3X11A

Crystal structure of hla-b*57:01.i80n.l82r.r83g
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRNARGYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x11A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3x11A01
4JKPL 4HFWA 5J6HA 4JFDA 1P4LB 3FB6B 4XTRC 4UI2A 3MBEC 4HMDA 1GXEA 1FHGA 3MGTB 1B6UA 4ODUA 2AAVA 3OXSA 5CEZL 5CUSH 3KXFE 5CEZH 1CVRA 3BGFC 2GTWA 2MKLC 1F4WH 2ADGA 5D1QB 3SDYH 3EO9H 5JOPD 1G7MB 1EHLH 4JN1L 2MJWA 4FP8L 3WYRA 3BH9B 4FQHB 4IDJH 1FV1A 1IGIL 3OSKA 3WNOA 4OZ4A 4HUUB 3O2DH 4WO4C 5D5ME 2X4RA 4KUCF 1IM9A 1K2DA 1ES0B 4EBQL 4XVJH 4DUXA 4MVBA 3CXHK 3QUMA 1QSFE 4G42B 4FQCH 1U2HA 4I5BA 1OAYH 5IBUB 2VUYA 3MGOA 4KMTL 2C1OB 4BFIA 1FORL 1J1XL 5IWLC 4XP5L 2PYEE 4ZAKA 3Q2CA 2G9HA 3FT4A 5EPMA 3GSUB 4Y16B 4HAFA 5FUCE 4AH2A 2FIKA 3U0TA 1KIPA 1PBYA 2FZ3A 1UXWA 1PEZA 3OAUH 2IPKB 1R5IA 3QIWD 2EH8H 3TH4T 4GMTL 1FC2D 4WI6A 1QYGL 1WT5C 5DEFB 4UQ3A 1MRFL 1KBGH 3ARGA 1WUNT 4A2LA 4F7CA 2X4SA 3A6BH 5F7LB 4LOUD 3VI3E 4HH9B 2PYFB 5IVZA 2I5YL 2J12B 4LK4A 4XVTH 4RZCB 3ZTJH 4KRNA 3GK8H 4L8DA 4MDJA 3MV7E 2APFA 3SKOA 4LIQL 2EYRB 3SOBL 3KPSD 4WRLA 1A3QA 3QUZC 1NGPL 3ZDZE 3QWOB 4WHTA 4FFWD 4YWGL 4F7PB 3U79A 4R90L 1C1EH 4R7DB 5GJSL 3VGFA 5D7IA 5BRZE 3ARDB 3S3JA 5BW7A 1Q94B 4AH2B 1LHZA 1Q72H 1HHHA 2FO4A 4UBDC 5HXMA 5C6PB 3SGJA 5C0AA 2B7DT 5CEXA 1JV5B 3W0WE 2DBLH 2JJVA 2MSPA 1IJ9A 4FTVD 1S7RA 3X14A 1EK3A 3QDME 2A74A 3NCYP 2MQ3A 3BESR 1BD2B 2AK4B 5LGJB 2EH8L 1JZ2A 5C0ND 4JG1H 1FFOB 5EOQL 3CVHH 3RJDA 3TYFA 1NAMB 2PYFA 5IVZB 1H5BA 3VXRB 2FNBA 4M4RA 1JZ8A 4QGYA 3DJ9A 1KOAA 3QEUB 3GJFH 4IMLB 4U1LA 3JSSA 3BKYH 4TUKH 4F8QA 4LIQH 4YHZL 2VC2L 3MRBA 1U3ZA 3KYAA 4CN1A 4PV9B 3EIFA 2EKJA 3UEZA 1AHWA 4YDIH 5DUMH 3CU7A 4OZIA 1UM5H 4HFWB 3S7GA 1JZ7A 4L3EA 5DGQA 2VQUA 2WINA 4Y4FA 4YC2C 3S35L 2EE6A 1T21A 4PRDA 3IJHB 2NZ9D 5EU5A 3RU8H 3P40A 2Z93A 3STLB 4HBCH 4NHUB 3OR7A 4GG6E 3CUPA 3MLSH 4TQEL 4XCEA 1U8NA 4NRZB 3T2PA 4GBXD 1ZT1A 2HWZL 4TSAL 1CFQB 5C08D 3SDAD 4NHCH 5CP7A 3VFGH 3KYMA 1OF2B 4AG4H 5F7DA 3D39A 1QFHA 2DTML 3EYQD 1A2YA 3Q5TA 5BOZG 5IVXA 2FWOA 5I8KL 4PR5A 1LO4H 1EO8H 4FQCL 1PLGH 4LAJH 2HVKA 1DLFL 4MA1B 1UACH 4NNXB 4D9LH 5I9QB 3MUHL 4JFHD 4LSPL 1JRHL 4PJ9B 3V4PL 4JGJA 4OF3A 2MPAL 4XNMB 3VXMD 1JHTB 3QQ9D 1A6VL 3L3OA 1S7RB 4ZODA 4P5MB 3EJYC 1QRKA 1S9YB 4L1DA 4H1LG 3NABH 3NA9H 1C16A 4EN3A 3QFJE 3ARBD 2OP4L 2X42A 5AWNH 1P7HL 3CJJA 32C2B 3SDXF 2CDGB 4P2RB 3TZVA 1HCFX 1EX0A 1N8ZA 1MCPL 3BPLB 2IANA 5EZOH 2C7UA 2OYPA 1Y18B 3CXDH 4I3SL 3LN4B 4OQTH 1DZBA 3PDDA 4U6YA 3LQMA 6CGTA 2IMNA 2VDRH 3DVGB 4M43H 4ETQB 2DF3A 5JW4N 5KTEH 3TNMB 2Y5TB 3ARSA 3O4LB 1HI6A 4F7PA 2PYEB 5ID1B 2X5PA 3GSXA 3GSQB 3MV7A 4QNPF 4U1HB 1FRGH 1F5WA 4JZJB 5FXCH 4UT7H 3N1FC 5TH2B 4X7SL 2P43B 5HHMA 1SY6H 2PTVA 4Z8FL 4JHWH 2CLVA 5I8EA 5DYOB 4HUVA 2GSIA 3VXSB 3KNBB 4JHAL 3RZCA 3ZKND 4P23C 3FMGH 2DKMA 3Q6FB 2A6JA 4PY8I 5GGRB 5KOVC 3VFMB 3CZJA 3W11C 4PJBB 4G9FE 5EBWB 2EE2A 3HG1B 4A6YB 1EVTC 1U8HA 1I8IA 4ELME 5JQ6H 3T2NL 1JGEA 4AL8H 3PGFH 4Q2ZA 3ZYZA 5I1EL 4JRXD 2F19L 3L3HB 4HKXA 4F2MA 2YPLA 4M8QA 4LCIH 8FABB 3EDDA 3ROLB 1G0YR 3JWDL 3ZE2E 3MRHB 1BJMA 3C5ZA 5JIIA 3P9LA 1OW0A 4G8GA 1J10A 3BP7B 5JZ7C 1WICA 4N8VG 2D03L 4GUPB 4YHIB 2WAHA 1WLHA 4OGYH 4QTIH 3QIBA 2DLFH 3WFBH 4S1RL 3CX5J 1BGXH 1VGEL 1BJ1H 2NX5D 1CG9B 1T4KA 3C6SA 4QO1A 3CFDA 4KK8C 3Q1SL 1DQJA 4WI7A 2HN7A 3MA9H 2HRLA 4JDTH 3MRPB 4G9DA 5CMAA 2J4WL 1MVFA 4JY4B 2XQBL 1CIUA 1EMTH 3BVNA 5E8DL 4J4PA 2FR4B 1MF2L 3W5NA 1MCPH 4P5TC 5DD0L 4U0QB 2PXYC 1JHLH 5DJZA 4BSVA 4JANA 1GOGA 5D2LA 4FFVC 5GRJH 1A7NH 3MCKA 1V3KA 3RGVC 1D6VH 2EXYD 5LWYL 4OIIL 4ONOA 2P5EB 5C0GA 3MOQA 4UDTA 4X7DC 3EO0A 2BSED 4ZPVB 2AEQL 1B0RA 3GM8A 4KROC 1BWWA 2BNUA 4PS4L 4K3EH 4EUPB 2EKSB 2EIBA 3BP4B 1GPOH 5DFTA 2I26N 5DT1H 4HUVB 5T3XE 3QQ4A 5INCA 4XVSH 1OAQH 4X8JB 4PJFB 1W72H 2OI9C 3C6LB 2OL3L 3CFBA 3JWNC 4P3DB 4PLKD 5E00B 2X1PA 2CIKB 2CK2A 5DRWA 3GMNB 3GSRA 4K2UL 3PXHA 4JN2B 3DGCR 1U58B 1MAMH 1PW3A 3UO1H 5F1NB 4O2CB 5E8PB 1QLFB 2DJUA 1AXSA 5I1CL 3ESUF 4BKLB 3ZYOA 2Z31C 2W9LA 4RA3A 3G5ZB 3QEQE 4XVUC 3RY6C 1KTKE 1CXHA 5IB2A 3GDBA 3KGRA 3GNMH 2VLJE 4K3JH 3BGAA 4JREC 1SYSB 3GSVA 3KPNB 4RGNC 4DN4L 4XPBL 3EBAA 1MREL 2R2BB 3OZ9H 2ZG1A 4HKZA 4PJ7F 1FORH 4MQXD 1CDIA 1BECA 3SDAC 3FZUC 3SY0B 3ZKNC 3C08L 4DGYH 2Q76B 4K94H 4K7PY 5D9SB 2DIJA 3HPLB 5GS0L 2ORBH 3H9SA 5I1HH 3VWJD 3AS1A 3H9SE 4X99B 3ARBA 1NEZA 2EZ0D 4DQOL 4D9RE 3WN5B 1IGJB 3VFNA 4DQOH 3SE9H 5HHME 3KPPB 4JAMB 4R2GC 5HI3C 2IPTL 5IKCA 1K4DA 4O58L 2DI7A 1BBDH 2JIXD 2XG5A 3OKLA 3NACL 5JOPE 1NC2D 3LKPA 1IC4L 3R1GL 3B2VH 4XP9H 4XCFL 4GRWB 1RU9H 3DRQB 3KXFD 1T1YB 4O51A 4I0PA 2XA8L 4HH8A 3QUKB 3RUGB 5E24E 3RDTB 2VLLA 1NGZA 3S5LB 1EERB 1FFNB 1X4YA 3V7AG 2PXYA 5EWIL 2ESVD 4LFHD 1YJDL 2EDQA 1JK8A 4NGHH 1Q9KA 5DUBB 1X5AA 3D39D 3E8UL 1A3LL 2OMBA 5CS7A 4U31A 4U1KB 2CK0H 2UY7A 4I18A 5ACZB 5M95B 1KXVC 5C8JA 4JFYA 3ZZ1A 3IU3B 4HFUL 3ARWA 4A6YL 3TBYB 4O2CA 5E8PA 43CAA 1HK6A 1TQCC 4JN2A 2CXKA 2AJZA 3I6GB 5IB3A 1OF2A 3QPQC 1RUPH 1R0AL 5DRZA 2NY5C 3SDDB 2BDNL 4U3XA 4MXWL 5DK2A 3O6FB 4OM1L 1D6EB 