5E8PA

The structure of the teipp associated altered peptide ligand trh4-p5nle in complex with h-2d(b)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8pA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8pA01
5BVPL 4YHOL 3O41B 2A0LC 1B0GA 4XMLL 4CU7A 4IDJH 2HKFH 3I9GH 1E27B 1NAMB 5BV7B 2NMSA 1AQDB 4UT7L 1EGJL 5K33A 1IGCL 1HIMH 35C8L 3FO2B 3BKJH 3H9SE 5CCKL 3ZSTA 3RGVA 1A6ZA 2B2XL 4JFFD 4F3FB 2EXWD 3DSFH 1INEH 1NGZA 3MOBH 1ZLSL 3SPVB 3MNVA 1J0YA 3OX8B 5HYQA 1P4LA 1L7TH 2AW2A 2ENSA 4PREB 3W39A 3EFFA 1ES0B 3MYJA 3RDTA 3BKCL 1R3KB 1JI2A 1S7XA 4LCYA 3LRSA 2C1OA 3RAJH 2GK0A 4HXAL 4KAQL 5EUOF 1AQKH 4PGJA 2YKLH 4ODVL 5K9QG 1IGJA 1MCNA 3A0OA 1S5HB 5EOTB 2ZSWA 4MD5A 4XNZC 2Z31D 4YXLH 4LPVA 3X13B 2VC2H 3PUCA 3R1GH 4X4MA 3GMQA 2VDMH 5FKAB 3VDCA 5DFVD 3MRMA 2HT2D 1CT8A 5GRYA 5F8RC 3U30B 1FG9C 2YEZB 4LQFH 5IB2A 4RFOH 5IB1B 1KCRH 1ZLWH 4OF6A 3GEWB 4JO2H 3LOWA 4P23D 4PRDB 1DQLL 5CUSH 5F3BA 3CPLB 4PLOB 1OTUD 3THMH 5ILTL 5JHLL 5JLZA 3RWEB 4LL9A 5I1KH 1NCAH 4DAGH 5J6HB 5BOPA 4XNMB 4P9HC 5D2NB 1OM3L 3AREA 1FZOA 5EO0A 4I4WB 3N9GL 2G75B 2BFVL 4KKCC 3BI9X 4WHYG 4G43B 1OHQA 2GSGB 2NTFB 4P2OA 4P9HH 2IPUG 4M02A 1YJDH 3BAEH 3DX7B 3PABB 4HK0A 3IJSA 5CZVH 3IFOB 3U30C 3GSWA 4KRPD 4XAKE 3SY0A 2ZZUT 1OD7A 2MCPL 1Z0MA 3KPMA 1GZPB 1OSZA 2WP3O 3MBXL 1T04B 4U1KA 2HH0H 3LRHA 5KVGH 3EJYC 3MUY1 4HWEH 3P4MA 1NFKA 1IC5H 1I7UB 2WUBH 1CIUA 5DJ6A 4S1QH 4K7PH 3PWLB 3C8DA 4IEFB 4UDUA 3SDDD 1IGIH 4H25A 3VW3L 5DHVH 2FHCA 1AO7D 2XICA 1S9VA 5KVMC 2QQNL 1WJ3A 2A0LD 2HTLC 3D69A 4R8WL 4JZJA 1ZHLA 2WM0A 2VKXA 1YEFH 1CFSB 5IR1A 2AJZB 4NQVA 4G8FA 5FO8B 4I3SH 2L7JA 4GJTB 4KPHL 1YEDB 3CSYA 2YPLA 2OMNA 2VLJE 4J3UA 4UT9L 3NIDE 1CR9L 4CRPA 1BZ7B 3Q0HA 5F6HJ 1KLGA 5DQ9B 4Y19E 2ZPKH 4LGPB 3I85A 1F4WH 1TZGH 3V5DB 5LQBH 1XZ0A 3MRDB 1NUGA 1XGPB 2XWTA 4TNWK 4GMTH 4KI5E 1CFQA 1RJCA 5IM7B 2DQCL 3GMRB 1PX3A 1MJ8H 3UP1A 5HD8C 4I0CC 4LIQL 3PJSB 2I60L 2OTWB 3EYFB 4U6XB 3JTSB 3SKUD 4BSVB 2AEPL 3MUHL 3MGOA 2GJ6D 4JDVA 4I3GA 1OPGH 3WN5A 4FFEX 1J86A 1KF9B 4UTBH 3DUUA 3KPQA 4UV7H 3WL9A 5BQ7A 1TNNA 4P5KB 4NKOA 2DD8L 3F58H 3L3IB 2NW3A 3RWDB 4ZS7L 5TPWH 5C70A 5HHNA 1TTGA 3QXWA 3FO0L 1RZKH 2FDBP 4PRBA 1MVUA 4M8QA 3H0TA 1HXMA 3ARVA 4JHWH 2VZ3A 1BLNA 4RFEB 4KKCD 1U8KA 5DR5H 4PJCB 1KC5L 3MRQB 1S8DA 3GHBH 5F6IC 2CKBL 3G9VA 2UYLB 4BJLA 4ZO7A 4N8VG 3TO4B 3DHMA 3PGFH 1UACL 2XT1B 2PO6A 4X6FB 1B2WL 4PJDA 5T1DH 5CJ8A 3BPLB 1FAIH 4NQEB 3P3YA 3EJYD 12E8H 1DVFB 3L5HA 1G6RA 1FN4A 4WW1B 1JPTH 3KPLB 4YHOH 5D7IE 5KSBA 1I8IA 1X5KA 1VGKB 3HE6A 1EZVY 2ARJA 5DD6A 2XG5A 5TE4L 4ORGA 2P24A 4UT7H 2HTLD 1KGCE 4WFGE 3U7WH 1EGJH 4PRIA 1J0JA 1IGCH 5JQHC 5CCKH 1TJHL 2D7QA 1YNTB 3NCEB 2DWEB 1U6AH 3TO4C 3GSUB 3AM8A 2R9HC 4N0FB 3U4EA 3WYRA 5CEXA 1VCAA 3WD5H 1CFVH 4YUEH 5SX5H 3UTQB 4M5YL 2BDNH 3BPLC 3HC0B 1OP3H 5EO9A 1XGTB 1DVFC 2BNUB 4TVPD 1NLBL 3QFJE 5C09E 5I1AA 1UB5A 2PW1B 4DZ8B 1DBML 4PY7B 4KAQH 1DEEA 4J1UA 3TBTA 1G9NL 1YEKL 4KKAC 1BFOB 2HJFA 5C08B 3NACH 3MCKB 3NCYS 3TBYB 3HRZB 4M1GL 3P77B 2PUQT 1JL8A 1AFVL 1EA9C 5SWZA 4KDVA 4QEGA 5HD8D 1AY1H 4X6DA 3L5XL 4XP4L 4Q0XL 1XR9B 5DEFA 4D0BB 5AD0B 1NCTA 3K1KC 4WWKC 3UZVB 4MJ5A 3D85B 3O11A 1DQLH 4HUUA 5FDWB 4WHDA 1OGAA 2D0HA 1FYTB 4QF1A 5ILTH 5CINH 1FFPA 4NO2B 1RUPL 4XX1E 2WINA 5IHZA 1HZHH 2XRAL 1KIRB 2X70B 2CIKA 3B8YA 3DX6B 2EYSA 4PJXB 5J12B 3MR9B 1MFCL 1FJ1A 3N9GH 2BNQE 1KXTB 4NNXB 2BFVH 5IB4B 5DDHA 3QJHA 5IVZA 4OZIF 5D72L 2D0GA 5I17A 2BVPA 5MP6L 1PYWB 1TXKA 3IXAB 1IGFL 4N1EA 3RX7A 1EHAA 4YK4B 4FQ2L 5DLML 3OWEA 1YEIL 3QEGH 4R7NA 1BZ9A 4HUVA 2OL3B 1FZJA 4PJFE 1X7QB 4KMTL 2ADJA 2MCPH 3ULUF 5IT2H 2BSED 5IFJB 1HXYA 1BQLL 2VDRL 2G5BB 3MBXH 2DKMA 4X7CC 1C12B 4PBXA 5J8OA 1JFQL 2Z4QA 5J12C 3U1SH 4X7SH 4QHNB 5EIIA 2DLGA 3V2AR 4E42B 3MRHB 4CJ0A 2Y9RT 3VI4E 1QSEE 4JR9H 4DW2H 3VW3H 5HHXL 5C8JA 4M93C 3RNKB 1UKTA 5C0RH 5FYJU 3UAJC 4Y5XC 3QUKA 4R8WH 3VWKB 3GGWB 1NJ9A 3OHXA 4YBLB 3MYZA 5HI5C 1PAMA 2R29H 4KPHH 1VFAB 2CLRA 5EIVA 5FECA 1A4JB 1IC4L 2MFNA 4HWUA 5DTFA 3UJTH 5CD5C 3TO4D 1EHLL 4P5TA 5CS7A 2QEJA 4JO4H 2WY3A 2R9HD 5B38B 5HI4C 1QLEL 4AK1A 4Y16B 1QZ1A 3QNZA 1DVFD 4C56B 1I1YA 4X6BA 1IC7L 3QXUA 5C0BE 5BS0A 5C0IB 1RZ8B 5GJTL 4PJ8A 5MEPB 3VWKC 2R2HB 3PWPE 2PTUA 4KKAD 2I9TA 2JLLA 4N9OB 3N1FC 3BGAA 4H5SB 1H3VA 1P5VA 5ACZB 4I2XB 2AEPH 1XF4A 5DJZB 1MH5B 1T7YA 3S35H 4PJEA 3EAKA 1LVEA 2V9QA 2VE6A 4M5ZL 3FB6B 4OFIA 3PGCA 4LEOA 3ULSB 3UEZA 2V5YA 1G7JB 2VDOH 4WWKD 1NFDB 4Y16C 5DURB 1UG9A 5DQJA 3PWUB 1QBBA 3TYFA 2EDEA 5BRZA 3P73A 5HI3C 4DUXA 1ZLUK 1E4XH 1NBZA 4QOKB 3D18B 2F54B 1N26A 3RX5A 4N5EA 3OPZL 1G0DA 4PJ5B 3PWVA 1ZHKA 1G0XA 5EC2A 1BMGA 3GMNB 4JVUA 3JUZA 1E4JA 3UTTA 5J1AB 1FL3B 1OQXA 5AUMA 5ICZB 3MRPB 1HEZB 1MSPA 5CP3A 1NSNL 2F5AL 2CKBH 3IU3A 1NC2D 3TFKC 4PIRF 3LPGA 3D85D 5CJBA 3T8XA 3EYUL 4U1SB 5IVXF 2MQ0A 4HIJB 3MCG1 1B2WH 3MOAH 1NCBH 1T21B 1HNGA 5FHBL 3RZWA 4NOBA 3C09B 4Y1AE 1MCIA 4MAYA 3RJDA 2QL1A 3FMGL 3IKCB 4HDIA 1AGCA 3VXSA 1WFOA 4C55A 3QSKB 3CFKB 4CVZB 4H1LB 1RUAH 4OFYD 3BEWB 4UOW1 5D7LB 2EEBA 3F5WB 4XAWL 4U6HB 3TJEH 2R1YB 5FGBA 1YY8A 4XBGB 2OSLA 