5E8PA

The structure of the teipp associated altered peptide ligand trh4-p5nle in complex with h-2d(b)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8pA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8pA01
2EKSA 5C07B 3WCYA 5GS0L 5CUSH 4TYUA 3HZKA 3G08A 4HKBB 3OTTA 1T4KB 4UUJA 3SKJH 1AXTH 3ESVF 3LAFA 1Z5LB 3BH9B 4JFZL 4X8XA 3EYVB 3OB0H 3PV6B 2HWZH 4RX4A 3H9SA 4GKZB 3QPXH 2I60H 2VDPL 5F7EL 1MUJA 1UZ6F 2GTZA 3TIEB 5IBTL 1T03H 5EUKB 3X13B 2P7TB 5CAYB 4LNRA 1XGUA 3C6SB 1ETZA 1BMGA 2A73A 3SDAB 4APQB 2OX5A 2DQTL 4Q2ZA 4PGEB 3ULVC 4P5KB 2MHAA 4OI8A 5E7FA 5IB2B 2V5YA 5D5MB 3VD7A 2H1PH 1YPZB 3ARTA 4LLMA 1AKJA 1J86A 4F7EB 2YD6A 1DN0A 1NUFA 3GMPB 5F9AC 1OLLA 4LPYA 1A6WH 2V9TA 4OZ4A 2VXQL 4YDIH 3QQ9C 4ZO8A 5TE6H 5HYIA 4HQQL 4LSTL 5EU6A 4G9DB 2ENYA 2KZWA 1LMKA 5HGAB 3T4YB 1T2QH 2D9CA 2G75B 1NC2B 4RRPG 3S37H 1QVOB 3KPOB 1EEZA 3BKCL 4NJ9L 1MVFA 1Q9WA 1JNNH 1QFWH 5FKPB 1S78D 3JTSB 1QSFB 3DXAA 1XGPA 4XGZB 2ZOKA 3ARGD 3HHRB 5AD0B 4F33B 2M8XA 5CBEA 4KK6C 3JV4B 5JW5B 3QCTH 1AH1A 3TJHA 1R3KA 1MJ7L 2JIXB 5D7JC 4OF7A 2VLME 3KPSA 3QUMH 3KPLB 1NCAH 3PHOA 4GKNA 3LKRA 3IVKB 3HG1B 2V7NB 4U1KB 1XF3A 1UYWL 2F54B 3WJJA 3ZKMD 1JMXA 2YZ8A 2EE2A 2UWEB 5D6CA 2NY7H 3RY4A 3P9MA 3TPUB 5D7LB 1NCDH 2Y36H 3BPOB 1A5FH 1Y18A 2BSSA 4YHMH 2CJUL 5GRVK 1OP3H 1HI6A 1IC7H 4P4KC 2CSPA 1E28A 4Y1AD 3DPBA 4NNPL 5ACMA 2UZIH 4Z0BH 4WI2A 1EBAA 1P5VA 3L6FB 1X5ZA 4JFDA 2GK0A 1Q94B 3JSSA 2VL5B 4WFED 3BP7A 2IQ9L 1T0MA 4GRWF 3UYRL 1P4LB 1UWGH 4IOIA 5DHXB 1I9JL 2VB5A 2RB8A 3O8XD 3GMLB 3BEVB 3B5TA 1MRCL 4BZ1H 3VDAA 1EMTL 2NY4C 3O6FB 4R4NC 4X9BA 4Y5VB 4BFIA 4PGCB 1GVIA 1IILE 1GGBH 3QUZB 4NZJA 1NH6A 1V05A 1NJ9A 3OKNB 1OTUC 1I4FB 3P9LA 4HH8A 5KG9A 4EDWL 1QBLL 4TRPL 1WEJL 2EXYC 1RQ5A 1SYVB 4XMPH 4RIRA 2JELL 4WO4C 3MBEC 3ZDXF 5FM5O 2BVQB 4NBXB 3L3HB 1T04A 4DFHA 5CSZB 2NLJA 3DUUA 2X4TB 3O2WL 4JE4B 5AYUH 1KLGA 2MPAH 5HHMA 3Q48A 4MNGE 4PLOB 3T0EB 5HYJE 4TULH 5EU5A 1NBZB 2DD8L 2QSVA 5KSVB 3WBDA 4QXGH 5DXWA 4HFUL 2APVA 3ZDYE 1HDMA 4PR5B 5KSBF 3OMZA 3L3JB 2K9UA 1CXKA 4Y8DC 4JFFB 3OKKA 5F9WC 5DD1H 5T1DH 3D3VA 2R23B 3OKLA 4JPIB 4I9WE 4R7NB 1J1OL 1E6JH 5EA0H 5FK9A 2D7TH 4U6XB 4RMSA 1DN2A 2F58L 2XPGB 3CMOL 2AGJL 5FYKL 1NAKL 1C1EH 4R0LC 3D85B 5C0BB 3FMGH 3UJIL 2X1PA 2RGSA 3GMNB 4HIHA 4UBDC 5E0QA 1UM6L 2XZCL 5IFAL 5J3HC 6FABL 1BQHA 1CDJA 4I0PD 4RMTA 3D2UA 1FG9C 3DX8A 1MIMH 4K94C 3FO1A 4Z7OE 1A9BA 5MENE 3B9DA 1DBJL 2V5TA 4YR6A 4R3SA 2A74B 2QHLA 4MD5B 1SY6A 3ZDZF 3VWKD 5C0EA 2CKBH 1NKOA 3EYOA 1PFCA 1KIPB 2H26A 4X80H 1GGIH 1JPTH 2H9GA 2ERJC 4YWGL 3W0WA 3QAZB 2NX5E 3LKPA 2YA0A 1OQOA 2QV2A 3GIVB 1B0WA 4WTWA 2F53B 3ULVH 4OLVH 1C8PA 4FG6C 1GH7A 1H3GA 5H35B 1HN1A 1WBYA 2F8VA 3L7EA 1A6AA 4I48B 3BWUC 4GKSA 4MJIB 4X98B 4X6FA 2AEIT 4EIGB 5I8EA 1F6AB 5I1AB 2ICCA 3B3IB 1AGBB 4ZSOB 4GO6B 1TFHA 3BD5A 4J8RA 4KTEH 5GSVA 4M03A 5IW1A 5IWLA 2VZ3A 1JUFA 3H3PH 3MRRB 2DLIA 5J9PB 2EDWA 3QQ4B 3TA3A 2VZVA 4PJ7E 2O5XH 3EFDH 4WI3A 1JF5A 3BZEB 1LO5A 4X7SH 3CIQA 1I9RL 2OI9A 4NWTL 1BFTA 1KFAH 4AG4H 4R8WH 2CLRB 4P57A 1TVDA 3ARQA 4WUUB 1S7VB 4Y4FD 3MGOA 4EI5B 4U1SA 4YHNA 3VJ6A 4ALAL 4JFOB 4NPYA 4IIQA 1FL5A 2A0LC 4OQTH 4F3FB 1AO7E 3ULUF 4TOYL 1G6RA 2DM7A 4PRHD 4P46C 3WE6A 1E27B 3MJ7B 1I7TA 5I19H 4MB4A 4OLUH 5IP4A 4KK5D 3RBSA 4JRXD 4MSWA 2EYSB 4PRPB 4NZUL 4I3RL 1BZ9A 3KLAA 3NVQA 1JNJA 2ZCLL 4IDJH 2NXZC 5TQ2H 4BH8A 4WHCA 3HAEH 3T2OA 1T89A 4K55A 4WI7A 4EI6A 5GS0C 5C0CD 4NO2B 3QUXB 4F7PA 3UTOA 1W8NA 5IGXL 4Q6IA 4IOSD 4LLQB 5CP3A 3WO4B 4FQQA 4LCUA 1G7MB 1FVEA 4WY7H 2IGFH 4Z95H 2VXSL 5SWZE 2R4RL 4YHYB 4MQXD 1T0PB 2X4SB 2R2HB 1CI5A 4NQDA 3LN4A 5E00A 1FNLA 5DJCB 3GSXA 1FG2A 2ESVB 5E9DD 5A2FA 4NM8H 4NP4H 5E5RB 1WT5C 2FO4A 3QI9D 2CLZA 4PP2B 4MMZC 3GSNL 3FT3A 4ZAKC 4OCLC 3IFPA 4O9HL 3SJVA 4QOKA 1LD9B 1DFBH 1MHHA 1PW3A 3ABZA 5CD5D 5I30H 3ALXA 2O5ZL 1U3HB 1U95B 5IMMB 1ZTXH 2XWJB 4PRDB 5EO0A 3SCMC 3WFBL 2VLRE 2QKIA 3PXHA 3EBAA 3L1OL 3C6LC 5FYLE 1G9NC 3ALWA 4HEPG 4HHAB 3VI3E 4M1DL 2GK2A 2HA1A 5I1IL 3SN6N 1VENA 2WLZA 4XMLL 1T1WB 3MO1B 4OV6F 4OCWH 2DQJL 2NY0D 3GM0A 2R9HC 4AYFA 4KK9D 5IG7A 2PXYB 2UZXB 3HC4L 4OGZA 4PUBL 1VADB 4YBLC 4EUPH 3WIFA 3CUPB 4ONHA 3PGDA 3CSPA 3QUKA 4GS7B 5LGHL 2R1XA 3O2DH 1WZLA 3MMEA 1DLHA 5HPOA 1UT9A 3RTQB 1JWMA 3RGVC 3OGOE 2HYMA 1AKJD 4K94H 4PTUA 3KGRA 5BZDA 5CJ5A 2NY3C 1QKZL 4PJ5E 3RNQB 1I7RA 1F42A 2G60H 1FSKB 3O41B 2LE9A 2VLJE 1KIRA 3MUGB 3PIQB 3WEXA 1U8JA 2YWYA 3NMEA 4A6YA 1UEMA 1YEKL 4XNYL 2AK4A 3X17A 3T65B 3VXRA 5B39A 5D7KE 1KTRL 3HZYB 3TCLA 1JZ5A 3U2SB 1U2CA 2VDKH 3DXAD 2Z31B 3B8YA 5CEXA 4W6WB 3RDTD 3VA2C 4XBPA 4Z7VE 1D3CA 3TJHD 5IB4B 1MJUH 5FV1L 3GMOB 1B90A 2IG2L 3KPSD 1N2RB 3L3GA 2P24B 3DO7A 4MYWB 3OXRA 2LQRA 2D0HA 3HUJE 3MREA 1EA9C 3FRUA 4X4XB 5LKNA 1A02N 3GJFB 5DEGA 5KSBA 2UYLA 4O2FB 3S35X 4O58H 4OIAA 1NBVH 1SVZA 4Q9CA 1ZHNB 3MCLH 1Z9OA 2DLTA 2QADD 4HLJA 4OTXH 1W8OA 5E8OA 3O0RH 5ADOH 4DZ8A 2A9NL 4QRPD 4LCCB 4ZMAT 4JHBA 2YZ1A 4U1HA 4LSSH 1KXTB 4PB0H 2VXUH 1B4RA 3L9RA 2PR4H 4TVSa 3OAUH 4NZDA 4JFDD 4TSAL 3ILPA 4LRIA 3WN5C 4LLUA 2P46B 1C5BL 3MRNA 5EORL 4YNYB 2YMXL 