4WO4A

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
b'LFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wo4A01
4EVNB 1WFNA 3VRLF 4HBCL 4OSUH 4IRJB 1L9NA 4OFDA 5KOMC 2VLRB 5GQBA 3EJYD 5IM7A 4OZGF 1CGUA 4OLWL 1VCAA 3C08H 3TZVD 3RBGA 1MQKH 2GCYA 1PG7H 1YY8B 4H0GA 1DQJA 2H3NA 4YHKH 3VFNA 4NQVB 1B2WH 5BW7A 1FDLL 1CXKA 3HG1A 2LU4A 3RRQA 4H25B 2GUOB 2P5ED 3MLVL 2VZSA 4N8VG 3GSUA 2VZ1A 4NHCH 4Y19A 3ZT7A 2QKIB 3UJJL 1RJLB 2DQDL 5ITBL 2YPVH 4EEEA 4NJ9L 8FABA 1P4IL 1NFDE 2EDNA 4TVPL 5BQ7B 4WUKH 4P46A 3OGOE 4MX7A 4P57B 1JYXA 4WFFE 5IB1A 4JN1L 3IS1X 4FXLA 1B4JH 3T0BA 3FKUS 4HHAA 2VDPL 5A2LH 4Y19D 2D4DA 2FBOJ 1S8DB 5DFWH 2XWJA 5CWSB 4LMQE 3HKFA 4S2SB 1YN7A 2VXUL 2CDEA 3ET9F 2CJUL 3RWGB 3GRWL 2L0DA 4OZHF 5D71H 1U58B 5BRZD 5MEOB 3BZ4B 3NZ8B 1FNEB 4XVTL 5HHQA 3K74B 3HPLA 3TF7A 5D7SH 4YHYC 4UTAL 4U6VL 5IVXF 5F7EH 2E9BA 1FL5A 3QPXH 1HQ4B 5IVOA 3RNQB 3WE6B 3BMVA 4BK4A 3QEHB 1Z0MA 3FN3A 4EDWH 3GBNL 1HHGA 3KYMB 4KMLB 1WIPA 5IJKC 5JR1H 3EOTH 5ICXB 4DQOL 4EXPX 3O11A 5SX5K 5JO5B 5ALCH 5CJ5A 2GHWB 2BNQD 4UUJA 5E56A 2YBRB 3G04A 2Y07L 3UYRL 4XNQB 2AXGB 1YQVL 5EC2A 5F7YC 2JJTA 4WU7A 4D0CA 4JRWA 4M5YH 4PB0H 4Y0GA 1DLFH 3LAFA 3BISA 4PJAB 5DVMA 5DJ6B 1PDKA 3KS0J 4KK8D 3SCMA 3S3PA 5DTFA 3X11A 1D9KA 4NPYA 5T3ZD 4Z7WA 3INUH 4Z0XA 1IKNC 5TDNB 4G43A 3LEXB 2YHGA 4HJGA 5JNYB 3WCYA 2AXFA 5ADPH 1YEDB 2MMXA 1T7WA 1RUAH 2R0WL 1I3VA 2CKBA 1NCBL 1H3PH 1FH5H 1QBLL 4JFFD 3LN9A 3HE7A 3SCMD 4I5BA 1SM3H 4PJ5E 4OFYA 3GB7A 3ES6B 1FNGA 4X0KA 4WI9A 1HILA 2QSCL 2X1OA 4FNLH 4LLYA 5EN2A 4DGYH 4UV4L 4KFZC 3WIIL 3Q3GB 3RWFA 3RX5A 2ZWLT 4X6FA 1DQTA 4K94H 3VFTB 2KUTA 2BXYA 1QFWL 1KCVL 4Y89A 1G7JB 4PRDB 2FJFB 4FFVC 4L4VB 4MQXD 1RUPH 3ZYOA 4EI5B 2CMRL 3MA7A 3KWWA 1UZ8B 3MOBL 4JM4H 5E2TH 3PWPD 4P2RE 5IP4A 3IVKB 1TQCB 1X5HA 4YK4C 1FV1A 5JHDA 2AXHA 5DQDL 1VFMA 3QUYA 4NQCA 4OQTH 4J4PA 4CW1B 3SE9L 3QUXD 4XNZC 1I1YB 3WXWH 5CLTA 3GUTB 4G9DA 3NZHL 1AGEB 2OMNA 2A2QT 2LU3A 4UT9H 1PYWB 2EE6A 5JHDD 4E5XA 2WK2A 2DN7A 4M8QB 3BP4B 4J4PD 1OSPH 1HHJB 3LRSB 5KSVB 3W5MA 4KMTH 2IC2A 3HZMA 1RI8A 1MH5B 4JFYB 4NCC1 1XIWD 2BY3A 3I3BA 2ZUTA 1NEZB 4UOJA 1G9MC 5IROA 1UYWH 1ZHBA 1S7XA 2FNBA 5JIKA 2Q8AL 4ZTOH 5INCA 1DCLA 3TPUB 4M3KB 3U36A 3QA3B 4OBRA 4R6UA 2DM7A 3BO8B 4KROD 4O58H 1N7MH 4I2XB 2FSEB 1IILE 3NCYS 3ZKSD 3CFEA 3O6KH 3QIUA 3E2HC 4HBQA 5D2LB 1PVHA 1FVDB 1FFNA 5CGTA 3B43A 5FYJD 1BVKA 1UM4L 4JKKA 2D2OA 25C8H 2AJXL 5IBTL 2YKLL 5HJ3B 1BAFH 1QRNE 1IC4L 3LN5A 4HKJB 5DK0A 3QEUA 4NT6A 3H9ZA 1XH3B 4Z7VE 2P1YA 5LG1A 5KTEH 1WZ1H 4NO0A 1WWBX 3PQYE 3KYKH 2N7AA 4HS8H 3V6OA 3UYPA 1GYAA 5I1KL 1NJ9B 5ESVB 2DQUH 3TJHA 2WQRA 3VXUB 3C09B 1X5IA 1KELL 4PJFE 3UBXI 2HRPH 4OF6A 3BZDA 5I73C 4FZEH 4X4MA 3EYQC 1G6RB 2FX9L 1U3HB 3GBLA 3O2VL 3RFZC 2XRAL 5F1KC 4HF5L 3I2CH 4XP4H 2Q76B 2YPKA 1LO0L 2AS5M 2XTJD 1GZPB 1VA9A 1YNLH 3JV5A 3MRNB 3L3OB 3RGVA 1D6VH 4PJCA 2AV1A 1CDCA 2VTFA 5D1QC 5DDHA 3IS0X 2VH5H 3IDUA 4U6HB 2ZJSL 2GEEA 2IGFL 2YA1A 2NW2B 3SE3A 1G7PB 1KLUB 4RX4D 5EO0A 4GRMB 4MAYB 3QDHA 4RFEA 1FL6B 4ZFGL 1GIGH 4PTTA 1JWSA 1Z9SA 2R8SL 3P0YH 4KQ3H 4ZAKB 1Q0YH 1MRFH 3IDYC 2DBLL 2VXVH 4NQEA 1F4XL 1F8TH 5ETUA 4KJWC 4I3GA 1F02I 4PJDB 3FQNA 1RK0A 4PG2C 1OAZH 3RZCA 2HT2C 3S36H 4KVCH 4L8DA 2KZWA 1I8MA 4O2FA 4Y16C 2I26N 4RMTA 2PYFB 2K9UA 1TJGH 4B7IA 4NN5B 3JWOC 4K3DH 4BSWB 5HHOD 2FEDC 4K7PL 2ATKB 2NXYB 2PYEA 4RRPA 4ZS7L 1KLFA 4OCWL 4UILL 5FB8A 2YUXA 3WJLA 2JB5H 4XTRD 3RZCD 1NGZA 1SEQH 2ADJB 3CH1A 3BN9D 4N8VB 3WS3A 1R5WA 1PGRB 3H3BC 4QGTA 5EBMB 1A7RL 4X8JB 1KJ2A 3WN5A 4HBCH 4K23L 3IFPA 2BSRA 4GJTB 1AGBA 3BWAA 4OF5A 2V5RA 4ZO7A 2PYED 3KYNA 3SKUD 5HGAA 4OLWH 3KPPB 2Z31D 5F9JA 5CIPH 1T83A 1R3IL 5JHLL 5IJVA 4OZGB 4A6YL 1F4HA 4LEOB 3ARFB 4P2QE 4LNRA 5EBWB 1P7KA 1FYTE 3L5IA 4NP4L 1JFQL 1WFTA 1J12A 4AH2B 3MLVH 1HXMA 2PUQT 4M9PA 3UJJH 3KLSA 1BLNA 2DWDB 3HS0A 2DQDH 5ITBH 4JO2L 1JYNA 3CFKA 1YEHL 3SPVB 3Q0HA 4NJ9H 1P4IH 4TVPH 3OJVC 2NNAB 4HIJB 3UTPE 1KB5B 3C5ZA 5HI5C 3NN8B 3U7WL 4JN1H 3C6LA 3V8CA 4LBEA 2CKNA 3NPSC 2FEEI 2Z91B 1QHPA 5C3TA 5IHZA 5ISZE 3V5KB 2VDPH 4YHOL 4LCUB 5J13B 3PP3H 5E9DE 3GSNL 3N9GL 2IPUK 1U3ZA 5C0AB 3V8OA 2O5ZL 2VXUH 4Q9RL 3G5ZB 3TA3B 2CJUH 1VFAA 1CL7I 3GIVB 2P7TA 3C6LD 3GRWH 3QIBD 4NO5A 5SWSB 2D7PA 3C60B 3E6HB 3IU3B 2RIKA 4OZHB 1QBML 1NANI 1Y0LB 2BHYA 3U0PB 1KFAH 4XVTH 3RVWD 3HC0A 1UJ3A 3AC0A 1JRHL 3HI5L 3RI5K 4UTAH 4U6VH 3MRBB 4Y2DC 3QT2A 2NLJB 1NPUA 5IVXB 4WUUA 3OKLB 1YYLL 4N0FB 2OL3L 4OZFH 2HFFB 3BE1L 3WO4B 5H35B 1S7SA 5DUBA 3GBNH 4HWBA 1LP9F 5CILL 1CXEA 4DQOH 3AVEA 3VE0B 1J1PL 3BP6A 2NY5C 4FTVE 2VLMD 5EU6A 2CH8A 3IDMB 2Y07H 1UWXK 3PWJA 3UYRH 3P0VL 2ZUQB 3RIAF 5MEQA 3EOYG 5GGRY 3WHE1 4WUUD 1Q8MA 3WDHA 2EDEA 5IMMB 2XXMB 1T1YA 3OR6A 4DUVA 1DEEB 3O2DL 4IDJL 1BMGA 3O8XC 3TYFA 1VEOA 2YRLA 1WIUA 3N06B 3RVTD 1Q94B 5TQ2L 3VRIB 3WNPA 1S9WA 2D31B 5EU6D 3PWVB 5FM4A 1T1ZA 3RL1A 1OAKH 1CDBA 5EA0L 3REWB 3U48A 3AMKA 4HW6A 2Z35A 4P23B 3FT3A 2Y6SD 2WQ8A 5GRWA 2R0WH 4NRXA 1QFWM 3NCEB 1NCBH 3VXRE 3STLA 3QUMH 4WFEE 2FLRT 5GGTA 1QBLH 3FOMA 1U91A 3JSSA 5FUZL 2V5TA 4X6BB 1S9VA 3VCLB 