5E8PA

The structure of the teipp associated altered peptide ligand trh4-p5nle in complex with h-2d(b)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
272
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8pA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8pA01
5CEZH 5DVKA 3T0WA 1UB6A 4RRPA 5CD3A 2VE6B 3UYPA 1CI5A 4ZAKD 3ZDXE 3BP7B 4TVSa 5D1XA 4O51A 1RUKL 1FNGB 1KCKA 2FJHA 1FNEA 3VDBA 1BQLL 5F7EL 5TF1H 1T5WB 4NUJA 2OP4L 4F7EB 2VH5L 3K2MC 3SJVA 1R3LB 3FCTB 3DURA 5KSAB 2YC1A 4P2RD 5F89A 2EDXA 1KIQB 4X9HA 5CEXB 2AXGB 5E2VL 3MRBB 2WBJA 3WIHA 4PJHB 3VRLE 4NZRL 4E41D 4XNUH 3DGCR 4BELD 4HMDA 1N0XH 3GIVB 1J1XL 3B9KC 4DZ8A 3FOLA 2VR5A 1VPOL 5DJDB 3C5JB 1Z9OA 4HUUA 1N7ML 3AS3A 3BIAX 4WO4B 1SQ2N 1L9NA 2IG2L 2ID5A 1I8LC 2HJKB 3KS0H 2APVA 4Z7QE 5MEQA 3S5LG 3V6OC 1IC4H 4U7KA 5HHPA 1AJ7L 4NHCH 5CMAA 4W4NA 3BZEB 3U0TA 4TOYL 3FQRA 2R1XB 5DDHA 2GFBB 4MHHG 4UUJA 1DQTA 1EGJL 4NKIH 2AK4D 1JTOA 2NY0C 4MJ5A 4MSWB 3S98A 3ARWA 1JTPA 4YAQB 3DI2B 1A1MA 3KYMB 1N0XL 5I18H 3C2AH 5DYOB 1QRNB 1R5WA 3EO0A 4X7SL 5K9QG 4OM0L 5CP3A 5IMOA 3RZCA 2AEWA 3QP3A 3PL6D 5IB3A 2A74B 5DRWB 3WNLA 4KTYA 1CZ8L 1JWUA 4YJZL 3HPJA 5L0QB 5EOQL 4UQ2B 3UAJD 4XNMB 3GJFA 2CH8A 5HHXH 3ZYJA 1QOKA 4J8RA 1IC4L 4JY6A 4TUJA 2FJGB 5F88B 4X4YA 1A1NA 1T7WA 4Z7UE 5I1IH 3TBSB 1QFHA 3SDCA 3DETC 1I9IL 1NGZA 2ZUUA 2NY6D 3MUZ1 3GSVA 3U6RB 5KSBE 3RDTC 3Q5TA 1D5BB 2APTA 4PJCB 1YEDA 3ZE2F 3C2AL 3FFCE 2BVUA 4RGNB 1WICA 2RCSH 2O5YL 3QHZH 1FVCB 1T83A 3FB5B 1MFAL 2OSLA 4KUCF 4OF5A 3DNKA 3RVUD 4GRLA 5GISL 2FO1A 5D2LF 2CRYA 2YBRA 2IH1B 1FJ1B 1NAMA 3IDJA 3WLWD 2CJUH 3TVMB 3OHXA 1R5IB 4CADB 1UVQA 3SO3C 4M93B 4DGIH 1X7QA 4EDXA 1CLYH 5GGSB 2E9IA 2E8YA 4TVPH 5CWSA 5I1IL 2VSCA 4YBLC 1GXEA 3BAEH 3K46A 1JL8A 2DLHA 5C6TH 3TO2A 5IQ7L 5IHZB 3HE6C 3JV4A 4RISH 1NMBL 3KR3H 1P7KA 4G8EB 2OXHA 5IR1B 1CGWA 1JNLL 4L3EE 4Q6IA 4WI2A 1ZSDB 3CFDB 5CD5C 2W92A 4TULL 4U6HA 4XXCA 3MV7D 3UPRB 2RCSL 5I8EA 4K07A 3CC5A 3QHZL 4P2OB 1KFAH 4M7ZC 3MRJB 4NWUH 3BT2L 3CD4A 3KPRA 2X9XA 4QWWD 4NNXA 4ZFZA 3VGFA 5HPMA 2CJUL 2FLRT 5E1AA 3U83A 1YECH 4OCNC 1F3JB 1BBJA 4K3DH 2B2XL 5CBEB 3TYGH 3BAEL 1TJGL 1TPXB 5HSFA 4PB9H 5GGTA 2HRPH 4RISL 4GG8A 5EZJA 3QDAA 4JJ5B 1U92A 5IVXF 1CFQA 3QFJB 2DL9A 1CDJA 1A7BA 1FZMB 2V7NA 4IIQB 4CKVX 4KV5E 5C0CB 1URLA 3KYOA 3B83A 2EZ0C 5KSAC 5DD5L 2P49B 4HUNB 4UOJA 4F9LC 4I0KA 4Z7NF 2DJUA 4EI5A 2Q1EA 2XQBL 4LSUL 2R2CA 4WY7H 4NWUL 5IEHB 2Y1VA 4MD4A 1WQVT 2EH7L 3BFOA 2I9TB 3AM8A 5F7FA 5HI3C 4X9BA 5FM4A 2Q7YA 4W68A 5T1LA 4YXKH 1BQSA 2WUCH 4QRRD 3TYGL 2OTPA 2O26U 5LKNA 2ITCA 2JTDA 3D9AH 1JNNH 1F5WA 4PB9L 4FQIL 4WO4C 1NMCB 2R0KH 1A1OA 3QWRD 2VLRB 1I1FB 3TNMA 1P1ZB 3THMH 2J8UB 2BJMH 4G8GD 3UJIH 3MJGX 5L2KB 3P4MA 4MLSA 1S7TA 3V7AG 4LKXB 2B1AH 4G7YH 4PG2C 2MKLC 1B0RA 3ZE2E 1M6OB 2RBLA 2Y5TA 3PIQA 4XP6H 4JG0H 2R1WA 4HIHB 4HKZB 1KLUA 5C6PB 2UZXB 3RIFK 2FBJH 4OGXH 4PJDB 3TFKA 4KUZL 5DJ6A 3T0ED 5D2LE 2BNQE 3DRQB 4H1LH 4U7SA 1RMFH 3QDGD 3SE3C 4Y4FB 5DF0A 4NRYA 3MROA 2VXVL 1J7VR 3NMEA 4LSPL 1E6OH 4JFFE 2FECL 3C5SA 4S2SB 2VXTH 1CVRA 1LDPH 4MNHA 5INDB 1RULH 1XR8A 1EO8H 3VXPB 5F9JB 5L0QC 3D9AL 1MCRA 2NMSA 5ADOL 5JIKA 3I6GB 4JPKL 3RPIB 1F6AB 3PWJB 4X5XA 3QPQC 3OPZH 4WW2A 1HDMB 5IFJA 2EYSB 2OR9H 2W1NA 3UJIL 4KZDL 4Q6YA 3FT4A 1ZHKB 4YDVA 4E0RA 2DQCH 1DCLA 2WAHA 4XP6L 1IC7L 2AJYL 4NCC2 1ZT7B 3BWAA 3ZO0A 2DICA 1LP9B 2FBJL 3DGGB 4ODUA 5C0FA 4CDHA 3QXWA 1WBXA 4LOUC 1HK6A 3IKCA 3M07A 4X4XB 5HXMA 4NQDA 4MDIA 2E7LA 2X1PA 1RMFL 1FPTH 2BFVH 4RGNC 4S1QH 5EBMA 2P5EA 3O2DA 2AV7B 3GRWH 4HG4K 1E6OL 2PXYA 5L2JA 4PLKC 4MNQE 4PRIA 2YHGA 1B6DA 4U1HB 1LDPL 1XR9A 4CUCA 4HXAH 4QRQA 2QJDA 1EO8L 4H5SA 4L29A 2E8ZA 4N0UA 3MLVL 3KPPB 4AH2B 3PQYA 2KQNA 5E24E 3MC0A 1G1YA 1ZHBB 5IVXE 3TVMC 1HZHH 5I2IB 1P6AB 2XWTA 4M93C 5DRNA 3D0VA 3CSGA 2OL3H 1FNSH 3G5XA 1CGSH 3FB8B 4KQ3L 1NBZA 5F21B 3QJHB 4AQ1B 3MV9B 3QXTA 3MJ8B 4Z7NE 1U8OB 3CZFA 5DMYA 1KCRL 4GG6B 4M9PA 2YZ1A 1ACZA 5FYLD 3QQ9D 1B2WL 4CJ0A 1X5YA 5L7XL 3OKNA 3VXNA 3HC0B 5I6XB 1QLFB 4G6FD 2DWEB 3REWA 1K2DA 3LKSA 4P2OC 3GRWL 4U0QB 2AI0H 1CICB 3HPLA 1NEUA 1WC7A 2R23A 4UTBH 2GSGA 5KZCB 2ARJA 4HXAL 1J87A 2HT4C 2X5PA 2YUXA 5J13B 3NBNA 2B5IB 4NZTH 3QNXA 4PGDB 1FO0B 4M5YL 5DEFB 3SKNA 4WUUA 5D71H 1HZHL 2ATKB 3MREA 5HHMA 2OXGA 3GMNA 1FNSL 4PJAB 2BRRH 3OGOE 5D2NA 2QR0A 3QUML 1TPXC 1REIA 3K4AA 5HYSB 3PV6A 4EOWH 4GUPA 4P46B 3U30B 2HFEA 4YXHL 4J7RA 3ZTNH 1FG2B 3O4LB 5D5MB 4IIQC 5BW7C 1BBDH 2J7LA 5C09A 3O6FD 1MEXH 5I8OH 3FN0L 4KTDL 4D9RE 5E5MB 1NC4B 2F5AL 2R69L 3F12B 2NY4B 4X80L 4G6KH 4JZNA 2NPLX 4PBVC 4J2XA 4UTBL 3MRLA 3SDAA 3ZZ1A 4AM0B 2X4PA 3MJ6A 4Y1AE 2P1YA 4WI5A 3KYAA 1BAFH 5LGHH 2PYFB 1FO0H 4NQED 1H0DB 4F7PB 1QBLH 3MCKA 5D71L 2VDMH 2D03L 4GW4B 3CVHB 4KKNA 1GZPB 2BRRL 4CU7A 3Q2CA 3KXFB 3VXOA 3EHBC 4N8VB 3MRGA 1NMCC 1RJYA 2EH8H 5FECB 4JO2L 2KUTA 1MCBA 5DD1H 4Q2ZB 5DZNA 3TT3H 2M2DA 2YEZA 4XHQA 5MERA 2W0FB 3QUYB 2CDEA 4OFYA 2A9NH 1CS6A 3MLTB 4QY8A 1AD9A 5AZ2H 1HNGA 4MHHI 1WCQA 1VKXA 2XV6B 4JFYB 2QQNL 3DBXB 3W11C 2LTQB 4LHQB 2BP3A 3DUSA 1BAFL 5LGHL 2XTLA 4Y4FC 1BWWA 3GB7A 3PWPA 1I1CA 