5E8PA

The structure of the teipp associated altered peptide ligand trh4-p5nle in complex with h-2d(b)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 69
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8pA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8pA01
4Q6IB 3VXSD 4M6AA 3AMKA 4JRYE 3MCLH 1INDH 4FZEH 1HHGB 5K93A 1TJHH 2ZOKB 4EQ3A 2J6EA 2WUCH 3SJVE 5F7HA 3CXDL 4JVWA 1CR9H 2VXTL 3MOAL 2CKNA 2FB4L 1WZ1H 2VLRD 3OTTA 5B38A 2Y06H 4XT1C 5D1ZD 4XCFL 1I8KB 2E6PA 4GAGH 4L8SC 4OCMC 4PRHD 3H9SD 2XWJA 2XKUA 3GJFB 1DBMH 4G7VL 4CVXB 4YHLH 4J23A 2ERJB 5L2KD 4HX1B 2GW5A 2AV1B 3QFDB 3HN3A 1FBIL 3OF6A 1A7PH 3RNQB 4FNLH 4TSBH 3ARBB 1RJZA 3RIAK 3QFJE 2PO6C 2ZUTA 1HI6A 4G9FE 2NNAA 3KR3H 4RA0C 3QG6A 1CCZA 4R6UA 2DQFB 5EG6C 3BH9B 3BW9B 5HYIA 2GJ6B 5I15L 4L1HA 3HC3H 3O9WA 4IOIB 5BRZB 5IFHH 1N4XH 5D1QB 2KUTA 4FG6D 1K4CA 1EEZB 5F1KC 2NXZB 1FG9C 4WV1A 3DYMA 5KAQG 5C0BD 2DIAA 2R0ZH 4YX2H 2JJVA 3DETD 4F9LA 1PFCA 5C0CA 5AAMA 1IBGL 1OWWA 4OF3A 1NKOA 3W39A 3F7VA 2EYSB 4ALAH 3QUYD 1KPRB 3ARDD 2OL3L 2ZCLH 3W11C 3VFTB 2YMXL 4AEHH 5L9DL 1A2YA 4LF3A 1WFTA 2CKBL 2F74A 5ADPH 3SE4A 3CX2A 3GGWB 5BVPH 1WZKA 5CKGA 2AW2A 2X4OA 2VLRB 3TBVA 5B38G 3ZT5A 2F8VA 2GJJA 3QDMD 5EOQH 1I9RL 2Z93B 3ARXA 1G6VK 3O6ML 2KZ1B 2CH8A 3WKMH 2P5EA 3WFCL 1KJMA 3AM8A 5J3HC 3V5HA 3ARDC 4LLVB 1DE4A 5DT1L 3NACH 5DJCB 3RGVA 1UA6H 2QQNH 4ZNEE 5E99L 3LEYH 3HTLX 5JHLL 1HKLH 5JO5B 4G7YH 5LG1A 1S7QB 2ITCA 4C4KO 5E2JA 5FOBB 3U0TA 2OBGA 1CGXA 2VQ1B 3NPSB 3CLEL 1RFDH 4JCMA 3S35L 1ROWA 3IDIB 1U58A 3QH3B 1DQQB 3BDBA 4Y4HB 3QP3A 5DK2B 3LN9A 4QCIB 4PRIE 2M26A 3NIGF 1H0DB 1FFOB 4FQXD 2BFVH 4NC0B 1XGQB 3MXWH 1MWAA 5J8OA 3QWQB 5BZWB 1CDYA 4WO4A 3MRGB 2P5WD 3CVHL 5SX4I 3ZT7A 2PXYB 5GGQL 4HZLB 3T2NH 2J5LC 4P5TD 1MQKL 3OX8B 4LVHB 1AXIB 4TQEL 1N6QH 3QIWB 4PLNC 3HZKB 4NQCA 5F1IB 1IC4H 5I2IB 1IGCL 3V4VH 5D7JB 3SKNB 4LVNC 1BQLL 1UQSA 3SDAB 4G8FB 3B3IA 1RULL 4WEBH 5E2WL 2JJUA 3ZTNH 1H15B 5DRXB 4ELMA 3DX6A 5DUMH 5TGBA 3TF7A 1BVLB 1C5CL 3EO9H 1LE9B 4QXGH 5IHUH 1DQJB 3V52H 1HILB 2BVQA 5JMOC 1PDKA 4KKBC 4NDMB 4PJGA 2ICWB 1CGTA 1F6LL 1O7SA 2BDNH 3L3DB 3PWPE 5F9JB 3G6AB 1AXTL 1I8LA 2CQVA 3ARED 4JKPH 2ORBH 4L3CA 4N0RA 1C8PA 1A3RL 4I8DA 3GZKA 2HN7A 4AQ1B 3O4LE 4M62H 4E42A 4PJ8C 3TJHA 3I75B 3QJFA 5JW4R 4HIEA 1NCWL 3T4AA 1F5WA 1D5ZB 3P4OA 3MUGB 4UV7L 3WIIH 3F7YB 4PGEB 4M6NL 3SO3B 4ACPA 5IQ7H 5C3TA 2FIRT 3L5IA 1U41A 3U1SL 2O5YH 2DKSA 2H8PB 2Y5EA 4AH2A 2O26U 5GGSA 1MCCA 2PO6A 3K4ZA 2OI9B 4F7CA 4JHWL 4Y2OA 3WHE1 3MYJA 4R97B 4M7JH 2PYEA 2VE6A 2ZSVA 3QIUD 4MJ5A 3W9EB 1C08B 4N5EC 3A6BL 3IJYB 4H8WL 3O41A 5EO1A 5C0DB 2H1PH 4TSAL 3T1FB 1T66D 1D6VH 3GMLB 4MSWB 4OZIB 2X4RA 4JRXB 5CIPA 3W39B 2AS5M 3ARZA 2DTML 3P4NB 4Y4FC 5ANMB 2GQHA 1AP2B 1IGYB 1WTGT 2R69H 4IBLT 4MA3B 4P46D 1JPTL 3LQZA 1LP9B 3IVKB 1FO0H 2N1KA 3G9AB 5A43C 1PZ5B 3ZDXE 1MHHA 4JY6A 1PLGL 1UENA 4HUXB 5L88H 2XG4A 1NAKL 4HSQA 2NLJA 5DR5L 2CD0A 3H7LA 2VIRB 2Q7YA 3VI4F 3VG9C 3QI9B 3OQ3B 4WW1A 5DS8B 1QPPA 2ZUYA 4QRSB 2GK2A 1WFNA 2W91A 2O5YL 2BSTA 2D7QA 2QADC 5B8CC 4YDLC 1KTDB 2F53E 4EI5A 5CP7A 3FTGB 2F54E 3N06B 1U92A 5CBAB 2L7UA 2WWKT 1J8HD 1A02N 2P49B 1CD1A 3LAFA 4UIMA 3VXRA 4TN9A 3I9GL 3GMOB 2NY3B 5ITBH 1FZMB 2D03H 1MCPH 3I02A 4WW2B 2V2TB 5IOPA 3WD5H 4KKNA 5HY9B 3PWUB 1BX2B 4RMUA 5TQ0H 1VEMA 2D31B 4JM2C 4PS4L 3LZFL 4PJDB 2BSSB 3ARFA 3B9VA 1QFHA 2R56L 3TCXA 4QEGA 1YMMD 3BSZL 5DJ0B 5E08H 1WJ3A 5FGBC 2B7DT 2KPNA 4HWUA 5D1XA 5DJ6A 1K2DA 2BERA 3U82B 5INDA 1OLZA 3QA3A 4WENB 5I1AB 3C8KA 3QAZC 4J3UA 5CHNA 2GKIA 3D69B 1IQWL 1U3YA 4CU6A 5CEYA 2CRZA 3ZE2E 5DURD 1XZ0B 5HDQH 2P24A 3DYPA 1CBVH 1QBLH 4L4TB 3VXOB 1X4ZA 3RTQD 1W0WB 5JNYA 4LSVH 1S9YB 1L6ZA 1DLHB 2DIBA 2XFXA 3T2NL 1VKXB 3QXAB 4WU5A 4D2NA 4AIOA 3MPCA 5HGAB 3DRQB 3IAQA 5EO9A 2HJKA 4WHCA 4XPFH 5A2FA 4HXAH 3V6BR 2VWEC 5JW5B 2J88L 2X89A 4J3SA 1EZVY 5A16B 3BP4B 4HKJA 5BQ7B 1NBVH 4X7DC 5SWSB 4OCWH 5F71A 1MFCH 4YAQA 5F6HI 5EZJA 2FO4A 4P9HL 1FE8H 2RQ8A 2NY5H 4NRYB 4QRSA 1M71A 1SBBA 3P0YL 3G6DL 3MA9H 4Q6IA 1ZMYA 1E28A 5EOTB 4XNZB 3RWCB 4JFEA 4HGWA 4FTVB 1RUKH 4O2EB 2X1QA 3ZO0A 4BYHA 3O9WD 3C5SA 1FYTA 2R1XB 1S7RB 4DUXA 5IG7B 1RZ7L 3RWHA 5HHVL 1XCTB 3O6MH 5E56A 1H3VA 5K59E 1I7ZB 4O51A 4Y4KD 4N8VA 3SOBH 4DN4L 4CAGA 4HZLA 2CIIA 2AJZB 4YE4H 3VXME 3RNKA 3VFOA 4OAWB 4LKCA 4K3DL 3SKOB 5E7BA 4WDIB 4DFHA 4KHXH 5I1EH 3VWJC 5AZ2H 2OM5A 4Z6AT 4PB0H 1JZ5A 2C9AA 2B20A 4OGXH 4K7PX 3MA7B 5C09D 4RIRA 4LU5H 1FGVL 1PSKH 5C8JA 5FKPB 1X4XA 3IDXH 3O4OC 2XQYG 3UTOA 1MI5B 4MAUL 5CHNB 3LS4H 3MUJA 4DW2H 2OQJB 4Z78A 2ITCB 1VFBA 3QO1B 5D71H 5HPOA 4MAYB 5HI5D 4X6DE 1M7DA 4KJPD 3BN3B 3SDXA 1AJ7H 1CU4L 3LIZH 2JCCF 2J4WL 3CVIL 5EU5B 4OJFL 4P2QE 4WUUA 5FHBH 3GSWB 1NGZA 1C5BH 3QDJB 1XFPA 2OJZH 3DPBA 2VLMD 3UTTB 4M00A 3QWOA 1IEHA 5ITBL 4U1KA 3BPNB 4I0PC 3KYOB 3GHEH 5CWSA 3M1BB 1ACZA 3GSNA 2X70B 4GW1B 4TVSa 1U8IA 1CG9B 3MR9B 2AQ1A 4R26L 4IDJH 4OGYH 4Z95H 4DGYH 2ZNXA 3MFFB 1II4E 4W6YB 2EC9T 1SBSH 4FXGB 3TESA 1DN2A 4U2ZA 1QUNA 5IFAH 2OCFD 3HE7D 3LHPL 3GFUA 2R69L 3RL1B 5I1KL 4LRIC 3J7HA 1Z9OA 2HT3D 3UCRA 4UB0H 1S5HA 4KTDH 