4WO4A

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
LFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wo4A01
5DUMH 1A9BB 2W9DH 3CFJB 4K2UL 3FQUB 3G6JF 4JQIL 5IESH 4Y19D 5DJXB 5E9DE 3O4LA 3PABA 2BNUA 3VE0B 1HYSC 4CVUA 2DTMH 3CMGA 4LHUB 3W5NA 3TF7A 1HNGA 3CX2A 4XMLH 3M07A 4Z76A 3WLBA 4P4KA 4KK5D 1KPVA 1RZGB 3ARBD 5DVNA 3U82B 4IMKC 4Z0XB 4GAGH 1UZ6E 3CPLB 4OLWH 5IOPA 1F4AA 4CMMA 4N90D 5BVPL 2V5RA 3P9LB 5T3XH 4IRSC 2ORBH 3REVB 1WFTA 4GH7B 4MXVF 1ODAA 1SJHB 2A6JA 1CQKA 1JNLL 4FTVB 4DN4H 2ENSA 3SJVB 4OFDA 1NBZB 1UKTA 2X4PA 1ZA6B 4QTHA 2HLAB 5KN5B 1T22B 4FNLL 3BEWA 2ZOLA 1UWEL 3QH3B 2ADIA 1OTTC 4R96B 3SBWC 4YBQC 2HKFH 1NC4A 1J0IA 4A6YH 5FB8B 1L6XA 5IB5B 5EU6E 4OZFB 2VLRB 1EHAA 3W81A 1VESA 3G5XB 4I3RL 3FO1B 3SKNB 1PFCA 5F8RC 4AH2B 3I3EA 3GM8A 2E9IA 5MEPA 1BP3B 1A5FL 4HK3J 4Z7WE 4DFHA 2A0LD 5E9DA 3NFNB 5DA0B 3SDAA 1ZHKA 4KQ4L 4XT1C 4J4PD 2A38A 2IPTH 4NDMA 3FCTB 2CUHA 3OB8A 4PGBA 1UYWL 1KN4L 4GSDL 3VWKA 2J6EA 1T04B 32C2A 4M1CC 4LIQE 3HNVH 1WTGT 1WWAX 2IQ9L 2BRRH 2EH7H 1AHWC 2PO6A 3G6AB 4RAUB 4UILL 4WVRA 1NFDE 3C6SB 5DTFA 3FO2B 4YE4H 3ZL4L 3QB7C 4XMKL 2A2QT 4YZFE 3NH7H 4YNYA 1BBDL 4WV1A 2MCG1 4DN3L 3JWDC 1Z9MA 1KLFA 3OKKB 4CU6A 1M4KA 1YEJL 2EIEA 4WI3A 2CLRB 4KI5D 1QLEL 3QDME 4BQCA 5F7NC 2EDLA 3V6FA 3PHQA 1Z9SA 1FNLA 4GO6B 5AUMA 4LAQL 5HHQB 2IPKB 2XG5A 2WINB 3LIZL 4X5WA 1JZ6A 2CIKB 2X70B 1V3LA 4OFIA 4XHQA 2Q7NA 1GVIA 3KYAA 5EU6A 5AAWA 3RZWA 1INDH 5DZLA 5I1KL 1NFIA 3QBTB 3NOIA 4XB7A 3GDBA 4PV9B 4RZCB 1RIHL 4S1QH 1K85A 1P6FA 4KAQL 2EDQA 3W39A 1HYSD 5EZIH 2M2DA 3QFJD 4LKXB 4YBLB 3CLFH 3IDXH 1WEJH 4M62L 1TVHA 3OBAA 4WFEE 4HS6B 5HHOD 1LHZA 3MZTA 3RUGB 4U7MA 4JDVB 3NCYS 4IRSD 2PYEE 3SCMA 1CGUA 1PEWA 3DV6A 5HDQL 1FDLH 3VA6A 1U8OB 1SY6L 4XNYH 5IJKC 1P4LA 1NFDA 4UU9A 3DRTB 4NHUB 1UM4H 4X7DC 4OV5B 1KTKE 5DD6A 2I9TA 4FQ2H 3OQ3B 4NRZA 2F54A 2CLZB 2PTVA 4LPWA 1P2CA 1ACYL 2AEWA 5T3ZH 5C6WH 2NY7L 1I1AB 1OTTD 3QDMA 4Y89A 1JFQH 4YBQD 1REIA 4YX2L 3QPXH 3V4UH 4LCIL 4FQ1H 3IFOB 3SDXE 5IFHL 4P9MH 1CICC 3I6GA 5FYJL 4OKDA 5L8JB 1FFPA 3WS3B 1MWAL 1JPST 1MHHB 1MI5D 2NY5C 3P0VH 1A7PL 4YHIA 3MJ9H 4M6AA 1UKSA 2GJ6E 1U9KA 2NR6C 5D96C 2YZ1A 3F6LA 4BFIB 5DDHB 5KW9L 2P48B 4DKFH 5F7YC 2VISB 3HMXA 4JFHE 3TF7C 2VSDA 5D7LE 1NJ9B 1QNZH 2W38A 4P4KC 4WI2A 4E0RA 2EEAA 4S0SD 3U1SL 1TVBB 3F12B 5E8OA 4M1CD 2E7MA 1RZKC 3BP6A 3D85A 3S34L 4H20H 1I1YB 3EYVA 4WFGE 5KOVC 2PYEA 3V6BR 3VFTB 1KGCD 3ALWA 3TWCL 4WIQA 1NAMA 4NWTL 2WWKO 2PW2B 3QDGB 4G59A 5LVEA 3QWOA 1AIFB 3RL2A 2YN3A 5TDNA 1FH5L 1S8DB 4ZS6C 4YAQA 5D2NB 3H0TB 4PB0L 5KVDH 3QIWA 1IGYA 3DIFA 3PP4H 5F3BB 1D5BB 5C3TA 1NDMB 4I4WA 3U30C 5IVOA 4YDJA 3WNMA 3MRHA 1S3KH 2DLHA 4TVSa 3V8OA 3MYJA 3SDXA 5FO9B 4JE4B 1B4JH 5DT1H 1U8JA 3QEUA 2V17H 3JWOC 2HMIC 3DSNA 4YJZL 5T33L 4MJIB 4OLZH 5E70A 2W0FB 1DN0A 2D7MA 2GJ6A 3BAEL 5FO7A 5FM5O 4NQXA 3VDAA 1EZVX 4ZPVA 5HJ3B 3TEUA 3VD9A 2IQAB 1OM3H 5JHDB 4N8CH 4PJIA 1KJ3L 3BXNB 1O7VA 5JPNB 1ERNA 4GW5B 4D3CL 5AYUH 2XZCL 4IRZL 3VDCA 3GSUB 1EEZB 4FS0A 4OKVA 1LWRA 4QRPD 2OZ4A 5SWSE 3AM8C 1RZJC 4MCYA 5GIRB 2BY0A 1OY3B 3ARWA 2R23A 2EDOA 4NKIH 3ARFC 3A6BL 4WV1C 5MI0C 4ORZC 4X6DE 2XPGA 3IAGC 5DLMH 5ESQA 2DB8A 2OL3L 5GJTL 4N0FA 2W9DL 2DJ4A 5FGSA 4NRXB 3PQYB 1EGJA 2FBJH 1FCGA 4MDJB 3S97C 1CICD 4QTIH 3ULVL 1TTUA 3C5ZC 3UTQA 1MCOH 4WWKA 1WT5A 4XMLL 2NR6D 2P5WB 3K7UA 1KT2A 4IRJA 4GAGL 5C0DB 1XIWB 1N2RA 2RCSH 1JVKA 4OLWL 5GGTH 3TYGH 3KPNB 2E7CA 5T3XL 4P4KD 2ORBL 2XT1B 1NUNB 3BGFC 3F58L 3DV4B 5JW4Q 3SGJA 4RAVA 2APBA 1JTPA 3GSOA 5AYQA 4LSDA 3VFVA 5FGCE 2XACC 4C4KO 1F4XH 3MRKB 1AGDB 1UEYA 1YEEH 1NKOA 2VDNH 4F7MB 4U1NB 3H9YA 3C5JB 2CPCA 3MXWL 4TULH 1OW0A 3VI4F 4HFUH 4NM4H 4XRCB 2HKFL 2VZ1A 4ZS6D 4A6YL 5ISZE 5LAXB 4X6DA 3NPSB 4GJTB 3MRFA 5FCUH 4X6BA 5I71B 3BZFB 4YHMH 4Y5VC 1XMWA 5K9KA 5F3HB 4NPYB 2E7LE 2HMID 2NY5H 2EXYC 4LLQA 3MUY1 4HXBH 1IL1A 5BO1H 5E9DD 2J2ZA 1UJ3B 1UH3A 5TDPB 3DMMA 4UI2A 4WENB 3Q0HA 5A2IH 4GOSA 3EJZC 4PB9H 2AXGA 3JTCA 2EH7L 1A6VH 2YPLB 4BH7A 5JW5A 4PLJC 1JMZA 4PJ7B 4LHJB 4P57A 3Q6GH 4DGYL 2JB6B 3NH7L 1I85C 1UJTA 1CGXA 4LPCA 1H5BB 4BZ1H 1G0XA 1QBMH 3LV3A 3VGGA 4B7IA 5EO9A 3D2UB 1CD0A 4U6YB 3V6OE 3FMGL 3ARFD 5D5ME 3I3BA 4NNYB 2ICEB 1S9XA 1XFPA 2X4SB 4NQEB 2I26N 1ZHNB 4FFYH 3U7AA 2FWOA 2H32B 5HHVH 3QIUB 3QIWC 5ISZA 3TCLB 3CC5B 2WWMC 1INDL 4BSVB 2O5YH 2X9WA 2R2HA 3HC3H 3QJFA 5FDWA 1RUQH 3LEYH 4OGAC 4S1QL 5DJCA 2Y7QB 4HS3A 5EZIL 5HD8C 3C5ZD 3K4DA 4GXUM 2GT9A 1UH4A 1J12A 3RTQA 1N6UA 4X4MA 3NTCH 5CGYD 2E7LA 2MFNA 1FL6B 3IETB 3CLFL 3IDXL 1U8KA 3E3QE 4MMXC 4FOMA 1IM3A 1I3UA 1RULL 2A6KA 2K7PA 2HJKA 4JVUA 3WJJC 2FL5A 3EIFA 5HI5C 3RNKB 1FDLL 1CK0H 1U3HC 2UUDK 4HG4J 3IDIA 4XNYL 3KYMB 3G5YB 3O8XB 4BSWB 1UM4L 5JLZB 1KIRB 2WBJA 2AV7A 4FQ2L 4XVJH 1WZKA 4BK5A 1TCRB 2VNCA 4HFWB 1LK2B 1JWUB 5EB9A 3DX9A 5T3ZL 5GS3A 1CL7H 3V6OA 4M02A 4PGCA 5D5MA 1JFQL 1RJLA 3V4UL 3QPXL 4KMQA 1BREA 4KJYA 3RWEB 1NGWB 4BJLA 2Y9RT 4P9ML 4V1DE 4V3DB 1GC1C 3AGVA 3QDMD 1JF1B 1UZ8B 2C4XA 1XF5B 3P0VL 4P2OA 4H8WC 4JGJA 4JY6A 4B53A 1RURL 2OR8A 4XVTL 4Z7NE 1S7WB 1CWVA 1XGTA 2DWEB 4G6FB 