1CFBA 2R15A 4OCLC 2R2EB 4U6VL 5HI5D 1KIPA 2WWMC 3RL1A 4U6TA 2BOBB 2H2PC 1M6OB 3WXWH 1FNLA 5GS1B 4HGWB 4M5YH 1G9NC 1I3RA 4ZFZB 1REIA 4OB5L 1T1YB 3UBXB 3C09C 5CD5D 3MV9B 5I66B 4XPFH 1NLBH 4LASL 4JG0H 2D7PA 4AIZA 5IHUL 4IS6A 3ESVF 3T2QA 4RAUB 1DBMH 5C0CA 5HI4D 5CD3A 4QRPB 1U95B 1G9NH 3B4NA 5IMLB 3O4OB 3EJJX 4M1GH 2CDEA 3O3DB 1MRDH 1AFVH 1U8IB 4K2UH 4PJHF 4LAQL 3I6KA 3VWKD 1A3LL 5JO5B 2W9DH 4XP4H 4L8SC 5F88A 5GS1C 2A74A 2ATPB 2WNGA 4NQDB 5F72S 3GSXA 1VDGA 3W0WB 4OZGA 2ZCLH 4GW4A 4XNQB 4HLZG 4JO3H 5JIPA 1INQB 2EKSB 1D5XB 1U3HB 5HGHA 3DURA 1H5BB 3F65A 3GMPA 4Y16D 3RX8A 4LSTH 2XRAH 3QNXB 1I4FA 4C56D 3BPOB 3ZYZA 4K94L 1LDSA 1RFDL 4IRSC 1MFCH 5HI3D 5C0DB 4ACPA 4GG6F 4JG1L 1G9EA 1KN2H 1ZSDA 1GGIL 1AP2B 4JRYD 3PNWA 4PD4J 3B5HA 5TF1L 4WW2C 1IGFH 1D5BA 4RMWA 4Z0XA 4ELMB 4KJQC 3C8KA 5JNYA 4X83A 1HWHB 4LF3B 5JW4Q 1MLBA 3UZQA 1JZ3A 1BQLH 2VDRH 4LQ1A 1U3HC 5HSFA 1UB6B 4IHOA 3TFKD 5DURD 5L88L 1BFSA 1B88A 2LFGA 3TPUA 3TYGL 3BPOC 2E3VA 3O3UN 4HJ0C 5EBLA 1CLYL 5L2KB 2NCMA 2XWBA 5TE6L 4NRYB 5F9AC 4M6OL 3NCFB 4AENA 4PJ5D 1PX4A 4O2CA 1NC4A 5IW3A 2NR6C 3TLRA 2VDPL 5F7UA 1TZIA 1IAOB 1MREL 5D5MB 2F74B 4JRXE 1JZ4A 3MV01 3R0MA 3IDJA 3TNMA 3OB0K 1R5IB 5I74C 2OBGA 4ORZC 5IIEB 3QDJA 4RMQA 2C7UB 2WWMD 2BMKA 3CAFA 2J4WL 1SJHB 4O02H 3ZKXB 2H2PD 1PJ9A 3WJJA 2UWEF 3MSPA 4PG2C 3VFPB 4U31A 1CFTA 5DJYA 4HFUH 1GGBH 3FQTB 4MYWB 4QY8A 1KG0A 4DK6A 5FYJH 1UVQA 4RBPK 3BD5A 3O3AB 4IDLA 2BZDA 15C8H 3O4LD 2EO1A 1OWWA 2E9IA 4YC2C 1CZ8L 2ZG3A 5GGRB 1N5AA 3QWOB 4XPAH 1MAKA 3MLWH 1OB1A 4M5ZH 2HVKA 5EO1B 1ZAGA 3C60B 5ESQA 3GIVB 3ZKXC 4TOYL 5IGXL 2E9JA 5ACMA 1IGTB 5F8QC 1Z9SA 4U1NB 4A6YA 3MV9D 3MMEA 5EOQH 2YD8A 1FCGA 1HH6B 3WFZA 2Y23A 2VLRB 2HN7A 4N8VA 4QRPD 3IDYB 5I1GL 3HZYA 3O9WA 3CNKA 5BZDA 3NA9L 4JFFE 3OPZH 3QG6A 1AR2A 4N0CC 4IRSD 5F44A 1IE5A 1UYWL 1TTUA 4M61B 5C6TL 1DBKL 3UPRB 1KCLA 2VZTA 3QDMA 2XI9A 2MPAL 3QO0A 1RIHL 4M1DL 3TJHC 2F5AH 5C71A 1U8HA 4KJQD 3WHXA 1YEJH 1D5MA 4NQDD 3TVMA 4WU5B 3W0WD 1H0DA 2D4FA 1EEYB 4MJ6B 1AIFB 5D70L 1B4RA 3IFNH 4S0UC 4HH8A 1LWRA 1R5VB 4WDIB 1U3HD 2OJZL 2X4PB 3IDYC 3GM0A 1ZTXH 5D2LB 5FHBH 5F3HB 3NVQA 4ZNEE 4FA8A 1TCMA 3FMGH 3BIKB 2P5WA 2CLZB 4RWYH 4NUGL 2V5TA 3WIIL 3GJFB 8CGTA 4KRNA 3I02B 3W2DL 2NR6D 3RL2A 1H3WM 3CDCA 3NFNA 4WV1A 3HAEG 1D3CA 4U6VH 2IPKB 4PJ9C 5DRXA 2DWDB 2J7LA 3CMOL 3MRBB 1X5LA 1C5DB 2XXCB 3MLTA 4JGJA 2JCCE 5A2FA 5EORL 4OZHA 3MRJA 3L3KA 2WIIA 3NCJL 4P57B 4QTHB 1FG2B 4R4FL 2ID5A 5IHUH 2FWOB 4OM1H 3FO1A 1JRHH 4DGYH 4G5ZH 1N8ZA 4WUUB 1J0IA 1QACA 4N1HB 3MV8B 1C7TA 2R1WB 5D93B 4WU7A 1F6AB 3K4AA 4OI9A 1MCOL 4R6UA 3QDGA 4O9HH 5FM5M 3WUWB 2AV7A 3O2VH 3GSQB 3ZHLA 2IADB 3AU1A 4YQXH 4JZNB 3VFWA 4G9DA 2X4NA 3BGMB 3C5ZC 4K94C 2W0LA 3S36H 1JGDA 1AO7E 4ZSOB 2G9HB 3C5SA 4FZ8L 4BKLA 2H9GB 4L8CB 3QHZL 3QIBA 1XCQB 1ZT7A 2CIIB 4R90L 5EU5A 2AQ3A 1KJ3L 4K94H 1Q9WA 1OP5K 4I8DA 2H45A 5I1DB 3IF1B 1L7IL 3RVWC 4MD0B 1GGIH 4OF5A 4AMKH 4D8PB 2VXSL 5TF1H 1M71B 4N0CD 1NCDL 1K4DB 5E8OB 1DCLA 1TMCB 3S88L 4IRJC 5KS9A 3BX7C 4X5WA 5C0FB 5E95B 3DBXB 5DC4B 3VMPA 3C60D 4FP8H 1IKNC 5FYKU 3TJHD 3OJVC 2ICCA 1VA9A 3KYNB 1HHIB 4OTXL 2FYYB 4PY8I 4NT6B 5HHOA 5I2IB 4Q74A 1J8KA 2FCBA 3VXOB 5L88H 3TYGH 2FBJL 1S3KL 3GSRB 5F70A 4Y4KA 2BJML 4OBRA 2A9ML 5TE6H 4V1DB 3C08L 1AD9A 3T3PF 5IK3A 1WCBA 1UM4L 2GJ6E 1F4XL 2EIEA 3SOBL 1CE1L 5DJXB 5I73B 4EDXB 3HG1B 1MREH 4XPGL 2X89A 2CK0H 2XFXA 4EDWH 2VIRA 2ICES 3QHTC 1HN1A 2APVA 1V3KA 2VQ1A 3I6GB 4JAMA 5DD3L 1J8HA 2ZOLA 2Y36H 1JUFA 4PJ9D 1EBAA 1JK8A 4IOFD 1ZLWK 3DTXB 3AUVA 4GLRH 2J4WH 3W9DA 2R4RL 4MB4A 3NCCB 1I3GH 4KDTA 5EBGA 4TUKL 4L8BB 2YK1H 5E8NB 2F53B 4G3YL 2ZUYA 1BX2B 1BGXL 4ZPVB 5I73C 3ZE1F 2X9YA 1K5NA 4NQTA 5I15H 1VACB 3WLBA 3L5WA 1G7IA 3FQXB 4X8XA 3WNMA 3ULUL 3TIDA 4R26L 1MAJA 1KPRA 2ARJQ 2P8PA 1JYVA 4N0UA 3BO8B 4EIGB 4YHLL 4PV8B 1CD1A 2IBZX 5EOCL 3BP6B 5IGXH 1I8MA 5CJOL 3NZHL 1IQWL 3NTCL 5EFIA 4PRNB 1KLUA 5IF0B 4FQCH 5I0ZA 3RNQB 5ADOL 3QQ4B 3C5ZD 4ZXBC 4WTZG 5L6YH 5HGDB 5GGTA 4MHHG 1MHEA 3LEXA 1S7UA 4XX1G 3HA0A 3QBTB 3WXVL 4F2MA 4BFBD 4V3EB 4WUUD 5KAQG 5F93C 2APXA 3S96A 3MV8D 1CL7L 3VH8B 1IEBB 5C6TH 3LD8B 3MNZB 3RVWD 4DKFL 5ALBL 3WFBL 4M7JL 3U46A 4TVPE 3CCHA 1B0RA 5DWUL 4M1DH 1SYVA 2NXZC 1CD9B 5FO9A 1A6VH 1QFWM 3DRQA 5MENB 5D70H 4MXQD 5GGVH 5LG1A 1HE7A 1FE8H 1BJ8A 2ICEB 1CDCA 4OIIH 4NRXB 4HIIB 1A7BA 4P9ML 3P4NA 4NPYB 5IMKB 3LN4B 3TN0C 4NUGH 3Q5OA 3EOTH 4X80L 4LLYB 1BVKA 1LNUB 2X4OA 4L4TE 1CE6B 4BQCA 5JW5A 2DMBA 4NGHL 2C3WA 1NDMB 3KDMA 3S34L 5F7DA 3CMOH 2D7TH 4X4ZA 4RX4D 3EZ8A 1F02I 1NBYB 4UAOB 4U6YB 1B3JA 4YHIA 1WAAF 3C87A 3NCJH 4R4FH 5DFWH 1NCWL 4UOW0 1W0WA 1P4BH 3MGTA 3QA3B 4LCCB 4V1DD 4W6XB 2J8UB 3UTSD 4K3EL 3T77B 1KENH 2QKIB 3FHAA 3QQ9D 2JJUA 4H0GA 5IOPA 2DLFL 5KSVA 2H26A 1MCOH 1WQVT 3ALWA 3HE7C 3CU1A 4S10A 1G7MA 3QWRD 2ZUXA 2YBRA 4CN1A 2CGRH 1TLKA 1EJOH 3K2UH 4FQPA 1DSFH 1FH5H 1PKQA 1FHGA 4UAOC 3UZEA 1UXWB 4HWBH 1F3JA 1YNLL 3HNVL 4LCCC 4NRZB 3D3VA 2AJ3A 3PQYA 3OKDA 4J3XA 3EW3B 1NGYB 3QHZH 4R90H 1KJ3H 3HUJB 4RCAA 2F53D 3MBEB 5HJ3B 3VXPA 1SJXA 4ODUB 4LLWB 2ZUQB 1YMHB 4Z7UF 5FDYA 