1PKOA 5JO5A 4RGMB 3QA3A 1DBMH 3CDGA 4NKOA 5L8KB 3EYQC 1XR9A 1TVHA 1CE1L 2EDKA 3AC0A 4CVZA 5E8EB 1N8ZB 1RIUL 1SYSA 3SDDA 4JFEE 2QLVB 3Q5TA 5AAWA 5IESH 4NZTH 4GMSH 2HRLA 4FNLL 5CJXA 2Y4SA 5HHMD 4LPCA 3FL7A 5GZND 3B9EA 3WLWD 4XP9H 5HDOA 3QQ3B 4DJMA 1IMHC 3C8HA 5EOCJ 2EIEA 4MAYC 5F1IA 5C6TL 3CFDA 1CR9L 1TJIH 4OJFL 1CGYA 3HB3C 3I75A 4JM2C 3D3VD 4D8PA 4LPVA 3U0PA 5I0ZA 1NLDL 1QFPA 1AQKH 2R1WA 4UINH 3BN9C 5F1NB 3FO9B 3O4LA 4G5ZH 4IOFC 1B88A 1TVBB 2UY7A 3K8MA 4E0RA 4LKXB 3D2UD 4YHOH 4F37K 1EUTA 4LSDA 1OARL 4W70A 1T20B 1G9NH 5JLZA 4JFHD 1G1YA 1HXMA 1NC4B 4R7DA 4Q9RH 2PW1B 4RFNB 3C5SA 4ZODA 3WD5L 4Y2DA 1IBGH 1IGCL 3BIAX 3W0WD 1AHWA 4JY5L 1Z2KA 4X5XA 2V2WA 1MJ7H 5LQBH 3Q6FB 1SHMA 2WBJC 1RK0B 3E6HA 1IC4L 1CE6B 4NGHL 4CMHC 3KYMA 3JTCA 4U6VL 2IFFL 4WEBL 4K9EH 4LOUD 1XIWA 1GIGL 2XXCB 1FE8L 3N0PB 4MNGA 2E8YA 3LVEA 4NC2B 1DQMH 2VITA 4UDUB 3RA7H 3G5XB 4R26L 5B39G 4IRJB 5HYJA 3TYGH 1JYNA 2YA1A 2VC2H 3ZE2E 3BPNC 4U3XA 1CFVH 3KXFE 3GHBL 1QLFA 3MFFA 2J8UE 5JIKA 4G6JL 4EOWH 3TA3D 3UBXB 4HS3A 1J7VR 3N85H 2OSLB 4X99A 2EC8A 1J1PH 3L5HA 3MJ9A 1DBKH 4N5EC 1MAJA 2CKNA 1D7FA 4YHIA 4CU6A 1MCBA 4P48A 2BOBA 5BV7B 1TITA 5I15L 5K59E 1TETL 2N7BA 5K93A 1OWRM 4GRMA 4YDLB 2NY1B 3DUSB 4PV8A 3VWJB 4NFBA 1RK1B 1LILA 4OGXH 3BEWB 4LCIH 1YC8A 5AZ2H 4MLSA 3JBG7 5DA4A 5EU7E 4PY8I 5ICXB 3TYFA 1HKLH 3I6KA 4HWEL 1M4KA 2G5BB 5J1TC 1W72L 3BKML 1QRNE 4CDHA 2EYRA 1G1CA 3DV6B 3PP4H 2AKRB 4KXZI 3QIWD 4W68A 2OBGA 1VPOL 4LLDB 4TTDD 3UTZA 4M6MH 4Y5YA 4C56B 2FB4L 4M5ZL 2GSIB 4QTHB 2HT2D 1A7QH 4KKLD 3ZE0F 3F7VB 4Z9KB 3DOSA 3LIZL 3MCKA 5GGSB 3D9AH 4D9RD 4G9FE 2F19H 2Z0BA 3QFJA 3RL1B 3MRHA 5I71C 4XP4H 3EO9H 1T0NB 2YHGA 4HJGB 3FQXA 4D0DB 1DE4A 1JJUA 2X2YA 3MUHL 2BP3A 4UDTB 5TPWL 3CCHB 3KPPA 1RJLA 4Y16A 3NIDE 1TQCC 2VOTA 1MNUL 5GGSY 4J3VA 5MENB 2EDDA 3OWEA 1MRDL 2DRUA 1X7QA 1ZGLB 2R8SL 4FQXD 4D9QE 1SMAA 5KW9L 1PY9A 1P4BL 3WXVH 1Y6KR 1CFNA 2QSCL 5BVJA 3I3DA 4OF5A 2HVKA 2RJMA 2A1WL 1YEEL 2NX5B 3LEYL 3SJVD 4QOKD 1FP5A 4J6RL 4DK6A 4RWHA 3D5OF 5L6YH 4Y8AA 1HQRA 3FN0L 2LAGB 3CXHK 5TH2A 3ARBA 4FQ1H 1AO7A 3IFOB 2PW2A 1XGRB 2EKJA 2O5YH 2D03L 4R4BA 4JY4A 2H32H 4KMLB 1BHGA 1MCFA 5IBLC 3D39D 1SVCP 1MCWW 1WICA 2ARJB 32C2A 4M48L 1CD9B 1DLFH 2C5DC 2YPVL 1CGUA 5EIVA 3NCBB 4PJ7B 3WS6A 4XP1H 4KRMB 5TFSL 3ETBF 1DVFD 1S7SA 5FYJD 4R90H 2OCFD 3CFKA 3MOQA 4ODVH 1ZT4B 2J4WL 1N64L 5IFHH 1ERNA 3DURA 3C08L 1M6OA 5DK0A 1RUKH 3AAZA 4P59H 5DJZB 5EBLB 2A6DB 4HIEA 4QXTA 3E3QE 2KQMA 5SV3A 3JXAA 2IPKB 1NMBH 4N0CC 2DBJA 5HGHA 2HT4C 1MVUA 4KU1A 3AXLB 4NYLA 2FSEA 3OR7A 1A21A 2AK4D 4PLNC 3VXRD 1MLCA 1A1OA 5IV2A 1FQ9C 4WI9A 4DEPC 4O4YH 4HBCH 1NFDB 3F6LA 1S9YB 5H2BA 1HQ4B 1WIUA 5FYKE 4CJ1A 5D1QB 5D5MF 1X5GA 5FDWB 1YPZF 5F93C 2C1PB 1NAML 2J6EL 4RISL 4MDIA 5E5MA 2C3VA 5GGTL 5JIHA 3VFPA 5DR5L 4ODBD 4L1DA 4WNQA 5FA4B 4YPJA 1NFKA 1JGEB 3PDOA 1JGLL 4FZEL 4I3RH 4HKJA 3UTTE 2CH8A 4M7JH 4NNYA 1P5UA 2EDXA 5F9JB 3NZHH 1EGJA 1YA5A 4KC3B 4BZ2L 1F8TL 4WFHE 4I0KA 5SWZB 1FNGA 5E2TL 1GOGA 1RIHL 2ZNXA 2EXWC 4W4OC 5M94B 3IXTB 1DUZB 5DO2C 4KHXL 4KGJA 5C09A 2XQBH 1BIIA 2IADB 5HGGS 4DN4H 3K1KC 4JRYA 4ZS6D 3LQAL 3DROB 2C1OA 3SGKC 3OKMA 3MCG1 3B43A 2UWEF 4KRNA 2AQ2A 5FAAA 1YNLH 2WUCL 1EBPA 4JFQB 3GRWL 5D7JB 1DQQB 1D5XA 4MWFA 2BVOA 3OQ3B 3VG0L 1MF2H 2PCPA 1OWWA 4HT1H 4WDIA 5DMJB 5HD8D 4GAFB 1FIEA 4L3AA 3F65A 3OB8A 5L2KE 3PG2A 5JXAH 2LFGA 2SEBA 3X12B 5B38B 5SV4A 3SDDD 3V52H 1IGJB 2QSTA 3VD5A 1MCKA 1LDPL 3IKCA 4Z0XB 3RWHA 5MEQB 1C7TA 1I1YA 5IQ7H 1GC1L 4MD4A 1OVZA 4P4KB 3U46B 3O3EB 1RHHB 4I3SL 2BDNL 4JANB 1YN7A 4GBXC 1MCCA 4WTZG 5DD0L 4XXCA 5IROA 3LPWA 3M45A 1VACA 4EDXB 2DQDL 4JKKA 4MNQE 5CEYB 1KJ2H 2A2QT 4PJ5B 5E6IB 2RAMA 5EO1A 1MCWM 2ITDB 3L5WB 5C08B 4I1NB 3MLUL 3SHSA 1D5MA 2CRYA 3W9DB 1XGTB 2XTJE 3S3SA 3OX8A 4H1LB 3HMXH 3MLXL 4CU7A 3OGCA 2B1AH 3CXDH 3O4LD 3V4UL 1YEGH 4LARH 4XCCH 3BE1L 4LQFH 4MAUL 5IEKA 4L8BB 5HVHC 4UAOC 2VR5A 1YJDC 2CD0A 2EE3A 1ORQA 3EGSA 4V2BA 1S7XB 4JREC 3ULUD 1Z9SA 3QXWA 4Z7VB 4H5SA 1MCIA 3VXTB 4YHPB 5IMOB 2V9RA 5KVFH 1G0XA 3ULSA 4HIJB 2IALB 2B39A 2NY2B 1AI1H 1FO0A 2DQIH 4O2EB 3HUJB 4PG9A 4PIRF 5T1MA 4BYHA 4F58H 1OT2A 5JDJA 2ICWB 5EZIL 4Y2DD 2VSDA 1D6VL 1R5WA 43CAB 3U36B 3KVQA 3G5ZA 1A64A 1RJCA 4BKLB 2Y06H 5EBWB 5M95B 3LEVL 3GSOB 3DGGA 3QWQB 3VXNA 1YEDA 3GKWH 3UAJD 1WTGT 3RBGA 4I5BB 2FCBA 4U1NA 1UB6A 5MEPB 1XIWD 3LKQB 2WW8A 5FHAH 4L4TB 3QEQB 4JKLA 4GW1B 4PJ9C 1Q9LB 4XVUC 1TLKA 1I85C 4KKCC 2X42A 2AK1L 4M3JA 1FV1A 2XZQH 2GSGB 3MRFB 5GSRA 3U7WL 5DMKB 1HOCB 2NQCA 3VGGA 4K7PX 1HILB 3A67L 5DUBA 1IAKB 1MH5B 3CLFH 3MRDA 4QT5B 1NGYA 4BFGA 4PJ8B 1KG0B 1NQBA 2FJFB 3HPLA 1LP9B 2ERJB 4HS6A 4JFEB 5CCKL 1BEYL 1N4XL 1P2CA 4XZUB 1WFTA 3DSNA 5I1GH 5HVGB 2HG5B 3V4PL 1L9NA 1EHXA 4OGAD 1WISA 3MRCB 4B41A 3IDMB 1FYTB 4HV8A 2F5BH 3DTXA 2F74B 5C0IA 1BVLB 1X4YA 2Q8BH 3W82A 3X3GH 1NUNB 1I3UA 2FGZA 4NQCB 5JW4Q 4HBQA 2B20A 3GMRA 4YK4B 5J12C 5I74C 4HPYH 3HI6L 2D31A 3OKEB 4WHDA 4CNIB 5I17B 1CN4A 3RWFB 5D70H 3BH9A 4ZD3H 2BVPB 1H15B 2OJEA 4N1CA 1TTGA 1OAKH 3QFJD 2C7UA 1QLRA 3NIFF 2IMMA 3F7PC 2FX9L 3NCMA 3L3KA 1T66C 