3QQ4B 1H8OA 1OD7A 1W0WA 3MJ7B 4OZFA 5JNYB 5EB9A 3IFNH 2OSLB 3TT1L 5J7CC 4UOW1 3KLHD 4YQXH 3H3BC 3QUYC 5ANME 2GSIA 4MA3A 4Z0XA 1RJYA 4PYGA 4Z95L 4NBXB 1I1CA 2LAAA 1F58H 2EIEA 1B0GB 4J8RB 3W5NA 1ED3B 3TCLA 4QHMB 2APVA 1WT5A 5D7IB 3JTSA 3QEHA 1QTYT 3SDYH 4W6WB 2J2ZA 3SDDC 1IEBB 4Q6YA 3LSOB 4APQD 1YPZA 5HVHC 4NQTA 3LB6D 5DMGC 1A3RH 1MJ7L 3MLTB 5D7JA 2IH3B 1INEL 3I3BA 3PQYB 2W9EH 1IARB 4ZD3H 1TJGL 1S7XB 4GRLC 1KIPA 1PX3A 3BO8B 5ICZA 1D9KD 3SPVB 5HXMA 3RP1A 3DETC 3O3BB 5ALCL 1FPTL 1OARH 2PYFB 3SDDA 2Q7NA 5IB4B 1UB5B 3TYGH 5AWNL 3V7AE 4FQQA 1Q0XL 2WNGA 4WI7A 5FF6B 1QSZA 2DS4A 1UEMA 1KCUH 1NAMA 4HJJH 5IUSA 3QNYA 2XY1A 3F6IA 2SEBA 3GJEB 4ORGA 4Y1AE 1FVDA 4V3DB 4CVZB 2DJUA 5GGQH 1RHFA 1EEUA 3TBWA 3MJ8B 2A6JB 1AO7E 4K3DH 5E2VL 5CGYD 2EYTA 1J0JA 4FQIL 5ICXB 1I3VA 2BJML 4PJBB 3SE4C 25C8H 2E27H 4JVUA 5GHWL 3NCJH 3WUWB 1M05A 3L9RB 3HPLA 5HYJB 3EDFA 3MNVA 3U48A 1HEZB 4OFKA 1XGPB 2WLZA 1MRDH 2P8PA 4F15C 4LASH 3MJ7A 4P57B 1YN6B 1LO2L 2P5WA 1YMHB 4XCNA 2YD3A 3GHBH 3S34H 3MSPA 1B0RB 2Z91A 4GAYB 1TVHA 2LQRA 4NO0D 2AVGA 1WF5A 3CZFA 4NN6B 4HIXL 3CVHB 2ARJB 3LCYA 3IS1X 1GYAA 2JJTA 3FFCD 2I07A 1N2RA 4YGVA 3NCJL 3ULSA 1AGFB 1NEZA 1A6VH 2V2XA 5KAQF 1DE4B 1AKJD 4PTUA 3A6CH 4YO0A 2DLFL 4NRZA 1J9CT 4JM2B 1R5WA 4M7ZB 4K3JL 1I9RH 3ALPA 1SJEA 4P3CH 4TSCH 1RMFH 3ILPB 5CS7A 1A6VL 4K9EC 3JWOL 3UBXI 4C56A 5EU6E 2J5LB 4YPGA 3DV6B 3AREA 2X4UB 4U1NA 2DMBA 4P48A 4HHAA 3P40A 3H6JA 5I75B 1T7WA 1NCBH 1MIEL 3HE6A 1OAYH 2EO1A 5E8EA 4JO3H 1ZXQA 4KDTA 4Q0XH 5C0FB 2X41A 4JDVA 1IGJA 4L8SB 3AC0A 4NO5A 1G1YA 4C58B 4DVRL 4MQSB 5DGQA 3BGAA 2FHFA 1R24A 5ESAA 4JZJA 1CIDA 1BFSA 3DROA 4JDZB 3MNZA 1FSKB 4S0TD 5I15H 1BJ1H 4XBGA 1XGTB 4YDIL 1S78C 3MXVH 3OAYH 4NNXA 3WXVH 3O0RL 4JAMB 2AJSL 3ULUF 1YZZA 2X1WL 3V6ZA 1FGNL 5FV1L 1X6LA 2ICWJ 5BRZA 5F1NB 5T3XD 4PJFF 3TFKA 4GBXA 4CJ1A 1XF2A 4ODTH 2XWBB 4DZ8B 3O3DA 4MD5A 1IKFH 2VXSL 4QGYA 2IFFH 2X40A 4XPTL 4UV4H 3WHE0 4NT6A 4YNYA 2D4DA 3FT4A 3P9MA 4HBCH 3WBDA 2C3HA 2NY1C 3B5HA 4PRHB 2OZ4A 4BQBA 5DUBA 2IQ9H 3GGWA 3FN3A 1PYWA 3SJVB 4LP4A 1J10A 3LHPH 5TPWL 5HJ3B 8CGTA 4OFYA 1UYWL 4HGMA 1A14H 1A1MA 4MXQC 4JRYB 5FK9A 3MV8D 3FCTA 3ZMRA 3ULVE 3DRTB 2VR9A 5BS0A 1FNGA 5I8CB 5ID1B 3WDJA 5B39B 4NC1C 5JHDE 3VGDA 4JHBA 1U3JA 4EUPB 2IBGA 1FFPB 4GXUM 1D5IL 1GGBH 1U2HA 4MS8C 2W9DL 3DOSA 1A1OA 3GSVB 4TVPH 4X4MA 5J1SC 3QB7C 1S9XB 1SBSL 1I1YB 2XPGB 2Y6SD 5IB1B 3RWCA 1NLDH 1JYVA 1WSST 5EU3B 3C6LC 2VLKB 3QXUA 3UTTA 4RFNC 2HWZH 1YMMA 2NY2B 2DDQL 2RFXA 3AGVA 2P8LA 4QTIH 1FIGL 1E6OL 1QFPA 3BMWA 3MACH 1P7KA 1Q9OA 1CU4H 3LIZL 4Z7UE 1BZ7B 1HI6B 2AKRA 5KJRL 2HT4D 2J3SA 5IMKA 1OSPH 1P4LA 4AEFA 3MODL 3FQWB 1RK0B 3CMOH 1C5BL 2Y7QB 3O2DL 2LABA 5FKPA 1IGIH 4DZBB 5JPNB 2JB5L 4ISVB 5TPWH 4EEEA 3TBSB 4K7PY 2CGRH 4HAFA 1G9NH 4QRRE 4K8RH 4MB5A 2H32H 1DP0A 4AIXA 4X98A 1NGPH 2CIKA 5EA0L 1T20A 4JO2L 1T6WA 2OJEA 3E6FB 4ELME 4HKZB 4D0BB 1P7QA 3GJFA 3H42H 3HFMH 5F7UA 3L9RA 2DQDH 1MHCB 2ZUWA 1BAFL 5SWZB 5BV7H 5JORA 3BGMA 4Z77A 1MCJA 2F53A 2YOCA 3ARRA 3Q3GA 3W81A 2ADGB 1D5MB 4X80H 5F9AC 1MFEL 2A6JA 4X6DF 1CZ8L 5HHXL 4H5SA 1D9KB 4PJCE 4OTXH 1QLRB 5AG9A 3OJ2C 3BRFA 1NUNB 3U36A 4Z7UF 1JYNA 3MLSH 5D2LF 4XCEA 3DI3B 4R96A 3STLA 3ELAT 5TE4L 4LL9A 1F4YL 1U95A 5MEPB 3I6GA 4OBRA 4PJ8B 4NM8H 2DL2A 5CILL 5LQBH 2IEPA 1JF1B 5JHDD 4Q0XL 3S8WA 4ZOBA 1F90H 4BJLA 1S7VA 1FFQA 2E9WA 2MNUA 3ZHKA 4X5WA 4KMTH 2BNQE 2F5BH 5IBLC 1BOYA 2ICEA 3OKDB 4D9LL 5EO1B 3VFRB 4LHJB 3LKPB 3FQRA 4M8VA 1NCTA 1KLFA 4WI2A 5E6IB 4UQ2A 5K59F 4JFQB 4R4BA 1UM5L 3UPCA 3T8XA 2VSDA 2Z8WC 1YC7A 2Z92A 4R90L 5C2BH 2XRAL 5E70A 3HE6D 2DQUH 3O3AA 4XPHL 1HK6A 1JF6A 6FABH 1ED3A 2GY5A 4XWGL 3B9EA 3R8BB 4GW5B 4AT6A 4MNGA 2UWEE 3FQTB 5FOJA 3FAXA 3QCUH 1OTSC 3BZFB 5L9DH 3FT2B 3EYOA 3R1GH 3OG4B 2OSLA 3GBNH 4UINH 4DWHA 1Q9LB 4BFIA 4UT9L 4G6MH 3FN9A 2CRMA 4OLZL 1FE8L 3ARGB 3ZE0F 3FFCB 1RIVH 3WNOA 2ADIB 4IDLA 3ULUE 1ZLWH 4NM8L 1VGEH 3BKJH 2DBJA 1VENA 3VMNA 5EUKA 2V17L 1LO2H 2NW2B 1M7XA 3EW3B 2CUMA 5EOCL 5B39G 2DOCA 3DMMD 3OAZK 1CXFA 1NFKA 3IFLH 4NQXA 5D7LD 1NL0H 2GT9A 3ILQC 3T4AB 4F15B 5GISL 3HAEG 2F5AH 1Z0NA 2APXA 4OF6A 2C1OA 4B50A 2IG2H 3JXAA 1P1ZB 2C7UB 3BN9C 1IC1A 3SQOH 2W65A 4U0RC 4UU9A 1T1YA 3DX9B 4UDUB 5I17B 5CZVL 2DYPD 4BQ9A 4O5LL 5DI8B 2XWBA 4KAQL 4R7DA 3QA3B 5CJ5A 5GSRB 2ATPA 3V9FA 2IBZY 1VFAB 4DKEL 4XC3L 1NUGA 3D0VA 3F7PC 4UQ3A 4NDMA 2UZIH 3TO4D 2BSSA 1S9WB 4ONFH 3T65B 3IDJB 3IVKA 4KKAD 5KTEL 3Q6FA 2VKWA 4JPWH 3DXAD 4KKLD 5I16A 3MV8E 3MCLL 1IM3B 3MODH 2NYYC 3PGCB 1MWAH 3WFBL 4EOWL 3HE7A 3EFFB 3EO1A 4DUWA 1CGWA 1DFBH 5CSGA 1MJ7H 1YEJH 1G6RL 1BEYH 1VGKA 3BMVA 5I1GL 4LCIL 1J88A 3H3PH 5KG9A 3CDCA 3FQWA 3STZA 3CPLB 1GAFH 1XF5B 2WSKA 1BWMA 1JUFB 1YEIL 1R3HA 3TZVC 4KJYB 5I1LB 1EAPB 4IRJC 4JFEB 5E8PB 1BFVL 3EYVA 5DMGD 1FSKC 1MFNA 2X4RB 2JF1A 3AAZA 4N8CH 1V5JA 2YKLL 5JIKA 1BJ8A 5JDSA 4YJZL 5C6TH 1AGFA 3U6RA 3QXDA 4CVWA 43C9B 4PJDA 1LP9A 3PL6D 3MC0A 3RY4A 4LARH 4HK3J 1IAKB 3NN8B 5HGBB 4M93C 3QUML 2OI9A 2CR6A 3S98A 1WWWX 5E2WH 1P7HL 1EERB 3FQUA 3G04A 3LH2L 1CLYH 3V5HB 3SDAA 1NAMH 1BOGB 1ZHNA 4GW4A 1RZIA 3SQBA 