2I9LA 4RFEB 3QEUA 4PRNB 3VG9C 3FO9A 4YNYB 2JIXB 5F3BA 1XH3B 2FJHA 3SKMA 1BGXH 1YMHB 2E5EA 4X7SL 5DJZB 3VXOA 3V52H 1BD2B 4LQFH 2APTA 2A73B 4WFHE 2GKIA 5GS2H 2AP2A 5EB9A 4LSRH 1BQLL 4L4VA 3CLFH 5EC2A 5LGKA 1NGXA 4RQQB 5I19H 1A7PL 4D8PA 4R2GB 2CD0A 4GAGH 3TBYB 5I76B 5DO2C 2L7JA 3EYFA 4IMKA 3NFNB 5E08L 2IH1A 4X7TA 1PKQE 3BIKA 3DRTA 4HIJA 3ZE0E 3TA3B 4FMFA 4JG1L 3QG7L 3RTQD 2EYSA 3D5OF 1UB6B 4R2GC 4JFXB 5H37H 7FABH 1RJZB 4N0CA 5DEGA 4XCCL 3S36H 3SPVA 3STBA 1X9QA 2AEPH 4G6MH 4IRSD 2YUXA 1X5YA 3T77B 3TA3C 5HDBE 5JDJA 1BOYA 3IFNH 3L95A 1MCIA 3GSNB 5H94B 1RULL 4JAMA 4ZOEA 4FQXD 3J8F7 1CFVL 5JOPE 2YPLE 3QWOA 4KI5E 3PIQB 1SYVA 3DVNA 4OUUA 4J1UB 3VDBA 5E00B 3B6SA 4HXAL 2FEDC 1UACL 2VDMH 4RRPA 5CGTA 2XZQH 5L88L 3MUZ1 2WBJB 5EG6C 2GITA 3LKQB 3SDXF 5IM7A 1HH9B 1JIBA 5B8CC 5DZNA 4P2RA 2PN5A 2KZ1B 4WWID 1FAIL 4AH2B 2WBJC 1T20B 5L2KE 2B5IB 2X4UA 4HZLB 1MQKH 4FTVD 4LCYA 4P23B 3NCCB 3ECBA 2QQLL 4PJXB 2CIKB 3HI6H 4HULB 1YN6A 1UADC 2A6JB 4ZNEE 1VGEH 3TYFA 2NNAB 5BW7C 1L9NA 4N0RA 4UTBL 5I8OH 4JFZL 4X6FA 5D7IB 5FK9B 4LLAA 4LP4A 1Z2KA 5BS0B 1J0HA 3VA2C 1FFNB 4DZ8B 1MWAH 1MRFH 4QRUB 5I71B 4YAQA 1OHQA 4HS6B 1NBYA 3OKLB 4PJ7E 2Z92B 5D7LA 4PRAB 1JFMA 3P11H 5GS3A 2HTLC 1NLDL 1NC2B 1DZBA 3KXFB 2HT3D 1JGLL 2VABB 4XCEB 4KXZI 3WSQH 5FDWA 1CXLA 1B4RA 3N50A 2NLJA 2RB8A 1FL5A 2I07A 5D1ZB 4C83A 3QEQB 3O11B 5C08A 4P9MH 3EJYD 4WUUB 3UBXA 1KCLA 2EDOA 4R97B 4AEIL 4YHZL 1WSST 4OCWL 4O5LH 1JPST 4GQ9L 1TITA 4EUPB 4RDQG 4TVPD 1V3JA 4NC0B 4NBYB 1I1AA 1KTLA 5FGCB 5FYKH 4R97C 4PLNC 2R0WH 2JJVA 3V4UL 2Y23A 3RX7A 1MPAH 4TSBL 3B3IB 1GRWA 3M1BA 4HWBL 4NJ9H 5JORA 1E0OB 5E8DL 2O26U 2X4SB 4JRXE 1KCRL 1G7PA 5EIIA 2VXUL 1CE1H 1OTUC 5DD5L 2WIIA 1J0ZA 3ULUL 4ODWA 1U8LB 3BD5A 3SGDH 1CXEA 4XC3H 1RAMA 3E8UH 5HHXL 1K8IB 4Y2DA 2W60A 5I1HH 4P46A 4M3KB 5B4MC 3CC5B 1AR2A 2E7MA 4L9LB 3TBTA 5DYOA 5CD3B 3VFOA 4ELKB 2FBJH 3QNXA 3NIFE 4JO4H 4Q58C 1HHIB 3D48R 3RGHA 1G9MC 4AY0A 3T0BA 3BGMB 2A6KA 4JRWA 1B6UA 2FX9L 5F1IA 1U95A 3RKPA 2EDBA 4NCC2 4ZOCA 5F6HI 2F5AL 3EFFB 3V6ZA 4Z7NE 3DI3B 4HBCH 2N4IA 1I75A 1Q72H 4WI6A 2DQIH 3MO1A 2HG5A 4KRLB 1BHGA 5FO9A 5ICXA 1K9TA 1W72L 3D3VD 2XQBL 1J0KA 1SBSL 4LLUB 4G59A 5LG1A 3QJFA 4AENB 1Q0XL 1FVCB 1VHPA 2BC4A 4OGYH 3FZUC 2UVEA 3QDGE 1KJ3L 4Y1AB 3WS6C 3RWGB 4CVUA 3H6JA 3AVEA 5DT1H 4DUWA 3OGOE 4DN4L 3WHE0 1HILA 4Q2ZA 3PV7A 2AJ3A 3RWCA 2DLHA 3JWOC 3VDCA 5KOMC 4HX1A 5LJYH 3NPSC 1R3JA 4L1HA 2YN5A 3ULVC 4NNXB 1H8SA 1NCWL 2PXYD 1TJGL 4RGND 4P5MA 5ALBL 4M6OL 5FA4A 4QXTB 2Q6WA 5K9QI 4A6YH 4LOUD 1UT9A 1F4YH 2VXTL 2NX5D 4FHBD 4NQDA 2CGRL 3SDCA 3INUH 5ERWB 3BMVA 1EEYB 4BYHA 1X5KA 5IB4A 5C6PB 1DP0A 3DX9B 2F53B 4L8SB 3GMOA 5GGQL 5ECJE 1RZ7L 1R5VA 2ENSA 3EDDA 3FO2B 1N8ZB 1A6UH 2R29L 3MUGA 2IALB 2BX5A 4YHKH 4M03A 3KPRE 1AP2B 5IB5A 2LU3A 3Q3GA 3UDWA 3AS0A 3WFEH 2QSCL 2A1WL 4F3FB 1K4DA 5INDB 4XCNB 3IVKA 4RBPK 5C09E 1N5AA 2HJFA 4JFEE 2HVKB 3KYKH 5TF1L 4XHQA 2Z93A 2FX8H 3BHBB 2P5WD 5KG9B 1MHPH 3M17B 3VA6A 3O3DA 2X9YA 4K8RH 1T4KA 3L3KA 4RX4D 2E7LC 5GGSA 1VB9A 3STZB 3RL1B 4GG6F 2JELH 1ZA6B 4YDJB 3PXJA 1WBYA 1NUFA 5ACZB 2PR4H 1IGCH 5E2JA 5HXMA 2OP4H 2VMFA 2X7LA 1CG9A 2NR6C 5D93C 4F8QA 4LAQL 4HQQH 2HTKC 4ORGB 4Y0GA 3KPMA 2R56H 1CLYH 4KKLC 1WAAE 1WFUA 4FG6C 4N9GA 5GZOD 2H45A 2RQ8A 3UO1L 3DGCR 1BOGB 1IKFH 4Y5XA 1AHWB 3SQBA 4RAUB 4LPTA 2YA0A 3U30B 3HB3D 4UV4L 4CN6A 2B4CH 1GAFL 5GRJL 4MS8C 4GRLA 4PJCA 3MLTB 4JCMA 2H8PB 1YEIH 3MV7B 4XGZB 3WUWG 5CCKH 1DFBL 1AHWC 4WW1A 4UU9B 3U30C 2DYPD 1R3KB 2R4SL 4WENB 5J1SC 3CD4A 3KDMA 3RVVD 5FF6B 3WN5B 5IGXL 1IGTA 3VXMB 1ZLUK 1LQSR 1XGPA 4HJJL 3MRLB 3PWVB 4LBEA 2MQ0A 1CGXA 1EIBA 4NN5B 4Q9RH 1VERA 4IRJB 4LGPB 3F7YB 1KELL 5FUZL 3QCVL 5IB3B 5JQ6H 4Z7OF 3OR6A 4Y5YC 4JM2A 4KKBC 1S5HB 3H2WA 2WZPD 5JMOC 2P5ED 2VLRE 3AMKA 3WN5C 5I8CB 5TGBB 3KPOB 3NIGE 3Q5OA 4NN5C 4RZCA 5EU6D 4NHUE 1YDPB 3QUMH 4K3JL 3K4ZA 4LCIL 4OFDA 4Y19A 1JK8B 3F7VB 3H0TB 3IKCA 3OF6A 2FCBA 3BH9A 4J4PA 4HIEB 5D70L 2XG5A 5C0GB 1UFUA 4N1CA 5ID0B 3AM8C 4Q6IA 1N3NA 3KLDA 1MJ7L 4AG4L 1AE6H 1UZ6E 2CQVA 4LSSH 5INCA 5ID1A 15C8L 4QLRA 4DGYL 1H5BB 5MI0B 4Z7UA 1OTTD 2DQHL 2GW5A 4F2MB 3C8DA 4EIGB 1AY1L 5DQ9B 3L9RA 5KVGH 3H42H 2V7NA 4U6HB 1P84K 3TCLA 1EK3A 3ZE0F 2GK2A 3HFMH 3L3OA 1H5BC 5MI0C 5C71A 4LPYA 5B39B 2EDXA 4PGEB 3PQYD 4PRID 2ZPKL 3D39D 3G5YB 3VXSD 4MJIA 5FA3A 4R4BB 3QQ3A 3CJJA 4XXDA 