3G5ZA 2BX5A 3CVHH 4BKLB 4RBPH 3HMXH 2MQCA 2V2WA 1MCPH 1LQVA 1S7RB 1KBGH 4V2BA 1MFDH 3EAKA 3VD5A 5T3XH 1VERA 5HBBA 3ZHKA 2AKRB 4IDJL 3ULVF 2EH8L 3CLFH 1T0NA 1XGPB 2AJZB 5BZWA 1S7SA 5TJWK 2EEBA 1PEZA 1TCRA 5I1AB 3MRNB 5EIIA 2D2OA 4HC1H 4QF1B 4MQ7B 3AXLB 4JQIH 4G59A 3ARGA 3CDGB 2XFXB 4NKOA 3D25A 4OD1H 1A7OL 2DM3A 2D7MA 5E9DE 5AZ2L 4WW1B 4P4RA 1K8IA 1DBKH 4JB9H 4M6OL 1NDMB 3ELAT 1BD2A 3CH1B 1H3WM 5CAYB 1KN4L 1K4DA 3SJVE 2Q76B 1UM5H 4TRPH 1P5VA 1YYLL 3CVHL 1HQRB 1X44A 3GMOB 3GSWB 5ADPH 4KJWC 5IVZA 4LP4A 2IANB 5T3XL 4HPYL 1XCTA 3MO1A 3O3UN 4MXWH 5FO7A 2EDWA 4LLYB 5C0NC 5ISZA 4MNGA 3N1MC 1KCUH 1C12B 4HC1L 2BRQA 3MLYH 3SBWA 1I7RB 2GSIA 4L9DA 3GUTA 4FFZL 2BXYA 1EXUB 4MCYB 3UBXB 1X5AA 1RZGB 2E9JA 2ZJSL 1DBKL 1F2QA 5BJTA 5I6XC 1U8KA 3ARSA 5DJCA 3GMLA 4QRPA 4ZO7A 4JN1L 5EUKB 2ESVD 1MVUA 3TESA 4TRPL 1FP5A 1V7ML 1WWAX 1CICC 3GMMB 4M8QA 3CMOH 2AJUH 1TVBB 2DIJA 3CFEB 5D7IA 3FB7B 1FFPA 2CSPA 5J13C 3X17A 2B5IC 4P57B 3UROR 2ZSWA 5SWSD 3GNMH 5AD0B 1FL6A 1BGXH 4MXWL 1UJ3A 4MJIB 4R4NC 2WANA 3X14B 2CLRB 3FQTA 4HEPG 1RVFH 2DQTH 4FQHA 5EOTA 4XC1H 4UNTA 4C83B 5TE6L 1XH3B 1L0XA 4OLEA 4PJ9D 3UTTD 4P46C 1KIRB 3U30C 5LGJA 1BHGA 4OUUB 2J3SA 3P73A 1A5FH 2NW3A 2G5RA 4MJ6B 3V6OA 4WV1B 1MUJB 3WN5B 4DKFL 4U1NA 4OV6F 3VH8B 1G9MH 2NY4C 3QO0A 1WCBA 1OSZB 4GKSB 4X6FB 3U7YL 5IT2H 1MFCH 3MRFB 5FUCC 3CMOL 3SKMB 5IQ9B 3STZB 2XQYK 4DN4L 3ZKNC 4U3CA 3ULVE 2IFFL 5DJ8A 2VDPH 3MXWH 4EXKA 2PN5A 3DSFH 4M6MH 2J1KA 3RGHA 4RZCB 2ERJB 4GW5B 3FKUS 1BOYA 1X3DA 2FIRT 4K23H 4XC1L 1DQJA 4XCYA 4ZQKA 1S9XB 3V4PH 5IB5B 3HR5B 5DVMA 2Y5EA 2CD0A 1P7QA 1TNNA 2GEEA 2VZUA 3DXAA 4YO0B 5DD6B 4KXZH 4GBXD 3V52H 4LU5H 1N6VA 1G7HA 3LN5B 3U36B 2BOBB 4XGZB 2GUOA 3GMPA 3QUYC 3W39A 4MA1B 3L7FB 3MOQA 2VQ1A 4JKKA 3DSNA 2Y7QA 3NGBC 1PYWA 5I66B 5AZEH 1MFCL 5KW9H 3LKQB 1UA6H 2LAGB 5JO5A 2CDGA 4L8DB 3TBTB 3O45A 2K7PA 4XMLL 4OD2A 3QXVA 4WW2F 2JB5L 5TQ2L 1NH6A 4XWOD 4XP9H 4ZFOB 3U0PA 2X44D 4M6ML 4NKMB 3UYRH 4PJFA 2HLFD 5HDBF 4R4FL 1NC2B 2P8LA 3CFJA 4LIQE 3UX9B 3IFLH 4HFUL 1Y0LB 2A6JA 3QEQB 2QHLA 3HS0A 4MQTB 2I07B 3KPRE 1SEBB 4MD0B 4LLDB 3IS1X 2D0FA 4M1CC 1W8NA 2ED8A 3MRPA 3WXWH 5MHSE 4S10A 5DA0B 4Z76A 1EDQA 1XGYH 4POYA 2B0SL 3L5XH 5AZEL 4H0IA 1OP5H 1XF4B 1A7RH 3HE6A 3WFDH 1KTDB 1X5HA 1WWWX 5KW9L 2FX9H 2X1QA 3TPUA 3UTSB 4HWBA 1PLGL 1JUFB 3VWKA 5FDYA 5I8CB 3HRZB 2FYYA 4XP9L 5J1AA 5C0AB 4FA8A 3RVWC 2XZQL 5D6DA 3OKLA 4JLRB 4Y4HD 3OJ2C 2DM4A 5ICYA 2KQMA 1AFVH 5HVWA 3IU4L 5FF6B 1EGJA 4TSBH 4YHLL 4P5TD 1Q9WA 4P3DB 5LAXB 3MPCA 1A47A 1V8HA 1H3PH 4TUOB 2DAVA 3VXQB 5TF0A 3WXWL 3MGTA 1IEAA 2Z9TA 1J86A 1XGYL 1W72H 1HQ4B 4RGOH 5F1IB 3VCLA 4JDTL 4FFVC 5EU4B 1I4FB 4H20L 3VFUB 3BP7A 3WFCL 5MEOB 1FNGA 5DEGA 2AXFB 5E99H 2H2PD 4QXWA 7CGTA 1FLRL 3RX5A 4F7EA 5B22A 4DEPB 1BMGA 1XIWD 4ZFOL 1R3LA 3EZ8A 3FCTA 1S7XB 4XAKE 2MKWA 4KY1H 1A9EB 1G9MC 4U1MB 1KIQA 4F9LA 5HJ3A 1A7NL 2AXGA 2YUVA 4GAJH 4G8IB 4TSBL 2GITB 5KAQF 1D6VL 1QSEB 3T65B 1FYTA 3GIVA 5CUSH 3FFCD 4BZ2H 2ZOLA 5D4QA 1P9MC 1QFOA 1T1XB 1NMAL 2A9ML 2DB8A 3ZKQD 2HJKA 3GK8L 2WWMD 2XA3A 5E99L 1PKOA 4JANA 1JFQL 3GHBH 4WV1C 3WN5C 3BZEA 1UCBL 4NKDB 3D39E 4U1JA 5FGSA 3QEHB 3P4NB 1GZQA 2CRZA 5HDBE 1CFNA 3IVKA 4ZTPL 4U05A 4NQXA 1DBML 4L3ED 1NPUA 3RUGA 3MNWB 1FFNB 1MJ7L 4YAQA 1AQDA 2MPAH 3KYMA 4I3RL 1MNUH 1R6VA 5CUSL 5B8CB 3SE3A 1HOCB 4NQDE 5DYOA 2E7LE 5F96L 4BZ2L 3QDJA 2YOCA 1OP3H 1FL5A 1QNZH 2P5EE 1YEHH 5D7LB 2C4XA 1JZ6A 2W9DL 5FKAB 1V05A 4PRIE 3V5KB 2A74A 5B39B 3ZE0F 5J56B 2DQDL 2UY7A 4N0UE 1DBBL 3GMQB 4BK5A 1JZ8A 5GS0H 3PQYE 4JO4H 1TZGL 4YR6B 4X99B 1JIBA 3VXRB 4PRBB 7FABH 3TBSA 5FGBA 3M1BB 5IBUB 1RZFL 3EDFA 3GSOB 4PJGA 4CRPA 4MCZB 1LO0H 3QA3B 3GI9L 15C8L 3DECA 4OB5L 3U6RA 1YQVL 5FUZL 2EECA 2MPAL 4BH8A 1D5BA 3E2HB 4DAGH 3IYLW 4PJCA 5I76B 2H3NB 4LSTL 1QNZL 4YH6A 1KCLA 1OP5K 1J88A 1FVCA 1C5BL 1D5MB 1A6ZB 3FB5A 4EIGB 3B5HA 3S4SA 4OLUL 1GC1H 1VGKB 2ARWA 3FB6B 1N3NB 3V79C 4OZIB 1QTYT 1IAMA 5B3NA 5ID1A 2LFGA 2IH1A 1FJ1A 3TVMA 1R5IA 1YEKH 3C60D 2NY1D 4GAYB 4D0BB 4EJ1C 1S9WA 4WUUE 1A0QH 3BDYH 4HGWA 5HHME 1LE5A 5D5ME 1CGTA 5D2NE 1ZHLB 1FV1B 5DMJB 3HNVL 2AK4B 4KAQL 1FVEB 4U6YA 1ZKAA 5IR1A 5K9KB 3QUKB 2AEIT 3CFDA 1OTSC 4CU8A 3AAZB 4XAWH 4NO2B 1L8JA 5C09E 5ENWB 3UPRA 5JA9A 3HLAB 4P2OA 4KUCD 5IFHH 3DV4B 1RZIB 4GAGL 1I8MA 1GC1L 5IMLB 4WFGE 3PG2A 2KH2B 4AEIH 2D31B 1D6EB 1I1YA 2J5LB 4NQUA 5BV7B 3CAFA 4LVEA 1CD9B 4PG9A 4QRUB 1JZ4A 1GL4B 1ORSB 1F3JA 4DVBB 4Z8FL 4HJ0C 5CBEA 3U7WH 1IE5A 4MS8D 3D5OF 4ZS7L 5HHOE 4KVCL 3EUUA 4NFBA 3LEYL 4MA7H 3GGWA 5ESAA 2NY6B 3QFJA 4HIIB 4DEPC 5C0CA 3RU8H 1QFPA 5F1KC 1NBYB 3V2AR 1CD1A 4JFDB 4Z78A 5IFHL 3MYJB 1LEKB 2R4SL 5DHYB 4GRWF 5EC1A 4LGRB 4RWYH 1F4HA 4PLNC 3H9HA 4KRNA 5FM5O 1HIMH 2I9TA 1W0VB 1W0WB 3TLRA 4HW6A 3QG6B 3PWPE 1CR9H 3BVNA 3MRIB 5K93A 1T66C 3UXFA 1LO2H 3T2PA 1EO7A 2V2XB 4NUGL 5CZVL 4UINH 2ZCLH 3FRUB 5IB2B 3WUWB 1I1FA 4MA7L 5GGVH 1P1ZA 2VZTA 2J8UA 3VXSA 5IB1A 3TH3T 1MELA 2E3VA 3N9GH 4MXQC 3O4OC 4N0CD 3BN9D 1AC0A 3RBSA 1M6OA 1TMCA 5CP7A 5C9JA 4HKZA 2FBOJ 3BISA 3CSYB 2IEPA 2EYRA 1HKFA 3U48A 3U4AA 5DMKB 5DJZA 2BVQB 4JCLA 