1FFPB 2H41A 4C4KO 3BH8B 4K3HA 1TZHB 4ZPTB 2Y7QB 1DBKL 5BV7B 2A0LC 2Y5EA 5DFTA 4HKZB 4J3XA 2YSSB 5DJ8A 3H9SB 2BSTA 4X98A 4UV4H 3FHQA 3UCRA 3WIIH 4P9HC 4FABL 3X3FL 1U8NA 1JTTA 4MD0A 1QFWH 3KPRA 2VIRB 4LCCB 5LXGL 5E6IB 4PYGA 1EHNA 2CO6B 3VWKD 1M7IB 3SJVA 2CMRH 3MOBH 3RTQC 3BP5A 4YHML 4WW2C 5DQDH 4HLZG 4Z76B 4PJCF 2MJWA 2ADGA 4CU8A 1MUJB 4ZFOB 2JJVA 4EN3B 2WWMC 3OV6A 5F7DB 2FR4A 4L8SB 1P53A 2VLLB 4RFNC 1N64H 4I0PC 2CIKA 5FHBL 3NZHH 4PLNC 1HKLL 3ZSSA 2IANA 1NMBL 4YDIL 4MWFA 1IQDA 1JUFB 4HLJA 1OQXA 4M61A 1F00I 1Z5LB 1R5VA 1HH9A 1ZOXA 3QEQA 4HX1A 2F19L 4CADA 3MRHA 1INQA 3CVHL 3MRDB 1NGYA 1W8OA 3MV8B 4HDIB 4TVPE 3L3HA 3AAZB 3ALPA 2MCG1 1T2JA 1BX2B 2NZIA 3OAYH 2IAMC 2IF7A 2Q8AH 1RZFL 1CGSL 5C0JA 3U4EB 5E8DL 4UB0H 5EBLA 1A6VL 1CD8A 4PJ9C 2IH1B 3OKDB 4JM2A 4S0TD 4WEUD 1YJDL 3NIFF 2HJFB 4HIHA 3TZVB 3LZFL 3QAZB 5DFVC 5ID1A 5JW5B 3QDGA 5CJQL 1UM4H 2OR7A 3RY6A 1XF3A 2AJXH 2R1WA 4XCFL 5IBTH 5IM7B 2YKLH 1IC4H 1CICA 1TITA 3NOIA 5CEXA 1H8SA 3ILQC 3ULUD 2GCYB 2W9DH 2MCPL 1DQJB 2NY1C 3HNVL 1MI5E 1UA6L 2NY4C 1T1WA 3LRGA 4QCIA 4LFHD 2NX5E 4YHZL 3HG1B 1ZSDA 4ZUSA 2WANA 3QDGD 3BD4A 5CUSL 3GNML 5JZ7D 3GSUB 4Y19B 5IW6A 5I1KH 1MCQA 4F7EA 5I30H 1KELH 4NM8H 5C0BE 8FABB 2VOTA 4DGVL 2FX9H 3U6RA 4HIIB 3O2VH 2ICES 4Q6IA 1YYML 2XRAH 1DL7H 4WFGD 1N4XL 5IB1B 4KHTL 2R39A 1LO0H 2X4UA 4PGDA 4PIRF 3SDXA 1NCAL 4J1UA 3DX6A 1X5ZA 1LVEA 4HHAB 3QWRA 4MCZA 2A6IB 2NY2B 3BPLB 3CUPA 4HIEB 5L7XL 3HZVA 5SV3A 3L3GB 1YN7B 4NWTL 3WD5L 1V3LA 1UFUA 2ZJSH 2X6MA 2IGFH 3BPOC 3KAAA 4NCC2 3VH8A 5KVGL 2BVOA 2VJXA 4XHJC 4ZFGH 4PJGA 2R8SH 3QWRD 1JHLL 1OF2A 2DBLH 4OCMC 3EFDL 1U42A 4KKAC 4PREA 1J0ZA 1CU4H 5HHQB 1KGCD 1SYSA 1F4XH 3HPLB 5IW3A 3M45A 3CK0L 3IDIA 2BNQB 2XA3A 2ICWA 2EDJA 3O4LA 3L95A 5C8JA 1FL5B 1NCDL 3RHWF 1W72B 4ONOA 1HHGB 1XFPA 5IVNA 4K7PH 4AG4L 4OCWH 4UILH 3NFPA 5D1ZD 3LS5L 4BQ8A 4UUJB 4IOFC 3O4LD 2ITCB 3G04B 2EDLA 3EJJX 1N5YL 4XC3L 5FA4A 5D6DC 1TNNA 5EC2B 4WU7B 4D0CB 1FNSL 5C0CD 1A7RH 1AGDA 2VLJE 4K23H 3RIFF 5GRZA 1ULVA 4P59L 3FO2A 2OK0L 3LDBC 3SCMB 1QLFB 3ARVA 3X11B 3BPCB 1AXIB 2BSSA 3FQRA 4NPYB 4G43B 2YD4A 1K2DA 5JHLH 1B6UA 4HJGB 3RY4A 4A6YH 3FB6A 3DJ9A 3DWTA 1JP5A 4LIQL 4DCQA 5HPOA 4KK9C 1JHKL 4AY0A 2OBGA 4I5BB 1LQSR 5DJXA 3TFKA 5KAQF 2YD3A 1YEHH 2A38A 4LKXA 4S0UC 3GB7B 1FNGB 3QISA 4X0KB 1HILB 5ACMA 4R2GB 4MNQE 5EN2B 4NC1C 5DZNA 1JF1A 3U7WH 3RWFB 2PTTB 1M1SA 4X6FB 4LDLB 2R0ZH 1C7SA 1W0VA 4YXKL 1A21A 1X3DA 3TFKD 1NMCB 4HK3N 3N9GH 3QUXB 4PJBE 4JY4A 1VFOA 2O5ZH 3KWWB 3MA7B 5MP6H 5A16B 4Q9RH 3NGBB 3B9KD 3WBDA 4Z6AT 4TUJA 2IPTL 3STBA 1AD0B 4QRRA 2IPKA 1FV1B 5JHDB 1BF8A 1JNNL 5E5RB 1MIEL 3CNKA 4NQCB 5HYIA 3IAPA 4P2YA 3MCLL 1EUTA 5KAQG 2HAZA 3WFEL 1A6ZB 1CXIA 1QBMH 4O2CA 5I74B 5C08D 2R2EA 3G08A 4LSQL 3HI5H 1JRHH 3PNWA 4L3CA 5EH1A 1MAML 1JGVL 5GS3A 4BFIB 4CL7A 2OTUA 4QRRD 2KDGA 4E5XB 3IETA 3MGOA 2PCPB 3W5NA 4X5WA 1YYLH 2WM0A 1A3RH 2OL3H 3BE1H 4JRXE 5ADOL 4DOHB 4O02L 3SE4C 5KVFL 5CILH 3HZMB 4MJ4A 5D70L 2X1XR 4KROB 5I1GL 1J1PH 1I7RA 3OKOA 4U2ZA 1I7ZA 5DI8A 1LP9B 1P7QA 2VAJA 1QSEE 3P0VH 1ZHBB 1S7XB 2CUIA 2JLLA 5INCB 4V1DE 4NO3A 1BQLL 3O2DH 4IDJH 4RGND 5E7FA 3VWJA 3U36B 3ULUF 2R4SL 5TQ2H 1CFNA 5DD0H 3U0WL 1P7QD 2J5LC 3CFEB 3EO1A 4R4BA 1A6PA 4CMMA 2YA0A 5EA0H 4LCWA 3RVUC 2EE2A 3QXTA 4UIMA 5KN5B 3ZE0F 4OIIL 1FFNB 3WJJA 1KLGB 2VR9A 4QHNB 1BVKB 4DKEL 1DVFC 5FUZH 3CIQA 3WYRA 4X6EA 4I13B 1EERB 3IRZA 3LN5B 4KTYA 5E99L 3QEUB 4NT6B 1QLEL 1DBKH 1ZT7A 4HS6A 3BDBA 4G8IA 4L1DA 3T09A 2B4CC 4NO0B 3ZDXE 4K8RD 3WXVL 1A0QH 5JW4R 2XTJB 1EDQA 3I85A 1A9EA 4PRAA 3T2PA 2EECA 5DRNA 4WEMB 4FABH 3M17A 3X3FH 3HB3D 1CTOA 3JUYA 4LARL 4NN7B 1EO7A 5FGRA 1H15A 4PJ7A 5LXGH 2DWEA 4RCAA 3RJQB 5CGYD 5LWYL 2WUBH 5J12B 3SDXF 2N56A 3RUGE 2PXYC 4R4FL 1PLGL 3DRTA 2YPKB 3QR2A 4YHMH 3QEGL 2W59A 1JPFA 4HAFA 3NFNA 5F6HJ 2K1MA 5MEND 3RGVB 1K9TA 2Y36H 4PJCB 2V7HB 3G5YA 2EEDA 2A6KA 3QXAA 4OLXH 5DDHB 4PV9B 4PJGF 2XZQL 1P9MA 5FHBH 2W65A 1E4WL 1ONQA 1HKLH 1PSKL 5EO0B 1NMBH 4PTTB 1JWSB 4YDIH 4Z95L 5TDPA 3SGKC 1OT2A 3STZB 1TIUA 1VACA 2DM4A 4NQEB 4UAOC 1TQBB 4ORZC 1LWRA 1TVBA 2OTPA 5ETUB 3FQNB 1RK0B 2F19H 5CJOL 3RZCB 3ARPA 3CVHH 2DLIA 5JQ6L 4CDHA 4NM4L 2DQJL 1MY7A 4HUVA 3N1MC 1CGSH 3VH8G 5E8DH 2PYEB 1A6VH 3IKCB 1MELA 2X9YA 5FB8B 1A1OA 2WUCL 2CK0H 4G8GE 2M1KA 1YJDH 4DFHA 1NGZB 3CH1B 4B41A 2AK4A 2DJUA 3WS3B 1F11B 1JNLL 3C09C 4WRLA 4OM1H 5T33H 1YDPA 4W68A 1FFRA 1KJ2B 4F15B 2V5SA 3IFPB 2BSRB 3QZWA 5I6XB 1U3HC 5CJQH 1AGBB 3BWAB 5IF0B 3CFJA 3KYNB 5BJTA 4XHQA 5HGAB 4EDXB 4XCFH 4PJ8A 4M7ZB 3QXDA 3K1DA 5F9JB 1AXSB 3MUZ1 5KSBE 2MCPH 1R0AL 5IJVB 1CDHA 4PS4L 3HNVH 5EPMA 1UA6H 4MVBD 3FQTA 4LNRB 3MUJA 4F80A 5L2JA 1AKJA 1P7KB 3OB8A 3T4YA 3DPBA 1XT5A 1EFXD 5L2KE 2OSLA 3SO3C 2VZUA 5HD8C 1OP3H 4LEXL 5CUSH 3GNMH 1HXMB 2DQTL 4PJ8D 5GS1A 1T5XB 1BLNB 5M95B 1JBJA 3CFKB 5BO1L 4A2MA 3DSNA 4ZAKC 1QVOA 1RZ7L 1VERA 1YPZF 4DGVH 3KGRA 5J1TC 1XGTA 3T1FA 3N0PB 2ZUUA 1YYMH 1A4KA 1N4XH 3QIBB 3C6LB 4KHTH 4F7MA 2VYRE 2P24B 1ITCA 1S78D 4ZYKA 3H42L 3W2DL 3CSGA 5L7XH 1M6OB 5I1DB 3FO0L 2A9MH 3ETBF 1AHWA 4GRLD 3U79A 4NWTH 