2XKSA 3QZWG 3QHZL 1B3JA 5HDBF 2ADJA 2ED9A 3O4LE 1MJJB 2R69L 2VQ1B 4ONGL 3BJLA 4G43A 2DDQL 2G60L 3L3GB 3PP3K 2WWKT 2ESVA 1U3YA 4KI5F 2X10A 1QSFE 1MCKA 4HXBH 2YWYA 4LCWA 3W39A 3LHPL 3G6AA 1FZKB 4MWFA 2XFXA 1DSFL 4ZUWA 1JGUL 2DOCA 2P7TB 3P4NA 4L4TE 4S2SB 3SJVA 4OFYD 3JV4B 2IPTH 4R8WH 3VW3H 4S0TD 5FECA 4JANA 3QFJB 5DFTA 3W9DA 1VENA 5BMFL 1E4KA 2XTLA 4K94H 3GSVB 5EFIA 4D9RE 3AAZA 4CL7A 5C0AE 4OCXL 3V8CA 2FLBT 2VDQL 3QO0B 4HEME 1VSCA 4LU5H 4GKOA 3U7YL 3O6KL 2PKDA 3E3QC 5E2TH 1WUNT 2LVEA 1YEDA 3WO4C 3KPSE 2EIEA 4RGOH 3NZHL 4JG0H 2E27H 3CFCH 1LK2A 3U36B 3U79A 5HYJA 1ZT1B 3MRKB 4TNWF 1WVZA 3L5JA 4YXKL 4GSDH 4R7DA 2Z31B 4PJ9D 2BNRD 3PNWB 4OM0L 5KN5B 1DLFL 4BZ1H 3P4OA 1WCBA 2B39A 1U8OA 3MGTA 3ARUA 2IH3B 1XIWB 4M61B 3RDTD 1QHOA 4PJ7F 3LOWA 2Z35A 3CH1A 3EZJB 1BQHB 2JJWA 1RIHL 3RY6C 3MV8E 3K2UH 4UNVA 2ICWB 1QO3A 1GGUA 4D94A 1DCLA 4ONFH 4RCAA 1FG9C 1U6AL 3LEXA 1U8NA 3STLA 2CMRH 4GG8B 1MREL 5I1LB 1RZ8B 3QXUA 3O6FB 2OR9L 1HZHL 1UWEL 1KGCE 5D2NB 1HCFX 4PS4L 1B6DA 4YPGA 4X6CA 1P69B 3HNSH 4JZNB 4MX7A 1T6WA 1FGVH 1EZVX 3WIHA 3O6FC 1JUFB 3LV3B 3OKNA 4HGWA 4JQVC 3MCLL 4ELMA 5D2NC 4U1LB 4Z77A 1N64H 5F3BB 4P2OB 1UWXK 4Y16C 4PY8J 3OAYH 4OLZL 3MRNB 2VDLL 2R2BA 1A7QH 1N2RA 4MNQA 1OAZL 1I1FB 1OAYL 2XXCB 1KTDA 1RURH 1H3VA 2NY5H 5BW7A 4L4VB 1RD6A 2YUWA 1P7QB 4MXVE 3QBTB 2R0LH 5I17A 2GCYB 4M7JL 2KQMA 2GSGB 3JV5A 3DNKA 3BPNB 2FGWH 4J6RL 4D8PB 2MQCA 4ZO7A 3CX2A 3TF7C 2GSIA 3NIFF 4QOKA 3TBVB 3ISWA 4YXHL 1TLKA 5AZEH 3BPNC 5GGUB 2AJVL 1OGTB 1NGPH 1T3FB 4G6FB 3C5JB 5IEKA 2XTJB 4TSCL 4CUCA 2F19H 1IGFH 2AJXL 5C0CD 2YMXH 4LPXA 4Z7NF 2BERA 1AI1H 3O2DA 1JWSB 4QRRA 1PDKA 1W0VA 5DLML 2GJZA 3FB8A 1LO5A 3WFCL 4XWOC 4F33A 1MCPL 2A9MH 3TJHA 2XTJC 3EOTH 4HS3A 1GPOH 2EIBA 3W5NA 4QRPA 4RMWA 3IDXH 5J6GA 3QUYA 4HXAH 3Q6GL 1HSAB 2RFXA 3IJSB 4XVSL 5GGRY 3OKDB 4U1NA 1GGCL 4XMKH 3TIDB 1TZGH 1X7QA 1T7WA 5IM7B 3VXUA 4OLVH 1QNZL 5SV4A 4JY6A 4PREB 2DQCH 3B9VA 5D7IE 1NCTA 5BRZE 3S88L 5IQ9A 1VFMA 2GEEA 1TQCC 1AR1D 1S9YA 3FQNB 3MROA 5EZIL 4GXVH 3TM6A 3RZCD 1ETZB 1DQJB 5DJXB 5ITFB 4XP1H 3D2UA 5IIEA 1MF2H 1X5ZA 1LO3L 3NOIA 4OGXL 4OJFH 3QH3B 1QSEA 1OGAB 1ONQA 4OF5A 5FYKE 1OSPH 4HPOL 3U7AA 3ARVA 4U2YA 5KJRH 3QIWD 1TXKA 4Y4FD 1NCNA 1MQ8A 4ZAKC 5EC1A 1I7ZB 5D1QD 1ITCA 3CFDB 4UQ3B 2ZCKH 4WFEE 4NWTL 3VG0L 5D71L 4O51A 4LLWA 2JB6A 4EN3B 4G7VL 4I8DA 4YE4L 5J8OA 1TIUA 1U41A 3OMZA 4UTAH 1NBYB 3VD9A 3NH7H 4OQTA 4S1RH 4MD0B 4DTGL 1MCRA 1G0DA 3WUWA 1HHHA 3D0LB 3MJ7B 2W9LA 5IBUG 4OKVB 5FUCC 3TPUB 4DW2L 2IADA 2CDFA 2WWKO 1PKOA 1NC4A 4LSTH 4XB7A 5EORH 1C5BL 3G5ZA 3NN8B 2K9UA 3SDAC 4KPHL 1CR9L 4NO5A 3Q1SH 3JTSA 2BK8A 5HGDB 3UBXB 4WUKH 4Z6AT 4W6XB 4HPYH 5DD3H 4I9WE 1Z3GL 1B4JL 5C0EA 2YZ1A 4GH7B 4WY7H 5F7DA 2WINA 4OD1L 2XPGB 5ISZE 2H9GA 2NY4B 5J7CC 1WAAF 3ZTNL 1KTLB 3MQIA 1YEGH 4ISVA 3JTCA 3FFCD 2VZOA 4YIQB 3TV3H 2V2WA 2XWJB 2OI9A 4HAFA 2JK5B 2XZAL 3RVWC 5TDPA 4PJEA 5HDQL 2NY4C 3CLEL 1YJDL 4UIMB 2ITCB 3C6SA 4G8GA 5CSZA 3WFHB 2Q86B 5DWUH 1X5GA 1S9VB 4ODWB 5BOZG 1FBIL 4HSQA 1F13A 4EVNB 1W72B 3JWDL 3RQ3A 4QHNA 1KCSL 4E0RA 2G5BB 4DVBA 3ZMRA 3E2HB 5EBLA 4P46B 2ZUTA 4O58L 4D0DA 1XGQA 2JCCE 2FB4H 1AH1A 3VFOB 4WNQB 4WO4A 3TNMB 2IQ9H 3JUYA 2HVJB 4PR5A 3CDCA 1F2QA 4ZUSB 5DD1H 3ZLQC 4UINL 5JXEC 2A6KB 3E2HC 1ZTXL 5IB2A 4Y1AE 1SM3H 4PJ8A 1DTUA 5F1IB 3S34H 4PRPA 3NIGF 1D5IL 1NDGA 1CLCA 3FTGB 25C8H 5C9KA 2Q76A 1F90L 1WBXA 2NTSP 4PV8B 5EOCH 3X13A 2AERT 1WZLA 3OPZL 2HJLA 3W9EB 1KPRB 3HZVB 2AK4E 3IXTA 4AEHL 2FLRT 1UZ6F 1IC4L 4X80L 1A6WL 1Q0XH 4HFWA 2H32A 4WTZG 4HKJA 4ZNCD 3LMJL 2VXQH 4AIXA 3SY0B 3SKOB 1ZT4A 3F12A 3C9NB 4BH8A 5CJBA 4Z7VA 5JIPA 1YC7A 2AABL 3IAQA 4PJHA 1ZLSH 1D9KA 4CU6A 1FYTE 4HUNB 1RUAH 4G80A 5HHME 3TO4D 1CGSH 4WFHD 5JXAH 3GI8L 1R3JB 2VLJE 3ROLA 3HLAA 1NCCH 2FEEL 1AIFB 2PW2B 5L8KB 1TTUA 2HLFC 2J88L 2NPLX 2QKIA 2BOBB 3HZMB 4R4FH 1EGJH 1JWMB 1TZHB 2RIKA 5DJYA 4NPYB 3L6FA 1QHPA 5CEZL 2GIYA 3D25B 1T83A 5T1KB 4FFYL 1CFTB 3MV9A 2HKFL 1B0RB 5DI8A 4MD4B 3U82B 3ZKXC 1CXKA 3W0WA 3VI3E 4KRPD 3NACL 5DUPH 3WKMH 2I9TB 3MUGB 1JF1A 1IL1B 2CRZA 1I9EA 3V0VA 1UKTA 5EZJA 4G8FA 4LHUG 4CW1A 5JOPD 2YPLD 6FABL 2QSCH 1BAFL 5DA0B 5JO5B 2VR5A 2CJUH 3GEWB 1OVZA 3B9EA 5FHAH 5FYLH 3DIFB 3HC4L 2R1XB 5FUOH 4DKDC 5GISH 2NY6D 3B9KD 4KKNA 3QWRD 4OKDA 4U0RB 5DJ8A 1E4XL 4ZSOA 2VLME 3LS4H 5MEPA 5GGSB 3O8XD 3T2QA 4ETQA 1F3DJ 4TUJA 