5IBLC 2WINB 5ALCH 4G6JL 4RWYL 5BV7L 3BW9B 2QQLL 2QTEA 5B8CC 1HIML 1BD2E 4XMKH 4G5ZH 2XTJC 3RI5K 1K6QL 4LLVB 2NYYC 4JGMA 4S2SA 3GBNL 2XYCA 1J05A 3PP3H 1GC1C 4N1CA 5BZDB 1G7PB 1N5YL 1LO2L 5F9JA 3VXPA 4UINL 3VWJB 4PS4H 1C16B 4G9DA 4QLRA 1F6AA 5GGVL 1HDMA 2EYSA 4RAUB 1UXSB 3QPXH 4U49A 5F6IB 2VLLA 2VDRH 1ZHKA 4XPGL 4MNGE 2M8XA 5ISZE 2LU3A 5IESH 4L1HA 2X70A 2DBLH 3QUMA 4PJ8B 5JQ6H 2X1WL 5JTWA 4Y5VA 3OF6A 4CVUA 5DJYB 3DGGA 4V2CB 4WU5B 5IG7B 4LEXL 5LXGH 3C5ZA 1FNAA 1HKLL 3WXVH 1CL7H 5HI5D 5I30L 4WJ5B 5C07B 2JK5B 1WBZA 4D9RD 4MDJB 3MMEB 5JNYB 2FR4B 4QRPE 1T20B 4JRXA 2AV7A 3MNZB 4HUVB 5EU6B 1MAML 5I1JL 5HGDB 5A16B 2JJVA 2XWBB 3UTZB 4NO3B 4Y1AD 2BOCB 2HT3C 1CGXA 2L7UA 5D7IE 4DFIA 1QEWA 2R0WH 3KPPA 2A83A 4AH2A 1DFBH 1KIUA 4FQLH 3JV6B 2IH3B 4G8GB 2VDRL 5GGSY 4RA3A 1KGCE 5DC9B 3TV3L 2A6IA 1ZV5A 3VA2C 2DBLL 3SGJA 3QJHA 3MV9A 5JQ6L 3AREB 3KPMB 1VEOA 1BZ7A 1U8OA 1QFUH 5EBWB 4OFVA 5HYSG 4GG6A 1MFEL 2VTFA 4WEBH 4GRWE 4GKNA 2DYPA 2XQYG 4PYHA 5CJOH 3QDGB 1OTUC 3V6OE 3G5YA 1T7XA 4MAUH 5HYEA 3BQUD 4DUVA 4FQCL 4OZFB 2V6HA 2XG4A 2J5LC 4YHPB 4FZEH 2R0WL 5BV7C 3FRPG 1CD8A 4FQLL 2ATPA 4HMEA 4OI7A 1HHKA 2ATKA 3VGDA 4C4KO 1ORQB 2Q8AH 3NA9H 5GSVB 4QT5A 4O2EB 5F97E 4PJHF 2VR9A 1U91A 2EO1A 1GGUA 3BMVA 4N8VG 4UZGA 3DXAE 2NY6C 1FG2A 3IDGB 3O4LA 1JF1A 2WNGA 1CQYA 3ZKMC 4HD9A 2YD9A 1CBVH 4N1EA 1A4KA 2CDFB 4LFHD 2VXSH 3QULB 1C5DB 1OARL 3F12A 5DUPL 4NM8L 4R2GD 5D1QD 4BSWB 1JVKA 3NCEB 4MAUL 2YA0A 3RVUC 5JW5B 2R4RH 5ID0A 3HB3C 4OZFH 3FRPA 4WTWA 5ITBH 3TP4A 4AM0A 2IFGA 3LQZB 5LVEA 4FZEL 2HTLC 1WVZA 4UB0H 3SJVD 2DI8A 4YDJB 1MH5B 4TSCH 3N50A 2X4RB 2CIKB 4PP1D 3O81A 3MACH 1ZT1A 4PJFE 3JWOH 4HWEH 4CVXA 5IHUH 3MUGB 4N8VA 1V7NH 3DX7B 4M3JA 1VACB 1X6LA 4BSVB 4IRSA 5FECA 3VRJA 1MHCB 2GW5A 2QHRH 4Q2ZA 5GSRB 3BKMH 3WJLC 1KENH 1JGEA 1WBYA 3VFRA 1EFQA 4KKBD 3MLTA 3MV8D 5J1SC 4P2CG 1HHHA 3P0YL 3VFGL 2MQ3A 5KOMC 4HS6A 4JFYA 4LSVH 5ITBL 3TPUE 1H8NA 1WF5A 4KGJA 4EN3B 1AGEB 4UMGA 1S9YB 4YNYB 1K3ZA 4KJPD 3NCJH 4TSCL 4BKLA 3SGKA 3DVGB 4N90E 3PWUB 1S7RA 1A22B 5KN5A 4AG4H 3CGTA 3DMMB 5IHUL 5IJVB 4Y8AA 1V7NL 3VWJC 4YHKL 3EYSL 4Z0XB 4V3DB 2X9WA 1E4KC 3LHPL 4KRPB 3SDYL 2QHRL 1XGPA 5J6HB 5F6IC 4PJCF 3WHE1 3IJHB 5I1AA 4QF1A 4MQ7A 3AXLA 3O6FB 1A6AB 4PJ8C 3RZCD 2CQVA 4PRAA 3QB7C 4DQOH 4WW1A 3H6JA 4UNUA 1QYGH 4L4TA 2HKFL 4LSVL 5SWZB 4PLJD 3UBXG 3I85A 1NDMA 4HH9A 4NDMB 1OM3L 3J7HA 3CH1A 1WITA 4JQVC 2UVEA 1WT5A 4XHJC 1OTTD 3NCJL 4QXUH 3QNYA 3GMOA 3SDCD 3O41B 1U41A 3GSWA 1K4CB 4CMMA 3QRGL 4UAOB 3LRSA 4AG4L 1ZWIB 3MYZA 5KVDL 1T22B 4OCXH 1G6RB 3ULVD 1SHMA 2YD7A 3FT2B 2ORBH 3DUUA 2P45B 2H9GB 4M62H 4LLYA 1FYTE 3ARUA 2NXZD 3NAAL 1C12A 5KJRH 1U93A 1JRHL 3I6KA 1CDGA 3QISA 5B38A 3AREC 1U6AL 1EXUA 3QI9A 4GRLD 4HV8A 3I50H 1PW3A 4MCYA 3WBDA 4K2UL 3MLWL 4IOFC 1QYGL 3BRGC 1CK0L 1CDUA 4YXLL 3T0EC 2R56H 5BRZB 1OY3B 1MWAH 3JUZA 3ZDYF 4KI5C 1RFDH 1AXTL 2UZIH 3BGMB 4Y2OA 3UTQA 3GMMA 5DSCB 1TVBA 1V3KA 3VH8G 3NH7H 1RK0A 3RAJH 3CFEA 4OCXL 2DMBA 4P57A 2OMBA 1I7UB 1FH5H 3RUGE 5JZ7C 2VAJA 1CGVA 1ZE3C 3V6FA 4M62L 5DUML 3X14A 2CLRA 4M5ZH 3RL1B 1EAPB 3QDJE 1CVSC 5D72L 2UVFA 3MBEB 5DWUH 1G7IA 4C83A 1XH3A 3F6IA 3GHEH 5I1GH 3V6ZA 2BHUA 4QHLA 2DL2A 2CGRL 3KPRD 4LF3B 1ZT4B 2V17L 1NL0H 2F53A 3HFMH 4NRZB 3B4NA 5MHSD 2P5WD 4MJ6A 4XH2A 5EULV 1FVDB 1EEUA 3T4YB 5CCKH 2UZIL 4PJXB 1QG3A 4ZUUB 1OSZA 2COQA 4X6FA 4IMLB 2YZ8A 3KLAB 3MRFA 3HE7A 4KJQC 1SY6L 4MB3A 3NH7L 4PJGE 4F37K 4Z7VB 5I73B 3KPLB 1G6RL 3IDNB 4ODTL 1O0VA 4ZFGL 2J8UF 1FH5L 1U8HB 4FNLH 2YPLA 2VQTA 4OQ1A 4PJCE 1JPSH 1RK1B 4M5ZL 1VFAA 4FRWA 1FGNL 1F4XL 3F58H 1YEEL 1UWXH 4LAQH 4IBLT 5IB5A 4EI5D 3LN4B 3GHEL 3GJEB 1UB5B 3UO1H 1KCSL 5DHVA 5DD6A 4XT1C 1M7IB 5C3TA 3JTTA 3WFBL 1LEIB 1WZLA 3LN5A 4QHNB 4OSUL 4XBPB 1NL0L 1TZIA 3HFML 5HVGB 3L7FA 3CJJA 2MQ0A 1TITA 5HVHB 3OAUH 3LKQA 5J9PB 4CAGA 1QP1A 5EO0B 3TBTA 4K3EH 2NY2D 4FFYH 3L1OL 4LCCA 4F58H 1C8PA 4NM4L 4OKVB 2XKUA 2CKBB 1OAQL 4EN3C 2AJVH 4ZFOA 4XAKD 4NKMA 5C08B 2BHZA 4R9HA 2K7QA 3ERYA 1RD6A 1J5OH 3DMMC 3F58L 3MLZH 4LAQL 4YFDB 4IHOA 5GGQL 3VFMB 3TFKD 1LP9F 3QEQA 1H3XA 3UO1L 1MLCA 2I07A 5ICZB 4S1DC 3D85A 5CBAB 1VFBA 1JGLH 3DROA 4APQB 4LSRH 1XCQA 5IFAL 3O6FC 3BZDA 5GS1B 3ZDYE 1QR4A 3OKDA 2ITDA 4JKPL 1XF4A 1T5XA 3IDXL 4MWFA 1HYSC 1NGYA 1FZJB 3UTSA 4K3EL 3PXJA 2CKBH 2NY3D 3QFJE 4ZOEA 5IROC 5I8CA 3NCCB 2Q3AA 1BF2A 3D39D 5C0AA 3DO7B 3QDMA 4JLRA 5C0CE 3W9DA 2AQ3A 3K74B 4UAOC 5FF6A 3VI4E 1NSNH 3F65A 4GG6F 3WNNA 4P3DA 5LAXA 4NJ9L 3WIFB 3GSRB 4NQDD 3BZFB 2Q3ZA 5F7NC 1OSPH 5FHAH 2VLJB 1HXYB 4TUOA 2P5ED 3VXQA 3WSQH 1CDHA 1RU9H 2PXYD 4X5LA 5FO8A 5IHBA 1DN0B 4PRID 2G2RB 3KPSB 5EU4A 3PP4H 3MLXL 1I4FA 1UZ8B 1NBVH 4HFWA 5ANMA 2VLRE 1T21B 3VFVB 3QQ4B 5J57B 2R9HD 4JG1H 1A8JH 2J8UE 4K9EH 3VXSE 5IIEB 3CUPA 4PJAF 3S3JA 4KDWA 3QJFA 2DI7A 1RZ7H 3VDCA 4U1MA 3KS0J 2P7TB 1NSNL 3ARBB 4X4ZA 4G8IA 3QXAB 4UT7H 1A3LH 1A7QL 1QSEA 2XIDA 4RMSA 3T65A 1OAZL 1OSPL 4HK0B 5I1DB 1MJUH 3ZYOA 4EDWH 3MBEC 3ILPB 1RU9L 4X7TB 2HFFB 3FT3B 3M8OL 2QV2A 3CSBA 5EWIL 3RWCB 3CZJA 5INCB 4FQPA 3VFNB 3QO1A 2JKXA 1U8QB 4WI3A 4WUUD 1H15B 1A6VH 1ND0B 5HHMD 