5JOFA 4G6KH 2VXSH 2WLYA 1MWAH 2FLRT 4I77H 1NCDH 5E2WL 4IMLB 2PF6A 43C9B 4JQXC 3ZL4L 2BOCA 2R0LL 5E1AA 5ITFA 3L9RB 4NJAH 4AEFA 5ID1B 4HT1H 1GGCL 3DMMB 3PIQA 1QKZH 1WBZA 4OTXH 2VLLA 4XCCL 4CADB 1CBVH 1BD2B 3MO1A 3VD9A 2E6QA 1OP3K 1ZMYA 2IMMA 3MBEC 1OW0A 1OT1A 4RMRA 4BZ1L 3FONA 2NLJB 4NHUB 3ZKMC 2HJKA 4K3JH 3C08H 1X6NA 3PWJB 3QRGL 3HZKB 5CLTA 2I24N 2P8MB 4HMCA 2EDWA 3X14A 3IT8D 3QUMA 4KTDH 2YSSA 5IG7B 3OB8A 5CSZB 3SOBH 4F7PB 4Q6YA 1CE1H 4ZUWA 3OR6B 1FIEA 4PRAA 2P45B 3F62A 1LP9F 4Z7VA 3MROA 4NSKA 4NM4L 1A6TB 1MCSA 1S9XB 3RBGA 3IFLL 5FYKH 3F12B 1NBVL 1ORSB 3KLAA 2MOVA 1R3LA 4U49A 1ETZB 5HHMB 5DUBB 2IFGA 4Z5RA 5JPNB 2BK8A 2IH3B 4JQIH 5I1JL 4DVBB 1CDBA 3WLWC 4X98B 3CDGB 4G3YH 1JTPA 4K7FB 4X7TB 4HJJL 3ULUC 1BGXH 2DICA 3L7FA 1ZS8B 2AABH 1PQZB 4KZDL 1P1ZA 2MTPA 4G8GB 3NN8A 4D0CA 1Q0XL 3ULUH 4NQSA 2GUOB 3GBML 5K59F 2FECL 3SDCB 3HE7D 3S3PA 4MNQB 2VL5A 4GXVH 4JKKA 4YHLH 3W9EA 4PJXE 3V5KB 1GCFA 2GCYA 3DIFB 2F19L 3NZHH 2YD2A 3NTCH 2AJSH 4R97B 5D1XA 3AMLA 1AJ7H 5EZJA 4AEHL 1F6LL 5IWLA 1JNHB 3LKRB 3U36A 2XZQL 3WE6A 1NGXA 1WZKA 1B4JL 4F57H 2BVUA 1EERB 5IV2A 3LKSA 4JFEB 4JVPA 2Z0BA 5JPMB 2CO7B 3WXVH 4JN1L 1RUKH 4PRHB 1T22B 2M2DA 2QADC 2XZZA 4F7EB 4OZFG 1MCPH 4TSBH 2VQTA 3MXWL 1MJUL 4CN4A 2PXYA 4DKFH 5ALBH 3Q6FB 4PJGB 2FX9L 5ESAA 4M7JH 3IDGA 3IRZA 1GZQB 1I1FB 2O5XH 3ZKSD 3QZWG 4OFKA 3VXRB 4NQUA 2Q3ZA 5TH2A 5DJDB 3DUSA 3DOSA 4R97C 5EU3A 3UJJL 3BE1L 1T0MA 5C0EA 3SDXF 4AL8H 1LDPL 3A6OA 5F89B 3UC0L 2NY2B 3HAEA 3D0VA 3I2CL 2Q76B 3CDYA 3HZVA 4PJAB 4FXGB 4QRSB 3NBNA 3SCMB 1F2QA 3RGHA 2EZ0C 3MBED 3ZKMD 4OD1L 3SKJL 2W0KA 4HF5H 3WFCL 2V2TA 4X80H 5CBAA 2A83A 2WWKO 3BZFB 3AY4C 2IAMA 3ZTJH 1ZLVH 5IP4A 4PP2A 4HPYL 5D8JL 3QIUA 4Z78B 3GI8H 1YDPA 4KQ4L 3S34H 1URLA 5E8EA 4C56E 4NZUL 4EQ2A 3R8BB 3LS4L 2NY2C 3P11L 4WI9A 1BD2D 4JRYE 4ZFOA 4I3RH 1NCWH 3RWFB 5M94B 3DGGB 4M4RA 4FMKA 1S9WB 1QUNA 5ACLA 3SKMA 3LDBC 2EH8L 3HS0A 1L0YA 3WLWD 3KYOB 3ULUD 5HPMA 1I7ZA 1FFQA 3L3DB 2OI9C 3D9AL 1FNFA 3EYOA 1YEEH 4JPVL 3ILPB 1C5CL 2QHRH 3FQUA 1EEZA 2DLIA 1GOHA 2DN7A 2B1AL 3ARRA 1WWCA 4YIQA 1KIUA 2JK5A 5HHMD 1A7QL 2L0DA 4K8RL 1ULVA 3K2MC 4GBXA 4HJGB 1HYRC 5INDB 1ZGLM 4YGVB 1YN6A 4PJ5E 5L0QB 3SGJA 1YNLH 1JPSH 5I71B 1ODAA 3WJLA 4P4KA 5I8CA 2LVCA 2Q86A 1YYML 4K7PY 1TCRB 3OR7B 1D6VL 4RDQF 5T1LB 4JN2B 4P48A 3WFHA 1X3DA 4R0LB 1YPZA 2R0ZH 4HWZA 2KPNA 3U0WL 4TNWF 2AKRB 1S5IL 4G8GD 2R0LH 2IANB 3I6LD 1WBYB 1R24B 1S7QB 1GIGL 5GS0L 3NIDF 3D2UB 1JHLH 5DJ2B 2Z35A 1OLLA 1DDHB 1TQCB 4MCZA 5I71C 1BIIB 4XCCH 5EG6C 1K8IA 2DKUA 2APTA 4MNGB 3U0TB 1KJ2L 3V6ZA 4KFZC 4BZ1H 3O4LE 2WBKA 1ZT4B 1NKRA 4JFED 3FRPG 1FL5A 4R0LC 4LLVA 1DLFH 4PRHD 2HMIC 3GMMA 2QR0A 1SBBA 4RAVA 2EZ0D 1U3JA 1BVLB 5CZXD 3QFJA 5FV1L 3VXQB 1IL1B 4P4RA 4NM4H 2DMCA 3WIHA 5TGBA 3IFLH 1AHWC 3OKMB 1TQCC 1AXTH 3B6SA 3NH7H 4QRPE 4XVSH 3N1QC 3QNYB 4ZUSA 4AYFA 3GKWH 4APQA 1IBGH 2PCPB 1WT5C 4PR5A 4Q6IC 4MD4A 2NY2D 3KPSB 1PZ5B 4EJ1C 4W68A 4XBEL 3EOBB 4H26A 4M00A 1KEGH 1SJEA 3CX2A 1LO2L 1UKQA 4G6FB 2AJUH 4HJJH 2IPTL 3BEVA 5IB5A 4NQDE 4WTZA 1A1MA 4JJ5B 3BH9B 4PJ7B 5I16B 2XN9A 1L9MA 4WJ5B 1KB5L 4P59L 3FB7A 4I0PC 1BFVH 2FJGA 3GBMH 5CGYC 2VUYA 4HG4J 1SYSB 3WDHA 4CVWA 3HI6L 4MAUH 2BNQA 3STZA 3IDXH 1HQRA 2JJSC 3QG7H 3ZKNC 5BW7C 2R39A 2P48B 3T0VA 3CVHL 2XZQH 1B4JH 1BP3B 5D7IF 4B7LA 4LBEA 5F9JA 3IU4L 4ELME 4PJFA 3RVTD 1XIWA 4OLYH 4X9FA 1NBQA 2C1PA 1CU4H 4L8DA 3MXWH 1MJUH 1WIPA 4QXUL 1FLRH 2X4RB 3HMWL 1NMAH 4ZOEA 3DXAA 3H9HB 3L95B 1EEUA 5FXCH 3VRJB 4P3WA 4HMDA 4KTEL 1QSEA 4L3AA 2XZCL 2FO1A 1QSZA 4P2RD 4EUPA 5I1IL 2DJUA 3KPRE 5E2UL 3UJJH 3BE1H 32C2A 4TUJA 3S36X 5B39G 4NQCB 5H2BA 3C5JA 1LDPH 3L7EA 1BBJB 2ZKHL 2FX7H 2LVEA 3ZKQD 4OV5A 3OXRB 4DCQB 3IDIA 4CUCA 5JOEA 2HFGH 4HULB 5D5ME 3CFEB 2VZUA 1A1OB 4JY5H 2W38A 5T1LD 4K3GA 4OD1H 1QNZH 3BDYL 3SKJH 3K7UA 3ILQC 5DI8B 3GBNL 4JREB 4EEEA 3O2DA 3DX8B 2HMID 3O6MH 3F6IA 4TULL 2R0KL 4JDZB 1E4WH 2IAND 4XVUC 4HPYH 1X6LA 5D8JH 3U4BH 5BO1H 1FFNB 5C0BA 3I50H 4ZUVB 5T33H 3BFOA 3D2UD 3PL6B 4MX7B 1C08B 3DROA 3L3OB 4NZUH 2B4CH 3ECBB 5M95B 4NKDB 4JGUA 4JQVA 1PKOA 3LS4H 3VRLF 3P0VH 3RI5K 1RK1B 3U2SA 2BSRB 5KAQF 1JZ2A 3WS3A 3FT4A 1I8LC 4U1HB 1S7SA 2L4OA 4GOSA 2BVQA 4WRLA 4JREC 2NY1C 2ZJSL 4DWHA 3BZ4B 3DV6A 3BKYH 1LK3L 4KK5C 1FV1B 1G84A 2BRRL 4ZYKA 1DN0B 3PL6C 1HKLL 1C5CH 5C0NC 4GAGL 2W65A 4YNYA 2Q1EA 1RUQL 4I0PD 5F1NA 2HFEB 5CGYD 5I1EH 5IQ7L 2A6JA 3G6JE 5F96L 4FQXB 5DD1H 3BD4A 2X7LB 3B9KC 3TH3T 3ZKND 1RY7B 3VI4F 3ZHKA 3O81A 4KY1H 3IJHA 1AKJA 5T1MB 1MIEL 4ZOCA 4HUWB 1D6VH 2OMBA 5GS0C 2GTZB 4WI8A 1CK0L 1LE9A 3MJ8A 4Y0GA 3U0WH 5CJ5A 2XACC 5IBLC 3AXLB 1S5IH 2NY6C 1FAKT 3O8XB 3FQWA 5SWQB 2ERJB 1GIGH 4YBQC 2IH1B 2ZP0T 3QCTL 3QXDB 5GS0H 2I26N 4LLMB 5EBMB 3O45B 2EDBA 1FNSL 1MNUL 5GGQH 4M48L 1F90H 3MRIA 4JLRB 2R69H 1I9JH 3ZYOA 1U8PB 2WK2A 1KIQA 1I3UA 1KJ2H 2J6EA 2E6PA 1RJZB 3Q48A 4F33B 3FZUC 5IEHA 1M7IA 4HD9A 4UNTA 5CWSB 2B8OT 5D1ZA 3H9ZA 4JY6A 1KTDB 1KB5B 3FAXA 4YHPB 3OAZK 3WKMH 1DE4B 1RUMH 5FGRA 2AVGA 4XGZA 3V8CA 3ILQD 4KJWC 5HHPA 4XPTH 3C9NB 1HHJA 3LQZA 4LSSL 2VDQL 3TCLA 5E2JA 3BVNB 4XVUD 3L1OL 