4L9LC 3RY5A 3WV0A 3TGXA 4NQCB 4ISVA 2JK5B 5ID1A 1KJ2A 3BUYA 4TQEH 2FSEB 4OGYL 4ZSOA 2EDKA 4U1MA 3N50A 2PO6B 3DECA 1MEXH 4OB5L 1N5YH 1JVKA 1JN6B 2HT3C 2IC2A 4XP9L 4HH8A 3QXWA 4AG4L 2JB6A 3KYAA 1IC4L 5DYOA 3LN5A 3G6AA 2VXQL 4IRJD 1KCRH 5EUOB 4MJIE 3F12A 4JY6B 3P77A 1NCWH 4KVNH 1G7PB 3CFKA 4OJFH 4IMKA 3QJFB 3L5XL 3MBEB 1HNFA 2DL9A 5HVFB 4V1DA 1CK0L 2DQIL 4HIHB 3CDGA 3OAYK 4ZS6C 3RVUC 5KSAA 2DQFA 5GJSL 2VR4A 4Y2DB 2IF7A 2SEBB 4ORGB 4PRIA 1W0VB 3DBXB 2IH1A 3TWCH 2HH0L 2ZSVB 3C6LB 1J1XH 1R5IB 3O2WH 3VXUE 1FNGB 4DUVA 4FTVE 1ZAGA 2HKFH 5L0QC 3R1GL 3GSOA 3PE9A 3U30B 1XF5A 5KSUB 3EGSA 3Q2CA 1KJ3L 2UY6A 5HYEA 1S9VA 4S1SH 4GRMB 5HYSB 1X5YA 1SMOA 4MSWA 4OZIA 4ODXB 5CZKA 5GGVH 3V79C 1U92B 4LLDB 3G9VA 5J0BA 4BQ8A 4YWGL 1A7QH 2FH8A 4LAQL 4EVNA 3ARDB 2DI9A 4AIZA 4CMMB 5HBBA 4R90H 5HDQL 4GG8B 1N0XL 2ZJSH 3OGCA 4O9HH 3MGTB 4TNVF 3DMMC 1T89C 2NY5L 4QF1B 1FNEA 3I75A 5F7LB 1I1FB 5J57B 3RHWF 4HPOL 3MGOB 4JFOA 2RGSA 2K9UA 4U6HA 3N1GC 4NN7B 3RDTA 5K9KA 4HWBH 1MCOL 1TQBC 1MCWM 1IZJA 2FEDC 5GJSH 1S7QA 4U3XA 4PP2A 4M43H 1KXQE 3RVXC 3TFKD 4KGJA 4QHUB 3HI5H 4ORZC 3ARFD 2J88H 3QT2A 3AROA 4O9HL 1YA5A 2E7CA 3S37L 3EOBA 4Q6IC 3HMWL 2E27L 4HUUA 4MWFB 5TGBB 5DVKA 2Q6WB 4CVUA 2X5PA 4J4PA 4YHLL 2RCSH 3E0GA 1K85A 1S78D 3A67H 3INUH 4M6OH 4OD3L 1NKRA 1WFUA 3HI1B 3PHQB 3QXDB 4R4FH 2EH7H 4EXPX 3GIZL 4F9LC 4ODUB 1RUQL 1Q0XH 4HLZG 4OI8A 3VG0H 3CH8A 4BM7A 2CLVB 3QG7L 1AO7D 3KYNA 4PJ9A 4ELKA 1KCUL 3MJGX 1V7NL 1D6EB 4ODVH 1INDL 4FZEL 1D5BA 5FYKE 3BAEL 5CZXD 4NZJA 1VFAA 1J87A 3BKCH 1AGBA 4MS8D 2EDRA 4Y5VA 5CEZD 2VISA 2NR6C 1I9EA 1KCKA 5KBNC 4XVJL 1B9ZA 2VLLA 3EYUH 2DDQH 1PKQA 3B2VL 4Y1AB 2PTUA 1A5FH 3O3EB 3C60C 4L9LB 2D03L 3L3JB 3LKQB 1U6AH 4NUGH 4ZPTA 2A9ML 1FFRA 4HKBA 5CGTA 4PJFB 3ZTJH 3V0WL 3VRIA 1CE1H 4LPVA 4QF1A 4QHLB 2AXGA 1BEYL 1W8NA 1EO8H 5GJTL 3MR9A 3TBVB 4YHYC 5E00B 3ZL4H 1P5VA 1D5IH 2BY1A 3L5HA 3QEQE 2QQLH 3EFFA 5DJDA 3B6SB 4HJGA 1QQDA 3MV9B 4CU8A 4G80B 4YUEH 4O02L 4X6FA 1R3IL 3MV9E 1BD2D 3EFDH 3WNMA 4JFZH 3VDCA 1XGPA 2PTTA 4IRSB 2GFBA 1AHWC 1IQDB 5IB2B 2KBGA 3QPXH 3ARPA 2E7LC 5EO0A 4Z18A 3QDMB 3VH8G 4EDXB 1NGZB 3IKKA 5TDNB 1Y6NR 2LTQC 1N3NA 1A14L 3KPNB 1GXEA 5CEXB 4NKIH 3ULUD 3EYVB 3U6RB 3RVVC 2DBLH 4LCWA 4P46B 4CRPA 5HHMA 4M6MH 4KK5D 1YEIH 2AJVH 5DMJB 3JWDL 1YY9D 2K1MA 4LLMA 1T2QH 1JL8A 1FVEA 1CICA 1IGCH 3V4VL 2EDTA 1LK2B 4Y88A 3PGCA 1A5FL 4UUJB 2CUIA 3BYYA 4X7FC 4GAFB 5BXFA 3RNQA 2H9GA 5FHBL 3GSNH 2VLJA 4YHPA 1NL0L 4NQXB 1HDMA 5INCA 3OL2A 4MA8H 4UTBL 3JWNC 3NCMA 2IH3A 3IDGA 2XTLA 5SWQB 2R8SL 2PKDA 4KH2A 4NCC1 4HF5H 3LEXA 1ZHKA 4J3TA 5DD0H 3ZSSA 1A1NA 2FJGA 3MXVL 2F53D 4K71C 4O2EA 2G60L 3MTRA 3GJFH 3PQYA 3WS6C 1SM3H 1TNNA 1FGVH 4NJAH 4YZFF 4NO3A 5IR1B 4OLZH 1H9VA 3OXRA 4X6CB 1B0GA 1DANU 3G5XA 3OB8A 4NJ9H 3M1BA 3UJTL 4HH9A 3EJZC 2XZCL 4KK6C 4M5YL 1W72A 3VWKD 1L9NA 4JM2D 4V3EB 4MXWL 4J2XA 2E9BA 3D39B 3PXHA 2AQ3A 3PL6C 3VFVA 3CXHJ 3SGJC 1F2QA 4TPRH 3VWJD 4U6YB 3VU2A 1U8KB 1U93A 3OGOE 4YBLB 5I1HH 5IJKC 2BNQD 2ERJC 2H26A 4G8GD 5HHOE 4OZIF 4FXGA 1RUKL 4YC2C 4O00A 3WFHA 1VEPA 3P0YH 5I8CA 1RFDL 3L3HB 2R2HB 4BFBD 2J6EH 2YBRA 1UVQA 4KKCD 5KSBA 1G0DA 1ZV5A 1N0LA 2IPTH 5IW3A 4HCRH 5CJXA 5JLZA 1ZVSB 4FXKB 5J12C 3HPJB 1HXYA 5I1DB 1ZHBB 3QWOB 4J3VA 2J8UB 1YEHH 1S7RA 1YNLL 3VXMB 3FO1B 3NIGE 1MSPA 3U0WL 4Z7WE 4D0DA 1T21A 4XRCB 1YEKH 4XNZC 5CWSB 2I25N 3EOYG 3WFCH 4XNQB 4Z8FH 4AJ0A 1YQ2A 2BMKA 5GRVK 2G9HB 4HUVA 1S8DA 4PG2C 1UA6L 1UCBL 4AT6B 5F7EH 4PGCB 4FMKA 4Y8DC 1KCSL 3FOMB 4F58L 3VXTA 1TETL 2R2EB 1L9MA 2VZTA 5FKAA 2IJ0C 1CTOA 4U7KA 3C5ZA 1A1NB 2FJGB 2RR3A 5HHQA 3G6JA 3OKKB 3TA3D 3VXNB 2VITB 4HWZB 3SE9H 3C5JA 3CSBA 1F4AA 4C83B 4Y4FD 2XKNA 3WFEL 1H3PH 3CIQA 4PRPA 4JPVH 2F54D 3SKOA 3V2AR 1XCQB 3VRLF 3O6KL 4ESKA 4ZS7H 1ZS8A 5KS9B 1K9TA 2I9TA 3L3JA 2AJYL 3HR5B 4NO0B 3BIKA 3P9MB 3GSQB 4OCYL 5CJQL 3WNNA 3QDGA 1MCPL 2R4SL 5I30H 2X4PB 4QLRA 3X14B 4XB7A 4Y5VB 3I3DA 4NHUE 4MQ7B 3SE8H 1WC7B 5E03A 2HLFC 3U36B 5K9OB 5C0AB 5E2TL 5KVEL 2FGWH 3KPSD 4NOFA 3DMMB 2F8XC 3MV01 1IVLA 2FECL 1DQJA 1B0WA 4OIIL 3HZVB 3UTPD 4JN2A 2APWA 4BZ2L 4P49A 1R3JB 4RRPA 3GRWL 5EC2B 3BESR 4ODHH 5MI0B 2XPGA 4FFZL 5JXEA 4G43A 3LV3A 4H1LA 3PIQA 1YPZE 1OP5K 5EO0B 4IIQB 3MLPA 4LBEA 1ZVSA 4FXKA 3H42L 1KBGH 4K7FB 4PJDE 1CLZH 4HULB 3FB8B 2EH8L 2NY7L 1J0KA 2Q20A 3S97C 4Y16D 3ZKMD 3PHOB 1P53A 1QQDB 4U33A 4PLJC 4Y19D 3DX8B 3Q6GH 2X4TA 5F70A 4R7NB 1PYWB 3SJVA 4YDKL 1CICB 1SJXA 2XICA 5AYUL 2V7HA 4I3SL 2UWEA 4LVOB 5MEPA 3FT4B 3MBXH 3U2SA 3EIFA 4HUMB 5LBSL 1HIMH 1WVZA 4LLWA 4MX7A 3C9NA 2YUXA 5E8NB 3VD3A 2DKMA 3BQUC 5A2JH 2HTLC 5IW1A 2AJXH 2EDYA 3OR7B 4X7CC 3TBYB 1W2KT 4WWKD 3V0WH 5A2KH 4EDXA 3TVMB 5DDHA 1KIRB 1OB1B 1HWHB 1JGLH 3RGVC 1HE7A 1FIEA 2BY0A 1FFPA 5KSAC 3GO1L 3CFJB 4PRDB 2VL4A 2YXMA 4XP4L 3V6ZB 2DWEB 1EPFA 1L7TH 1S9XA 3NIDF 3OB0H 5E2UL 1I1YA 4MS8A 3O3UN 1AR1D 1R5VB 4ZTPH 4OGZA 2AJXL 1HQRB 3CX5K 4C59B 3WJJC 4D94A 4PJXB 2YK1H 2AJUL 1G9EA 3EYQC 4M6NH 1NC4A 4QNPF 4ODUA 4ZFOA 4I3RL 3B2VH 3FCTB 1ZLVH 5J13B 4JE4B 2V17H 5ACZB 3HG1A 5K9JL 2J4WH 2PXYA 1HDMB 2E7HA 2ORBL 1C5CH 5INCB 5I30L 5DUBB 