5IWLC 1BFTA 3RGVB 1EFXA 5I1CL 1UWXK 3N1PC 3P4NA 2H1PH 2APBA 3SY0B 4U2YA 4BFEA 5IBUG 3ZYIA 2EE3A 1LP9E 1FFNA 3L3GB 4P5TB 3MJ9L 4NP4H 1OF2B 1JNJA 3AROA 3QBTB 4LSSH 3SOBL 1I7ZB 1UCTA 5C09D 2BC4B 3MV01 2VLKD 4EDWL 5I1HL 4X98A 1T4KA 4JRXE 5HGBB 1T03L 1J0JA 5D7LA 3PV7A 4HCRH 2ADJA 5FKAA 3V5KA 4WFGD 2D3VA 3OR7B 1U3YA 5B39A 4J6RH 3L5IA 5DMIH 1OHQA 3T2NL 1DVFD 3SDAD 1T80A 3MGOB 5EBGA 2ZCKH 4UNVA 2Z35A 2D7TH 3WFEH 2OX5A 2A0LD 1QBMH 3KWWB 1U8MB 2AJSL 4YR6A 4X99A 1X5ZA 1A6VL 1M7DB 3K2UH 1XIWB 4TSAH 2X4OA 3VXRA 4Z7UB 5H8DA 5HVHC 4GRMA 1UG9A 5HGGS 2P8MA 3WV0A 3M1BA 4EEEA 5HHOD 5IK3A 1JZ5A 3DTXB 3QUXB 4TYUA 1F6FB 5FAAA 3MV9E 3O9WA 3QA3A 4UDUB 4ZPVB 5DTFB 5ERWB 4GG6E 2C3GA 4F8TA 2APFA 3H2WA 3SDXA 3E2HA 4K7PY 2G75B 4LSSL 2H6PB 1IILE 4OFYD 1D5XA 3ZYZA 5TPWH 4JO3H 4U1LB 1D5MA 1A6ZA 5B3JE 4JPWH 2E5EA 1VGKA 2V5YA 5AUMB 5F7HA 4OZIA 1DQDL 5EOCL 4I3SH 1MI5B 1ZHNB 3GSNB 2ZCKL 3OAYH 2Z93B 5MEND 2ZUXA 5CSBA 2BVOB 5MP6H 1CF8L 3KLDA 5GS1C 3OAZK 4I0PB 1J0ZA 3OR6A 4K3JL 4ZMAT 2YSSA 1MCWM 4QGTA 1FV1A 4EVNB 3HNTH 2IBBA 4KDVA 3IFPB 4L3EB 3INUL 4V1DA 5KSVB 3TYFB 3UBXI 3O4LE 1JF6A 4NC0B 1KEGH 2EC9U 1CE6A 3T2OA 4FZ8H 1LGVA 4QXGH 2PYEA 5TPWL 5H2BA 3SCMA 2VIRB 4JPWL 4LLWA 1RZIA 2MJWA 4IEFB 5IMLA 5FUCE 3MNVB 5CJXA 3R8BB 2D31A 3GSNH 1D6EA 3L6FA 2GKIA 4OCYH 1UH4A 1BD2D 4LCWB 3RJQB 2WZPD 5MP6L 4QRUA 1U8PB 5SWQB 1RIHL 1EUUA 1ORSA 4DVBA 1G7MB 2XXMB 1T0PB 3P4OA 4EUPB 3U4EA 5LCVH 1ADQA 1EHNA 3MCG1 5E8OB 5GGRB 1A6TA 4HIIA 1F11B 1MRCH 1RZ8A 3WUWG 1YC8A 5ISZD 5E94B 5F9OL 2FGZA 4KXZI 1FFOB 3KJ6H 4FZ8L 4KVNH 4QXGL 1VADB 2N7BA 4JFDA 3DVIA 1LEKA 3ARBC 1BX2A 4ISVA 4N0RA 1GPOL 1MREH 3O3EB 5DHYA 1G7JB 3GSNL 3DIFA 1R0AL 1RUQL 4J4PA 2HG5B 2GJ6B 4EKXA 4I77H 1W0VA 4QRPD 3NCYP 1FE8L 2CK2A 3SE4C 1NAKH 3MRIA 1RZJH 5H35A 3RA7L 1D9KB 4MX7B 5C6WH 2V2XA 4MB4A 1YEJH 1DQMH 2R0LL 1EEZB 4G6AD 1AI1L 4JQXC 2VITA 4JFEA 1CU4L 5I17B 3RGVC 3KJ6L 4R26L 2W9LA 4GSDH 4DW2L 3IFNH 1S7VA 3CSYA 4ALAL 4AQOA 3ROOA 3BN3B 3EBAA 1DUZA 5BVPH 2D7QA 3OXRB 1EH9A 1MREL 2WINA 3HAEH 4P5TC 2YD6A 5D2LB 1UEYA 2BNQB 2F19H 1DR9A 4L4TE 3BW9A 3P0VH 3RWDB 1XGQB 4BH7B 4I77L 2X4SA 35C8H 3A67H 2J88L 4GLRH 3CK0H 1IGIL 1NAKL 4JFFB 4OCWH 4ZDHB 1L0YA 4MA8L 1AKJB 4IS6B 3UTPE 1BM3H 3WFHB 5BZDA 3OXSB 1OB1B 1DQML 1OAKL 3VWJA 1C16A 3TZVB 4LEOA 2VDKH 2C3XA 1XIWC 1FGVH 3RVXD 5I75B 3IF1A 4P2YA 3QUXC 4PJ8A 5F1OB 1EHLH 1INQA 1P7QD 2DQHH 1YY8B 3DXAD 1AGCB 1ZLSL 5DJYA 1MHEA 4WU5A 3Q48A 1BQHB 3OAYK 5D7JA 1HINL 5D70H 3TJEH 3PXHA 4OLXL 5C07A 2JK5A 1E28B 4HX1A 4MDJA 1MCIA 4PGBB 4LHUB 4FQ1H 4G80B 5BO1L 1NFIB 2FR4A 4XCEB 1T20A 1KJMA 3ARFA 3CPLB 3HA0A 3MNZA 3CK0L 2WP3O 4HUVA 5EU6A 4MNQB 3LMJL 2ENYA 5A16A 3DETD 2BHYA 2XWBA 4RQQB 3UTZA 2BOCA 5KS9B 2N4IA 3U46A 4LQFL 1OGTA 2FEEI 5HDLA 1JMZA 3NZ8A 1B9ZA 4OZFG 1A7PH 2XN9A 2VDKL 2ZWLT 3KPTA 1B6UA 4QTIH 4R97B 2HYMA 1R3KB 4I0PC 2VO5A 1MCWW 3FO0H 4H8WH 4HBQA 4NPYB 1NGPH 3AREA 3DRTA 3KPMA 1EHLL 2DKSA 5F1NB 1WSST 5EBWA 2HFGH 4A2LA 1DANT 1L6ZA 3QHFH 4MAYB 1SJXA 2NTFA 3TJEL 3EYOB 1RHHB 3DX8B 3IFOB 4A6YB 4HXBH 4ZOAA 3MLRH 3R4DA 5E2TH 3H42H 4OLYH 4PLOB 4K3GA 3HE6D 4PREA 2BSRB 2JIXA 4HJGB 4AMKL 5HYFA 4YHPA 4HIXL 3VWKD 5TE7L 2YN3A 1A21A 3H3PL 2X40A 3AB0B 1FRGH 1OWWA 4QYOB 2YPLE 4N90D 4LGPB 2H32B 3HI1A 5GSVA 1K3IA 4YQXH 1GHFH 1IGFH 1NGPL 1YEFH 2G5BB 4ZUSB 1CDIA 3VG0H 2HFGL 5M7QA 2N1KA 3D1MC 3SE9H 3QHFL 5GGVY 4E5XA 4A6YH 4HKXB 4O02L 5TDOA 1IZKA 2CDFA 5I1LB 4K71B 1C5DA 3KPNB 4HJJL 3RWJA 2JB6B 2GK0B 5FV1L 3OKEA 3H42L 4O9HH 3LAFA 3ZL4L 3FQUB 3LQZA 1MPAL 5C70A 4YDJA 2NY1C 4X8JB 1MH5A 1FRGL 2H32H 2X4RA 2CIKA 4YLQT 1N26A 2EZ0D 5KSAD 4N5EA 1ZTXL 3RI5F 1D9KC 3JTSA 4L8SC 4YQXL 4Q58C 1YEFL 3OB0H 5DUBB 4ERSL 1VACA 3QEQE 3LEXA 2R39A 1MHCA 5GSRA 1OD7A 5ALBH 4A6YL 3Q6GL 1MCKA 4JM4H 3L9RA 5HI3D 5BVJB 4PRPA 4ETQB 1JV5A 1UYWL 2VABA 5HHVH 4YBQC 4O9HL 5CGMA 2ZUVA 4R4BA 3GSXB 3UCRA 4WO4D 1WUNT 4BZYA 3FJTA 3UTSE 1BVZA 4Q0XH 4AL8H 4EN3A 1KJVB 3NTCL 4EBQL 1S9YA 4ELMA 3S34H 1DL7H 4RA0C 3DYPA 2PW1B 5C0AE 5DK3A 2VYRE 3VMPA 3DVGA 3PWUA 3QDME 4PTTA 12E8L 5DZLA 5CKAA 3X12A 1A9BB 3TZVC 2MTPA 4M4RA 3D3VB 3SDXF 5J6HA 5ALBL 5I75C 3ARDB 4KK8C 1QRND 1YEIH 1IAIH 2D9CA 1JYVA 4OTXH 2ZSVB 1A6AA 3ECBB 5E9DB 1JN6A 5HHVL 5CD3B 4OZIF 3KNBA 2EXWC 3P3YA 4HQQL 5D1XB 1Q72L 5SWZA 1AE6H 1DBJH 2FJHB 1FNEB 1R24A 4JHAH 1ACYH 4NDMA 5ANME 1JJUA 4AL8L 1N59B 3SJVB 5GGUA 1NKRA 3DURB 1WIPA 3O41A 2YC1B 1ZLUK 3VW3L 5DC0A 1SY6A 3TIEA 4Q97A 4KROB 1T22A 5J1TC 2WBJB 1R3JB 3H9ZA 1G6RA 2FB4H 2FO4A 1RI8A 3WIIL 1QSEE 4LOUD 2H9GA 4MYWB 2DKMA 4R97C 4M61B 1EJ6A 1MQKH 2W0PA 3ZLQC 3BI9X 1IAIL 3NCMA 4N8CH 2EEDA 2FD6H 3B2VH 5DXWA 3ALPA 1N6QH 5CGYC 4DKEH 1KULA 4MAYC 2EIBA 3KVQA 1INEH 3EOAA 5BRZA 3TVMD 1ACYL 2CPCA 5MEQB 1JGVH 3BE1L 1BWMA 5HHPB 4Y4KA 3BGMA 1Q0XH 4HIJB 3FQRB 5DDHB 3WIHH 2VZVA 3FO9A 4OCMC 3DLQR 1XGTB 4MJ5B 3OZ9H 1HEZA 1DUYA 3AB0C 1A1MB 2FATL 1JGDB 3GFUA 4P9MH 1MQKL 4L9LA 3RL1A 2YD8A 2HWZH 2VB5A 4NCDA 2FD6L 1H9VA 3B2VL 3MBEA 4LCUA 4P2OD 4XBEL 5F8QC 3U2SA 4JCMA 1FBIL 2DI9A 5D7LE 32C2A 1V3JA 1JHLH 1ODAA 4LF3A 4Y8DC 2HT4D 3AS1A 4M02A 2VKXA 1ZMYA 