1KNOA 5J57B 4HUXA 1MRFL 1ZWIA 3CVHB 4NQCD 3T4AA 1QTYT 2FHBA 2NZ9C 3MV8E 3S5LG 2YZ1A 3UJIL 1CDJA 3O3BB 4XCYB 4P46A 2WLZA 5JHDB 1G7PB 4U4BA 2P1YA 1DQDL 3OGCB 1A6AB 4IIQB 8FABA 3VWJA 2VAAB 5EUOE 1MI5B 2AV1B 5TE7L 2NY1D 1U8MA 4P59H 1PY9A 3C6LA 4NNPL 1BECA 4KK5D 1JWSB 2FH6A 4K8RD 4OZFA 3PL6D 4GKNA 4KUZH 5EZIL 5C0ND 1MHHA 1YN7A 3TV3H 5FUZH 4F9PC 1KPUA 5DMGC 3QZWA 3MLZL 5A2IH 3SE3A 1DUZB 3B9KD 4NWTL 4Y5YB 2A77L 4IIQC 3VG9B 1HSAB 2DIJA 3HC3L 4O58H 2P5EE 4BQ6A 4CNIA 5I75C 1Q8MA 4MVBA 4OF8A 1PSKH 3MJ9L 5FM4A 2WBWB 3MV11 5DJ8A 2X9XA 5GS0D 2EEDA 1MLCB 1IJ9A 2YPVL 3D1MC 3F7VA 4X4YA 4QXWA 5IBLD 1Q72L 3SE8L 1MJJB 1QFWI 2NY6D 2VXUL 3X3GL 3NIGE 3EJZD 5JXEC 2O61A 3GSNB 4JFDB 5I1HL 4YBQD 5E2UH 3PDGA 4V1DE 5EU7C 2I9LA 4OCWL 4WFFD 1N64L 3R8QA 2GW5A 3UTSE 3QUXA 4HFWB 4BSWA 1IM9D 3TIEB 3MLPA 2ZKHH 4WY7L 3SDAC 2I07A 3VG9C 1QRNB 1X5ZA 4JRXA 1ZVSB 3R0NA 2JIXB 1T83C 2ADGA 4HCRL 1JWUB 4NO0B 4FFZL 4F15C 4PTTA 3T1FB 3E3QC 3FZUD 4IOIA 2NY7L 4UIKL 5GRJL 3E6HA 3TT1L 1EDQA 3PHOB 4WO4B 4GKSB 4LARH 2MKLC 1KTKE 4J3VA 1X5IA 1QFHA 5HYJB 2GTWA 3O8XD 3I75B 1N2RA 3H7BA 4NKIL 1RQ5A 5GGUB 3RY6C 4KJWD 4OFPA 2AJXH 4UDTA 3Q5YA 5D9SA 3MUZ1 1U8LA 3INUL 3PWNB 4KGLA 5T3ZH 2ZOKA 3HPJB 1DZBA 2F53E 3MFFB 2Q7YB 1G6VK 2XZAH 2QTEA 4I18A 5E00B 2FGZA 2SEBB 1T89A 4Y2DB 3F7YB 4OJFL 3QR2A 5H94A 5DYOA 4ONHA 3WBDA 4ZAKB 4NKQB 1KJMB 3M17B 1JTOA 3REVB 4HKBA 1WGOA 3VFNB 3G04A 3QIWB 4O51A 5JW3H 1KTRL 3OKLA 2P8LB 3OZ9L 3PP3H 3TO2B 4JFFA 1RVFL 5DQDL 1MIML 5F1IA 5E7BA 3OAYK 4OLZH 4PGDA 5DK2A 3IGAB 1R3HA 4X6CB 4KKNA 4Z76B 4BUGA 1UJ3C 4XMPL 5DMGD 3BKMH 2NPLX 1FVDA 1WLHA 5MERA 1KTLA 2ZG2A 3PP4L 3FFDA 2CMRH 3FFCB 2QQLH 5EBWB 1X5GA 2EDDA 3HPLB 3EUUA 3PGDA 3QIWC 1CK0H 4PJBF 1MI5D 3VCLB 1MCLA 1T4KA 5TQ0H 3QFDB 5LBSL 3FRPA 3VFOA 2BY3A 1ZGLP 1T20B 4ZNEA 1EPFA 2XIDA 3WHE0 3C2AH 1N3NA 4CDGC 5B4MC 2GT9A 2MSPA 5J6GA 1V3JA 2BSSB 2V7HA 1MNUH 1XR8A 3MRRA 4I13B 3ES6B 5JXED 5HDBE 1ZA6A 5IESH 1QG3A 2CJUL 3TBSB 1Q94A 1RZJL 5HPOA 1MCHA 3S8WA 1HI6B 3SDAD 3E2HC 5FHAL 3DHJA 1MCJA 3E6FA 2EDKA 3ZYIA 4AT6B 3AAZB 4M4PA 1TJIL 2JCCA 3P9MA 1RK0B 4HZLB 4OCNC 4YDVA 1XAUA 3PDOB 4PRPB 4QRTB 1Z5LA 3BH8B 5DRNB 4OGXL 5J1SC 2FJFB 2D3VA 1UZ8B 1FFRA 3ARFC 4LSQL 5HDLA 4LSSH 4O2EB 3DI2B 5IB3B 2B5IC 4JFDD 2YPKB 5B38G 1MRFH 1NUDA 3DX9A 3M45A 5HTSA 2A38A 4KQ3L 1QRND 3H3PH 5ISZD 4UBDC 2KZ1B 3ERYA 3VFSA 2DQHL 2IEPA 4E41E 1N0XL 4NO0D 3UYRL 1DQDH 3SDDA 5L9DL 4Z7WB 4GUPA 3KYKL 1AO7A 4GRLB 1XFPA 2ZUSA 5FO7A 5TE7H 5E9DB 3P9WB 4HS8L 4WUKL 4YDJB 4ZDHA 1AGFA 3F7PC 3GNML 4NNPH 2ZUWA 3ARQA 3T3MF 4XP6L 4JANA 2NX5B 3RWGA 4C59B 3BWAA 4E5XA 2GITB 3EOAA 5HVHC 1QR1A 2EDOA 3HUJE 1MOEA 2UUDK 1G7LA 4YE4H 1IM3B 4X9BA 5IQ9A 2Z93A 4Z77B 5GGRY 2HA1A 4G6MH 3T65A 2Q8AH 1FGVH 2W0PA 5HGBB 3VFTA 2Z92B 4NWTH 3DRTA 2QSTA 5B39A 4RGNC 3VXUB 1YMME 4ZAKD 1EFXB 2AK4B 3CFIC 2AQ2A 4U0RB 4XCNA 4PJIB 5DC0A 5EU6A 1W0VB 1WC7B 3QIWD 4QHUA 4RMVA 2YPVH 5E5MA 4NJ9H 2W60B 2DQFB 3T0EC 3SE8H 4WI7A 5DMKA 2VXUH 3BOVA 4B50A 2RAMA 5I1HH 2GJ6A 3ZDZF 1F4HA 4NHUE 3T0XA 4M8VA 3SQOL 4OCWH 4N8CL 1N64H 3HCVB 1CTOA 2FSEA 2ITDB 5B4MD 3RRQA 3MRCA 3QDHA 3KS0J 2V17L 4POZC 2H32H 4WY7H 2LAGB 1I3VA 3ULUE 1B0GB 3D39B 4K23L 1QR4A 5CBEA 4H1LG 4U0RC 4G80A 3EGSA 5MI0B 4UIKH 5GRJH 3BMWA 4MZ3A 1CS6A 3RGVB 1A6ZB 4ODHL 43CAA 1GOFA 4LSUL 2YS4A 3MNVB 3TPKA 4NKIH 5HYQB 1P4LB 4ONGL 2I5YL 3BP4B 4LVOB 3W39B 3INUH 3EFFB 2N4IA 3HI1A 3MYJB 3RDTB 1JGVL 1DFBL 3JVGA 4V3DB 4LCYB 2E7CA 2YEZA 3LRSB 3CH1A 2O5ZH 4JVWA 3DO3A 4NFBA 4BQ9A 4G9FA 1IGJB 1RZ7L 4OJFH 3HKFA 5CIPH 5HGAA 3KAAA 1AR1D 4G8GE 5E08L 5DHVA 4MD5B 4UBDD 3RGVC 5T3XH 1QFPA 2C3XA 2HVJA 5CMAA 4I4WA 5JIHA 3L3GB 4AZ8A 1I8KA 4MA7L 1QD0A 1IZJA 4G43A 3MRMB 4LVOC 1CT8B 1EAJA 2QSCH 3RDTC 5IB2B 4PB9L 3OZ9H 1Q9OA 4L1DA 3S98A 4R7DA 1RVFH 2CKNA 4JFEE 5DQDH 5JLZB 4LHUG 4EVNA 4PRHE 2DL2A 1T2QL 5F9WB 4XT1C 4HLJA 1A47A 4JFXB 4LGRB 3AREB 4XMPH 4ISVA 1FZOB 3IRPX 2VO5A 4QXGH 5EO0B 2WBJB 4PJGE 3PP4H 4TYUA 1H3TA 2NYYC 2VUOA 4X6EA 1B90A 3SJVB 2VLKD 4P2OB 5IBUG 4GRLD 3S37H 4HK0B 5D1QA 3IJSB 3QCUL 3QJFA 4DEPC 5IUSA 2V6HA 1JF6A 3GSWB 1BQHG 5LBSH 2CUIA 1TVBA 3U82B 3NCMA 2AJZA 1ZLVK 3KPMB 1RZJC 2NX5D 5ID0A 3T0ED 4U1KB 2HT3C 5F9WC 1N59A 4P2QE 3P4MB 2WZPD 3AREC 1N5YL 4L4VD 1YNKL 3E1F1 2WBJC 3ARPA 1GHFL 4L4TA 4TSAH 4H25B 1S7TA 4HIHA 5E2VL 1GGUA 1S9VB 1PGRB 3LKOA 3VXUD 3D69B 4C83A 4JZJB 1EK3A 1ZHLB 1BBDL 1EFXD 1F45A 2AK4D 2IJ0C 1IAKA 4LLUA 1PG7L 1TJIH 1ZHNA 3JSSA 4U1MA 3S5LA 5IR1B 2XY1A 4YBHA 4G8FB 1WFUA 1ED3A 3GMRA 3WDIA 1PLGL 4QT5B 1R0AH 3CSYB 2YPLB 4K9EC 4P49A 4Y4HC 3D5OF 3FQRA 3QYCA 1JN6A 1F13A 2EC9T 4K9EH 2Z8SA 3PHSA 5IW1A 4AY0A 1Q38A 2V9RA 1I9RL 5FGSA 4WTWA 1A7OL 4M3JA 1CFQB 3D39D 2L7UA 1NEZA 3N85H 2X5PA 3VFRA 3DO7A 1RJYA 3GI9L 4UI2A 1PZUB 1H15B 2YD1A 2ZG1A 4P2RE 4ZO9A 2FD6H 3VE0B 4HKXA 4JRWA 3RTQC 1EGJA 3RGVD 1CLCA 3MGOB 4L5FL 5KSUB 5BOZG 4WUKH 4JDVB 5ADPH 4GS7B 2V2XB 3GNMH 4I9WD 3BPNB 4XP6H 3WN5B 3OG4B 4PJHE 3D0LA 3RDTD 3DUUB 4UU9A 3KPQB 5BQ7B 1VFBA 1ZGLA 1RULH 4NKOB 5CSBA 2NW3B 1D7FA 1KULA 2ZUUA 5HHNB 4ZTOL 4PRBB 1MVUB 4F7TA 4CGTA 4OM0L 4M8QB 