4PV9B 3LN4A 1NSNH 1BM3H 5LGJB 5ILTH 1MJJA 3CDFA 1ZLSH 4HBCL 2CIKB 3VXRE 4WFFD 4Z7VF 2NPLX 4X4ME 1CFTA 5C92A 1BFTA 1NGWA 5CUSL 2VTFA 5CJ8A 3JV6B 4NWTH 3WIHH 1DUZA 4PV8B 2P1YA 4GH7B 3MUZ1 1N7MH 5BMFH 1LD9A 4YR6A 1IAOB 4XPBH 5DJAB 3U4AA 4UNTA 5D6CA 4V1DB 4D0CB 3P4MB 3CU7A 3BZEA 1X5IA 1AGDA 1VSCA 3A67L 3INUL 1DBBH 1N6UA 4WNQB 2OXHA 4PR5A 5E5MA 1G7LB 4XPAL 1JPFB 3UP1A 3VH8A 1LE5B 1F02I 4QRRD 4MCZB 1U8HA 3MRQA 4NYLA 1SJHA 4M43L 2DQHH 4G5ZH 2AJ3A 5EZOH 4X9IA 3VGAC 3GSVA 2HT2C 5HGHB 1GGIL 3BT2L 3VWKB 2H8PA 1C08A 1KB9K 4HCRL 5ELIA 3KPLB 3L6FA 5E99H 2VDMH 3E8UH 4LFHD 2K3TA 4PJ7F 4POZC 4TNWF 4J1UA 2P8MB 3U0WH 3UC0H 1D7FA 1OAQH 3MV7D 1NCDH 3TH2T 4X7TA 2BC4B 2X42A 2FH6A 2BNQB 4QWWD 4JFXB 3VMOA 1QA9B 4YGVB 3RA7H 1VEOA 2DN7A 4B0MM 2J8UE 2YA2A 2W0FA 1AC0A 4PJ5E 3CJJA 4OF5A 1LVEA 1WEJH 4FS0A 2J7LA 5EIVA 3KS0H 3CCHA 4LLVA 1MHEB 4M1DH 5DQ9A 4EDWH 1F45A 1A6UL 3I3EA 1BHGA 4EN3C 4OQTA 4GRWE 5D2NE 3QZWB 5I71C 2BRQA 1MI5D 3VFWB 4RMVA 4JQIL 5E08L 5GGVY 3C09B 1JZ3A 3GUTB 1N8ZB 2EKSB 4NCDA 4JFDE 2XA8L 3JV6A 4M7LL 3NH7L 3SO3C 5IVOA 1QFUL 1Q72L 2G60H 1LEKA 3H0TB 1QVOB 5C08E 5E6YA 5HI4D 5DJXB 5T3XE 3PWVA 3CFBA 1KN2L 1UH2A 4LBEB 5ICYB 1T03L 5H2BA 5DD5H 3BPCB 4HXBH 5B22A 4ZFZB 1JFQH 1Q1JL 1BAFH 4PR5B 5HDBF 1QO3A 4PJBF 3PGFL 4MQ7A 1CT8A 3SN6N 3LKOA 4IRZL 5KSAB 4XTRD 4KY1H 2E7LA 3MMEB 2BHYA 5FEBA 2C4XA 4Z7VA 1DR9A 4P4KC 8FABA 4TSBL 2P44B 1JYWA 2ZUQC 1EHLH 1WBZA 3NFSL 4KK9C 1AY1L 4OCSL 2P7TB 4MNQA 3WLWD 4HFUH 3QO1A 5JUEL 4RMTA 5FGCE 2XN9D 4EJ1C 3B83A 3HRPA 4Q9QL 5F96L 2EDJA 5IBUG 2PCPB 1G7QB 1ZVHA 3MOAH 3V6OC 4WEUD 1YNKH 1EK3A 4OQTH 4X7TB 4U3CA 2Z35A 1ZGLA 5K9JH 5KSBB 5LGHH 3DO7B 3O4OB 4KJWC 3HAEA 5IP4A 5J11C 5LCVH 3HNSL 1QOKA 4GAYA 5TE6L 5GZOC 2NW2A 4OT1L 1JV5B 1TMCA 1RU9L 1NH6A 2FBJH 4OAWA 4Q58C 5EO9B 1V3MA 3VGBA 5DLML 3KPQB 3CK0H 2A74B 4MA8L 3S3PA 1ZSDB 4K3HA 4N0YH 1PAMA 3MACL 2C3VA 4JFFD 5E24E 3O6FD 2NX5D 3GBML 2NXYC 4ODHL 3CH1A 3LEVH 1A64A 4JRYD 3VXSE 1IEBA 3TYFA 2P24B 4OCNC 1BQUA 4ZUSB 4M1GH 2VWEE 3WJLC 3EHBD 3WDIA 4LCWD 4TULL 3GB7A 4JO1H 1AFVL 3OR7A 1P6AB 1XGRA 2HYMA 4PJAB 5GGTA 5I1DA 5IMMA 4JB9H 2E5EA 1T22B 5E8PA 3RTQB 7CGTA 4R7DB 4XP6L 5DRNA 3LDBB 4Z7WF 4HKJB 4JFEE 3GMQB 3KPMB 4FFWC 4BK5A 2VLJD 2GT9B 1BIHA 1J1OL 4PV8A 4P5KA 1FP5A 4XHJC 3T0WA 5ESVA 4GRLD 1YECH 5FHAH 3AFLA 4FP8L 4JFZL 5MENB 4Z0BL 4E0RA 2NY0D 5HPMB 5I74B 3ZTNL 1Y6KR 2M8XA 1JIBA 2Z4QB 5CSBA 2LU4A 2FD6L 4P5TB 4XBEH 2FL5A 5FKAB 1FZKB 2FWOB 3HR5A 3MFFA 3DGGA 4YE4L 4OLUH 1SY6A 3NVQA 3ZYJA 3MLWL 1CN4A 3OKKA 3QNZB 3S36L 4OZHA 5T3XH 1KT2A 3L5JA 2XNAA 2Z31A 1EBAA 3VFSA 4YDIH 5GZNC 4S1RL 1MLBB 1U8NA 4LRNH 1MCLA 1XCTA 3GI9H 3HCVA 3L3GA 4KUZL 2HFGH 1JGUL 5F6IC 3HI5L 4XZUB 3QHZH 4U7MA 4WUUB 3S37X 1HKFA 1UWXH 3MGAA 4XNYH 1T03H 3A0OA 3MOBH 1QHPA 3IDMA 3GMNB 1KJVB 2D31A 2Z31D 3BKCL 3IGAB 3KYMB 4DKDC 5GS0L 1JNLH 1FL5B 5EOCH 4P4RA 5D70L 5HHME 1G7IB 4OCWL 4UNVA 4ZAKB 1G6RA 1MPAL 5SV4A 4I77L 2X1OA 1PG7H 4F57L 3T0ED 4DVBB 3DURA 4NFDA 5DJDB 1I9JH 1FG2B 2FX9L 2ESVA 2V9RA 4LAQH 3DHJA 5I8KH 4LQ1A 5EBLB 2VH5L 2WWMD 4POUB 5I1HL 1C16A 4YK4B 3ZYIA 1N0XH 2ZJSL 4EUPH 4J6RH 3EYFA 1QRND 1UC6A 3CZJA 5J89A 5I9QB 4GS7B 2CDEA 4X4XA 5F7EL 2PYED 4ONGH 2P8LB 2B4CC 1Z2KA 4KRPB 1PGRB 3WLBA 2VDKL 1FHGA 3KHQA 1BVKA 1FLTX 4X83A 4PD4J 3QUMA 5E8OB 1PEWA 4GUPB 1FORL 4QOKE 2GJ6D 3NCCB 3HZYA 4PRNB 3TYFB 3BPOC 1OARL 1I1AA 1I8LC 3NMEA 2FJFB 2JJWA 4KDTC 3HMXL 1DL7L 2AERT 1IL1B 4L3EA 4ZFGH 3IDGB 4WI8A 3OKEA 3S3SA 3E3QE 4IEFB 3TV3H 2CR3A 1MEXL 2N7BA 4JJ5B 4O4YH 5EBMB 4ZQKA 3BOVA 4JLRA 3GMQA 3KPMA 1S7WB 3ROLB 3EYSL 4AL8H 1UWEL 4Z7UB 4UUJA 1Z3GL 2I5YL 4WO4B 4K07A 3RZCA 5C9KA 2H3NA 4A2LA 3KYKH 3VE0B 1QFWL 3SDCA 1ORSB 2NY0C 1CFSA 3NPSC 1FH5H 4BKLB 3MRPB 5JZ7C 4DEPB 4R96B 1BVZA 3JZ7A 3LB6C 1WICA 1CDGA 5E9DB 4IJ3C 3T0DA 3FQNB 1ZLSL 3K2UL 2C3VB 3IJSA 2UWEF 3DUHA 3ZKMC 3IDUA 3W9EA 4AENA 3AVEA 3IXTA 3S5LB 5ID0A 1D9KC 1QG3A 1RVFH 4TTDC 2A6DA 5DD0L 3VD5A 3OGCB 1ORQA 1V3LA 5E95B 1QBMH 3D85B 4JFPB 2IQAB 1QP1A 1ETZB 2ZKHH 1T7ZA 3CFEB 3ARDA 3VFRA 1OF2B 3TIDB 5I8OH 4RMRA 4N8PA 4U0QB 1AQKH 5HHMD 2RIKA 4NHCH 1K8IA 4LVNB 3MLYH 1A6TA 1I85C 4LLQA 4QHLA 4HUUB 4MWFA 5FAAA 1A6AA 1NBZB 2OR7A 4Z7QE 4NM4H 3O6LH 1IGTA 5DF0A 5IESL 5ALBH 3T04D 2VO5A 1HHHA 2AGJH 4XPGH 3W0WE 4UTAL 2EDLA 5MENA 4JKLA 4RGNB 2OTUB 3N1MC 4X0KA 4XCCH 5EULV 5IB3A 1KLGB 4JM2A 1WBZB 5ENWB 2MOVA 2IPKA 2IWGA 1EA9C 2F19L 3U9PH 4HPYL 3ILQD 2VLKA 3QUXA 3KLAA 3D3VD 1ZHBA 2WWMC 2A9NH 5IB2A 4JREB 6CGTA 5FYKH 3HB3D 1MAMH 1A9BB 3FB5B 4XP5L 3DUUA 3T4YB 1A4KA 2ICCA 4GKSB 3WDHA 3MV8B 4YUEL 1T4KB 4L9DA 4Y4KB 2F8OA 4D3CL 2NXZD 4J3XA 2FLBT 4HFUL 4RAHA 3PHQA 4PGZA 1FZKA 2FWOA 1JV5A 3VDAA 4LHUG 3MRMB 3G6JF 2H9GB 5DK0B 4PJIB 5AD0A 3F65A 3JTCA 5IKCA 2G5BA 1U8JB 1N8ZA 3P4OB 3UBXG 4HV8A 3F7YA 3HMXH 4PGEA 2NY2C 5HGGS 2EDEA 3ILPA 2VLJB 3BGFB 1WTLA 1XGUA 1GC1C 2HG5B 3FTGA 5TF1H 4PJCF 4C55A 3S4SB 5F1NA 4BUHA 3IDIA 2Y6SC 3LQMA 1RZJH 4DZ8A 4YDVB 3VXUD 4X6CA 3KJ6H 5DTFA 3S9DB 3QJHB 1HXMA 3Q1SH 4OGXL 2V2WB 5JW4Q 2RHEA 3U4EA 4ETQB 4ZUWB 1TVHB 5IEHA 1I7TB 1MJ8L 2DQUL 4R4FL 5DGRA 4AM0B 