3Q3GB 1S9WB 4N90E 3HR5A 4ONFH 4UNUA 4Z7WF 3K1DA 1NCWL 4KKLC 4O51B 1F8TL 5E1HB 2NY2C 3MACL 2CLRA 5EA0H 4OCWL 4PRIB 4IS6A 1U8LA 4WO4B 4WW2C 4ODWB 4HV8B 1INEL 3BXNA 3O9WA 5L6YL 2C4XA 4W6WB 1BVKB 1SBBA 3NTCH 3DETC 2VLKA 3EZJB 1ZANL 5D7LE 1XGQB 3STBA 3ROOB 3T8XB 2YD5A 4ZTPH 3I75B 5C07D 2DMCA 4JFZL 4G6KL 3UTZA 4CW1B 2B4CL 1NUFA 1F11B 2VDQH 3H9SB 4KK5C 3SDXE 2DQDH 5FUZL 4JKMA 2AV1B 3BYTA 4JPKL 4W4NA 4YNYB 3I02B 4PJXE 2KUTA 1D5ZB 4NN7B 1K5NB 1FIGL 3LRHA 3VH8A 3HI5L 3ECBB 4HUXB 1IC5H 4TSCL 2ZCHL 2KQMA 2CDEB 4AQ1B 4PJ8B 1C5BH 1KBGL 4PJGE 3D85B 2Q7YB 3RPIA 5GJTL 1ZE3C 3QHZH 4Z7WB 3VFGL 3GMRA 3QCVH 1I9IH 5IGXH 1QFPA 4M1GL 2MMXA 5FCUL 1GGCL 4J8RB 3ZTJG 4MQ7A 3G5VB 4J7RA 3I9GH 1KC5L 5GXBB 4R96A 2RFXB 4OF0A 2OTUB 4XPFL 1I8MA 1WIUA 3RVTD 1X6LA 4XMPL 1R3IH 4ALAL 2L0DA 4HT1H 5HDBF 1TLKA 3UC0H 1L0XA 2IADA 4D2NA 1T89A 4D9LL 5KANG 1JN6B 1A7PL 5C3LD 4ZUTA 1JHKL 2OR9H 2P48B 1TQBB 3NPSB 1SJEA 2XWJA 4I18C 4A6YA 4XTRD 4G6MH 3TCLB 1I7UA 5HVWA 3TIDB 3SQOL 3UPRA 4PGCB 2XN9D 3ES6A 3QUXD 4PRAB 5K9OB 4J3TA 3WXWH 3EO9L 1CDHA 1ZAGA 2CDEA 3QBTB 5CEZE 4PB0H 5CSZB 2F74B 1LK2B 4U1GC 5LJYH 5BW7C 5FF6B 3QDJB 4CADB 3ULVC 1MIMH 1S9XB 4U1HA 2ADGB 1YQ2A 2NY7H 2R2HB 3HRZA 4HK3J 3MLZH 4ODBD 5B3JE 1CD1A 1T1WA 1C12B 5ETUA 5C09B 2Y36L 2DAVA 4U0RC 4OFKA 3HUJE 3VWJA 2R69H 3T8XA 3FO0H 4HJ0C 4R90H 4JZNA 3IJYB 2Y07L 1P7QA 4MD5A 5BQ7A 4UILH 1MJ8H 2IAMA 1FSKB 3JWDC 5L88H 1U58A 5TF1H 5EOTA 2N1KA 3FQNA 3VRIB 2WBKA 1JUFB 3RGVB 1JRHH 2JB6B 5JMOC 4GKNB 4RRPA 3ESVF 3WV0A 4RQQA 2NXZC 1J12A 3R8BB 2H2PC 3L3OB 4MQXC 1JPGA 4PD4J 1MCEA 1U3JA 3DMMA 4KPHL 3WL9A 1A4JB 2HJFB 3HUJF 3L3KB 1S78C 1OARH 5F7UA 4I3RH 1FL6B 4X4XB 1ADQH 1I8LC 1G7LB 1IGCL 1J05A 2OXHA 4ENEC 1JNHB 5IBTL 1HYRC 4QCIB 2VZ3A 2X4PA 2H3NA 5C0BB 4Q97A 1KG0B 5E94A 2RHEA 1CQKA 3EDKA 4QXWA 2WY3A 5D1QC 5L2KD 5M7QA 4XVUD 2NX5E 2V5RA 5IOPB 2XQYG 2YD2A 4G8EA 2UWEF 4ZFFB 3JV6B 5IW1A 3RHWF 2NR6D 5MEQA 4E0RA 3S35H 1UJTA 4ZFOL 5GSVA 2W60B 1HSBB 3B2UC 4L3CB 4GBXB 2FIKB 2COQA 3DO7A 3RKDD 3DX7A 4PJEA 5T1LB 4N9OB 3BOVA 3IT8D 3DGGB 1NFDA 3PDOA 4PGEB 2BNQA 1IC7H 3QZWA 1JCKA 3X14B 2BY1A 4N0UA 1QO3B 2G75A 4F58H 2GUOA 1E28A 4NQEA 4PGDB 5TQ0H 1IARB 3CSGA 4WW1B 3QXUA 4KJPC 3FQTB 4NKOB 1GIGH 3REWA 1RIUH 1LO4L 4FFVD 3NN8B 2FX7H 1BZ9A 2HVJA 3O4LE 3FQUB 4OAWA 1YEDB 3JTSA 1ZHLA 4YZFF 2C3WA 4XZUA 4Z7UF 1Z2KA 5D1QD 3U9PL 4FFZL 3KPPA 1FNEB 4JAMA 3TA3A 3T2OA 5HHOB 2E7LA 2R9HC 3ALXA 3WIFB 4PRBB 4WEUD 4WJ5B 1WC7B 3WD5H 4NNXA 1YY8A 4RBPH 3NGBC 3AAZA 5IIEA 4ELMA 5HGBA 5K9QI 3MUZ1 1T5XA 4ORGA 1TQCB 2NYYC 1DUYB 1BOYA 4PJHA 2PTTA 5K9QG 5JNYA 4D8PA 1R5WA 4MX7A 3W0WB 1SJXA 2ZOLA 2QQLL 5J9PB 1YEFL 4KK5D 5GRWA 1T0MB 1JGDB 5ABDE 2O61B 3MUJA 1XR9A 3ULUD 3TIEA 1K4CB 3OV6A 1SQ2N 3CXDL 4CMHB 1Z9MA 4CU6A 1CCZA 3MV8E 4OIIH 4P23A 1IKFL 5F7NC 4MAYC 5EG6C 1HXMB 4RIRB 1WZLA 4X98B 1ZHKB 1BBJA 1I8LA 2I9LA 5GS1C 3WIIL 5F21B 4NRXB 4LEOA 2NY4B 3UPAA 3NBNA 1DBAH 3VXSD 2FDBP 2VLRA 4HJ0D 4M61B 5ESQB 2AEWA 5IROC 3NCFB 1HSBA 1QLEL 2ADIA 1MNUH 4GRLC 1YYLH 3VXQA 1NEZG 4BQ9A 3RU8L 3MJ9H 2B39A 3IF1B 1T80A 1JNJA 4HIIA 3P4LA 1KEML 3V4UL 1AI1L 1GJIA 2Q1EA 2BNQB 1J5OL 1U8IB 3QA3B 4LCWB 4I3GA 5L2JA 3S36H 3WS6A 1KJ2H 4GRWH 4PJEF 4KZEL 3QIBC 4QOKA 4MCZB 1R24A 3GB7A 3TN0B 4TVPL 2EC8A 2EXWD 1BOGA 3FQTA 4Y4KC 3BDXA 1U3HA 3DX8B 5D2NE 3U9UB 1IEBB 5JHLL 1X5ZA 4PJ5B 3QDMB 4KU1A 1KLGA 5IOPA 4RFNB 1HWHB 1XIWC 4WU7A 2F54B 3MBEA 1AGCA 2PCPA 4P5TA 3T3PF 1CL7L 2BNRB 1F42A 1BIIB 3VDBA 1FGVH 3P9LB 2W60A 2VAJA 4L3CA 4LHUD 4G80B 1XZ0B 2YZ1A 1CF8L 4P46A 2ZOKB 4MXVF 4MAUH 1OPGL 1Z5LB 1OD7A 5EU5B 3M45A 1MCJA 4WTZA 2Q86A 1A6TA 3IGAB 2VLKE 2CRYA 4QLRA 4MCYA 4ELMF 3FQWB 1RMFL 1UXSB 1S7SB 3TLRA 2AQ1A 4QHKJ 4GW1B 4K23L 2R2HA 3HRZB 1TJGL 1ZXQA 2AJUH 4H25A 1WWBX 3FKUS 4RFNC 1OAZL 2OI9A 4YBHA 1JGEB 1RV6X 4LPWA 1Q8MA 3DYOA 5IWLA 2FGWL 5IBUG 1KXTB 4OZHF 2MQ0A 4KQ3L 5HGDA 3Q48A 3QQ9C 5FGRA 2V17H 4KMLB 3F7RA 4U2ZA 3SDAB 3BQUD 5GGTA 4YHML 1QG3A 3DETD 3QB7C 1NCAH 1RVFH 3FT4B 2HFTA 3DXAD 4MZ2A 3REVA 3MO1B 1FNGA 2XACC 4PJDF 2O5YL 4HGMA 5EN2A 5K33A 3WJJA 2DRUA 1F97A 4MGXA 4UT6L 4LLWB 3VXMA 4C83A 2QSCL 1F4YL 4UIMA 2VXTL 1U91B 1T7VA 4KZDH 2K1MA 1AFVH 5ADPL 3PWPB 4LRIC 5EIIB 4ZO9A 2V2TA 1QVOA 4P49A 5AG8A 5D1XD 3QSKB 3PJSB 5IK3B 2ICCA 3W2DL 3PP4L 5JDSA 1U3HC 1OGAE 2X4OA 3WN5A 5GRJL 1M05A 2X2YA 5MENA 4FZEL 3OXRA 5A3ID 1QLEH 1QFUH 4DAGH 1MHHB 4Y88A 4UT9H 4QRUB 4DAGL 1QSEA 2OTUA 4JFED 1RHHB 1CXLA 5I8EB 3W39A 3D87B 5JIKA 1NC2B 4O58H 3BI9X 5SV4A 4Y0GA 2WBJB 1QACA 2OL3A 3H9ZA 4CDGC 4CVXB 1MJJB 4LLWA 4MNGA 2R4RL 3MCG1 1S7SA 4EJ1C 3ZHDA 4N90D 3BPCB 4FHBD 5MEPA 3QRGH 2GJ6B 4RNRB 3I6KB 5DJXA 4MLIA 3D39B 1FG2B 4JM2D 1YN7A 3MRIA 2HTLC 1YEKL 1D5IL 1KJVB 3AREC 1TVHB 1IM9B 1AGEA 4LKCB 3K81A 4WV1B 5IQ7L 3GIZH 5IFJA 4DN4H 4X6CA 2BNRA 1WBYB 4YEFA 4WWID 1ULVA 1SJHA 3HS0B 1AGBA 2OS7A 2AJ3A 3CVHB 4PGBA 3FFDA 3X11B 5JMRA 4OKVA 2VISA 5IVXE 1LDPH 5BO1L 1RZKL 1LDPL 4X7FC 3U4AA 4Y1AE 3GMPA 3U0TB 1KLFA 4HK3N 4WWKB 2FX8H 5DVMA 4UT9L 2YD6A 1DE4A 3TV3L 1JWUB 3QCUL 5F1OB 3BAEH 3AB0B 4DKDC 3BXNB 3JUYA 3FFCE 4PB0L 3SKMA 3CFJA 3HE6C 