3VXME 4WWKC 1WT5C 5B39G 2EXYD 2OL3B 2Y25A 3JUYA 4IRJC 4YQXH 5TFSH 1MHPH 3PXHA 2SEBB 4LGSB 3MRPA 4RBPH 1X9QA 3MLYH 1EEYB 5E2UH 3T0AA 3E3QA 4P5TB 2BNQD 3C2SA 1NCDH 4XAWH 1BQHG 1PYWA 4H20L 4Q9BA 1ETZA 3EJZD 4J3WA 5IK3B 2FDBP 4S1RH 4PLJD 4POUB 5DI8A 2G9HB 3D85D 3WL9A 4WFED 3BN9C 4OCNC 3B9AA 3DVGB 3CX5J 4DTGH 2IALB 5MEQA 3MBEA 5EZOH 1BJ8A 2O93L 4H5SA 1OAQH 2YXFA 4PTUA 1AD9B 1T2XA 5GSRA 3VFPA 3P4NB 1FNAA 5I2IA 3HMWL 3STBA 3BIKA 5KVDL 1WWWX 3WNLA 5EU7E 4U1GC 3PP4L 2JE8A 3UJIH 3H42H 1GGTA 1JN6B 2B4CH 1A4KB 2NY0C 4S10A 5DJ8B 3GRWH 3QIWD 3FHQA 2NY4B 5E8DH 2WWMD 1KIUA 4JANB 1B4JL 1TETH 2X4QA 2X2YA 3LSOB 5DT1L 3TBTA 3VRJA 2V17L 5L8LB 4OLZL 4OGAD 5EDXA 1QA9A 1HNFA 1A9EB 1K8IB 3HPLA 2B5IB 5HD8D 2A9MH 4ZD3L 3HRPA 2R2CA 4A6YB 4XCEB 3QUXA 2VUYA 3K81A 5JDJA 4KGLA 1ACZA 1OM3L 2GJ6D 4N8CL 2FSEA 5IEHB 1NLDH 3IJHA 5EA0H 3VFOB 4OZHE 1DQLH 5AYUL 3DMMC 2ZCLL 1W72L 4JFHD 4Y19B 5D7LD 3QXWA 4Z7UA 3QEHA 5HI5D 1F45A 3BZ4B 3SPVA 1U3HD 1BVZA 4XPTL 1E28A 1M1SA 4NKIL 3DTXA 1JNJA 4MAUH 1K5NA 4WFGD 2NY6C 1LEKA 1S7RB 3EHBC 5DEFB 2DQFA 1EAPA 4UUJA 5DLML 3PIQA 4PJHB 4PR5B 2MQ3A 3O6KH 1T1WB 3WEXA 3E0GA 5H37H 1HN1A 4MD5B 2QQNH 3BO8B 5IBUB 2FBJL 1ONQB 5CMAB 3V0VB 4UIKH 4NKOA 3R4DA 4WI8A 1MFEL 2ARJB 5HI3C 3Q5OA 2V5SA 1N64L 5LGHH 1DL7H 3BEVB 1TJIL 4R90H 3QISA 2RCSL 3TYGL 4WWKD 1N5YH 3RTQC 2E7LC 4LPYA 3Q2CA 2L0DA 1IEBB 1QO3A 4IRJD 3R8BB 1LQVA 3DXAE 1TXKA 4OZHA 3ULVF 2GY7B 3QHZH 1MUJA 4LP5A 3RJQB 1KTLA 4ETYA 4HSQA 4M5ZL 2VDNL 4FFEX 4HIEA 1EZVY 2YBRB 4KI1A 4KRPB 4QHNA 3BN9D 3ILPB 1A8JH 2NY2C 5SWZA 4TULL 2ZUQB 5A16A 3U2SB 2WBJC 4G80B 3U0TA 1AGBB 3UAJC 3F5WB 5SWSD 4PJDF 5EC1B 3B2UC 3G5ZA 1R5WB 1MFNA 3V6OC 3RWHB 1G7PB 5FCUL 3SKJH 2ERJC 2VLJD 2XNAA 1MLBA 3O6MH 5DMYA 4L3CB 2NY0D 4RCAA 4JHWH 1GOGA 1CE6A 4JB9L 1YPZE 5GGRA 3SE3A 2Y4SA 2FATH 5JNYA 4P2OC 3N1FC 2NY5L 4NC2B 3O3EB 3BVNB 4HXBL 5BO1L 3IXAB 4PG2C 4JKPH 1W8OA 5D93C 3KPRE 4C83A 1N26A 3CSYB 5LCVH 4JZJC 3KLAB 5HDBE 5IFJB 5GS1B 4PB9L 3BSZH 5T1DH 1A6VL 3JWNC 3PDOA 2ZG3A 2IAMA 3DMMD 3E3QC 3DI2B 3DXAA 4K9EC 4OCXH 3FB8A 4O51A 2YK1H 3BW9A 1U8LB 1W8NA 4PJAB 4BZ1L 4NKQB 1A6ZA 1JHLH 1H3TA 1DQQA 4UT7H 1WBYB 2OSLB 3HN3A 3PHOB 3QFJB 1J1OH 3D25B 4ZPTA 1OSZB 4PJHF 3IXTB 2BXZA 2NY6D 2OJEB 3EHBD 4FFYL 2O5ZH 4YHLH 4JRXB 4IRSB 4HUWA 4JG0H 3S37X 5GGRY 2BVOB 3WFBH 5I8KH 1BIIB 3FTGA 3FOMB 3OR6A 4NSKA 2XZQH 3WKNA 2G5BB 1RUQL 4NKDB 3VRIA 3LEYL 5ISZD 4NBYB 4FFWC 3DJ9A 2CDGB 3X17A 5HI3D 1JGEA 1YPZA 1ZT1A 4G5ZH 4GRMA 3ARZA 5DK2A 5F7DB 1I7RB 3JWOL 5JA8B 4KTYA 4RWYH 2NTFB 3V4VH 5DEGB 3T0WA 4XZUB 4RQQA 1AC0A 2VSCA 5H8DA 1G6VK 3QUXC 1YY8B 3RTQD 3Q1SL 3RWCA 4DFIA 1IKNA 3OG4B 4WU5A 4JDTH 4OLVH 2A6IA 2FO1A 1CK0L 2R15A 1AXTH 1CFTA 2E7HA 1MI5B 5E1HB 5D1XA 5GRUH 4X7TB 1XF4A 4WW2C 1INQA 4CADA 3CVHA 3RWFB 2DQCH 2BOBB 2VRAA 3MRRB 5HGHB 3QG6A 2V5TA 2NY2D 3I02A 2NW2A 3VH8A 1R3HB 4NUGH 2MKLC 3T3ME 2WBJD 5JIPA 3UAJD 2GYSA 1W72B 3B2UD 3CFKB 2FZ3A 5FYJU 3G9AB 1FFRA 5EBMB 1MAJA 5E6IC 1NBYB 3L6FA 3SDDA 5CBAB 5EU7C 2VE6A 1AHWB 1JGDA 4OCYH 5KS9B 1AFVH 3KPQA 4FMKA 4PRAA 4XP1L 1G7HB 1G9NH 3KPLB 5FUOH 5J1SC 4OZIF 2YA1A 5F93C 1Z5LB 1KXQE 4HKZA 5IUSA 4YQXL 5TFSL 1MHPL 4RGOH 3O3BA 4D0DB 4RDQG 1NSNH 2YD2A 1EH9A 5E2UL 2NLJA 1ED3A 3INUL 4LLDA 4XAWL 1FZMA 2H9GB 3TH3T 4WHYH 2VERN 4OZGF 1XR8B 4S1RL 2EC8A 5DF0A 3V5KA 3MOQA 2N56A 3UTZA 1WBXA 1B3JA 1OTSC 3GJEA 4DTGL 1KEGH 2XN9A 3NACH 4JN2B 5EZOL 3GM0A 5IR1B 3I85A 1OAQL 4K3EL 4QXWA 5IHZB 4ZO7A 4S2SB 2NNAA 1EUUA 2YN5A 3UJIL 2G5RA 2B4CL 5DGRA 1S9YB 3C08H 3P4MA 2Y1VA 3GRWL 1NCAH 1EXUB 1FIEA 4QRPB 1U8NB 4ZOCA 4U6XB 3ARXA 4X4YB 4YHKH 2C9AA 2BSRB 3C8DA 1UB5A 4XNQA 3G08A 4V1DD 1A6AA 1BD2E 4FFWD 4UDTB 4UQ3A 5C0BE 1AP2A 3SE3C 3IFPA 2A9ML 5C3LD 4LLUA 4U3HA 3ZDZE 5EBWA 5BS0B 1HH9B 2WP3O 3KNBA 5DD3H 1Z2KA 3VJ6B 1A21A 1NLDL 5EA0L 3VW3H 1DQLL 3QUXD 2GKIA 2AQ1A 4YWGH 3VXMD 4G9DA 1CICB 1G6RA 3FONA 3MJ7A 4YHOH 4L8SA 4YPGA 4O9HH 1BQLH 1MAMH 1YJDC 4U2ZA 3TPUB 2IBBA 5D96B 5GRVL 4GLRH 3GMOB 2DIAA 1CXEA 5KZCD 1FG9C 3X14B 1B0RA 1PKQB 1BVKA 3QQ4B 1NGZB 3G5VA 1CTNA 3WLBB 3O6KL 2HJLA 5F9JA 1A4JA 2V7HB 3QSKB 5F72S 5F89B 3GJFH 3QFDB 4LLVA 4O2EA 5C7XH 5E6ID 4UIKL 2D31B 5F1NA 5AZ2H 5BQ7B 2DDQH 5JQHC 5LGHL 1DL7L 4YGVA 3B9KA 4R90L 9CGTA 4MNHA 4QEGA 1P7QA 1BD2A 3SOBH 43CAB 3T3PE 1N5YL 1RFDH 1QFWH 1XH3A 5IEKA 4PJBB 1NEZA 4L4VB 1EERB 5EO1A 5J9PA 4JHZA 2PN5A 1KN2H 2BCKA 4ZFZA 1IKNC 3SN6N 4CN4A 3U30B 5DC4B 3QHZL 3TZVA 1W0VA 4HG4K 3ALXA 5D1XC 5J1AA 1OTSD 3GMPA 1IGTA 1EHXA 2GCYA 1LO0H 4E5XB 1AQDA 3HPJB 5E9DB 4AK1A 3FO9A 4OLYL 1ZHKB 4OGYH 3L3IA 3IKKA 1FPTH 3TO4A 1UA6L 4PGBB 4PY7A 4CMHC 1BFOA 2R0LH 2BNRA 3P73B 4WI7A 3EOBB 3O6ML 4K07A 3DX7A 4WTZG 5BRZE 2GSGA 3OKDB 4P5MA 1Q9KA 1JPTH 1K8DA 4J3XA 5CS7A 3T4AA 1GC1L 4GUPA 2C4FT 2FATL 2UZIL 3MRMA 4IDJH 5DTFB 2Q76A 3VRLE 4P23C 5GJSL 3ARFB 5DJ6B 1B6UA 4JKPL 5MI0B 4WHCA 4F3FA 3EOAB 1K4DB 4K3JL 5BCAA 5LCVL 4PJXF 1RJYB 4EVNB 5T1DL 4ONHA 5AUMB 1S7QA 4HUNB 5F1OB 5IV2B 3E8UH 2XXCB 5DJAA 4DVBA 4X5WB 1A7NH 1Q8MA 4ZAKA 4OCXL 5IMOB 2YK1L 4ELKB 1OD9A 3O9WB 1JHLL 4ZS7L 5ALCL 2GK2A 4UT7L 3C5ZB 