3H0TB 1HXMB 4KMLB 4LRIA 2R8SH 3GRWL 1A8JH 2IANE 2DQDH 1BLNB 1DVFA 1RIVL 2P46B 4XP1L 5AZ2L 3ISWA 2A9NL 4DOHB 1XGUA 1U8KB 3EBAA 2NYYD 4MJ2A 2DQUH 1O7SA 1ND0A 2OTUA 3V7AE 2DTML 2V2WA 1S8DB 2X4TA 4R96A 4GG6E 3X12A 4MNGE 4PGBA 3U83A 1CDGA 4M9PA 3FN0L 2PO6B 3GSUA 4PJDB 4N8CH 5L8JB 4N0FA 2HT3D 2XV6B 2X4SA 1FN4B 4WWKA 1LE5A 3ARED 2GY7B 4WHTA 3W81A 5KSBB 1I8IB 2WBJD 4XNXL 3HLAA 3HE6B 3M8OL 1K85A 5EB9A 5F7EL 2FZ3A 2ARJB 5JZ7C 5DD6B 3SJVD 1OQOA 2P24B 4ORGB 3OAUH 4NZDA 1DL7L 5AWNH 1T1XA 3TBYA 4G7VL 3PV6A 3VMNA 2FEEI 4YFEA 4XP5H 3U4EB 5CEXB 1B6UA 2I5YH 2OJEA 2WIMA 1JGVH 5EO9B 1DFBH 2PYEA 1J11A 1NC2A 4BK4A 2O93L 1AE6H 5I1AB 2LU4A 1UB5B 3BYTA 1DEEB 4J1UB 5FEBA 5E56A 4PYGA 3TBTB 1VFUA 1U42A 4PJCF 1RZ7H 3KJ6L 2HJFB 5JW4R 1IC1A 4NO2A 3OKOA 4Z18A 3DX6A 4PJXA 5D96B 2UWEE 3MZTA 5DT1L 5TJWK 3WUWG 3HN3A 3EDDA 4X6DB 3GMLA 1KCKA 3JWNC 2PYFA 3IS1X 1CDHA 3TT3L 3AM8C 4MSWA 5CHNA 1CGWA 4GKZA 4QHKI 3WO4C 3RTQD 4Y5XA 5I8EA 1ZVHA 4PB9H 1A5FL 3HNTL 4MJ5B 4JKMA 2MCG1 3O11B 3MTRA 2OR9H 3HR5A 4HUUB 1OGAB 1X7QA 1FFPB 3LCYA 4L3CB 2WINB 1XT5A 5IHZB 1T2QH 1NKOA 5EZLA 2CIKB 2EYSB 2F9BT 4YHNA 5C2BH 1FJ1B 1SM3L 1XEDA 2BY2A 1HOCA 5DDHB 4XTRC 5IVZB 3KPTA 1HQ4B 5I17B 2RFXA 2BVPB 4ODXB 1OVZA 1Y0LB 1JGLH 4Y4FC 3QCUH 4KK6C 3AS0A 4R7NB 3LB6D 1IT9L 4NQCE 4HUVB 3MCLL 4IMKC 1FZJB 1BOYA 2LU7A 3U4AA 1VEPA 2ADJB 5IVOA 1HXYB 3MLYL 1NFIA 4K71C 1F11A 5K9JH 1VFAA 3CZFA 2Z4QB 5FIEA 5EIIB 4FXLA 3RWCB 3UBXI 1YC7A 4Z8FL 2Z9TA 3LH2L 4MGXA 4HKJA 5B38A 4LKCA 5C8JB 4RMUA 5DZOA 4FXKA 3QUKB 4YHYB 4JFQA 2CD0A 1MELA 1NJ9B 3QEUA 1KN4H 5JZ7D 3WO3B 2R2HA 1FL6A 4JRYA 1MF2H 2CLRB 5L8KB 1UA6H 5FECB 4LNRA 4PJXF 2CKBA 5DTFB 3VXMD 3MLRH 1LHZA 1UADC 4LCIL 4P5TB 3ROLB 2DBLL 3NOIA 2EXYC 2NQCA 1OAKL 2GHWB 4MQ7A 1JF1A 1WBXA 1JHKH 4F7CA 3QNZB 1W72H 1HHHA 1I9RH 1I1YB 4X6BB 1DBBH 1G7JA 5A43C 5BS0B 4LVHC 3QUZA 3NZ8A 4YHYC 4PJ8B 1NAKH 4NCC1 5BJTA 1JYNA 2JB5L 3LKPA 2I9TB 3GI9H 4YHML 3WNKA 5HY9A 1FORL 1Z9LA 5I6XC 5KOMC 3O6FC 4J8RA 4QRUA 1IARB 4OD2A 4WFFE 4PJEB 5FA3A 4GXUM 2VE6B 4P5TC 4OGAC 3PGCB 4LEOB 2DM3A 4DTGL 3MRPA 1HEZA 2Q87A 2XOTA 2UVFA 3LEVH 3VA2C 5DQJB 1A22B 3TYFB 4X0KA 3P73B 2HRPL 4L3EE 4X4XA 1NBZB 4ZTOH 4LCWA 4MDIA 1JPGB 1T21A 1NLDH 3GRWH 2GSIA 3PWVB 3BQUC 1ZHKB 4WTXA 4XP1H 1HHKA 2IFFL 3CSPA 3G6DL 5EC2B 4MQTB 4PBWD 1EHNA 1T7VA 3UTTB 1A0QL 3DECA 5AUMB 1T2XA 3N1GC 5E03A 5DEGA 3SN6N 4KK6D 3IU3B 4HIEB 2BRQA 3F5WA 3K46A 3O4LA 1HSBA 5MHSD 2R1YA 4LSDA 1LO5A 4XBGA 1UZ6F 2N7BA 1OGAD 4L8SA 4H8WH 3H42L 2EICA 4N5EC 4A6YL 3IAQA 4MAYB 4ZFZA 3BHBA 5SWSA 4HDIB 3TC9A 1J1OH 1MQ8A 1FO0L 3VXSB 4QNPF 4WENB 4XNXH 4G6JH 3M8OH 2B20A 3MRKA 5I19H 4LLQA 4QRPA 2DJSA 2VN4A 2CDFA 4YO0A 5IMLA 5E94A 3CGTA 2EO9A 5FOJA 1NFDF 1YY8B 5KVDL 4IRSA 4F7MA 2NXYC 4G7VH 1KIPB 1Q0YL 3LQMA 3RL1B 1T5XA 4WW2A 1J18A 1I3RB 3CFDA 3TBWA 1TPXB 2F58L 4LDOB 3KPOA 2Y7QA 4AIZB 2BX5A 3QEQA 2EXYD 2AEIT 2EDYA 1MI5E 4ZPTA 1QYGH 3NGBB 1A7PL 2CDEB 4DQOL 4YLQT 1JTTA 5IROA 4DGIH 2CPCA 4LHUA 2J6EH 5DT1H 1EZVX 1YUHA 3I6KB 2R56L 2M26A 4PLKC 3B9AA 3WFDH 2EIZA 5F88B 5DJ0A 4GRWB 3KPNB 1MCBA 1SVZA 5DVOA 2PTVA 3ARWA 3GSXB 4NN7B 2KH2B 5EU7E 3ZE1E 4OZGB 1TPXC 4ELMA 1A5FH 4GW4B 1K4CB 4P5TD 2ORBL 4GFTB 2QQKH 3KS0H 1BQHA 3DURB 3GMPB 1OWRM 3HFMH 3VDAA 3NGBC 3VFMA 1AXIB 4X9IA 4OBSA 4UIMA 1SM3H 4JPKH 4OV6F 4NQXA 1ZSDB 3KPRA 3PNWB 3SHSA 4PG2A 1INDL 4YHKH 3RIAF 1D5BB 1DBJL 3BDXA 4Z0XB 4JFDE 3BQUD 3ARBC 3IS0X 1Y18A 3C8KB 1X5XA 4NN7C 1IT9H 1OAZL 4FRWA 4FNLH 1MLBB 1Z3GL 3T2NH 1QRNE 3MLYH 5ISZE 5L2JA 2AJYL 4IHOB 3WSQH 4C4KO 3EDJA 2C7UA 2XWBB 3CFBA 4Z8FH 3RUGA 5GZNC 4N5ED 2DMKA 3FL7A 1T7XA 1JZ8A 4O2CB 1MJ7L 1NC4B 4NOFA 4RISL 3HRPA 1A4KA 3FQTA 5AG8A 2D7NA 4ZQKA 4DKEL 5IKCB 3IVKA 3UTTD 3QHFL 3VRIB 1KBGL 1IFHH 3IDJB 3TNMB 4N0CA 5J9PA 2NXYD 3QDJB 3PP3K 2BMKB 4QHLB 3MLSL 1OAKH 5DJYB 1CFTB 3TJHA 3UPCA 4KHXL 1EUUA 2D03H 1S7RA 1AI1L 4MAYD 1OAXL 4ELMF 4QY8B 1KG0B 4OF0A 1MCWM 1UVQB 3BN9C 4DN3L 4ZTPL 1UWXH 1WAAE 4LFHD 4XXDA 4BFGA 1KACB 1FORH 4D3CL 3G6JA 1ORQA 4KMQA 1K2DA 4Z7OE 3OMZA 4S11A 5LXGL 1N5AB 3VFVA 1A02N 4PLKD 1OB1B 4JPIA 2NNAA 3A6BH 2HVKB 5B8CB 4OCXL 4PG9A 5ESQB 2MHAA 3WJJC 1E28A 4OLXL 3K74B 2FJHB 4DTGH 4KDWA 4A6YB 1WISA 2DKSA 1A9EA 2XPGB 3CX5K 3MMEB 3LEYL 3LV3A 4OIBA 3FT3A 4G7YH 3ARGC 2HRPH 4PJ9A 5J1TC 4N8VB 5IW6A 3P2TA 1T1ZA 5D5MF 1CYGA 3HZYB 3O9WB 5BZDB 2VXQL 1C8PA 3QG6B 3ZTJG 1ZKAA 3RI5F 5F3HA 4HIXH 5GSVA 3RU8L 3QDMB 5B8CC 3BP7B 3BT2L 4FTVA 3QO0B 2X40A 4ELKA 2Y06H 4MJ4A 1IZKA 3ARBD 4U1GB 1U8HB 3Q1SL 4FZEL 1D5MB 2ZCKH 5MEOA 3X11A 2YXFA 3CFJA 3TVMB 4Z7UE 2EXWC 1H0DB 2VZOA 4LAJH 4S1SL 4KC3B 3CUPA 1CN4A 2IQAB 4UB0H 2X1WL 2IPKA 3SE9H 3MRBA 1C5DA 3H42H 1HNFA 2D7MA 2AAVA 3C5ZA 5GGTL 1FO0H 3IETB 2P5WB 4P57A 1KXVC 5L7XL 3G5YA 2ZUTA 3TP4A 2JF1A 3DLQR 1E6OH 3S37X 3MV8A 3RL2B 5GRUL 2R1WA 3NFNB 4WV1B 3RZCC 3FOLA 2IQ9L 1IRAY 1C1EH 1Q0YH 3BPCA 5J0BA 5DRXB 4MA8L 1HILA 5GJSL 3WUWA 3MLTB 3QWQB 2W0FB 1F00I 2F58H 2R2CA 3MRJB 4OZHB 4UILH 3L3KB 4IRJA 1LP9E 1TQBC 5EUOA 5DO2D 4ODSL 1FFOA 1QFWH 2VLKE 4QHKJ 2PTTA 4QRRE 4Z7WE 2O26U 4RGNE 4UQ3A 5E6IA 5HYEA 3FO1B 1IKNA 