4WO4A

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
b'LFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wo4A01
4JKPL 1F3DH 2FATH 3MUZ1 4M1GL 4LMQE 4ZD3L 1QD0A 3SE3C 5I6XC 4WV1B 4R7DA 3MRQB 1JPST 1NL0H 1OSPH 1VENA 1DANT 1UC6A 5KS9F 3VFOA 2NXZC 3BZFB 5E99L 2AXGB 3L5WA 5T33H 3O4LA 1E4WL 4XWOD 4QRQB 2DWEA 4LSRH 4LRNL 4U49A 5B3JE 2K9UA 2ZNWA 5L8JB 2PXYA 3VI4F 1WFTA 2UYLB 5JW5A 2W9DH 4ETQB 5HGBA 4LPCA 4PB0H 3MRFA 4NUGL 1PGRB 3MQIA 3RZCB 1QOKA 4PB9H 5IHLB 3RWIA 2JCCF 2ITDA 2C3VA 5TE4L 5LG1A 4XVJL 2VDNH 3HC3H 2HJLA 4Y89A 1DLHA 5F9DC 5I2IB 4BA8A 3RPKA 3RTQD 4FQJL 4Q74A 4RRPG 2YRZA 3H9HA 3DIFB 3KWWA 1I4FB 4WO4C 3QDJA 2Z93A 2Q76A 4D3CL 4DAGL 1UH3A 3OPZH 4O2EA 2J7LA 4FQCH 1AGBA 5K9KA 1MCWM 2P8PA 1EHLH 1N6UA 2K3TA 4N0YH 4AY0A 1CG9B 2DM7A 1ZXQA 2LTQB 1CXKA 1P2CA 4LPYA 3MA9H 4ZXBC 3BMWA 4NJ9L 5EA0L 4PRIA 2PN5A 4JZJC 3U79A 1RZGB 3ULUD 1GGIH 2A6DA 2FZ3A 3O2DH 4ZFZA 3STBA 3E2HA 2H6PB 2ATKB 2H32A 3OSKA 3RIAK 3V52L 5LGJB 4KXZH 4LOUD 4Y4HB 3TNNA 1J05B 1DL7L 2HT3C 1U8JA 2G2RA 2BVOB 5ADPL 5AAMA 2KPNA 4JFHE 3DYPA 3WHXB 1WC7B 1BQSA 3LS4L 3KYAA 3SY0B 3QO1A 5C0CB 1UACL 1JRHI 1MJ8L 1IGFL 3QXDA 2A6IB 1L9NA 3ESUF 2EZ0C 4OLYH 1AE6L 2D7OA 4HUNB 3V0AC 4G6AC 4B7LA 1CICC 1EPFA 3BUYA 1PD6A 2A1WL 1TCMA 1N64L 3PWJB 3VG0H 1BF2A 1RZJH 2F5AL 1U93B 3O81A 3QIUC 1JFQL 4PLOB 2IQ9H 4TSCH 4WUUD 5EB9A 3PV7A 3NZ8B 2QR0B 1X5XA 4APQD 5HPMB 3QFJB 4WV1A 4G7YL 1PY9A 5MERB 4FABL 5C0GB 1U8OB 3W82A 4TVSa 3O11B 5T5NG 2E7MA 5DD5L 2FX8H 3BZFA 1N5AB 1KUMA 4ZSOE 4GQ9H 2OTWA 4MD4A 5ITBH 4CRPA 4QRQA 1M71B 1AQDB 3MBEC 5JZ7D 3VGAC 4XNYH 4BUHA 4E5XB 4ETQA 1IM3B 4L4TD 1KJ3L 2A0LD 3TESA 3RZCA 3BDYL 3HS0A 3VCLB 4DCQA 1XAUA 5K9OA 2Z0BA 1ZV5A 3NFNB 1SJHB 3KPOA 3MRLB 5EZIH 1U3YA 1YEKH 5D2NE 1F3DJ 1YPZE 4S1RH 3DYMA 3KNBB 3I6GB 5F96H 3NCJH 5C1MB 1JMZA 5CD3B 1H5BC 2YZ1A 4OAWB 4OZHB 1H3WM 3LS5L 5I2IA 2DQTH 1ZGLB 5DHVB 3BOVA 1CGUA 4OGXL 4A2MA 3GGWB 2WBJC 1IC7H 3MACL 4QRRB 1GZPA 1KT2B 3MLZH 2P8MB 1ZOXA 3DIFA 1ZANH 1EFXD 1U8HB 5E94B 1MPAL 2HFFB 2H2SC 4LLVB 7CGTA 3U48A 2QADC 2XACC 2YXFA 4H0HB 5KS9B 2VDLL 4MWFB 5KG9B 5CCKL 5I8EA 4PLJD 4CVZB 3AREC 2N1KA 1CG9A 4POUB 5IGXL 3EO0B 4D0DB 4XHQA 1FYHB 2O5YL 