3WD5H 3OAZH 3AUVA 3T77A 4OF0A 3ULVF 1VFAB 5K9KA 1BD2D 2NXYC 1XEDA 2I24N 2P7TB 3MRGA 4NO5B 3ZE1F 2CLZA 5KVGH 3D9AL 4MA7L 2X4RA 2J3SA 5D2NB 4NSKB 1JHLH 3EFDH 1BBDL 1ZLUH 2HT4C 4OGZA 2ESVE 5F71A 3T0WA 1WWAX 4H88L 1BM3L 4XBPA 1KT2B 5D7LD 3X13A 2Q20A 4WUUB 1NCDH 2ZZUT 3BKCL 3D3VA 1JIBA 1NFKA 1MWAL 2I5YL 1S7SB 1N6VA 5DUBB 3ARFC 4OD3L 4AG4H 4H20L 3LS5H 3BP6B 4XX1E 5EU6B 4Z7WE 2APXA 2IG2L 3PWJB 2AEPL 1I3GL 2L7UA 5MEQB 1N5YH 3ERYA 2KH2B 3GMMA 3D3VD 1FNSH 1PKQA 3BYTA 1T1YB 4X4YA 3OR6B 3GBMH 1CGTA 3AB0B 1GH7A 3LKRA 4G6AC 2PW2A 4P59H 2OK0H 1J86A 1H5BA 3PV6A 5I0DA 3KR3L 1FE8L 3QHTC 2WBJA 4UBDC 1T1ZB 5J13C 2JIXD 4PRPA 3SDCA 2Z35B 2YEZA 3UAJC 4NRXB 3IT8D 4LIQH 3N50A 3TA3C 3FOMB 3MV7D 1RZKL 1U91B 2IQAA 4PB9L 4RWHA 1JHKH 1EX0A 1KJ3L 1S9VB 4NZJA 4OFIA 3VWKB 4HCRA 3IU4H 3SDCD 4KMQA 4E0RB 5DJ8B 2BSTB 4X98B 3DVNA 3S5LA 1HWHB 4PJ7F 2EZ0C 2NPLX 1U8NB 1T66C 4YXKH 4MD0B 3KPRB 3DV6A 3WIHA 1KXVC 3SJVB 1PEWA 5FDWA 3MZTA 1FJ1A 2GW5A 3BP5B 4GW4B 3T4AA 3PDOB 5BOZG 2IPTH 3ZKXB 2ENYA 3WLWC 4U1KA 1JNNH 5D7IA 5FM5M 1Q0XL 5K93A 5I19L 3CLFL 5CBAB 3MCLH 3UPCA 2QADD 3WFEH 5F3BA 2FR4B 3RWHB 5CD3A 3QG7H 4AEFA 4X7FC 5FUCE 1MAMH 1JGVH 4PJHA 3ARGA 4DVBA 3K4ZA 1MCBA 2HKHL 2IANB 4JR9L 4FQCL 4MWFB 1IQDB 4M61B 5CSZA 5ADOH 3V7AE 4GKNA 4M8VA 4G8EA 5IWLC 3UX9B 5KVFH 1R5VB 1T6VN 3VA2C 1HH9B 1CDIA 1EHLL 3HHRB 3QEQB 4HX1B 3L9RB 4L5FL 4ZUVA 5I1GH 2EDFA 1INQB 3MRHB 5K9QI 3H9HA 1NGYB 3WNNA 3MMEA 1QD0A 3L3HB 1GC1C 1CFBA 1HDMA 4LPUA 5FK9A 5IFAL 4MHHI 3AU1A 3FONA 4C55A 5C0JB 1BQLH 4OAWB 3MJ9A 3MNZA 4HK0A 5EBLB 3LKPA 5FGCE 1DJSA 4HIHB 5ID0A 1EAJA 4MZ2A 2VISA 3QPQC 5C09E 3U0WH 4R90L 3V4UL 5JORA 3L7EA 5E6IC 1V3JA 2X1WL 5T1KA 4OIIH 3KPSA 3QDGB 4PJEE 1ZGLP 4OUUA 3TH3T 1QFWI 3FB5A 4HMCA 1XF3B 2R1WB 3C5JA 4DKEH 4QRTA 3T2QA 2DICA 1CICB 2D03L 5CEXB 5E99H 5IQ9A 1QLEH 3V5DB 1KPVB 1T1WB 3MACL 4QCIB 4BQ6A 1ZSDB 4QY8A 4ZUSB 3DLQR 3OMZA 2VLKA 4PRHD 3VXME 15C8L 1Z3GL 5I1AB 1WJ3A 4YPGA 5IW6B 4LARH 4F7EB 4LVNC 3LIZL 3MTRA 1N26A 4KY1L 3U6RB 1T2QL 5LWYH 2Z0BA 4BSJA 4R4FH 1OY3B 1PLGH 1ZA6B 3FFCD 2X4UB 1EEYA 3IYLW 4PGDB 1TZGL 5D7KD 3SDXB 4JANA 3QEGH 3DX6B 4LLAA 1FFOA 3UO1L 3B5TA 3HRZB 1YMMD 1ZWIA 2DKUA 3CUPB 4HKBA 1OVZA 3PGDB 1CFSA 4CVXA 3HZVB 3GM8A 1S7QA 1WSST 4NUGL 4TOYL 3D25A 5GISL 1F6AA 2CRZA 3GHEL 1P4BL 2QV2A 2XZQH 4PPTA 5E8EA 3N1GC 1E4WH 3VH8B 2BVOB 5IB3A 5HHME 3U9UA 3O9WA 4PJGB 3HZKA 4Z95H 3QAZC 4L3AA 4BZ2L 2YUWA 1OF2B 4LIQE 4PREB 1SYSB 5IIEA 4C56D 5DZLA 3BQUD 3IDIB 1KIRA 5HSFA 4I9WE 3W0WD 3O4LB 3L95B 5C8JB 2A1WL 4GKSA 5EZOL 3UPAA 5HDOA 5CD5D 3O9WD 1OP3K 4OZ4A 1VGKB 1DQDL 1IZKA 3RIAK 2DQJH 4LSRH 1YY9C 4WU5A 2WNGA 3K8MA 4RGMB 3R8QA 3GSQA 5BW7C 3GEWB 4LDOB 3IJHA 3ISWA 3NFPB 2WUCH 1XF2A 3RU8L 4JO4L 4QHMA 3HUJF 5FA4B 1JNLH 5L88L 3KJ6L 5EOQL 2DLEA 1AGDB 4F3FB 3RX8A 43CAA 2D0HA 4P46C 3PHOB 3P11L 5FF6A 1NBZB 3W9EB 1AE6L 3V0VA 2VITA 3LHPL 3BVNA 1IC7L 5I9QB 1ZHKA 3FQRB 4I18A 2D9QB 1LEKB 1QSFE 1K2DB 1R0AH 2NY2C 4PS4H 3FB6B 2DLTA 1G7MB 5KZCD 3TCXA 4UIKH 2VC2L 3MRPB 4DCQB 5JW4M 4LEXH 3SDDA 2DQTH 4Y5VC 4P5KA 1DP0A 2ZCHL 4K2UL 4OT1L 4XCYA 5I8OL 2YD1A 4CJ0A 4W6WB 5HGDA 1GHFL 2R0LL 1RZ7H 1BFOA 2JE8A 2R29L 4ZFOL 3DROA 2ZUSA 3TF7C 3KHQA 1YPZB 1HXYA 4W6YB 2DQCL 2P8MA 3SDDD 1W0VB 1NCUA 3H42H 1MFAL 3W2DH 4ZXBA 1WQVT 4NZUL 3G6DL 3VJ6A 4LSTL 5ESQA 4MS8A 4JY4B 5C08B 3FO0H 4MJID 5FKAA 3OGCA 3ARBA 5D7IF 3H3PL 1KCGC 4QRRB 4K3EL 1FG2B 3D9AH 2HFEA 1JZ2A 2ICWJ 4B53A 4O2CB 2GITA 3QG6B 2JJTC 2FJHA 3GJFH 4RFOL 1BBDH 3QWQB 3S5LG 4PJHF 2R2EB 3G08B 3F7RA 3PNWB 4L3CB 5ANMB 4N0UE 3PHQA 4H88H 1BM3H 2OTUB 3JV6B 3UBXA 5GXBB 4OI7A 1TPXB 2R2BA 2W38A 2LVCA 1D9KC 3IETB 4D2NA 3MGOB 2HJKB 4OD2A 3RKDC 1GGCL 3L5XL 4X5WB 3BKCH 1UM5L 4K55A 1B0RB 2VKWA 5HVHC 2MHAB 4KRPC 4YR6B 1MWAH 2I5YH 4RGNB 4OD3H 5I75B 4H20H 3EYUL 3VXSD 2EIDA 1I7RB 3OKOB 4NQUA 1I7ZB 3KDMB 3QFJA 1P7QB 5DI8B 1ITBB 1UKQA 2IG2H 3HE7C 2AEPH 1ZT1B 1IM3A 1I3GH 2QQNL 4IMLB 2H32A 4JPWL 1BJ1H 2E7LE 2AJVL 2DOCA 3WFHA 5BVJA 4NO3B 4X9HA 3IB4A 3GI9L 4R2GC 3VWJB 4DAGH 4ODHL 2GJ6D 1XCTA 1YEFL 4NKOA 4CVWA 4C83A 1HOCA 4UTBL 1IGFL 4C4KT 1JGDA 1CFNB 5ELIA 3KR3H 1FE8H 1MCCA 2D7NA 3EO1B 4R4BB 3MRQA 3GSXB 4CMMB 5K9OB 1NMCC 4UIMB 4UDTA 3CZFB 1FGVL 4TULL 3EDJA 2BVQA 2F8VA 1FIEA 1J0JA 3K3QA 4M3JA 3T04D 5T3XE 2BY1A 1E4JA 1RZKH 3S97C 4XP5L 3EOBA 4PB9H 3VD3A 1KJ3H 1U8KA 4X6EB 5DSCA 5T1MA 3QUYC 5DEFA 1WZKA 3C6SA 1EVTC 3EDEA 4Q9QL 4G8IB 3ZE2F 1OGTA 1AD9A 4CJ1A 4BFEA 1IE5A 4L9LC 5E24E 1A9EB 1AQDA 5DRNB 4DN3L 2G2RA 4LGPB 2ZKHL 3M17B 4YE4L 4FFVD 4QXTB 2DAVA 4L3ED 1I7TA 3TVMA 1H15B 2ZOLA 4PJ7B 2DWEB 1JRHI 3AREA 1PJ9A 3H7BA 1QG3A 4LQFL 4Y1AE 4QRQA 3D39D 4HQQL 2LTQB 4D0BA 5HI4C 2HLFC 3T0DA 4MNGE 1I85C 1JPFB 3TIEA 3NFNB 1Q0XH 3TNNA 4G6JH 4Z7OF 3ZDZE 3CLFH 5I19H 4OCRH 5IROC 5BOPA 3FB8A 5CZVL 3BXNA 1PY4A 4BJLA 3MLRL 2HA1A 3G5YB 2A6KB 5E0QA 1W72L 1EZVX 1ONQB 4YQXL 2ED8A 1OP5K 2JCCF 2HKHH 4JR9H 4FQCH 5TDPB 1H3UA 5KW9L 3L3DA 5EBGA 5T3ZL 3DI3B 3BAEL 3QIUC 4MMZC 1F42A 1IGJA 4XRCA 1TVBB 1PX4A 3H7LA 1EHLH 4AIOA 4LPCA 2QR0A 4P3CL 5KG9B 4J3UA 5EU5A 5IFAH 4JRYE 4DTGL 1WT5A 