1S3KH 1INEL 4F7TB 1PZUB 5FOBA 4NRZA 3RWGA 4K71C 2JE8A 4JY6B 4J3TA 3VXRE 4K8RH 4ZUUA 3OB0K 3EYUH 5EO9A 4Z7VA 3WIHL 2ZG3A 2NXYD 2ZG1A 1NGZB 3PABB 3QFJD 2AJXL 3GSVB 3OZ9L 1U8HA 2XY1A 5A1AA 2OM5A 3SDXE 5C0CD 4P9ML 1CL7I 4UIMB 4Y0GA 3RVVD 5CP3H 2CR3A 2EDJA 3EDKA 5E5UB 4J12A 2OSLB 4IJ3B 1DLHA 1FNHA 1UB5A 5GRZA 1MY5A 4OZIE 1A6UH 4YEFA 1M7IA 1C1EL 1KT2A 2YBRB 4Q7DA 4U3HA 5GRJH 3GJFH 4AEEA 3NFSL 4CMHB 5JW3H 4KZEH 3JVGC 5TH2A 1NAMB 3IDJB 1BECA 3OHXB 5IMMA 3VXMA 1X7QB 4EDXB 2J4WH 4JVPA 3UC0H 1KPVA 4K8RL 3OX8B 1ZA3A 1T04A 3JV4B 5J9PA 2H8PA 3EGSA 3EYUL 2Z4QB 5EO0A 2VLRD 3CDFA 2NY7L 4WWKA 3ULVH 2MMXA 3DX9A 2WV3A 4OKVA 5HY9A 4V1DE 5L2KD 1CXFA 1SM3H 5I71C 1HHIB 1JTTA 4U6HB 5C08A 2PYEE 4P5MB 3BD4A 3VXUA 1MCCA 4G7VH 1FZOB 4NQSB 5F6HI 3VFMA 2R15A 1YMHB 2P48B 4TUKH 2NR6C 1T0MB 4D0CB 5GRJL 5JW3L 2HN7B 1NAMH 3MRKA 4NNXB 3FN3A 4APQA 3ARDC 1KB9J 4ZFZB 4AJ0A 3RL2A 5HPMB 4PGJA 5GS1A 4PY7A 3G6JB 2AEPH 1BF8A 3RP1A 2J4WL 3UC0L 1Q8MA 1P4BL 3LS4H 2HJFA 4GG8B 4OZHB 5D1XC 5EZJB 1CFQB 4YFLF 3ESUF 2V7NB 4DGYH 1L7TH 1U3ZA 2OTWA 3U9PL 3TH2T 4XPTL 3H0TA 4LIQH 4S1SL 1RSFA 4Z95H 1ZGLP 4JFDE 3QUZA 1NQBA 3OF6D 4KROC 2LVEA 2WBJC 4XMPH 4EI5B 3WEXA 4XCCH 3N85L 4MD4B 4WIQA 4Y19A 3C5ZD 4AIXA 3MJ9A 1PAMA 3BZFA 2X89A 3V8OA 2VLJA 1TQBB 1EIBA 1HXYA 1MOEA 3TA3A 5GHWH 4KI5F 4JRXD 3IDIB 1F3DH 5T1LB 2Q7YB 1INDL 1I9RH 1R5VB 2AEPL 1DN0A 3LKRB 3I3EA 1YY9D 4Y88A 3KPSA 3IDYB 4U4BA 5GGTH 5DO2D 2ITCB 4WI7A 3K7UA 1A1OB 2Y36L 5HYJB 2ICWB 2NY2B 4P3CL 3VFVA 3QQ4A 4NOBA 4JFEE 5C0ND 2VDOL 3L3HA 2JCCB 1S7TB 3V0WL 2QSTA 4KJPC 1R3HB 5EFIB 2IAMA 1C5CH 1B0RB 4WCYH 3PDOB 2Y5TB 2C1OB 4K8RC 4LIQL 2R1WB 3MV9D 5TDPB 4XC3H 4S11A 4K7FB 1KLUB 5C0GA 3KHQA 4ORZC 2LVCA 3ARXA 3MOAL 4XPHH 5JW4Q 2B4CH 4F37F 5DJ6B 2DYPD 4WFHE 1TJIH 4KJYB 5LJYH 3TH4T 4Q9CA 4NRYB 3DV6B 5IOPB 2RGSA 5CSZB 4BQ8A 3FT3A 3KJ4B 3RZCC 1RIUL 4AT6B 1UM6L 4MNHB 1XR8B 3NFNA 4WTZG 3V5HB 3NPZB 1JI2A 3RWCA 3VFNA 2VMFA 3BRDA 2F9BT 3MFFA 4L1DA 4X5XB 1J10A 5IFJB 2NY3B 1ND0A 3TCLB 1BP3B 1F4YH 3FT4B 4JO1L 5GRVK 1JNHB 3MA9L 3EYFA 1OTTC 4WCYL 3QSKB 3SDCC 1MHPH 5EZIL 3SY0A 4P46D 2CR6A 1UH3A 3BWAB 4I4WA 4ODUB 1MCQA 2OZ4A 5C0FB 3L3GA 4KMTL 3O4LD 5DFTA 1E4WL 2AABL 2B4CL 1T2QH 2EDEA 2YPKB 5BOZG 1WBXB 2OTUB 1OF2A 3IKCB 5MI0B 5E2WH 5IM7B 1TJIL 4MDIB 2D9QB 5C07E 1I7ZA 1CT8A 4Q9QH 1NC4D 1BJ8A 3LEVL 4ZNEA 5EN2A 5K59F 1CIUA 1T83C 2NY4D 2PXYB 5EU6E 4IJ3C 4WTZA 2PR4L 3OR7A 1F2XK 3V4VH 1ZGLA 4GRLC 4L29B 2H26B 2QL1A 4N0UB 3S36L 4CMHC 3MGOA 3PQYB 3ZKND 1LO4H 1U8MA 4YGVA 2XN9E 1M7DA 1Z6JT 2VRAA 4M7KH 2XWTB 2VDNL 4RMRA 3D0VB 1X4YA 4MZ3A 2O93L 2DQGL 1UZ6F 5CZXD 3QUXA 5D96B 3MRDA 3QEGH 5A2FA 2J8OA 1FSKB 5T3XD 4IRSD 4YHYB 2GTZB 4UV4H 3X11A 3NABH 3ES6A 1T2QL 3OKNB 4UIKH 3VXNB 2RJMA 3BJ91 2P46B 2G75A 3E8UH 5E2WL 3SDDA 2H6PA 4Q9QL 3O2DH 4XXCC 3REWB 3WE6A 1G9NH 3BKYH 4KI5E 3LKSB 2DQIH 1WK0A 3CIQA 2P4AB 4QRTB 2DJSA 4RX4D 1V5JA 1SYSB 2Q20A 3JWDH 2R23B 4X0KA 5LQBH 1MI5A 2BZDA 4PJBA 4U3XA 4C56B 3IJSA 2BVOA 2DTSA 4XVUD 4NO0A 4OLWH 3L3KB 4WUUB 1UH2A 3MCLH 2CIIA 3O2WH 4M7KL 2NZIA 3MREB 4I0PA 5HHMB 2QBWA 3O6LL 5D2NB 2QR0B 4EVNA 4HAFA 2W38A 2HFEB 3IFPA 1Z2KA 4EUPG 5HHNB 1N6UA 1ES0B 4I5BB 3NABL 5KSVA 4ONGH 4MLIA 5FYKU 4M1CD 1T3FA 1TDQA 5EPMB 3O2DL 1P84K 4S0UC 3BKYL 1ZVHA 4HSQA 4BUHA 3K4ZA 4EI5C 4ODSH 1AGBA 4JZNB 2XZCL 2PETA 3MNVA 4NGHH 4P48A 3QWQB 1LK3L 4PGCB 3SDAB 2B4CC 2X4PB 1A3RL 3O3AA 4LCWA 4UTAH 1MFBH 3HAEG 3RY4A 5FYJU 1B4JL 3AM8C 1TQBC 2NLJA 3O2WL 3HC3H 3M45A 4HUXA 3UTPD 3NIFF 3EFDL 3IDYC 3ME0A 3VXOB 1DSFL 1HH9A 4EUPA 1BLNA 1HNFA 1G6VK 2OMNA 5BMFH 1IAIM 1RJYB 2NY2C 3S37L 5GGRA 4AEFA 2YD1A 1F11A 4QXTB 1A6WH 1EZVY 5E94A 2YEZB 1IAKB 1WZMA 4CVWA 1OQOA 3VD4A 4PRPE 3IJYB 5K59E 1WAAA 4QY8B 1MCJA 4FFVD 5ICXB 3QI9D 3S88H 3TFKC 3V8CA 4AY0A 1VKXB 1G7JA 3QXDA 5BQ7A 1TCMA 4OLZH 4PB0L 3VFSB 4XTRD 2HG5A 1MFBL 2NNAA 3GSUB 3GB7B 3PWPB 4ELME 2IMMA 3IRZA 2VKWA 3KJ4C 2NCMA 1V3MA 8FABA 1UZ6E 2VOTA 1MF2H 4Z7VF 1GYAA 4NO5B 3RWFA 3TC9A 5JMOC 4YK4B 5BS0A 5C71A 3E3QC 4ZSOB 5ESQA 2ZUYA 4O00A 5F7UA 2NY3C 1A6WL 4MJID 5BZWB 1S7SB 3HR6A 1TCRB 5I17A 1I9JL 5EIIB 2XOTA 4LRNL 1FIGH 2JJTC 3ARGB 4JVUA 4FQ2H 5FCUL 4NHUB 1D5ZB 1PQZA 4GQPH 3O8XA 3L5JA 3S88L 3PWVB 4Z77A 1K8IB 4OLZL 1BQHG 4QOKA 5SWZE 2A6KB 2RFXA 2R29L 5MI0C 3OL2A 4BH7A 2E7LC 2DQJH 4OD3H 4G42B 1LWRA 3W82A 1JHKL 2OQJA 4LHUG 3PF2A 2PXYC 5KVEL 4GMTH 5T3ZE 1AKJA 4KWUA 4PR5A 4IS6A 3HE7D 1KB5A 4ZXBA 4JRWA 3IRPX 1IGTB 3JWDC 4L8CB 4NYLB 3NIGF 5IVZB 1DDHB 1LO5A 1IJ9A 2EE6A 1X6NA 4CDGC 4M03A 1MY7A 1XCTB 3MO1B 1YYMH 3DWTA 5I1EH 5FO7B 2YPLD 1MIEH 4KMQA 2HH0L 1YJDH 1PFCA 1S78D 2BVYA 2O5ZH 5B4MD 4M7LL 2GSIB 4YHIB 5D96C 2R2EA 3UJJH 1NUFA 1FSKC 3WNKA 4YHYC 1SBBA 4R3SB 1LEGA 1NCWH 1KC5L 3ZKXB 5BJTB 1U8KB 4PRHA 1NCTA 2MCPL 3GMLB 5BRZE 4DTGH 5KG9A 4QTHB 2B39A 4QRPB 1NFIA 4XCEA 1ZLWH 3MV11 4L8BA 5AWNH 5D7SH 4GQ9H 1X5KA 2OLDA 2ICEB 2Y6SD 4J3OC 5GZOD 3NIFE 4M1GL 5D7IB 5KS9A 1FFPB 1IGCL 2APXA 4KHTH 2AXJA 2ZKHL 4IM8A 2ZSWB 4CNIA 3K1DA 2EDNA 1FL6B 1YYML 4DGVH 4HDIB 5I1EL 1UJ3B 4HF5H 5L88H 1MIEL 4ODBD 3MRHA 1Y6KR 2DDQL 3I6LD 1OGAA 1NC2D 