1SYVA 3MV11 1I9IL 5FKPA 1W72A 3DHJA 3PJSA 4NQDE 1ZEAL 2ZCKL 4OCYH 5C0NC 5F7DB 3CFCH 1T3FB 5FA4B 5FYLE 3X13B 3KHQA 1KCLA 4PJXF 1TVHA 4MA7H 2I5YH 3H9SD 3RIAK 1XGUB 3HC3L 5ALCL 1IFHH 2H2SD 3JZ7A 2HG5A 1T22A 4L4TA 1JYXA 3OAYH 1XH3A 3SPVB 4Y5XC 1G84A 2DKUA 5DMKA 1Q94A 1KYOJ 3SCMC 3HHRB 1W0YT 1HIMH 4PJ8D 4I18B 5ACZA 5J7CC 3D85D 4PG9B 4HBCL 3TZVC 3R0MA 3BDYH 1LO5A 3HZMB 4LGPB 3VFUA 4G8EB 3B2UD 1SBSL 4YGVB 4XH2B 4JRWA 1RZ7L 2OBGA 5B4MD 3D2UB 2HLFD 3QCVL 3S3SA 1X3DA 5FV1L 5JIPA 3O8XB 3AU1B 2VDMH 4AIZB 4CU7A 1I1FB 3BSZH 1AIFA 3HKFA 4YFLF 1HNGA 1VFMA 3V5KB 1NKOA 3VD5A 1ACYL 1AGFB 4XP4L 5C09E 4K3DH 3DYMA 1I7TA 2HH0H 4YHZH 2E3VA 3VW3L 3RKPA 5E2JA 5ESAA 4XCNB 1AE6H 2R23A 4JFZH 4EDWL 2I60L 2IQ9L 3E6FA 3HC0B 4APQC 4Y8DC 3PGDA 2BSRA 4YDKH 3N50A 1M1SA 3NN8A 4NM8H 4X99A 3P30H 1KF9B 2VZUA 3QG6B 3SCMD 3FQRA 1IGFH 5EU3B 1MFEH 4JKPH 1GGYA 4H26A 5AWNL 5D70L 1RK1A 4YXHL 3UAJC 1FH5L 4OCLC 3OTTA 3QNXB 3NZ8B 2NNAA 5DD6B 3U4BH 5BMFL 4F9PC 1MQKH 2BVPB 4OCYL 4S0TD 4UNVA 5C0EB 2VLKD 5T3XH 2PNDA 4NFDA 4PLNC 3B4NA 5GJTH 3FO9A 1T1XB 5FYLL 1W2KT 4UTBH 3MBEB 2F74A 2CH8A 3NFSH 2ZUVA 4E41A 1IFHL 3PNWA 2FATH 1HH6B 3MRLA 5ISZB 1J8HE 3HE7D 1EEQA 1AQDB 2OLDA 2FJFA 3U36B 1B0RB 5I8KH 4D3CL 2V5MA 3EOBA 3AXLB 4NZUH 5L88L 3LH2L 5HDOA 2VMFA 5A2FA 1JYNA 1QYGH 1V7MH 3Q6GL 3ARTA 2ZUUA 3NA9L 4UZGA 1MPAH 3C9NB 4Z76A 5F3BB 2VE6B 3OAUL 4I0CC 4ERSH 4U1SA 1JF5A 3DROB 1A6VH 3BUTA 4YX2L 2CR3A 4JO4H 3IXTA 2VKWA 4PJ7E 5CZVL 5BVPH 2YC1B 3T2QA 5D93B 3PUCA 3ZKXC 1NMBH 2R56H 5EC2A 4JGUA 2I25N 4X9HA 1S7QA 5AZ2H 4HQQL 4NO0D 5DHVB 5EB9A 5EZJA 1TJHH 5IHZA 2VDNL 3PDGA 3MV9E 1HHJA 3OBAA 4GKZB 4XCCL 3U9UA 5FYLH 4OIBA 1HXMA 4R97C 4B53A 4U3CA 3VG0H 2GITA 1NC2A 1JF1B 3G5XA 5ICXA 4X7TA 3MLRL 4CU8A 2FJHB 3LEYH 2X41A 43C9A 2NMSA 3LMJL 1SEBB 4YHOL 4L8CB 3AGVA 1DVFA 1FYTE 5F6HJ 5HPMB 1O7SA 5F7WC 3OMZA 2ATKA 2P5WE 5KZCD 1KN2H 1B90A 5C0AE 3MBXL 4MJ5B 5EZLB 2WBWB 4EEEA 2EDDA 2HT2C 5B8CC 1ZLSH 2IH1B 3UMTA 4HAGA 5CJQH 3CFKA 4F58L 1M71A 3S4SB 2F5BL 4TUJB 3L6FA 4WI4A 3ARBC 3SJVA 3W9EB 4GW1A 3E3QE 5I1AB 2BSRB 1NDMB 4O9HH 5ENWB 1KTLA 3LSOB 1UZ6E 5F9OL 1BZ7B 5ANMA 1CQYA 1RUQL 1HILB 2L7JA 4MXQA 4PRPE 5DEFA 4FQQA 4LSDA 1YECL 2VOTA 1CFTB 3GBML 4KK6D 2OTWA 4K71C 4XI5D 5GS1A 3TIDA 4WTWA 1F4YH 2DMBA 4HH9A 1DBMH 1ZWIB 3MRKA 3OL2A 5IEKB 1A1NA 3BIKA 4WJ5A 5EFIB 1MHCA 4XXDB 3GUTA 1F4AA 3EOYG 2ICWA 3SKJL 1YDPB 3QCTH 1UT9A 2F58L 3QHTC 4GSDH 3QR2A 4QHMB 4ORZC 2RGSA 1EJ6A 4MB5A 5EBMA 2C1OA 2V5YA 1IEHA 4U1IA 3SE3A 4O2FA 4GKSA 4L3ED 4PJ7A 1T20B 2PW1B 1UXSA 2C3GA 5AUMA 2X40A 3N85H 4KI5E 3QO0A 3MOBL 5GZND 4H0IA 1G7IA 3BZ4B 3QDGB 3QFJB 4JDVA 3S3PA 3TO4B 1ZGLM 1U2CA 2VERN 5D72L 2J8UB 3K4ZA 4PREA 3S98A 2CKBA 1ED3A 1KJMA 2FECI 3B9EA 4JO1L 4LNRA 4Z7VF 1FRGL 1ERNA 4NJAH 5DTFB 1EFXB 2GFBA 2XWTA 2H9GA 3FT3B 4CL7A 4AEHH 4WHCA 2DM2A 2XZCH 3IXTB 5T33L 4DGVH 5DK2B 3DIFB 2WSKA 3SDDA 1MLBA 5CJXA 5J1TC 3ARXA 5EUKA 3KS0J 4F2MB 4CGTA 1ZHBB 5JHLH 1VERA 5GGUA 4M6AA 3TT1L 1KTDA 2BVQB 1KV3A 1G7QB 3TT1H 1N6UA 3SO3B 4HXBL 3ZKMC 5F70A 4KDTC 4IIQB 2ENYA 3LRGA 4OD2A 1R24B 3DOSA 5IMOB 3TIEB 2H3NB 1K8IA 5C0BA 5CGYC 5GIRA 3C60D 5A2JH 3QJFA 2E9BA 3WCYA 5IFAH 3C08H 1ADQA 2EYTA 2ZSWA 4GRLB 4OGAD 5DJAB 2ILLA 1B88A 1BX2A 3QRFM 4N1EA 1EJOH 3ZYJA 3V95A 3G5YB 3FCTB 5ITBH 4KKCD 3WFBL 5DJDA 2IH3B 3Q5OA 2BOBA 4KDVA 3FRPG 4K94L 2YBRA 3BN3B 4L5FL 5SWZB 4F80A 5FYKD 3ARGD 1LQSR 4YFLI 1XGTA 4NC0B 1ORSB 1U6AH 3U4EA 1YNLH 5JOEA 4QHMA 1YNLL 1RI8A 4RSVA 4U1LB 1N5YH 1I7TB 2NW3B 3FO9B 2ESVA 3VA2C 2P5EA 5C0GB 4LCCA 4Z0XA 2HT2D 1NSNH 4G8IB 2FGWH 1XR9B 2WK2A 4BSJA 1G9ML 4K3JL 4YXLH 1TVDA 5I1IL 1C12A 5ETUB 3DLQR 1JMXA 5E2TL 1RQ5A 1VFBA 3CVIL 5D1ZA 3Q1SH 1T83C 2NY5H 4P5MA 4HIEB 3RWFB 5HI4C 4X5LA 1OSZB 4I0KA 4G9FB 2IAMB 3F58H 5F8QC 3VXQB 2DQCL 4XAWL 5C0RH 1J5OH 4NT6B 4PGCA 1NCTA 3V5DA 4RAUA 2VXTH 4FFWC 1P1ZA 5EU6B 3ARED 5CJOL 1YMMA 2E6QA 2HKFL 3LRSA 4NQSB 4RAHA 3ZKSD 4M7LT 1A6WL 4QY8B 2B1AH 3MROA 1KTDB 3LS5L 3D25B 5DJ6A 2EDEA 3GJEA 1TZGH 5FGBC 4F7EA 4PG9A 1ZHNB 1N2RB 4YDVA 3FQWA 1K4CA 3ZE1F 2MTPA 4NNPH 2DL2A 1FZJB 2X9XA 1BVLB 1VCAA 3I6LD 2J2ZA 3NCBB 1MI5A 4DOHE 4LBEA 1BQHB 1LO2L 1YPZA 1KIQB 3OG6B 2QQKH 5I30H 3QO1A 4M5YL 1BX2B 4JFEB 4JPIA 2R4SL 1ZLUK 3PP4H 2HRPL 2D3VA 3PV7A 3QULB 4GS7B 2MHAB 4Q0XL 1GZPB 1GC1C 5C7XH 1QFWL 1KLUA 3CX5K 3G6JB 3JTTB 1Z9LA 2DYPD 2VLRD 3FQNB 3RWHB 4L4TB 4NZTH 2H41A 4IIQC 4ZOCA 1YMMB 1FH5H 3MJ8A 4S10A 5GZOC 4FQXB 2VITA 5LG1A 5KS9F 3I3DA 5F8RC 1RJCA 4NN5C 5D4QA 3KJ4C 1QSVA 4JRYA 4ONFL 3NOIA 5I17A 3O9WB 3HMXL 5BV7L 2AJVH 2XTJD 4NCC2 4LCCC 1I9JH 3QDMA 2YPVL 3GIVA 2H26B 2NTFA 4EVNA 4OFDA 3RWEA 3EO1A 4H8WH 1IT9H 4DUVA 3RVUD 5A2KH 1L9MA 4FXLA 1AGEB 4LKCA 3SOBH 3DTXB 4KJYB 3VFRB 5LGKA 4F7TA 3X12A 1PAMA 1RK0A 4E0RB 3HC0A 2ERJC 3B9KC 2MWCA 2C9AA 3P4OB 3QUZA 5J4MA 4B41A 2PR4H 3RWGA 4XHQA 4HCRA 4ELKB 3ULVE 2XNAB 4Y2DC 4FXGA 5DJCA 2Z0BA 2NY0B 5D96C 5SWZE 4BZ2L 4YPGA 3ARRA 5CKGA 2B1HH 3T0EA 3CDCA 3V8OA 3VFNB 1F4WL 4I2XA 3CLFL 3SDYL 4IRSD 1U8LB 4WO4A 4QNPE 2HT3C 4ZPTA 2ADJB 4ZUVA 3JV4B 4PJAE 4MVBC 3IVKB 2A9NH 5EO0A 2LAGB 3BZEB 3AS0A 4KK8D 