4O51A 4YBHA 4U05A 2YD2A 1MEXL 2EE3A 2H45A 4HUVB 1EV2E 2IMMA 2VR5A 5L0QB 2MPAL 3O2WL 3ZDYE 1A1OB 2GJZA 3RIFK 1KXQE 2AK4B 4D94A 3WFCL 5D1XA 3TJHC 4NN7C 4R90H 3V4UH 1RJYA 4X6CF 1RZJL 2RR3A 3MOAL 1YDPB 3ESVF 5J12C 2HVJA 2XKUA 5BJTB 4ODVL 3V7MA 1K6QL 4X6DA 4PJ8B 1CN4A 3ABZA 2D03H 4YNYA 2XZCL 1Z9OA 4U1JA 1J1XL 2E6JA 5D1XD 2F58L 3RGVC 1UC6A 2FHBA 2XFXA 5EPMB 3SO5A 5B3JE 3FQTB 3MACH 5BS0A 3WFBL 1D5XA 1AKJB 4NFBA 5L2JB 5ITFB 3T4YB 4BH7A 4BFBD 3CU1A 5IGXL 3F12B 2OSLB 2XT1B 4PLJC 15C8H 1Z3GH 3VGFA 5EDXA 1J0IA 1V3MA 3SE3C 2H2SC 5FV2A 5TE7L 2EDTA 5GS1B 4TSCL 3EYQD 4BUHA 1EPFA 1MVFA 1CE1L 4GUPA 1QVOB 3GMRA 3L3KA 1KB9J 2VRAA 3LIZH 5CS7A 4KY1H 4LSPL 1T2QH 1YC8A 1XGTB 3T1FB 2H1PL 1TQBC 1S7RA 1A4KB 1BD2B 4KVNL 1MHPL 1WUNT 3ZKMC 4F7MB 3VFSB 1TZGH 4YBLB 3B2VL 4ZYKB 3UO1H 4M7KH 1Q9OA 1PD6A 1N3NA 3ZKQD 5J1AB 2G75A 4K71B 5JW4Q 1NQBA 4NWUL 3V2AR 3V6BR 3BSZL 4R0LA 4TOYH 1IQWL 1AHWB 1RUKL 5GISH 2OX5A 4P5TA 3T77B 3GHEH 4HUNB 5K9KB 5CJBA 4JFQA 2CLZB 5D7LB 5FGSA 2EO1A 1H3VA 1JF6A 2X4RB 3DGGA 3SOBL 4OKVB 4BZ2H 1AY1L 4KJWD 2UWEE 3SN6N 1TXKA 3WN5C 1N5AA 3MLUL 5I6XC 4O5LH 5FYJL 2HT2D 3HRPA 4H1LB 3BP7B 4XBPB 5ERWB 3DHJA 4Y16D 5EZOH 1KPUA 2VMFA 4XPHL 3X13B 4JPVL 1T83C 1A02N 1EEQA 3D3VB 2BNRA 3E1F1 35C8L 2W07A 4YLQT 5EZLA 5IG7B 3R0NA 1DQDH 2FEDD 4POUB 3DXAE 4ODTL 1ZA3B 4H26A 4NOBA 5BVPL 3UROR 1CF8L 1JF5A 3RU8H 1NGXA 4JO4H 5IB2A 3EHBC 1NFDA 2JIXB 2C3VA 3OF6D 5L88H 3LV3B 3GMMB 5CGMA 2EC9T 2FBJL 3ZHKA 5D5ME 1PKQB 4GW5B 4X4YB 4JFZL 3HUJB 5BV7H 3UBXG 3P11H 3LKRB 4C54A 2PW2B 3S34L 4JFPA 5K59E 3C5ZC 3MLTA 1AE6H 1H5BB 3PV6B 5T1LA 3D6GA 3LHPH 2FJGA 1IC7H 4PY8I 4FOMA 4DZBA 1Q72L 4ONHB 3LSOA 9CGTA 3MGAA 5CEYA 5D8JL 4WTZA 2FWOA 4X4XA 4KK6C 4PRPB 3SDCB 5F21B 3BPNC 3RX7A 1RZIA 3RVWC 2UY6A 2YEZB 4WFFD 2VC2H 2DIJA 1GSMA 5T1LD 2IQAB 4OT1H 2ZCHH 4K2UH 1YECL 5FHAL 4FQHA 2J4WL 5I8OH 1HHHA 5DHYA 5CCKH 1GHFH 2R0LH 3B83A 4KQ4L 2DQIL 5HI5D 2R29H 4ODWB 3QNXA 3OG4B 3DVNB 4M6OL 2IBBA 1UJ3C 3S5LB 2DQCH 3RWIA 3D85D 3VA6A 1AGCA 1IAIL 5GSRA 5LBSH 1MFAH 2QADB 4XAWL 3VD7A 4NZUH 4CVZA 3BRFA 3G6DH 4LSTH 3NFSL 3NIGE 1J87A 1RJCA 1E27B 1F2QA 4Y2DA 4HULB 4XNXL 1FJ1B 4PD4J 1JPGA 3H3PH 3QI9A 3VGHA 3T4AB 2W0FB 1QQDA 2H26A 4K3EH 1OWWA 4U1KB 5D7IB 2IBZY 2ILLA 2YD8A 5C2BL 1O5DT 5F3BB 1L6XA 4AZ8A 4RFOH 2WP3O 4X8XA 5CD3B 1I1RA 4Y2DD 1ZHLA 4MQ7A 3V5HA 1DQQA 1GVIA 3AB0C 1RUQL 1D5ZA 4PJHB 4DVBB 2AJYL 2A83A 4W4NA 3I75B 1GGCH 4GSDL 1UM5H 2OZ4A 1NC2A 5CSZB 2V9QA 2B7DT 4GKNB 4G8EB 2HRLA 5GGVY 5D93B 5HGBA 3TJEL 3EYUH 4CMHB 3H9HB 2IFFL 3V52L 4WDIA 3WFZA 3GMPA 3MMEB 4PJ5A 5FK9B 2FX8L 4QT5A 2QQNH 4LCWE 2PF6A 4JPWH 1BZ7B 3AU1B 3O8XD 1OAQL 1NC2D 1HEZA 1ES0A 3FONB 4ZOEA 3GI9H 1J1OL 1ROWA 3MNZB 4HK0B 1J8HE 4ODHH 1YEFH 1KEGL 1SJXA 5C07E 1CDYA 2XKSA 4UTBH 1IGFH 4RMSA 2VISB 3MPCA 3MGTA 4YEFA 4PJ5D 4QEGA 1NAKL 3HI6L 5JORB 3T0EE 2RFXA 3CFDA 1S7UB 1H9VA 5EUOF 2F54E 4BH8A 4X6DF 1FGVH 3KG5A 4HMDA 3QCVL 4OUUB 3QDJE 5AG8A 3FB5B 4LRIA 4LQ1A 3MV9D 4GMSL 3WFDL 1KIUA 4N8CH 4QRTB 3ZKXC 2BNUA 3C2AL 3EFFA 5IQ9B 2A0LD 3UP1A 5HDQL 4Q9QH 1T89A 1U95A 3LCYA 4P2RD 4D9RE 2VLKB 4DN3H 1YMMB 2ZKHH 3KYAA 4YPGB 4LASL 4YE4H 4XAKD 3T3PF 1G0DA 1G7QA 4GW1A 2RQ8A 3D0LA 3RTQD 1AFVL 1H0DA 1NL0L 4LQFH 3P4OA 4DGIL 3LH2L 1ZS8A 1IAKA 1A6UL 4HQQH 4JANB 1FFOB 1N2RA 5I1EH 1ZWIB 1CXLA 4JKWA 2WWMD 4HKBB 4HGKC 1CFSB 3UTSE 3TWCL 4CVXB 5CZVH 2W60A 4J2XA 1S7QB 3BKJL 4I0PD 3MLRH 4C56B 3BQUB 1W72H 3D25B 3OXRA 3W0WB 1EIBA 5E8EB 4Y4HC 3MRLA 4HWBL 5IHBA 1I8IA 2P8PA 1WLHA 1KCSH 4JM2C 5C0GA 5IEHA 4YBQC 2IAMA 3U9UB 3O9WB 2PW1A 3HZKB 4D0DB 5KW9H 4EUPB 1YMHA 2XPGA 5T3ZH 1OL0A 3TT1L 4Q7DA 1PQZA 3BAEH 1JVKA 2JCCB 4YJZL 4PJ9A 4HUKB 3L5WA 5MEPA 3U1SL 5I76B 1KIRB 4FMFA 1KENL 2R9HC 2L7JA 4DKAA 1QRNA 2YOCA 4GKSB 2IAMD 4RGOH 4CRPA 4OLUL 1CD9B 1CICC 4KHXH 5DJAA 4DTGH 1U92B 1X4ZA 4Z7VA 4OZ4B 4QXWA 4WEBL 1MEXH 3PQYA 3HFMH 4HZLB 4PJ9D 3GSQB 3O2WH 3IJHB 5EOTA 5IK3A 1NFDF 5FV1L 5DFVD 1QRND 2X4TA 3MLPA 4PJFA 2GI7A 3I3DA 3WFCH 2DQFA 1TETL 1T22A 2EE9A 2MQ3A 3Q6FA 1RZJH 3MOAH 4Q2ZB 4WVRA 5C6PB 5KZCB 1RURL 3SKOB 3MRJB 3RL2A 43CAB 3PQYD 5IMLA 4X6CB 1X44A 4Q6IC 4B50A 1FIGH 4Z78A 3RDTC 3IFOB 3I6LD 4ODVH 4WTWA 3V0VB 1K6QH 2VITB 3ILQD 5E8OA 3BVNB 1OGAE 1ZHKB 3B2UC 2GT9A 2NY1D 2CR6A 2AI0L 2JK5B 2NY4D 2XZCH 1J1XH 2NW3A 2F58H 2P8LA 3VFGL 2C1OA 1PFCA 3WFBH 5CBEA 1BEYL 3MO1A 3RNKA 5IGXH 4O2EA 3P9LA 1XF5B 4XCNB 2GFBB 3SDDB 4UINH 4XCYB 3BDXA 5TE7H 4KZDL 4TSCH 5FXCH 5TH2A 3MCG1 4NDMA 1BFOB 4MJIB 2YPLE 4LSPH 3DROB 2P5EE 4KKBD 2H1PH 1MCSA 1GRWA 4LLMA 1BECA 4YEEA 4KVNH 3PUCA 4DVRL 2PR4L 5B3NA 4OLEA 4J3VA 4NQDE 1HXYB 1KB9K 3B2VH 2P8MB 4WTZG 2HN7B 1E28B 1LD9A 3EAKA 4KAQL 4NWUH 3BSZH 5ESQB 5CFHA 1FAIL 1IQWH 5FKAB 3OGCB 1RUKH 5F72S 3ARBB 5I15H 1RZKC 1ZT4A 2R1XA 4NO2A 3L1OL 4XHJD 2BXZA 2AABL 2V2WA 1P84J 4U1HB 1GL4B 4H8WL 2HFEB 4IRSA 4KKAD 5I8KL 1VPOL 3IDNA 2XNAA 3FMGL 3MFGB 5F8RC 3FT2A 2I9TA 1AY1H 2GITB 5GRXG 4OQTA 5IFHL 3QDME 4PR5A 2F8XC 3MLUH 3X14A 3VXSB 5FYJH 1FN4A 5BRZE 3QQNA 5D6DA 3UBXB 4GQPH 1GAFL 2R2BB 4N9GA 4XPHH 3NBNA 4OD2B 4JPVH 4CU6A 3ULUL 2JJSA 4IRSD 