2DRUA 2ZG2A 2Q76B 3D3VB 2GFBB 1MCNA 4Y4HD 2GYSA 3BJLA 1FYTE 4IIQC 1MQKH 3G08B 3OAZH 1JPGA 3LS5H 3QHTC 2DICA 4OZFH 3SKNA 3LKNB 3BP5A 4G8IB 3CVHH 1QSEA 1I3RA 1RUML 3OKMB 1GJIA 4ZFGL 4K94L 5DHVA 3K80A 5F1OB 3U0TB 3VWJA 1NUDA 4CMHB 1YJDH 2XN9B 4P46A 5GS2D 1JRHH 3CD4A 5DK2A 1FAIH 2EXWC 2FX9H 4QCIA 1XIWD 4R0LA 4L9LA 3RWFB 1KIRA 1OB1A 1QNZH 2VL5A 1RZJL 4EN3A 4RRPG 1K8DB 2XXMB 2VDML 5B8CA 1RIHH 1BLNA 1JPSL 1YEFH 4EIGB 5GSVB 5D1ZB 5F89A 4RFEA 3RGVB 5T33H 5IFJB 4FQIH 1O5DT 2JJSC 4G80A 4P4KD 3UDWA 3DROB 4DCQA 1LO0L 3S36X 1FJ1B 3TPUB 3RUGB 3BZ4A 5D6DA 1A7NL 3CMGA 3H3KA 2DI7A 3VXRD 3WJJA 4JGJA 2WBJB 3LQAL 1VACA 3DHMA 4R3SA 3THML 2QV2A 1BZQK 1TZHA 5IBTH 1YEDA 2EIBA 1DBML 3WN5C 1QLFA 4X80L 3MX0A 2XWJB 4U1SB 4AEHL 3U7YL 5KSVA 4I48B 5DXWA 3IJHA 3RJDA 2IAMC 4HHAB 4PJCB 4YBQD 5J4MA 5JA9A 3DSFL 1JK8A 1U8MA 5D1QC 1I8MB 4KJWD 4D9RD 2BOBB 3LRHA 5IQ9B 2VAJA 1F3DJ 5HYJE 4PUBL 2QSVA 4XAKE 4G6KL 2KQNA 5SWSD 5IEHB 3FHQA 1JNLL 3RVTC 4D0CA 2W9EL 4F37K 5KS9F 4L3EE 1ZT4B 4OKVA 1JGVL 1KCGC 3IETB 4NZRH 3GM8A 4OV5A 1JI2A 1J0HA 2BXYA 2EEDA 1AO7B 5GGSY 5FUOL 1LDPL 5BOPA 3K3QA 4ELMB 5C0AA 3BHBA 4FQLL 4UU9B 2DQEH 3RIFF 3SDAD 3GI9L 3K8LA 4JB9L 4PJ9D 2VDOL 4WU7B 5EU4B 4C57C 4Z7VE 5C08D 3VWJB 5D9SB 1EX0A 2HWZL 1EHAA 4TRPL 4M5ZL 3CK0L 1ZS8B 1ETZA 1AGEA 4AIZB 4YBQC 1DBJH 1DN0B 1E27B 2L4OA 3LEVL 1BREA 2BOCA 2I60L 1C12B 3DUUB 2DBLL 2R0KL 3GSNB 3T4YA 5CGMA 1FO0L 4ZNCD 1BVKB 1J86A 1GGCH 4OZGA 3JTSB 1HIML 4NKMA 4AM0A 3S6CA 1HYSD 3HHRB 5JQHC 3V5DB 1EV2E 4EXKA 5D4QA 3U9PL 5JZ7D 4U1GB 1DBKL 3TP4A 2R1WB 4Y5XA 2RAMA 4YXHL 1P1ZA 4L4VA 3HZVA 1P5UA 3UJIL 1GCFA 2LV4A 1YY9C 5I1LA 2VXSH 1OQOA 4GKNA 4MNGB 5AZEL 2PO6D 3DXAB 1S3KL 4AEEA 4Y0GA 5KS9E 1S5HB 3H9SB 5DUPL 1QRNE 3PV7A 4LLWB 4UT6L 1YUHA 3RY6C 2HP4A 2VSCA 3BRDA 2CMRH 5LGKA 5HYFA 2JJTC 2J8UA 3VMPA 3OHXB 1M4KA 1G6RH 1NMCB 4WDIA 1SYVA 1UH3A 2APTA 4ZUUA 4HIJB 2X4SB 1F2XK 1OAXH 1NANH 4KQ3H 3WXVL 4G6KH 4ZFOB 5CKAA 3FB8A 1BMGA 5HGBA 2DMKA 4APQC 1KJ2B 4RISL 5DJYB 2BSRB 1FV1A 1JGVH 1RZIB 1OAYL 4KRMB 4H26B 4OFIA 3WL9B 4BFIB 1KELL 1TNMA 4TUJA 2EH7L 2D7TH 2NX5A 3BE1L 1QFUH 1A6UH 5INDB 4UV4L 1MFDL 5EBWA 1LNUA 3HNVH 3KLAB 3QDJA 1Y18B 3MRNB 5MHSD 2OLDA 5DI8A 4LIQH 3IFPA 4P3CL 4TSCL 3QDJE 5L8LB 1MHCA 4L4JA 5AZ2L 3TV3L 3ZHLA 1MCQA 1S7SB 1JJUA 2C4FT 3S3JA 4RGMC 4UAOB 4PRPD 4MA7H 1D5MA 1XR8A 3OKLA 4OLVH 2VC2L 5IGXL 4AL8L 4OD2B 1PY4A 3BP4A 2V7HB 1CI5A 1C7TA 2N56A 4KROD 4X7EC 4BSVA 3OV6A 3T1WA 1GIGL 3EO1B 2QQKH 1NGXA 3M8OH 1F6AA 1MRCH 4U1JA 3RX5A 5BQ7A 4KDVA 3SO5A 1CXHA 3S5LA 5ID0B 1QRKA 1KNOB 1WLHA 5JHLH 3D39E 3D85A 2VABB 5GGTH 4N9GB 3IDNB 1Q9LA 2FATL 4L4TD 5GS0H 1A6WL 1JHLL 2ZUVA 2L7JA 4JM2F 1EUUA 4U2YA 2MPAL 1QSFE 4ONGL 5KN5B 1JNHB 2HFGL 3UROR 1ZSDA 4MNQD 5DRNB 5FYKU 3WKML 5JOPE 4NNPH 2NTFA 3WIFA 2OMNA 5IJVB 4MNHB 1CE6A 4Z5RA 2FRGP 2ITDB 2OXGA 3ARGD 4XX1E 5F7NC 3HLAA 1NFIA 3BDYH 4G6FD 3LKRA 2BSRA 3HFML 4RIRB 4NRXA 5CUSH 5DC0A 5C07E 1OGTB 3FB7A 1KTLB 5DVNA 5D7JD 2GTZB 4NJ9L 4GAGL 4Y7MA 4TOYL 1F4WL 2R39A 5GRYA 5CCKH 1NSNL 2FECI 2BHZA 2K7PA 4FHBD 3RGHA 1NC2B 1T7YA 1UCTA 1U3HB 2GY7B 4YEEA 3RZCD 3T0EE 4MDJA 1OT1A 2C5DC 3MRDB 4NFCA 4M7LT 1GPOL 1SEBB 3DYOA 4PTTB 1SYVB 1DDHB 1X5FA 4RA3A 1VPOH 5BO1H 2XV6B 5BS0E 2XOTA 3WSQL 1JGUH 2FEEL 3UTSB 1N59B 4OZFG 5DZLA 4RAUA 3GSRB 1E4KA 3QIBD 3CDYA 3GNMH 5DRXA 5FK9B 3ULUL 4XBGB 5BCAA 1N2RB 1HHJA 3ULSB 1XEDA 2EICA 4DGIH 2A9NL 2DWDA 1F11A 3TN0A 4F7CB 3IAPA 4YFLI 2UY7A 3IJYA 4V2BA 5E9DD 3O6FC 1VFUA 3ALWA 3CSGA 4LGRB 5E4EB 1J1OH 3WXWL 5LWYH 3OAUH 3O4LB 3BXNA 3MLRL 5JR1L 3TJEL 1MCKA 2H1PL 3GKWH 5FB8B 4M8QB 3QWRA 2YEZA 1BZ7A 1ZT7A 2Y4SA 2AEIT 4OCSH 4AMKL 4QRTA 1MLCA 1GHFL 4PGJA 5IFJA 1L0XA 4LAJH 3VCLB 2Y7QA 4TULH 3VFGL 4HMCA 1AQKL 3FT3B 3TPKA 1E0OB 4XMLH 4M1GL 1SEQH 4L4VB 1NGYA 2FBJL 3EDEA 1QBML 1N3NB 1D5BB 1EFXB 1RI8A 4JRXA 1BGXH 4GKNB 3GB7B 5D96B 1WZMA 1BJMA 3F7QA 4HLZH 4NZRL 4WWKC 3WKNA 5KTEH 4YHIA 4Z76A 4F2MA 3F62A 1RU9H 3KPNA 5HDLA 2IMMA 4YQXL 4M1CD 1ZANL 1YN6A 1LILA 3IJHB 4FQLH 1KYOK 3T3PF 3UX9B 1QVOA 2B8OT 5SWZA 4IOSD 4JGUA 5SV3A 2AXHA 4JFXA 2AXFA 4L8SA 4H0GA 4YDKH 5IB4A 3GMOA 3KPOA 4HEME 3PWVB 4RBPK 4P2YA 4YHPB 4PJHB 4ZFOL 3MCG1 2Q6WA 4PB0L 3ZE2F 2LTQB 3DO7A 5J1AA 3BZEB 4PRBB 1CLCA 5FO8B 4NHUB 3JUZA 4RMWA 2IH1B 4LU5L 2RB8A 5SWZD 1JPFA 1VFMA 4X6DB 5CCKL 4YXKH 1Q8MA 3OJVC 1CFQA 2CJUH 5CSZB 4OIAA 4H0HB 1K4CB 3WNLA 3JBG7 2DYPB 5C0JB 2VMFA 4G42A 4LPXA 4Y4HA 4NN6C 3SCMB 1LO4L 1BVLA 1GRWA 5FF6A 5BJTA 4FN0A 2HFFA 1HILA 2BVQB 1QFWM 4Y5YB 1OP3H 5JDJA 1CXEA 1AGDB 3PHSA 4JPKL 3HMWH 2HVKA 4CMMA 1RIVL 2QHRL 2MQ0A 4CDHA 5KVGH 1QSFA 3VWKC 2YPKB 5C9JB 2Z91B 5KOVC 4DAGH 1X5LA 5IEKB 1KJMB 5LXGL 2BNQA 1NGQL 2XTJD 4JFDA 1HKLL 4P5KB 1MFCL 4DGVL 3SKUD 3GI8L 5ESAB 4KC3B 1Q9KB 1WBXA 3QEGH 1JWMA 1CGSH 2XN9E 4XWGH 4OIBA 1NDGA 1R5IA 1A1MB 4QXWA 2Q3AA 1P4LB 2XG5A 4OI9A 3RPKA 2FBOJ 2YRLA 5E6ID 4Y19E 5IMMB 4GQ9H 3QH3A 1KIUA 4U6TA 1FO0A 2EYRA 4JG1H 4S1SL 2B0SH 4GBXB 5ENWA 3MV7B 2HFTA 1RZGA 3D3VE 1QA9A 4PRAB 2NY4C 5HGDA 5EUOE 1J05B 4G9FB 3HRZA 4I9WD 5CINL 1LHZA 1Q38A 1JTPA 1PKOA 2MSPA 4DQOL 4NWTL 3WUWG 1NEZG 