5CIPA 5HI4D 3F7VA 1P53A 4HX1A 2VDNH 3HZMA 4HKXB 1JFQH 3RUGA 1YPZF 4MA7L 1S9KC 3QEGH 1SJEB 2DJ4A 5DUML 4I2XE 1JF6A 3MODL 3OWEA 5GJSH 3REVB 3KPSB 1YMHA 4P9HL 4OUUA 5H35A 3V4VH 1QD0A 4UB0H 1CE6B 3OAZH 3L3GA 4PJBE 3TBWA 5CZKA 4TTDC 5CKAA 3DVIA 5J9PA 4PBXA 1CZ8L 4S0SD 1KC5H 4MYWB 3L3IA 3MLSL 4TQEH 2RFXA 3GM0A 3B3IA 4C56E 3MLPA 4KKCC 1KACB 3A67L 3HR6A 1KTLB 5HD8C 1M6OA 2DTSA 3IAPA 1KTRL 2DS4A 4OZHB 2NCMA 5CP3A 4GRLA 3TFKA 4DZ8B 4NM4H 4JR9H 1D6EA 3Q3GA 1IAKB 2DOCA 5DSCA 1J0KA 1NFDE 2OJZL 3P0VL 3SCMB 4PJGB 3ZKXB 1TTGA 3PP3K 2DD8H 1RUQH 4DK6A 3JV6A 2YS4A 1P5VA 1WFNA 4G6KH 1NBZA 4OKVB 5AYUH 4UV4L 4G80A 1KFAL 3GI9H 5D7IB 1J8HA 1MJ8L 4NN6C 4NKDA 4WFEE 1A6TB 4G7VL 1INQB 2EYSB 4PJ7B 4ZD3L 1E6OH 5D70H 4N9GB 3CFCL 4O4YH 1H3PH 1LO0H 4Z7OE 3ALWA 4H25B 2Y36H 4RZCA 3RTQD 4OCNC 3AXLA 2R2EA 2PW2A 3KG5A 5TE6H 5IP4A 1MHCB 4LLMA 1W0WB 2LU4A 4XPFH 2YKLL 1CN4A 1I1AD 3KPOA 3KXFA 3X3GL 1CLZH 4IMKA 3CDYA 4G5ZL 5A16A 4XPHL 2NY6B 2YOCA 3CFKB 1XEDA 1WVZA 5CEYB 4BH7B 1XF5A 4O2FB 2NXZB 3FFCB 2NX5B 2UV3A 2YPLE 1XCTA 4P46B 1KIRB 2CGRH 3JVGA 3TH3T 1NMCB 5K59F 1A3RL 4DZBA 1UQSA 3LSOA 3TBVA 4K8RH 4L3EE 25C8H 4OM0H 2Z93B 2VDML 3TBWB 4HF5H 3KS0H 4PD4K 1GYAA 4U49A 5T3ZL 3VFTB 2HT4C 3IDIB 4LLQA 3B3IB 5ITFB 4NWUL 1FP5A 5FO7B 3KR3H 5T5FL 1UZ8B 1N8ZB 3T2NH 2OI9B 3C6LC 4FQHA 1KEGH 1YJDC 1ZVYA 1ITCA 2P5ED 2EDWA 2P24B 2ARJA 5AD0A 3R4DA 1CFBA 4IJ3C 1SYSA 4GG8A 4XXCC 3UTTE 5DS8A 1NCDH 4PRPD 1WBXB 1T7XA 5ILTH 4NZUL 2EICA 4EKXA 3GZKA 5I1GH 5SWSD 4FQIH 4Z7WE 4GQ9L 1ORSA 4X6FB 4KK9D 1WC7A 5FV2A 1D7FA 1OGAA 5C07A 3O4LD 3ZL4H 2CUMA 4TNVF 3O6ML 1I3VA 1Q9WA 4R0LC 3F6LA 3GKWL 5E6IB 2IALB 3FONB 1YYMH 7FABL 3LPWA 1IC7L 1CU4L 4RGOH 1I3UA 5B4MC 3QH3B 1R5WB 3FOMB 5E03A 5D7IF 5D93C 4PRHB 2KDGA 2X89D 2WUBH 5EIIA 3SDXB 4YH6A 5F1NA 2P49B 3MV8B 4MXQC 2CJUH 2V7HA 4LSQL 4MQSB 4KDWA 2DN7A 3MXWL 4L9LB 1VSCA 3B5TA 2IG2L 5DWUL 3MLYL 4MDJB 4YDLC 4GT7A 3S37H 4JRXB 3PNWB 3BFOA 4N8PA 5LBSH 1DFBL 3VI4F 2GJ6E 5HHVL 4LPXA 1NMAH 4EUPH 5BV7C 5L2KE 1AGBB 5MI0C 2F5AH 1AGDB 4L8BA 3EOBB 2B5IB 3FT2A 1X5HA 2EIEA 2NY1D 4HF5L 5KBNC 4KZEH 1CGTA 3MRGA 3TF7A 4KWUA 1JGUH 1U41A 1GC1L 3F7YA 5DDHA 5EZIH 2XZAH 1GGUA 4GRMB 3TO4A 4RNRA 5HI5C 3LKRB 1TXKA 4GS7C 1LE5B 4XNQB 1TPXB 4AG4L 4WFED 2HYMA 1A1NB 4KHTL 4MMXC 5I75B 1TZHB 4OJFL 3JTCA 1OSPL 1URLA 1BM3H 3PV6A 2N7AA 2YPLB 4M8QB 5EIVA 5L9DL 4K3EL 3UYRL 3L9RA 4MLSA 4OI9A 2YKLH 5E9DD 1H3VA 5A16B 4KI5C 2KKQA 5MI0B 5ISZA 3MRBB 4H1LB 1A14H 1KB5B 3V5HA 2R8SH 2ZP0T 1KT2B 1S7WA 3QI9C 1F3DH 1T5XB 4NJAL 3VD3A 3FONA 1KB5L 5T1KB 3CFDB 2FHFA 1BQHG 3NIGF 4ZS6D 3OJDB 2YD8A 4ZNEA 4PV8A 1P7KB 1KJ2L 3ILPB 5GRYA 2HJFA 3BPLC 3ZTNH 4K7FA 3CU1A 4XZUB 4HK0A 5E5MA 1BOGB 4Y5YA 1I8IB 5C71A 2IFFH 3OKEA 4WEBH 5C09A 3C6LD 4F7MB 2XKNB 3LQZA 4NT6A 5T3ZD 5K9KB 2V7HB 4PPTA 3F62A 4WUUA 4AL8L 2YMXH 1WCBA 1S7VA 5ANME 1UVQA 3V7MA 1FGNH 5DJZB 3AC0A 4JG0L 2AV7B 4OLWL 4Y5XA 1NGYA 3O4OC 4PP1C 1FO0L 3SCMA 4XCNA 1DQDL 5ESAB 4TNVK 2B8OT 2JB6A 1MREH 4NSKB 3O6KL 2B0SL 4OD2B 3HI6L 5C07B 1U8OA 2E8YA 3ILQD 4ZXBB 3ARVA 3RWGB 1CR9H 5C9JA 2O5YH 4CNIA 4JZOB 4M93C 4NCC1 4XNXL 2NW3A 3QIUB 5IEHB 3LN5B 1AY1L 5DD1L 1OCWL 3IDGA 3NACH 4BZYA 4ENED 5C3TA 3RY6A 3BKCL 4HPOL 3PWPA 1N5YL 3HCVB 4TNWF 4XH2A 2O26U 5FYKH 4I8DA 4X6EB 2GJJA 2IPTH 2XZAL 32C2A 3QWRD 4CDHA 4D94A 1O0VA 4UOW1 4S11A 1T0NB 4P2OB 2APBA 4P2QB 5IVXB 1U92B 4APQA 4Y19D 3O3EB 5H2BB 4ZUWA 3JWDH 3RWDB 3SDAA 3WFDH 5EWIH 1G9NC 4Z9KB 4H8WL 4QHLA 3UYPA 2J8OA 4FMKA 1Z3GL 3V52L 4IRJD 5J6HB 3BE1L 2MFNA 2BJMH 3T4AB 2D7NA 4XP5H 4F15B 2CLVB 1UWEH 3MV01 3O9WC 4FQ2H 3FHAA 2IANE 1V3MA 3MYJA 1JPSL 2H1PH 2WLYA 3LS4L 2DM7A 1VEPA 1RIHL 4MSWA 4MXWH 4F7MA 5L0QC 1ZWIA 5E8DH 1RZJL 4UV7L 1RUAH 4RMWA 3ARFD 4Z7UE 1DJSA 1P4BL 3PGCA 1A7OH 2AJSL 3PHQA 4JN1H 1K8DA 4K23H 4L1HA 3VXUB 3DMMB 1WAAA 3QDJA 2Y23A 1NLBH 3O6FD 1FFQA 1RHFA 5LKNA 4ZFGL 5EOCH 3HNVL 3WO4B 4XP6H 2JKXA 3HI6H 4LSTL 2HT4D 1BP3B 2NTSP 5I19H 1PKQA 4HG4K 5AAMA 2YN3A 1DBKL 1JVKA 1OLLA 3H8NA 1WBZB 1E4XI 5GGVL 3IDGB 5LQBL 5AAWA 4PJ5E 2N4IA 4YDKL 1TETH 2UZIL 4L8CA 4JVPA 5I71B 1VACB 2XZQH 1VADB 1LEGA 3BW9A 2YWYA 3MLWL 4G8GE 3VH8G 1RULL 3PQYD 4LHJB 4YZFE 2BX5A 4XP4H 4WW2F 3CGTA 2F54A 2APXA 3SDCB 4G8GB 1QR1A 2X7LA 1B0GB 5JW3L 3T0AA 4EBQH 2R1YA 4D9RD 3SE4C 5GIRB 1OWWA 3FQXA 1OGTB 1F2QA 1R3HA 5L2KB 1S7TB 3BPNC 5BJTB 3V6OA 3PABB 3PWUB 1R6VA 3QO1B 3U82B 2FX9L 3K80A 5C0AB 3WJLC 1RIVL 1G0DA 2E7BA 2XG4A 4PRDB 3W9DA 3UBXA 2I9LB 5ANMB 5E2UH 5DC0A 5GHWL 4DWHA 4JR9L 2Y07H 1OSZA 5GHWH 5GGRA 3FB7A 1VHPA 1OGAD 1MWAA 1A6WH 1J88A 3S5LG 1HEZB 4IRSB 1NCWH 3BP5B 1SEBA 3B8YA 1I1FA 3QNZA 3UTTA 2MQCA 1IGYA 2V9RA 2J3SA 1MI5D 3A0OA 4E42B 3NIDF 1J86A 4PJHB 2JLLA 4S0UC 2XWBB 3KPQA 4PGEA 3S35X 3S4SG 4GG6F 3WMSA 4FZ8L 3CH1A 2XNAA 3BPNB 3VFOA 4DW2H 3A6CH 1ZEAH 2ZCKH 2EE3A 1I85C 4CKVX 2HAZA 1H3TA 2AXFB 4S2SB 2XFXA 2I07B 1N6VA 1DQQB 3FO2B 4MDIA 1BQLL 1FLTX 4K3DL 4M48H 1MH5A 3SGEH 2QSVA 1UCBH 4Z18A 3OGCA 1WAAE 1JV5A 1YEDA 3JTSB 4Z5RB 4OLYH 5HHPA 5C0DA 1KB9K 3K3QA 3HI1B 1HQRB 3U7YH 1MFEL 1ZSDB 4F37K 2GFBB 4KC3B 5GZNC 3PG2A 4KRPD 3FMGL 1BF8A 