4P2QA 4J6RL 35C8H 5I1LA 1FYTA 1KIPA 4QWWC 3OKMA 3WIFA 4ODTH 4JFEA 1G0XA 4FS0A 5BVPH 1CF8H 1RJZA 4YDLC 1I9RL 3LQAL 1QSVA 2IQ9L 2EICA 3OL2A 4M9OA 4P2QD 2FBJH 1FYTD 2ITDA 4JFZH 3WFHB 1A7QL 1XCTB 4NKOB 3S34H 4C83B 5ISZA 1ZLWK 1C8PA 1JGDB 3U2SA 3D69A 5IBLC 4BZYA 1Q72H 5E9DA 3MRQB 4NKIL 2FH6A 2EDOA 5D8JH 2WIIB 5DJ0A 5GIRA 3UTPD 2BVQB 1IAIM 5T3ZE 2ADIA 4KK9D 3J8F7 3BJ91 3MODL 5GGRA 5ISZD 3A67L 1U8KB 5E95B 1YECH 5T1MB 3ULVC 2J4WH 5DEFB 2ORBL 5DWUL 2J6EL 1CGVA 5E9DD 1WTLA 4KV5E 1RFDH 4KQ4H 2FL5A 1OGTB 3D39B 4JFFE 4N90D 1AD9B 1U8JB 5AZEL 5F1OB 1MFDL 4M6OH 1XGYL 2G2RB 1JV5A 1QPPA 2Q7NA 4M48L 4UQ3A 3PABA 1IAIH 1U8MA 2PETA 32C2A 1JNHA 1I7TB 5B4MC 2X4PB 4XAWH 3RWCA 3LPWA 2LVEA 3UTQB 1MVUA 5F1SA 4XNZB 3AREB 3NFSH 3H7BB 4QRQB 2EYSA 4TTDC 3QJHA 3HLAB 4FTVA 2IBGA 4ZO6A 5I75C 1HINL 3TIEB 3TNNB 1HSAA 3PL6A 5EU7E 4BUGA 5C2BH 2KL6A 4PD4K 5DC4B 5F9OL 5DD5L 3E8UL 3BXNB 3PWPE 3S36X 2DLFL 2WBKA 5CZKA 1IC5L 3VWJC 3OJDA 1RUQH 5JOFA 3LRHA 3I02A 5L8KB 2AJYH 2FZ3A 1NGPH 4M93B 3L3DB 3L3JA 1LK2A 5F3HA 1OP9A 1IGJB 4GSDH 1AI1L 5E2WL 4XRCB 4QXGH 1KTDA 3Q2CA 4AYFA 4MJ5B 4WI3A 5JXEC 3VXRA 3WJJC 2EXYC 1RHHA 3TJEH 5IR1A 4Z7VF 2IFFH 1KC5H 3V52H 2QR0B 2E27L 1RU9L 1M7XA 5SWZA 2FX8H 4HFWA 5EU5B 4O51B 1NCNA 4YZFE 1OAQH 3KPSE 1C5BH 2AKRA 4Z7NE 3WUZA 1J1OH 1SY6L 3KPNA 2GJZB 3BEWA 4WFED 1KEGH 3PIQA 4BYHA 3RVUD 5D1XB 1RJYB 1NAKH 3HI6H 1QRKA 3W39A 5E94A 2HVJB 3V0AC 2P48B 3QCVH 3BRGC 1DVFD 3GIZL 1M71A 1QYGL 4WNQA 3ZYZA 5EUOB 4GMSH 3WFDH 4X6DB 4MXVE 5I73B 3C2AH 2FECL 3PGCA 4YNYB 2YMXL 3SKNA 4U1JB 4URTB 3ULSA 2GSIB 3RI5F 1LEIA 1D5BA 3NA4A 5FYJE 2XFXB 2DI8A 5HDQH 4H0HB 4E42B 5CIPA 5JTWA 1FRGL 4BH7B 1IM9A 1I8LA 2HT3C 2CRYA 1MJJA 1P9MC 4UV7L 2CRIA 4LASH 5HGGS 4NZRL 2IPUG 1EAPA 3V4VL 2M2DA 2DQGL 4G3YL 1QSZA 4GUPB 3L3KB 1T20A 2PXYD 4U31A 5EU4A 1AFVH 1NL0H 4ELME 1JWUA 4OGXL 1S7RB 1A6UH 1ZMYA 2FIKA 3SGKA 2IJ0C 2RHEA 4JFOA 3A6BL 3IDYB 5C0DA 1Q9OB 1N3NB 4XCEA 5EZIH 2G75B 3TWCH 4OSUL 3BKJH 1BVZA 4F7PA 3CLEL 1CFTA 1V05A 1BFTA 2ZSVA 1ZTXL 4LHUA 1CLZL 4P5TB 4MDJA 5L0QC 4HWBH 4JFQB 1MQKL 4U3CA 4G6ML 1HYSC 5DS8A 4P5MB 3TT1H 3DGGB 3GRWA 3DX9A 3M8OL 4X7SL 1X5FA 3KXFA 2P45B 1KCKA 2QL1A 1N5AB 3U1SH 1ZANL 2K3TA 1KENH 1VFBA 4NC2B 4P48A 3VXOA 3MUGB 1BIHA 2A77L 3R4DA 4OLUH 1MI5A 4WUKL 1F5WA 5EZLB 1XGQA 1M7DB 4WEBH 2NX5A 1OOAA 2O93L 1QA9A 4H26B 4LHQB 5DC9B 2CLRA 1LILA 5D7JC 4K8RL 4OZFA 5C0FA 1R3JA 3PG2A 1YEKL 5L8LB 1CG9A 2FO4A 1NGXB 5IB2B 5GS1C 5C0BA 1NFDB 5HHOE 2FIRT 1MI5D 1R3LA 1DANU 1RURH 2NX5D 3OKKA 5LJYH 4C59B 4D9QE 2C9AA 1ZK9A 4WHYH 3MLTB 5T1LB 3RVXC 2UY7A 5DUPL 4J3OC 2FJGB 3T3ME 1MIML 1OTTC 4YBLC 1NH6A 4DZBB 2AI0H 5TE4L 3LSOB 5CEYB 1KG0B 5C3LD 3CSPA 2FWOB 3VFGH 1F97A 1ADQL 3NPSB 1BEYH 1RZIB 2BY2A 3E0GA 3HMWL 5HD8D 2YA2A 1OW0A 2Y4SA 1V7ML 1VADA 4G7YL 2X1PA 5TFSL 1IARB 3PJSA 1FPTL 3B6SA 4FQHB 4ZAKD 4CNIA 4KZDH 5DHYB 4P3DB 2OJZL 3F7YA 2KPNA 1QR1B 5FIEA 3QNXB 3KPLA 4MA1C 4U1GB 5J56B 2PR4H 5C7XH 5CAYB 3K8LA 3RWIB 4XVUC 4PYHA 1DQLL 1AGCB 2APWA 5GSRB 2X9XA 1JZ5A 4ZD3L 1NC4A 1X5JA 3OB0H 4OTXL 4XGZA 5F1NA 4CVZB 4KAQH 2C3GA 4NYLA 4Y2DB 1KUMA 1FAIH 5E00A 2NXYD 1JPGB 3QI9B 3U82B 2DYPA 3L1OH 1QQDB 4JFXA 2H26B 1UQSA 5L8JB 2AABH 4C58B 1WCBA 3OTTA 4H8WH 4PRNA 3RQ3A 5ADPL 3PWUA 5I8KH 4YDVA 1NC4D 5KVEL 3OXSB 5CJXA 2HT4D 3FMGH 1PZUB 3EGSB 2VLJA 2MOVA 2XI9A 1P84K 4PV8B 5IFHH 4MQ7B 3V5HB 5EIIA 1DQQB 1NDMA 1D5ZB 3QFJE 3R0MA 1GAFH 2A83B 1B0WA 5DA0B 2WBJC 1OWRM 2XKNB 3ULUH 1IFHH 3O3EA 4J6RH 1NC2B 4FFWC 2VLJD 1ZLVK 3H2WA 5J1SC 1MJUL 4K94L 5HGBB 4ENEC 2UZYB 2JB6A 4WDIB 3GMPB 4UZGA 1I9RH 2F53A 5J3HC 4PJ5B 3LQAH 2E9IA 4ISVA 5EO1A 3KNBA 4QT5B 4EI6A 2IQ9H 3KLAA 5DQJB 3EO0B 4O4YL 5B22A 4JM4L 4MNQA 3IF1B 4G6AD 1WGOA 2D7OA 1A7QH 3MCKA 2VDQL 3UTZA 1FSKB 2VXQL 3TN0A 4UBDD 5LGKA 4JZJC 4HS3A 5TJWK 3MGTB 4KI5E 4NKIH 2RFXB 3CFDB 3RJDA 3UAJD 3ARTA 4GAGL 2YK1L 4MNQD 4OLZL 4P2RB 3TA3D 4UT9L 3DMMA 4LGSB 1U8OA 3MODH 1W0YT 1UWEL 2VUYA 3R06B 2BNUB 3EFFB 5I1HL 1AJ7L 3HZYB 3A6OA 3K7UA 2NR6C 5DWUH 2J6EH 2B39A 3D0VA 1ND0B 1QFUL 5J6GA 3SY0A 4ZQKA 3AXLA 3RWEA 4X5XA 4GMTL 3ZTNL 1U95B 2EZ0D 5AZEH 1MFDH 1T66D 3ARRA 4XNMA 5JIIA 4ERSH 4MJ6A 1XGYH 3JZ7A 4M48H 3ARGC 3C8HA 5C71A 2LE9A 3E6FA 4RFNB 4ZTOL 1LE5A 4JRXA 4I0PB 2EDRA 5EU7C 3QXVA 4X83A 3RAJL 3C8KA 3P4OB 1B88A 5C70A 1ZS8B 1IAKB 3WLWD 1A47A 3IXAA 1IZJA 1HINH 3PWLA 4QRPE 3K81A 5DMKA 3W11C 3ZKNC 3KJ4C 1RK1A 3QJFA 4OZIE 2OI9A 3MRIA 5F9OH 1BZ9A 5DD5H 4F2MA 2P43B 2W60B 3MLYL 2H6PA 2EH8L 4V1DA 1JWMA 4XNUH 5TDOA 4N5EC 25C8L 1OARL 1IC5H 2HLAA 3UZQA 3OXRB 1FL3A 3MRLB 4IHOA 1GGYA 1I8IB 2P8PB 5IEHB 5C0GB 4QHLB 2IAMB 3A0OA 1QSED 1YMHB 2XPGB 3Q1SL 2VERN 1U8HA 1AI1H 4WO4A 4PJ9B 4JGMA 5E2WH 4V1DD 4R96A 5MEPB 2C1PA 5AAMA 3P30H 3D87B 1QRNB 1G7IA 4Y4FA 3RVVD 4X7TA 1HI6A 2E27H 1KV3A 4Z7VB 4LHUG 3JTSA 3H9SD 4WO4D 3PQYB 2EH7L 4BQBA 3GMOB 1MNUL 3MYJA 1SY6H 1G1YA 5EOTB 5IK3B 3QPQD 1NUDA 1D5MA 2X4TB 2NY4B 4PJFB 1BFVL 2Z4QA 5E1AA 2DQFB 3D1MC 1T22B 1U8LA 5E6ID 1T0MA 5BS0E 4UOW1 3T2OA 3Q6FB 3RUGA 3GMLA 1MFBL 1KJMA 2HFGL 3RL2B 1IEBA 2ATPA 5IMLB 3ARSA 1EZVY 3GIZH 4Z78B 1QYGH 