4N90D 4QT5B 1RZKH 3QEUB 2BCKA 3MYZA 3PV6B 3UTQA 3QUXD 4LSUL 4P2QD 4BZ1H 3O2WL 4QXTB 3MRCA 4NQCE 4O58H 1T1ZB 5HHOB 1G7JA 5IFHL 2I9TB 4JFFA 2VAAB 4HFWA 4X99B 1X5KA 2IAMA 5I66A 3O8XA 3QIWA 4PJHF 3MLZL 3D18B 2X4NA 3NABH 1F8TH 4NQCD 1ZVYA 5D70H 3P11L 4YDJB 4CDGC 3VA6A 1MNUH 3I6KB 1FNAA 4PG2A 4CNIA 4C83A 1P4IL 3H0TA 2VLRE 5I8EB 2QQKL 1CK0H 1MVUA 1JF5A 1MH5A 1TDQA 4YHIB 1HHJB 2A0LC 4HZAA 3MV8A 4NZUH 4P0DA 5JIIA 5T3XL 1UM6L 4TUKH 4PJIE 4QNPE 3FN0H 3TC9A 5H35A 1BBJB 3GMPB 1DLFL 1TXKA 1BIIA 4FQXA 5C7XH 2DTSA 1FNLA 3GO1H 4F7PB 2GSGA 4XMLL 2ZUQB 1N5YL 1CLYL 1KSRA 2AJVL 3BH8B 4NBZB 2A73A 1P84K 35C8L 5HYJD 4CL7A 4BK4A 2ATKA 2X4PA 3X14A 1YECL 3KPPA 1T0PB 3OB0K 4CW1B 3REVA 5FB8A 3MRJB 3RL2B 4HMEA 3QUZB 4PJ7B 3OMZA 5IVXA 1WC7A 2R56H 1IGFH 4JDTH 4XNUH 2VJXA 3RY6A 2XZQH 1HH9B 5DQDL 5T1MA 4YPJA 3MNWA 3BPLB 4ZQKB 5HI3D 1YEEH 5FYLE 1K4DB 3L95A 3VXPB 2HJFA 3PWJB 1RZKC 4IIQA 4XCNB 1KEML 4FFVC 4GKSA 1EH9A 4U0RB 2VZUA 4N8VB 3GNML 2YPKA 2LVEA 3C8HA 3S88H 4XNQA 1IEAA 3SCMC 3HZYB 2Y5TA 5F7DB 3E6HA 2NYYD 1GOFA 1M6OA 3NCEB 4LCIH 4S11A 4YHNA 4MZ2A 4XNXH 5A3IC 3HUJF 5IJVA 1SHMA 3ARTA 5D1ZA 5F89B 1QRNB 3FQTA 1UVQB 3QQ4A 4LHUA 3PWLA 2PETA 4XVJH 1JUFA 3WFZA 1CLZL 5IHUL 2I26N 3X11A 2XZQL 2VDQH 3QUKA 4YIQA 5E9DE 2QSCL 2R0KH 2WQRA 4WHYG 4LVOC 4LLQB 4KQ4L 1KTKE 2V2TA 3NFNB 4KHXL 4CU7A 5F3HA 5ABDE 4GLRH 4K7FA 2PR4H 2ZUUA 3SE9L 3KPOB 3DSFH 2VZSA 1C1EH 1VKXA 5T5FH 4R26H 3PHOA 1CG9A 2NTSP 4FFZH 4G6AC 5KVEH 1PQZA 3MLVH 1NC4B 3Q6FB 3DV4A 3FOMA 3VXTB 1RIUL 4CKVX 2VDRH 3RNKB 4PLOB 2DYPA 5EIIB 3UTSA 4UV7H 2LE9A 3G6JB 1I3GL 4NUJB 5I1AA 3QDGE 3J8F7 3SE3C 4JVPA 1DUYA 2QLVB 1AXTH 2EIZA 2QKIB 3KJ4B 3ZKND 3MZTA 3MRDA 3FQXB 1H3GA 3V6OE 4X5XA 3KNBA 1MI5A 2LU3A 2P47B 3OXSA 3DVIA 4XC1L 1FZMA 1V7NH 4F9PA 4HGWB 3MV11 4QOKA 4R4NC 5KS9A 4P4KB 4M7LH 5JLZB 2B2XL 4B41A 4WU5B 1F3JA 2AXFB 3WO3B 1U8LB 3CLEH 4KMQA 1MCBA 5EWIL 4K23L 1UKQA 4K8RD 3MLUL 2Q8AL 1KLUA 3NBNA 3C08H 2VDKH 5EOQL 2X9YA 4Q9RL 2AK4E 4G8GE 5D72L 5HHOD 3W2DH 4JANB 3QISA 4OCLC 1RUMH 5DC4B 4F3FA 1BP3B 1EVTC 3MO1B 1WCQA 3C5SB 4HIXH 5K9QG 2GTWB 4LSPH 1JNJA 4ZXBB 3PIQB 5HHQB 4FTVA 3EYQD 3NZ8A 12E8L 4Z7WA 5C0RH 4YFDB 3BZDA 4ZFFA 4PRPE 4XXCC 3QI9C 1NGQH 4M5YH 2YUZA 5IG7A 4K23H 2D7TL 3CFCL 1JWUA 1KV3A 1BZ9B 3RPIA 5F44A 1RZ8A 3BPOB 3RWGB 3VGAB 2DQHL 3VXMA 4FG6C 1JZ7A 3QCTL 4NKMB 5KVGL 4FQJL 4R7NA 1NJ9B 4AEIH 4M7ZC 5D2NC 2E9IA 5SWSA 4U6VH 1BX2A 5F9OH 3ORJA 1NBVL 3GSQA 1HHHB 1D5XA 4OLVL 4IOFC 2X4SA 3G6JE 4HC1H 4YZFE 4ZO8A 4KUZH 5I0ZA 1EXUB 3QPQD 3H2WA 3DSNA 5F6HJ 2BVOB 2KQMA 3HC0B 3RI5K 1IL1A 3T0VA 1N6VA 1UZ6F 2Q3ZA 2X7LB 3VRJA 3AREC 5BV7L 1I3GH 5D1QD 2GK0B 4I0PA 1REIA 3O6FA 2D4FA 3H8NA 4UT6H 5AEAA 1U8OB 3KPRD 3QDGD 4UDTB 1TPXC 1FYTB 2R1XA 1IILE 3OHXA 1S3KH 4K3GA 1CICC 4G6FB 1H3XA 2XQYK 4LVHC 1JZ4A 1JWSB 1IC7H 1G9NL 1I75A 1LNUB 2CO6B 3B5GA 4P4KA 4L4TA 1PX4A 2ATKB 5F9JA 3GMRA 1RHHB 2XT1B 4EZMA 2GJZB 3K81A 1HINL 1WAAF 4XAKD 2Y07H 3DIFB 3BPCA 3MRHA 2YK1L 1JPTH 1YY8B 3DUSA 1ZT4A 4NQEB 4OKVB 1URLA 4P99A 3PWPD 2NX5B 1T6VN 5FA3B 4N8CL 4PJAE 5E4EC 2CPCA 1HHIA 1F6AB 4OLWL 2VDRL 2P5EB 5T3ZH 1FZJA 3BP5B 4GKZB 4M5ZH 1CXLA 4GFTB 4MJ5B 4M7JL 3T2PA 4Y89A 1OTTC 3I2CL 4H20H 3MLYL 4N0UB 5FYJD 5C0IA 3TEUA 1N64H 3L3IA 5FYLH 1ZA6A 3FO2B 4NWUL 2F74B 3QWRD 4C56D 3VXPA 4WJ5B 1UFUA 1U42A 1NLDL 3E1F1 3QBTB 2APBA 2VQ1A 1I1AC 5FUCE 5GS1B 2BNRE 2WK2A 2W9DH 2AI0H 4E5XA 4RZCB 4RWYH 4YHOL 4Z7OF 5CD3B 1ITCA 4GXVH 4HUKB 1AI1H 4IRJA 3MJ9L 2EZ0C 3HZMB 3V4PH 5L6YH 5L88L 4WWKB 3LQAC 1XGYL 3TVMD 3BHBB 4J3OC 3O11B 4GAJL 5C2UB 3VGHA 2BCKB 4ZUSA 1MCWW 5FGCB 5C0CE 4P2RE 4GS7C 4D9QD 4KAQH 3WO4B 2PTTB 4IRSA 3N1FC 5L8KB 1R3IH 3DVNB 4KTEL 3GRWH 5GIRB 4DKEH 5MERA 1RZGB 1F13A 4E9LA 5EU3A 5I2IA 5KW9L 2JB6B 5D7SL 5DMIH 4LMQI 5F3HB 1K4DA 3RWEB 4ODXA 1R3KB 1B0RA 3MRLA 2B1HH 4MJID 1N26A 5DD1H 3GHEL 3D25B 4OI7A 2IG2L 2P5WE 3PXJA 4KY1L 4U1NB 4ZUUB 5DA0B 4P2QA 1MWAL 1DLFH 1QBAA 3T3PE 3GSXB 2OJZL 7FABH 3EZJB 1YEEL 3TN0C 3FRUA 1AO7A 5IHLB 5C08A 4CW1A 4R9HA 4L3ED 4NRZB 3BH9A 4JO3L 4O58L 3EZ8A 3U9UA 4Q97A 3S35H 1FDLH 3I50H 2MCG1 4PY8I 4JFFE 1SJEB 3E2HA 2IANE 3ZDXF 3V5DA 3FQXA 5C0AD 4ERSL 3MRJA 2AJYH 4IHOA 1NEZB 5DYOB 4WHDA 5C0JA 5JO5A 4MNQB 2GJ6A 4GRWB 1T04B 5D2NB 5E1AB 5FDWB 1CFTB 5H35B 1ND0A 5DTFB 4PP8C 4JPVL 3ROOB 3SOBL 2NY0B 4TTGA 2ZCKH 3OKMA 3QRGL 1WIUA 3PWJA 5C6PB 1UXWA 3CDGB 2X2YA 1T83C 4LSRL 4J6RL 1XF4B 4YGAB 1YMHA 3RA7L 2AEQL 5GGVL 3MV7E 4GRMA 1RMFL 2X4OB 1A7BA 1A0QH 3UDWC 2OX5A 3PP4L 4K7PL 4HJGB 5HHNA 3U46A 2X1XR 2D7PA 4LF3B 4Y19B 1LEGA 4PRHA 1BECA 3PJSA 3HE6B 4ZO9A 5IVXB 4NIKB 5DO2C 2YPLB 2Z4QA 5GGTL 5GRXG 4MXQD 3DJ9A 1IGJB 4XI5D 5E5UB 1WK0A 2VIRA 1L8JA 4S0SD 5HGHA 4QKXB 4JO4L 4ODWB 2P45B 3PWLB 4WI6A 5DMYA 4QHUA 3F7VB 4LFHG 4U1HA 4PBXA 1X5GA 1I4FB 1MREL 2VDPL 4IM8A 1UWGL 5FA4B 1CGVA 4Z0XB 1LP9F 1LE9A 4TTDD 4YWGH 3L5XH 5BV7B 1XIWB 5ANMA 2CSPA 3EOAA 1ACYL 1IFHH 4RGNC 4ZAKD 5F7KC 2ICWA 5A2IH 1OY3B 3UO1H 1E27A 4PJIF 4U05A 3B9KB 2XZAL 4EIZC 2B5IC 1WGOA 3ARBA 1R24B 4WFGE 5E00A 3CH1B 3FRUB 1HH6A 4NQVB 5C0ND 1OGAE 2DQTH 4WI3A 5DJ2B 4JREC 3RUGA 4M1CC 