4OFYA 4WHDA 3DXAD 3P11H 3NIDE 3O3DB 4U0RB 3LQAH 3MRDA 4U3XA 4WI4A 3CX5K 1IKFH 1J1OL 1DCLA 4Z7WB 1U91A 2W9LA 4XCYB 2VDQH 3FB5A 3QWRD 1RZFH 3MNWB 4F33A 3GSWA 3WFHA 3BGFB 5I8KL 2HA1A 3MX0A 4EDXA 1FNEB 1MCRA 2QLVB 3VXOA 2XZQL 1F6AA 5E8EA 4UTAH 2COQA 3P3YA 1I1FA 4JO4H 2AJUL 3U4BH 3TGXA 4XB8A 2PF6A 2FHBA 4RWYL 2OTWB 2ICWJ 2I07A 2L7JA 3V4VL 3MPCA 2ATPB 3DNKA 5DD6B 4QY8B 3LCYA 1KJ2A 2Z92B 4M8VA 1HIMH 3U9UA 3C87A 3ULSB 4OLVL 2A9NL 1H3XA 1CFVH 4P2QA 5BOZG 3O0RH 1R3JA 3QDMB 1AXTL 1X4XA 4Y5XB 3KPRD 2ENYA 3TO2B 1UWXK 5GRUL 3QUZA 4G8EB 1H3GA 1SJEB 1U3ZA 4P46A 4Y5VB 4YHPB 1FFPB 2DQCL 4OD1H 4L8SC 2X1OA 5D1XD 1KXTB 4RMVA 3WUWB 3V4PH 4MQ7A 1DSFH 4NUGL 3KR3H 4GXVH 3GHEH 1RHHB 4F9PA 2BNQB 4TPRH 4P3CH 4E0RB 1JPFB 2YSSA 4UOW1 3NA4A 5ALBH 1UZ6F 1J1XH 2ZWLT 4PG9B 3ES6A 3OJ2C 1AFVL 25C8H 3SDCA 1OP5H 3Q3GB 5KSBE 4ZOBA 2ZNWA 3FB6A 3EYVB 2GUOB 5FUOL 4LSRH 3MGOB 4GMTH 2HFEB 3MLXH 1RZIA 3QG7L 3IDUA 4K8RC 4P23D 1J5OH 1EK3A 1T2JA 4RGOL 1NSNL 4HGKC 1KG0B 1BVLA 4U1JB 3IFNH 5GRXG 4BYHA 3AROA 1HDMA 4RBPK 3MRBB 2CO6B 4LRNL 4NQDE 3IU4H 3WNOA 4JZNA 1BF2A 2V5YA 3ARGB 3BPCA 3U7YH 3GSNA 3KYOA 1HSBA 4I4WB 5CP7A 3MRHB 4KMTH 3V52H 1EX0A 1KEGL 3HRZA 3NACL 4YDVB 2F74A 3MYJB 3TZVC 2HT2C 43C9B 1OLLA 3D18A 2PXYA 3N85H 1DQJB 4FXGB 5KAQG 4TYUA 2M26A 5IMMA 4Z7WF 1T5XA 2DQUH 2F5AH 4GKSA 3BP4A 3MREA 4GQ9H 5D8JH 2MWCA 5CJBA 4LLYA 4NQVB 3CU7A 1NEUA 5J06A 3C08L 5ESVB 2LAGB 5D7LB 1NCAL 1S9VA 2WM0A 2JJVA 1U3HB 4ELMB 4HKXA 2W0PA 1J9CT 2VQUA 4DOHE 2YD6A 4OKVB 4U1LB 3L9RA 3UROR 3D3VA 1U2CA 4U1MB 1NFDF 4UDUA 2R23B 1KCGC 3HHRB 1G7JB 4YZFF 5CZKA 5C6PB 1C5DA 5DD3L 1YEKH 1JYNA 1IAII 4G9FA 5I6XC 1VFBA 3VW3L 2WW8A 2DQDH 2XPGB 1B0WA 2Z91A 4YWGL 5ESQB 5FHAL 2W92A 4N0FB 4ETQB 3DO3A 3D9AH 4YHOL 4YHNB 5DC0A 1KCLA 4QHKI 4O9HL 1MAML 4NQDA 4ZAKC 3KHOA 2W59A 4QF1A 1TZGH 4K9EL 3QIBC 1KXVC 5GRVK 3VXQA 3MLUH 1QG3A 4HIIB 2EDNA 4AEIH 3WXWH 4Y2DA 5EZJB 3GKWH 5CEYA 3EZJB 5BJTB 1BAFH 1KT2B 1MF2L 1BLNA 4O58H 4U6HA 2XICA 1ND0A 3L3KB 3O41A 4IRJB 1N2RB 1YN6B 3ARQA 4LARH 4I5BA 5C7XL 5FDYA 3V95A 1ZT7B 2JJWA 4LVEA 5ENWA 5AZ2L 2ADGA 4NO2A 5DVLA 3TN0B 1OTUC 3BWAB 1I8IB 3GSOB 3L3OA 3MR9B 5A2FA 5L2KB 3EJJX 1IRAY 5ACZA 3MGTB 1FG2B 4Z7QF 3SOBL 1FC2D 1UB6B 1RFDL 1QFWL 3BWUC 3NCBB 4QYOA 1HHIA 5SWSB 4K8RD 4IBLT 3GZKA 3DO7B 1HH6A 1IGJA 5C08B 4U1GB 1P7QD 1BD2D 2VLJB 5C0BD 4FRWA 3SKOA 5B3JF 5LXGH 1I8LA 1D5ZA 2NY0B 4X6DB 1VCAA 3BP7B 3OHXA 3PGFH 3FN3A 3H9HA 1MCDA 3EAKA 1IC1A 3SDXF 5A2JH 1YECH 3QUZC 1LO0L 1NMAH 4P46C 4U31A 3TZVD 2HT2D 5I0ZA 4YR6B 4OGYL 1RU9H 1FPTL 4HIXL 1N6VA 4ORGB 2GTWB 4LSPH 1Y0LB 2CGRH 3U79A 4YFEA 3WN5C 4PJIF 4F7TA 2LE9A 4ODWA 4JN1H 1U93A 5JXEA 1JPTL 5KVMC 4EOWL 3GMRA 2IANA 3BKMH 5JW5B 5IKCB 3SDCC 4IDJL 4P57B 1MCPH 4WTZA 5D2LB 2IF7A 4HWBH 1K3ZA 3HI5H 5FGCB 2HFFA 3K8KA 1NQBA 4PRBA 1UGNA 2MPAH 4PGEB 2P5EE 3CSGA 5B8CC 2NY6B 4OB5H 2VLKE 2QR0B 1A6WH 4BA8A 3L95B 4ZYKA 3E8UL 2WQ8A 3WJLA 1WCBA 1A7NL 3KPOA 1R5IA 2FWOB 3LZFL 3ARDA 3OMZA 2CR3A 1F5WA 4U49A 1O7SA 4DZ8B 4FZEH 4CVXA 3QJFB 4ZAKD 4QXUH 5CJQH 3LQAL 1IKFL 1FL3B 3HA0A 3QIBD 2EO9A 1NH6A 2PXYC 2VDQL 4LP4A 4OFYD 2GT9B 2VL5A 3DWTA 3RTQB 2R2BA 2W60A 5E5MA 2ZUSA 5FM5M 5M7QA 5JDSA 2GIYA 5CP3H 3Q6FA 1M7DA 2QV2A 3GNMH 1UXSA 4OCRH 3LN5A 4JO4L 1U0QA 3MRQA 4P4RA 4NO0B 5E94B 3U4BL 1G9EA 1OTUD 2OR9H 5FCSH 3WNPA 5GXBB 5BRZD 3MLPA 2NY2B 2V2XA 5GSVA 2WBJB 1KB5A 3QYCA 3WS6C 2AV7B 2ZSWA 1HQ4B 2F53A 4JO1H 1HIML 2P5EA 4TVPE 4Y7MA 3HC0A 3C09C 1S9KC 5E03A 5E2WH 5CILH 3NIGE 1N7ML 3O0RL 3O2WH 2ERJB 4X6DF 4F8QA 1RJLB 2ZPKH 5CUSL 1JNNH 2E6QA 4QRUA 2RAMA 5K93A 4MWFB 3WKMH 2XY1A 1X3DA 2LTQC 1CDUA 1JPGA 5IHBA 3ULUF 1Z3GH 3IT8D 4JFEE 3V4PL 1DSFL 1RIVL 3QUZD 1K9TA 3KR3L 4GXVL 3GHEL 4P46D 3TP4A 5ITBH 1HXYA 5D93B 4Y2DC 1C1EH 4JO2H 4JZJB 3MBXH 4TPRL 4P3CL 1JYWA 1NBQA 3B9EA 1XAUA 3AS2A 5ALBL 4QRTA 1J1XL 4HW6A 4U33A 4HT1H 3X13B 1T0MA 3MRPB 2RR3A 25C8L 4DCQB 3CFEA 2X4UB 4H26A 1ETZB 1C12A 3QEGL 4LSRL 3H3BC 4GMTL 3MLXL 1AJ7H 3SDCD 3EW3B 5GRZA 3KPSD 3MRNA 3WL9B 3BP5A 4NZDA 3GMNA 2CIIB 1J5OL 2J8UE 1R24B 1VGKA 4FXKB 4GS7B 5CZVH 3GJFB 4H5SB 4P5KB 3IFNL 3ARPA 4LCUB 3VFPB 2YWYA 4HHAA 4QLRA 2XYCA 3GMQA 4YIQB 5L8KB 4DUWA 5DQJB 3IFLH 1I8LC 4W81A 2VUOA 3EFFB 1HHHB 4KMTL 3V52L 5I1JH 3MV9E 4NOBA 4V1DB 4F58H 2X4QB 2ICWB 3N85L 1DLHA 1G1CA 5ADPH 2F5AL 1H15A 1VADB 2DQUL 4GFTB 3S35X 3VFUA 1CGSH 4JFEA 5DRWB 2Z35A 3L5WB 4GQ9L 4PJ9C 1WFNA 1Q9WA 5D8JL 4PBVC 3W9DB 2PXYD 4PLOB 1A3RL 2PCPB 3D0VB 1A7QH 2QKIB 3VXMB 3PWNB 3MUZ1 4MVBA 3IJHB 4ZUVB 3T0BA 5CD5C 4ZFOL 4PGZA 4L29A 2E3VA 1GGBH 5JXEC 3R0NA 1TNNA 4WW2B 3WCYA 3T65A 5HYEA 4W6YB 2I24N 5IG7A 1K6QH 1YEKL 2A1WH 1QSVA 2J8UA 1M71A 4B0MM 1QBAA 2P47B 2DQDL 4PJCB 1S7TA 5INDB 2DYPA 4A2LA 4JZOA 5D5MF 5L6YL 2CLVA 1KC5H 5E6IB 3RIFF 3WEXB 4GT7A 3T0VA 2FIKB 4KXZH 3D9AL 1LE5B 5FUZL 5H94A 5JUEH 1OCWH 3QULB 5JW4R 2D7PA 4O00A 2VC2H 5D72H 3ARDC 1TZGL 3LQZA 5BVJB 4HPOH 3VFSA 3MV9A 4JCMA 3HUJE 5ICXA 1ZLSH 4AEIL 4EIZC 4NQDD 3GKWL 4Q58C 2C3HA 3VXTB 3SDYL 2DQJH 1BAFL 4NN6C 1MRFH 4WDIB 4O58L 4X7FC 1CE1H 5FGBC 1GXEA 1G84A 4DK3A 1IM9A 2P8PA 4TN9A 