4YX2L 3SE9H 5K9QG 3CH1A 4Y16D 2KPNA 1NCWL 4XVJH 1WFOA 3TF7C 1LO3L 4U7KA 2XN9A 2LU3A 2D7OA 5JDSA 1QO3A 2J8UA 5KSAA 4DK3A 1T3FB 4P46B 3CFBB 3OR6B 4ODUA 1OTTD 3CJJA 1C7SA 4PS4L 5D5MA 3IJSB 3ZKXB 4O2CA 1YPZA 1AGDB 4KROC 1HNFA 3BZFA 4EN3C 4JO3L 1MIEH 1MI5A 4X9FA 1X5YA 2OK0L 5ITFB 1INEL 3B5GA 4DKFH 1X3DA 2EDRA 2Z91B 1IAOA 2XIDA 1KCSH 3C2AH 2FECI 3M1BA 2NXZB 4ODSL 5T5FL 4K7FB 5EZLB 3REVB 2MQ0A 2J5LC 3ARBD 1S9VA 4X6DF 2H8PB 1NGXB 3WLBB 3S96A 1I1FB 4UB0H 2NW2A 2GAZB 2XWTB 2Y07H 2YBRB 3MA7A 4L4VE 5FKPA 3QHZL 4B0MM 4CU8A 5JHLL 4ZTPL 3DVFA 5C9JA 3JTSA 4JN1H 1M7IA 5EH1A 1I7ZB 4JJ5B 4Z76A 4RZCB 2X4UA 1D5BB 1FNEA 1JNLL 3WKMH 4F33A 4NGHH 3ZSTA 1GZQB 3EYUL 4Y5XA 1MCJA 3KXFB 3P0VL 4NHCL 5FCUL 2GJJA 1PX3A 1HWGB 2BY3A 3KPQB 4Z77B 4Q0XL 1RUQL 1X5IA 4O5LL 4X8JB 5D9SB 4CDGC 3IVKA 1YJDH 2R1YA 4R26H 2ZJSL 5HGDB 1K2DB 1MFCH 4QHLB 5T1KA 1S7TA 4X6BA 4G9FA 4FQCH 1XCTA 4IS6B 1JI2A 1IM3B 2R29L 1WCQA 1YEJL 2FD6H 2ZZUT 2VLLB 4KK8D 1AIFA 4S1DD 1MCRA 3WHE0 2F9BT 3Q1SH 2FX8L 2PTTA 3V6ZA 5FOBA 4CAGA 5CWSA 1XMWA 4YFLI 3KR3H 4LGSB 5ERWB 1CFTA 3KDMB 3QJFB 3C6LB 1YDPA 3GSWB 1BD2B 4UT7L 1PKQE 3HPJB 1QRNB 1PG7W 4J4PC 1DDHA 3EIFA 4LVHC 1LE9A 3LQAC 2WK2A 2AW2A 3NA4A 2ZCHH 1D9KC 1BZ7B 3MOAL 1ZHLB 2BHUA 5L7XL 3RJDA 4YBLB 2PNDA 3C9NB 4GQ9L 2EO9A 1I4FA 4RAVB 4P2OA 5CEZL 3GM8A 5L2JA 3DETD 1QUNA 1YY9C 2CO7B 1ZHBB 4PJXE 4HH9A 3IU4H 3RGVB 3RP1A 1M7DB 4YXLL 1X4ZA 2ITCB 2NY3B 4LLVB 3C8KB 5F9OH 2XFXB 1GGCL 2IEPA 2P5EE 2Z92B 1IAIL 1D5IL 3QIBB 1JZ2A 1A6TA 4BQ8A 1GC1C 1ZT1A 2EDLA 4PBXA 1GAFH 1ZANL 3S3PA 1ZSDB 1BFVH 1KLUB 2JJSA 4Z7UE 5C09D 3QEHB 5T3ZL 1U8HB 2OQJB 2AAVA 4JRYD 4DCQB 3KLSA 3ILQD 2EZ0D 4BQ6A 1SEQL 1CVSC 1GPOH 4I18C 4WJ5A 2R8SH 1IE5A 4HFWB 5IT2H 3EDEA 2ZG3A 3ARVA 3ARXA 2DQFA 2XPGA 4KUZH 4RQQB 1N3NB 1A7NH 2AABL 3LQZA 2H2SC 3MLWL 5EDXA 1ZVSB 3VFTA 2Q86A 5LGKA 2D7PA 5TDPA 1VGEL 3NFPB 1MFBH 2AJUH 2R0LH 2BRRH 1YEFL 4ZFFA 3F7YB 3ET9F 3ROLA 1B0GB 2GI7A 4CN6A 4MNHA 3WFCL 4GG8A 1FVCB 2GITA 2R56L 5I8CA 3OHXA 1J05B 4WV1C 4XNZC 3BPLC 3WN5B 2PYFB 3LHPH 1UQSB 3UYPA 5F7NC 5BMFL 3RVWD 1N6VA 3GIVA 4N1HB 2F53A 1FJ1A 2X89A 1X5LA 1FZJB 1AP2B 2EIZB 5CD3A 3G5VA 4XC3H 3CU7A 3VGAC 3BRDA 4J3OC 4QCIB 4DZBA 4OM0L 4I8DA 15C8L 1PD6A 5I1EH 4G6FB 5DZLA 3CK0H 1AGBA 4NN7C 4X6CE 1F13A 3AREA 3SGJC 1EIBA 2CXKA 4QRRB 4BSWB 1CIUA 4FFYH 1NCNA 4OI9A 5HY9A 3UC0L 3O3AB 1BJ1H 3QQ4A 5J9PA 1UJTA 3KWWA 2BVTA 5GGQL 1IVLA 4RFEA 3T2QA 3VFMA 3BZEA 1IEAB 3CGTA 2JJVA 3IKKA 4P2RE 5L88H 4PP8C 4GXVL 4O51B 4NQVB 5KS9F 4Z78A 4LSVH 1PZUB 2CDGB 3T77B 2JLLA 4LLAA 3VGHA 4HC1H 4GUPA 3FT4B 4ZDHB 2R4SH 5L2KA 3UTTB 4LAQL 3WIIL 4TPRL 1RUAH 3HE6C 4N0UB 4MAYB 1QR1B 1A6VL 1PZ5A 3EOAB 1QFOA 4OF3A 4YBQD 4JM4H 4P5TC 1FZKB 1IKNA 4JM2B 1I9IH 4RGNC 2BNRA 1X5HA 1FFRA 3L3OB 5ESVA 1KCRH 1NDGB 4M4RA 1G7JB 5CILH 4Y4KD 4GMTL 3DBXA 1UADC 4LRNL 2AXJA 4JZNB 1DQLH 2E7MA 2GEEA 1KCUH 4FTVE 4S1QH 2WINA 3MBXL 4MNQA 1CL7I 4L8SA 2HT3C 3EHBC 5KVEH 1EX0A 5DD5L 2V2TB 5I1HL 4NO2A 3VXSE 1ZLVH 5EBMA 1SY6H 5D72L 4E42A 3MLSL 3BHBB 1XF4B 5GRXG 2AJYL 1MLBA 4PJHB 2IQAB 1HH6A 3O9WA 4G8IA 1G7MA 5D1XA 2DLHA 4MJ5B 3C5ZA 3HI5L 5ITBH 4X6DA 5IIEB 1DQJA 1SJVA 4B53A 2NTFB 1ACZA 5F89B 2W1NA 3GB7A 4JY6B 3TBTA 4D0CA 3VXME 2HKHL 3TNMB 5DJCA 1AGCB 4S1RH 2ESVA 1FC1A 5EU3B 1H5BC 1B3JA 1C08B 3TNNB 5J56B 2X70A 4XPGL 1OAXL 1LDPH 3S4SA 4I3GA 3M8OL 1QTYT 4XPAL 4YE4H 5FM4A 2VN7A 3VRJB 3BPNB 4HK3N 3BJLA 3EJZD 3SDCC 1FZOB 1U3HA 1V7NH 3LV3A 1GYAA 1FGVH 2C26A 3CX5J 1A14L 1JI1A 1KTLB 4M3KB 3BRFA 3WFEL 2XTJB 5HDLA 1MPAH 1JNHA 3LRHA 3WJLA 2GJ6B 3V4VH 4FFWC 4KJYB 3HFML 5F8RC 5JXEC 4WI8A 1T1WA 3MO1A 4YO0B 2IBBA 3WHE1 4PFEA 1B2WH 3WHXA 1XH3B 2WUBL 5E8PA 1VADA 4LVOC 2XN9D 4L5FL 2YKLL 4XWGH 4N0FB 5DWUL 5HDQH 1G6RH 3EFFB 2E7BA 5KSAD 5JPNB 2Q6WB 3SDAD 3PWVA 4DGYL 3VFWA 3WFDH 1U8NB 1SQ2N 2P8PA 2IPTH 1MI5D 3K2UH 4JPKH 4P5MB 5MP6H 1ITBB 4CVWA 4GG6E 2EDNA 4JO2H 3GSNB 3CVHL 3O41A 3PHQA 1RULL 4XCNB 3PIQA 3KYNA 4ZXBA 4JHWL 3HC0B 3FCTB 5A3IC 1NC2D 3DX7B 1BZQK 1WC7A 1CT8B 4LSPL 2DN7A 5L8JB 1UCTA 3NCYS 1EEYB 5ADPH 5EOCL 2BSRA 4KJQD 3NH7H 4MDJB 5IB4A 4PRNB 4J3WA 1KBGL 4D94A 4RWYL 2H3NB 5GISH 5IMKB 3NCFB 5DHYB 2EECA 3L7FB 3STLB 4R2GC 4JQVA 2ATKA 1QQDA 4V1DE 4HJJH 4X4XA 5T1KD 4KKBD 1OP5K 5FO7B 4IJ3B 4X6EB 4M5YL 4M93C 3I85A 2ADFL 1QSVA 3MFGB 2NCMA 3MJ6A 4NRZB 3UTQB 2O61A 4P49A 3TH4T 1BX2B 1RUML 4WHTB 1T7YA 1I8IB 4FQPA 1A22B 1T1YA 5I1LB 4JZJB 1MREH 3T0VA 2AXHA 2D9QB 2Z8RA 4UT6L 4Z8FH 2HFGH 4HCRA 5FF6B 4Y19B 1U8QB 1CXEA 1XZ0B 1BEYH 1DEEB 1NLBH 3RGHA 5BOZG 1N26A 3V4PH 3EZ8A 4Y89A 2VXTH 1FL3B 3UPCA 3O6FD 2X05A 1HSAB 3FO0L 5DD3H 1PLGH 3SO3B 5IF0A 3PNWB 4P2OD 5FYJH 4KFZC 1FBIH 4L1HA 5EUOF 5L9DL 1XGYH 3IFLL 4L4VA 1OAQH 1II4E 1UXWB 4OUOA 3RVVC 5AWNH 1UZ8A 2W0FA 5JIIA 5LXGL 4XI5D 1SJHA 1NFDF 3DX9B 3QDME 1CTOA 2X4RB 4ZUVB 5EZJB 1IGFL 2DIBA 3FAWA 3FFCB 2WM0A 3LKSA 5GQBA 1YQ2A 1J18A 4ZFOA 1W0VA 2IH1B 3M17B 5I2IA 4OFKA 3MV9E 3P4NA 4IEFB 4JFPA 1IM9A 4ODWB 2Y7QA 1O7VA 1P4IH 1N5AB 1G7LA 4DEPB 1CXLA 5BW7C 3ULVF 3THML 2E27L 2VE6A 4ZPTB 2B2XH 2IC2A 4XP6H 1A1NB 3FO2A 4OD2B 4XBEL 5IEHB 1R3JB 1EO8L 