4UIKL 1KPVB 1EXUA 2WIMA 4GW4B 1HSAB 2WANA 5D5MB 4Q2ZA 3KVQA 4G8GB 1MJ8H 1KIPB 2OK0L 2ZG3A 4YXKL 1IAMA 5D7IE 1A21A 5B38B 4LARL 1DQLH 3Q1SL 2XI9A 5HSFA 4JR9H 1GGUA 1PD6A 4OFDA 5ALCH 3MUY1 3VFMB 2MHAB 2IPUK 5GRJL 1WAAE 2D7OA 4I9WE 2F19H 2D0GA 1MRFL 1DBAL 1L0YA 5MP6L 5H94A 4NQDA 1BM3L 3SCMA 2OR9L 5KZCD 5GSRA 4GRWF 4H88H 2DQJL 3LZFH 4WFHD 4LDEB 1WQVT 1AFVH 3TFKC 1JHTA 5E8DH 4U31A 4YDLB 4GSDH 4N5ED 4PJ8D 2ED9A 3BIKB 1FYHB 4XP4H 2NNAB 3O6LL 1GVIA 1OAXL 5IVZB 4GJTB 4QRRB 3GSRA 5F1IA 5D8JH 4GQPH 1CL7I 1XR9A 5F1SA 2JE8A 4JANA 3VCLA 1MVFA 1XAUA 2ZCHH 4Y4FA 5I73C 5IF0A 2BK8A 5F9WC 1YEJL 4BH8B 2WBWB 4OLUL 3SDYL 1MFAL 3FO2A 2EDWA 1ORQB 3LH2H 3SBWA 5KG9B 5BVJA 2WP3T 1KN4H 4J4PD 5F7FA 3GIVA 1F3JB 4ZPVA 5C0CB 4F2MB 3MREB 3ULVL 2ADIA 2VLKE 2VUOA 1IGIL 1UXWB 2AQ2A 5F97E 3NIFE 5GRZA 5JR1H 3RPIB 1NPUA 1X7QA 4PBWD 1CE6B 1A22B 4K9EH 4TSAH 4HUVB 2I9LB 2R9HC 4XPTH 3P0VH 1W0YT 2Y36L 4ZODA 1Z9SA 5FM5M 2E8YA 5AG8A 1YPZB 2F15A 2FEEI 2WW8A 3OJDB 4PJXF 2C1OB 3U1SH 2E6QA 4UBDC 5IMOB 1BD2B 2AJSH 2BY3A 2NY5C 3UAJD 2GK0A 4PRHE 3WSQH 1R3HB 4DN3L 1MJJB 5IW1B 1R3KA 3HC0A 3IYLW 1EEYB 3WIHA 3L3KA 1QKZL 1ZK9A 4JPIB 1T4KA 3O4LA 1F8TL 4QRQA 5EUKB 3F8UB 4OSUL 1T1WA 4Z76B 3TIDA 1EO7A 2C3WA 3T65A 5DK3A 1IC7L 2UZYB 3RIAF 5DJZB 4KRPD 2BDNL 4Q9QH 3DIFA 2P46B 4OF7A 3FQUB 4OLEA 3ARSA 5ACLA 4MNHA 2VERN 3VI4E 5IMKB 4NQEA 5C0CD 3QG7H 5FFLA 4HWEH 5JXEC 1HOCA 2DJSA 4PB9L 3FOLA 5JTWA 3SDCB 4I18B 3TJHC 1M71B 4LSPL 3KYKL 3AMLA 4LSQL 3DX9A 1BQLH 4HV8B 5EBWB 2Q87A 3B9KC 1ZWIB 2D3VA 3SDXB 4KRPC 4DJMA 4NGHH 2D7MA 3LVEA 4X4ZA 3ZTJG 2OQJA 1FNSL 4P3WA 3G5XB 1FCGA 3FN0L 4LSSH 1OAKH 1J0ZA 3Q0HA 1FNFA 4CN4A 3B4NA 5HY9A 5T1DH 2DQCL 4YHZH 3RWJB 3RL1A 4HC1A 3QIWD 5KVMC 3KG5A 2WUBL 2F5BL 1X7QB 1FRGL 1E4JA 4U6VL 3BP7A 2PF6A 1AE6H 1A9EB 4F8QA 3D0LA 1MQ8A 2OZ4L 1OF2A 3MJ9A 1I3UA 3IDJA 1YYLL 4XC1H 3MA9L 5FM8A 3W82A 4HJ0D 1TZGL 4M48L 3OSKA 2F54A 3RZWA 5F7YC 5I16B 2Z8SA 3KWWA 1RZFH 3FT2A 3T0EC 3ZLQC 2R29L 3BDYL 3BPNC 3HNTL 5E6ZA 3JWDC 1TFHA 2A83A 4XVSL 4UQ3B 4QHKJ 1UKSA 4L5FH 4LMQE 5AUMA 4YXLH 4MA7L 1M7DB 3CPLA 5EWIH 3GK8H 1N7ML 5GQBA 4HS6A 5F9WB 4NQDE 5ESQA 1OAUH 2HLFD 4PJEF 2WIIA 4F8TA 4LEXL 4XGZA 3QIUB 4BH7A 1DTUA 1EFXD 4M8QA 2OL3H 2ZCLL 4X8JA 3VXUA 2QR0A 4AYFA 3NFNA 3RHWK 2F53B 4I3GA 4X6EA 2CDFB 1Z0MA 3U7AA 4CMHC 1TVBA 1YYMH 4NO5B 5C07D 5GRWA 4CBPA 1ULVA 4PRNA 4MVBC 3QUYB 4LPCA 5I75C 3EO0B 4HF5L 2DLIA 4LEOA 3P9LB 4K3EH 4LKXA 5EIQA 4ZS6D 1X9QA 4Y16C 2X89D 2P7TA 2XZZA 2B39A 1NCAL 3DLQR 2BNUA 4S2SB 4G9FA 3HE6C 3U83A 2O61B 3MRNA 5CJOH 3CFDB 1XF2B 1F4HA 1SYSA 2VISB 3N0PB 2ZZUT 2OP4H 2R1YA 4JRXE 2ENSA 3DARA 2APFA 4LRNL 4NKOB 2DI8A 1VHPA 4YC2B 2UYLA 1QR4A 2W60B 1IAIH 3BQUB 3BIBX 1DANT 5IK3A 4JRWA 4OV5B 3KPRB 1ES0A 1F97A 4DK6A 2GSGB 1YEGL 4F7EB 3PQYE 4H25B 1DBKH 3QQ3B 5FO7A 3JWDH 5BV7C 2AK4D 2W38A 3MV9D 3O2VH 4K94C 5AWNH 3NIFF 1AR1C 2VXTH 1MH5B 4KMLB 4Y4KC 1KPUA 4JZOB 3HE7C 2LFGA 1UKTA 4N9OB 3ULVF 3I6LE 1TTGA 2F58H 4LHUB 4YHYB 4WY7L 1RV6X 3EOTL 5DWUH 3BZFA 4YIQB 5KJRH 3PWPB 5IT2L 2I24N 4WFED 2AXGB 4NHCL 2YN5A 5DA4A 2EH8H 2NY7H 3PV6A 3V0AC 1YUHB 4PJAF 4PJXE 2I07B 4LPYA 1BLNB 2I9LA 1UM6H 4TUKL 3GBMH 1BQHB 4URTB 2VR5A 3EUUA 4U6HB 4L4VE 1PKQE 4NZTH 5ICYA 5DFTA 1MAKA 1DFBL 4O2CB 5DLMH 2CLRB 5IBUB 2IQ9L 4HIIA 5I8EA 5DWUL 4KK6D 4U1HB 3BAEH 2FYYA 4OZHB 4LLYA 2VXUL 3MLZH 3KPLA 1LEKB 4R0LB 5HYJA 1TZHB 1MVUB 2DM7A 4ZPVB 3VI3F 4TYUA 3GSOB 2R23A 1KN4L 5F96H 4DW2L 3K2UH 4P57A 2EC8A 2B4CH 4U1GC 3MNWB 3KXFD 4I2XB 2JELH 1FQ9C 1AGEB 1LK2A 5HI4C 3QUKB 2EE9A 3LKQA 4ZS7L 2E7LE 2IFFL 5DJ2A 2EDBA 1B2WH 4W6XB 3ULUH 2V9QA 4RX4A 4XHJD 2A73B 1UXSA 3TNNA 3QNYB 3ARVA 1QSFB 8FABB 1XR8B 1JPST 2EZ0D 1HYSC 2EECA 3O9WB 5AAWA 1NAMB 1SJHB 2B1AH 2BVTA 4I5BA 1DL7H 1EEQA 5HDBE 1T83A 3BKYL 4NNXB 2VKXA 5E5MB 5JW3H 4OM1L 2IBBA 4F33A 1M6OB 1QSVA 3QNZA 2XWTA 1ODAA 3IETA 1LO0H 2PYFA 3UTSE 3MZGB 4KK9D 3IXAB 4JHAL 5H94B 2XIDA 3DX6B 1NCBL 1MNUL 2G75A 3DRTA 5BS0B 4KJPC 2BVPA 1S7UB 3T1FA 3QIBB 4GMTH 3K1KC 1I8MA 3NH7H 4EDWL 1JFMA 4S10A 2UZXB 4DQOH 5JQ6H 1G7QA 1FNEB 1EHNA 4WVRA 4ZTOH 2AV1A 5I1EL 1GIGH 3MROB 4YEFA 4WCYH 5C0FA 1Z9LA 2C1PA 3A6CL 1ERNA 1D5ZA 4KK8C 4GBXC 5JDSB 4JG1L 3GKZA 1FYTD 5BRZE 4FQCL 2Q86A 5C07B 5ERWB 4OLXH 4PJ5D 1LO4H 2CO7B 2V5MA 4XPFL 1FVCB 1AGBB 2Q8AH 2YD2A 5BZDB 2VN4A 5C70A 2VH5H 4DK3A 2V2XB 4GLRI 1RAMA 4NSKB 3W2DL 3E8UL 4X5LA 4Y2DD 4I4WA 1H5BA 5GGUB 3MLUH 5CEXA 2ZPKL 4GMSH 4DAGL 4MQXC 4WUUD 1H15A 3ULUC 4MJ6A 1V3JA 3BI9X 2HTKD 3LRSA 5HVWA 4I18C 3QRFM 1OP9A 3T0XA 4KI5C 2HT2D 2NXZC 4OSUH 5I76A 2XACC 1T1ZA 4MJ2A 1AE6L 5J06A 1L0QA 4HX1A 4I3RH 4YNYB 4NZDA 4X6FB 7FABL 5DZNA 3SY0A 3X3GH 1CZ8H 4G5ZL 4JFHE 4JG0H 2PUQT 4YK4C 1NFIB 4M4RA 5GIRA 4ZTPL 2FDBP 2FO1A 3H9SE 5JW3L 4EBQH 4P23B 5EN2A 5ICXA 4PB9H 4A6YA 4FQHA 1I85A 2UVEA 1RIUH 5FECB 2BXZA 3I9GH 3O8XD 4Y1AA 1YDPB 4BQCA 3OKOA 1EEZA 1BQHG 3L3OB 4FP8H 4KXZI 1GOHA 5FDWA 3FFDA 5ETUB 5D7SH 4JN2B 4K55A 4DTGL 2KH2B 1F3DH 1T5WB 5GS1A 4Z7NE 1NCNA 2GJZA 5EZIL 5L0QB 3BSZH 3DGCR 4X6CF 3UYRH 1JI1A 4MA1B 5D2LB 2FR4A 4XP5H 2NY1D 3QFJA 5DEFA 3VFPA 1U3HC 2VLRA 3ES6A 