4Y2DD 5CD3A 5E08H 4OBRA 4LARL 4U6TA 5DYOB 4LHUG 3GJFK 2O5XH 3H3PH 3M17B 3THMH 4PD4J 5M94B 2J6EH 5AG8A 3EBAA 5HGAB 1E27A 5HGBB 2ITDA 1T0NB 4OLUH 4X9BA 1KTLB 3WLWC 1AKJA 5EH1A 5MERB 5GS0C 3S4SA 4P3WA 4MYWB 3C8KB 2DQEH 5BMFH 1G7LA 1M6OB 4F9LA 3OX8A 3FHAA 1MCEA 5GRJH 4L3EE 1A7OH 3R1GL 5LXGL 4X99A 3FB7A 1QACA 2UYLA 3G5ZB 2X40A 4BM7A 1F4HA 3HI1B 3AAZA 1V3MA 4XNZB 2AK4E 4EJ1C 4HCRH 1NMAL 1CE6B 4WJ5A 2Q86A 1SEQH 3NZHH 3VGBA 4JLRB 4YEEA 1RU9L 3RPIA 2MJWA 3K4ZA 3HUJA 2DMCA 3GI9H 3F7PC 4LSPL 4F7PA 3UPAA 4Z7NF 3LKNB 4PJ9D 4C83B 2BOCA 3CZFA 4QXTB 1CD8A 1RAMA 1IARB 4ZSOA 5C8JB 2BHYA 3U4EB 1CVSC 3BKML 5CINH 1QPXA 3TIDA 4Z7UF 5CD5D 1FVDA 2VWEE 1ORSB 4C56E 1QLFB 2X09A 1MCPL 3QUKB 3KS0H 5JXED 4HWBL 3BH8B 4ZDHB 3HI5L 2D2OA 2MPAL 4Y2OA 1A6ZB 4NZRH 5IIEA 4OB5L 4OLEA 5DFTA 1A6WL 2K3TA 1LK3H 3TFKA 4OF7A 5INCB 5FYLH 4ZNEE 4UIMA 3NCEB 1ZOXA 1JZ2A 3K1KC 4HUWB 5CAYB 4HUVB 1TQCC 4NSKB 4FQXB 3RI5F 4U1IA 4QXUL 1IAMA 5CJQL 3ARDD 2IADA 4ODTH 4IIQA 3OSKA 1OF2A 5C1MB 3MGAA 4Y88A 3B3IB 1JGEB 1YPZB 4GRMB 3JVGC 3S6CA 1YZZA 3DECA 2Q6WA 5E95B 4R2GC 3D39B 4Z8FH 1KYOJ 4AM0B 1TJGH 2X4RA 2OR7A 4OM0H 3GNML 2LU4A 1LNUA 2BRQA 3KPRB 4ISVB 4OCRL 4KRMB 4OCSH 4OZHF 1WWBX 5IQ7H 2K7QA 2XTJB 2OR9L 2ZCKH 3EFDH 5FKAB 1XF4B 1INQB 1NAKH 4XNMB 4ODXA 3WLWD 1S9WB 5GS0D 5HPOA 3AY4C 4O2CA 4JO1L 3I02B 1WC7A 4HJGA 1MCNA 5CILL 1G7IA 1QTYT 4CMHB 5FHBH 6CGTA 2F5BH 2ZPKL 4ZFOB 2P5ED 1XF3A 3RWDA 1JNNL 1MFBH 1V7MH 4YH6A 1IEHA 2LVCA 3ZKSD 2VLKD 3UTSE 4CJ1A 5EBGA 3OKNA 1Z3GL 3KPQB 2DQHH 4PRAB 4NO3A 4P23B 1FORH 5ITBL 3S8WA 2IFGA 4O2FB 1RK1A 4UQ2A 1C1EL 4JO2L 4HKZB 3MBXL 5C2UB 3FFDA 3H9SE 5EIVA 3TJEL 4HT1L 1S7VA 1B88A 3O3BB 1DE4A 2DL2A 1Z9LA 3OPZH 5F7UA 5EBLB 2FO4A 1ED3B 2FHCA 4LLWA 4R0LA 4RMQA 5B39B 1OP5K 3KS0J 1UH2A 4XCFL 1AJ7L 5ELIA 5F7EH 3EYSH 2VH5H 3E1F1 1FNHA 3DUSA 1BQHB 3LY6A 3BDBA 3QNYB 2Y36H 5F9OH 4J8RA 5DJZA 1AD0A 2Y23A 2A74A 4U0QB 2FYYA 3ZYJA 4F9LC 4L4TA 3VXSE 5GGVL 3IFLL 3HI6H 3WDJA 1KJ2L 4LCWA 1J0ZA 3P4MB 4JFDB 4NZJA 4Y16C 5I1JL 3IJYA 3HC4H 4F58L 2E7BA 2DM3A 3UTSA 5I1EL 1LQSR 2GJZA 4DAGH 5ADPL 5DGQA 4NNXB 3DGCR 1YPZF 3P9WB 2CK0H 2GAZB 2AV1A 1C16B 5FFLA 2C3GA 4HD9A 5SX4I 2QSVA 3MYZA 1AGCA 3QO1B 1A7QL 1T1ZB 4JFED 4NQCB 4R2GD 1N8ZB 5IB4B 1FVCB 3KXFE 2E27H 1IILE 3QAZB 4HPYH 1MREH 4HGWB 1HILA 4D0CB 5HDBF 4EI6B 3MO1A 1GGBL 1MRCH 3L3JB 4G9DB 1TMCB 4IHOB 3ME0A 3ZYIA 1S7SB 5C9JB 3H7BB 4L8SB 4X0KB 4HC1A 3B2VL 1L0YA 2J7LA 1RQ5A 1K6QL 2A1WL 1I3VA 3S3PA 3F65A 5I16B 1BVKB 1S7XB 1QKZH 4MX7A 1DZBA 1IAIL 1MHEB 1OAUH 4IMLB 1KC5L 3SJVE 3H3KA 3TFKC 4G42A 2X4NA 2WUCH 2I5YH 4NO5A 3S3SA 3VXSA 3IDGA 5JUEL 1OCWL 1K4CB 2DYPD 1JF6A 4KKCC 4EZMA 4CNIA 2VC2L 3QCTH 4PY8J 4H0GA 2E8YA 4HPOL 3RHWK 1DANT 4FG6C 2DQJL 1MRFL 5T5FH 1X7QB 3DETD 1CE1L 2EYRB 3RAJH 2WP3T 1TLKA 3MV9D 5E08L 1BD2B 1P9MA 5C0BB 3SE9L 3IDMA 1A9BA 4C57C 4X7SH 1VFUA 3CFJA 5EO1B 2O5XL 4TNWF 3FQUA 1J86A 3H3PL 3UJTL 1IM9D 2LABA 2YD1A 2BC4A 5DJXA 3THML 1D6VH 5TE6L 3VE0A 4OLUL 4OZ4B 4LHUA 4GRLC 3AS0A 5I8OH 5EIIB 3A67H 5J1AB 2YPKB 1RZGA 2DQEL 4XPAL 4Z0XA 5EG6C 5BMFL 3GMPB 3GK8H 1J18A 1AKJD 5D6DC 2D7TH 1U36A 5GRJL 1Q72H 3P9LA 3NABL 4X6FB 3REVA 1WFOA 1IQDB 1QZ1A 5EUKB 4UV7L 3T8XB 5AEAA 3ZTNH 4FTVA 3SJVA 1BFOB 4CDHA 4WGVB 4PREA 1NBZA 5C92A 3MRJB 4XGZB 1MJ8H 4Y16D 2HLAA 4KZEH 1SEQL 4M1GH 4CN6A 3NZHL 4GUPB 1JZ5A 1T22A 4U7SA 2Q76B 3QH3A 3LRSB 5T1MB 5DSCB 3GI9L 1MCIA 1T4KA 2Z93A 3HAEG 1GAFH 3CH1B 3H2WA 5I6XB 3QI9B 3Q5TA 1X5LA 3ZSSA 1A7RH 2ADFH 3G5XA 3FO1A 5IW3A 4FZ8H 3QP3A 1KF9B 3NCCB 5CINL 3IB4A 5E4EC 4K94H 4OD3H 1NPUA 5DJAB 1BHGA 2AJ3B 4R0LC 2BY3A 5EORH 3NFNA 4ZAKB 5C0CE 3K0WA 3MA9H 3QIBB 1LE9B 4NZRL 2ARJQ 2QHRH 3FCTA 1QLRA 1C7SA 4G6MH 3VD7A 3RUGE 1CDBA 4GKNB 2WNGA 1VACA 5FYLL 4RGNB 2EC9U 5MEOB 3GSVB 4ONOA 3G6AA 4RAUA 2K1MA 5F88B 2ZUVA 3WBDA 3TFKD 3FO2A 5CZXC 5D7SH 4KKCD 3PV6B 4L3ED 1AH1A 3D1MC 5BRZB 1RUPH 3EZ8A 4YDIH 3N1GC 3OKKA 3LN9A 4LMQE 4Q9QL 2CLRA 4XBPB 4FG6D 5I1AB 2AK4D 2DICA 1A3QA 3TV3H 5HHQA 4Z8FL 2IPKA 1TJGL 1KNOB 4S1DC 2CIKA 1KJ2B 2X70A 4OM0L 3ZDZF 4PLNC 5DQ9B 5E2JA 5I74B 3U9UB 4MZ2A 1NBVH 2NQCA 4OCSL 3SGEH 2HN7B 5IQ7L 4MXWH 1LP9B 5IVZB 3OAYH 3LD8B 2VZUA 2HLFC 4RZCA 3EFDL 1NAKL 1SBSH 2FB4H 4GRLD 3VXPB 4P46B 2HFGH 2XV6B 5DQDH 4MQ7B 4C56D 3ZE1E 1CDHA 2CH8A 2PW1B 5J8OA 4HS6A 5FHBL 3RUGA 2F5BL 2Z31C 3IRZA 4JDVA 3WN5B 1V7ML 3S36X 1FFNB 3C8HA 5J89A 4ODBD 1U8OA 2YSSB 3QDGE 1RHFA 1DQTA 5BV7C 3ERYA 3RWIB 1CFNA 1N5AB 3KPSB 2DQHL 4OV5A 1WK0A 3WIIH 3LDBB 5D2NE 4P9HC 2CLZA 5B21A 1RZIB 5BZDA 5JHLL 5B8CB 1SYVB 3HZKB 2HP4A 1PY4A 1RJZB 4WEBH 1VHPA 3T3PF 4FQIL 3OPZL 1HCFX 3OJDB 4UNVA 4JQVA 2KZWA 3WS3A 2VLME 1C5BH 1MHHA 4JZNB 1BBJA 2JIXD 3EYSL 4BFIA 2VH5L 5DDHA 3UJJH 2VISA 3SEPA 1RVFH 1L6ZA 4UTBH 5JHDE 3PWVB 1NJ9A 2EICA 3EUUA 2Y36L 5F9OL 3IKCA 3ZT5A 3O2DH 3WXVL 1T5XB 4GKSB 3RQ3A 1TVBA 3RVUC 3F12A 1CGVA 1IE5A 1JRHH 1I1YA 5FYKH 3OR7B 4JPIB 1MAKA 3HC4L 1BJMA 1J87A 3EYOB 3OJVC 2QQQA 2YD5A 4LHQB 5DD0L 5CZXD 2C3VB 3QDGA 5SX5H 1AIFA 1OT1A 3STLB 2BSSB 2X41A 4XP9H 1S8DA 2CK0L 5KSBB 2XWTA 3UTSD 5D2NA 2XA8H 4TSCH 5F3BA 1D5BA 