1BHGA 4JKPL 3GKZA 4UNVA 1N8ZB 2MWCA 4LRNH 4DQOH 1EMTH 5T5FL 4WU7B 1NPUA 3BN9D 2R56H 2NX5E 3QDGB 3T0EE 1A2YA 2WSKA 4G42B 1QA9A 2OR8A 2AV7B 3NA4A 1SBSH 2AEWA 2DDQL 3AU1B 5TDNB 4D8PA 5D2LF 4G9DB 4L4VE 2X4NB 5FOBA 5BCAA 1QBLL 2P5EA 4PGCA 1JGDB 6CGTA 3OL2A 1JWMB 4KVCL 3C5SB 1XGRA 5K59E 4OFVA 2AK4E 1BF8A 4J4PC 3QIBB 2D2OA 1ZT7B 2DQTH 4JEGB 4NT6A 5EU5B 1RZFL 4BYHA 4IJ3B 2X1OA 3ARGD 4XBPA 2Y5TA 2Y6SC 5I9QB 2UZXB 2AQ1A 5K93A 4YFLI 3NABL 1ITBB 4UOJA 3QPXL 1INDH 1OP5H 1DBJH 3G5XB 3UTSA 4UNUA 4F9LA 5KS9B 2WUCL 2VLMD 1AGDA 4X5WB 3MA9L 1EO8L 2YZ8A 5DJXA 3V7AG 4HG4K 3VFGH 4JHAH 5IMMA 5TDOB 3S4SG 2OYPA 3D39E 1UM5H 5HHOB 1J05A 2AJYH 1J87A 3QWRA 1F58L 4RWHA 5T3XE 4MMXC 4R3SA 2FIKB 3KNBA 4J3WA 4Y4KB 2D7OA 2FHFA 2XTJC 3LMJL 1LEIA 1AD9B 3O9WD 5IK3B 3SDXE 1WCBB 4HQQH 4AIXA 1I85A 3DV4A 1W8OA 5BZWA 4IM8A 5GZOC 2R2BA 3QO1B 1MJ7H 1BOGA 4I9WE 1V05A 3IXTA 3V9FA 4ZXBA 4ZD3L 2F53A 1HINL 4QYOA 5IHBA 5J7CC 1U92A 5BV7C 1KBGH 1JCKA 2XFXB 2VIRB 1OSPL 1TIUA 1GYAA 4TTGA 2VQ1B 4N0YL 4JAMB 3TVMD 1RURL 4O5LL 2ZOLB 3RZCD 1QVOA 1JUFB 2KDGA 1JK8B 1NAMH 5BV7H 3W9DB 3MLSH 1U2CA 1DQML 1A7NL 1X5HA 2E7HA 4X4ME 1J9CT 4LSVH 4D9RD 3B2VH 2P5WD 2DLTA 3O0RL 5D6CA 4ZTPH 3G5VA 1UFUA 4S1DD 6FABL 1K5NB 1T1WB 2CXKA 3MLVH 3QUML 1FPTL 1E4KC 1G7IB 1J88A 5J56B 2Z91A 4MWFA 3TIDB 2H3NA 1KPRB 2P8PB 4N0UB 4LPTA 5ICXA 3NIGF 2UV3A 4OCXH 1CD1B 5DC9B 3TN0A 2FGWL 3LSOA 1UWGL 4KDTC 4NWUL 5EFIB 1KLUB 3MACL 2DB8A 4WWID 3ET9F 1UH2A 3SJVE 4H20L 1MHEB 3LZFH 3LEXB 3TA3B 5INCB 1S7UB 2V5SA 1YC8A 5C0GA 2VXQH 3HC4H 4J4PD 5EC1A 4F2MB 1D9KA 1UJTA 1QSFE 5D2NC 3S96B 2Y6SD 4JFZH 1FC1A 5A3IC 3EYSL 1JNJA 3QDGD 5GIRB 1HKFA 3OJMB 4MCYA 5DD5L 3U46B 3CCHB 1B0RB 4S0SD 5DK3A 4H88H 1FIGL 1SYVB 3Q1SH 4O00A 5FO9B 1P2CA 4AM0B 2J12B 3DRQB 3GSVA 3HE7A 1VSCA 4E0RA 5DZLA 1ZHBA 2CH8A 4QRQA 5IFAH 1P84K 1KELH 4HWBA 4POYA 3TA3C 1QO3A 1J1PH 1WEJH 5HXMA 3QIBD 2OL3L 1JMXA 1XF5A 2J3SA 3BISA 3FKUS 4GG8A 4HAFA 3X3FL 4LEXL 3P4NB 2XTJD 1OGTA 3U6RA 1CL7I 5ERWA 3BJLA 4TVPH 5GZOD 2R0WL 4TVSa 1BVKB 1MWAA 2X4OB 3IJYA 2QKIA 1TJGH 2F8VA 5JW5B 3EFDL 1T0NA 1TENA 4JO1L 1HH9A 3U9UA 2DTSA 4M7LL 2D31A 5F7DB 2EKJA 4DFHA 1G7QA 5E2TL 4E41A 5HHOD 1W0YT 5JQ6L 5CILL 4JQXA 5KZCB 1KYOK 2UY6A 4YHIB 4TRPL 5I76A 4EOWL 3FOMA 1W0WB 3V4PL 3MGTB 3BJ91 4JKPH 2R1XA 2W92A 4Z6AT 2BXZA 3K8KA 1A6PA 5IOPB 1H3PH 5T5FH 4WCYL 3EO0A 5KSVB 2H26B 1J5OL 3MBEA 5HJ3A 4YAQA 2X89D 1WFTA 3GFUA 2G60H 2YBRB 2DDQH 4FQIL 3B43A 2ICWI 1QBLH 4GXUN 1PKQB 1CI5A 4YFLF 1YMMA 4U0QB 4YPGA 5E8PB 5HDBF 2NTSP 3TWCL 1F3JB 2FEEL 2VITA 4BM7A 5ENWA 5I30L 3D3VB 2AJ3B 3OKDB 1WZLA 4DUWA 4X7FC 3VXPB 4OZIA 2X1XR 4ZO6A 3MV7A 4HEME 3NABH 3QQ3A 5JOFB 4XCEB 3VXME 5BVPH 1P5UA 3S6CA 2OCFD 4RMSA 3FTGA 4NCC2 2BOCB 4XMLH 2WUCH 4PJDE 5ITFB 5DRZA 5A3ID 2A1WL 5GS2D 3PIQB 1WBZB 4MXVF 35C8H 2EE6A 2J8UF 2VLLB 3BIAX 1F58H 2B2XH 1Q9KA 3BZEA 1ZLSH 3M1BA 3MO1B 3U48A 3OF6A 3IAGC 1IAIL 4O4YL 3FONB 3F6LA 1FSKB 1XF2A 2N56A 1QBML 4RSVA 3TA3D 3FN9A 3ARDB 3BKCH 1YQ2A 3UYPA 5GSRA 2OP4L 3X14B 3QUMB 2YSSB 2VSCA 5EN2A 4HXAH 4ZUWB 4ODVH 4PRAB 1HINH 4DN4L 5LGJA 4HEPG 5DVMA 4U1IA 4Z7VB 3MROB 4NSKB 2HKHL 4OAWA 4X8JB 3KG5A 5IEKB 4KRMB 1RURH 3KLAB 1CQKA 5IFHL 2BC4A 3SGKA 4YHZL 3HUJF 4PFEA 1ZEAL 4NP4L 5F71A 5F97E 4Z5RB 1VEMA 2C3HA 1FSKC 3LIZL 3ARDC 1DQMH 1FNAA 3LQAL 4J2XA 3ESUF 3QCVL 3DIFA 3AS1A 3F8UB 5JHLH 7FABL 1V3MA 3VRLE 4QKXB 1NGWA 3L7FB 1RMFL 4C57C 4JFEA 1CGSL 1OM3H 5HVWA 5GS3A 4NBZB 1N6VA 4D0CB 5C7XL 3EO9L 4NQSB 4BH7A 1L9NA 4B53A 3EYVA 5ALCL 2VL5B 2FB4L 3VFUA 2FGWH 4HS3B 4YEFA 3U0PA 2GCYB 1UWGH 5D1XB 1N6UA 5KZCD 2P42B 3AY4A 5EZJB 3U36B 3WE6B 1NGXB 1NDGA 3TBVA 4H20H 5IV2B 4RGMB 3LKSB 3ZTNL 3TESA 5EWIL 2A6KA 5DMYA 2OQJA 3CLEL 3R06A 4HGKC 1LK2A 3BUTA 4P2QA 4Q9QL 3B8SA 2PXYB 3EYSH 4QGYA 5DS8A 5ESAB 3IDGB 5DD5H 1XCTA 2QQNH 4KJPC 1RI8A 2FECI 3H3KA 4XVTL 4YK4C 1I1RA 1FIGH 5TH2B 1Y6KR 3DUSB 4GSDL 3LPWA 5EU3B 3BZFA 5IVXA 1U8QB 1T0MB 4P3CL 5DSCA 5IWLC 2VISB 2OI9A 4Y8AA 1U91A 4Z78A 1IKFL 4RGMC 4N90E 5E7FA 3MJ7A 3HAEB 3D0VB 3D3VD 4UT9H 1CR9H 3HZVB 2OL3H 3STLA 2YR3A 4NC2B 3X3FH 4LEXH 2EDRA 2FIRT 4NQED 3ZT7A 2V2TB 4TQEL 3SKOA 5CBAB 4G8IA 4S2SA 2IAMB 2DQCH 4PP2B 1FNHA 3QIUB 3EFDH 3RY5A 4YBLC 3L3DA 1GGTA 4LIQH 4GW5A 1YDPB 4GAJL 2I60H 3C8HA 5E8EB 2N7AA 1U8NA 2JJWA 3RBSA 1KCSL 2CRYA 5JQ6H 5CILH 5HYSG 4P2RA 1G7HA 4XC3L 4TRPH 4ZFOB 4AEEA 2P7TA 4YZFF 1LO0L 4M03A 3JUYA 3ARDD 4PJGF 3SKMB 3O6LL 5IBTL 5CJXA 3HS0B 4PJEE 2GJZA 4LK4A 2DD8H 4PJHA 5JUEL 3QXTA 5DF0A 4ZUUA 1J0HA 2IAMC 1I7ZB 4WCYH 4ZS7H 3QIUC 2AS5M 3FO0H 1TCRA 1OD9A 5T1LA 3EYOB 4HC1L 1A9BA 5C08D 3O2DL 3FQUB 3LRGA 4R0LA 1EEZB 4FQIH 2DL9A 2AKRA 4YIQB 4PJAF 4OQTL 2JK5B 2A6DA 1MHPL 2APWA 4GBXB 1KC5H 4PP8C 3NPZB 1JGEA 1YN6B 1KJVA 3TWCH 2AEQL 3MREA 4S0TD 5I8CB 1L0QA 2Q86B 1AHWA 4A2MA 4OCYL 3S4SA 1ZXQA 1UACH 3UTTE 4HXBL 1CFNA 1BIIA 1F3DJ 4GG6A 3U9PL 1FYTD 4WI6A 1P6AB 1H8SA 3WFHB 1IAMA 2ADFL 1YPZB 1RZIA 1WT5A 2NY3B 4HWZB 1ZT4A 3BYYA 4Q6IA 2W1NA 1DQJA 5LVEA 3OQ3B 1U0QA 5CEZL 5F7MC 4H0IA 4OLVL 4GBXC 5TE4H 4WEBL 4KJPD 4F37F 4S1RL 2Z35B 3LHPL 4NHCL 4LNVA 3SGJC 3SE4C 