4BQ6A 4LAJH 4XBGA 4H0HB 1T89C 3IGAB 4YQXH 5GGVH 4P2QD 3BT2H 3DO7B 2CLZB 2DBLL 3RPKA 4U0RC 3TYGH 5IFHL 2LFGA 5BVPH 4KHTH 3KLSA 3ARGB 3G08B 1RQ5A 2NY3D 3KPQA 1CFNB 5T33H 4H5SA 4O2FA 4H88L 1WICA 5F7EH 4LIQL 5IV2A 4UV4H 2M26A 4XBEH 3RP1A 3CFIC 3V4VL 2PO6D 1G9EA 1N26A 2YPKB 2ZNWA 2C9AA 4JKWA 4N5EC 1R6VA 4U1KB 1CLZL 1TPXC 4APQB 3MNVA 1FNEB 1IGTB 5IGXH 4W4NA 2BNQD 4C57C 4GRMA 2CR6A 4MA7H 3QYCA 1NJ9A 1OB1B 2VL5B 3MGOA 2BY3A 3DI2B 3NMEA 4H0GA 4ORZC 2YD5A 4APQC 1LO0L 2IEPA 1MFAL 3RL2B 5FM4A 4UNUA 1ZGLB 3GJEB 3JUZA 4AL8L 3FQUB 4EOWL 1R0AL 3IKCB 1CI5A 1MSPA 1IGJA 4ENED 5DA4A 5E8NB 4Q6IB 4PY7A 1F11B 1SJVA 1DQDL 4MXVF 4QGTA 4FQ1H 5ID1B 5I16A 1DUYB 3OR7B 1LDPH 1MFCL 1FNGA 1AC0A 1MIMH 5ESVB 3RJDA 4OIIH 1WFNA 3VDAA 3FT4B 3PGCB 3F58L 3HNVL 3S37L 3WIIH 1W0WB 3VRIA 4BH7A 2V7HA 3CFJA 4E42A 5I2IB 4UZGA 1UYWL 4BSWB 4IMLA 2XZCH 3BP4A 3WFBL 4ALAL 2PW1A 4OT1L 5DK0A 5T1DH 3VFSB 3BPLB 4CADB 1E28B 1A7BA 2AXGB 4NN6C 1S7TB 4MJIB 5E6ID 3QQ3B 2KKQA 1BEYL 2MTPA 3DHJA 3VH8G 2J8UA 4PDCE 4JPWH 1ZHKA 4GMSH 5I30H 1UC6A 1AXTL 2MHAA 3MLWH 3IDIB 3BPLC 3SCMD 2DIBA 3QIUB 3MJ6A 5GS1B 4M6AA 4U1GB 4UUJA 1I3GL 1BPVA 1QFPA 5DK2A 1ES0A 4OZHA 2B1HH 3VXTB 4TULL 2VIRA 1P2CB 1GIGL 2DQUH 4JN2A 3FT3B 3W39B 2W07A 3QIUC 5HI5C 3BZFB 5GS1C 4C56B 2W0FA 4U1GC 1CZ8L 4OF7A 4WHYG 1A1MA 3NCMA 3MPCA 1EV2E 4W4OA 1ZV5A 4JANB 4G9FD 3UJIL 2XRAL 3ARDC 5D7IF 3SKNB 4ZFZA 1Q1JL 1R3LA 2YK1L 4JRYA 1FDLL 3FQTA 1HINL 3FCTB 1R5IB 4WVRA 3HPLB 2EEAA 3VFGH 4L29B 1I8MA 3ROOA 5FHBH 5I1EH 2OK0L 4Q9BA 1SEQL 2BVYA 4KJYA 4NQSB 4XC1L 5DFVD 3WJLC 4ZFOA 3ZYZA 1YECL 2R0KL 3KPTA 1MI5D 4OI8A 4PTTA 2XV6B 3QDJA 3O6ML 3HE6B 4MNGA 1PSKH 4LL9A 2ZCHL 1JGEB 3BSZL 5KW9H 1ZSDA 4XMLL 1OPGL 4N8VG 3TO2A 3PDOB 5JPNB 1H8OA 1QPPA 4KXZH 1LEKB 1GZQB 2Z35B 1A6TA 3DVGB 4BSJA 5J6HB 4NFBA 5ESQB 2P8MA 4V1DA 3HE6C 4YEFA 3WFDH 3LKOA 4OLXH 3UX9B 1MJUH 2HT4C 1NCBL 1IARB 2R8SL 4YHML 1KBGH 3X17A 5KSUA 4LEXL 3E6FA 5D7JD 4LSUH 1BJ8A 4WCYH 3WIFA 3NCFB 5I8KL 3MSPA 3H9HB 1IM9A 5BQ7A 3FB6B 5FKPB 1OD9A 4F57H 1Z9LA 4QO1A 4JFED 4OD3H 5A2JH 4MX7B 2XN9A 4FQ2H 5FB8B 3EJZD 3OKNB 4WU7A 3QCTL 5E2VL 1RK0A 3NFSH 4ELMB 1J18A 1YMMD 1NFDB 3NIDE 1QEWA 3C6LD 3PHOB 1DBAH 4JGJA 3UAJC 7CGTA 4LFHG 2KUTA 3H9SB 4NQCD 1J87A 2AJZA 3QAZC 4K07A 2EIZB 2W1NA 3V5DB 1G6VK 2VDLH 3IFOA 1JRHL 4ZPVB 2O5YL 2F8XC 2DJ4A 2OQJA 2XI9A 4ZAKA 1OAZH 4Z76A 4HKBA 1PYWB 4PGBB 1GZPB 3SGKA 1MIEL 1HIMH 1J1XH 5TE4L 1S3KH 2WIMA 2JCCF 5TE6H 3RHWF 1C8PA 2EXYC 4FNLH 4KDWA 3VXRD 3WIHH 2QQKL 2NY0B 2HT2D 2NY1D 5DUMH 4UQ2B 5ADPL 3X3GH 5DURB 1CBVH 4LCCB 3SO5A 5IJVA 3FOMA 4FQJH 1L6ZA 3KPLA 1Z6JT 2A9NL 3SDAA 1KLGA 1UVQB 2NY0C 3LIZL 3EYSL 3W11C 1INDL 4LLYA 4JHZA 1MHHB 4QRRB 2D31A 3FMGL 2APWA 4LCCC 1LO5B 4WEBH 3MYZA 4OZFG 4HDIB 4P2RE 1UJ3B 3UTSA 3BRFA 2CLRB 4X7DC 2P8LA 4Y5VA 3SEPA 2I25N 4LCUA 1EVTC 1YQVL 3QUYB 3GBML 4LHUA 4WDIA 2OMNA 5K9JH 4MCYA 4RSVA 4YR6A 4GBXC 1ZHLA 1T1ZA 1UJ3C 1YNKL 1R5WA 1GH7A 5JTWA 2AJSH 4KMTL 3W81A 3KS0H 1FZJB 1AGEA 4CJ0A 4XWGL 2WBKA 4LRIA 1TQBB 1T1WB 1Y6NR 1BZQK 4JVWA 3O2DH 1T03H 1QUNA 5F3HA 5KSAB 1QOKA 5ADOH 3PHQA 2BOCB 4J3VA 4QXUH 4FFWD 2Y7QA 1BM3H 5D7LE 3MC0A 5F9JB 1LP9B 1RIVH 5DRNB 1S7XB 5JHLH 2VZUA 4QXGH 2NZ9D 4P49A 4WIQA 5KSAC 3L5XH 3KWWA 1JPFA 5HYQB 1DQQA 2CDGB 4NYLA 35C8L 5CJXC 4YFLF 4IDJL 4XNUH 1JNJA 1F4XH 1T21B 5JXEA 5HHNB 4NWTH 5C08E 3QDMB 3VI3F 6CGTA 4PRBA 3L1OL 4EUPH 4N90E 1T66C 4TSAL 1NUNB 4TTGA 4NQVA 3T4AB 1HHHB 4QY8A 3BIAX 4YWGL 1SJEA 4I0PB 1NC4B 2NYYC 2FO4B 2D4DA 3MX0A 5T3XL 4KPHH 5IUSA 3KJ6L 4E5XB 3BP5B 1MFDL 2YPVL 1XF4B 4KVNL 2VLKB 2A0LC 3LRHA 2C7UB 4YUEH 2FGZA 5EZOL 1F6AA 3MLUH 1S9KC 1G9MH 5HGHA 4OLWH 3WDJA 4PJ5D 5BZWA 5C0AD 2WINB 3KYOB 2FNBA 3FJTA 4RIRA 3WHXA 5EA0H 2NW3A 1HDMB 1N7ML 1AO7B 1OT2A 4ODTH 3DTXA 4OQTH 4X4XB 1CGVA 1ZK9A 2CO7B 4DKEL 3PL6A 4E41B 4ISVB 5SX5K 1VESA 2OL3A 3TZVB 4JZOB 1I9RL 1CYGA 1NAMH 4JPIA 3EO1A 3L5HA 5JHDD 3RFZC 1KENH 1JYNA 5I0ZA 2ZJSL 5F72S 4NKDA 4AK1A 4Z95L 4PRHD 4L5FH 1C08B 5JW3H 3U9PH 4S1SL 3ZO0A 1I4FB 4HJ0D 3TZVC 4NUGL 1YNLH 4UILH 1TJIH 3IDJB 4HUXB 2Q8AL 4QHNB 1S7VB 1IQWH 1FH5L 5EN2B 4KJQD 3GIVB 4K3HA 5DXWA 4WWKA 3V7AG 3QPQD 3IAPA 2HN7B 4NC1C 4U1MA 4P5TA 3BKCH 3GMMB 3VH8A 3FQWB 1HXYB 3QZWB 4CVZA 1FAKT 1S5IL 3MV8D 1RUPL 3GJFA 1NCAH 1YPZA 4R4NC 1JV5B 1LE5A 2QHRL 4QHUA 4QTHB 2FL5B 3LQZA 3U1SL 4RMSA 4HWEL 1AKJA 5TQ2L 4HIHB 