3VG9B 4M7LL 1FQ9C 2AEPH 4LMQI 1NDMA 2E27L 3MQIA 1T7VA 4ZQKB 4S1DD 4HPYL 1MREL 3RDTC 3NZ8B 3SY0A 3QUMH 1MRCL 5FO9A 2P5WE 3H9SD 2YXMA 5F44A 2HLFD 2W0FA 4QGTA 2EIZB 3VCLB 1FVEB 3N0PB 3VGEA 4QF1B 4GAYB 5HJ3A 2W0KA 2IQAA 4NC1E 4AT6B 1QKZL 4Y2DB 3RU8L 5JHDA 3BXNA 3NIDF 4UT9H 1OAUL 1BLNB 4GW5A 4AL8H 2D9CA 5HYJE 1B4RA 2G60H 2WUCL 2I5YL 3WMSA 2Z31D 1EEZA 4N9OB 2I60H 2DQGL 3SKMB 4JFYB 2DLFH 3MJGX 4I5BB 3QCTL 2WLYA 4IEFB 2EE3A 1UCBH 1KCUL 1PSKH 5ENWB 3VXSD 3FN0H 1EAJA 3MCKB 1I8KA 3GBLA 4KVCH 4ACPA 2QQLL 5F6HJ 1XCQB 2WANA 3I3DA 3RAJL 3ZDXE 4DOHB 4OSUH 4DEPC 5IWLA 2Y07L 3OL2A 4OCLC 3U46B 4QYOB 1HHIB 2AI0H 4EI5A 4X7SL 1MCSA 1T1XB 1X5FA 4NRXA 1KYOK 4RFOL 5DHVH 3SKOB 2CUIA 4HS8H 5D6CB 1DN2A 3VFGH 1WCQA 5DHXB 4RISL 3OTTA 4W4NA 3ARSA 5HHPB 4RDQF 5JORB 2P5WA 3KXFD 4G3YH 1ZVSB 3A6CH 4HH9B 1XIWA 4LHUD 2D7TL 3KPNA 4NRYA 4PJ9B 5FYJE 4NM8H 1Q72L 5IHLB 2ZOKB 2D3VA 5I18H 3C6LC 3GI8H 4YBLC 3DV4A 1WIOA 4PJ7E 4K3DL 1J7VR 3RVUD 1HHGB 3OXSB 1I1RA 4ZUSA 5FA4B 5HYJA 4F7TB 3MRKA 4ODWB 1AGDA 1MJ8L 1MJJB 5BW7A 2D03H 2W9EH 3SJVD 4U1NA 3K8LA 3C5JA 1CZ8H 3LMJH 5L7XL 4M00A 5KSBF 1I3GH 3P4LA 4NN5B 2CSPA 2EYSA 1EUTA 2QHLA 3P0YH 1ZGLM 5DFVC 1A7RL 2KUTA 4K3HA 2ADFL 5E8PA 2LU7A 1G9MH 1SY6A 2VL4A 3BZFA 1N4XH 4K94L 4OD3L 3RDTD 3HAEA 4JQVC 3ZYOA 2XKUA 5F3HA 3ARDB 4OGZA 3T2QA 4TOYH 1F8TH 3DX6B 4G6ML 4NN6B 4JKMA 5TDPA 4FABH 4R3SA 4ONFL 1FYHB 4KZDH 3NCYP 1XEDA 1MWAA 2R2BB 3ZLQC 2ATKA 4GBXC 1V5JA 5E5MB 3BPNC 3L3GA 5JDSB 4PJ7A 4QHMB 2OXHA 5D7SL 3Q6FB 2JB6A 1MCFA 1RUPL 4Q7DA 4YDIL 1H5BA 3O6LL 3KWWA 1YY9C 3KYKL 4U6YA 1NKRA 4OF3A 3QDHA 2FX8H 2DRUA 1FLRH 3TV3L 2ICEA 2X4SA 4NQEA 2MOVA 3LRHA 2X1PA 5D2NC 2H32A 5J4MA 3QIUA 1T7ZA 5SV3A 3TCLA 2VMFA 3CC5A 1NLBH 3VXUD 3HG1D 1HI6B 2VLKB 5HVFB 2F19H 4MXWL 4CU8A 2PNDA 1TITA 2Y7QA 1J1PH 1SBSL 2FB4L 3OKOA 3R0MA 2HFGL 5ID0B 1JPGB 3L7EB 1FL6A 3IETA 3RX7A 4I0KA 3CAFA 5BXFB 1M7XA 5C0CD 4JPWH 1ZHBB 1MCLA 1HXYB 3C6LD 2EYTB 2F15A 3RNKA 4BQ6A 3KDMB 4QRTB 3S88H 3KYMA 3G5YA 3O8XA 1F00I 4BSWA 1BJ1H 4LVOB 4MQXC 1O5DT 2YEZB 3HR5B 2XRAH 5JLZA 2R4SH 12E8H 1KIRA 2ED7A 4HFWA 1S5HA 1LK2A 3SE4A 3MJ6A 5HYQA 4FFVC 2CRMA 1YNLH 4Q2ZA 4QNPE 5IWLC 5GISH 4NFBA 1NGWA 5DFVD 3F6IA 4EI5C 4DQOH 2R8SH 1A0QH 2H3NB 5GHWH 5D1QB 1JF1A 1UZ8A 3MLWH 1C5BL 1XF5A 2HRLA 3F7YB 1ZA3A 4XPBL 1KELH 4WUUE 1HCVA 1E6JH 1S7WA 1BFSA 2DWEA 1RVFL 4UTBL 5IBLC 1F11A 1OQOA 2J12B 3D0LB 4OIBA 2OL3A 1CD1A 2J88H 3O2DL 2X42A 1H15B 2SEBA 4M7LT 3CMOL 1BEYH 1FYTB 4JFEB 4R2GB 3RY5A 3TBVB 1EEYA 1QSEE 4P5TA 3IU3B 5FYKL 4HIHA 1P1ZA 4GBXD 5IK3A 2VQ1B 4X4ZA 4MB4A 2FH6A 3KLSA 3QQNA 5E99H 1IC5H 1JWSB 3KPMB 4WNQB 3DVGA 5T5NF 1UCTA 5BW7C 3EKCA 3OZ9L 3G04B 1YY9D 3T0EE 1AD9A 4G7YL 3QDGD 1X4ZA 3P4NA 1RUAH 4EBQH 2DM2A 1MVUB 4R4BB 4TSCL 3UDWA 1OQXA 3DURA 5H2BB 2R0KH 5IG7B 3J8F7 1MSPA 5DJ8A 2DYPB 3QUML 3RRQA 4D8PA 3G6DL 2HYMA 3LSOA 3PWUB 2XIDA 5JOPD 5CWSB 1KSRA 1FGVH 4Y4FB 1A9EA 1K8IA 4U7KA 35C8H 4GG6B 4WUUA 4A6YA 1UT9A 4XCEA 2VLMD 4NFCA 3VFSB 4OGXH 3MV9B 5ICXB 4NYLA 4UT9L 5IEHA 3VFOA 3L5XH 5HVWA 2OCFD 5F6IC 4AL8L 2C1PA 2G60L 2CUMA 1KEML 1Q0XH 2DKMA 2P8PB 2I60L 4GRWH 1SJVA 4L9LC 1QSEA 4Y19A 1BJ1J 4QT5B 3KG5A 3BZ4A 1PKOA 1UCBL 3VFWB 3FN0L 4MQXD 4HLZH 1H5BC 2ITDB 4CVZB 1LO5B 4OSUL 1S7RA 4KK6C 5DEFA 3T0EA 4PJHA 1BQUA 2YMXL 5E0QA 3TBYB 3AUVA 3V6ZB 2AI0L 4LQFH 2V7NA 4K7FB 4MD5A 3OX8B 3BO8A 4OI8A 1ONQA 3Q48A 5CMAA 2CQVA 4EI5D 3VFGL 4NQTA 1OGAE 5T3ZE 2ARJA 3NIGF 4Y16B 3WFCH 1IT9H 2XZZA 5J6HB 3BEVA 5KG9B 3A6CL 1A1MB 1UADC 2KZ1B 5IBLD 2P5WD 4M3KB 4NM8L 4Z77A 5I18L 2W91A 3GI8L 1IEBA 1A1NB 3HUJB 4TSAH 4JR9H 4M6OH 3HKFA 4FFZH 1WV7T 5F9DC 2NZIA 4R26H 2IC2A 3CZFB 5KAQF 4PJAE 5DD5H 4CJ0A 5LBSH 4MD4A 2W9EL 3VD5A 3O8XC 5HYJD 1CZ8L 3LMJL 4X83A 3ILPA 3QFJE 2B1HH 4M4RA 3U2SA 4G80A 4MA8H 3WHE1 4C55A 3F5WA 1CDCA 4JRXE 5EC1A 3SE4C 3RWHA 1G7PA 3QXTA 3IDYC 2J8UF 1G9ML 1Z0MA 3BT2H 4L3CA 1N4XL 4KDTC 1J8HE 3B5TA 4L3EB 3T4YB 5D7IE 3V0AC 1OP3H 1F8TL 3BVNA 4U1IB 2VXTH 3FO0H 2AK4B 5T1LA 5IB3B 3WNNA 4M7JL 3CSYA 3KLAA 4RGMB 5IFJA 5GS1A 4KZDL 4X6CB 3MJ9A 3ROOB 5CEXB 3TYFA 3CDGB 4RMWA 2QEJA 4JRYE 5FYJD 4RFEB 3RVXC 4M6NH 1FN4B 4PJAA 1U8LA 2XFXB 4X9HA 3HNTH 4GRLB 3TH4T 1JTTA 2OSLA 2Y5TA 3REWA 1HKFA 2FX8L 3QFJA 3D25A 1FLRL 1V8HA 2V2TB 1OSZA 1V3JA 4C56B 3STZB 2OJEA 4KK6D 3LB6C 2R29H 4JRXA 4MSWB 3UDWC 4IRSA 5KS9E 2EIBA 2BVOA 3VGFA 1BIIA 5L2JB 1FAIH 3FOMA 2F19L 3VWJC 4NKDA 1VERA 5IROA 4MD0A 2CMRH 1J88A 1D5XB 1FP5A 2CDGA 5IVXE 5HHNA 3ZE0F 2WBWB 1I7RA 2X89A 1YMHB 1HXMB 2NTFA 5BZWB 2AJVL 5C9KA 2X44D 2HRPL 4XZUA 3O3AB 4PRPE 3SBWA 3MJ8B 3HUJF 2XY2A 3V7AG 1ZANL 2JJTC 3KPPA 3OKMB 3QUMB 1IVLA 3EGSB 3WUWG 3HNSH 3S88L 1MI5A 5IP4A 2NY1B 4PJFB 4X7TA 5E4EB 2R4SL 2JIXB 4LLWB 12E8L 4M5YL 4JRYA 3RWFA 1EHLH 4QO1A 3SQOH 2EDFA 1F3DH 2BOBA 3O8XD 3ORJA 5J6GB 4MLSA 3MRRA 5HGHA 3AS1A 4PV8B 2JK5B 1R3HA 3MMEB 4ERSH 1AE6H 3BRGC 3DUSB 2FGZA 1W72A 2JJUA 3T0EC 1AGEB 3CFKA 5K9JH 3P30L 5EBMA 4I48B 4DQOL 1NBYA 2R8SL 1T7YA 1KCKA 4HEME 1A0QL 5GHWL 1SYSB 1FNSL 3MLWL 4BFGA 5CBAA 2FYYB 1ZLVH 4LK4A 5KS9A 5MP6L 1QBLH 1IGCH 1KELL 1RUMH 1SVZA 4CUCA 