2NY2B 4RMSA 3DROA 3IRZA 4OUUB 4MXQD 5J06A 4YHLL 4ODVL 1G1CA 1I9RH 4RFEB 3W5MA 4FP8H 3HB3D 2EXWC 2IBGA 1G7HA 3QP3A 5FCUH 2E5EA 4ZUUA 1T20A 2PW1A 2BVQA 1ADQL 3UTOA 4OLEA 4KMQA 4QRPD 4KKNA 3N1MC 1PKQE 2EKSA 1L6XA 2HT3D 4R3SA 3E2HB 2LV4A 2GHWB 3BD5A 4U6TA 4CAGA 2OXGA 3EAKA 3LEYL 4PFEA 3MRRA 5IJKA 3HNTL 4HWBA 4OLYL 4OLVL 1RJYA 3TA3C 3MRMB 4YK4B 4GKNA 2SEBA 4WCYL 4O4YL 5DJ8B 3RDTA 1ODAA 4DGIH 4MS8D 3HAEH 3STLA 3TFKD 4ZUWB 4IOSD 4F33A 1LK3L 1SM3L 1WZ1H 4AEFA 3WNMA 4X4ME 5D1QA 4XVJL 1NMBL 3BGMA 1AD0B 2JELH 5CLTA 1BAFL 4NUJB 1QOKA 4XB8A 3V79C 2X4PB 3QYCA 5E2WH 5CCKL 4HUWB 5HBBA 3VXRA 5HTSA 2RJMA 5TF1L 2BNRD 2M2DA 3QPQD 3GMMB 3DHMA 5E7FA 2JJTC 1AGFA 4KROD 1XF4B 1E6JH 4KY1L 5I1KH 3S37L 4LAQH 1FFPA 2W59A 3VXOA 5I66A 1FCGA 1C08B 1OM3H 4PRPA 1VEOA 2X4QA 3SGEI 4YDLB 2PN5A 4OGXL 5HHOD 4RGNB 3DYPA 3WKMH 3L7EA 1FNHA 4X8XA 4LHUA 3H42L 2YPKA 1T1YA 4PY7A 4GJTB 4DKEH 3OQ3B 1GC1H 3QQNA 5BXFA 1INDH 3TBVB 2DM4A 1K6QH 1UGNA 1F3JA 1Q9OB 1RURH 1S3KL 2IH1A 1E28B 1S7QB 1FBIL 4OLXL 1QO3A 2G75B 2FHCA 1VESA 1F13A 4K7FB 5DRNB 3LKOB 3HZKB 3MCLH 4PG2A 3C5SA 3WFHA 3PWJB 3EGSB 4M43L 5KTEL 4OAWB 3TVMC 2DD8L 4JFDD 3EYSL 4YLQT 4PJFE 4OI8A 4PJ9C 2D03H 3UTZB 4CW1A 2ZCLL 4DEPB 1PY4A 2VE6A 1MVUA 2NY4D 3MC0A 4NQDA 2X1WL 1QBML 3BH8A 4YHMH 3UTTD 4BA8A 1AQKH 1W72B 1MFCL 2D7OA 3DX9A 3D48R 3O4OB 1XIWA 3HTLX 2P5EE 5BVPL 4H8WC 1I7UB 1NAKL 2ITCB 5I1KL 5IB2B 2F58H 2W0FB 5DA0B 1U8JB 2ZG3A 3IFNL 3HMXA 5C0CD 1VEMA 4V1DD 5JR1L 5EU4B 2BNQD 3EJYD 2DL9A 3GNML 4GKSB 4HZLA 2R39A 4KV5E 3AMKA 4OBRA 5DHXB 1J0IA 3B8SA 1SEQL 3X17A 4PDCE 2HJKB 3ROOA 3K8MA 1MWAH 1CD8A 3HUJB 5INCB 1HKFA 5TE4L 3RWEB 2HN7B 4ZO8A 1MFAL 4L4VE 3TWCL 5IQ9A 1KLUB 5KVFL 5J12C 4Y16C 3QI9B 2ZJSL 2EEAA 3RI5F 1F6FB 1YQVH 2GTZA 3PIQB 1H8NA 2VXVL 1JPST 4UT6H 3T0XA 5HDQH 3GHEL 4J1UA 2Q8AH 3WD5L 1F45A 4OZIB 1N26A 1FZKB 1X6NA 1JL8A 3LKSA 1AO7D 1NAKH 3SKJH 3TBTB 1HH9B 1UB5A 3C09C 4WDIB 5K9OA 3F7QA 1PSKH 4WWKA 3MJ8B 4RFOL 5LGHH 2EDBA 4M62L 4Y4KB 4OGAC 4LSRL 4LCWA 2KL6A 2BOCB 1JMZA 4TUJA 1U6AL 1YEJL 4BUHA 1SVZA 5CMAB 1J0ZA 1R3JA 3SEPA 3LY6A 1N64H 3NZHH 1BIHA 4YIQA 1GIGL 4JLRB 1FFRA 4M6OL 2P5WB 3EYFB 3NPSC 1UB6A 3O81A 3U46B 5I1LB 3VWJB 1BMGA 5I8CB 4B0MM 1X7QA 1EBAA 2FB4H 5FO9B 4OI7A 4QHNB 5IFAL 4UINH 3ARFA 1CL7I 1HEZA 2DM3A 2JIXB 5HYQA 1ROWA 3VU2A 2QADB 4OV6F 5IM7B 2E6JA 4WIQA 5DMKB 3RJQB 3PL6B 3VGAC 1GZQB 1CXIA 5DMGD 3DXAB 3QXAB 1XMWA 4PRNA 3G04B 3BZDA 4GW5B 2ESVB 1P7KA 3ILPA 4XPGL 1EO5A 1X5IA 2KQNA 2CUHA 3ZKQD 2ICWI 4MNQB 2W07A 2Y1VA 3IFOB 4NZDA 4YR6B 2V2TB 4L29B 1WSST 3UYRH 5SX5H 2K3TA 1U3YA 4NKOA 1IKNA 1I1RA 1MOEA 2Q76A 4X6CF 3LB6D 2GSIB 2YD4A 1XGQA 4GAGL 3CD4A 2CKNA 4NYLB 3LQAC 1T5WB 4J3OC 4NQCE 4DTGH 1BLNB 2EIZB 3A6OA 2WP3O 4OCXH 3HC3H 5IHUL 1YEHH 5FUOL 3D1MC 2VXQL 2E9WA 3VJ6B 4AK1A 3AY4A 6FABL 3C5ZD 2A6IB 4N0UE 3BIAX 3DX7B 1JPSH 2YRZA 2W1NA 4LLAA 3BKCH 1NBYB 3D6GA 2W9EL 4J3WA 5GS2D 1H3XA 2ITCA 4LRNH 3TJHD 1EA9C 1WBZA 2CLZA 2HTKD 4W70A 2QR0A 3MJ9A 2OL3B 4Q9QH 5EC1A 1G0XA 3CLFH 4XNUL 3GMNA 3GSRB 5MHSE 4R6UA 4LVHB 1T03H 1FN4B 3QDGE 3MMEA 3LQZB 4ZS7H 3T08A 4OZGA 5E6ID 5ENWA 4KVCH 2UYLB 3KYOB 4RX4A 1ZLWK 4J4PC 3NFPA 4I5BB 2X4OB 4M9PA 4KJQC 5KS9E 3L3JA 1BFTA 3TBYA 3O3EA 2WWKO 4M7ZC 4ZNCD 1FFNA 3AFLA 3QUXA 2QSCH 2R1XB 3MLTA 4WV1C 5D2NA 1KUMA 1IT9L 1XCQA 5MERA 4NDMB 4I0PD 2DKSA 1TETL 2YPKB 4HUKB 4YDJA 3U0PB 4UIMB 3DUUA 5A40E 3T4AA 4JFPB 1FNLA 4Z5RA 2IPUG 3MRGB 4L4JA 2FIRT 4XPGH 5T1MA 5FF6A 4HG4J 1KYOK 3RL1A 5BS0D 5JO5B 5I1DA 1E4KA 1T03L 1LE5A 5IT2H 4ALAH 3MX0A 3BH9A 2XV6B 2YUVA 3C2AH 4M7LL 1S5IH 2V2XB 3SQBA 4X6DE 1A0QH 1PG7L 2VC2H 3JVGC 4DVBB 1L7TL 2YRLA 3RL2B 3UTPD 3STZB 2QTEA 4UDUA 3T77A 2BHZA 3W81A 6FABH 3GEWB 3TT3L 4P9HH 3ARZA 3W39B 2AJXH 1Z9SA 2CPCA 5DI8B 3UZQA 3M8OL 5CHNB 1T1ZB 2VDKL 4FXKB 4M6MH 3G04A 3SGDH 1LK2A 2NR6C 5EC1B 3FOMA 1Y6NR 1IAIM 3BPCA 3EOTH 3GRWH 4D9QD 3V6OC 3FTGB 3VFMA 1SBSH 3MLZL 3FQXB 4LEXL 3MZTA 3VI4E 3MRNB 4NBYB 1RZJC 1CTOA 5HPMA 1A6PA 4ZFOA 3EHBC 3ECBA 4HUXA 4WEMB 1T3FA 2UWEA 3WFDL 1NAMH 4C4KT 3INUL 5HY9B 3O45B 4WI9A 5I74C 4Y4FD 2KPNA 1WCQA 5DS8B 1G7JB 3ZE1E 3OKOB 1IVLA 1QFWH 3RX8A 1AP2A 1FFPB 1JWSA 3WDIA 2WV3A 3H2WA 3BN9D 1A21A 2P45B 3D3VE 1TCRB 1BD2E 2AK4E 4J6RH 5J0BA 5D7JA 1OGAB 2P4AB 3FB8A 1MHEA 4I9WD 4X5XB 1D5BA 3DVFA 2FRGP 4G3YL 1T22B 2NY0C 4EZMA 3P4OA 3QUZB 2F8XC 1MQ8A 2RIKA 4Z7VB 2FBJL 2LFGA 3U2SA 3C8HA 1HQ4B 4G6ML 3PQYA 4NO5A 1H5BC 5DRXA 5BRZB 3OGOE 3BAEL 3BP6B 3UTQB 4YEEA 1QKZL 5I76B 2ZNXA 2Y6SC 2VZTA 2H26A 4XHJD 4Z7UA 1KENL 1H3UA 5FYKE 2NY7L 1EGJH 3HZYA 2YHGA 4JO3L 3HNVH 3A67H 4X80H 3WS3B 2OZ4H 5IQ9B 1S5HB 1UWXH 5J1SC 5AEAA 4TVPE 4YE4H 3MV9A 5I16B 4R4FH 2ZPKH 1VFAB 2R1XA 2I60H 3UBXI 3V0WH 4UT7L 3PWNA 1DUZB 3TF7C 4IOIA 3OJ2C 3HE7B 2WIIA 2Z91A 5CCKH 2VABB 3RTQC 3SBWA 3VD4A 4HSQA 5D6DC 1TNNA 1FIGH 3VXUE 1K9TA 5J57B 2WLZA 4HDIB 3FN9A 4MCYB 5JHDD 4HCRL 3BVNB 4LCUB 4PB9L 3ULSA 3LVEA 3BUYB 5TDNB 2GY7B 1A4KB 4NRYA 4YXHH 5BOPA 1ZT1B 4HK0B 5E7BA 4U1SB 4ODHH 5CZVH 2D7QA 3LKPB 3WKML 5GISL 4X98A 5C6TL 3DSFL 2W0LA 4K71B 4XHJC 5LAXA 2A83B 3QI9A 1AO7E 5DGRA 4LKXB 3CH8A 