2WUCL 3ELAT 2VOTA 2Q76B 4KH2A 3ARTA 2ADFH 5AYUL 1BD2D 4MAUH 2V2TB 5HPMB 1QBMH 3REWB 4X83A 4XX1G 3OL2A 4S1QH 1T1XB 5E95B 5FO7B 2O5XL 3IS1X 5KVDH 2V17L 1MCSA 4R2GD 2QTEA 2X42A 2YSSA 1LDSA 2EC8A 4KMQA 1LK3H 5IHZB 4XCFH 4NQDE 5IBTL 2EDQA 4Z0BL 2CO6B 4Z7VB 5FYLE 4BH8B 1IEHA 1IEAA 3ARPA 3QPXL 3TA3D 4F9LC 4KUZL 1KULA 4ODHL 2JF1A 5JNYA 3RWFB 4G80B 1VPOH 5BZDB 4MQTB 5TJWK 4OV5B 2UWEA 4TRPL 5GRUL 4K3EL 3ROLB 3HLAB 2BNUA 1FLRL 3LQMA 1EVUA 3DXAA 1U93A 1CU4L 1VADA 5JIHA 3PP4H 4JJ5A 3LQAL 5DD6A 4BFGA 4F15B 1MH5A 4MDJA 1BVKA 3P0YL 5CIPA 1DBJL 2ARJB 5DJYB 1PX3A 3DV6A 3L6FB 1UM4H 1MLBA 3X12A 2H32H 4N8VA 3O4OC 3QI9D 1T5XB 5C7XH 1JNHA 1YN7A 1IGMH 2BSSA 2Z8RA 4X4YA 3GNMH 3VCLA 3CDGB 2Y07H 5HSFA 5J1AA 3W0WB 3H3PL 1CF8H 3MCKA 1K6QL 4L3EB 2WBJD 4KJPC 4G42B 1SJXA 1EFXB 4XH2B 3CMOH 1A6PA 5BO1H 4PBXA 2YXFA 3D0VA 5H2BA 5T3ZD 5D7KD 5TH2A 5DVKA 4OLYL 4PIRF 3AB0B 1TMCB 5AAWA 5CBAB 1DUZB 1QA9A 2AI0H 2P44B 3MJ9L 3P77B 4RFOH 4J3UA 3C60B 4P23D 3EIFA 2AGJL 2IFGA 5D5MA 3CCHA 4M5ZL 4G6AD 1HHJA 4UT7H 1AFVH 1WC7A 4OM1L 5CINH 4KC3B 2CK2A 5BRZD 1QRKA 3RNQA 4JFQB 4PJCE 4MJ6B 2FX7H 3C60C 4LLQB 4IS6A 5BS0D 3H7LA 1U8MB 2HTLD 3D1MC 4KRNA 4WU5A 4JPVH 3MXWL 3NCJL 3BEVB 3ZT5A 1W8OA 5CILH 5ANMA 3BISA 2FH8A 3N9GH 1QBLL 4GQPH 5KANG 1K8DA 2XXMB 5F7NC 5FYKD 3G5XB 3SDDB 4YDVB 2YA1A 1NC2D 3KXFD 5FYKU 3I9GL 3QRGL 4H88H 5IK3A 1GGBL 5HHVH 1DQMH 4OLUL 3UTQB 5C6TL 3C09B 5DJAB 4QT5B 3VE0A 4YFDB 3EJYC 3R4DA 5D1XB 4HG4J 1XGTA 5D1ZD 2ICEB 1DQTA 4WFED 4PJFB 3HN3A 3SDDC 4PLKD 3UYRH 5CJOL 3VWKA 2X41A 3WS3B 3OZ9L 4F7EA 4Y19E 4WUUD 3VFWB 1DQLH 3N1MC 2ATPB 2X1PA 3BVNA 3WUZA 5DRWA 3AXLB 3C09C 4HMDA 5MEQA 5D1XC 4NQEA 4KFZC 1VFAB 1FE8H 1XFPA 4ZFFA 1ZWIA 4XCYB 5GS0H 5D6DC 3LKSA 1LEGA 3B2VL 4FRWA 1NGZA 3BPOC 1OL0A 2EC9T 1JPGA 4Z7UE 3DOSA 1ADQH 4JE4B 3CZJA 4MHHI 4UBDD 3U2SA 4U6VH 2O61A 4OZFA 4LARL 5DJ2A 1YY8B 3L7EA 3ZKQD 4K9EH 4YDKH 1VCAA 5K9KB 3UTTA 1SHMA 4I9WD 3MYJA 3KPPB 5ESAA 4ZFGH 3P9WB 4G8IA 5C2BH 3HRZB 3MV01 3PDGA 2XKNA 5MENA 5IVOA 2ZUVA 5T1LA 4GKNB 5J9PA 3FOLA 4GW1B 2P1YA 3L3HB 4Q0XH 3O3BB 4IOIB 5GGRA 3G9AB 3QUXA 2ESVE 3S37H 1CFSA 2VN7A 4Q9QH 3CFJB 1ZLWK 5D7SH 5TDOB 2WP3T 2A74A 2R9HD 4P4KA 5TE7L 2OM5A 1UYWH 4IMLB 1JZ3A 3O81A 4LCWE 3MOBL 1E27A 3WLWD 4Y4KB 2OZ4L 1PZ5A 3ARSA 4ZO8A 3SJVE 3RBGA 4QHMA 5AZ2H 1BEYH 4ZG1A 5I1JH 1P4LB 2BHYA 2QHLA 1A7NL 1MCBA 2JB5H 4NSKA 1G7HA 4Y4KC 5GJSH 3EYVA 1K3ZA 2V5TA 3FL7A 1ES0B 4XVTH 3LZFH 1FN4A 4JFHE 3A6BH 3KR3H 4Y1AD 1DN0B 2RCSL 1G9NL 2ADIA 3FQRB 3PJSA 3C2SA 1DANT 1BBDH 1J8HB 1HI6B 4M48H 4NO3A 4HK3J 4TUOA 2NX5B 1DVFA 3PWPA 1WEJL 1SJHA 4U6TA 5IBUB 1KPVB 4YXLH 1A14H 32C2A 4G6KL 4U05A 5CUSL 3BAEL 3U9UA 1R3LB 2AK4D 1EJOL 4LOUC 5C0BB 5HYJE 5IW3A 4H1LA 4YGVB 43C9A 2EE9A 5JA8B 3QUZB 1XGRB 1HXMB 1MFBH 3TFKC 3ALXA 2I60L 2Y5TA 1KT2A 3MLYL 3RAJL 1BX2A 3JTTA 2NW2B 4L3CA 2F54A 1M05B 5HHMD 2F5BL 2F53D 1LHZA 1JHTA 1B2WH 1KC5L 3BWUC 3RKDD 3QXDB 3WXVL 2BY2A 3F7PC 2XYCA 4O2EA 2PYEA 4NZUL 1U8IA 1RZJC 1LWRA 4NQTA 4OFVA 2VDRL 5HY9B 1MAKA 3MACL 2HH0L 4LSPL 5E7FA 3ZKMC 2BDNL 3GSUB 2VKWA 1CK0L 4X6CE 5ITBH 2P8MB 5DD0L 1KN2L 5D2LA 5E6YA 4K55A 4XPTH 2W9DL 1S7RA 4ELME 4RISH 3MOAL 5CZVH 4R96A 4M1GL 3UROR 2NR6D 4JFFA 1LO4H 1Q94B 3K81A 3A6OA 5DEFA 4KKLD 3VWJB 4CU8A 3HR5B 4GBXA 3D69B 1PLGL 4MNQE 5DRZA 4JKPL 3BH8A 3S37X 1F3RB 3KNBA 2DLTA 3T0EB 1F2XK 4X0KA 2X4NB 4KDTC 5GZOC 2JLLA 3OXSA 1FCGA 4ZUVA 4JO2L 2X4TA 4P5KA 2D3VA 2IPKA 3HB3C 2DYPB 5I6XB 1KG0B 1QLRB 3CFBB 3N0PB 3T0EC 2EZ0D 3LN5A 4XMPL 1UM5H 4M6MH 3RHWK 4QOKE 3CFEA 2DWEA 1U42A 2BHUA 4LNRA 4HF5L 4Z7WB 5JR1H 3DLQR 3MV7D 4MQXD 5L9DH 2BSTB 2VR9A 1TJHH 5I6XC 1J1PL 3RVVC 2H26A 4BELD 3RUGB 1BZ9A 5CJXA 4KKBD 1S7QB 1QRNA 4AZ8A 4UOJA 3VXMD 1H0DB 4XPFH 3MRBA 5HHOA 5ETUA 4IRJD 1GSMA 2E9JA 4EDXB 1XR9A 4NNYA 3UJJL 4QRPE 5ADPH 2X1OA 3BD4A 3O45A 3UXFA 1SBBA 1HYRC 5E70A 4ZUUB 1KEMH 2WW8A 1KIRA 1CL7I 4W70A 4XP4L 3N1GC 3HG1A 3VXUE 3M45A 5D8JL 5FCUL 3Q5TA 4AEFA 1OTTC 5IMLA 4PRIB 2H1PL 2RBLA 2BVQA 2FATL 3D39B 4XP6L 1EMTL 4HH9B 4P57A 1IMHC 1DE4B 1I3UA 1QFWM 1FP5A 5IKCA 3GHEL 1IKNC 2IAMB 1EXUB 4WHCA 1QSEE 1V3MA 2YBRA 2YD6A 3B8SA 4JFYA 4XPHH 1R5WB 1H3PL 3CXDL 4JQXA 5IR1B 3SDYL 2GTWA 1G6RH 2MCPH 1UXWB 2IAMC 5BXFA 2R2EB 4RNRA 4DN3L 2OXGA 2EH8L 1FZMA 5A2KH 1UB5A 3D85A 1FL6A 2CKBA 2C3WA 4JY4A 3O3EA 5F3HB 4G8EB 4K2UH 3B2UD 1JFQH 1D5ZB 3GI9L 4U1SA 