3KPLA 1E6JL 4NNPH 4UOW0 3UTTE 5BS0E 3FZUC 1Z5LA 1UEMA 4KRNA 2J88L 3QCVH 1JNHB 1WZMA 2FX9H 1P5VA 2R56H 1BEYL 3MC0A 1QFOA 1TJHH 1FRGH 2AV1B 2V9TA 4PRPA 2H9GA 1K2DB 1MNUH 4XVSL 5ANME 1QRKA 3VFMA 1AO7E 3RGVB 1XR8A 3RFZC 3TPUE 1IC5L 3H9SB 4KV5E 3RVXD 3KLHD 1HILB 1VGEH 1U2HA 4JN2A 3MO1B 3T77B 5IR1A 5SX5K 1B0GA 4HUXB 5GGTA 4KRPC 3B8SA 4YDLC 5IHZA 4KVNH 4RMTA 1IMHC 1RUAL 5ERWB 4ZTOH 4S2SA 2ZUQC 3LKOB 1DVFB 2R0KL 1F90H 1F42A 1DUZB 4JVWA 1U58B 4JY5H 3LB6D 1S9YA 4PP1C 2Z31B 1EXUA 1U8NA 4U6XA 1AI1H 1PLGH 5T1KB 4KFZC 3VWJD 5IJKA 3VXSB 3IDGB 4PRHE 1FGVL 1QVOB 2OM5A 4UDTA 4CNIB 35C8L 1VDGA 4PJBE 3PG2A 4L4VE 4OGXL 5BS0A 2KBGA 1HH9A 4FQCH 5EO0B 3LEVH 3VJ6A 4I2XE 4G6KL 3L5XL 4WUUD 5I19H 2X05A 2N7BA 4L8CB 4YFDB 5GS1C 1NDGA 3BZEB 5ANMA 2R0ZH 1UVQB 3RVVC 1AO7A 3IF1B 1F3DJ 1CG9A 1Z9OA 2P24A 3TPUA 2BC4B 1QSED 3ZMRA 3KXFB 3GMOA 1Q9LB 5K9OA 3X14A 2Z4QA 1PKQA 1V7NL 3EDJA 3QQ4A 1FCCA 2OI9C 2X9YA 1NGZA 1RY7B 3RJDA 2V7HA 4LQFL 3UC0L 1KBGH 5F89A 4QCIB 4HJ0C 3QFDA 4MXVE 3T0ED 4TSBH 4BH8A 1F6LL 2D31A 5TGBB 2DI8A 3WIHH 2ZUWA 5BQ7A 5L9DH 5IROC 3HE6A 4PREB 2JELH 4PRHA 2R1WB 4I77H 3FZUD 43CAA 2E8ZA 3WFDH 4AY0A 4PJBA 3HS0B 1BF8A 4L4VA 4LNRB 5A43C 4JR9L 4M6OL 4OF8A 4KRLB 1U8IB 1T4KB 1ZSDA 2E6JA 2Z93B 4D9LH 4N0YH 4E41B 3DVFA 3X11B 5DD5L 3RDTB 1DBJL 3DUHA 1A6UH 2GI7A 4HWZB 1FNGB 2R1YA 4ZFGH 4E5XA 4MA8L 1WISA 3HPJA 2OP4H 4KMLB 4FQQB 5I0DA 1I9IH 2NTSP 4KRPD 2CXKA 2KL6A 4LVNC 1QLRB 1QRNE 3IJSB 3P73A 3EOBA 1X6NA 2CRIA 3BT2L 3PWLB 3OKDA 1PY9A 4F7EB 1J11A 1VACB 4HWUA 4PP1D 5HVHC 4ESKA 1BX2B 5AWNH 1MJ7H 5I1LA 2YRLA 5LGJA 2YC1B 3BKJH 2EH8H 3AM8A 5HDLA 4XBEH 3WFEH 1WICA 3GFUA 2ZJSH 1J0JA 3ARFA 5DJ6A 2VXTL 3EOAA 3LS5H 1K4DA 1OGAD 1G7MA 4DEPB 5T3ZD 4LPXA 1RJYA 4EVNA 3NCJH 5T1LD 5IV2A 3VXUB 3HG1B 2HKHH 4KKNA 2V9RA 3O2VL 5EC2B 1I1CA 3V7AE 4WEUD 4M6NL 5IMOA 4ELKA 4LAJH 1LDPH 3RVVD 3O9WA 4PIRF 3HNTL 3C5ZA 4WHYG 5F1IA 3DGGB 3P4OB 1T1YB 1VEMA 3O3DA 4Z7WA 5HHMB 4GQPH 4RFNC 2DTSA 3SE8L 4X9FA 4TTGA 4LF3A 2BNQE 4XCYA 5C0CB 4LPUA 2AEIT 4S1SH 2R29L 3MNWA 5HGGS 3C6LB 3TBWB 1ZWIA 1FNEA 1H3PH 1FAIL 3V79C 4HJ0D 5B38B 1N6QH 1YEIH 4JRXD 3SO3B 1ITBB 3I9GH 2CDEB 2AXJA 4KKBC 4NQUA 4OUUB 2EDHA 2OTWA 5EOCH 3JTSB 3I2CH 1CFNB 2ATPA 1J8HD 4QY8A 3MRLB 1CL7I 2Z92A 1DR9A 2X89D 1CIUA 3GRWA 4OQTH 3ULSA 5BZDB 5K9QG 2RFXA 1M7IB 1D6EB 2YPVH 3RWJB 2AS5M 4Y5XA 3MCG1 3TO2A 3QA3B 2O61A 1X44A 1E4XH 4MNGB 3ROLB 4G8EA 1SJEA 4Y5VA 4YHPA 3S96B 3TLRA 3BPLC 3SQOL 4B7LA 1MFAH 3BKYH 3LN4A 4YO0B 3WUWA 4YGAB 5EU5B 1BBJB 1FBIH 4JRYD 1RHHA 4TQEH 3UZQA 1SQ2N 2K9UA 1AE6L 2LFGA 4X98B 2FX7H 5K9JL 4GRWB 3RWGB 1BZ9B 2BNQA 1LD9B 3IKCB 1JPFA 4ELME 3U0PB 3TCXA 4PJEE 5ICZB 4PG9A 4GBXB 3BPNB 1QBLL 4GAJL 1IGCL 1J05A 1RUML 1SHMA 1UXWA 3Q3GA 4LLMA 1AR1C 1I85A 2GUOA 3VG0H 3JSSA 2Q8AH 4NNPL 2P4AB 3MGOA 2HFEA 1MELA 1LO2H 4NP4H 4WEMB 2YKLH 3HE6C 2RHEA 3UPRA 1GPOL 3QCVL 3QEQE 1ZXQA 2R56L 1HQRB 4V2CB 3U0WH 1KG0A 1P7KB 1TJHL 1FRGL 4U1JA 2XWTB 5FYKU 1D9KA 3CUPB 4Y4KA 1MNUL 3MRBA 1QYGL 5E5RB 1D7FA 3PNWB 3F7QA 2IH3B 3ARGA 4PRPD 2BXYA 1VGEL 1VEOA 2UWEB 4M61B 4YDVA 3SY0B 5ADOH 43C9A 2C7UB 1X5HA 3N1PC 4OF0A 2HWZH 1DQJA 4FXGA 1GZQB 4KVNL 2PKDA 4RX4A 3CFBB 3VGAC 5LQBH 2AKRB 4JY5L 4NQVA 4UT6H 2ZG2A 4HEPG 4U6VH 3CCHB 3MLRH 1FO0L 4X80H 5ESVA 3AB0B 2VXQH 3S5LB 3WJJA 5D7LA 1RV6X 2R2EB 3RUGF 1AI1L 1U3HA 4ELMA 1PLGL 5L2KE 3HLAB 4OJFH 3RGHA 4U1LA 4U1MA 1QQDB 3V7MA 2AQ2A 5B3NA 4KKBD 3UP1A 4FQCL 1F3JB 5C08E 1G7JA 3LEVL 4PGDA 4JG1H 4XH2A 2VLJE 2X1WL 1I8KB 2Q87A 5I19L 3UTTD 5BS0D 4NGHH 4LQ1A 4EI5B 2P8LB 5DUML 2IFFH 4ETQA 5F71A 4PUBH 5C0FA 2ID5A 5IJVB 4YHNA 3ZSTA 4DWHA 4W70A 3QDAA 5IESL 1S7UB 2VKXA 5JW4M 1IC7H 4EN3B 3PJSB 3O9WC 1FIGH 2DTML 1AO7D 4HIIA 1T2QH 5EZJA 1PX4A 5BJTA 4U0RC 1IZJA 1DLFH 4U1KA 1N3NA 3OGOE 5CGYC 5K33A 3IDNA 3L3KA 1H0DB 3K74B 1KBGL 1YN6A 2P44B 4NRYB 4TSBL 3SQBA 1ZT7A 3ZE1F 3WIHL 3TN0A 3CD4A 2UVEA 1CFSB 3BWAA 1GZPA 5L9DL 4DN4L 5D2LE 1I8IA 3MR9A 5JW4N 4ZUSB 5HYJB 1CS6A 5L2KA 4G8GE 3QDJE 1AR1D 2JELL 3MGTA 5E4IA 5EOTB 1FG2A 4I77L 2YRPA 3WFDL 4JFQA 1UB6A 1MLCB 4ODVH 3U9PH 5SWSA 3HE6D 5GGSB 3DSFH 3DO7A 3DRQB 2AP2A 5C08A 4PRHD 3LKQB 2VLJA 2B4CC 5C0AE 2EYSB 4N0CA 4D9LL 3U4AA 3EYQC 4L4VD 5DA4A 3BP7A 4Z78A 1ZVHA 3BPOC 5E8PB 3D5OF 4MCZA 4Y5XC 1A6UL 2AJSH 2FHFA 1EBAA 5ID1B 4PBXA 1MIMH 3HAEB 4TUJA 3EO1B 5FUCE 1FGNH 3BMWA 5CIPB 2OP4L 3MROB 4YR6A 3VFNB 1I9IL 3B6SA 1A14H 2P43B 3FRPG 2IPTL 4FMFA 4ORGA 2GTWA 2IPUG 3U7WH 1QSFE 2ZZUT 1BWMA 1Y0LA 1ORQB 4NN7B 5F6IB 3HNVL 3QR2A 4R3SB 4NCDA 4L9LB 1T5WA 2BRRL 1EO5A 5AWNL 1MWAB 1MJ7L 2ATKB 2DJUA 3BKJL 3L3GB 5IKCA 2EH8L 2BX5A 4XBEL 4YE4L 4OFKA 4F37K 1YEDB 2ZJSL 4HIJA 5D2LA 2CD0A 1OP3K 2H8PB 1IEAB 4G8GA 1KCSH 4PGEA 1MHCB 3KWWB 5HBBA 3LS5L 5ACLA 1TENA 4JFOB 2QR0A 3L95A 3PE9A 2XQYK 1JHKH 1OLZA 1D9KC 4Y4KC 4AJ0A 4F37F 1X6LA 1Q9OA 1LDPL 2GEEA 4LBEB 4U2YA 4DZ8A 1BZQK 3ARGC 4AEEA 5IT2H 1GOHA 1R3LB 4IJ3C 1PQZB 4JFPB 2O26U 1F2XK 4IOIB 1FL3A 3OAZH 3O9WD 5JW3H 1PG7X 4U05A 3OKOB 1YUHB 5MENE 1DEEB 4S1SL 2DMBA 3NIFE 4CDGC 5C07E 1WEJL 4YBHA 1H3PL 4BUHA 3TIEB 4O02H 1YEIL 2L7UA 2H6PB 