5E8OB 1VESA 4XZUA 1CD1A 4LPYA 1MRFL 2OXHA 2AEWA 4HKXA 4ZUTA 2YMXH 1MCLA 3DUHA 5JDSA 2NW3B 5LKNA 1F8TL 2P8LB 4HUWA 1G7HA 2C1OB 4X9BA 5DYOA 5CBEB 3S88H 4JHAL 4XVSL 1FRGH 3RNKB 2RCSL 4GXUM 1HNGA 4O2EB 2QBWA 2X7LA 3K2MC 4A6YA 1R5IB 3JWDL 5FYKE 4UV7H 4NZRH 5DUML 4WWKC 3OHXA 3V4VH 1NBYA 2EEAA 2X4SA 3EYOB 2DQGH 4G3YH 4GS7C 5TH2B 1CXFA 2VN4A 3MLSL 5EUKA 3UDWA 3BPOB 1BREA 2X5PA 4OGXH 4LLMB 4I4WA 3MV8D 3S7GA 5I8EB 5GGSY 3A6BH 1UJTA 3CU7A 1KPRB 3O6FA 4XT1C 4TUOA 1LD9B 3QCUL 5K9QG 3CLEH 3CX5J 2NXZB 1ZTXH 3RWDA 5FO8B 3MX0A 1CLZH 1ZT4B 2D7MA 2R1XB 3GSNA 4G8GA 4NO2B 1MCKA 1MLCA 4MHHG 3I6KA 3MZGB 2V2WB 3LB6D 4G6MH 1FZOA 4J3SA 4IRSB 2BNRE 3IDNB 3KPOA 3FT2B 3M8OH 4X7SH 1KCRL 5F9WC 4XXCA 4PR5B 1QEWA 1ZANH 3X14B 4IMKA 1CXHA 4QKXB 4G8GD 1CDJA 2WBWB 5FYLE 5GS2H 2A77H 5KSBA 4N9GB 3B5HA 3T65A 4I18C 4NKQB 1YY9D 4P2QB 1JN6A 5I1LB 1FYTB 1KIPB 3HG1D 1EHXA 1I9JL 1GGUA 2WMPA 3LDBB 5L2KA 3OKMB 3WIFB 5A2IH 5HYQA 2OL3A 5GRVK 4K8RH 2DKSA 4ZSOA 5SWQB 1YEKH 3SDDC 1RJZB 4DN4L 1G9NC 1IAOB 1WZLA 1NUFA 5EULV 3QHFL 5J11B 2I27N 4P46D 1V8HA 4YIQA 2ITDB 2C26A 1YEGL 1A7PL 1DBJL 5AWNL 2PN5A 4Y5VA 3HAEH 5E8NB 4F33A 1F13A 4ODXA 5ISZB 5DUPH 4M7JL 4PJBF 3JTCA 1MIMH 1FCCA 4NKDA 1L7TL 3O2DA 2NY2D 2UZXB 3U2SB 3AS1A 5C0CE 5E9DB 5TE4H 1KFAL 4ZXBC 4HUXB 5DJ0B 3F65A 1U8PA 5IB5A 1ADQH 3MRKA 2BVTA 4MS8C 3HMWH 5GIRB 4XWGH 1WC7A 2ADIB 3ARBC 4XBGA 1V7MH 4K9EL 4G7YH 5GGRB 5A2KH 3SKMA 4F58L 3BIBX 5GRJL 5TFSH 1FPTH 3SGDH 1BQHA 2CXGA 4Z7UE 3NAAL 3BUTA 2OJZH 2DMKA 4PGBA 2CLVA 2FL5B 2ESVA 5EOCL 3TT3H 5IOPA 3BEVA 3BJLA 2VQ1A 4LPWA 1JV5B 4MSWA 1F6FB 4YFLI 4MMXC 1VB9A 4UQ3B 1DQLH 3PABB 1U8MB 32C2B 1JNHB 4OGAC 5LCVL 4ZD3H 4OTXH 3RWCB 3GMQA 1MVUB 4NNYA 2WP3T 3DECA 2XOTA 3FTGB 3LKSA 3TBTA 2EYSB 5DD3L 1IBGL 1UT9A 4GRWH 3MLXL 3QJHB 3PDDA 4FTVB 2XXCB 5ICZA 3HE6A 2D9CA 1OAKL 4ODBD 3P77A 5EC1A 1HSAB 5B8CC 3PL6B 2DMBA 1GXEA 4PP2A 5KVEH 3GK8L 1FYHB 1ED3B 3JV0A 1CDUA 3VXQA 3K0WA 1BJMA 4LF3A 5F97E 3QUML 1AC0A 3OJDB 3NH7L 4OB5L 5FOJA 1Z9MA 5JOFB 4HWUA 2BVPB 4WJ5A 1D9KD 4BK5A 3LKQA 3I02B 3CX2A 2FZ3B 3RKDD 2OS7A 1LK2B 1BIIA 4KRPD 5F3HB 5SX4H 1WBYA 3RPKA 2MNUA 3VW3L 1XR9A 3VXRB 1MJUH 1RHHB 2BMKA 2J5LB 5KS9E 4I3SL 3HE7D 4PG9B 3FZUC 1TTFA 3I50L 3ZDXF 4LCYB 4HFWB 3TO4A 3B8SA 4OFYD 4O4YH 4KI5C 3CVHA 4R2GD 4KJPC 1GZQA 5GHWH 3ILPA 2AKRB 1DVFB 2E6QA 3QNZA 1MQ8A 3KPNB 3BEWB 2VDQH 1XAUA 4L4TA 2VXQH 2Z8SA 4ZOCA 3PIQB 3RUGF 5GRYA 3TVMC 4IS6A 4L9LA 1N64L 5D4QA 3GSWB 3ARDA 3LQZA 2YK1H 4GAGH 3AREC 4RMVA 4OLZH 3W39B 1RVFH 5E94B 1OAUL 3EIFA 1IAII 3CFBA 1M71B 2OR8A 4WNQB 2Y72A 3HA0A 3QUYD 5DEGA 4NQTA 4NQCD 1UWEH 5E8PB 3PGCB 5I1HH 2HMID 1AJ7H 3SKNB 3ULSB 4KJQC 1LEIB 1D5BB 2EKSB 2PXYB 1DR9A 1QFUH 1EGJL 4GBXA 5CIPB 4LP4A 4GMTH 5F7MC 3ZTNH 2BZDA 3VGEA 1I85A 1IM9B 1T0NA 4XH2A 5EZJA 2J12B 2BHUA 3MFFB 1EAPB 4FQXC 4M93C 2OLDA 1YEIL 1T20B 4UT6H 2R23B 4UB0L 5EU4B 3RAJH 1GOGA 5HI4D 2HLFD 3JVGA 5C0EA 1Z9LA 3VI3E 1X9QA 4KK5C 4XP9L 4JFOB 1QO3A 5C0DB 3QIWA 4UAOB 4H1LH 4XCEB 4YHPA 1ACYL 4AM0A 5GSVB 4K3GA 3MLYH 1AQKH 1J0HA 1WT5C 3CFCL 4F7PB 2XY1A 2EH8H 1J05A 5GS0C 1CFTB 1GOFA 2X9WA 4HIXH 4LHUB 3QSKB 1OARH 3LQMA 4MDJB 5BXFA 5FCUH 2AEQL 5MENE 2P5WE 1GGBL 2D7QA 5C09A 1B9ZA 4M4RA 4ZOBA 2W9DL 5DVNA 5D6CA 1H8NA 4J23A 3QIUD 3TBYA 5D1XC 3B9AA 3Q1SH 1KOAA 4PJEA 4RBPK 1Q9LA 4JZOA 4KDTA 1T04A 2MWCA 5KSBF 4QF1B 1CYGA 1VFBB 5HHNB 2APFA 5KSUA 3VXOB 5I30L 4NM8L 3WKMH 5C09D 4PJIE 2B1AL 1MI5B 3TBSA 4AMKL 2D7TH 1DL7L 2NX5B 4NO0D 4JKMA 2EH7H 1MNUH 3VXMA 2CLRB 5C0FB 1R3JB 4Z18A 3TJHD 2FO4B 2BRRL 4JJHA 1BFVH 2VABA 3QUZA 5HY9A 4AIZA 5C0BB 4GRWE 2RBLA 1R3LB 2GK0A 1FZKA 3SO3B 1MFBH 3OKKB 2HFGH 2XA8L 1YNKL 3VXMD 2NY0C 5JPNA 3IDJB 3MRRA 1J88A 3RGVD 4RDQF 5DRWA 1CU4L 2BVYA 2B2XH 3L3IB 4R7NA 4R0LC 4WV1A 1B90A 1SMOA 4JHAH 4XVSH 3VXPB 4PLJD 2RCSH 4P5TC 1REIA 2EXWC 2H2SD 4N9OB 3UTTE 3JWDH 5HHMA 2YZ1A 1ETZA 4FXGA 5E1HB 3B6SB 5DUMH 2MKWA 1YN6A 4NQED 2ICCA 3MLSH 3MREA 3ZKMD 1MCPL 2J1KA 4EOWL 3P9MA 5FM8A 2X4QA 5I2IA 4IRZL 4P9MH 5IMOA 3QQ3A 4XPFL 3OG6B 1G9ML 1S9KC 2ICEA 4S11A 2O61A 4OJFL 1VEMA 4GXUN 1NC4B 4XGZB 5F1NB 4RDQG 3QCUH 4NYLB 4Z7WF 4MXWL 2DF3A 5E00B 5F88A 2ZP0T 3BUYB 3PV7A 5DJZA 4HJ0C 3NCCB 4I9WD 4JFXB 3D18A 5JDJA 1BQHG 1UQSB 2FEEL 3EOAA 2X1QA 3CX5K 4JN2B 5J06A 3MNVA 1WCBB 2ZG1A 4PRNB 3PWUB 2AXJA 4P2OA 4YDVB 5FYKU 2UUDH 4EJ1C 2VLJB 4Y2OA 1KCRH 4ZOAA 4EQ3A 4PUBL 4JFEE 5EIIB 5HI3C 4GXVH 3H0TA 3BGMA 1NDMB 4TSBL 1PX3A 1EHAA 5C92A 2XZAL 1QSFA 4ZO8A 1JJUA 3I6GA 4F37K 1P4LA 3ZTJH 3O3EB 1PZ5A 4PP1C 1DN0A 5MERB 2X09A 4KDWA 2V5MA 4XX1G 1I9JH 3V0WL 3BIKA 2R0ZL 4HEME 3WHXA 5E4IA 1MJ7L 3TBVA 2JB6B 4RNRA 1ZVSB 2AQ1A 3EHBD 4DN4H 4U0RC 5FECA 4GAFB 4ISVB 5EO1B 4ZUWB 4IRJA 4WHDA 4EI6B 3KLAB 1T3FA 2LQRA 3QHFH 5MP6L 4F9LC 4MNQB 2VWEE 1YEGH 1A7PH 1DBJH 3C5ZD 5AWNH 5J0BA 3MCKB 4X9IA 4HEPG 2OQJA 1A7OL 4KWUA 4U1GC 4M7JH 4JVUA 4HS3B 1L7TH 4IBLT 3BW9B 4KK6D 2EIBA 2ZOKA 2C3HA 4PJBB 4H25A 4OFPA 4J3WA 1NUGA 1NCCL 2BERA 5TQ0H 4LLVA 5KVMC 4TN9A 4QHKI 3DMMB 3RPIA 1MCWW 3QI9C 1U8OB 4XP1L 4K9EH 1KTLA 3ZYIA 1EMTL 4F58H 5GRJH 1A3RL 5DLML 3NAAH 4JG1L 