3GMNB 4HIXH 3QG6B 2APVA 3ZDYE 3MBED 5GJTL 4FQLL 1UEYA 5F6IB 4TYUA 1KPUA 5CP7A 3HI5H 3L3JA 2IG2L 1JI1A 3QNYA 1DDHA 2C3VB 5CZKA 3IRZA 2AKRB 3DMMB 3TCXA 5B38G 1HQRA 1L0YA 5I75C 2WP3O 4V2BA 3EGSB 4YDLB 1NCDL 5SWSB 5I66B 2Y9RT 4NQXB 4Z8FL 4YK4B 1PG7H 2UV3A 3SDXB 2P24A 2ILLA 2LU7A 2J6EA 1DL7H 3DMMC 1P1ZA 3O6LH 3M8OH 1IGIL 3HZYA 4YDLC 5I1CL 5MERA 4EDWL 5SV3A 5IQ7L 1A1NA 4LVEA 2XA8H 4HMEA 3BKJH 4YK4C 1A7RL 1MRCH 3P0VH 1LE9A 2BNRB 3WEXA 2Q3ZA 4KRMB 1QVOA 3A67H 1H9VA 1A2YB 2ADGA 2ICWJ 4YO0A 3RTQA 4PJEE 1L7TL 1T2XA 2JJTA 4IHOA 4G8GE 4PJCF 1KB5A 3O2WH 4MCZA 3VRJA 4X5XA 2YR3A 5DMIL 5IHUH 2CK0L 4DKFL 4IRSA 3RDTC 2CXKA 2Z31D 4RIRB 1BFSA 3WHXB 4QYOB 3BI9X 1XIWD 1YYLL 3GMRA 3PGFL 5I8EA 3I2CH 5LCVH 4FQXA 3EO9L 2X5PA 4NO0B 4IOSD 1UH3A 1CIUA 3IFLH 1F45A 3GM0A 3NPZB 4JM2F 2DM2A 4U4BA 3MLZH 4KTEL 5DR5H 1FO0H 4PRPE 2QJDA 5EO1A 4JY5L 3UCRA 3QO1B 4NUGH 1JI2A 3NCEB 3UTZA 1FPTH 4BUGA 4U1MB 2IFFL 5IWLA 4YBQD 2ZCLL 3T1FB 2BFVH 3IDNA 2VXSH 4Z7UF 4FTVA 3CZFA 4JDTL 1TZIB 3RY5A 2OL3H 3U83A 3AS2A 3S7GA 4P2OD 1KJ2L 1KTRL 1A6VH 4PJHE 4MVBA 4M7KH 2VWEE 5FGBA 3S4SG 1X6NA 3EFDH 1A3LH 3FO0H 1T2QL 1EBPA 1V8HA 2VXVL 4ZS6C 2ZKHL 3MMEA 1WIOA 4L4VD 1XCTA 3I50H 1A5FL 5HVGB 1CICB 4YC2C 4NNPH 3HAEA 5J0BA 4PJGA 5E2UL 2GY5A 1JYXA 3I75A 4NKMA 3JVGA 4WFGD 4HW6A 2OJEA 1JN6A 5E9DB 2BJML 3TH2T 1MVFA 3LQAC 1A4JB 1JYVA 5DF0A 4JJHA 1J10A 4X5WB 4LVNC 3GJFH 4MJ5B 1CICC 3U4EA 3BZEA 4BFBD 5KVFH 5D72H 3LN4B 5EO9B 1IVLA 3OG6B 1J86A 4QF1B 4XWOD 1FV1B 1FFOA 4N0CD 4G6FD 3MV9E 3E0GA 1T7ZA 3TBSB 2XTJD 3NA9L 4LF3A 5F9DC 4NO2A 3LKRB 3DXAB 4MSWB 3PWJA 1E6JL 1KF9B 2DWDB 4P59H 3HZKA 4H8WL 2ZUQC 3DUHA 2H3NA 3MNWB 4MDIB 5LGHH 1F4WL 3CVHA 2EH7L 4NCC1 3GIZL 5F7KC 1MCFA 3DV6B 3NZ8A 3DUSB 3OKEB 1AGCB 5CZXD 3TN0B 5LQBL 1C1EL 1K85A 2D03L 4JR9H 1CGUA 2YD7A 1JNHB 2FJFA 1GCFA 5D6DA 1T1YA 5I1AB 5J3HC 4NKIL 2Y72A 4ZSOE 3H3PH 2YKLL 4M7ZB 3TN0C 1KJMB 3PGDA 4P2RD 3OKMB 3UPRA 1S9XB 4TUKL 1RUQH 2APFA 3RPIB 1WZMA 3LRGA 2LU4A 4M7ZC 4NP4L 5CIPH 5GRVK 4UT6H 1UKQA 4Y4FC 1OGAD 5CGYD 4ZMAT 2BRRL 1U3HB 4N1EA 2MPAH 3EYUH 3FT2B 5D1QC 2AGJH 1NMBH 1WC7B 4X99A 1FRGH 3QFDB 3O41A 3CDYA 2PF6A 2W9EL 1U3HC 4ZO6A 4YHIB 3VXNB 1BQSA 1IAII 2QADD 3NAAH 1JPSL 3SE4C 1F58H 1QLEH 4EN3D 3NCJH 4BFIA 4Z5RB 5B3NA 2OYPA 1A4KB 2BCKB 1X5JA 3OSKA 1EEUA 2VC2H 3D3VA 5C0RL 1MCCA 4TPRL 2O5ZL 4ZPTA 1K2DA 4ZUTA 1NKRA 3CXHJ 4KMLB 1KJVA 4X6CF 3THML 9CGTA 3GRWL 3CPLB 5DJ0A 3H7BB 3HPJB 1RIUH 5E94B 4N9OB 4BK5A 4PP2B 2Q7NA 4ELMF 1KNOB 3MODL 2BVPB 2IANB 1B0GA 1FIGH 4LSQH 4S11A 2EXWD 2X4PA 3ULUD 3FB7A 4OSUH 2Y36H 3N06B 1G7LA 1LD9B 3S35L 3RU8L 2YRLA 4GG6B 2PXYA 4G6JH 4HGKC 3RVWD 1I7UA 4JPKH 1T04B 2NY4D 3VXQA 3T8XA 3MRMB 2DMBA 5ELIA 2APBA 3L3DA 3DYPA 1F4HA 2H2SC 1ZAGA 1DBBH 5DJ2B 4HLZG 1T22B 3T4YB 1QQDA 1S78C 3OV6A 2Z8WC 1U8KB 1PEWA 3IFPA 1YEHL 2VDNL 4I77L 4NT6A 2WUBH 5MENB 1D6EA 3U46A 1BVLA 4AIOA 4DWHA 2J8UE 1OQXA 4FFZL 1BGXL 4I18B 2B2XH 3JSSA 3RGVA 4P46D 3V52L 2X70A 4LQFL 1RZKC 1HOCA 4LSRL 5T5FH 3CLFL 4OZHE 1ZS8A 5LAXA 3VD5A 4HCRA 5IMKA 5F8QC 4I18C 2JKXA 1A7OH 5I19L 3Q6FA 4OZFH 4GAGL 2P5WA 4X4MA 2Y5EA 3GHBH 1G9NC 3KYMA 5C07A 4PGJA 1BIIA 2IGFH 5IW1B 1CT8A 4RX4A 2DF3A 4AIZA 5HHQB 4LKXB 2F9BT 5DK3A 5B38A 1G7HB 1KIQA 5HGAB 4LSVH 7FABL 4EI5B 3FRPA 4JRYE 1K5NB 4OCLC 3OJDA 3S36L 1ITBB 2AEPL 4G6ML 1CWVA 1KFAH 1ROWA 2V6HA 3MRCA 4TOYH 5M95B 3HRPA 4KDTA 3IFNL 2ADIB 4PGCB 3X11B 4NO3B 1QKZH 1DVFB 2EDYA 5E8EB 1ORQA 1SJHB 4JDZB 1PKQB 4QCIB 3MLVH 1FCCA 3MRHA 4XZUA 4S1DD 5F7HA 5KSVA 1CE6A 5D6CA 1L6XA 2VDML 3EAKA 1R3HB 3EBAA 3QDJE 4GAYB 2XZQL 4MNGE 3IXAA 4M7LH 5HYSG 1FNHA 3OHXA 2P8PA 2QV2A 4NQDD 4PJDA 4JFOA 1GGIH 1MUJA 4RMTA 2EDEA 3ZDYF 2DI8A 2X05A 4U6XA 4V1DE 3MRRA 1H15B 2YPLB 1V3LA 3P9LA 1UXSB 5GIRA 4DQOH 3CXHK 2DQFB 2P5EA 4KRPC 1MQKL 4JN1H 5DHVB 5EU6A 4Z78B 5IVXA 1VKXA 1NFIA 1S7SA 4P99A 3B9KB 2ID5A 4QGYA 4KGLA 4NDMA 1VGEL 5DMKB 3DRQB 5I8OL 4H1LH 4L8BA 3O8XB 2AS5M 3CFKB 4XRCA 1TVBB 2OTUB 4F7CA 1MWAL 2A83A 1MRFL 3B9KC 2XN9E 3P4LA 2EDHA 4YHPA 5DTFB 2FIKA 2W9DH 1IEBB 5L2KB 1CFQA 5EO0B 1WT5C 3O8XC 1IC7H 1FFPA 1NMAH 3P4MA 1FGNH 3P11L 3ARFB 2NY3B 1RZIB 2D0GA 4PJEF 5TDNA 2PYFB 3WSQL 3EOAB 2SEBB 4X0KB 5C0ND 4HUVB 3SKJH 3ARFC 2NY3C 1Y18A 3S4SA 1V5JA 2PO6B 4P9ML 5KOVC 1OARH 5HGBB 3ARGD 1Y6MR 2XWTA 1IJ9A 5J12B 1EO5A 4N5ED 4PJ7B 4O5LL 1S7UB 2NXYB 2P45B 3LN5B 2F15A 4LLVB 4XXCC 