4AG4H 3I9GL 3I50H 4NO0A 5E94A 1QRND 1VKXB 5I1DB 3L3HB 3ZE2E 2FR4B 5EOCL 3I2CL 3QHFH 3FOLB 5TE7H 4GXUN 4HUUB 2YD8A 1S5HB 1HQ4A 1FO0B 1WAAE 1CF8H 1MCQA 4OQTL 3V2AR 4HKJB 4Q97A 1RJCA 5HYQB 3IDYB 3ZDXF 2YPVL 3JV6A 4FQPA 1FJ1B 4Q2ZB 1FFOB 4FQ1L 4NJAH 4P0DA 4HBQA 3CK0H 3FQTB 3LKRB 1E4XL 3EYQD 3K80A 5IQ9B 4JFZH 4NZUH 4MWFA 4D0BB 5GQBA 3FL7A 4PDCE 1MFAL 1ZT4B 4PPTA 1JYXA 3BKYL 1MQKH 3MJ9L 1ZA3B 2CKBH 2BERA 1FBIL 1KPRB 1NGYA 4TQEL 4DKFL 4PG2A 2BFVH 2D4FA 2GQHA 3JV4B 4LOUC 2CKNA 4X9GA 1F11B 4JZJA 1QNZL 4B5EA 1CD1B 2I9LA 4P49A 1AXIB 3X13A 3MUGB 1U3JA 3M1BB 5C07A 4DCQA 2X4UA 3P77B 3S35H 4HIHB 4PJ7F 5DWUH 5I8EB 2PTTB 2Q8AL 3VG0L 1CGYA 1P1ZB 5B4MC 3TN0C 4XC1H 4PP2B 4NP4L 2YKLL 2CIIA 1R24A 4I18C 4PJCE 1R5VA 4FXKA 3GJFA 4P5KA 4QRRD 5C0IB 4LCUA 3SHSA 1PBYA 3CSBA 5DRXB 1WAAA 3MNVB 3DURB 4YIQA 4ZO6A 5DQJA 3DROB 1ZGLP 4N0CC 1D9KD 5K59E 4Y4KD 2F8OA 3EFFA 1HHHA 3VWJB 3W11C 1S3KL 4H1LH 4HBCH 3R06B 4V1DA 4D8PB 4NT6B 5FOJA 2HWZL 3ARGD 2ICWA 2R1XB 4NKMA 3HZMB 1SBBA 3QO0B 4WU7A 2BVUA 1VADA 5DRWA 1QPPA 3L5WA 3RBGA 5LQBL 2ZP0T 3W9DA 3VXRE 4WUUB 1LMKA 4U6VL 3MLRL 3PWJB 2PCPA 3D0VA 3HE7A 2EIDA 2QKIA 2VXQL 4NYLB 4RX4D 3VXMA 3PWNA 1G7QB 2NXZB 4ZUVA 1I9JH 2C1PB 1KPUB 3FFCB 2EDWA 4OJFL 2VDKH 5I66B 1A6TB 1QSEB 1GIGH 4GG8B 4WW2A 3ZHKA 3TC9A 1CTOA 3A0OA 4GLRI 4E42B 2FBOJ 4LCYB 1VSCA 4JG1L 4PJCA 2BVQB 5INDA 4NGHL 1OAKH 4W6WB 3T0EB 1U8PB 2AABH 3OXRA 5E6IA 1NL0H 3KPTA 3QEQD 2FIKA 2V7NB 1LE5A 1HEZB 4JFFE 5DZOA 4DW2H 3QULA 4QXGH 1G9NC 1BGXH 5BVJA 4QTIL 4OZFH 1WBZB 1T2QL 3AREB 5I9QB 3MUJA 4MDIB 1MCOL 1T0PB 1N0LA 4OF6A 3VXTA 4J2XA 1DLFL 2B1AH 4WDIA 1QFWI 2FNBA 2ICWI 5D9SB 4DK6A 5HYSB 5FUCC 5GGTL 5HDOA 4LOUD 5EU3B 5DYOA 2C5DC 4Z77B 4UAOC 3TNNB 4YHYC 1DUYB 1LDSA 4HMCA 5L0QC 3X12B 3M17A 4BZYA 1CLYH 4AIZB 1F4XL 5HGAA 5HGBA 3MRGB 1T0NA 1BOYA 4NQSA 5B4MD 3X3FH 1YEEL 3TN0D 4MD4B 5MERA 5J57B 3CDFA 2WIIB 3U9PL 4YDLB 3C8KA 3GKZA 5L2KD 5C0EB 4ZUWB 1M6OA 3I6KB 2D7QA 4HFUL 4NM4L 4MA7H 1CXLA 1DBMH 4D2NA 5C08D 1L7TH 3BKCH 4J3UA 2OS7A 2VDLH 2ZSVB 3PGCB 3HI1A 4MS8C 4QNPF 4N0CD 2AJSL 4M48H 3MCLH 3ABZA 2MQ0A 4JFFA 3W11D 1MIML 4YHML 4R4FH 1F3RB 3IS1X 5IMLA 3ECBB 1FGNL 3ISWA 3BGMB 4JLRA 1KLUA 1XGPB 1D5IH 3QUYA 1OGAB 1JPSH 3D39E 3LKNA 4KHXH 5T1LB 4QXTA 5I73C 5HGDB 5DHYB 5C8JA 2XTJE 3FRPA 1YQ2A 3U4EA 2YZ8A 1XZ0B 3PWPB 4OAWB 4YC2C 1QR1B 1ORSA 3TYFB 3HZVB 3Q6GL 1QLFA 1OAXH 2MMXA 1QEWB 3QUKA 3BH8A 4ZDHA 1FZKB 1KCSL 3ARRA 1OGTA 3K2MC 1QBML 5FA3A 2OI9B 1OD7A 3QWRA 2Y5TB 5F9WB 4ODHH 3ARYA 5CEZH 4G8GD 1JHKL 3QDJD 4GS7C 4RMUA 3REWB 5HHXH 2EE6A 2XWJB 4EKXA 5INCA 2VAAB 5HHVL 3ZT6A 5I1IH 3WV0A 5H35B 5IF0B 5ECJE 1GGIH 3IGAB 2O5YL 2D0FA 1OHQA 1CN4A 3HC3L 5IT2L 4HUVA 4FQXA 4L1HA 1MCWW 5C0AD 1HK6A 2H45A 3A6OA 2AGJH 4MD0B 4F2MB 2XKSA 5JW3L 1J8HB 1N0XH 3MODH 4XHJC 4FQHA 2D0HA 3B3IA 5M95B 4G8FB 5HHNB 5TDOA 2PTUA 5D7IB 3NTCL 2QTEA 3D39A 3TNMB 4AM0A 3L5IA 5IB2B 4O02L 3IVKB 3HE7C 3KPRA 3S98A 4ISVA 5J12C 4K3GA 4PJGE 2A77H 5DR5H 1AGFB 1NCCH 3KPPB 4AG4L 3BESR 3I50L 1AY1H 3UX9B 1QSFD 2OLDA 5DC9B 1KIQB 2DLTA 1TZIB 2OMBA 3RZCC 4K2UH 5FKAA 4JAMB 4XAKE 3QHFL 2AVGA 4XNMA 4NO0D 4X7EC 5TE7L 4JRYB 4RWHA 1S9WA 4XVJL 2HJFA 1MIEH 5KSVB 3DUUB 2VN4A 1CL7L 4LVNB 4I13B 3OKEB 3MRIB 4JFDE 4ZFOA 4N8PA 1MOEA 2QADC 3D87B 4TUOA 4JFZL 4NZUL 2BVTA 3PP3H 2DIJA 4TNVK 1KUMA 2OTUB 5HVHB 4PRDB 4MS8D 2YUVA 2AXFB 1AC6A 1MQKL 2CKBL 3GB7B 5CLTA 4P23A 4CW1A 5E2TH 1F6FB 1PW3A 2BFVL 4O2FA 3JV0A 4KI5F 4NQCE 4JQXC 5IVXB 2ADJB 2J3SA 5E8NB 3TT1H 3BJ91 3MLYL 3PGDA 3LRGA 5EBLA 1I3RA 4OZGE 1NCDL 4PRPB 4HKBA 5EPMB 3RY6A 5MEND 1JBJA 5B39A 3ARUA 3CLEH 3VFMB 4XNXH 4PJGA 2BJMH 3CH8A 5C07D 4I3RH 2DWDB 3LQAC 4JM2B 4PJAF 1BQHA 2ESVD 3WDHA 3DBXB 1B0GB 4RFNB 3QNYA 4WO4C 1CYGA 5CJ5A 5CBEB 2RIKA 1FSKC 5CHNB 3H42L 1T21B 4JFDA 4KUZH 1MH5B 4G7VH 2VLLB 4HBCL 5E8DL 1TETL 3VMNA 4XNZC 1CFQA 4JFXB 1H9VA 4NNXA 2C26A 4WFFE 1FE8H 3ZL4H 1T66C 2GAZA 1T3FB 1C16A 4XHJD 2ARWA 5D7IF 3C9NB 3W0WB 3QUYC 3UTTB 3QO1A 1BM3H 1T1ZA 1YEJH 5A2LH 4LDLB 4NQCA 1N8ZA 5IB4A 1FVCA 2C1OB 1QLEH 2G2RB 2HT4C 1I9JL 5FXCH 4HGWA 4D0CA 4LAQH 3HE7D 4EI6A 1NDGB 2VDKL 3L3JA 3R8QA 1EFXB 5C09B 1TMCA 4IHOA 5ANMB 5HY9B 1S7SA 3BD5A 5C9JA 3BPLB 3H7BA 5D7JB 1AO7B 5IMKB 4X0KA 3S3JA 1CG9B 2P24B 3RZCD 4K71C 5I17B 1BZ7B 5K9OB 2Z4QB 4MAUL 5I16A 1RIHH 1S7XA 3C5SB 5E2VH 5E1AB 1OAKL 1MHEA 1U42A 4IMLA 2AABL 4XXDB 1NL0L 3UPCA 2QQNL 4MXQA 4DW2L 1K4CA 2QADD 1QOKA 4NJ9H 4QXGL 4HWBA 1BGXL 4BH8B 5KS9F 3GIVA 1RK0B 4MHHG 4IOFC 2UUDH 1XR9A 3QJHB 4FQXC 3C60C 1PEZA 3VXNA 3GMMB 1SY6H 3HE6B 4WUKH 1X7QA 2KKQA 2EDYA 2EYRA 1BOGA 1L0QA 5DJ2B 4PRHB 5D1ZA 5IVXF 4KU1A 4G43A 4PBWD 5C0BA 1HWHB 4AENB 1NGXB 3W5MA 4HK0B 3PUCA 1ACYH 4WW1B 3AVEA 5JOFB 4I2XB 5FIEA 1ZSDB 3VXRD 4M03A 2ICCA 4Q6IC 4OZ4A 2VDRH 2OXGA 3X3FL 2XTJC 3G6JB 5EIIA 5FV2A 4WHTB 2YPKA 3MV8D 4HUMB 1BIHA 2R1YB 2RB8A 1FZJA 3VGAB 4RGNE 1RSFA 4WO4D 4MA7L 4X6FA 4KJWC 5ILTH 4QOKD 3GUTB 1IQDA 5EUKA 3T8XA 3VMOA 2VDLL 3SKJL 4BK4A 4LDEB 3MCLL 1N59A 4JHWL 3MRJA 4XGZA 4R4FL 2H32H 3IS0X 5I1LB 1NUGA 5LGJB 1D5IL 4LSQH 1JPSL 3AXLA 3LRSA 4JFFD 5T1MA 