5KS9A 1YUHA 4X5WA 5EOQH 3SKNA 2P8MB 4TTGA 2WV3A 2X7LA 3TVMB 3D85D 3TBVA 1TCRA 5FUZH 5D2LF 1BOGA 4LKXA 4OIBA 2Z4QA 1CFBA 1KJ3L 3S98A 2DWDB 1KB5A 4AEIH 1IRAY 5DC9B 1VEMA 4XPHH 1NC4A 3FB7B 3SE3C 3TH2T 4LF3B 5J6HB 3I84A 4FXKA 3PWPE 3CSBA 1A4KA 5CP7A 2WIIA 3Q6GL 3EYSH 5EZOH 5KJRH 5F6HJ 5DVKA 2HP4A 2V17L 5C0RH 5GGVY 3VD4A 3E2HA 4ODTL 2F53D 1FNAA 2X89D 3K0WA 1KT2B 3TO2B 1OP9A 3I9GL 1MHEB 1CGSH 1AQDB 5DQJB 5C0DA 3OZ9H 5ANMA 4HUNB 4Y4HA 1H3PH 4UDUA 1YEJH 2VDOL 3TWCL 4IRJA 2FEEI 2BJMH 3ARED 1INDH 2X4NB 3IU3A 5E1AB 3FQUB 2FBJH 3S35H 3DRTB 4K3EH 2LU4A 1TZGL 2H2PC 1QBMH 5IFJA 1LK3H 4GRLB 4MXQC 3V0WH 4FQ2L 4JN2A 3NTCH 1R3HB 3RJQB 1VDGA 4GBXB 5LAXB 1WVZA 1J1XL 1ZLWK 1KYOJ 3CFEA 1M05B 1YECL 3ES6B 4PJBF 4WUUD 5CGYD 1ES0B 2R2EA 4DGVH 3OKYA 3RWJA 3UX9B 1RK1A 3HTLX 3GGWA 3TBYA 5T1LB 1RIVL 4W6XB 2G9HA 2E8ZA 1B4JH 4KDWA 2BNRD 1NGWB 1UC6A 4M7KH 4LSUL 1KCLA 3IRPX 4Z7UB 3UPRB 4JQXC 3O4OC 3WIHL 1VERA 2PO6C 3DV6A 3QUMA 4DQOL 1Q9KB 3FAXA 4IRSB 4PRPD 5HVHB 3ULUH 5I73C 2O26U 3LZFL 2GIYA 4JREB 4MNQD 1YC7A 1NMAH 5DVNA 5DS8A 2GSIA 3BX7C 3V5DB 3FQNA 3KYOB 5E94B 4AEEA 5DJDA 3F7VA 4JO4H 3L5IA 4RMQA 1UH3A 3R1GL 1URLA 5CLTA 4FABL 2DAVA 2IH3A 1OSZB 2MWCA 1XR8B 4OKDA 3QDJE 3O9WD 4MD0A 5D1XD 5IVZA 4I2XA 3C5ZD 4HAGA 3UDWA 3RKDD 5IQ9B 1HINL 3ZTJH 1ZA6A 4OCYH 5FO8B 3W11C 1X6LA 4XX1G 4KTYA 1N59B 2DQUL 3FB5B 3VFVB 1I3GH 4H0HB 3FQTA 4YDKH 2ESVD 4M8VA 2QQNH 3MLWH 3MACH 5DJ8A 1H0DA 1W72B 3HE7A 1FCCA 4UOW1 5GJTL 5DQDL 1LP9F 4KQ3L 1BVKA 1U3HD 4OZFA 2VSCA 1JFMA 3IXAB 2HJFB 3RY6C 3C60B 1BQLH 2CMRH 3MJ9H 4R96B 4HDIB 4DKEH 5GZOD 1RZIB 4HZAA 5FUCE 1TZHB 3P0YH 3MNVB 2AXGA 2YD7A 2EH7L 4PJDE 4XRCA 3FONA 1LEKA 1A7OL 4X6CB 4JPWH 1QHPA 4LEXL 3MV8E 5CIPB 1U36A 1Z3GH 4PJEF 3U4EA 3Q3GB 3QG6A 1INQB 5IB3B 3O6KH 5K9QI 5F7MC 1F3JA 3BT2L 4P2RB 3VXSA 1KJVB 1G9ML 1RZGA 3MV7E 2FATL 1J8HA 2ICES 4S0TD 3ROOB 3T8XB 5T3ZE 4FQLL 4DUWA 4FXGB 1CFSB 1PEWA 4PJAF 1HCFX 3EJYD 3RL2A 2IAMB 3QEGL 1EDQA 4DGIH 2ZCKL 1S9WB 2VXVH 4ZXBD 4C83B 3EDKA 4PJCE 1FFOB 2P45B 5IHUL 3CC5B 5EC2A 5EUOA 1KNOA 1JWUB 3IS0X 3CFJA 1NFDA 3EO0B 1WIPA 5T33H 5C0AE 5KZCB 5ICYA 3NA9H 1VFAB 4ERSL 5E2WL 3BZ4B 1SBSH 4OT1H 4FTVB 4Z7QF 1LEGB 4L4JA 3UO1L 4BSVB 2G2RA 2FIKA 4HUVA 1E4WH 4GAJL 4JHZA 2UUDH 4K3JL 4TSBH 1HWHB 4JVUA 3FB6B 4UILL 3UBXG 4G6MH 4WGVB 3MLVL 1KJMB 3REWB 4WW2B 1GZPB 1TCMA 4QHKJ 3BO8A 4PRAB 3C2SA 3AS3A 2FEDD 4F7MB 4EN3B 4NO0B 4ZOCA 5HHQA 3BYYA 5E2UL 3ZL4H 1HEZA 3AMLA 5BJTA 2PETA 3SPVA 3LOWA 3MRGB 4OFDA 1T5WB 2FECL 2KBGA 4FQHB 3QUYC 4QRSB 3BDBA 4LCYB 5D2LA 4U1LB 4JDZA 1ZLWH 1GGUA 4NC1C 1E4JA 4S0SD 1UA6L 3CVIL 1WZ1H 3GI9H 3L5JA 1IJ9A 5B4MD 2AI0H 1BWWA 1TIUA 3QCVL 3RX5A 3UJJH 1Q9OA 1I8KB 1A47A 4NQXA 1T83A 4RBPH 3BQUC 1NAMB 5D7JA 2APXA 3BZDA 1J12A 4LP4A 2BFVL 5M7QA 1UWEL 2NXYC 5D96C 4H25A 2APFA 2NPLX 5B38A 2BSTB 5AUMB 2GT9A 1OGAE 1S3KH 2AJZB 1AR1C 2AV7B 2EIBA 4Z0XA 1AJ7L 2PUQT 3O3EA 2P48B 4XCYA 4FMKA 5J11B 4ZUTB 5BS0E 1JF1B 3E8UH 5HI3C 2A9MH 3WL9B 5L8LB 3HAEA 4KTDL 3D0LA 5KANG 1IM9D 1NGPL 1U8MA 3PHSA 4HPOL 2APWA 4NJAL 2FLRT 2W9LA 4KI5E 4X9HA 4EXPX 2EDBA 4Q74A 5C8JB 1SEBA 3BWAA 5CEYA 4LVHB 3B9KB 3UTSA 1U93A 3BGFC 2CDFA 3A6BH 4N90D 2KH2B 4URTB 4YHLH 5I1CH 2P5WA 4LLYB 1D9KB 2OP4L 4JO1L 3SGDH 4QKXB 4TUJA 3EOYG 1JF6A 4JHAH 3IDXL 5MI0B 1A7RH 3IJHB 1UACL 3BXNA 4OZFG 3BVNB 1YMMB 1LHZA 4PJBA 1KPRA 4IBLT 3P4OA 2ZOLB 2EDQA 3TCXA 1C5DB 4YZFF 2XKSA 4LDOB 4FQIL 2NZ9C 4C57C 4WO4A 3MBEA 4X7EC 4K2UH 3DRQA 4WU5B 2ILLA 4I0CC 1P1ZA 1IGMH 3SEPA 3OKOB 3QNYB 1NC4D 1MWAH 4FFVC 2CRIA 4CN4A 1ORSA 3K4DA 4UTAL 3TIDA 2AJVH 3H7BB 4LEOA 1V8HA 4HZLA 5CGTA 2YUWA 2I27N 3ZSSA 4NT6B 1QNZH 5DTFA 2JJUA 4QHUA 2EH8H 3QIUA 1EHLH 4FHBD 4BKLA 2QBWA 2JTDA 1TJGL 1AE6L 3ZE1F 4BFEA 3BISA 3QEUB 2VZUA 2X10A 1HHIB 4QHNA 5DRWB 3UZEA 4OIIL 5DFVD 1ACYL 2BHYA 1KEML 3MV9A 4IRJD 4OZHE 4APQC 4R0LA 3GIZL 3QEQA 3P77B 2FR4B 2Q8AL 5DZNA 1FORL 4JEGB 1NBQA 2W65B 3VGBA 1IL1B 3RIFK 3BAEL 4N9GA 4X4ZA 3EDJA 2M26A 3HMWL 1T7XA 4Q9QH 5ESAA 4P2QA 3VD3A 4RAUA 3H3BC 2A83B 1ULVA 5AZEL 3D25A 5I8OL 3OPZH 3U7YL 5JA8B 3BPLB 3QQNA 4NQEE 1BBJA 3QDMB 4M43H 4U6HA 5EO9A 4DAGL 4F80A 25C8H 3MXWL 3VI4F 3TN0A 5I1KH 4OLYL 5KOVC 5E03A 4G59A 1U42A 3MRCA 5DRNB 5IKCA 1OW0C 4Y1AE 2AJ3A 2EDTA 5ICZB 4FZ8L 3HS0B 3RWDB 2Y72A 4JG1L 3FOLA 1KPVA 2G5RA 2GY5A 3GNML 4NQCA 5E2VL 1R24A 3PWPA 4Z7NE 1RJZB 3L5XH 4PJEA 3I6GB 4NN7B 5FGCE 4MCYB 2E7LE 1KCGC 4HIXH 3ARDB 4PV9B 3OKEA 4TNVK 4CADA 2B1HL 3W9EB 3BPOC 3LSOA 1AXSA 2PF6A 4YXKL 5CGMA 1JK8B 1H15A 1MFDL 4PLKD 4UZGA 4DUVA 4XBGB 1MY5A 5B21A 2JK5B 2NYYC 4JM2F 4HKXB 4WW1B 1ADQL 1U92B 1ZWIB 3ECBB 4PJAA 4ETYA 3HLAB 2YK1H 3QZWB 4L8CA 5B38G 2FJHB 2JCCE 3HE6B 4G3YL 2I5YH 3GZKA 4HW6A 1KN2H 4F9PC 4GAYA 2C9AA 5T3XL 5D7IE 2ADGA 4UIMA 3RWCA 1MJ8L 4P5TB 1L7TH 4M6OL 4RGNB 4Y5VC 3D48R 3SQOL 3KYKL 2DM3A 3QUZC 5D8JH 4U05A 5DMIH 3O2VH 5AAMA 1MEXH 3HAEG 3V2AR 3S97C 4F37F 1AGDA 1I3RB 1UGNA 4TUKH 3WJJC 3BKJL 2DQGH 1ZT7B 3GI8H 5HVFB 5JORB 4PJHF 1WWAX 3HE7D 4KRPD 1I8MB 1BFOA 2X4PB 4JDVA 3GFUA 1PGRB 4G43B 5HHNB 5IR1A 3O6MH 1QZ1A 1JFQH 1EEUA 3CSYA 4AM0A 4A6YL 4KH2A 