4MQSB 3QUKA 5EOQH 2PO6C 3MNZB 5DDHB 1QR4A 4PG9A 1PG7W 4OF6A 3KYNA 2VH5H 2R0WL 4OFYA 5J12C 4V3DB 3QCUH 2AJUH 1QYGH 2NXYC 1MPAL 1J1PH 1RZGB 1EHLH 1FNSH 4NJ9L 1JPTL 4LKCB 2R1YA 5AWNH 1CE1L 3TIEA 5KSBA 1YYMH 3UTSE 1N6UA 3O9WB 4NOBA 1WBZB 4XC3L 3MUHL 5GSVA 5CEYB 3E8UL 1AGBA 3ZZ1A 3AS1A 5E99L 4ZD3H 5I1HL 4TN9A 3KG5A 2LV4A 4Z7VF 4HIIB 2HRPH 4H25A 3NFPA 4PJHF 1I3RB 2FBJL 3OF6D 2I5YH 3BN3B 3R0NA 4JO4L 1TCRB 2G2RA 3FB5A 1J05A 1C5DB 1KTKE 4JRXB 4ZOBA 4CN1A 4PJ9A 2EDFA 1J0YA 3BX7C 1S9WA 4LEOB 3QULA 4HBCL 3RDTA 4F58H 2DQIL 2JE8A 3GMLA 5DHYB 2RGSA 4HJGB 4DEPC 4D9LH 1DEEB 3RIAF 1XGYH 4EI6A 3DUUB 2A6DA 4RAVA 2AAVA 1BF8A 4XPAH 3ARBA 3EO0A 3OGCB 4OGYL 5F8RC 3BP6B 3J7HA 2VAJA 2DICA 4WV1B 3IJYB 4MJID 3ULSA 4MB4A 3ZDXE 4RWYH 3HUJA 4JFDE 5DT1L 2XICA 4GAJH 1FL6B 3UYOD 3QA3B 1I9IH 3S97C 3V0WH 4KUCF 3MR9A 3QIUD 2H6PA 5HI5D 3MBXH 4MYWB 4WV1C 1RJLB 5E8OA 3GZKA 1RHHA 2ESVD 5C0FA 4GXUM 4K71B 1X5AA 5CKGA 3L3JB 5ICZA 3ZYIA 1DDHB 4JHWH 1F4YL 1HQRB 3REVA 2VE6A 3QDGB 3SJVD 4XAKE 3INUL 5CSBA 3VFRA 1BFVH 3ILPA 3S5LA 4K71C 1OAUH 3KPNB 4YBHA 2F58H 2FZ3A 2YC1A 4PG2A 4Z8FH 2V5SA 2AQ3A 1NGWA 1BMGA 3PWLA 1FHGA 4HAGA 4OCYH 2CKBH 3HZYB 2GTZB 1S7WB 4PJBA 1A6UL 1HSBB 4YHKL 5CJQH 5LXGH 5DFVC 1HHKB 1GHFH 5FYJH 5EZLB 5ICYB 4X98A 3WFEL 5C2UB 1L4IA 2OXHA 3O3UN 2RR3A 1PD6A 3ARWA 3IU3A 3UTPE 3CSYB 2ZG3A 4M7LT 3KYKL 3P0GB 2X4OA 5L8JB 2VTFA 4ZDHA 2ZOKA 5DS8A 4IIQC 2FX8L 5EPMA 1MHPL 3HE6D 5FOBB 3L7FA 4DKFH 5C0CA 4X8JB 2HT4D 3MFFA 4K8RL 4NUJA 2J6EH 4DZBB 1E4JA 3PGFH 4J8RB 4ODXB 2JELL 3KPRB 4PB9H 5LWYH 2GYSA 1INQA 3DBXB 2PR4L 3P30H 3DURB 1IGCL 5GZNC 1L7IH 2OP4L 4K7FB 4HQQL 1KJ2B 1PFCA 1YPZE 4U6YB 2R56L 1CLYL 5C09B 4JFEB 4LVOC 3AU1B 3CX5J 1CD8A 1MFEH 1XZ0B 5TPWH 1IKFL 4X6EA 1NLBH 1IE5A 2AXHA 5H35B 1OOAA 4QRQB 4JQIH 3VFNA 1U8JA 2R1WB 1KB5H 3F5WB 2B4CL 2X4RB 2YXMA 3ZKSD 5K59E 2EYRB 3RVTD 4DVRH 3QJHB 3UAJD 3EJZC 3RZCA 1TVHB 1YEIL 3G6JA 3LEVH 2AV7A 1I85C 3JV0A 3SN6N 4M5YH 5CCKL 5C9JA 3QNZB 5DMYA 2Q7YA 1SEBB 4OBSA 2G75A 5BJTB 3L5WB 2FWOB 4U31A 3C5ZB 3QIWA 3OX8A 3MLXH 4Y4FA 5ENWA 3H9SD 3GGWA 5I0DA 4Q9RL 5SX4H 3MCG1 3BXNA 3OBAA 2Y1VA 5JQ6L 2WLZA 4ODBD 4I3SH 1MELA 5C8JB 1VACB 2UWEE 1NCUA 3HR6A 1KLUA 1RZFH 1YUHB 4LLDA 3RVXC 2H2PD 3C5ZC 1MLCB 3QUML 1WV7T 4V3EB 2J8UF 5I74B 5F88B 1ZA3B 3I75B 3SE4A 3Q2CA 4C55A 3OJ2C 4U1HA 2NY1C 2VR4A 4JLRA 1XGUB 1OTSD 2KZWA 2DLGA 2C3GA 1AE6L 2NY0D 4QOKD 3W11D 4OZHF 1XF2A 4LSSL 4PRDB 5I74C 4OZIA 5HYSA 5DURD 3G04B 4OCRH 4L8DB 1I1YA 4KGJA 1DBMH 3PABA 4PJIE 3LEYH 2ZSVA 5IG7B 4JCLA 1C12A 5KVGL 1OLLA 2VLRB 3H42L 3MRFB 2EEBA 2OBGA 5EUOA 4NHUB 3HFML 5CHNB 1U8QB 4PJAA 4QRRD 5ALCH 1OP5H 3RWJA 2HJKA 1SYSA 2BMKB 4TQEH 3SQOL 2Z4QA 3LB6C 4NCDA 1P9MA 5J56B 3FN0H 1RY7B 2OJZH 3HAEH 3BQUB 5EU7E 4BJLA 3QIBB 3QUYD 2H41A 1CD1B 2GK0B 3FFCA 4F7TB 5D5ME 3BQUC 2EKJA 4HV8A 1JZ2A 3BE1H 4HXBL 1FVEA 2EECA 3VFTB 2DQEH 3QIBC 2FECL 1NBQA 5L8LB 5HDOA 4QRTA 1NGQH 4FFWC 1FC2D 3K7UA 3V6BR 2EKSB 2IPTL 3D2UD 4R8WL 5A2LH 5KSAD 5ANME 3VW3L 4D0BB 2DTMH 3RNKB 1KXVC 3CVHH 3O4LB 2NZ9C 4UDTA 3BW9A 1EHXA 2BRRH 1NAKH 4TVPH 5EBMB 2ITDA 2IBBA 1U8PA 4K94L 2K3TA 4H26A 4X99B 5EBWA 1T66D 2UYLB 1QSFB 4LU5L 5B3JE 4WW2B 4YHYB 5TQ0H 4HK0B 3CUPA 2HFFA 1U92B 2EC9U 4NHCH 2VISA 5E2TL 5EUKA 1BZ7B 1P53A 5C0IB 3QDMD 1ND0B 4L4TB 1P4BH 2NMSA 5SWQA 1XF5B 4BA8A 1ZLVK 1FJ1A 4OAWA 2VITB 2YS4A 4RGOL 4YHYC 4JG0L 2E27L 4NQEE 3CFCL 4ZPTB 5EBGA 3X14A 3BO8A 4TPRH 3NABH 3ZE2E 1FL3A 2ZOLB 4NRZB 4XVUC 5CS7A 4JB9H 4GSDL 4I0PD 1AQDB 1M7IB 1NC4D 5C0AB 4BZ1L 3IETB 4GRWH 1EAPB 3MLPA 3D18A 1A9BB 4NJAH 4K3DH 5CMAA 3TBWA 4CNIB 1GYAA 4NRXA 4M1CC 1I8IB 3FONA 4FOMA 3DWTA 4OGAD 3FB7B 5GRZA 1A1OA 3IJHB 3TO4A 3UTTE 3S96B 3K2UL 1CLOH 3KPSB 3VFUB 3FQXA 3LH2H 3S35H 3U0PB 4ONFL 5MENE 3MRQA 1CIDA 3HS0A 4UIKH 2CMRL 4OZ4B 4PP8C 3GSQA 1RUMH 1AO7D 1YQ2A 4U1JA 1G0XA 3QQ4A 3F62A 4E41D 1Q9KA 5T5NF 4R0LA 4JM4H 3FRUA 3BP7B 1QFWL 3FFDB 4HJ0C 1SQ2N 3HNSL 3MRDB 1FGVL 1RPQA 4NKOA 2IJ0C 4G8GD 3MV8B 3LVEA 3JV6A 1YEHH 1L0QA 2XACC 1GOGA 1D6EB 1F6FB 4NM8H 1N64L 1BVLB 3QPQC 3HMXA 1PQZB 1DANU 4R4ND 4QHLA 4FFZH 4I0CC 3AS3A 1A7QL 1I7RB 5KS9A 2UZIH 4WO4D 1RURL 3BEWB 3IDGA 2NY5L 3I3EA 1YEFH 5GRVL 2DQDH 4FXGB 3VFMB 2R0LL 4S0SD 2OR8A 1M4KA 2FGWL 3IF1A 4HHAB 1CL7H 4CDHA 3PWNA 1Q9OA 3PWPE 4R7NA 3KYMB 4UDUB 5CP3A 1I8KB 3BWAA 1WWBX 1ZHNA 2Z91A 3DX8B 1YEKH 4AIZB 1MHEA 