3TWCH 5DSCA 4Y4HA 4NWTH 1T66D 1W0WB 1MY7A 4KHXL 3CH1A 3QI9A 4Y1AE 3QUYD 1G7MB 1NCBH 4HDIB 4NC0B 1FH5H 4M3JA 4NHCH 1TPXB 3BSZL 4OFPA 1LP9E 2HT4D 3KJ4B 4G6JH 2CKBB 2AJ3A 3RY6C 1OAXL 4UZGA 2A83A 3O4LE 1Y18A 2JJSC 4P59H 3QIBA 3FKUS 1LE9A 4UBDC 1BECA 4KV5F 3MLTA 5F1IB 4ODHL 5JIHA 5HHXL 2R0WH 3RKDC 1Y6NR 4GKNA 5EIQA 4LF3B 5MEOA 2O5ZL 4Q9RH 3GSVA 5I1IL 4YHLL 4X4XB 5F1KC 4J3SA 1GGIL 5F88A 3WFBL 4JG0L 1ZWIB 2VXVH 2YUXA 2IG2H 3KPSE 1QRNB 4N5EA 2L4OA 5J1TC 3PV6A 1UWGH 2XZCH 5BRZA 4R9HA 3K4AA 4IOFD 3VFRA 4JPKH 4OFVA 1N0XL 3MODL 4FQXD 4XBPA 5CSZB 4G5ZL 3C60D 3S36H 3BRFA 3BRDA 1AR2A 5I1AA 1GCFA 1KB9J 1IAKB 3A6BH 1KNOA 4PJBF 1D5MB 2X10A 1BMGA 5DQ9A 4H1LB 2A77L 5DR5L 1NCCL 3KHQA 3KJ6H 4JDTL 3D39D 1CLOH 2RFXB 1AY1L 2HN7A 3QAZC 3BPOB 1LP9A 4JCLA 5IVZA 4Y0GA 3PDGA 1OSPH 2O61B 1OP9A 5I76A 3VXPA 2XTJD 3LPFA 1MIEL 3ULVH 3LN4B 5D70H 1V3KA 2LAAA 1T20A 5JPMB 2PW1A 3B43A 1NC2D 4AQ1B 1DDHB 2YUWA 2GW5A 4KJWD 3WN5A 4NWUH 5J13C 2Q1EA 1NANH 1FFNA 2FECL 2DQIH 3F58H 3MV01 2AK1H 3MFGB 3BYYA 4OCYL 4MXQC 1ZGLA 3RWIA 1J05B 1N5AA 3KPSA 4I0PD 5F8QC 3U83A 3NPZB 4D9RD 1UXWB 2P8MA 4LLMB 4JJHA 5IFAH 5DUBB 5GGVY 4LSSH 3GBNH 1G9NL 2YR3A 2JCCE 2Z8VC 1CD9B 5E2TL 4F15C 2VOTA 1HWGB 4QRRB 1PZ5A 5EULV 2DOCA 3OJMB 5B8CA 3EYUH 1SYVA 3UPRB 3HZKA 2VN7A 1RJZA 3TT1L 5D1ZC 3MXWH 1GH7A 4KTDH 1IAOB 1D9KB 3OJDA 4Y4KB 4MJ5B 4MNQB 3CLEL 4XNXL 4QHUB 2BJML 3GSQB 4URTB 4HXAH 1GGUA 3SGDH 4IJ3B 2YHGA 1R3IH 4JJ5B 3UBXB 5DFWH 3PWVA 4UBDD 1E4KA 1RUKH 2XQBH 1OVZA 3LKSA 2DLEA 1KJMB 2EE2A 4XAKD 3RKDD 1YNTA 4M7KH 1JUFA 1KTRL 3OR7A 5C86A 4KUZL 5KSUA 4NIKB 4JPIA 4G7VL 4M43H 1DQMH 1FZOA 3EYOA 5C0JB 4ONGH 2C3VA 2P7TB 3ARTA 4PJEB 4JFDD 4YHKL 3STLA 2BSSA 3MLVH 5D7KE 4HMDA 2WWKT 1NMCC 1FE8L 4DGYH 5KSBA 5FYLE 3V5DA 3WS6A 2JCCA 2AEQH 2F54E 3QWQB 1BM3L 4Y4HC 3OWEA 4PGDB 4XH2B 3FMGH 4Z7OE 3BD4A 4XVUC 4HH8A 4ZQKA 3QI9C 3QEQB 1A3LH 1R3KB 3NZ8A 4HCRA 4KXZI 4NQCD 4H0HB 4ZUUB 4PYHA 5C0FB 3VDBA 1BQLL 2EIZA 1IGIH 1RZ8B 3IDJB 3VCLA 1FVEA 1P4IH 2N7AA 4GAYA 2DM7A 3KLDA 3GSXB 4AT6A 5E2VL 1HZHH 3F8UB 4U1KB 1N3NB 4XWOC 3IDNB 4YPJA 3NVQA 3OGCB 4G8IA 4RGNC 3L5JA 3AU1B 3SKMA 4JFYA 4NJ9L 1RULH 3PXJA 2CO7B 1Q1JH 4N5EC 3TA3B 4MXQD 1GZPB 2DDQL 3MCKA 4Z7QE 4WUKL 2GK0B 5I8CB 3ZKNC 4PJ8B 1XCQA 1IGMH 4RIRB 4F7CA 3KAAA 4I18B 3U46A 3FT2A 4JFQB 5B3JE 1QFUH 1T1XA 1ZLWH 4WFFD 3HCVB 5D1ZD 5C71A 1I7UB 5KJRH 3LKPB 5DD1H 3KYNB 1KN2L 5I74C 4FXLA 4KY1H 2Z8SA 5D6CA 4N9GB 1PD6A 2VDRL 4Z78B 2J5LC 5HHPA 1EV2E 5JORA 4MCZB 3LD8C 1ZVSA 3QPQC 4HH9A 5FM8A 4X5XA 1MFCH 4TUJB 3RIAK 4DGVH 4PJ9A 1RURH 3B6SB 2ZOKA 4XVTH 5ILTL 5CLWA 3VD4A 4PJIE 1U8HA 1HHGA 4QRQA 3OXSA 4L8BB 2R0LL 2H26B 1XF2B 5FA4A 1MJJA 4ELMF 4C4KT 1T5WB 4PJEF 2DIBA 2AQ3A 3RIAF 4LSQL 3O11B 1CGWA 4HIJB 3LDBC 2IEPA 3FQRB 4PFEA 1ZS8A 2OX5A 4G8GB 3QDJB 2R9HC 1B6DA 4UMGA 1YC8A 3CFCH 1NCBL 4OUOA 4Y4HD 4NHCL 1KFAH 3WHE0 3HMWH 4MHHI 4XVUD 1I7TB 3QI9D 5DJ0B 1FV1B 2WK2A 1DBKH 1T89A 4G6JL 5E00B 5C0AB 5JA9A 2IMMA 4P2YA 4P59L 1Q9OB 2HH0H 1CLCA 4R6UA 1J8KA 5HVGB 3DX6A 3P11L 4XMPH 5JOEA 1II4E 1EDQA 2R0WL 3GGWB 5FGBA 2FEDC 3WHXB 1HOCB 1KACB 3DOSA 3SDAC 1E4KC 1CDGA 1XGQB 4Q9RL 2VITB 4ZD3H 2V5MA 4NCC1 1RZFL 4NUJB 4CBPA 4XWOD 5EFIB 2NW3A 5ITFA 4UAOB 4S0TD 3AMKA 5CCKH 3ZT7A 4YHYB 2VXVL 4QHMA 2IG2L 1G1YA 1PG7W 1QSFB 3CFDB 3VWKC 4RGND 3TBSA 5L0QB 4UTAL 5EUOE 2PETA 1UWGL 1ADQH 4O4YH 2ZCLH 1W72H 2KDGA 2ITCB 1U8MA 4UV4H 3BDXA 4JPKL 2PO6C 4N5ED 1YYLH 2R39A 1X5GA 2C3WA 2VDPH 3S36L 4ODSH 5JMRA 4XPTH 3ZKND 4I8DA 4JKWA 4EUPH 2EE9A 2Y5EA 4WY7H 2J8HA 4ZUTA 3JWDH 3VG9C 3KJ6L 4DKAA 4MMZC 1HI6A 1CLOL 2VLKA 4HX1B 4UB0H 1CFVL 4YHZH 3JV6B 4TRPH 5DMGC 4Y1AD 1JIBA 1OSPL 4KJQC 5J11C 3ULUE 1F13A 5ID0A 1KOAA 4PY8I 4OD1L 3L7EA 1QSZA 4LKCA 5D70L 1MFEH 4BKLB 1FYTE 3QPQD 3OKLB 5BXFA 2ILLA 1N64H 1NGYB 2Z9TA 3O4LD 1X5YA 5DRNB 1ZHBA 2VIRB 1TJIH 1A02N 2RQ8A 4NWUL 2EYTA 5I73B 1C8PA 3TPKA 1U92B 2ZCHH 2I9LB 5MENB 3KDMA 2DQIL 2AK1L 3PP3K 3BUYA 5C07B 1MCKA 4YC2B 2YEZA 2BVPA 3HR5A 4N0UE 5IFAL 5EUOA 4LSSL 3GBNL 3SCMC 2CXGA 1XGUB 2ESVB 5HYIA 5D2LF 4FQLH 4Y5YB 1FNFA 3EYUL 4M5ZH 1MCBA 4HQQH 1LEGB 4QHLB 2BY2A 4JKLA 2OBGA 1TTGA 3UYRH 1R5VB 5HPMB 2IGFH 2YA2A 2R9HD 5B22A 4KTDL 1I7ZA 1P6AB 2H3NA 5D1QA 4ZFFA 2YS4A 5DUPH 5DS8B 4D94A 3F7YA 3QCUH 3IU4L 1NC4D 3U7YL 4HXAL 4GG6E 4L1DA 4AIXA 1R3IL 2BMKA 1AXSB 2A6DB 1NGPH 4JB9H 5FK9B 3D0LA 1I8MB 3IAQA 1RUKL 3FQNA 4NKMB 3BD3A 2XKNB 2XQBL 2MHAA 3JVGA 4X4ME 4WU7B 1SEBB 2XI9A 1FYTA 3TBVA 1IFHH 2FEDD 3SDAD 1H8SA 3IU3A 4M7KL 1KCRH 1E4WH 2PUQT 3DVNB 1P69B 2Q20A 2DKUA 2UVFA 3HE7B 4M43L 2UV3A 1DQML 5J12B 1OWWA 2IWGA 1HHJB 2VQ1A 2ED9A 4EXKA 3BYTA 5IB1B 4ONGL 3VWKD 4HWEH 1JWSA 3KPMA 4WNQA 5JMOC 3MLVL 3RZCB 3G04A 1RZKH 4N0UA 4MB3A 1F2QA 3UYOD 5KVEH 3BJLA 2PO6D 3FQWA 4GKZA 1WVZA 2AEQL 2W65B 3AY4A 3RL1A 1MVUA 4R4BA 5F7MC 5H2BA 2AJZB 2Y6SC 4NN5C 3T1FB 3J7HA 2NX5B 3FRUB 3BGAA 4CAGA 4NBZB 3W9EB 1X5JA 3JTTB 1A3LL 4MB5A 2QADB 2UY6A 4QRSB 4U1HA 2Q7YB 3OXRB 3PWUA 3V0WH 3ZZ1A 4LU5H 3O4OC 1T89C 5CWSA 5DMGD 2FJFB 4KJQD 2DKSA 1IGIL 4Y4FA 4AEHH 1P4IL 4GG6A 4XC3H 4RMSA 5EU6D 1JWMB 3GBMH <