3TBWA 4PLJD 4NRYB 5HI5D 1NGXA 3WLBA 1CL7L 2A6IA 4Y7MA 1IC5H 5HYEA 5JHDA 3GK8L 4PJFF 4AENA 3T0EC 1CG9A 1CDUA 2VN4A 4JJ5A 4OLXL 3PDGA 1QFUH 4RZCA 3UJTL 1UKTA 2HKFL 3V6OE 3FTGA 3P11H 5KVDL 4EQ2A 1TJHL 3QXUA 1MCPL 3QCUL 1BF8A 4UIKH 4X8JA 2E9IA 3NIGF 5DUPL 5E8NA 3VXSD 2LVCA 5E24E 4CMMB 3DO3A 3LEXB 2R0WL 2ZUQB 3RVTD 3DYMA 3AM8A 1J8HD 1YYMH 1WT5A 1H5BB 5DJYB 5D2NE 2XKNB 1FNHA 5HPMA 4NWUL 4ZAKA 2DQHH 4UQ3B 3NZ8B 2I07B 5A2JH 4TQEH 4KKAC 3SCMA 3VMNA 4KMTL 3T4AA 1BBDL 3C6LA 3GSWA 4KRLB 1BD2A 4K7PH 4ONGH 5EOTB 2KUTA 1IQDB 4NBYB 1VKXB 4OB5H 4ZYKB 2DIJA 2Q7YA 4PJIF 3QAZC 4LVOB 1KSRA 2OTWB 3QH3A 1S7RB 1QRKA 3W5MA 4KJPC 3JWOC 3WIHH 3ARFB 5GRJL 3RPIA 2X4OA 1MFNA 1XCQA 3ULVD 4DQOH 4M9OA 3LB6C 4OZGB 1D5ZA 3QDJB 1TMCA 5GXBB 3S5LB 3JV5A 5EN2B 1VGKA 3AY4C 1JGUL 2YEZB 3QQ9D 3C8KA 3B2UC 5D93B 2ADJA 4TVPD 4FFZL 5F6IB 3I6LD 5I76B 1PSKL 4WI4A 2BC4B 3R1GH 3TT1H 3EDDA 1IQWH 1C16B 3VFOB 4PRHE 3BH8B 2CK0H 1FZMB 1KELL 2Z35A 3TC9A 2OQJA 5CHNA 1L9MA 4JRXE 3IFNL 4GLRI 5F8QC 2DLFH 4LIQH 3S9DB 1B6DA 4KK6D 4EI5C 1IT9H 2DMCA 2R69L 2AERT 5HYSB 5D7JD 3DNKA 4XMKL 4HFWA 5C0CE 5IB5A 1JL8A 2WWMC 1CLYH 4L29A 3MRMA 2MTPA 1L7IL 3KNBA 2FX7H 4FOMA 1N3NA 2VQ1B 4OUUA 1CDBA 3F62A 1KGCD 4M93B 2HAZA 3SE8H 5EFIB 5FUOL 3QHFL 1P7HL 5IWLC 3QXTA 4XNXL 3DMMB 1SM3H 5BXFA 2Z93B 4PGZA 3WXWH 4OLEA 2VRAA 3S36H 3S34H 5ILTH 1Y0LB 1FGNL 4QRQB 5GIRB 3TT3H 5IHLB 3HRZB 3VMOA 3QUXC 1B0GA 3IJYB 5E08L 4CVXB 4YUEL 1A7OH 2HJLB 2DDQL 2E6PA 4PJGE 3RHWF 5E9DE 1J05A 3WN5A 5BV7L 3UTSD 2XQYK 4KHTL 5IMLA 3F5WB 4NCC2 2P5WD 2XXMB 3GSUB 4F7CA 3N1MC 3WS3B 4HMEA 4IIQC 1EJOL 2NY4D 4R4ND 4K3DH 4XAKD 3W2DH 4WTXA 4YFDB 4P3CH 1OTUD 3AVEA 5F7WC 4YHYC 1JHTA 1YNKL 1OB1B 3VFNA 5F7KC 3W39B 2HJKA 1UJ3B 3QDHA 2EXYD 5C0AB 1OM3H 5DJ6A 3I2CH 4WO4D 3E6FA 3MSPA 3MBED 3QEGH 4QRRA 4G80A 2CDEB 3HZVB 4ELKA 5I18L 4J1UB 4V2CB 5HGBA 4AIZA 1BM3H 1NL0L 2VABB 3C5JA 1ZHKB 5CS7A 2I9LB 1R5IB 1RZFH 1PEZA 3NCEB 3RUGF 4LASL 3ZYZA 4O02H 2W0LA 4HF5H 1NANI 4N0UA 2OR9L 4X0KB 4MCZB 4EQ3A 1KIUA 3CSGA 1JYWA 2PYEA 1DL7H 4WCYL 2PXYC 2VMFA 1EZVY 4JM2A 4M61A 2HFTA 3G6JE 5FHBH 3QJHB 4KDVA 3T1FA 4PREB 4GS7C 1G7JA 4BSJA 4PPTA 2BNUA 5I16B 1EH9A 2VDML 4P2YA 4JZNA 3CLEH 2GW5A 4L4TD 3QEQD 1Q0YH 1C5CL 3RTQC 4UBDD 3DXAE 5I1JL 5J3HD 1YYLL 1AFVH 5GS1B 4JGUA 5HHOB 1ZV5A 4QYOB 1A0QL 5SX5H 4QF1B 3AU1A 4CUCA 2W0PA 2BXZA 1FSKC 2KQNA 5DVLA 4JR9L 5EWIH 4P2QD 3VGDA 5EIIB 2R0ZH 3RWEA 1N7MH 4Z7WB 4NM4L 1X9QA 4GSDH 2H32B 3GMMB 1NBYB 1RHFA 2HFFA 1OGAB 1NSNH 2Z31C 4NUGH 4ZPVB 4MXVE 3JWOH 3MRIA 5HI4C 5AEAA 4HWBL 4OLZL 3V5KB 2WBJA 3BP6B 1W0WA 4P9HH 1A1MB 1S7WB 3BGMA 3V6FA 4FG6D 1FYTD 4PJFA 4QRPE 4WENB 5INCB 4N8CL 5BS0B 4JY6A 3OBAA 1JE6A 1PYWB 4ODXA 1CICC 4N68A 3GJFK 2DLGA 4NQCD 1FFQA 4DN3L 2GTWA 3PWPD 4KAQH 4HUXB 1F3DH 4JFDE 1ZGLP 5K33A 4JZOB 1AJ7H 3ERYA 4HX1B 3T3ME 3VRJA 3IGAB 2FEEL 1T21A 2C3HA 1JZ4A 1T7WA 2DJSA 1HH9A 3GSVA 3KJ6H 1FZOA 1Q38A 4OBSA 4BH7A 2CGRH 2WQ8A 1MCSA 1FFNB 2VISA 4LCCC 1JN6B 2GJ6A 3NFNB 1N0XL 4KJYA 3D69B 4I4WA 4ORGB 3N1PC 1EO5A 2ZKHH 5DLML 1R0AL 3LMJH 3ARGA 1NMCC 2A0LD 2VDRL 3QRGL 4GLRH 4N0FA 3ZTNL 5I1DB 3MRLA 2ZUTA 3MRBB 4P46D 4RGOL 5HHME 4XCFL 4RGMC 4QGYA 4MA8H 5C0JB 1NGQH 1ITCA 3VFUB 2OTPA 1AGFB 4PJIA 3UZQA 3CPLA 3IETA 4H8WH 5DURB 4E5XB 5JA9A 1UM4L 4KY1H 2NXZD 1X5JA 4NQEA 4NUJA 1TZIA 3DECA 1JIBA 2X1OA 4XCNA 5EC1B 2V5MA 1MCOH 5GS0D 1T1XB 1J87A 1KENL 3D3VE 1ZLSH 1UXSB 3NAAH 2YRZA 3NCJH 5JHDD 1FVDA 4K23H 4Y1AA 2Q76A 4P3DA 3RX8A 4M8QA 5DRZB 4OZHB 4QNPF 1I8LC 2VDLL 3PWJB 1JGVH 5FB8A 4UT9H 3TESA 5IB1A 1CQYA 4Z5RB 2VKWA 4PRNA 4XH2A 3QO1A 3VCLA 1KJ2A 3VRLF 5DHYA 4QRUB 5F3HB 1LK2A 2XWBA 5DFTA 5CZXC 3CAFA 4IRZH 5DUML 1CBVH 4LPWA 3V0VA 8FABA 1XFPA 3HMXA 4KZDL 3R0NA 3BI9X 1D6EB 1EGJL 4P23C 4ZAKD 3W0WE 5ESQA 2KL6A 4ELMB 1S8DB 1RU9L 4DKAA 3MGAA 4XHJC 1Q0XL 1C12B 4RA3A 3SCMD 1CGWA 3KS0J 4LCWB 3SY0B 3C6LD 1DBAL 5EPMB 1PQZB 1BD2D 4DOHB 2D7MA 1T7ZA 4RFNC 3MLTB 5BRZA 2YSSA 3O3DA 4ZNEA 2A6KA 2R9HD 1FAIL 4FMFA 1CLCA 4OFIA 5HDBE 1FL3A 1DUYA 2P47B 3O8XB 2FZ3A 1AXIB 4AEHL 2JKXA 3AS1A 4W81A 4GW4A 3WFZA 5CBAB 2AJXL 1MRFL 3RAJL 4JB9H 3HA0A 1UWXK 1S7QA 3RGVD 1YEHH 4OLWL 4P99A 1WITA 4YQXL 4GAGL 3FZUC 4ODHH 1RZ7L 2NY3D 2WNGA 2X4RA 3B4NA 3PUCA 1LWRA 3QFDB 5EZJA 1ZS8B 3T1WA 3FFCA 3TLRA 3V6OA 1MFDH 3F8UB 2VH5H 4N0CA 2ZWLT 5D7IB 4K8RL 5FECB 3EOTL 1XGQB 2HLAA 2IH1A 3M17A 12E8H 2GFBA 4EIZC 4ODWA 4CVUA 3GO1L 3P3YA 4IHOA 3INUL 2VDQL 4L9LB 1JGDB 3MR9A 1UZ6E 1IGTB 1ND0A 2IJ0C 1JHLH 1A7PH 3GMQB 4OCXH 4JQIL 3RVXC 5F7DB 5F96H 3IDGB 5BV7C 4OKVB 3VE0B 3VH8B 2X9XA 5TGBA 3MRQB 4UTBH 3AMKA 1PVHA 4JFYB 4YDLC 3MGTA 2NY1C 3VWJC 3VFSB 4MB3A 3RUGA 3U30B 3FQRB 2NW3A 4EVNB 4NN6B 2FJGB 2O93L 4KVCL 4RRPA 1R5VA 3BKJH 4NSKB 4D9RE 3CZFA 5FO9A 3RZCA 3DYPA 1K4DB 2QQLL 3U4BL 1A3RH 5BO1L 5TDNB 3SKOB 2OJZH 4QY8A 4MA7L 4D3CH 5D7SH 1OAUL 2X4QA 4U1MA 2V5RA 2MQCA 5C2UB 4I0PB 2D4DA 5LJYH 3MNZA 3CX5K 2ZSVA 1DBBL 1FO0L 3VXQB 3B8SA 4XVSH 3QUYB 5E6ZA 2Q7NA 2BNQB 2EEAA 3VWKB 1J0KA 2B5IB 2IPUK 4M1GH 1FL6A 5D2NB 3SGKA 4OD1L 3NBNA 1U8IB 3OAYK 5KANI 2CIIB 3B9VA 1RZKH 3SOBL 4Y4FA 4RDQF 