4FQHB 5D2NC 5DT1L 5GPRA 1S9KC 5JUEH 4GFTB 3QEQD 1HCVA 2C3VB 5DK0A 5DVOA 5LGJB 3KPOB 3D85D 3HUJB 3EYOA 3P73B 1RHHA 1NLBL 3DX8A 3IFOA 3JWNC 4CU6A 2YS4A 4E42B 4DTGL 5FA3A 5AWNL 4GQ9L 2DN7A 1IGMH 3B6SB 3ZDXF 4TQEL 3I2CH 4BJLA 3L7EA 1I3VA 3SDAC 1K85A 5EU7E 4Z7VE 3UTSD 4KHTL 5C2BL 5DS8A 1GOGA 3BH8B 2A0LC 3O11B 4JFPA 4JAMA 4NFCA 4HF5L 5C0AD 5L88L 2P47B 2RB8A 2R0ZH 4WNQB 4R8WH 4OM1L 4ZQKB 5L8KB 1MCDA 3X3GH 1DQQB 5JUEL 4JFOA 1II4E 1P7QB 3DXAB 4GRWH 4ODVH 1EBPA 4NNPL 2YWYA 1BOGB 1G7HB 3RNKA 1BFVH 3MXVH 1FFQA 1BFOA 2GUOB 3GMPB 3MJ7A 1SJVA 5E5RB 1A6PA 2ARJQ 2VQ1B 3KPNA 3OJDB 3SQOL 4LASH 3VXME 2JB6A 1PYWB 4LLUB 4HJ0D 1KNOB 3P11H 4ELKB 4I9WE 1T7VA 2ADFL 3FQUA 1WWCA 3I2CL 5JO5B 5KVFH 2Z8VC 2CDGB 3NIGE 5I19L 4OD2B 2ADIB 3FAXA 4ZAKA 5KOVC 4WHTA 3U0PB 5DD0H 1OP9A 4PJFB 5C08E 1OAYH 1P4IL 2IPTL 2P8LB 4R8WL 4ZO9A 3CFJB 1BEYH 3VU2A 3VXUE 3X3GL 1FDLH 4YK4C 4P2RA 1QSED 3HS0B 4FFWD 5E8DH 1QKZH 4D3CL 5T1KB 1NUNB 4E41A 1HCFX 1BFVL 1UQSB 4YWGH 3K8MA 1TIUA 5FA4A 5BVJA 4DCQB 4ETQA 4Z76B 3ARGC 5F9AC 2AGJH 4LFHG 4JFXA 2Y72A 4OCRL 5D7KE 4TTDC 3MODH 2CLZA 3D69B 4C59B 3GSXA 4BQ9A 2GTWA 3P30H 5KVFL 1FZKA 1RUKH 3TPUB 1BQLH 5F7EH 3VWKB 2OP4H 2VH5H 1KJVA 2CXGA 2FYYB 2PW1A 4Z7UF 5J1AB 5C9KA 3HC4H 5E08H 3MLUH 5CJ8A 1NUDA 1CD0A 1BEYL 5LWYH 2BY2A 2VL5B 1FDLL 5IBLD 1A9BA 1S8DB 1Q9WB 4OCSL 4Y19E 1JGUL 3D3VA 4TPRL 1J1XH 1ZLWK 3ARDA 3VFPA 3ZSTA 5HGHA 4DK3A 2A1WL 2VLJE 2X4TA 4O5LH 3MGTB 2NYYD 1VPOH 5D7LD 1WFNA 2AGJL 1H3GA 1XF1A 3KPSE 3MODL 3BDBA 4O4YL 1N7MH 2EDTA 4Z9KB 3P30L 4HWBH 3CVIL 2IG2H 3KPQB 5DEGB 1PZ5B 1N59A 5M94B 1AJ7H 3VXRD 5L9DL 1WLHA 4TOYH 3LV3A 4LARL 3P4LA 3HC4L 5E08L 3MLUL 1CG9B 1EGJH 4FTVB 5HJ3B 4I0CC 1R3JA 2GIYA 4U33A 1VEPA 5LWYL 2P44B 4G6AC 1I85A 2JJSC 2OBGA 1UJ3C 3DVNB 1FYTB 2BY3A 4M61A 3X13B 4FXKB 3S3PA 1E27B 2ZOLB 4X7SH 4O5LL 4OM0H 3N1GC 1H3TA 5DJ2A 1CZ8H 2HT3D 4CGTA 2A77H 2UV3A 5EOQH 1G0YR 4HWBL 1HHJB 3O3DB 4KKLC 4XNQA 4JANB 4J3SA 3LD8B 2VN7A 3U4BH 4LLMA 4U1JB 4RIRB 4HIJA 4D0DA 3FQWA 1GZQB 1CFNB 2FIKA 1KXTB 3IVKB 2AAVA 1I9IH 4NQXB 5JORB 1XGTA 4EQ3A 4IRZH 4I8DA 3RUGB 4QHKI 4V1DD 5TDNB 1AQDB 5DLML 4KV5F 1QPPA 3KHOA 1JGDA 4YX2L 3RVXC 1OTUD 3QDJB 2CUHA 1FL5B 3P0GB 1BVLB 1CXKA 2O5YH 4ZNEE 1AO7B 1MFAH 1WAAF 5F8RC 4GLRI 3L5HA 4YHZL 5GISH 2V5SA 2A77L 3OSKA 5SX4H 4JGUA 1HN1A 4XB7A 4F7TA 3S3SA 3MZTA 1T7ZA 3U4BL 5AG8A 3PDGA 1P2CB 5IQ7H 4MQXC 2PTTB 2QADD 4PJGB 2X9YA 5I9QB 2WM0A 1NMBH 3NIDF 5JA8B 4UILL 4WI8A 5GJTH 3PABA 1AD0A 1EMTL 4KK9C 4IRZL 1JNLH 4XX1G 3BJLA 1KTLB 3ZKMD 4BH8B 5DK2A 4TULH 4X7EC 1JWMA 1S5HB 2X4UB 4O2FA 4UIMA 1Z5LB 4JFDD 3MTRA 3JV0A 1OD9A 3S4SB 3AMKA 1RY7B 2F8XC 3BT2H 3G6AB 3HB3D 4OLVH 4I1NB 5GJSL 1I3GL 5ID1B 1MI5E 4PJBE 5I74B 2HTLD 5D1ZA 5J06A 2VDLH 3C6LA 1S9WB 4HK3N 4HGWB 1YA5A 1LE5B 2B2XH 2UYLA 1TJGH 2YWZA 3VFTB 3OX8A 2Z4QA 1H3UA 1J18A 1QZ1A 5GJTL 4QRRA 1AHWA 1IT9L 4U6YB 4JFED 5DC4B 4YHNB 3VWKC 1BPVA 3QWRA 1SJEB 1HHIA 4E9LA 1G7QA 2XI9A 4XWGL 5D6DC 5LGKA 3GIZL 5C0JB 5DD5H 5DJXA 4P5MA 1N2RB 1D5IH 1IC5H 1XFPA 2XQBH 4LSUH 1FZOA 3B43A 3IAGC 4NQSA 2IGFH 1I8MB 1YMHA 1T0MA 4OLVL 4D0CA 2EH7H 4WFHD 1I1YB 1ZOXA 2HN7A 3H3KA 4LCWE 2YRZA 1AR1C 5BXFB 5AG9A 2VDLL 4PG9B 2AP2A 3IGAA 3G6JA 1IKNA 4YDKL 5KS9F 4FQIH 1HXMB 2FH8A 2C4FU 3VWJD 4OZHA 1RIVL 2NXYB 2UZYB 3GGWB 1FORL 5ESAB 2R2BA 3LPFA 3WHXB 3EOBB 4TN9A 1KJ2A 2FCBA 3R06B 1I3UA 2Y25A 4PJ8D 2ADGB 1CD1B 3MUJA 4Z78B 1WAAE 1D5IL 1IC5L 3FTGB 1UWEL 2IGFL 4KUZH 5EC1B 5CINL 3H9HB 5C07D 2BSSB 1I8KA 2GJ6E 4LKCA 3VJ6A 4W81A 3ARFD 2VXVH 3HN3A 4XHJD 3IDIA 4LSPH 2ENSA 3LCYA 5EU6D 1R5VA 3BVNB 1YPZA 3LKRA 2XNAA 3EO1A 1QSZA 4R90L 1I1AB 2V9QA 3NIDE 1Z9SA 5ADOH 5HYJA 2ICWA 4F7CA 4JPKH 5BS0E 5D93B 3VXSB 4HPOH 5IB1B 3LD8C 4KZDH 5CLWA 2JCCA 2ZZUT 1R3HA 5EFIA 1FAKT 1TMCB 3PDOA 2C1OA 1IC7H 5CP7B 2AJYH 5FDWB 5C9JB 3GKZA 5TDPA 3ARED 1I75A 2EYRB 3QIBB 4LPUA 4K7FA 5DJZB 4LHJB 1W2KT 2BSTB 3RKDD 4IOFD 1DEEB 4QOKE 2O61B 3QWOA 1UXWB 4KJYA 1XAUA 4P3WA 3DV6A 5IOPA 4KI5D 1LHZA 2FX8L 3RX8A 4ZODA 5CSZA 1WIUA 1IFHL 5GS2D 5CFHA 3PGDB 1E0OB 4UT6L 1S5IL 4AT6A 1J05B 3ULUL 1N0LA 4ZUVA 1XGUB 3V5HA 3MLVH 3E3QA 1VFUA 4G9DB 3CXDL 5JZ7D 4HPOL 3TCLA 2VLLB 1RUPL 3UPCA 5JOFA 1JNHA 1I8IB 3N0PB 5FGBC 4P5KB 4KQ3H 5E95B 4BFGA 3BGAA 2X70B 4M7LT 3QUMB 2JJTA 5B21A 2Z8WC 1IAII 5I9QC 4OF7A 4Y5VB 1KCRH 1AIFB 5F9WB 1B2WH 5L7XH 3L95A 4YUEL 3C5ZB 2YPKA 5E7BA 3PWNA 2OTUA 4KI1A 5EU5A 5JMRA 4HIEB 5IM7A 1WBZB 1OW0A 4PRHE 1JBJA 5JPMA 4JRXB 4DFHA 4X6CA 1KYOJ 5A2KH 1YN7A 3LQAL 4KJQD 1DTUA 1CGUA 1DZBA 2H26A 1MCLA 1QEWB 5DD3H 5KS9E 5I74C 2A83B 1PVHA 4M5YH 4X7FC 4HAGA 3ZSSA 1U36A 4NQEA 2A6IB 4WFEE 3QUMH 3ZT5A 1OGAE 3IB4A 4JR9L 2EO9A 1BZ7B 4Q9BA 4Y16B 4YXHH 2AVGA 4B50A 2GTZA 3KLHD 3H9SB 4U1SA 4GKNB 5KAQG 2DYPB 3GM0A 3FN0H 4KTDH 2X6MA 2F5AH 2R69H 4PRPD 3G5YB 4X4MA 1X5JA 1MCHA 2F54B 4X80H 4QRTA 4ZTOH 1SYSA 2VDQH 3E1F1 4M1DL 2A2QT 5E00A 5DD3L 4C56A 4EN3D 2ATPB 1A14L 3CU1A 4NFDA 1HHKB 3L3KA 5T5NF 2D03H 5IV2B 3DMMD 4QT5B 2EDYA 1U8LA 5AYUH 5FXCH 2NXYC 1U91B 2Q8BH 5HHNA 2BDNH 1ES0A 4JO2H 4S1DD 4I5BA 4KRPD 1JF1B 5LBSL 5DQ9A 4NQCA 1CGYA 5GRYA 4U7MA 1A4KB 