3U0WL 1JWSB 3PWPE 1HOCA 1QBLL 1ZLVH 3TNNB 2OJEB 4XBGB 1TCMA 4JY5H 3CDGB 1AKJD 2YA0A 4Y2DB 4Z0BL 2X4TA 2JTDA 3V4PH 1YPZE 4UAOB 4GW4B 2VDOL 5J13C 4EQ2A 1FLRH 5IEHA 1RUKL 4X7TB 2V7NB 1IGJA 3VXRE 3UTQA 1A1OA 3U48A 3V6FA 4POUB 4PJBA 4ZOEA 2A6JB 4J3XA 4L29A 2AVGA 5DMIL 3VE0A 3KPTA 4WI5A 3OKLB 4K55A 4V1DE 2BK8A 2UWEB 3ULUF 3EHBD 1N7MH 4G7YH 2M8XA 2XTLA 3QXTA 35C8H 3MLYH 2QADC 2IBZX 5F9DC 5JXAH 1IGMH 1XGRA 1IGML 3O4LA 2Y5TA 4JO1H 1MH5B 5GSRB 2F9BT 5K93A 5E8NA 5T5NF 2I24N 1NBVH 2DB8A 1DLHB 5C9JB 4YHNB 4KY1H 4PTUA 4DEPC 4ZXBA 3QXAA 3D18A 1SY6L 1I1AA 4Z8FH 3AMLA 4LCWD 4XCYB 3OHXB 4J2XA 2YXFA 2VIRB 1QLRB 4OD1H 4V3EB 1EAPB 4RGOL 3NFNB 4AT6B 4UV4H 3BUYA 5TDNA 3DV4A 5KSAD 3ARGB 4WVRA 4LDLB 3RAJL 1V8HA 4MSWB 5JW4M 1FNSH 3MRDB 1JIBA 1RUKH 1RURL 1S3KH 1ZLWH 2VJXA 1GH7A 5C0AD 4OTXH 1JTPA 4QHUB 4HLJA 1N3NA 1FYTD 3IJYA 1QP1A 4LKXA 2Y7QB 2MOVA 3H0TA 4GBXC 1CLZL 3HE7C 3BKJH 3RNKB 4YC2B 2YRPA 3ZDYE 1F02I 2HG5B 1G9MH 4FQ1L 5IHZB 4LFHG 2C4FU 2X1OA 4PJCE 4U6XA 5LXGH 1A7BA 1MI5B 5HYSG 1ZMYA 4FZEH 2WW8A 4JFHE 2WINB 3QDJE 2VXVH 2ADFH 4OZ4B 1OAQL 1T66C 1U8JA 1T6VN 4C56B 3MV9D 1VKXA 2DWEB 4KH2A 1LE9A 3VD9A 2WM0A 1JJUA 3WHXA 4ISVA 4HC1A 2R29L 5TGBA 4JQIH 4AT6A 4LLQB 4FQPA 3GSNL 5DFVD 3SKMB 3DX6A 5BZDB 2VSDA 2KH2B 3ZDZF 5E94B 1EFXD 4UOW0 5ADPH 1EPFA 3SE3C 4HC1L 5H8DA 5F1IA 2ICWB 4GFTB 4N8CL 2EE9A 2IFFL 4WEBL 1IGTB 4K8RD 4MWFA 4HHAB 1U93B 5IW1B 4PYHA 1VGKB 4DCQB 5IB4B 1NSNL 4L3AA 4F15C 1IQDB 1CFSB 2FLRT 2R23B 4WWKC 1V7NH 2R1WA 2AABH 5E0QA 3QXVA 3MR9B 3HC4H 4XCCH 5EO0B 3VXTB 2WMPA 5L8LB 3QG6A 1CL7H 1DQDH 4N0CC 4EN3D 3OKNA 1KPUA 4HPYH 5JW5A 2R8SL 1LILA 1GZPA 2Q6WA 4JDZA 4GRLD 3L95A 4GAJH 4MAYB 1ZKAA 1KCGC 3MRCA 5TQ2H 2VWEE 1AXSB 4WY7H 5DJ2A 3VH8B 4N5UA 3QNYA 4JKKA 1LEIB 1K4DB 3EKCA 4IRSA 2DQIL 5I73C 2I9TA 2BSSA 4MD4B 2VQTA 4LSVL 1BJ1J 1N3NB 3P0GB 5KAQG 4R8WL 5HYJD 3C60A 3CSBA 3QRGL 2W91A 5EU7C 1N64L 3NZHL 5T1DL 4LVEA 1RZJH 4UV7H 2LU7A 1BFSA 1N0LA 5JQ6L 5DA4A 2D31A 4OCWH 1REIA 2WBJC 3EYUH 1AD0A 1EHNA 4ZPTB 1JNNL 2DLIA 1AR1D 3LEVH 4JVUA 3T3PE 3QAZC 4PJ5A 1LVEA 4NFCA 1F58H 4U3HA 3TM6A 4KVNL 1ZA3B 1P69B 1VKXB 3KPSE 4LQ1A 3OKNB 1FJ1B 1P84J 1RSFA 1PZUB 4LP4A 1ZHLB 4N0CD 2X1QA 5HGDB 4HDIA 3ZSTA 1IKNC 4ONHA 5FKAA 1YQVL 4ZFZA 1XGYH 1JE6A 2DQCH 4XAWH 5C0RL 4HIXH 5DQJA 1I4FA 4D0DA 4EXKA 1NCBL 4GAJL 4FNLH 1ACZA 5LAXB 4YUEL 2EDKA 4JRYE 4ZNEE 5HHXH 2X10A 5GRUH 4RGNE 1J1OL 1CFVL 2Z92A 1B2WL 1FZOB 3GMOA 1T83A 4WUUD 3T4YB 3U6RA 3OB0K 1F6LL 3T0EE 1BQHA 1YPZB 3IAGC 2HJKA 1S8DB 4X5WA 5F7YC 4OCRL 3BKML 3QXDA 4EDWH 5HDLA 5D7LD 3O6KH 2YWZA 1UKQA 4ZTOL 4NKMA 1JGVL 2AV1A 4YXKL 1T2QH 3RIFK 2BVYA 3HMWL 1VDGA 5GGTL 43CAB 1YEIH 5I19L 1J7VR 1P7QD 3CFJB 4Y89A 1U8HB 2VZVA 4WNQB 4JJ5B 5I1HL 3F12B 1HZHL 2X4UB 4RAUB 4G6JL 5FGBA 1HH9A 5IMLB 1UYWL 1CK0H 2GT9A 4L4VB 5D2LB 4RFEA 3MRFA 5FECA 2C3HA 2YUZA 3B9KA 1WV7T 2Q3AA 3WUWA 3Q0HA 2Z8RA 4XPBH 2DLTA 4ETYA 2Y6SD 5CGMA 1XZ0A 1ZOXA 1WFOA 1FZJA 1A0QL 3HMXH 5BV7H 5IFHH 1U3HD 1VPOH 1ZA3A 4ZFOB 3FT2B 5I8OH 4CVWA 1EUTA 1Y18A 3CPLB 4U6HA 1KJMB 5C2BL 3QDHA 4KJWC 4P4KC 4JQXA 1AD9B 2NY1C 1YEHL 4OFYA 3F6IA 4X6DF 2DQJH 4NZJA 3LKRA 3OKMB 4POYA 3GUTB 4HIXL 2WIMA 3SJVE 3MNWA 3R1GH 5DQJB 2DQIH 4X6BB 2CKBL 5KS9B 1G9NL 3GJFB 3WXWL 1GVIA 1RMFH 2EDOA 3P0YL 1YNTA 5MEOB 2ZNWA 4PJFF 2BRRL 3RIFF 2XZQL 4JM2A 3EJZD 2AXHA 4OF7A 3STZA 3FL7A 2BP3A 4QKXB 4NO0A 4RMTA 3WEXA 1UM4H 1ND0B 4TUKL 4NQTA 2OZ4L 3KJ6H 1OY3B 4MXVE 4RMUA 5SX5K 4U1MB 1ZA6A 2UUDH 4W81A 3BJ91 4NRXA 2JK5B 3D3VB 1B6DA 2PO6C 2RCSL 3W9DB 1DN0A 3VCLB 5L7XL 1FNEA 1ORQB 3NIDE 3TA3B 1U92A 3NTCL 4APQB 5IQ7H 5B38A 1WBXA 4KJQD 3T0ED 4Q6IA 2IQAA 1PY9A 2DBLL 3V6ZB 1RD6A 1RK0B 1SHMA 5HGHB 5MEND 4G6FB 4KKBC 4JFXA 3EOTL 3GRWL 4U6VL 4JGMA 4Y2DA 4AM0B 3VWKC 2OX5A 5HY9A 2DDQH 4G8FB 3HZVA 5JNYB 1NH6A 3HE6B 1CLOH 4AQOA 1DQJB 1FL5B 1PQZB 2FATL 1MCLA 3TVMA 4IRJA 2QADD 3A6BL 4WCYH 4PJ9A 1CICD 1FNFA 5DJYA 1IEBA 2UVFA 2Z35B 3S37X 4PP2A 3CSPA 3E2HA 5E8EB 5E2UL 2VXSH 2DQUL 3PHQB 1INEH 3CPLA 2OR9L 1KB9J 1F11A 1IRAY 3RVWD 3RPKA 1XGPB 3WBDA 1J9CT 3MLTB 1IGFL 3DMMC 4JKLA 4GMTH 1XCQB 4O5LL 3BDYL 1Q72L 1XR8A 2D0FA 4QHUA 1U95B 1QKZH 1ZT4A 5IB5B 3VRJA 1O5DT 2HWZH 4QT5B 5SWQB 2PTUA 4IM8A 1FL3A 5IBLC 2VDLL 1JHTA 4LPVA 3ARPA 4OB5H 3OXSB 4OLUH 1WWAX 1IGIH 4UAOC 1A4JA 3L3KA 4NO0B 5D7KE 5DJ8A 3CFBB 5ACLA 4NN6B 1QHOA 4PLKC 1I9RL 3MMEB 3WFZA 1NUGA 1OP9A 5F96L 2D2OA 1BAFH 4U1JB 5IMMB 2AJVL 1LK3H 1SM3H 4JCLA 2R69L 1KGCD 1KJ2A 3IFPB 4N0FB 3LN4A 5E1AA 1T1XA 2ICEB 4QRPA 3NMEA 4G5ZH 3VRLF 3RA7H 5GS1B 1P4IH 1NMAL 5KZCB 4KTEL 4WU5A 5GGQH 5BCAA 3OAYK 4WUKH 3QIWC 3KYKH 2PETA 3QJHA 4IHOA 3P11L 2MPAH 2VZSA 4Q6IC 2VNCA 2YSSB 5FA3A 2D0HA 3S5LA 1OARL 2W0KA 1N2RA 4PJDB 1FBIH 4M00A 5SX4I 2JJWA 2ZG2A 1T0MA 4F9LC 4I77H 4P48A 5D6CA 5F9JA 3C6SB 2R56L 3RWIB 3NFSL 1N4XL 2E7LC 4IMKC 4Z0BH 3D0VA 5GRZA 1HHIA 2AABL 5IW3A 3V0WL 4LL9A 1UFUA 3IFLH 3KDMB 4G9FA 2VDRL 1A6ZB 1E6JL 2EC9T 4YE4L 5GGRY 4KKBD 4Y16D 1TCRA 2IQAB 1DFBH 5J1AA 3AM8A 4GQ9H 4QEGA 1HIML 4HGWB 1U9KA 4PRPB 3UYOD 4O5LH 5EN2B 4MAUL 2BC4B 4PRID 5CAYB 3FJTA 1FZMB 3BD3A 1S9VB 4CNIB 