2HLAA 3DVFA 2XKNA 2DBJA 1TJHH 4MCZB 3ROOA 3UDWA 3WJLC 1K8IB 4XVJL 4I0PA 1PY4A 2BP3A 2WQRA 3V6ZB 4O4YH 4PS4L 1QBMH 4XAKD 1I75A 2AXGB 5DHYB 1FL5B 4R4NC 4LLVB 2JJSA 2NY3C 2HWZL 2OP4H 5LGKA 3FRUA 5BW7A 3K1DA 3KPPA 1R5WA 2QR0B 2R4SL 4RAVB 1MEXL 2CLVA 5FF6A 1A7RL 1LD9A 4LPWA 3T09A 2J8HA 4U3HA 4DN4H 3QFJB 1YEKH 3RA7L 5KN5A 3V4UL 4P4RB 3P4OA 1MUJA 1NL0L 4HPOL 2YD3A 2HKHH 5TGBB 4Y89A 3LQAC 3B6SB 5IFHH 2BXYA 4YHZH 2HRLA 3L5XH 4H1LH 4FQLL 2UY7A 2UWEA 4Q0XH 4APQB 2EIDA 4M9OA 4PR5B 4MD4B 2Y07L 3QCVH 5DVNA 4H26B 1SJEB 3E0GA 3L3HA 1FNGB 4GRWE 7FABH 2BCKA 3BEVB 1RUPH 5IB5B 2X41A 3IFPA 1A1MB 2IC2A 2AGJL 4OZGE 3O4OC 4HGMA 5JDSA 4OKVB 4M3KB 2XN9B 1QSVA 5C7XH 2IAMD 3EO9H 2XKUA 3FB7B 4RAHA 3QIUD 3B9VA 5D72H 5ALCH 4DVRL 2FB4H 5ANMB 5MP6H 5FK9A 1OAYL 2BVEA 4FQ2H 5DLMH 3STZB 1HQRB 1YEIH 4JGMA 1LMKA 3HTLX 1GC1L 4M62L 3S9DB 4KMTH 5FM5O 5I1CL 4CVXA 2VERN 4LBEB 5F9JB 3CC5A 1H5BC 2DS4A 1XIWB 4OD3L 4PJFB 5EOCJ 1JFQH 5CJQL 5E99L 5EWIH 1RPQA 2C1PB 2HG5A 2R23A 3EIFA 4DCQA 3I84A 3CFEA 4A2LA 5C9KA 4RIRA 4CL7A 4QOKD 2ZUVA 1I8LA 3KR3L 3UTPD 2F54D 3DXAB 2Q20A 3OGOE 5HHXH 5IJVA 2NW2A 1F8TL 1QSEB 2VXTL 4OZ4A 2VDNL 4EUPB 4PJBE 1U9KA 3GIZL 32C2B 2E7LC 4P3CH 4TUJB 4GBXD 1VESA 5H2BB 3C5JB 1II4E 3PL6A 4OV5B 1C08A 2CRZA 1XIWC 1IC4H 1QLFA 1K6QL 1OY3B 3IDIB 4PJ7F 4J6RL 4JM4L 4L9LB 2YN3A 5IMOA 1EHLH 5HHQA 4K07A 4BFIB 2NY0B 5CSGA 4R2GB 1SVCP 3AS3A 1QLEH 3G08A 2H8PA 4R4ND 3B9KA 2NY3D 1RD6A 1UWXK 1MFBL 1EJ6A 1IC7H 3VDBA 4KTYA 2VNCA 5GJTH 1A3RL 5EUKB 4ODTL 2VDLL 2GFBB 2E5EA 5C0BB 3RKPA 1S7VB 4GAJH 5D7LD 1IEAA 3DROB 1FV1A 1O0VA 5DVLA 1FC2D 1ONQA 4MNHA 5HHVL 1PFCA 3PE9A 5KJRL 3V5HA 4LMQI 1JYWA 4WFGD 3UTOA 4L9LC 4XC3H 3GBLA 3WS3B 1A21A 3PDDA 5DRWA 1S7SB 1IM9A 1KJ2A 2BVQB 4K3DL 3O6LH 1S9KC 5IBTH 2VLME 2X7LA 4Y88A 1U36A 3GSOA 3LVEA 5TQ2L 2BVYA 3QFJD 4PV9B 4U7SA 4HC1H 4ZYKB 4L3EA 2W65B 3MODL 4YNYB 5LAXA 2H2SC 4JQVC 1SJVA 4LCUA 4OQTH 2A6JB 4NKMA 1SEBA 2C3VB 2IALB 1A6WL 3VGAB 3C60C 2EH7L 1EXUB 1NSNH 4W70A 4PDCE 2B7DT 1YY9C 5D6DA 3T3ME 2AEQH 5H35A 1EAPA 5SV4A 5HDQL 2V7NA 3GMOA 3EYUH 3IJHB 4XC1L 1AKJB 4ETYA 3U9PH 1U8PA 2E8YA 3RWIA 1R3IL 1LE9B 3MJ8B 4XMKL 1DQQA 2HFTA 2JB6A 2VH5L 2XN9D 3FQWB 4MDJA 5CWSA 2QQQA 5GHWL 2CUMA 4MJIA 5GISL 4PGEB 1KB5A 4OLVH 4XAWH 4GAYA 4LVEA 2H6PB 2W9EL 4RDQG 4D9RE 1NMCB 1D5ZA 1RJLA 2I27N 3MRIB 2P5WE 1MY5A 2ZSVA 4BELD 3MXVL 1KIQB 4IOFC 1W2KT 2IWGA 5DUPL 4NDMA 3ZDZE 3P30L 1HDMA 1MCKA 1XIWD 4ZFFA 5IEHB 4OB5H 1M7IB 5FB8A 4LASH 5D1ZB 1ZVYA 4F9PA 2XQBL 2R4SH 2EE2A 4K7PX 1MEXH 2H1PL 4JY6B 4QXTA 4ETQB 5L2KD 1A7RH 4XGZB 1DLHA 2DQGL 1WK0A 5HHPB 3RA7H 1VEOA 3DXAD 5F7FA 1HHJB 3LQZB 2ATKA 3OAZH 3H3BC 1QSED 4FQHA 4HX1A 1MI5A 4YFDB 3TCLB 5JW4N 1KNOB 4LAQH 4YR6A 1A3LH 4HUXB 1ZWIB 1AH1A 3T4AB 2PKDA 4ESKA 3UROR 2XNAB 3GJFH 5CKGA 1ADQL 4ZO8A 3QH3A 5D1ZC 3MRNA 5C07B 4XPBL 4F58L 3MOQA 1XF3A 4BZYA 3Q6GL 1V3LA 8FABB 1ACYL 3P4LA 3VWJB 2AGJH 3G6AA 3SDAA 1HSAA 1K8DA 4XHJC 4LP4A 2DQJL 1HYSD 1RFDH 5EPMA 5I18L 1MFAL 1T83A 1U8MB 5D93C 1S9YA 4LSPL 4KXZI 3C6LB 4JG1H 3U7YL 3RHWF 1GC1C 3EHBD 5C0BD 2ZNXA 4OZFB 4GKNB 1MHHB 1YN7B 1NGPL 4LVNB 4DK3A 1MRCL 1OAYH 2H2SD 4JKLA 1CLZL 5DUML 4TPRL 1TITA 1MJJA 2HP4A 2XTJE 3CXDL 4XPHL 3DETD 2YC1A 1VGEL 3GHEL 3RY6A 1UXSA 4MXQC 2P49B 4OGZA 3MX0A 1WCQA 2PR4L 1P9MC 1YY9D 5FYLL 2FRGP 3TIEA 2BY0A 2WW8A 1CQYA 5E99H 1OP9A 2KBGA 3V0VA 1L6ZA 1CLYH 5ISZA 5CEZD 5DJ8B 4IDJL 2VLRD 1JWUA 3I9GL 3QXAB 5SV3A 4M6OH 5HHOE 3F7VB 4X4YB 4ZMAT 3ALPA 1VHPA 4WEUD 4GKOA 4NUJA 1HIML 2VDNH 2O61B 2VDPH 1INEL 3MOBL 2I9LB 2DJ4A 3QUXB 2JE8A 4OF7A 1NGQL 1DN2A 2I07B 2CRIA 3PWNA 4EBQL 4JRXB 1HHGA 1CD0A 2GEEA 1R3JA 4XRCA 5T1KA 2ADGB 3RAJL 4PTTB 2EDTA 4O2FA 4F8QA 3CK0L 5HYSA 4IOIB 3F7YA 3ARTA 3MRGA 3MRLA 3G5ZA 3QQ9C 1MFBH 1UJ3A 2I25N 1QLRA 4YXLL 2GTWB 3KXFA 2VDLH 1SQ2N 1N2RB 4HMEA 4XCFL 5E4EB 3REVA 4UDTB 1UGNA 3PXHA 5D9SB 3QUXC 1KV3A 2AJVL 1U8LB 2UZIL 2ZOKB 4JFOB 1CF8L 1WAAA 1CZ8H 4LQFL 5HHVH 1KCRL 3GUTA 3DUHA 3A67L 4I18B 3MA7A 4EI5A 2FEDC 5CUSL 3THML 5D2NE 5H94B 5DYOB 4TOYH 5I1KL 4DAGL 2J8OA 4ONHB 4NM8L 1N4XL 1QFOA 2KQNA 5D1ZD 3BRGC 4HH9A 5FKPA 1T3FA 4HKBB 3U79A 4RQQA 5E4EC 3G04B 1ZT1A 4O51B 5I1GH 4BQBA 2OX5A 2IBGA 3NA9H 3E2HA 1L6XA 4XHJD 4P9HL 1WIUA 3OKLB 1YJDL 5HBBA 5CZVL 1UYWH 4P3DA 1KT2B 4JFFB 5CP7A 1NCUA 1DBKH 4I18C 5F1IB 2MPAH 1T89C 2ZWLT 4LLDA 4PGDB 2EH7H 5JDJA 5DK2B 3ARFA 1RIHH 1R3HB 3NIFF 3ULVF 2OZ4L 3VGHA 3OAYH 4HV8B 1IC5L 2WUBL 5C07D 3VMOA 1FVDB 5MERB 3BUYA 1KTLB 3FFDB 4Z7UA 1CXHA 2OJZH 5IJKC 1ZANL 3KYMA 1R3IH 4Q7DA 1T4KB 4XMKH 2VH5H 3T08A 2HFFA 3VFOB 2OXHA 3LD8C 1U8JB 4QRTA 5ECJE 1N3NB 2FJFA 1IEHA 2GT9B 3BIBX 1VADA 4V2CB 3WIIH 4EN3B 1TZHB 5F7HA 2V7HB 5J6GB 2W9EH 3MRRB 5FCSH 3W2DH 2YD4A 1Q94B 3MXVH 1D6EA 2JKXA 3QAZB 2X4UB 1Y6MR 3CDFA 2ZPKL 5EORH 1TZGL 3P30H 1WWAX 3E6FB 5LQBL 3LY6A 4KROB 3EDKA 5HGGS 4GMTL 1CGXA 2XQBH 5KSAA 2JCCB 4MB5A 3P9MB 1Z5LB 4Z7OF 1LP9A 1JPFA 4U3XA 4AG4L 1EVUA 2VLKA 4QRRA 4EN3C 4X6CF 3T1WA 2BNRB 2X4QA 4JCLA 3K3QA 4RFNB 3HG1D 1G1CA 3C6SA 5F7LB 4KRPB 1BQSA 4YDJA 3MNWA 2RQ8A 3OBAA 1C16A 3PG2A 3QUXD 1OPGL 3DX9B 2ITCA 2A2QT 