3SJVE 4QOKE 3RU8H 3GBMH 2BOCA 3SDXF 4OGYL 2I25N 3BQUB 5TQ0L 4GFTB 4YAQB 4S2SB 2EDYA 1T22A 2CO6B 4WVRA 5TF0A 3EYQD 4J7RA 4YDVB 4G6FD 5D96B 4UQ2A 4JPVL 4NWUH 2R0KH 2XTLA 4XC1H 2C4FT 1J5OH 1QSEB 3CDCA 4QRRD 4JRXA 4QWWC 3EO1B 3D39E 1K4CA 1E4XH 4LSRH 1HYSC 4Y5YC 4KPHL 3GJEB 5INDA 3QXAB 1MHPL 5C0GA 1BBDH 3LDBB 3PDDA 4E41A 5A16A 3CD4A 2AVGA 4GBXA 1S7UA 5B8CC 5LAXA 3O6LL 3D0VB 1UKSA 5FYJE 3ES6A 2OTUB 4QRTA 1DSFL 4GRWE 4OD3L 5LBSH 4DVRL 4MAYD 1NGZB 2PYED 4ZFZB 3WUWA 3MOBL 1LO4L 5D6DA 4P9MH 3HB3D 4TUOA 5IOPA 4B50A 4JM2D 1UM5H 2WZPD 2H6PA 3G5YB 3BKYH 1NGWA 5F7FA 4PRHB 1NCUA 3NACL 1NEZB 4HXAH 3WUZA 3EYFB 2AK4E 3BN9D 3VG9C 3VXRE 4IOFD 4MZ3A 5JQ6H 4HIIB 3ZDXE 3K4ZA 2M1KA 4MXWL 3BFOA 2DM2A 2W9EL 3PWUB 1LO2L 5CJOL 4KKNA 4NQSA 2YD8A 5DJXB 3OXSA 1YEIL 4DUXA 1A4JB 4FQJH 3STZA 2WAHA 3MRJA 5C0CB 1U8LA 1F4YL 3VRIB 5CJ8A 3UZVB 3IFNH 1DJSA 1X44A 1DANT 1VHPA 1F4WH 5KSBE 5I66B 2JB6A 4AK1A 2HH0L 1MHCA 2R69H 2RCSH 5JZ7C 4JG0L 3MA9L 1OPGH 4PTTB 5D1QC 2WBJD 1HIMH 1T5XA 1MFAL 1OCWH 1K8IB 1CF8H 1KN4H 2WIMA 3K8KA 3MLRH 3FB8B 3O45B 1S5HB 3WS6C 1ONQB 3FB5A 3RNKA 1A2YA 1KCVL 4NHUA 4TN9A 4V3EB 4U1IB 2J88L 3I50L 1IGYB 1T2XA 1FIGL 3QO0A 2FYYA 4WWID 4F2MA 4PJGB 5E9DB 1WBZB 1W72A 5F97E 1F58L 3ZHDA 2RIKA 3HNTH 3QI9B 3U79A 3O11B 4PJ9A 3OAZH 4U1JA 5DRXB 2EKSB 4OZIB 2R2BA 2X1WL 3HZKB 3ZDZE 1TPXB 5JOFA 1FPTH 2B4CH 3JWDC 4UUJB 4YHZL 1M1SA 3B2VL 3LS5H 4JCMA 1JWSB 1ZEAL 1TZHA 3HNVH 1TQBB 4N5ED 3G6JA 2GJ6D 3VFGL 4KDTC 2RFXA 3LKOA 3B5HA 3H9SB 2ED9A 3H42L 1MUJB 3P2TA 3TV3H 2GTZB 2NY0B 5CIPA 4R4FL 1OTSC 1WIOA 4UV7H 1LQSR 3RDTA 4XPBH 3ARSA 3S88L 4RNRB 1HHHA 1RZJL 3V5HA 1QYGH 3QWOB 1XGUB 3MLZL 4YHKH 2A73B 2CIKA 1M7XA 4QTIL 4Q2ZB 4QHMA 3X14A 2CK2A 2DQCH 4G42A 1CYGA 2DTML 4G8GA 1EHNA 4FXGA 4U2ZA 4LLMB 3G6DH 1I1RA 4NRXB 5GS3A 4OZ4B 2IBGA 4NQED 4YDJA 2NY5L 5CINL 5K9JH 5EU6B 3FOMA 5IVXF 3MXVL 4ZS7H 5JR1H 5I75B 4QRPA 4XNQA 1EEZB 1K5NA 2NR6C 3O4LE 2LABA 3K81A 5DJAA 1U3YA 4JDTH 1VFAA 3JV6A 2FHBA 3DXAB 1XGPB 2ZOKB 4MS8C 5EULV 3ULUE 3V7AG 3OJ2C 3TF7A 3SO5A 5CBEB 4WWKC 1KUMA 5E6IC 3V6BR 1U9KA 4XPFH 3KPSB 1Q1JL 5SWQB 5LWYL 3CFCL 4HLZG 3PHOB 1JRHI 4LSQH 3LKRB 3KYAA 4PYGA 5JUEH 1J8KA 1I7UA 1XF3B 4LMQI 4OCRL 3VA6A 1MQKH 3IDNA 1GCFA 4MA3A 4NZRH 4I77L 4UV4L 4RA0C 1QD0A 4XNMB 3EOBA 2GQHA 1S9KC 3NABH 5IHZA 3P9MB 1A0QH 5FKAA 4KVNL 4LGPB 2DMBA 2VYRE 2QADB 5ENWA 5DHVA 4OZFH 2D4FA 1RUPL 5KTEH 5IW3A 3WUWG 3SGEH 2OMNA 1HI6B 5E6YA 1E28B 3HI1A 4K8RC 5C7XH 4X7TA 1A3LH 5LCVH 2GJZA 1O5DT 2CLVB 3BIKA 4H26B 4Y19D 3VXOA 2FIRT 1KYOK 2XRAL 5GHWH 1P7KA 4XVTH 2NY2C 4XPTL 2W9DL 5BRZD 4JFDB 4IMLB 2GK0B 5IBLD 3QNZB 2AXFA 1ZXQA 3BP7B 3DV4A 5BVPL 1T0MB 3CH8A 4NKIH 4HC1A 1BAFH 1LO0H 5JNYB 5C2BL 1O0VA 4U4BA 1KXQE 1XF2A 4BFIB 2ADIA 1G6VK 2VQTA 4M7LH 1FH5L 1OSPL 3SDYL 5I9QB 1WQVT 2FRGP 3P9LB 3K74B 1ZLUK 5KG9B 3LKNB 4JAMA 1KEGL 4B7LA 1NCCL 3TJEH 4ZO9A 3SDXA 4RIRB 1GHFH 4ZFGL 5IK3A 4HG4J 4C59B 4XAWL 4ONFL 5JPMA 3FFCD 4Q6YA 2VERN 1T04B 4N0CD 2NLJB 3DUUB 4H88L 3R0MA 1KTDA 1JF1A 3WKNA 1KLGB 3PGFL 1U6AL 5ETUA 5HHMB 5CZVH 4X7DC 4DTGL 5EU5B 5F3BA 2Y5TA 1R0AH 1S9XA 4J4PA 2YN3A 1G7HA 4OZGF 1HDMB 4PJ8C 3M07A 5D71L 3DX6A 3OKKB 2F5AL 1YMMA 2HFEA 4GKOA 3D3VB 2D0GA 3EZJB 3GRWA 3DSFH 3ISWA 5E99L 5FK9B 3RZCD 4G7VH 1F3RB 4YXHH 4A2MA 1YMHA 1DQDH 2B7DT 3QFJE 2NZIA 4WRLA 3BJ91 5CJQH 2BY0A 4HXBH 3WDIA 3U0WH 5T5NF 5DD6A 4YK4C 3JWDH 4NKMA 4TVPH 1BQHB 3N9GH 3D2UB 4KJWC 4XNUL 3OKOA 3FO1B 1A9BB 5EB9A 2X6MA 4H20L 2EXWD 2ZUXA 4POUB 5DO2D 1NDMA 4JGJA 3WSQL 1A6ZA 2D0FA 2VDLH 4NQUA 5C0EB 1U8PA 5TE4L 2H26B 2E3VA 1OAZL 3QT2A 2H9GB 3OL2A 4N0YH 1MSPA 4NKDA 1NFIA 2VDNH 4JFXB 3GBNH 4JRWA 4I18A 3LKPB 5GRYA 2XYCA 1XF1A 1IFHL 5FGSA 2AJSL 1HHIA 1R3IL 3K4AA 1ZAGA 1J0HA 4LU5L 5FYLH 4L8DB 1HSBA 1WFUA 2YD2A 3L7EB 1A6AB 3DGCR 5ALBL 1OAYH 4GKSB 7FABL 4NBZB 4X6FB 5I8EB 3ZKXC 4ENEC 3HCVA 4OM1H 2DMKA 2CUMA 5ISZE 2W65A 5TE7L 4J8RB 5GSVB 3QIWA 1WTLA 2VAJA 5IW1B 3LD8B 4NO5A 4U0QB 3LH2L 3TA3B 4E41D 4PB9L 4HJ0C 4JLRA 1CZ8L 4GBXD 4ZUWA 3NGBB 1VFUA 2OI9B 4P57B 2OR8A 1S5IH 1GSMA 4M6NH 1N6QL 4WV1A 4YFEA 2ZSWB 4U1SB 2DJ4A 3HRPA 3QG7H 4YHNB 4F57L 1K6QH 4NPYB 4IIQB 3QDGA 1KULA 5BZWA 4N5UA 3KJ4B 4LKCA 3GUTA 4PGDA 4H1LH 1J0JA 1YY8A 3P4MA 1FRGL 4M62L 4CN1A 2NTSP 3KAAA 4BQBA 3WE6B 5KVGH 2OLDA 5J6GB 1I7TB 4YQXH 4FP8L 5F21B 1PG7L 3RI5K 4FQXA 3PP3K 4ZTOH 3I6GA 4MCYA 3SGJA 4LPXA 1JRHH 1WZMA 4MSWB 4WUKH 1ZA3A 2B0SL 1LNUA 4S1SL 1G84A 2A38A 3O3BA 1BZ9B 3KLAB 3W9EA 2JB5L 2ORBH 3R06A 4BH8B 2W60A 4EI6B 1MJJA 2ATPA 1CU4H 1CVRA 2JK5A 4AH2A 4F7PB 1MAML 4OF0A 4DW2H 2OZ4L 3P4LA 1G7QA 1ZWIA 4Q6IB 4MQ7A 5EU7C 5IBUB 5I8KL 1N5YH 3HC3H 4IMKA 3MLYL 1CLZH 2DOCA 5GGRA 3P9WB 4WGWB 1F90L 4FQQB 1A6UH 1AGEA 1MFEL 4LCUB 4RDQG 3DHJA 5IVXA 2EDFA 1FDLL 3IT8D 3D39A 4CBPA 3PGCA 2YPKA 3G6AB 1IKFL 3KPRA 4NQDB 1KF9B 2Y1VA 3KPMA 3LN4B 3NFSL 5DT1H 1ZLUH 5E00B 5C09E 3P30H 2P8LA 5A2KH 4Z18A 1DVFA 1FG2B 4JRYE 4HWZB 4Z7WF 2FO4B 2HRPH 2XA8H 2X4PA 4PJ9D 4XVUD 2CLZB 3T2NH 4KMQA 1NUGA 4HS8L 4KKCD 3BRGC 1E6OH 3OJMB 3SJVB 4QOKB 2XZAL 3D1MC 2NY5C 3K7UA 1JPSH 4G7YL 5EO0B 3QIBC 1U2HA 4KQ4H 