2AGJL 4RDQG 2ESVD 4RBPH 1JMXA 3EGSB 3PDGA 4UI2A 4W70A 3L1OL 2CDGA 4JN1L 2ZG1A 2ADJA 4ZYKA 3LV3B 1FZOA 4H1LB 3SEPA 2YD9A 4O02H 4MLSA 4RAVA 3BISA 3S35X 3VXOA 5I74C 3P0VL 1FZJB 3DX7A 5TE7L 3BP6A 4OLWH 3FONB 1LP9E 4XH2A 4JFPA 2R15A 1JGLL 3FB6A 1ZEAH 4L3EB 1WV7T 4EI6B 3MLRH 2NZ9C 2E6JA 3QIWC 2F58L 1A4KB 3D39A 2AXJA 4NKOA 1VPOL 2EDQA 3TH4T 1DDHA 3F58H 5KOMC 4IMLB 5CD3A 4N5EA 2FX7H 1OP3K 3CVHA 4FABL 3B8YA 5TE6H 3W5MA 3WFDH 1JGDB 1QSFD 1BWWA 3QIBC 3SDDD 1Y0LA 1YEGH 4KI5F 5F6IB 4IRJB 4P5MA 4YHOH 3O6FB 1J0YA 4LQFL 3LY6A 3NFSH 4X0KB 3MA7A 3CLFH 5J1AB 3O2VL 4HS3B 2X7LA 4PGBB 4ETYA 1AD9A 5SWQA 1AD0B 2R23B 2YSSB 5CD5D 5E6IC 3RAJH 3D2UB 3KPRE 2ZP0T 1EEYA 1CFNA 4MXVF 3GM0A 4UIKH 4I2XA 2NY1B 4P3DB 3VXNA 1S7WA 2Z8RA 3ROLA 3V4UL 5J13C 3NFPB 4A6YH 4M61A 1QYGH 2W0KA 1DQMH 3PG2A 4I0KA 4NQUA 4CADB 2RBLA 2VYRE 5EU7C 2OI9C 4X4YA 5F8QC 4TNVK 4LLMB 3I85A 1XF3B 3CXHK 2CIIB 2OS7A 1IFHL 1K3IA 2W60A 2HA1A 3BQUA 3U4EB 3T0EA 1Q72H 1ZT7B 1LDSA 2GCYA 4MCYB 3FZUC 4E5XB 2OR9H 1E6JL 1OLLA 1W0VA 4G6ML 1R3LB 1W8OA 1DVFC 2HVJB 4P4RB 4Q9CA 4R4ND 3U2SB 4ODVL 4NC2B 2EIZB 1IGTB 2BNUB 2ATPB 4JR9L 2FO4B 1MOEA 1PVHA 2IPTL 3MRRB 4L8CB 1GZPB 3JWOH 1ADQH 3RIFK 15C8H 4E41A 2OK0H 3I6LD 4N9GA 1CIUA 3T3MF 5F21B 6FABL 3L3HA 3D9AL 4FFYL 4NCC2 4KTYA 5HHVH 4HMDA 2DLFH 4LEXH 4OUUB 2IQAA 4QGTA 2QL1A 2NXYB 3UO1L 3LQAH 3QXAA 1Q94A 1QACA 3AU1B 4DN4H 2FX8L 4JM4H 3BGFC 1J7VR 5IV2B 1TJIL 2DM2A 1Q9OB 2FHCA 3EKCA 4MNQE 1OAQL 3RWGA 4BSVB 3PGDB 1IQWH 1E4XL 1JGDA 4XVSH 2C3GA 3QEQA 3C2AH 2XXCB 5EOTA 4QXUL 2CKBH 1CVRA 5IVXF 2YPVL 3TO4C 3BVNB 3QO0A 1MHPL 4GXUN 4UNUA 3GMLA 5CLWA 3EYOB 2DIJA 1T0MA 2QQQA 2P4AB 3ZKNC 1AP2A 1IGYA 3RGVD 5GHWH 4JZNA 5F7MC 1JRHI 4NN7C 5DMKA 3NACL 3TT3L 5C71A 2IGFL 1WT5C 3TBTA 4LCYB 2J1KA 2HJKB 5IMLA 1UT9A 1A7QL 1CYGA 1L4IA 2NQCA 3LS5L 3IU3B 4Y16B 4JLRB 3S36H 3HMXA 4X6EB 5I1JH 4OD1L 4ODSH 5T1LB 4X6BA 2WV3A 3W9DA 3MRKA 1B6DA 4GBXD 4KJQC 5GGRB 2BSTB 1AXSA 1U8PA 5IWLA 4D3CH 4PREB 4P2RB 5HVGB 3K7UA 4TPRL 5FGRA 5A3ID 3VFVB 4QRPA 5K9OA 5T5FL 3CSYA 4QRPE 2B2XH 1K2DB 2W0PA 4KKLC 1FPTH 2VXUH 1YN7B 4ERSH 2YS4A 4PJ5A 5J9PB 4XXDA 3D0VB 4LDLB 1RJCA 3GMRB 3QULA 4B7IA 4HUWB 2H32B 3HS0A 4WI5A 1DVFD 1J8HA 3MOBL 5L8JB 3Q3GB 2HMID 4R97C 3LKPA 5ACMA 3DI2B 3KR3L 4EI6A 3EHBC 4WFHE 2HJLA 1KB5A 3MCKA 5DD3L 1VERA 2MCPH 3KJ4C 2A6KA 3NOIA 4F7MA 1WWCA 4NNYB 5C0GB 2GEEA 1A9EA 3ULVD 4HLJA 1BD2E 3TZVA 5M95B 4JFED 3ME0A 4QTIL 4Y4FB 1L7TL 4HT1L 4OLYL 3BFOA 43CAA 5IT2H 1OOAA 1JGEB 1LGVA 4PYHA 5TE7H 3ARUA 4L8DB 1Y0LB 3IFNL 3B2UD 3HI6L 1IGML 2PYEB 1JYXA 4LCWE 1TCRA 4E41B 1ND0B 3HAEH 4OF8A 4WU7A 1INQB 1LQSR 3TPUA 1A7RH 1H5BB 4MD4A 1AI1L 4JKPL 4C56B 4YFLF 3FFCA 5I1IL 5T1KD 4K9EL 5I19H 3S96B 4D0DB 5HGDB 3N1QC 5FOBA 5LCVL 3WXWH 1IGMH 4PG9A 3LRGA 3ZDZF 2Y5TB 1O0VA 5F7DA 1MCEA 3H9ZA 5TQ2L 5IHZB 1A7RL 2R2BB 2YZ1A 1IGFL 4R0LC 3UYRL 3HRZB 1H3UA 5TJWK 1KGCD 1XF3A 2ZOLB 3HI6H 4WEMB 3X17A 1OCWH 3RVWC 1OP5H 1NCCL 3A6BH 2M2DA 5DJYA 1HHKA 4JFHD 3THMH 3SY0B 1BF8A 5BVJB 4O4YL 4HS3A 5T5NF 5I1GH 5IM7B 3UTZB 2FSEA 1XGTA 4OZ4B 4JN1H 4V2CB 5I66B 2WAHA 5E1HB 4H88L 4WV1B 4HEPG 4NOBA 2Y07L 5E8DL 4OBSA 5B4MD 5I18H 4KVCL 1XGQA 4M61B 4C4KT 4DEPC 2YD7A 5I76B 1CL7H 4Y5XC 5L2KA 2V7NA 1AJ7L 3N9GH 43C9A 1EHXA 2XKSA 3M45A 5F3BB 2W92A 3L3OA 2X9XA 2H2SD 3QAZB 2KDGA 4PJGB 1JHTB 1NANI 2EYTB 3UTSD 3OJDA 4U3HA 3K8KA 3VFUB 4R8WL 3VJ6A 4D9RE 4F7PA 3QCUL 4L3CB 1LE5A 1H3TA 3LKOB 5M7QA 4PBVC 4P23A 4BZ1L 3RWIB 3B3IB 2QEJA 3LPFA 3U7WH 2NY4D 5EIIA 2PTVA 2W0FB 1WCBA 2V5RA 3PJSB 1AKJB 3L3GB 1ZGLP 4ZUTA 3QEQD 3IF1B 4WI9A 1F4XH 4JAMA 2RCSL 4HKXB 1UCBH 3BO8A 1ZLWK 3P77B 1S9VB 5EU4A 4WCYL 3FONA 1MFBH 4F58H 5JA8B 3EOBB 2A77H 3PP3K 3P30L 2PCPA 1MREH 3TLRA 1WIPA 4FFEX 3ZT6A 3UC0L 3UBXB 1I7TA 2N7AA 1CWVA 1ZTXH 1FFOA 1Z9MA 2UVFA 1TCMA 5TH2B 4XMPH 2XTJE 3R0MA 3MRGA 4GMTL 3RKDC 3VFTA 1G7LA 2D9QB 1J11A 4M9PA 2QQNL 3FZUD 3UTQB 3GBNL 4JQIH 4AQOA 3RDTB 4D9QE 3FFCE 1EUTA 4XX1G 1QRNA 1MHEA 1ZHLA 3D48R 4XI5C 4RGMB 3DWTA 4UAOC 3LMJL 4OTXL 5IVXE 4YHNB 2L0DA 1UQSB 4IS6A 4GG6A 4ZMAT 2QHRH 2VDNL 4IOIA 3FAWA 4POZD 3VFNB 4JPKH 1LK3H 3FO0L 4OLXL 4FNLL 4RFOL 2WBJA 3IS0X 1Y6MR 5KSVB 4FQQB 3F12B 3VFMA 3IRPX 3X3FL 4JHZA 5C1MB 1WUNT 3QFJD 4D9LH 2ZCKL 3U30C 2EYSA 1KPRA 2CJUL 4AK1A 1XF1A 3GI8H 4PJEB 3MRMA 1IBGH 1HSAA 5D5MA 4U49A 2CRIA 1U0QA 3RU8L 4OGAD 1KFAL 3HC4L 2X4QB 2DLEA 4DOHB 4JFFB 3MCKB 4M9OA 3SKMB 3CGTA 4LLYB 3NCBB 4Y1AD 4RWHA 2DMCA 2ZOKA 4XCYB 2FIKB 1FDLL 3I50L 5ILTL 5L2JA 5TE4H 3QZWA 1R5WB 1HWGB 2MWCA 4WO4C 5JW4M 3WUWA 4XP9H 5C0BE 1NBYA 2G2RB 4WFFE 4M7KL 1VFBB 1KTRL 4HBQA 3RWDA 5D6CB 5T1KB 2V7NB 1I9IH 1OCWL 1UZ8A 5TDPA 5I73B 3QUZD 5CMAA 3DO3A 1M7IA 3TNNB 3L3IB 4KQ4H 4WI4A 2PNDA 3QFDA 1E6OH 4P59L 3PDOB 1VADB 1KEMH 3RVUD 2HTLD 5H2BB 5DRZB 3WJLA 3REWA 5DQJB 5HHNB 2LVCA 4L29A 5FUZL 43CAB 5F88A 1RSFA 4R2GB 2HLAA 4BFGA 3W0WD 3T0BA 5CIPH 4O2CA 4PP1C 4HG4J 1JHKL 4HCRA 4PP2B 1IAII 1N5AB 3EOTH 2FYYB 3N85L 1CDHA 3BYTA 1EFXA 1D6VL 1HHGA 2CXGA 1DEDA 1UB6A 5ALBL 3RKPA 2VZ1A 4QRUA 1KENH 2ZSWB 1TENA 1KLGA 4RGNE 3JUYA 1GGYA 2WIIB 4TRPH 2VLME 2J8UF 3DV6A 4IOFD