3QAZC 3T0EA 3WS6C 1ADQH 3L6FA 4JRXD 2H32A 1F3DH 5ICYB 4KROC 4XPBH 3HR6A 3F58L 2FEDD 4HKZB 4QGTA 4L4VA 2Q8BL 4FZ8H 3Q6GH 3SDDB 1MFDL 3HZMA 5HGBA 1WICA 4GUPB 1RZKL 3J7HA 1AO7B 2VMFA 5FO7B 2DAVA 1PKQE 4PJCE 4JHWL 5I18H 5ETUA 4ZDHB 1AGFB 4LSPH 4OCMC 2AK4A 2HTKD 1L7IH 3IB4A 3WEXA 4RFNC 3T0WA 1KSRA 3L3JA 4JANB 4N8PA 5DR5L 3RWGB 1CXLA 1BM3L 1WC7A 3BWAB 4E5XB 3GHBL 3EOAB 1QR1B 1MRCH 3S88H 3ZLQC 4K55A 5DUMH 4LU5L 2DQFA 3S35X 5IQ9B 3LN5B 4TPRH 2X10A 2ESVB 2Z93B 3CXDH 5EA0L 2XWJA 1H8NA 3PGFL 4NQEE 1VGEH 3T65B 2C4FU 3GHEH 1OCWL 2UUDH 3EO1A 3VFTB 2PR4H 4DUVA 1FAIL 5FYLH 5B39B 5CIPA 12E8L 1JPTL 4XCNB 2FBJH 3D39A 3H9SA 1S3KH 3T4YA 3DVGA 2BJMH 1DANT 3B3IA 3RPIB 4UT6L 5EU6B 2A9MH 4W6WB 4U2YA 2ZUQC 4QHUB 4GRMA 5E5MB 4GQPH 1UM4H 2A73A 4M7ZB 1F4XH 3DVNA 3U7WL 4XNZB 3UO1L 1U8OA 5DMKB 3OSKA 3SDXA 1X9QA 3OTTA 2GJ6B 2Y25A 4XPGH 1U6AL 3VGBA 2FSEB 3MRCB 3DMMC 1NGQH 3BP4A 3H9YA 5B21A 3WD5L 1CFVL 4YUEL 4Z7WF 4EBQH 2BDNL 5DD3H 1J1XL 3ZE2E 1DBAL 4NO3A 5CBEB 3VXNA 5MEND 4LFHG 1MCRA 4G80B 3EGSB 4QCIA 5C08E 2R4RH 2MMXA 3ZDXE 4Z7VE 3CK0H 2LU3A 4CAGA 4TUKH 3RWJA 4FQQA 3NACL 2PW2A 4M7ZC 4EXKA 43CAB 5A2KH 4CN6A 3B5GA 1TVHA 1SMAA 4X7EC 4XCFH 1AY1L 4JY4A 4U1JA 3L3GA 2AJVH 2UZIH 3KWWA 4AEIL 4EN3D 3HI1B 1CF8H 3GJEA 5JA9A 1FYTE 3CH1B 4R26H 4XH2A 3A67H 4G9FB 5EOCH 5ESVA 4PJIF 5CINL 5HGAB 5CJOH 5EDXA 3TM6A 1IQWH 2KUTA 5DHVB 5C0AB 1HZHL 2VSDA 4NM8H 4KROD 4Y5VA 5ADOH 1N4XH 5E70A 4JFXA 4QO1A 3BESR 2WP3T 1YJDC 2HVJB 3JTTA 5CMAB 1VKXA 2WBJA 2Q6WA 5AEAA 1I8KB 3SJVA 1WWBX 1Q9OB 1JHTA 4L29A 2BNRD 3JVGC 1CL7H 3QEGL 1H3UA 3QULA 4R7DB 3V6FA 3SDCC 4JB9L 1QSFA 2RB8A 3WFBH 5I8KL 5J4MA 2ICWB 4DZBA 5IT2L 4EVNB 5DWUH 4Y4HA 1ZOXA 4LOUC 4N0RA 5FYLD 2OZ4H 4BH8B 4ISVB 3SKNA 3SO3B 3SBWC 3U1SL 4X7SL 4LIQE 4M7LT 2EYTB 4X6EB 4JR9L 2MQ3A 1ZANH 4DW2L 4Z7NE 5D1QB 4JFPA 3QJFB 2A6IB 5C0RL 3UX9B 4OLEA 2VLJA 4P9MH 3G9AB 1TVBB 5GGSY 5C3TA 2GAZA 4BQ8A 4XP9L 5CZXC 2GQHA 2R29L 4QT5A 5ID0B 1CGTA 4Y19A 1N59B 4ZODA 3RTQA 2FL5B 2G2RA 2AXFB 3EDFA 4ODWA 5E8DL 2ESVD 2D0FA 1EV2E 4NGHH 3UJTL 4OGYL 3SO3C 4JO4L 4L4TB 4MB3A 5HVFB 1S7TB 4HIHB 3DMMD 4RNRB 1UZ6E 2XQYK 3LKOB 4C83B 1QEWA 3CX5J 2W91A 3GM8A 5D1QC 1FQ9C 3SCMC 4LLUB 1IAKB 1L0XA 1ZHNB 4U1MB 1QPXA 5GRVL 3S5LB 1VENA 1ED3B 5EU6D 4M6AA 3NMEA 4I2XE 5CKAA 3QUYA 4K3EH 4AG4H 4QNPE 3DI3B 1H15A 1R6VA 3BP5A 3FQRB 3VE0A 3S35L 2DLFH 4ZNCD 4EI6A 3RQ3A 5KSUA 2RJMA 1JN6B 2V2XA 1NFDE 4TUOA 1A64A 5IW1B 5F6IB 3JV6A 3T2PA 3MZGB 1MFEL 1OTSC 3OKKA 2VDOL 1RZKC 4QOKE 5LKNA 3UTPE 1NEZB 4M7KL 2F54E 3VFRB 3DO7B 1AGBA 1RJYB 2Q8BH 1KB9K 2W59A 2YA2A 1M05B 1E4XL 3HNVH 1MFDH 3RVTC 3AS2A 4HKXB 3MUGA 4KV5F 1PVHA 4PY8J 4HBCL 4U1LA 3UTZA 2FR4A 3IDMA 2M1KA 3D0LB 1BM3H 5E2WH 4UU9B 3ZT5A 3ZL4H 4LU5H 1VFBB 1ZGLB 3VXMA 1GAFL 5EA0H 3SDCD 4MNQD 5D7IA 5FA4A 4L1HA 4G9FD 4IOSD 1YPZE 1OCWH 1GGCH 2FO4B 1B0WA 5DJAB 5TDPA 5L0QC 4ONFL 3MOAL 4D2NA 3V52L 1NCBL 1LEGA 1WVZA 3WIFA 4F7TB 4LOUD 1ROWA 5C0AD 3MRFA 1IMHC 2CDGA 1UC6A 2J88L 1XGUB 4QHMA 1RZGA 5D7LE 1WZMA 1BJMA 4UT6H 1ND0B 2OTUB 2VRAA 2V2WB 2EDHA 3FT2B 3QRGH 1RUAL 2X4TB 4R96B 2KL6A 3X12B 3WV0A 3UO1H 4PGBB 3TJEL 2DQIL 2EE9A 3OV6A 5KW9L 3WNOA 2YRLA 2Y1VA 5F7YC 5C09A 3OJDB 3MV9E 1JZ5A 3WXWL 3VXRD 2X4SB 3Q3GA 4LRIC 4WWKB 2Y72A 1LE5B 1J1XH 1NBVH 1RAMA 4WI3A 3RWHB 4WHTB 1DBAH 4Q2ZA 4XPFL 4JG0L 3DYMA 3HLAB 4NC1C 2BVOA 2FZ3B 1QQDA 1QFUL 2MKWA 3PHQA 3B9EA 1X5FA 3RIAK 4XNYL 1T1XB 5D1QD 5I1JH 3SCMD 1FZMA 3PV6B 5CGMA 1MRDL 3ZE0E 4K2UL 3MJGX 4LP5A 1A1NB 5KVFL 4OUUA 3MFGB 3W0WE 4E9LA 2W9DL 2OJEB 2G5RA 4WVRA 4AEIH 2OK0L 4Y4FA 4KZDH 2PYEB 1NC2B 1Q0XH 5JIKA 4X5XA 5FUOL 2ZCLL 1CG9A 4IMKA 1B9ZA 3D25B 4JO3L 3VXTA 4FOMA 4UQ2A 4L4TD 3FQNA 5FUCC 2XN9E 1OTSD 2F19H 4L3CA 3OKOB 4LSTL 4AEHH 1T6VN 5T5NF 2GIYA 4Q9RL 2HJLA 5ANME 3GMLB 2PYFB 5GRZA 3NFSL 3T2OA 4NZTL 4MSWB 5CHNB 1KN2L 4GKZB 1HQ4A 4PJDF 1M7DA 4ODXA 1Y0LA 4M93B 4JN1H 2GI7A 2E7LE 4Y5XB 5I8EB 1M4KA 4MA3A 5F9DC 1EH9A 3BW9B 3HMXL 1BJ1J 1QP1A 3HR5B 5KSBF 4JB9H 3AB0B 2FX9H 1D5IL 5I8KH 4KKBC 4XXCC 2EDFA 5EZLB 5L2KE 1CXIA 4YHNB 1W72A 4HS6A 5JIIA 3GB7A 1X4XA 4MMZC 3K8MA 4ZUTA 5K9OA 3LKQA 2ADIA 3DXAE 1HOCB 4N9GA 2RFXB 5EU4A 3RWCA 2OLDA 3UC0H 3I2CH 5J89A 1RHHA 4KI1A 1A3QA 5I1LA 1ZA3A 5K9QI 5J06A 4XP9H 3LPFA 2VN7A 3AB0C 5C9JA 3WFCH 1NFIB 5H8DA 1F11B 1OF2A 3MQIA 3ORJA 3O6FA 3CZFB 5E8DH 1LQVA 2NY4B 4OGYH 2VR5A 3ROLA 1UCTA 3OKEA 4KQ4H 5CEYA 4FFWC 4X6DF 1BREA 4O02L 4CMMA 4HKJB 1JZ6A 2PNDA 3PWPA 4LKCB 5F21B 3KVQA 2DM4A 3GSNL 3P11H 4FXKB 4HFUL 1GGBL 3GRWA 4JFQB 1PEZA 4FABL 3TNNA 5FYJL 3QEUB 4W4OC 3RY4A 1FL6B 4JRYB 4BFEA 2EH8H 3ETBF 3A6CL 4I5BA 3BRFA 15C8L 4LNRB 2CKBB 3BQUA 2DI8A 2VJXA 1AD0A 3UXFA 3TF7C 3ULVL 1KLFA 2LTQB 4XPAL 3MLWL 1I7TA 2NY4C 2Y5EA 3D9AH 2RBLA 4K8RC 4KJYA 3V0WL 4JPVH 4MQ7B 4P5MA 4D0DA 1JF1B 1WBXB 2X1QA 4F7CB 2F5BL 1HHHB 2B1AH 1MFEH 1FDLL 5CEZE 1IAIM 2VLRE 3QI9B 2CSPA 3QUZB 3NZ8B 1P69B 1A7QH 2BSTA 4K8RH 4M7KH 5EOQL 5BJTB 1P84J 4BZ2L 5DK0A 3LKPB 2YUVA 3ZSSA 1T80A 2W07A 5HY9B 3KPSD 4RZCB 1I1AB 1JPGA 3JV4A 1VPOL 3FB5A 3ARXA 4J8RB 1CDYA 4QRUB 4OD2B 5FA3B 2VL4A 5KG9A 1YYMH 4G6FD