2QKIB 3I02A 5F1OB 1CLOH 2HTLC 4PG2C 2X1QA 2DL9A 1T7VA 5CMAA 5TF1H 4NNXA 2OL3L 2ID5A 4JKPH 5HHXH 5IG7B 1RURL 1FLRL 4HK0B 1JTPA 2GUOA 3WIFB 2EYTA 2A77H 4ONHB 2VJXA 3PGDB 3QUKB 4G8FB 3LEXA 1HZHL 2R1XB 1CICB 3MMEB 1DLHB 3J7HA 1H5BA 4GRWB 4HMCA 1JWMB 1JV5A 5DJYA 4G8GD 2QR0B 3GHEH 4U7MA 3FT2A 3U1SL 1FFPA 1GL4B 5BZDB 1V7MH 4N8VA 3U9PH 2QQKL 2QHRL 1BOYA 1I7RB 3SDCA 5BQ7A 2A6JA 1CK0H 1KIRB 1F2XK 1U8JB 4M00A 4A6YB 5SX4I 3E0GA 3FKUS 3ESUF 4HCRL 3LRSA 2AK4B 2HTKC 3BDYH 5B39B 2W92A 5F70A 1T66D 3TCLB 5J1SC 4AMKH 4KZEH 2YC1A 1VEOA 4XBPB 2OTWA 4NO3A 1NMCB 2VZSA 4LPUA 3E3QC 1S7RA 1BGXH 4QXUL 1JHKH 3BN3B 1RVFL 3L3GB 3CU1A 3DO7B 2DF3A 1F4XH 3OXRB 3MQIA 4S0UC 3LPGA 3MREB 3VDBA 1YZZA 4LFHG 4RFOL 4KROD 4TSCH 3FRUB 1FCGA 4EN3D 5DEGB 4NO0D 5KSBB 1CD8A 2UYLB 3HNSH 3WFHA 4PY8J 4XP5H 4LQ1A 2Z8SA 3NN8A 4G6KL 1VFBA 5GS0H 1AY1L 3UXFA 5E8OB 3ZE0E 1KC5L 2GYSA 2V5SA 1HXYB 3RVUC 1F45A 4DZ8B 5ACZB 4DVBA 5ID1A 5GGVL 4JFZH 1CTNA 1Y6MR 3VW3L 2MKWA 4U1HB 1JPFA 2VNCA 3RQ3A 3O81A 4PRIE 3PWNA 5I0DA 1TNMA 2DWEA 2VDPH 5F7EH 5FGRA 3PQYA 2EDHA 5TJWK 5IBTH 5FXCH 3MRNB 2IFGA 4ELMF 5JO5B 1L4IA 5ID0B 2BCKB 3QA3B 1YNTA 1CDGA 1FIGH 4NKOB 1RJYA 2DQTH 2R2CA 2VQ1A 1B9ZA 1E0OB 1TVHB 4CVZB 4LBEA 4M9PA 3AREC 3QZWG 2JJTC 4P23B 1SYSB 2VXQH 4HKZA 3SDDB 1KB5L 1L0YA 4HQQH 4LSTH 4R97B 1EZVX 1Y0LA 5CUSL 3HRZA 1KB9J 1G7IA 3SKJL 1AXTL 3BKCH 4NJ9H 4CVXA 2HJLA 5DSCA 4J4PD 2X9WA 3QPXL 3TH3T 1D9KD 2I60L 3WS3A 5C07E 3CFDB 3D87B 4F15C 2FNBA 3MLZH 4LHQB 1T03L 2LAAA 3FQWA 5A2IH 1YMMD 4D8PB 3U0PB 4XT1C 4PRBB 1OB1A 3K46A 1LEIB 5HJ3A 1YY9D 2H41A 3AB0C 2R1WB 1UYWH 2RQ8A 3O4LB 5DJ2A 4EEEA 2IANA 3B6SA 1F11A 3P73A 1QR4A 4E0RB 2H1PL 2MCG1 2CDEA 2GCYA 2UZYB 2CJUH 5KSUA 1A6WL 2XN9E 4YDIL 3T3PF 1VFMA 1OGTA 5TE6L 1HHJA 4OFPA 2I9LA 5F88A 4NNPH 1R5IA 4R7DB 4ZQKB 5IVNA 2BMKA 1T2QL 5I6XC 3C5SB 2XTJC 2VLKA 5D5ME 3S37L 1MCLA 5DYOA 1YPZE 5BW7A 4BA8A 4ETQA 4Y2DB 1JNNL 1QFWL 2IQ9H 1MI5E 2MJWA 3UYRH 1JTOA 3RWGA 1AHWB 4PY7B 1I9JH 4X5XB 2V2WB 1MRCH 4N8VG 1EMTH 3E6HB 1EV2E 3KYMB 3GSQA 3QCTL 3SE4A 4X4MA 4HK3J 3DYOA 1KIQA 5DA0B 1XIWB 3QUML 4EDWH 3LS4L 5I16A 1NCAL 5B3JE 5BOPA 4MNGB 2VITB 1QBLH 2H2SD 2OXHA 4TRPH 1WEJH 5HYJB 2C3WA 2JELH 1YN6A 2NY7L 4LIQE 1QLFB 3L3DA 3MFFB 3BPCB 4QF1A 1NCDL 2Y36L 3BP4A 3O2WH 1A5FL 3MYJB 4YHML 4HS3B 1IC7L 3SE3A 4X99B 4LFHD 1CFQA 5EIIA 1TXKA 3IRZA 2VIRA 4Z7WA 1EJ6A 4YHIB 2DD8H 5SX4H 2UZIL 4J3XA 4Z0BL 3SBWC 2UWEE 2BOBB 5HHPB 4HFUH 5C2BH 3S5LG 1UG9A 4X9GA 3GSRA 2AP2A 3QDGD 4GRMB 4PV8B 1A1MA 1UWGL 1U91A 5FYKU 4BZ1L 1J1OH 1GGBL 1F02I 3I6KB 2F58H 4WTZA 3CMOH 1U8OA 3MTRA 2AGJH 5FYKH 1NAKH 1EFQA 2FWOA 2PTUA 5T5NG 2EYRB 3ME0A 2LTQC 3UJIH 5IFAH 3BUTA 1UM6H 2XZCH 2KKQA 3IGAA 2FDBP 4IJ3C 3UTZB 6FABH 4YPGA 4XMPL 4Y5YB 43C9A 3PGFH 1DBJH 4MXQA 5HYSG 4MVBC 5AYUL 5B8CB 1JN6A 3MCKB 4JZJC 2MPAL 3D69A 3QFJB 2IBZY 3MRHB 4KV5F 4BQCA 4U6YA 3MROA 3FQXB 4TULL 1DE4B 4YWGH 2L7JA 4QXGL 3DVGA 1M71A 1SJEA 1IEBA 3KPPB 5ISZA 4Y16B 3MRPA 1XF5A 2PKDA 1JPGA 4P5TD 4OAWA 4RGND 3BW9B 4X7FC 4HGWB 5GPRA 5SWSA 5TDOA 3KPRD 5C0JA 4DFIA 2WLYA 3SO3C 3VXUA 5T1DL 2NNAB 4JQXA 3VG9B 1E6JL 5EA0L 2D7TL 2PO6A 1U58A 1UB5A 1WWWX 1CFNB 2I9TA 5BVJB 1C1EL 3ZT5A 1A9EA 2HVKB 3FMGL 2HT3D 4HAFA 3EHBD 3HZMB 1HQRB 4M7ZB 1MIML 3ARBB 1AO7B 2PW2B 3ZKSD 1I9RH 4NWTH 4R4BB 4JY4B 1OAZH 3ZTJG 1MCDA 1B0RA 2CKBL 3AS0A 4X80L 1TTFA 1JPTL 1WBXB 4ALAH 5L0QC 32C2B 2BVUA 4TOYH 2XT1B 3DI2B 4OZIF 1UFUA 3ULVL 4OLVL 3RIFF 1S7SB 5KN5A 1BLNB 3FFDA 3VMPA 3CFKB 2J8HA 3K8LA 3TVMC 1D6EA 5C0FB 3IB4A 3MNWA 3DURB 4NZUH 1M6OB 4CW1A 3AAZB 4ELMA 4HIEB 2ZCLH 4QXTB 1S8DA 3SDCD 4KTEL 2F53E 3CVHA 1MVUB 3RY6A 2FSEB 2C3GA 5EPMA 5IGXH 1P7QA 2VWEE 2O5XL 2PTVA 3EFDL 5IV2B 4FFWD 1MWAA 5JXED 3QRFM 4X7SL 1KFAL 4AG4L 5K9KA 1OF2A 2HN7A 4R8WL 4YC2C 1U8KA 4J3UA 4NKQB 3SQBA 4C54A 2EDEA 4L3EA 3LN5A 3U48A 1KCKA 2VXSH 4MDIB 5E5MB 4P4RB 2R4RH 4HUMB 4EKXA 2C3VB 4AIXA 3VFPB 2UVEA 4OQTL 5MHSD 3PABA 1CXIA 4K3GA 4WNQB 5JW4R 4WIQA 4TNVF 2J2ZA 3OSKA 1RFDL 2VLRB 1WSST 4WUUE 5I19L 4HKJB 4OLUL 3IDJA 3GSNH 1P6AB 3ARPA 4NNYB 5GGUA 4O9HH 1K8DA 2WMPA 3ZKNC 5CKGA 1H8NA 2O5ZH 5GRVL 4IDJL 5TQ2L 1I1AC 5A3ID 1FNGB 1PJ9A 3NIFE 4WEMB 2BNRE 3DIFA 3WFBH 4GRLC 4JGMA 3L1OH 4HULB 3OB0K 1JGDA 5C09B 1AD0A 1BIIB 4M1DH 3GMQA 5I1IH 4D0BA 4JRYB 4XMLH 4PRPE 2DQJH 5KOMC 3PQYD 5MERA 4M1CC 3VH8A 2YPLA 3OKMB 3HC4H 3OJDA 4PUBH 3RKPA 4WY7L 2IGFL 4HSQA 3JTTA 4WWKB 4ZUSA 2DI9A 4Z95L 2HLFC 5LGHH 4R2GD 3RWIA 1D5XB 1W2KT 4MWFB 2BVOB 2VLJB 5CEZD 5K9OA 4Y4HC 2HMIC 3VXPA 3NCCB 3SKOA 4JKWA 2SEBB 3EKCA 4WFFD 4NM8L 4NP4L 4IRSC 1QKZH 3NCYP 1CD1A 3IKCB 3RWHB 4X6DE 1I1YB 4GW5B 4PGJA 1BJ1J 1DFBL 5I30L 2UV3A 1YEKH 3QUYA 3G9VA 1ZTXL 4XNYH 2BNQA 3WDHA 3KPNA 4HUUA 2ESVE 3DVNA 1VACB 2CQVA 3LY6A 1T6VN 5DK3A 4POZC 5J1AA 4OCWL 1X5AA 1P6FA 3PF2A 1EAPA 5CLWA 1EVUA 2IG2H 2AEPL 1VESA 4MA1C 1D5MB 3BDXA 3U7AA 5DEZA 4PGBA 3OX8B 3UROR 2IAND 3O2DL 3RVVD 3I3EA 1QSEA 4MMXC 4Y4KA 4PRIA 2K1MA 3EGSB 3MYZA 4OF8A 4K94L 2XNAA 3GJEA 2A9NH 2MMXA 4H5SB 1OP3K 5FOJA 4U3HA 3OKDA 2G60L 3NPSC 3ULSB 3C60C 3BYTA 5CFHA 1FO0B 2VLKD 4PG9B 1J88A 3IAQA 4GT7A 