2P44B 3D0VB 3CPLA 5J6GB 3SY0B 1UEMA 4ZQKB 3AXLB 3RWEB 4X5XB 5EOCH 3MV7E 1WITA 4NHUE 4N0UA 3ZHDA 2VB5A 4XNMB 3PP4L 1EH9A 3HNTL 1MLBA 2QQKL 3E6FB 3ORJA 5C1MB 5LCVH 4MB4A 3DX7B 1LE5B 4JRXB 1SJEA 5FO7A 1MHCA 4EUPH 3JWOL 1EBAA 3K4AA 3BZFA 3C8KB 4PJXE 5DD3H 1IBGH 3JV4A 5F7KC 3MLXH 1G6VK 3IXAB 5DD0L 3ELAT 3PWLB 4R97B 4YFDB 1QSEB 2IH3A 3BZEB 5DMKB 1INEL 2P49B 1WAAA 3MRIB 4F2MB 4WCYL 3KPTA 2R2CA 3GK8H 1HSBA 2E7LA 1KULA 2H6PB 4U0QB 4V1DB 1JWMB 3VFOB 1I9IL 3RGHA 2HLAB 3DVFA 1FL3B 2OP4L 3G6JE 3NH7H 4OB5H 4IHOB 3KYOA 4N1EA 1FSKC 1AO7E 3V7AG 5SWZE 5CMAA 3WL9A 1QKZL 4APQC 3ZL4L 1U8HB 4WO4B 5JO5A 4PFEA 1A0QL 4R96B 3VW3H 2C1PB 2Q8BL 4U6YA 1XGPA 4I3SH 4Y4FB 4LRIC 1HI6B 1UG9A 3I50H 1BBJA 2DM3A 2WUBL 1G84A 3JTSB 4PJAA 2MKLC 2FGWL 3IRPX 1T89C 4DK3A 4RIRA 5T3XD 1T80A 4E41E 3VMPA 3KPRD 2Y36L 2NMSA 1YEDA 5E1AB 2DL9A 4WWID 1U8LB 3BMWA 2DI7A 3SJVD 4OLXL 1QFOA 3GMLB 4Y1AA 3RUGB 2K7PA 5CHNA 1KJMB 1IEBB 1I3RA 1OAUH 4RISL 1AR1C 2GTZB 2SEBB 2PKDA 4MNGA 4LVNB 4XZUB 4DZ8B 1CD1B 4GG6E 3ES6A 4HKXB 4ZUTB 4NQSA 1QFHA 2ED7A 3VGGA 5JDSB 4HUWB 5DK2A 2Q6WA 1S9XA 2C4FU 2OR9L 1G7HB 1EGJH 4JFDE 1EEZA 2X7LB 5IW1A 4RQQB 4A6YB 1MRDL 1B6DA 2FJFA 1DUYA 4XI5C 2IAND 1T21A 3CH8A 4O9HH 3WO3B 1KTKE 2F9BT 4I0KA 4K3JL 3OHXB 3FT4A 1NBYB 4TNWF 1UZ8A 1YEIH 5DMGD 4PRHE 4Y4HA 3VG9C 2CK0L 3QEQD 3MUHL 4XNYL 4I4WB 5DMIL 2NY5L 4Y5YA 4XP9H 1U6AH 4CW1A 4JRYA 3O6FB 7FABL 2NTFA 3FQXA 4OM1L 4G8FB 1ACYH 1XMWA 4TUOB 5T33L 1BQSA 1DBBL 4G7VL 3QQ9C 5HTSA 3CFCH 1VEPA 3FFCE 4P49A 3KXFE 5D7KE 5J9PA 4Y4HD 4JM2D 3GSNB 4G8GB 4YBQD 1MLCB 2QSVA 2AEQH 4P4KC 1GGBH 4JAMA 5H8DA 2Y06L 2H3NB 5CP3H 3VFNB 2HWZH 3LRSA 4RRPG 4JRYD 1NBVL 3KPOB 4UQ2A 5KSVA 4I8DA 3B9VA 5F93C 2GAZA 2AP2A 2R9HD 3CMGA 3QFDA 1UB5A 1SVCP 5JOPE 4FQQA 3GJFA 2AJZA 3VFVA 2GYSA 1CICD 5KSBB 2B1AH 4M6AA 3VDCA 2DL2A 3NABL 4P46B 4AMKH 1JN6B 4MX7B 5E2UL 3RDTA 1TDQA 3RZWA 4KKBC 4X5LA 3QULA 5L2KB 5HYQB 2BCKA 4P9HL 4M43L 2FECI 1WZMA 2OL3B 2PO6A 4NQXA 5ABDE 2CPCA 1MWAA 4QGYA 2XWJB 3BH9A 5J6HA 1H3XA 2BRRH 4KC3B 5D2LA 4Q6YA 4MXQA 2A9ML 4WI2A 4ZFZA 2CDEB 4YIQB 3HTLX 1VSCA 1DUZA 3RDTD 2XA8H 4Y5VB 4JQXC 5E08L 2ID5A 1YNKH 3HR6A 3B2UD 5I1IL 4L4JA 1FGNH 2MFNA 4DKDC 3C5SA 1K8DA 5IHLB 5HHPA 1MAKA 3S96A 4MXQD 1JZ8A 3HI1A 5IB5B 4K94C 3MRKB 3VD4A 4MD4A 2NXZC 4G9FE 1WC7B 3DUUA 5KVDL 3SBWA 4Q9BA 4F57L 2R15A 5KSAA 1WBXA 1BQHB 4HUMB 2UWEA 4IRSC 3LY6A 3GMNA 2YRPA 1EBPA 5T1DL 2FGZA 4PGBB 2CLVB 2ESVB 1MCPH 3O11B 5IVZA 1HCVA 4EOWH 4TSAH 5IOPB 3BEVB 4IRZH 1A5FL 5JUEL 4MSWB 4XPFH 1G9MH 2D3VA 1JGLL 4OJFH 4EIGB 1K85A 5FFLA 2GQHA 4OCYL 5KSAD 4JJ5A 2V7NA 3GBML 3GMQB 3HMXL 4NNYB 1UGNA 2JJSC 3DXAA 1U8QA 3LKSB 4MXWH 1FNLA 2BX5A 3PP3K 3SQOL 3TBTB 4Y5XA 5DVKA 5DTFB 1D9KB 3HCVA 4Z7WB 4Z0XB 5ICZB 3JTTA 3HE6B 5MI0B 4JVPA 5HVHB 3P77B 4KRPB 2CIIA 2AXFB 1BOYA 2XICA 4PP2B 1KIQA 2Y1VA 1JE6A 4JKPL 5D5MA 4JLRA 5J11C 1YUHA 2CKBB 3VXQB 3DXAD 4LF3B 4PUBH 4MLIA 3HE7B 1QZ1A 3NIDF 4CBPA 1F4YL 4WJ5B 4TSBH 5FA3A 3LKQB 4N1HB 3S6CA 5AYQA 5H2BA 2F53E 3E3QA 2XZAH 3IU4L 1IGYA 3DIFA 1BIIB 4BSWA 2ENSA 3MLWL 4F9PA 1F4WL 4QWWD 4LLYB 1NANH 3DARA 3BOVA 1L6ZA 1CLYH 1XR9B 2E7BA 2VWEC 3V0WH 2BMKB 4N8VA 2CK2A 1MJ7H 3LEYL 4QTHA 1UWGL 4Z7QE 2EIEA 4M1GL 3TO4B 4HC1L 4BFGA 3CC5A 3ILPB 2VE6A 3QNZB 1J18A 3SGDI 3QUYB 1A7OH 5IBLD 1RMFL 1ZEAL 4KUZL 5DA4A 4IS6B 4F8QA 3QG7L 2GJ6E 4L9LB 4QOKE 1P69B 3RWJA 1RULL 3ARDB 3LQZB 1NCCH 4G9DB 3ZDZF 2Q1EA 1YNTA 3CFBB 3R1GL 3F7QA 4XB7A 3ULVD 4XP1H 5DEGB 1EMTH 2CRMA 3BWUC 4BELD 5DLMH 2FD6L 4DJMA 3PL6C 4JG1H 1RZGA 1ZGLM 4XCCL 3K4DA 4AIXA 5IESH 1CI5A 5F44A 2BVEA 5TF0A 3PP4H 4LCUA 4Q58C 3HNTH 3MROA 5EZJB 2QQKH 3B9EA 5B4MD 5DGQA 4U1NA 2YC1A 5C0AA 3S9DB 4JM2F 4N0CC 3JWOH 3L5HA 4TTDD 4WGWB 4Y7MA 2AJ3A 3OPZL 5SWSA 1I4FA 4I3RL 4L3EE 5F7FA 1X5KA 4D9LL 3IU3A 1QO3B 3QIUB 4EKXA 3QIWB 4YHPB 1INEH 2ARJA 2Y9RT 3ZDYF 4AM0B 4WCYH 4CVUA 5JXEA 1WFOA 1J05B 5DZOA 2BFVL 3MRBA 5F9AC 1I9IH 3D2UA 4TRPL 3VWJD 1JI2A 1J8HA 4OV6F 5FGCB 2OP4H 5C07A 5BXFB 3T0XA 2CSPA 1I8KA 5C09B 4N0FA 5D6CB 5DK0B 3UJIL 3TBYB 4GKOA 3CAFA 3T0EA 2YS4A 1QKZH 4LCWD 5E03A 4ZMAT 3ZL4H 5EO9A 2F54A 4W70A 2ADFL 2BK8A 2YD5A 4PJEB 5JXED 1Q9LB 4TUKL 4JZOB 3DGCR 2EXYD 3WUWA 1T04B 1DN2A 3QDJA 3BGAA 1J8HD 2Q8BH 5DHVA 5B3JF 1Y6KR 1S7TA 5C07D 1CBVL 3CMOL 5C2UB 2HTLD 1OQOA 5BZWA 1X5LA 1MJ8L 2E6PA 3VDBA 3VGAB 4HFUL 3T0ED 3TBSB 4LCIL 1F3DH 4S10A 1QHOA 2FGWH 2F54D 5E4EC 2FYYA 1Q94A 3OAYK 3UYOD 1G1CA 2QSQA 3VXMB 3QDJD 3RBSA 2J8UE 1I8LC 3TPKA 5HYJE 1NMAH 1FLTX 3GI8L 3QUZB 4P23A 4AIZB 5HY9B 5DJ2A 4EXKA 3I9GL 4ORGA 2AV1B 4IJ3C 1RIVL 5FEBA 2GK0B 3EUUA 1TJIL 2RB8A 3LPGA 4X6BA 4D9RD 2CDFA 4RISH 4RFEB 4Y8DC 5JPNB 4ODUA 4C57C 2IFGA 4NGHL 4U6TA 5CEZD 1MPAL 3MRRB 4RMQA 5C9JA 3UTSA 4CKVX 3NACH 5DRWB 4K7PY 4JDTL 1XGUA 2OR9H 4R7NB 2W9LA 3DYMA 2PNDA 2HT3D 3MR9A 4LCCA 2VIRA 4UT7L 4L8CA 3H3KA 2UWEF 4L8DB 5HHMB 2WY3A 1MRDH 1ETZB 1I8MB 4PRIE 2N1KA 4FXGB 4O2FB 3SDAA 3L6FA 4K3JH 4U7MA 4PY8J 4ONGL 5E6YA 4LSRL 2V9RA 1BZQK 4KTDL 2YWZA 1IGML 2X42A 4A2LA 3MREB 3FAXA 3T8XA 4OKDA 3P9MB 4Z76A 4XNYH 5F7HA 5I2IB 1NCWL 5DMIH 5IMOB 2NY5H 