4D8PB 4Z7VE 4B5EA 3T0WA 2PTTB 1AQKL 2GITB 1EVUA 4L5FH 1MCRA 4DFIA 2XIDA 1D5XA 3MUGB 5IMKB 4J8RA 2XICA 1S7UB 3NCEB 4ZD3H 2XKSA 4ZXBC 4D0BA 4LCUA 3ULSB 4Q6YA 1FN4A 4NQXB 4P5TD 4HXAL 2X70A 5TDOB 1E4WL 1JNHA 4XXCA 3MOAH 2A0LD 5F9AC 1QRND 4YXLL 1JN6A 4PJCB 5ISZE 4R2GB 1P84K 3TWCH 5DO2D 4JE4B 2CR6A 4P3DA 5E00A 3IRPX 3MLUH 4GG8B 4F7TB 1FYTA 5I1JL 4U1NA 4KJYA 3VFRA 5C0BD 3D0LA 2G9HB 3FB5A 5EPMB 3I3EA 1M71B 4NC1C 1U8QB 1OP5H 5EOTB 5C70A 2VH5L 4P59H 3EFFA 3QIUD 1Q0YL 2CO7B 3O2WL 3HE7A 4LPTA 3VRJB 5JLZB 2ZOKA 4U33A 4Y4FB 3GMRB 4ODXB 1GAFL 4YPGB 1UG9A 5AZEH 2A6DB 1H8SA 2X7LB 3QIWA 4Y5VB 2WQRA 2IGFH 5I76A 4DK3A 2A6KB 1AQDA 3GB7B 3TN0A 4NFBA 43C9B 1GGBH 2VTFA 4W4OA 5CD5C 5GS0D 4N8CH 1RZFL 3F7YB 3QUZD 3VXRD 1OTUD 5KN5B 2DWDB 5JQHC 4Y19B 1LEGB 3BW9B 4CN4A 2R0WH 3TZVD 1DL7H 1VFBB 1NANI 3PF2A 5D1ZB 5TE4H 3MV9B 5ITBL 3CNKA 5I75C 1WTLA 4DVBA 2OMNA 5JA9A 1JPFB 2YPLD 4JQVC 1ZT7B 2OSLA 7FABH 1X5GA 2VISB 3O6FC 1XIWB 4PS4H 1CT8B 1OB1A 4WUKL 5TF0A 4HWZB 1A47A 3JXAA 5HGAB 3RVTC 4MJ6A 3DBXB 2FEEI 3HR5B 3MNVA 4LAQL 4KKAD 5F9WB 3ELAT 4P3CH 4MNHA 1ETZB 3PXJA 1EAPA 5EULV 15C8H 4QRTA 3JV5A 4NHUA 5T3ZH 1J0HA 1JHLL 1ZTXH 4ZFZB 2P44B 4HC1H 1QNZL 1Y0LB 1Y6KR 4LPUA 2PF6A 4HJGA 2CJUL 1H5BB 3ULUC 4AEIH 3NCJL 4PP2B 3T3MF 1DANU 2YMXL 4XXDA 3DMMD 3E1F1 5E99L 5DVNA 4V1DA 1NCBH 1A5FH 1T7ZA 2JK5A 3D3VA 3KPRB 1I1YA 3RI5K 3GI8L 1QSFB 5JHDB 1RZFH 2MHAA 1XGUA 2IAMD 2HJLB 4MA3B 1PX3A 1UH3A 4WHDA 2V2WB 4LVOC 3P77B 2H32B 2AKRB 4OGZA 2AI0H 3RZWA 1KGCE 5E8NB 2IEPA 1N5AA 3MRMA 1P2CA 5CHNA 5IIEB 4KK9C 1OPGH 1UXWB 3RPIB 3QFDA 3K74B 5I6XB 3AVEA 5EUOA 4H88H 4OLZL 2R0LL 4LSRH 1A9BA 5F88B 2A6KA 1U91A 5DD0H 2R0KH 3K1KC 5TE7L 3DV6B 4TTGA 4GRWE 1AD9A 1I8MB 1YA5A 5E6ZA 3M07A 4POZC 5CINH 5BZDA 4U1GB 3IDIA 5T1DH 1ZA6B 2AK1H 4PJGF 1WAAF 1DCLA 3MJ6A 2B2XH 2X4RB 1OAZH 1WCBB 1J1OH 1PD6A 2A0LC 1W0WA 1BEYL 3NGBB 1DDHA 3H3KA 3FRPA 1QEWA 1CICA 2A9ML 1YEGL 1DBJH 1IM3B 2PYED 5JW3H 1KCRL 1S5IL 2RAMA 5GPRA 4PRIA 3G08B 5GGSA 3WFEH 4PTTB 3DGGA 1U8OB 5GGTH 1KEMH 5EBLB 4WW2B 5D71L 4R4ND 5I8OL 5BVJB 3QIWB 4Y5VA 5FM5O 4FXGB 5DJCB 5L2JB 3PHOB 4MNGB 1F4XH 1ZSDA 4UQ3B 1TJIH 3F5WA 2XQBH 1J8KA 5IGXL 2B1AL 1D5ZA 5FO8B 2YBRB 4WUUB 3QG7H 2DICA 3BWAA 3QXDB 3L3DB 3RUGF 4M6NL 3NA4A 1KJVA 4WDIA 4NQCA 4R7NA 1OAYL 1TVBB 2Y9RT 2ZSVA 4OLWH 1UJ3A 4M7JL 2H2PD 4YBQD 2APWA 3GJEB 4NP4L 4M7JH 5CWSB 1HHGB 3VDCA 2J6EA 3O3DA 1DANT 1FO0A 2C26A 1PQZA 5DZOA 3ULUH 1BQLH 3UTPE 4P4RA 2X9WA 1VA9A 3HMWH 3F65A 3QIBB 4KFZC 1E4XL 1OAUH 3VGGA 5E2TH 2XKUA 1XT5A 5JW4R 1D9KB 5TQ2L 2DWEA 2ICWJ 4L8BB 5KVDL 5EBLA 1CBVL 5L0QB 2ZKHH 5EUOB 3FO1B 5L7XH 4KRPB 1DEEA 1EGJA 3HCVA 1C8PA 4NKIL 4ONHB 5FKAB 5D1XA 2PO6B 3LD8B 4MJIB 5F71A 1ZTXL 3HZKA 4JY4A 3WNLA 3VXOB 5I66B 4M6ML 1K85A 3BEWA 1OP5K 1DEDA 2BDNH 2DIBA 4LPCA 1WFUA 1UM4L 5JHDA 1Z3GH 2NW2A 3GSVB 5K9JH 3ZYIA 4M61A 5ESQA 2OQJB 3GO1H 4QRPB 4Q9RL 4V2BA 3TCXA 1YEGH 3BZFA 1QBBA 5HVGB 1Q1JL 2ITDA 1NFKA 4X6DB 4JB9H 3U4EB 1CGWA 5IW6B 4UTAL 4ZSOB 1BZ7A 3ME0A 4M1CD 4OZFH 2FYYB 5J3HC 3QEGL 2IADB 3UBXB 2FX8L 3HLAA 1T2JA 4GOSA 1LNUB 1JGVH 1WTGT 4TULH 4U7SA 1TTUA 3P0YH 1U0QA 3QNYB 2DQHH 4PJHE 1E4JA 4QYOA 2PXYD 3RWIA 5C08B 3V5KA 1MQKL 4PGJA 1XR8B 3D85A 3VGHA 5EOCL 2WNGA 2GW5A 1GHFL 3SE4A 1ITBB 3ZE0F 4H1LA 1PFCA 3M1BA 1HH6A 3MRLB 4Z7OF 1MJ7L 2BNUB 2VL5B 4I2XB 1U8KA 3IETB 4RDQG 1RJZB 1VFAA 1K8IB 4P4KB 5D5MA 4QCIA 1IM9D 5FHBH 4NQCD 1JI2A 4KROB 4IRJC 3AB0C 1UCTA 5JXEA 5INDA 4IBLT 2J88L 4WUUE 2DQDL 5FUZH 3SQOH 5E1AB 2X89A 2Q3ZA 3PP3H 1F00I 1RK1B 3L3JB 1TPXC 5FYJH 3MGAA 4HIHB 4TSAH 2UZIH 1F6AA 1TJIL 2VDLH 4N1HB 2D9CA 4QTHA 5HYJE 2YUWA 1UZ8A 4JFFB 1I85A 1RZIB 2NY2D 1KENH 4PJCF 2RQ8A 1H8OA 4GXVH 1CXEA 3SE8H 3ABZA 5SWSA 1R3IL 5FAAA 3OR6B 1HHGA 5IV2A 2EYRA 4MWFB 2Z92B 4KUCD 1KCSL 5DQDL 4P46D 3GSNB 5HYSB 2DQUH 3FB8B 1AH1A 1G7IB 4JDVB 3BP7A 2D4DA 4JFDB 2BMKA 4XRCA 2P1YA 3MNZB 2AJXL 5E8OB 5EZJB 3IFLL 2A1WH 3WNNA 1NBYA 4TRPH 1PZ5A 5E2WL 1IQWL 1T4KB 1AR2A 3GGWA 3V6BR 5EBGA 3RZCB 3JV0A 5HHPB 1H15B 1ORQA 2O5XL 1UENA 1DSFL 3RL2A 2CUIA 1NANH 4YGVA 4NRYB 2HP4A 1UH4A 4TUOB 3BWUC 2JJTA 3HG1D 2PW2B 2KZWA 4HWNA 4S1DC 1PYWA 4X6BA 1RJYB 2YD3A 3TYGH 1O7VA 2G2RB 4V1DB 4HLZH 4WI8A 4X9BA 1GSMA 1RZ7H 4KQ4L 1GGIH 4LMQI 5E9DA 5DMYA 3MROB 5IHLB 1NKRA 1T1ZA 3MA7B 3ZT5A 3QEQB 4R0LB 5DQ9A 2VXUH 3U30C 4GW5A 1H0DA 3L3IB 4YO0B 4N0CA 5ID1A 4OCSH 5CIPH 3BMVA 5I1AA 5DWUH 5C0JA 3JUZA 5D96B 3REWB 4DUWA 4KMTH 1FV1B 4L4VD 2GJ6D 5FHBL 3ARYA 3QI9D 4HUWA 5C0DB 1HYSC 3C5JB 5EORH 5IJKC 3LN5A 4RISH 5I18L 2VDPH 4Z77B 1DP0A 4AMKL 3TPUB 1H3WM 3NFNA 4H5SB 2L7UA 1NBQA 3MV8D 3MRCB 1BD2A 2AK4A 5FHAL 5SWZA 1J1PL 3CFIC 4BK4A 2P7TB 4RWYL 1IQWH 2WWMC 3MRKB 5T1LA 3KYOA 3RDTC 4Y4KD 4J3SA 1TQBC 1P6AB 1I8KA 2FJGB 5D7SL 4P2OA 4GSDL 3OKYA 3KR3L 3AM8C 3HRPA 4KAQL 3N0PB 4PRNB 2VUOA 2BOCA 2HFEA 4MVBD 3VFSB 2C3VA 1SJHB 1YEJH 3ULVH 4O2EB 5F89A 5F9WC 4YHYC 1IGCH 2VB5A 2YA2A 5J13B 1KCUH 1KJ3L 2VLKB 1ZV5A 2JELL 3E6FB 4M02A 2H2SC 5C0BE 1A6AA 1BFVH 2NY6C 4X8JA 5SWSE 4X4MA 3CMGA 3RX5A 1FLRL 1FPTL 1UH2A 1D5MA 2Q8AL 1HE7A 3PHSA 2OZ4A 4NKMB 3O3AB 1IAOA 1BFOB 