5H94A 4RAHA 1R5WB 4TSAH 1UH4A 3O3UN 2AV1A 2VDKL 1DR9A 3KHOA 3G5ZB 1C5BH 3PL6C 5EORH 3UDWC 2YMXH 5GJSL 5JTWA 4ISVA 3G5YA 1JVKA 3WYRA 3VXNB 3DGGB 3WMSA 1MJUL 5DQ9A 4U1NB 1UB6B 3FRPG 5C1MB 3CNKA 3VU2A 1CE1H 1EUUA 4G6KH 1RAMA 4LVNC 4PYHA 3QXDA 1RZ8B 4G8EA 4L3CA 4UU9A 1RIUH 4HGMA 4O58L 5HHOD 1NBVL 5DJXA 3MCLL 4OTXL 2IAMC 1FV1B 5C07A 2Y9RT 4FNLH 3O0RL 5GSRB 5ADOL 3VRIA 4HKBA 5JOEA 1T4KA 2J7LA 2FL5B 1Z5LA 5DUBB 1PAMA 5JW4M 3EYVA 3PV6A 1CQKA 1L6XA 3MRDB 1NGYB 1QP1A 4LSSL 5DFWH 4PB0L 2VXUL 4XTRC 1WAAF 4GKZA 1MCNA 2PR4L 3OAUL 1V3JA 4LDEB 3HPLB 3IYLW 5C6TH 4HS6B 1CR9H 4LAJH 1Q8MA 1P2CB 4OJFH 3TIEA 5EUKA 3A0OA 3X13A 1ONQA 2P7TA 1NLDH 2MCPL 3RZWA 2ZG2A 4U1IA 4HV8B 3C6SA 4TNWK 3DTXB 1QACA 1DBML 2DKUA 5C0IB 3SDAA 4APQA 1REIA 4PGEA 3WIHA 4AQOA 4P5KA 1WBZA 4WW2C 5IB2A 4R9HA 3GMRB 5B3NA 4F7EA 3GMPA 4OZIA 2D31B 2H2PD 3VH8G 3STBA 4HLZH 1H3TA 1OARH 4U1GC 4MXQD 4HWNA 4G9DA 3QHTC 4NZTL 4GMSL 1JWSA 5IESL 2ED7A 5HGAA 3T4YA 1QPPA 5E5UB 2OJEB 4BELD 2G75A 1NC2A 3WD5H 3AFLA 4EZMA 2C7UB 1QLRB 1QSZA 1QVOA 3KPOA 4ZUUB 5F7HA 2BVYA 4XP9L 3L3KB 1IGCH 3UPAA 2EC9T 1QSFA 4JY5H 4XGZA 5ISZD 3CH1B 1JZ3A 5AD0A 2XN9B 1IC4H 5E4EB 4XX1E 3JV4A 2Y23A 4RNRA 5JDSB 1QO3B 5JW5A 1TJIL 1OW0A 5SWSD 2J8UB 3QWOA 4U6VH 2IWGA 2JIXA 2IFFH 4K7PY 4WEBH 4BK4A 5KSAB 5CKAA 3VXUD 1GIGH 2BSED 1UH2A 3KPLA 1FE8H 4ODUB 2PO6D 3HG1A 2V7NA 4U1KA 4O2CB 1AQKL 1YQVL 4UINL 2F54A 5CSGA 3BZFB 1JBJA 4G5ZL 4NRXA 3QPQC 5DURD 1MI5B 4IM8A 3ZKQD 2UWEA 4N90E 3TPUA 1R6VA 4YGVB 3GHBH 1IAOB 5D7LA 3M1BB 4G6JH 4YHOL 5ALCL 5KS9E 1QPXA 3KLDA 1S9VB 5J11C 3S96B 1G9NL 2VZ1A 2ZPKL 5FGBC 2NW2B 3MA7B 5A43C 4Q9RL 1CDYA 2Y5EA 1DCLA 1WJ3A 5C9JB 3L6FA 1M7IB 2QQQA 4Z76B 1Q94A 2X4UB 5I15H 2VL5A 5DEFB 1FNEB 1TETH 1IBGL 4F9PA 1PBYA 3B9KC 1P4LA 4Y5XB 1U3ZA 5EIQA 1T83C 5IJKC 3TGXA 3GMLA 3W11D 3BEVA 5LQBL 4Y5VA 3O6FA 5SWQA 3KLHC 4PGCA 5MI0C 3LS4H 3QUZA 4HWEH 2R1YB 3OKNA 3Q5YA 4K9EL 5DC4B 1W72H 3BKMH 1S7TB 5T1KB 4X6BB 4G9FB 2AS5M 1XCTB 4XNMA 1VPOH 1DQML 3MJGX 3RA7L 1DZBA 1SYVA 1AIFB 3TYGL 3CFIC 2BVQA 2FB4H 2VC2L 4M5ZH 3L3HA 2PTTB 4J3SA 3V6ZB 5FOBB 1CFVL 5CSZA 4LCWD 1UCBL 2X4TA 5CWSB 4EOWL 3LIZH 1P7QD 4OFVA 5ANME 2CLVA 3N85L 1CFTB 4H26A 1NEZG 4X4YB 3T0EA 1OD9A 1YDPB 1J1PL 4FS0A 1DBKL 4IMLA 3QNZA 1NBZA 1DDHB 1N0LA 5CIPH 5KSVA 5TPWH 1LE9B 5JNYA 5GRUL 4L3ED 4PR5A 1MNUH 3L3JA 1IARB 1MRDH 4JFFA 3ALPA 2DS4A 4OGXL 5DZOA 4LCIL 4P2OB 2E5EA 2R23A 5HYQB 4JPIA 5AZ2L 5L2JB 4R7NA 5KW9H 1HKLL 3LKNA 4U6XA 3JVGC 3V8OA 1P4BH 4HH9B 2QSCH 4OV5B 2BY2A 3F6IA 5B22A 3D85A 3PP4L 4U3CA 2A1WH 1YEEH 3LEYH 5C0BA 5D4QA 3GMNA 4J6RH 4QO1A 2MFNA 4UMGA 4CGTA 3FN0H 4M6ML 3KS0H 1A6TB 3H9ZA 1G7PB 2APTA 1ZT1B 5J57B 1A7QL 2D03H 2A74A 4MD5A 4MJ4A 3D9AL 2F19L 3U6RB 1KIPA 4XP4L 1K3IA 3EO9L 2YRPA 2YPLD 3QIUC 4J12A 3T08A 4C56E 4M48H 1BIHA 4WJ5B 2YPVH 1GGYA 5TFSH 2P49B 3MV01 2BHZA 3EW3B 3TO4C 5H35A 2XACC 2DQFB 4I48A 3Q2CA 2X40A 4MJIA 4X98A 2J4WH 1N64H 1H3XA 3LQZB 5D1ZC 3AY4A 3C08H 1F6AA 5I1AA 3B3IA 3K3QA 4I2XE 5DHVH 3WXVL 5IUSA 4ZSOA 3R8BB 3VFTB 3ARDC 2Q86B 4OCMC 5TDPB 5HYFA 5E2JA 2YWZA 3MRRA 5L6YL 4XB8A 3QUYD 4ZFFB 1I9EA 2BNQD 4FQ1L 4LHUB 4M02A 2O5YL 3ROLB 4MJ2A 3UTPD 2AEQL 4MNHB 4GG8B 2CLRA 2GITB 5I8CB 2Q3AA 3OHXB 4WUUA 1J10A 1S7VA 4JFXA 4EI5A 1HYRC 1NAMH 2J6EH 4RISH 4JFOA 3TN0C 3BQUD 5HXMA 1FJ1B 2W0KA 3ELAT 5GGTH 5DR5H 4F3FA 3C09B 1DLFL 4LK4A 4L8DA 5CD3B 3G5VB 1WAAA 2NXYD 4XP1L 4DZBB 1E27A 3MJ7A 1JGLH 4FZEH 1QSED 4R90L 3AREB 1AR1D 4H0GA 4PRID 4ODVL 2EYSA 2P44B 4PRPA 5IFHL 2I26N 1RUKL 4P59L 4BZ2H 5HY9B 1F8TH 2YUVA 5DF0A 1Z0MA 5E2TH 3KWWB 4RFEB 2CUIA 2NY6C 1RIHH 3OV6A 2YXFA 5HI3D 3VFMB 1NMBL 1CGXA 3ARRA 3QUXA 4KHXH 3H2WA 4Z78B 3U9UB 1J8HE 3LQAH 4GUPB 3RIAK 2CR6A 2YRLA 2ZSWA 4LLQA 4O4YL 4OCSL 4HBCL 5L2KB 2MNUA 1G9EA 1A7BA 1PZ5B 4F15B 2WUCH 3GRWH 3IDIB 1RFDH 2BNRB 1TNNA 5EUOE 2X4SA 3VG0H 1EFXB 2R2HA 2N4IA 5J6GA 5ESVB 3AB0B 1NFDE 2ZUQC 2NZ9D 3DBXB 4ZG1A 2WINB 4PP2A 3F12B 4MNQB 4M7JL 4L8SB 1GC1H 3NZHL 5FIEA 1LD9A 5C07D 4FFVD 4I3SH 4OI7A 2BDNH 5EBMB 5J8OA 1MQ8A 1U95A 5IMMA 2XWJA 4PRDA 1EEQA 4E42B 3ULVE 5DD0H 2GY7B 5I6XB 1JYXA 1MLBB 4K3HA 2DQDH 3S3JA 1HH6B 2XQBL 3O9WB 4HHAA 4G8IB 4DN4L 5D1XB 3ZYOA 1QEWB 3C5ZB 2J3SA 2PXYA 4X6DB 4TVPE 3T04D 1F4AA 3I6LE 1DQJB 3G6AA 3MLUH 3ZDYF 1YNLL 3CUPA 2C3XA 2Q87A 1PY4A 5D2LE 3GB7B 4D0CB 3TBTB 3ARFC 3MLXH 4APQD 3V4UH 3V79C 4PBWD 2IF7A 5GRZA 3AM8C 1MF2L 3BE1H 4HT1L 4HWZA 4MAUH 3RTQA 5JOPD 2X70B 5JXAL 3S4SB 4MJ6B 4HG4K 2RHEA 3V52L 5D93C 3RNQA 5C70A 3LV3B 1LVEA 5IM7B 5F6IC 3TZVC 1T80A 3ZYIA 5IQ7L 3MUGA 2BY1A 4RX4D 3H9SD 1JNHB 3HN3A 4Z7OF 5EZIH 1ADQA 3T65A 1D6VH 1N6UA 3HZYA 3U2SA 5HSFA 1QSFD 1KGCE 3P0GB 2Z31A 1K3ZA 3WHXB 2YS4A 5E8PB 3V7MA 3QWRA 1KJ2L 1BQHG 2AEPH 4HK0A 3WNOA 3LEVH 1OD7A 2RR3A 6CGTA 2E7CA 4UOW0 2JIXD 1MCHA 3TEUA 3GMOA 4G8FA 3D18B 3PWVB 1RPQA 1N2RA 1CICA 2P24A 3VFWB 5FM8A 2VZOA 2VUOA 3HG1D 3HMXL 3BSZL 2QR0A 2F54D 5FUCC 1IEHA 1SMOA 4K9EC 2DYPB 2B1AL 3CXDL 1IAII 4GH7B 3GJFA 1YEGL 2LTQB 2P8PB 2YD3A 1UEYA 4LARL 4O2FA 4XCCL 3UTSE 4LQFL 1HHGB 1ZHNA 2P5WE 5D7LD 5EU6D 2AK1H 4XAKE 5C08E 3PHQB 3KYNB