3F7QA 1T1YB 5EPMA 4XNYL 1SEQH 5E8PB 1RAMA 3RVVC 1MLBB 1NFDA 4KMLB 4ZTOL 5F3HA 2VDQL 3VDAA 5ID0B 1IARB 1U8JA 2QQNH 4PGCA 1ZK9A 5SWZD 1G1CA 1HYSD 1CTNA 3MBXH 4FQXA 5HDQL 4TNVK 2DRUA 1WEJH 2QSCL 3OKMA 1ZT1B 1QFWH 5J12B 4CVXB 1I1AC 5AYUL 3I9GL 1FAIL 3ALWA 4IDJH 2Q8BL 4P2RE 3NFPA 3GSQA 2FZ3A 2BDNL 4IRSB 4M7JL 3VRJB 4QXTA 4WI4A 5D93C 3W0WB 2I5YL 4E41E 1EJOL 1ZANL 1IAKA 1JGEB 1SEQL 1WBYB 3VFRB 3IJYA 4N68A 2XWJB 1L9MA 1A7OH 3QIBC 1YMMB 5ICXA 1HHHB 4FXGB 4HS6B 4IRJA 4M6OH 3T2QA 3MBXL 4PP2B 5BRZD 2QQKH 3VFSA 2DMKA 4JRYA 3MLPA 1KN4H 3GSUA 5F72S 3CX5J 4Y4KD 3CFCH 4LSQL 1WEJL 1YYLH 5GRUH 4L3CB 1QFWL 3DO3A 5K9QI 5KN5B 2OCFD 4NO5A 2FWOA 43CAA 4HPYH 4LDEB 4RWHA 5DA4A 4ZSOA 2IC2A 5A3IC 1RUAL 3HCVB 5C0IB 3D3VE 1BVKA 3MR9A 1FQ9C 2NX5B 3ORJA 4JDVB 3H8NA 3MBED 2ZCHH 4NHUA 4FFZH 1D5ZA 1YNTA 4PRAB 4Y5VC 2PF6A 1JPTL 1DE4B 1KXQE 4NBXB 5F9WC 3PWVA 3UTOA 4RAVA 4L4TB 2ZJSH 3C5ZC 3UTTA 1Q0YH 5E6IB 4HH9B 2A6KA 1J0YA 2QQKL 4OQTA 1R3IH 3RHWF 1RUML 2GCYA 4JN1H 4G42A 3UEZA 1JWSA 4KHXL 1QD0A 3CFCL 1V7MH 4LP5A 4H25A 3QNYB 1OCWL 5GRUL 1YY9C 5IEKB 4CMMB 5ABDE 5F70A 3LRSB 1IGTA 1HSAA 2K3TA 3QEUB 4NYLA 5DO2C 4L8CA 1DDHA 2AEQH 2HTKC 3VA6A 4JHWL 3LS5L 3DUUB 5C1MB 1RURH 1U93B 3I6KB 2V7HA 4ZD3H 5B38B 5TE6H 4YHIA 2IBZX 1IBGH 3SGJC 3B9DA 2ZCHL 5DVNA 2GAZB 2WIMA 4Y16C 3QI9B 4HV8B 3HHRB 1XF2B 4U6VL 2EIEA 2OJZL 4R3SA 1Q0YL 2G60H 1R3IL 4QTHA 3VXMD 3FAWA 4GBXA 1VB9A 4DKFH 4LPCA 3G6JF 4DN3L 3NZHL 3UTQB 1CXHA 4W4OC 3U7YH 4I9WD 2ICEA 1PY4A 5C0BB 1RK0B 4DN4H 4OZHF 4WWKD 2WP3T 1KCVH 2AEQL 4F33B 1EO5A 3PGCA 2IFFH 3HZKA 1MRDL 4HDIA 3V6FB 2JJSA 4FQJL 1UT9A 5C08D 1RURL 3EDEA 5DRZB 1G7IB 4ONHA 4ZD3L 1F6LL 5CILL 1IBGL 3P2TA 3BPLB 3V6ZB 5DURB 1B0WA 4QHLB 2C3VA 3ARVA 4HK3J 2X4NA 4DUXA 3QCUL 3KPOA 3HUJA 2F8VA 2WLZA 4H26B 4APQD 2F53B 2G60L 2ICWI 4KDTA 4E42A 4XH2B 1XF3A 3ZKSD 1YPZF 5D7KD 2Z8SA 4Y2DB 3B6SA 2JELL 2DD8L 3HE7B 1KJ3L 4YHOH 1UGNA 1KG0A 4B5EA 4F80A 5I1KL 1KCVL 4XMLH 5CGTA 5FOJA 3QAZB 5TQ2H 2JB5H 3BH8A 3O11A 4R7DA 4PY8I 4KRMB 2JCCF 2YPLB 2BY0A 2X10A 1VFAB 4WNQA 3EYQC 4R4FH 5J12C 4DZBB 1IGJB 4LMQE 5CZXC 4LVHB 1NLDH 3P9WB 4Y4HA 4HFUH 1DQQA 1XZ0B 4F3FA 4IRSC 5DHVB 1HSBA 4BZ1H 2Q7NA 4J3WA 3TO4B 4RMUA 1BOGA 3JTTB 2OK0H 2X89D 4U1GB 4P0DA 4LPYA 4UV7H 2VLJD 1TZIB 4JFQB 3OJDA 3SGEH 3BXNA 2J6EL 4LLUA 2B0SH 1K9TA 1KNOA 3EOYG 3KPSD 4ETYA 1Z3GL 3PHOA 4JY5H 4ELKA 3GDBA 4YHOL 5EORL 2XRAL 3HI6H 4XCNA 2CLVA 2LTQC 4XX1E 5ELIA 1PLGH 4LCCB 4QRRE 2ADIA 4XVUC 3VD3A 2EIZB 2XZQH 2EYTA 3SGKC 2VQUA 4FABL 3QH3A 3IU4H 3ARBD 1F90L 1JF5A 1NLDL 5C0DA 1UACL 4YHLH 4IHOB 3EFFA 3NCBB 5DHVH 2LU7A 2C3HA 1MLCB 4BZ1L 4HS3B 4P23A 3V4UH 4JKMA 3D85B 1TJHL 5T1KA 1VFBB 2OK0L 3DROB 3ZTJG 1UQSA 4UV7L 1XCQB 3S97C 1MVFA 4RNRB 1ZAGA 4TTGA 4DCQA 4X6CF 3G6JE 3IXTA 3OKDB 2ITDB 4JDTH 5FO9B 3D69A 4Z7WB 1T5XB 4JY5L 4HKBA 4H20H 4MWFB 4YIQA 3WFCH 1NGYB 2BVEA 3HI6L 4OZHE 5E6IC 4RFOH 2ED9A 1FLRH 5ILTL 5DJAA 2PTVA 1WT5C 3RGVD 3QDMB 5L6YH 3FQXB 3W9DB 4HHAA 1FN4A 1A7NH 2DQFB 5K9OA 5T5FH 1NEZA 2VL5A 1D6VH 1S8DA 4MZ2A 3UMTA 3V4UL 2GJJA 4QO1A 1A3QA 4HZAA 3C6SA 1QVOA 4H88H 5FO8B 1L0QA 2E6JA 1YPZE 5HYQB 1HH6A 3QI9C 1NMAH 1X4ZA 3L3IB 2A9MH 2HMID 1VDGA 5J4MA 4HFWB 1F4AA 1NCBH 5CJQH 5ANMB 5IF0A 3GK8H 1M71A 3KPQA 1PZ5A 2VC2L 4RFOL 5HYJE 2EE2A 4XTRC 4MA3A 2M26A 1JFQH 2NTSP 4CW1A 3I3BA 3R1GL 2EDHA 2JCCE 1UCBH 3ARRA 5EBLB 3CUPB 1Q1JH 3S96B 5L6YL 1E6JH 2F58L 1G7LA 3QJFB 3QUXD 4KK6D 3TBVA 1CG9A 2NY5H 4FTVA 4ZTPH 1DBMH 1BIIB 5T5FL 3FONA 3A0OA 1IGYA 1OVZA 5HI4D 1MJ7H 4Y5XA 4C57C 1F8TL 4I3RH 3DVNA 2FNBA 3PWLA 2I24N 1GOHA 3X13A 3SDDD 5F96H 4FXKA 2IMNA 1E27A 2YD4A 5H94A 4N0YH 4H88L 4ACPA 3V95A 1B3JA 2NQCA 2W9DH 2LU4A 3BPLC 2DQDH 3AY4A 1MI5D 1JHTA 3IXAB 3DYMA 1DBBH 3AU1B 1F00I 3BIBX 1NCBL 1HHJA 3O3DA 3QO1B 2YK1L 4POZC 5CJQL 3NVQA 3E3QE 4BM7A 2V2TB 1TZGH 1KELL 4NO0D 1CDYA 3HZVB 4JM2A 5EC2A 5IBTL 2EC9T 4I0PD 1KPUB 3C9NA 4NQVB 1EFXB 3G04A 1Q1JL 5MEPB 4RIRA 2EDBA 3C60A 1E6JL 1RZFH 1CDCA 4JPVL 3HE7C 2IQAB 3LKPA 2NY5L 5GS3A 3V0AC 4U1KA 3OWEA 3GI9H 5JORA 15C8H 2BCKA 4OB5H 3QAZC 1A02N 5TDNA 1N64H 1YQVH 5FUZH 2I27N 4NCC1 3OB8A 3MGAA 4OJFL 2W65A 3RTQA 2ERJC 1S78C 4LSTH 5B4MC 1BVLA 5E56A 4N0YL 1C5BH 1AO7A 4X98B 1T4KB 4LVHC 4X6CE 4OLUH 2ADJB 4HUKB 5DZOA 2DLIA 1PKQB 3S4SG 1HWHB 3TO4C 3U1SL 1NGQL 4LCWD 2PKDA 4U1GC 2Z35B 1HILA 3N1QC 4JE4B 1EPFA 4MA1C 2IADA 3CU7A 4NNYB 1WFTA 3G9VA 2X4OB 1P2CA 4GRMB 1GRWA 2P8MB 4NQEE 1F13A 4R7NA 2PTTA 2Y6SC 3OTTA 1SJHB 5IK3B 2HVKB 5GZOC 1BIHA 3HNVH 3O9WB 43C9A 3E0GA 4KAQH 3AMLA 4U0RB 4MS8A 3C8KA 4LCCC 1N64L 1KTLA 3Q3GA 3SDXB 2D7PA 5E8NB 4HLJA 1S5HA 2X4UA 5IJKA 1D5XB 1Z5LA 1J0IA 3QCTL 4X4ME 3RBGA 3T77A 1GGBH 4GAGH 5DQJB 1I3RB 3G6AA 5IW1A 5CJBA 4HWUA 5ACLA 4F2MB 4AIOA 2CO7B 4BK4A 4B0MM 4C56E 2GJ6D 1QFWM 4P4KB 5EIQA 1CYGA 5HGAB 4JN2A 3DJ9A 3OR6B 3WO4B 2YD2A 4Z8FH 1YDPA 2YSSB 1D9KD 1OWRM 1QSFA 4ZS7H 3VFTA 4XBGB 4KVCH 3RPKA 4F9PA 3BX7C 3GKWL 3LEYH 5BS0D 3HI5L 4EIZC 3VGGA 4YHNA 4V1DB 1OLLA 3ARTA 1SJEA 4NQCE 2VAAA 2DLGA 4AENA 1CE6B 1IMHC 1EUTA 4XP1L 1ZS8B 5C0JA 2PYEB 5H2BB 3SCMB 1N2RA 3HZMA 2NY5C 4LLWB 2W60B 