5AZEL 4M62L 1KIQB 3LPFA 4P2QA 4YX2H 1NGPL 5IEHB 1UCBH 2F19L 1IGFL 1CGWA 4LQ1A 2DIJA 2YMXL 5CEZD 1RZJH 1AI1L 5A43C 4M8QA 2A9ML 4HCRH 2F54E 3EOTL 4GUPA 1GPOL 2R4RH 2ERJB 2ZSWB 3EHBC 3CK0H 5M94B 5E5RB 5IVNA 2XWBB 3V6FA 5L2JB 1KEGH 3IDXL 5D6CB 2AK1H 3QI9B 2CUIA 2R23B 3TWCH 3PP3H 2PYEE 4XMKL 1Q9WA 1ORSA 5IESH 1TZGL 4I4WB 3WV0A 3T65A 1MWAB 3DGGA 3OHXB 2NY7H 4OLVL 3ESVF 2DQCL 2BNQA 5DVMA 3QRFM 1HHGA 3FAXA 3QI9C 4N8PA 4NFDA 4GXVL 4KJPD 2E8YA 4D0CB 4X6DA 3GSOB 1YY9D 4XP1L 1LEIA 5D2LE 3ILQC 3S35X 3WL9B 4Y4HA 1MF2L 2D7TH 3V7AE 1EFQA 4OJFL 1RFDH 3R1GH 4HGMA 1M6OB 1Q0YH 1B9ZA 1PBYA 1OSPL 1VKXB 4N0FA 3W0WD 4JFFE 4L3ED 5KJRL 1KN4H 1S7SB 1EFXD 3KGRA 5IMOA 1OW0C 3OXRB 3V5KA 4PYHA 2HMIC 2FR4B 5BRZB 4OB5H 1NEZG 2B5IC 2ZCKL 4PLOB 3WXWL 5IF0A 5MHSE 4U7MA 43CAA 4P23C 1N6QH 3VJ6B 4G6AC 1YNTB 1A6AA 2A6IB 1LNUA 3C60D 4UTAL 2IBZY 3S98A 5J1TC 4XX1E 5DJDB 1SMAA 1CFQB 5F96H 3NH7L 4S1RL 5CBEB 3N1PC 2HLAA 1JWUB 4LSTL 3RY4A 5I71C 5EORL 1EEZA 1FORH 4OD2A 4F80A 4O02H 5BOPA 1F02I 5E6IA 1U91A 5HYFA 2E6QA 3S4SB 4RMVA 3Q1SL 4YBLB 1MHCB 3MUY1 3MRPA 5F7YC 4P9HC 2HP4A 1QRNE 4WUKL 3SCMA 1CQKA 3C08H 4HPYL 2UUDH 5DD3L 3SDDD 5HHOE 5DQJA 8FABB 3V79C 1URLA 3BZ4B 5D1ZC 4WY7L 2QQQA 5BVJB 2GUOA 4FZEH 4PLKC 4GW5B 2YD1A 3DHMA 1YPZF 1CDIA 2VQUA 3HHRB 2Y06H 5D1XD 4HUWA 3GSWA 4POYA 5E1AB 3KYNB 1YEGL 3OAZH 3S36X 3TV3L 3OG4B 2YN3A 3ES6B 3MJ8B 4G9FA 3HG1E 2G9HB 5E8PA 1JPTH 5K59F 4MAYB 2R1YB 5DWUL 1Q9LA 4RFNB 5KSBB 4UBDC 2CLVB 4X6BB 2FO1A 5C70A 3LN9A 5ISZB 1UWXH 3AMLA 4FXKA 5FKAB 4Y8DC 4JZJB 5E99H 2W59A 4MAYC 5E5UB 2VRAA 2C1PB 2BP3A 4RFNC 2FB4L 4H25B 5DJCA 2IQ9L 1PZUB 5CLTA 5DD1L 3P9MB 1VFBA 2UWEF 2WQRA 4JZJC 5TFSH 1SM3L 3EDJA 4JVUA 4OF0A 3S34L 4HUUB 1RK1B 2WQ8A 4JDVA 4L9LC 4XHJC 1HH6A 25C8L 1U36A 1L8JA 3WCYA 5EOCL 3GMLB 3S9DB 2IQAB 2R9HC 1N0LA 5GSRA 4A6YB 2NCMA 3WLWC 5FYJE 1QFUH 3VRLE 5DSCB 4OI9A 2JCCB 4YDIL 4P4RA 1EGJA 3ARBB 4NC1E 4MA3B 4Y4KD 4C58B 3SE8H 5DQDH 1XR8A 2VYRE 1A3QA 4KQ4H 2VXQL 3F7QA 4WHDA 4BSVA 5D7JA 1BF2A 4OFIA 1LGVA 1ZLSL 4G5ZH 5IOPA 1AGFB 1RUAL 2VAAA 5L6YH 2BSRA 1CGSL 5JXAL 1JHLH 1AXSA 1NBZA 1Y0LB 3IYLW 4K7PH 1NCCL 3ZL4H 5C0FB 1C16B 4GKSA 2AK4B 4CVXB 3WJJA 5FO8A 4XNYH 3B83A 2EE3A 1YMMA 2YOCA 1J8HD 1P84J 3ZYJA 2EO9A 4R4FL 4Z0XA 5K33A 3C6LA 3SHSA 1EGJL 3LRSB 3BPCA 5D5MF 4NQCA 5K9QG 4AM0B 1ZVSA 4NRYB 3TFKD 1GC1C 2QSVA 1FYTB 2YC1B 3I6GA 1E4WH 3MLSH 4KROB 1A6ZA 5C0BD 5HHMB 2XZZA 4F7MB 4CMMA 5IB1A 2VLJB 1BBJA 2P48B 4F7PA 4HFUH 3QUZD 2E9WA 5DUPL 3WKML 1QLFB 3DO3A 2X4QB 1IGYA 1PY9A 4K8RC 1KCGC 4BQBA 4KROC 3VGEA 2RAMA 3HE7B 3EYOA 4AMKH 4L8SC 2PTTB 4TNVF 1IAIH 3RKDC 1XF1A 2WBWB 4FS0A 3O0RH 3ZKMD 2ZWLT 3ALPA 1A22B 1S8DA 2CJUL 5JW4M 5FHAL 5FYLL 2CDEA 1IZKA 5FUOL 2DS4A 3HE7C 5GISL 2G5RA 4EUPG 5JIKA 1ULVA 2YRPA 3MFFB 3VFPB 2DL2A 5JMRA 1UQSB 1KIPA 3LS4L 3RWDB 3WO3B 2F74A 2CXGA 2GJ6A 2YD4A 4YQXL 5GGVL 1MVUA 3BT2L 4I5BA 2B4CC 2QR0B 2J3SA 3ZE2F 3TYGL 3WNPA 1T0MA 3DX6B 3EOBB 1OAQH 4MZ2A 3TP4A 1N4XH 4FTVE 5BVPL 4M93B 4KHTL 1MOEA 3QXAB 5T33L 4ODUB 3MRJB 1H3GA 3VWJD 2DKMA 2OSLA 5F7EL 1M7DB 5A16A 3T0DA 3QUMB 4ZXBB 3IAGC 1IM9D 3VFNB 1ZHBB 2B0SH 2GFBA 4M93C 4GW4A 4HLZH 4XBEL 3T0ED 2W92A 3SGJC 1T5WB 2LAAA 3HI1A 4U1IA 4AEEA 2XN9D 5EU4B 3PHSA 3NCYS 4PD4K 4PJGE 2Q7YB 1IQDA 1UENA 2EZ0C 2HFEA 3OKOA 4JKMA 4ZXBC 3GMQA 3C8KA 2C1OB 5E5MB 4PTUA 3B43A 1NGYB 3FAWA 1XCQA 4MMZC 1T0NA 4MA7L 4MQXC 4LDEB 5IROC 4KZEH 3P40A 3HCVB 1KLUB 1WTLA 1Z5LB 3S3JA 4PGDB 2IPUG 5EU3B 4PPTA 3I02B 3UTOA 4IRJC 1JZ7A 3PWUA 4P48A 5FAAA 1ZEAH 1NDMA 1D5XB 3MRIB 3GB7B 3PG2A 1MCHA 2EDWA 1KCVH 4J3TA 1SY6A 5HJ3A 4WHTA 4TVPE 4JHBA 1XF2B 4FQ1L 4N0UA 3V5HB 3BGAA 3GSXA 1LDPL 4ONOA 2VO5A 3F65A 1MIML 3GBLA 4OIIL 1UM6H 4K23H 5EOTB 3WIIL 2DJUA 3SBWA 1FVDA 1I7TB 3DV4A 5AAMA 3NTCH 4H0IA 5EDXA 5C1MB 1RJYA 2HFTA 4KZDH 3RWJB 2HJKB 2XZCL 1SYSB 3K1DA 5T1DL 5JPMA 1UZ8A 4LMQE 5IFJB 4PJ5A 2DKUA 1J12A 3AREA 3SQOH 4UV7H 2B8OT 1HWGB 5K9OB 4QRSA 1ED3A 1JP5A 4JPWL 2IAMD 4GMSL 5JOFB 5I30L 3DPBA 3MLWL 3BKMH 5JW5A 1NEZA 4GRWE 1CDGA 3JZ7A 4R3SA 5JHDA 1EERB 3ZHLA 5L0QB 2ZUYA 3BUYA 3MBEB 2B1HL 5DJ6A 4QEGA 2DQUL 5IFAH 4PRHA 4K94C 1F97A 1EBAA 5F1KC 1OSZA 4XPGH 1FG2A 2ICCA 3B2UC 1AD0B 1II4E 4I48A 1WITA 1BLNB 5L0QC 2EYTB 3MBEC 4B7IA 3D3VE 1ACYH 5HHPA 3ALWA 2CKNA 4ONHA 5T3XD 1U8PB 2BVOB 5F89B 4RAHA 5D2LF 5DC0A 1JMXA 3DMMD 4PRNA 1ZANH 1IAOA 3VFGL 