1MUJA 3QQ3B 4ZFOA 2ICEB 2AGJL 1R5WB 2CGRL 4XB8A 2O61B 4LVOB 7FABH 3SDAD 2VLLA 3H6JA 3WN5B 1DBBH 2W9EH 4G7VH 1TVDA 4Z77A 5F88B 2I60H 3DRQA 3MBEA 5DJZB 5GJSL 1HYSD 3D18B 4J3TA 5D5MF 2AK4D 3O3BA 4JFHD 2Y06H 4ZDHA 3MNVB 3DUSA 3MQIA 1NBVH 4RAUA 4UIKL 5D7JA 4ACPA 1YEJL 5IHUL 4UI2A 1TCMA 1GGIL 2NY6C 4ZSOE 4V3EB 3H0TB 3BGMB 1KN4L 4Q0XL 4ZTPL 1OGAA 1WV7T 1JMZA 1N59A 3HS0B 5HDBF 1QSFB 2F5BH 2VZVA 3I6GB 1A3LL 1P4LB 4Y88A 1YEEL 1PZ5B 3NABH 1AKJD 4G6KL 2B4CL 3C5ZB 5E2UH 1OD7A 3ARYA 5D7JD 4LBEB 2HJFA 4P9HH 1OTUC 3BIKB 4M43H 2OYPA 3WHXB 5IHZB 1OW0C 3CD4A 5F89A 5JW5A 5FECB 5D72H 3ME0A 4PBVC 1MFCH 3BPNB 4OLVL 1T3FB 2YPLA 4OI8A 3L5JA 1SMAA 2P5EA 5D96B 4JQVA 5IEKA 2NY3C 1N8ZA 3C2SA 3RVXD 2XTLA 2VDRH 4NQDA 5E08H 1C12A 1OTTD 2OQJB 1C5DA 3LVEA 5I1IH 3NIGF 2OTWA 3P4MA 4WTXA 1T4KA 2E9WA 4FHBD 4YC2C 1U2HA 2ZOKB 4Y4KC 4OIBA 3P4NA 4PGEA 3BHBA 2YPLD 1N6QL 3HC0B 1UJ3B 4LLVB 5DD6A 4HGMA 4M7LT 4RZCA 4NQDD 3RPIB 3RY5A 1KTLB 5KVDH 4F57H 3O3AA 1OAYL 4HIIA 4MA3A 3S4SA 3GO1H 3CPLB 4IEFB 5CJXC 5T1DH 3QDMA 2AJSL 4N0UB 2E8YA 4XVUD 2A74A 5BRZA 1A5FH 1NBQA 2A6IA 5JW3L 5JUEH 4MDIA 4HIEA 1MLBB 3VU2A 2E7HA 1MCJA 3L3GA 4NFCA 3VFMA 1JGLH 5EG6C 4J12A 1UZ6E 4OCYH 1SJEB 3GKWL 2CUMA 3HMXH 1MHCB 5FO7B 4DAGL 1TNMA 1FQ9C 3TYFB 3BZFB 4K07A 3FJTA 3QDMD 3SQOH 4EBQL 3JV4B 4Z5RA 2DM2A 1FNHA 2OM5A 3DURA 2VDOL 1FORL 1R6VA 5DJYA 1S9WB 3RL1B 2IH3B 1FO0A 2DLHA 4FA8A 2XG4A 3FT3B 2NCMA 5C0IA 1HSBB 3P9WB 4JKPH 1G6RL 3AFLA 4LHJB 3LPFA 2BNQA 2N4IA 3VMNA 3STLB 3PXJA 4X80L 3FAWA 3CFIC 1F4YH 3KYOB 3C9NA 4W4OC 1W72A 2WBJD 3TN0C 4TNVK 5CMAB 3WL9B 5JXAL 1V5JA 1MCRA 3DVIA 3MLWH 4FFWD 3MJ8A 4PRPD 4QNPE 1F4WH 1P6AB 5CKGA 3DYPA 4UMGA 2XN9E 4HXBH 4ENED 3HN3A 3REVA 4JZJA 3EYVA 2C3WA 4CUCA 2ITCA 1FBIL 4U6YB 4L4TE 1XGPB 3LKNA 3QO1A 3U9PL 5J3HD 3LEYH 3DMMC 5CINL 5DVLA 1UWGH 1O7VA 4M1GH 1BBJB 4KUCD 4HC1H 4KU1A 4JFFA 3EDFA 5GGUA 2GTWA 1QLFA 3BPCA 4RIRB 5HVFB 2ADGB 4G6JL 5A3IC 4MJ2A 4OCRL 1RMFH 1ZEAH 2X40A 4KUZH 1HN1A 3WUWG 5KANI 2B5IC 2AV7A 4Y1AB 2CIKB 1N0XH 1RULH 5CHNB 1RAMA 1VENA 1I3RB 5CZXC 3S35X 1NCTA 3R1GH 4MNGB 2NR6D 5FGBA 3THML 1CCZA 4NRYA 4HUUA 4R97C 5H94A 1KCUH 4NQSB 1SYVA 2FD6H 4L8BA 3PWPA 1UWXH 2OI9C 5DK2B 2Q6WB 1S9XB 4XCCH 2PTTA 1IL1A 3EYFA 4KKCD 3MV9E 4FQJL 1EEZB 4CADB 5A1AA 2DIAA 5IW1B 1SQ2N 2IEPA 1VHPA 3ARGD 3ALWA 3QH3A 1EA9C 1DUYB 4OQ1A 3RVVC 1T21B 3ZO0A 4OV5A 5DGRA 3QUXA 3FT4B 2C7UA 5A16A 4N5EA 4HPYL 2COQA 3KS0H 4Y4HB 1AD0A 4WO4C 1A14L 4JM2B 4FMKA 3OPZH 3FO9A 4XAKE 4D3CL 1CDGA 1CGXA 3KLHD 4I3RH 4Y5YB 4YXHL 3W11D 3ZKND 4D9LH 4XWOC 4Y4FC 1A6ZA 1JGUL 4JRYB 4R4NC 1U41A 2NTFB 4KJYA 3FQXB 5ID1B 3AS0A 1TENA 3BKYL 1XIWA 4N5ED 2YD6A 2BFVH 5J9PB 4TRPH 4BFIA 2PTVA 2I9LA 3HR5A 1KB5L 3G9VA 3QQ4A 2YN5A 2PCPA 1EJOL 3TESA 1PKOA 4JAMB 3CVIH 4KXZH 5MHSD 4U1IA 3UJIH 4TPRL 4UQ2B 2M26A 3MV11 2ADFH 5T1KD 3KPSD 4TUKH 3O41A 2GAZB 1NAMA 1LP9A 3QFDB 4M62L 1UB5B 4FQQB 4MAUL 4LU5L 3GJFB 2AJZB 1MREL 3VFVB 1FZJA 1CBVH 3CMOH 2V5YA 1HHKA 4YX2L 3QZWG 1QLRA 1MJ8H 2ZUXA 1MCHA 4HFUH 4LCIH 3CGTA 4PY7A 4Q6IB 3RDTB 1L9MA 2E8ZA 3QULB 2BCKB 2VLKD 3TNMA 4J1UB 2VAAA 3QRFM 2PO6B 4NQXB 4M7KL 1MWAB 4MCZB 3D5OF 5J89A 3BH9B 5J6HB 4NFDA 5KN5A 3GI8H 1JGEA 1DDHA 3I9GH 2W0PA 1KLGA 3FRPA 4QHNA 1KN2L 1RIVH 3QNYA 4ZFZB 4ELMA 4R8WL 1TJIH 3UDWC 1DUZB 3B3IA 4JO3L 4WWKA 1MHHA 3HPJA 3MC0A 4NGHH 3LB6C 3I84A 1MPAH 3C5SB 1K8DB 2EDWA 3O6FC 5HHPB 4JDTH 5JA9A 3S96B 4P99A 3HI1B 3KLDA 3I6LE 4O5LL 4MD4B 5IBUG 1EK3A 3BI9X 1FC1A 1RV6X 2ICWB 1WF5A 3DUUB 4UT7H 4WWKD 1SHMA 3OKNA 5KSAB 1WBXB 4ONGH 3O3UN 1ORQA 2UWEB 1AC6A 4MD5A 2APBA 3GMNB 1Q1JL 4KTDH 2MQ0A 1IGMH 4RX4A 5IVZB 3MRMA 4P3WA 2Q3ZA 4XXCC 1NCWH 4IMKC 1NSNL 4M02A 4DUXA 1DBAL 2DDQL 2AGJH 2CGRH 1GC1L 1MCIA 2R1YA 2V7HA 4JJ5B 2V7NB 1QTYT 2WINA 4PV9A 5BV7L 3DXAB 5FUOL 1U8QB 4NJAL 3FO2B 4RMUA 4Y5XB 5GJSH 2BSSB 2FO1A 3HCVB 3S4SG 3STZA 3JTTB 4CDGC 3OAZK 1J0YA 4XP6L 1LQVA 3OJMB 3FRUA 2CIIB 1Y6NR 5HHOA 3DVGA 4PLOB 1AP2A 1KIQB 5D5MB 5BMFL 4JLRB 1F90H 1JK8A 1YUHB 2Z92A 1E4KA 1YEJH 5IHUH 5F7UA 3ARQA 3K80A 1GGIH 4YDLB 4KUCF 4LPXA 2XQYK 1C08A 1ZLUK 1CZ8L 1KN4H 4Q0XH 4ZTPH 5DJXB 5FA3B 4AT6A 5H2BB 4KKLC 5CCKL 4LKXB 1IGYB 3DIFB 4YH6A 5A43C 1WWWX 1A3LH 1U36A 4GLRH 4OCNC 2VLRE 1YEEH 2Z8VC 3IKCA 1AH1A 4G6KH 3WKNA 5I0ZA 2B4CH 1JF1B 4D9QD 2Z31A 4GAJL 3ARXA 5LBSL 4KV5F 1F11A 4QTHB 1S7WA 5C0RL 2RJMA 3Q5YA 2ZCLH 1QOKA 5I66A 1BJ1J 4OLVH 1FHGA 5I17A 1KBGL 4OM0L 5IF0A 5DK3A 1A6WL 3CC5B 4EDXA 3LN4A 4TUJB 4ODSL 2VE6B 2IPKB 2KKQA 4WI6A 4XMLL 1AXSA 4IOIA 4M5ZL 5TE6L 4ZXBD 3A6CL 4MQTB 1FDLH 4XPGL 2LAAA 3IJYA 4MS8D 5J4MA 3RWJB 1N6QH 1HZHL 3ARBD 1YNTB 4GT7A 1T5XA 4P4RA 2ZCKL 2XYCA 5MI0C 3HE6C 3O4OB 1OAYH 4I48A 1RZGB 1II4E 3QIBA 4TNWK 2P24A 4MCYA 3WMSA 2AJSH 5JW3H 5B8CA 3MROB 2NTSP 4OGAD 4POZC 2VL4A 1M6OA 4U1NB 2YC1B 5I1DA 3LKOA 4NC1E 1WAAE 3FHAA 5E5UB 4N90E 3GKWH 2W0KA 1VGEL 2AJ3B 4EBQH 5TPWL 1I4FB 2VDOH 1FORH 3MNWA 3QFJD 5D2NA 4YZFF 1IGIL 2X05A 4NSKA 1MSPA 1MFEL 4Z7NF 2ARJB 4LCWB 4R26L 4PTUA 5H37H 3TO4C 1G6RH 1CQKA 5INDA 3PWNA 3D2UB 4CU7A 1J8HB 4X80H 1LO3L 1KT2A 1CVSC 4N8CL 5C07B 1NLBL