1WK0A 4PJIF 3IKKA 1A4KA 1EEZB 5FHAH 5TGBB 5A2LH 2H9GB 2X4UA 1KIRA 1MEXL 5HYEA 3QUMH 5DUPH 4WNQA 5I18H 5DJ0A 5BMFH 1JZ3A 3QNZB 3UTTB 3C5ZC 3B83A 1ZHBA 3VXUA 2CLZB 1YN6B 2N7BA 5LWYH 4DN3L 1CGXA 4PG2C 4GQPH 3BD4A 4QOKE 5CBAA 3DV6A 3V2AR 1J05B 2WZPD 1VFUA 3TGXA 4KXZI 2F19H 5AUMB 4NNYA 3U36A 4ZMAT 5LGJA 3PWUA 5LXGL 4DKFL 1NGWB 3HE6D 1G1YA 3D2UD 3GIVB 5HJ3B 2BNRE 4DKAA 4P57B 3IJHA 5F9OH 1B4JH 4LNRB 2VO5A 1BLNA 4W4OC 1CDUA 3P9MA 4LSPH 4TSBH 4JDTL 4X7EC 3H7BA 3FT3A 1DQTA 4FRWA 5CP7B 2MKWA 2YEZB 5E2VH 1K6QL 1FPTH 2E6PA 3DVNB 5E2VL 4R7DA 4HEPG 3ES6B 2OM5A 4C58B 3DX9B 3FHQA 1CGVA 5FYKL 1LO3L 1GGBL 5D1ZD 4M1CC 2VN4A 2AEIT 4JHBA 4BQ8A 4FXKA 1A9BB 1NFDF 3IS1X 5GS2H 3OJMB 4QOKB 5JPMB 4XWGH 5EO9A 4OLXH 1LP9A 5D7JB 5FFLA 1CD1B 4D0BB 2AEQH 3MBXH 3FOLB 5JPNB 1L6ZA 3CVHA 4PGBB 5I0ZA 3R06A 4ZXBD 5IF0A 4HKZB 1ND0A 2BXZA 1NCDL 3F7VB 3MNVB 5DYOA 2ZUYA 1LGVA 2QEJA 1XF2B 2IF7A 4JFYB 5BRZA 3MFFA 4KGLA 5JOFA 3NVQA 3SE9L 3MLUL 4K2UH 4LVNC 5HD8D 1OTTC 1R3KA 5GS0H 2NNAB 3KPSA 3MBED 5DD6A 5I6XC 5GGSB 5DHYB 1CS6A 3H3PH 1CVSC 5DI8A 1UWXK 3V7AE 3AY4C 4F37F 2AV7A 2BCKB 4QWWD 1R5IB 2VLLB 4J23A 4HHAA 4G6JH 3TC9A 4QRSB 4HLZG 2ZOLB 5D1ZC 1P9MC 2QQNH 2XI9A 5GRXG 3BDBA 1F2XK 5CLWA 3IFOA 3L1OL 5IT2L 1D6VL 4IOFD 3SO3C 1LO2H 5I30L 3BGMB 1X5JA 2V2XA 3S9DB 3RQ3A 1FGVL 3QIUA 4P57A 2KZ1B 4LLYB 4D0CA 1K2DB 5KW9L 1YY9D 4GMSL 4RX4D 2Z8SA 4ISVB 4LLUB 3L95B 1T66D 3GMMA 2ZSVB 1JTOA 3FN0H 2FL5A 3FB5B 2JIXA 5HYQB 3SKUD 3ARFB 2NX5A 1RAMA 4I48B 2AKRA 4E41E 1X5KA 2CKBH 4BKLA 4Z7NE 4GG6A 2MCG1 3X11A 3ZTNL 5DK0B 4YHKH 3PGCB 1CDGA 3DXAA 4U4BA 1OAXL 3MXVH 4BZ1H 3O0RL 3RGHA 2J5LB 2GT9B 1HOCB 1T0PB 2ID5A 1LE9B 4NQEB 2YD1A 2HMID 2A77H 2R4RH 3E2HC 1I75A 3RWCA 5DHVA 4K8RC 3IU4H 5L8KB 2BY2A 3DUHA 3SDXA 4R3SB 2NPLX 3P4NB 3D5OF 4Q9RH 3DPBA 4XWOC 5ADOH 3QPXH 2P46B 4DJMA 4JFEA 4JPIB 1EUUA 4KRMB 1QFUL 4M48L 4I9WE 1WQVT 5DC4B 3CK0L 4XCEB 3X13A 1NGYB 2P8PB 4O00A 5KSBF 2HA1A 4BYHA 1AGCB 1U8MA 1EFXA 4BH7A 3OAZK 1MSPA 1NBZB 4O02L 2H6PA 1F3DJ 2ARJQ 5KSBB 1RHHA 3DECA 1ZT4B 5MP6H 5IB5A 5DD3L 4I48A 1MCNA 1N59A 4HIJA 3QWRA 3T09A 3WFCL 4WW2A 5BXFB 4G8GD 1I3GH 2HKHH 4LCYA 5C1MB 2ED9A 4N1CA 1G7QA 3MYJB 3DI2B 2HFEB 2MNUA 2BZDA 3VFSA 3SJVD 3WJJC 2LTQC 3WEXB 1A7OL 1HXYB 2DWDA 3K2UL 3CLEL 2YR3A 1A6UL 4R26H 5EH1A 5ADOL 1I9JL 2FX9H 4HS3A 4LRIA 2HRPH 3C5JA 4J6RL 3CCHB 4Y5YC 1RVFL 3FO1A 5E56A 1B2WH 5JTWA 3T1FB 2EH7L 4Y1AD 5EUOE 4WV1A 1I7RB 5B39B 3ROLA 4H5SA 4OZFG 3TNNA 4NM8L 3M8OH 4I1NB 2VXQH 3TCLA 4X6FA 3C8KB 4QRRB 2FCBA 4MJID 1CGYA 2O5XH 2X4TB 3G9AB 4CJ1A 1QFOA 1YDPA 3I6LE 4ZOBA 4JKWA 4KTDH 1WZKA 4F9LA 3UJTH 3QDGD 3KWWB 1H9VA 4PJDA 4OLUL 2NQCA 4QRTB 3TVMD 3S88H 4GAYB 5MHSD 3A6CL 1QA9B 3W2DH 2X4SB 4LLVB 4HS6B 4XC3H 4FNLL 3WSQH 1XIWD 5CIPB 3PABA 1FAIL 4LNVA 4LSSH 5GRVL 3T04D 4HKJA 3IKCB 2EYTB 3UC0L 4NN5B 3OPZH 1PYWB 2P5WA 3EYFA 4OCSL 2VWEC 3NCYS 1UB6B 3U46A 3ARDD 4MD0A 4R4BB 3WE6B 2JB5H 4PR5B 4P2RD 4YK4C 4U6YB 2GK0B 3G6DL 1GGTA 4Y4HB 4EUPG 4PRHE 1CYGA 3C87A 3AREA 4FTVB 1CBVH 3VG9C 4OFPA 4PJBF 1K5NA 3K8KA 2IMMA 1EH9A 3GSXB 3MV7B 2FH6A 4K94C 3G9VA 3CX2A 1OAUL 4YDJB 3U0PA 5IW6A 1MCWM 4YBLC 1S8DA 4X5WB 3S34L 5HVFB 2PR4L 3VRLE 1G7PB 2Q86B 5JW4Q 4EOWL 4HUNB 1WISA 2AGJL 2A73A 2D4FA 1HZHH 3WXVH 4POZD 3VMPA 5C92A 3LKNB 3UJIH 5EIQA 1SVCP 5E08L 3L5XL 1EEYA 3CZFA 1HXYA 4YJZL 4JJHA 5JXEC 4WGVB 4JRYB 1HKLH 4HT1L 3MLWH 3BRFA 3GBNH 1EEUA 2G2RA 1RJLB 4GLRH 4NQCB 2EC9U 4LVHC 4DVRL 3ZHKA 5LVEA 2Y7QA 3IJSA 3IB4A 2LQRA 4HEME 4NWTL 8FABA 4WHYH 5FYJU 3O9WD 4B50A 4NO2A 1RIVH 4K7PH 1FYHB 5FDYA 4FQXC 5GGVH 5LQBH 2O5ZH 2I07A 5DJ0B 1D5BB 1UWEL 3MJ7B 4TSCH 3LRSB 4NQSA 4X4YB 4YHYB 3E6HA 4YHPA 5D5MB 3T65B 5DURD 2E9IA 3OR7B 5T3ZE 3ORJA 5IUSA 3V9FA 2A73B 4NJ9L 4UB0L 3UZVB 2D7PA 1EZVY 4CJ0A 4C54A 3QO0B 5MEPB 4P9ML 1HYSD 4LBEB 2XA3A 3IDXH 4P23B 2VXUL 4NYLA 4PJFA 4KKLD 4JFFA 5AZ2L 3ARGC 1AJ7L 3IXAB 4HX1B 3GSOA 5JZ7D 5H2BA 1X5FA 3H9YA 3RZCD 4E41B 2GK2A 4XPTH 3DRTA 1QSEB 3K8LA 5DEGB 4XMLH 5D6DA 3NABL 3AAZB 5E70A 4WWKD 4ZO7A 1Q9WB 2Q7YA 3ZE2F 3HNTH 3PL6A 3VXTA 1NPUA 2F15A 1PG7X 5HDQL 3SO5A 3VXSA 3UTSB 1T7YA 1E27B 1S9VA 1C16B 2BHUA 1Q0YH 5C86A 4MJIA 5HI5D 1G9EA 1LO3H 3ZHLA 1C5BL 1ACYH 1HINL 1PKOA 3D9AH 1FFOA 1YUHB 4KPHH 4MB4A 1CLOL 4ODTL 4LSQH 1D9KD 3C5SB 1G6VK 4XNZB 3WFHB 3QJFB 1UM6L 2QQLH 3I50L 5DFWH 4LLYA 1NJ9A 2GSGB 1QSFA 1MCDA 3N85L 4W6XB 3RVXC 3D0VB 3LZFL 5JXAL 2XWJB 1IAKA 2R15A 4HS8L 5F7EL 3KVQA 2ZPKL 1OL0A 1PG7W 3B9KD 3ISWA 3CDGA 1BWMA 3L5WB 2FD6L 5CZXC 4LHUB 4LF3B 2AXJA 1A9EA 4PJEB 2H45A 4AENB 4FFZH 3O41A 1MUJA 4RMQA 5FM8A 1UB5B 3P3YA 1JBJA 4FQXA 4RWYH 3O2VL 4PP8C 5FCSH 1OM3L 1E27A 1H15A 2VDPL 1Z0NA 4MAYA 2R0ZL 2LVCA 1QR4A 3VFUB 3GSNH 1BZQK 5C0CE 3D9AL 1SEQH 1AO7A 2DI8A 2C3XA 4N0RA 2E7CA 1X5LA 1AIFB 2DQEH 4JY6B 4XNQA 2DQEL 5IROA 4NN7C 5HHOE 3GI8H 2VQ1A 1A2YB 1CDJA 3GK8L 1LEKA 1JYVA 4LCWE 2L4OA 3NIFE 4NPYB 3MLXH 5CJQL 1MHPL 4NZRH 1JWMA 3ARQA 3E0GA 3RTQB 1N6QL 4WFFD 1I1AC 3MYZA 5TE6L 4HPYL 2PXYB 5DZNA 4OSUH 3IDNB 4HGWA 3MNZA 3N1GC 1DQQA 1JRHI 4HKBB 3U9PH 1KT2A 4PJEE 3HC4L 4WFFE 4LGSB 3WIHL 1I1AB 1QBMH 5FGCE