1DLHB 4YNYA 2JIXA 1XH3A 2VUOA 4KTDH 1G7MB 1BFOB 5SWSD 4F37F 5FHBL 1P7KA 1YMHA 5DJZA 3RA7H 5I1EL 4MJ4A 3LDBB 1QG3A 2FJGB 1BD2A 3E6HB 4O9HH 3NGBB 3GDBA 4RGNE 5I1GH 1D5MB 5I1IH 4MNHB 4WFFD 4DKAA 4RQQA 1PSKL 3LDBC 1OP3K 3V4PH 5I76A 3TBYA 5KW9L 2V2XB 3CVIH 2XNAB 4XNMB 3NFNA 5C0DB 4YHLH 3D18B 3G5VB 3NGBC 4K3GA 3TA3A 1JGVH 4NRXB 4UI2A 3TVMB 2W38A 1WCQA 3WFDL 1UB6A 2MQ3A 3CIQA 2MKWA 4JFXA 4OLXL 1P4IH 4EXPX 1MJUL 1RJZA 2Z31C 1VA9A 2LTQB 5HI4D 1TETH 1KB9K 1KBGL 1XIWC 2VB5A 3QQ9D 3T77A 3QEHA 4HZAA 1Z9MA 3TVMC 4LSUL 3IT8D 4IRZH 4M9PA 5DUBB 4WCYL 3GSNA 4R6UA 5H94A 3UJTH 4NO0D 3PIQA 1UA6H 4J1UA 4F57L 4JFPB 5E00A 2BZDA 1XF3B 1QFWH 4OD3L 5ILTH 4DCQB 3L3IB 4FQ2L 2NY5C 4NKOB 5B8CA 3PXHA 4KK9D 3MRGB 3EDEA 3NFSL 2P5WE 4X4ME 3KYAA 4PGZA 3A6CH 3K2MC 4HS8H 2I9LB 3QEUB 5C07E 1YEEH 1DBAL 2WBJA 4EEEA 3FO9B 3LKQA 2FJHB 3SKMB 1HH9A 4WWKD 4YBQC 3VXOB 2X6MA 4A2MA 3H3BC 2MSPA 4LASH 2Z9TA 4AH2A 3VGAB 1T20A 2V5RA 4HZLA 4P2OC 5EC2B 4ZS6D 5GHWH 1NGXB 1HIML 1PVHA 2DM4A 1A3RH 3ZTJH 1J1XL 1RMFH 5GGTA 4PJXA 2CIKA 3EYFB 1S3KL 1Q9OB 5FM5M 3QR2A 5TE6L 3UPCA 2IH1B 3I3DA 2A6JA 4FNLL 4X7TB 1F5WA 3VGAC 3BIKB 2NNAA 3DRTB 4HIJB 1G7IA 3WIHL 5DUML 5FK9A 4BFEA 3X3GL 1MHEB 5BS0A 1CBVL 1AJ7H 2EYSB 4M62H 4NBZB 1FFNA 4DZ8A 3HMXH 2BY0A 4FQJL 4IMKC 1CICD 5DEGB 3SPVB 4HS6A 3OKLA 1V7MH 5E9DD 4JO3H 4PRAA 3TGXA 4PJDE 3L95B 4MMXC 4WEBL 1NC2A 3KXFA 4JAMB 2VABA 4XCEA 3UZEA 4N0CC 3VRLF 3SE9H 1KCUH 4GUPB 1NL0H 3QWOB 1CXHA 1SYVB 3DVNB 4OUUB 2P5EE 3QEQA 3B6SB 3DVIA 4XP9H 3O11A 3UP1A 4Q74A 4M4RA 5EU6E 5IVXE 5K9JL 5CP3H 2Q3AA 3DXAD 3RI5F 5DC4B 1ORSB 1QZ1A 3VXPA 2AJSL 3T65B 2AQ1A 1INEH 5CZXC 5SWZA 2GITB 3F8UB 5J3HD 4XI5D 1JCKA 4EUPA 2V9QA 2EE6A 4P2RB 3TN0D 4NWUH 1CDCA 3O2DL 1T03L 4Y4HB 2NXZB 3HKFA 2D2OA 5ADOL 1JE6A 4QXUL 4Q6YA 1BM3L 2X4UB 3QP3A 2WV3A 3TH3T 4YFEA 3B3IA 1RIVL 1EX0A 4N0FB 4LCYB 3U48A 3ECBB 5JHLL 5IMOB 4QXGL 1F3DH 1YN6B 3GO1H 5C0JA 3L5XL 2NXZC 1WQVT 3VMOA 1CDUA 1U8LA 2ICWI 3TYFB 3VXSE 5JUEH 4X6FB 1BQHG 5IF0B 5CGYC 4XNUL 3WXWH 1K8IA 1F4XL 4CDGC 1MY7A 2QADB 4J23A 4OFKA 1IT9H 4KTYA 5B21A 4R90H 1JZ8A 4YAQB 1U3HD 1VEPA 4L9LA 5GXBB 4N5UA 3KVQA 4ELKA 4PV9A 4MA8H 5D7LB 1A47A 2DN7A 4WI8A 3W82A 2QADC 4MXWL 3BGMA 1NAMA 4HKZA 4EN3C 4D9QD 2C4XA 2HFGH 3GJFK 5FDWB 1J1OH 2NLJB 4LFHD 1FL5B 3EFFA 2I07B 3WNMA 4C83B 3F6IA 4KV5E 3MRPB 5C08B 3WS6A 2FH6A 3ABZA 3QXTA 4HBQA 2ZUSA 4YUEL 3X3FL 3MFGB 4LLUA 3MLUL 5DQJB 1G9ML 12E8H 4AENA 4I13B 1FVCA 4M1DH 4OLWL 5KSBE 4GLRI 1P7HL 1KUMA 2CRYA 4WI5A 5EA0L 3EDKA 2EXWC 1HCVA 3RWGA 3ULUC 2VZ1A 4HUWB 4ODTL 1I1AB 4OQTL 2IAND 4XP5H 4GJTB 3SOBH 3V95A 1NAML 4DFHA 3U7WH 1KENL 4FQHA 3M1BB 4BUHA 2H2SD 4NNXA 4NQED 5JORB 4GO6B 1I1AC 4L5FL 5JW3L 3U9PL 1G7PB 5EIIB 3LKNA 2YUVA 2WIIB 4QXTA 1S78D 5F7UA 1YNLL 4UILL 1TJIL 1MEXH 3GSRA 1IQWL 4PJGF 5F1SA 5CWSA 4Y2DB 2C3XA 5FFLA 2W60B 1XT5A 1EEYA 1OAXH 2LE9A 3BKCL 3TBTB 5DYOB 3ULVL 4BQ8A 2Q8BH 3QNXB 3DX9A 2F53A 1NCAL 4BKLA 5MEND 2D7NA 1P5UA 3FO2A 1N8ZA 3HUJE 4P46C 1U95B 2A38A 2IALA 2E6PA 1AP2A 2ADFL 3V6ZB 5I1KH 4MAUL 4F3FA 2N56A 4LRNH 1QBML 4XCNA 3MO1B 2HG5B 5FO9B 5ICXB 4R26H 5ABDE 4PP1C 2E7LA 3HC3L 2HVKA 4S1QL 4YDIH 3QJFB 5KVDL 4DOHE 5IHLB 2BC4B 1ZVYA 3I6LE 1ZMYA 1SMOA 5KG9A 3M17A 1LK3L 4XCFL 2D0FA 4HWNA 3STZA 4AT6A 3RL1A 5CFHA 1WTGT 5HVFB 1HILB 4Q2ZB 1VPOL 1ZA6A 4YDJA 2AJ3B 3RWCB 4POZD 4KAQH 3TT1H 4EI5D 4O2CA 4HX1B 1AXSB 4ODSH 1UH4A 3O2VH 5T5NG 3WKNA 4ORGA 4PJBE 2X2YA 5LBSH 4MS8A 4P5MB 5FA4B 5FO8B 3PP4L 2Q6WB 1BOGA 1DVFD 4GRWF 5F7LB 1AHWA 4POUB 3KAAA 4RAUA 4S1DC 4NQDB 1MCWM 3SDCB 1J0IA 1UM4L 3I6GB 3MLTA 2M1KA 4WW2F 5C7XL 5IB4B 3MV7A 1IGML 4XGZA 3GNML 2Y07L 4CMMB 1BBJB 3GMOB 4F7PB 2UY6A 5C0CE 1FNFA 1R5VB 2D7MA 4UU9A 4Y5YA 3SDCC 1CF8L 3EDFA 4X9BA 5FF6A 3WN5A 3VXMA 3CMOL 3UBXI 3MRLA 3PWVA 1NBVH 3G6DH 5BO1L 4IRJA 5IB5B 3Q3GB 3GFUA 5M7QA 3F7YA 4TTDC 5IB3A 2RJMA 4KI5D 1K4DB 5A3ID 3IVKB 1U3JA 1S5HA 3AM8A 2AI0L 3BN9D 1N5AB 2HJFB 5TGBA 4RFOL 3KPOA 1JF6A 1YDPA 1RI8A 1JK8A 3F7VA 2Z93B 3UDWC 2PYED 3H0TA 4HIEA 3MZTA 4UT7L 1AFVL 3O3DB 4M3JA 5ID0A 5CINL 1T4KB 3ZDZE 3L3KB 4PLJD 4HT1H 2PNDA 2FX7L 1LMKA 1PJ9A 1DN2A 3VGBA 3G6JE 4BZYA 1WBYB 4I5BB 4JPVL 1H5BA 3T2NH 4F2MA 2X7LB 1CG9B 5CILL 4Q97A 5DQ9A 3N9GL 3KPMB 5L2KD 4U6HA 4DGIH 4N9GB 1N0XH 4XTRD 1ADQA 3ARFD 3LSOA 4U33A 1DJSA 2F8VA 1DR9A 4Y5XB 2OSLB 5B39A 5HHVL 4PGEA 5C0NC 1DQML 3G5YA