4YBQD 2R4SH 1NFDE 1GGBL 4KPHL 5GRWA 4F57L 1T89C 1PJ9A 2BNQD 3VE0A 4QOKD 3L6FB 4IOIA 1HWGB 3PHSA 2YN5A 4CN4A 4NZUL 4X83A 5BXFA 4PD4J 4XP5H 2N7AA 4JFFD 1AKJD 5JDSB 4XPAH 5CZVH 4NUGH 3EDDA 4ZXBD 2QADB 3P4OB 1IC1A 4JFHE 4XI5C 5D7IF 5I0DA 3U4EB 1XMWA 1HXMA 2X7LB 4FXLA 3TZVD 1FC1A 1A6TB 3WHXA 2CO6B 3EOBA 5CS7A 1RZ8B 4QHMB 4BQCA 4KK8D 2BK8A 2NZ9C 3R06A 1TTFA 2ADGA 2KL6A 4YPGB 1L7IH 5J3HD 3IU3A 2AERT 3FTGA 2FHCA 1Q9OA 1BX2B 1RJZA 4ISVB 1H5BA 2EXWD 3Q1SL 4HMCA 4G6JH 4FFWC 1I1RA 3HUJF 2E27L 3DIFB 4OFKA 5BV7H 2QQLH 4PRHD 2OR7A 3EO9L 2BSSA 4LHUD 4JRYE 3SKUD 1K6QH 4X7DC 3NACH 4F8QA 1LILA 4XP5L 5CZKA 3UDWC 4JVWA 4MNQD 2PW2A 1U95B 2ICCA 3GBNH 5H35B 2EICA 5A40E 1OQXA 4CL7A 1N5YH 1X5FA 2HFTA 4XPAL 1I1AA 1NCDL 5ETUB 1ADQH 5C0EB 5JHLH 2YKLH 2X1OA 2VITB 3QG7L 4JFEB 4ZSOE 3TCXA 3O3BA 1E4XH 2X2YA 1VA9A 3TJHA 4XPGH 4ZS6C 4WFED 3RDTB 1OGAD 5FB8B 3C09B 1Z9LA 3FQNA 5FDWA 3OJMB 1S7VB 5TQ0H 1L7IL 3QIBA 3ROOB 4NHUE 1YZZA 1DUZB 5CGYD 2BSTA 3S9DB 1DEEA 5J7CC 1IQWL 4LEXH 4MAYD 1HKLH 3GBLA 4MVBA 3UTTE 1KEML 1U58A 5E70A 3TT1L 5I30H 2O61A 4O2CA 1UXWA 1IM9A 2D0GA 2X4SB 1P4LA 5HTSA 3NACL 1MAMH 3PGDA 2FRGP 3DOSA 4J1UA 4URTB 5I1JH 2IBZY 3GI8L 2V5TA 2FHFA 1XGUA 3CMGA 1NCAL 4JKLA 1ADQL 5J8OA 1MJ8L 4HS8H 5JHLL 4LEOB 2YKLL 3BQUA 5EUOB 1TVDA 2VZ3A 1E4XL 4RDQG 4WFFE 4NC1E 4PJFF 1I8IA 3I75A 3IF1B 3TV3H 4P5KA 5DGRA 2CMRL 5TQ0L 1INQB 3O9WC 3O6KL 1AIFA 4KKCC 4U0RC 1MHEB 5CHNA 1MFEH 2Z92B 1UM4L 3ARZA 5D7JB 5ITFA 3E2HC 3BESR 5FYJL 1ZVYA 4HIEA 4HX1B 3MLSH 3QCVH 3NOIA 1KJMB 3ARFB 1AH1A 3TF7A 5IB4B 3IS0X 4CN1A 4FQCH 5D1QA 4KKAC 3PGFL 3U46B 1FLTX 1OGTB 4JY4A 2E7CA 3NZ8B 4HS8L 3T3ME 5JDJA 1B0GA 8CGTA 1T1WA 2XN9B 4P4KC 2W0LA 4D9LL 2W91A 2D4DA 2E9BA 4Y5YA 3WO4C 5TE4H 4NSKA 3DRTB 5IMKA 4Y16A 2C26A 3H9SA 2YUZA 5FCSH 2NTFB 3HUJE 4OZ4B 4UDTB 2BMKB 1J0KA 2LE9A 3H7BA 1UKQA 3MLSL 4PPTA 5DFWH 2VZOA 3QCVL 1OARH 2WY3A 4AK1A 5DUPH 4NM8H 2WMPA 3SCMC 4A2MA 3C8DA 2F54A 1QHPA 4LPWA 4W4OA 4PRDB 2DTMH 4HT1L 1SMAA 4XPBL 4PREB 5AEAA 2JIXB 5CJXC 2A73A 3MV8A 5CEZL 3I84A 1AGFB 1BJ1H 2IWGA 1CXEA 3T1FA 5TF1L 4LCYA 4FHBD 3HI1B 5IV2A 5TE4L 4R6UA 2QADC 2D0HA 1FC2D 4PIRF 4YHMH 2FX7H 2NR6D 1J12A 5ACZA 4KQ4H 3D3VD 3IETA 4E5XB 3BUYB 3ARDD 4XNUL 5TDOB 1T1YA 5SX4I 1N5AA 3RWJB 5E8PA 5JIHA 3B9AA 1MLBA 3ILQD 1KPRB 5E9DD 5GS2H 3CCHB 4FS0A 3OKEB 4OKDA 2DTML 3P0YH 5AYQA 3VFGH 1FYHB 4ESKA 5CIPA 5D1XD 3WHE0 2WUBH 1JFMA 1F45A 1AC6A 3ARQA 4J4PC 4D9QE 1NDGA 4JM2F 3S5LA 2APWA 5JR1H 1EV2E 2Q6WA 3W5MA 3JTSB 4NHCL 4KROD 2WBJD 3VD9A 5E4IA 1LE9B 5FIEA 1P6FA 2QKIA 2FX7L 3EYSH 4YHKH 4YHML 3RUGF 3LEXB 4NKIL 4WU7A 3LHPH 4KQ4L 3SDYH 2KKQA 3W0WA 5K33A 3L9RB 3C09C 5EG6C 3LIZH 4YEEA 4PRPB 3F7RA 5I18L 1JV5B 2XWJA 2VABB 1YMMA 3D6GA 2Z91A 1HHGB 4R4BB 4FXGA 2HKFH 5LG1A 2WUBL 4PP2A 1OM3H 1XEDA 4ELMB 3E6FA 1CN4A 5GXBB 5D6CA 4F15B 5HHXL 5JR1L 4K8RD 5JXEA 4L3CA 4PTTB 3QRGH 4HWZA 4PJGF 2AK1H 5KVDH 3BHBA 3J8F7 3X12B 4K94H 3AS2A 3QFDA 3HCVA 4I2XA 1CIDA 1H8OA 2UWEB 1J8HB 5C0IA 5E7FA 3NAAH 2NX5A 4M8VA 1JRHH 4JDVA 3LIZL 4Z5RA 3LKNA 1U6AH 2AW2A 1JN6B 5B38G 1DE4A 1F3RB 4K2UH 3KNBB 1A2YA 3MLWH 1CK0H 4YXLH 5D7JC 3BD5A 4FOMA 5E6IA 1R24B 4X6DA 1BQUA 1NGXB 4AIZB 2JJWA 3ARFC 1AXTH 5HHQA 3K80A 5JW4R 4PV9B 5GGUB 2DLEA 1QO3A 2P5WA 4IMKA 5IEKA 4DGIL 2YRLA 5J6GA 4QRSB 2MWCA 1CLYL 2AK1L 3TIEB 4FTVE 3QEUA 3KDMB 4TVPL 2ZP0T 5C6TL 4EI6B 2FO4B 4K94L 1ULVA 2DWDB 3KR3L 1IRAY 3CXHJ 5DUMH 1LQSR 4WDIA 4G3YH 3VFOB 5D72H 4N5UA 4W6WB 4N1HB 2D7NA 4WEMB 2GAZA 3MX0A 4LVOB 2CGRH 1XF2A 2FECI 4OI9A 3RKDC 4MB5A 5IKCA 3LOWA 2CK0H 5FM8A 1KFAL 6FABH 2V17H 5D1ZD 3EOAB 1JZ7A 3C6LD 4H1LB 1FL3B 4Y4KB 5T3ZH 2HVJA 2J6EA 4PGEB 3VRIB 3ULUF 1SY6H 5T1MB 1YECL 5C0BA 5FUOH 3FO9B 4K3DL 1G6RH 4ODTH 4G9FB 2KZ1B 3DX6A 4ZOCA 4F33A 4ZFGH 5C7XH 2HLAB 1HEZB 2HRPL 1DUYB 5CEYB 3FFDB 4P2QA 2RQ8A 3D2UB 4L9LB 4TNVF 3P40A 1FGNH 4G3YL 5DRZA 1F4XH 3U2SB 1YEEH 4LCUB 1NCNA 2WWKT 3S6CA 4HUWB 2Z31A 1AO7E 3P9LA 3VI4F 5JHDB 32C2B 5HD8D 1KCSH 4UQ3B 2HRLA 4BQBA 3WFBH 2CK0L 5KVGH 4OSUH 6FABL 4WY7L 4H26A 2IPUG 2RR3A 1RJCA 1UC6A 5FOBB 3RWGB 4DWHA 1LVEA 5T3ZL 4G43A 4Y2DA 2BNRB 5F71A 4LAJH 1P69B 5EO9B 1C08B 5FUOL 4YXKL 3LB6C 2WUCL 1DLFH 3L1OH 2AJ3A 2G9HB 4NM4H 1OAQH 1JNNL 5C7XL 1MRFH 4J3XA 2R0KL 3VXTB 3W2DH 3THML 1TLKA 3WDHA 2BJML 4N5EC 5A2LH 4DZBA 1IGJA 3D39A 2B1AL 4G7YL 2OL3B 3G5VB 3V5DB 5C3LD 5GGQH 1XZ0A 1JYWA 1DLHB 2EXYC 4JG0L 5KBNC 4K94C 3TO4A 3KLHC 1KT2B 5KVGL 1Q9LB 3RY6A 1X5IA 4OGXL 5TH2B 4JFQA 5IFAH 5IMMB 1CFTB 3VXMB 3C8HA 5T1LD 4JKPH 1KPVB 4FG6C 4QHUA 3PNWB 1QSFE 3IDXH 2FDBP 1ZA3B 1T04B 2H8PB 1UKSA 3EGSB 3I3DA 4OBSA 1U3HB 1UEMA 2VXTL 2VSDA 3R0MA 4WWKB 5HYJD 1DLFL 1RULL 3DX9B 1SYVA 5HY9B 5JOPE 4JEGB 1MRFL 3W2DL 2EIZA 2WSKA 4F15C 3OPZL 5DI8B 2OR9L 1SBSH 3VXUB 2DQCL 1QSVA 4RAHA 2ZOKB 3GEWB 4PJEB 2F74A 5J0BA 1YNLH 3IDMB 1QLEH 4HS3A 4KRPC 4NJ9H 3MRKB 1DQLH 1YN6A 3HNSH 2HJLA 3RL2B 4XNZB 4RNRA 4JDZA 4ENEC 2XZZA 4PY7B 1KOAA 5FO9A 1FPTL 2XKNB 2BFVL 4S1QL 4Z7WA 3F62A 5KTEH 3MLXH 3ULUE 2HJFB 4OF3A 4RGMB 1F58H 3N1FC 1N4XH 5DFVC 3TBYA 4RDQF 4PJ5B 2FJFB 5E1HB 2OTWB 1YEGH 3FO2B 2YD3A 3H0TB 3QQ3A