4BSWB 4XH2B 4ZS6D 1KEMH 4S11A 4G6JH 4TSAL 1RZGA 3S36L 5HYJE 3IAPA 2NY3C 1MAJA 2H6PA 2ATKA 1ZS8B 3HAEH 3TJHD 1E4KC 1TQCB 1WICA 2DM2A 4IMLB 4OGYL 1J05A 3EFDH 3T3PF 4JM4H 2BVOA 4S0SD 4XNMB 3WHXA 3RVUC 1A6PA 4KHXL 3FN9A 1UJTA 2FWOB 3D6GA 3SY0A 1JL8A 1S7SA 5C0CA 3GI9L 4JO1L 4BFBD 4JZNB 1FSKB 2NZ9D 3RIFK 1M7XA 1AHWC 2A6IA 4TNWF 4XMPH 5IW6B 5K59E 5L7XH 2R23A 4JFZL 3RY4A 3WXWH 4LSPL 3GSWB 1CVRA 3BWAB 4GG6E 1K4CA 4K8RC 3PWJA 4M9PA 2I9TB 1DQDL 1U93A 1AQKH 2JK5A 2P8LB 1WGOA 4K3JL 3NZ8A 3EYUL 1A6TA 2QR0A 2AJXL 5HPMA 3QFJA 4TSBH 5DJAB 1MFBL 1J12A 5IBUG 5EU6D 5F9WB 4BELD 1U8OA 2ZUYA 5DR5L 4OCYH 3O11A 4BZYA 5GGSA 1DBJH 1GXEA 3GSXA 5EIIB 1OT2A 2PXYC 2BMKB 5GIRB 1N5AA 4JRXE 2EKSB 2J4WL 4H1LB 1CU4L 3ULVE 1B88A 1MCOH 4QHMB 4LHUB 3P4OB 1QSEE 3ZTNH 4M62L 2VC2H 1KBGH 2H1PL 4GT7A 4NN6B 5E7BA 4E5XA 4KJPC 1IM3A 4F37F 5C0IA 2YN3A 2E27H 1X5KA 4HZLB 4X9HA 5JDJA 1S78C 2MKLC 1EEZB 3L1OL 1CQYA 3FQTB 3QG7L 5F6IC 3ARXA 3VCLA 4WJ5B 1HYRC 4C56E 12E8L 4WDIB 3NFNA 4Z95L 1MAML 3MRLA 4PY8J 2FEDD 4UT6L 5IVXF 2D03L 3G08B 5I1EL 3N85H 5I1CH 3WDJA 3KNBA 2AJ3B 3I6GA 2B2XL 1W72B 3KYOB 3RAJL 5CFHA 5CD3A 4OAWA 4OZHA 5F1SA 1ZGLA 5DHVA 2ESVB 5E6YA 3KS0H 1T83C 4QRRA 3MRCB 3DV6A 4FP8L 5JA9A 1KT2A 3BRGC 2P8MA 1OF2A 2RQ8A 3C8KB 2VDKL 2UVFA 3QIBB 5ALBL 5E94A 4TNVK 2BY0A 2X4QA 1FVEB 4QRPE 1AO7B 4LLVA 5CGTA 4UU9B 4YFLF 15C8H 5GS1C 3VJ6B 4MWFA 5KG9A 4AQ1B 2GSIA 3EO0A 1RIUH 4D0DA 5I1DB 3QCUH 2Y07L 3BKCL 3E2HC 2DQIL 5DRWB 1A6WL 2GK2A 4XH2A 3NGBC 4V2CB 4DN4L 5FOBB 1EJOH 4OI7A 4RRPA 3UAJD 3O6ML 1JRHL 3THML 3QPXL 5BS0B 4ZDHB 1ZS8A 5FM5O 2WUCL 1BOGB 4WCYL 4Y16B 4UBDD 5AYQA 2V2WB 3HRZB 4XNUH 4N1HB 3DMMB 4XNMA 4KUZH 2YD9A 3L7EB 5JHDE 4S1SL 3IT8D 5FYJH 1I1FB 4JFEE 3TZVB 4C83B 2PW2B 4HT1H 1L9MA 4P9HL 4JZNA 5EOQH 3QIWB 3OB0H 5IW6A 1S9YB 4ZYKB 3CZJA 4NQCE 3OTTA 1HZHL 1KB5B 3EIFA 3GSWA 3V4VH 3BWAA 3BPLB 2F19L 1I1YB 3K81A 2VXSL 3MFGB 2I9TA 1Q38A 1G7QB 2LVCA 1WEJL 1J0HA 1UGNA 3K3QA 4AL8H 4LIQL 3BAEL 4XPAL 1A7NH 2D4DA 4CUCA 1VFUA 3F12A 4LLAA 4WY7H 5L8KB 5IVZB 5DJAA 2AGJL 1N7ML 4WTXA 1MJ7L 1BHGA 1YY9D 1QEWB 3N1FC 1FYTE 1HNGA 4NQDB 5DJ0B 3TA3C 5EIIA 5L2KD 3T0WA 1FC1A 4OSUL 3LQAC 2BMKA 3W39B 2YKLL 2F53E 2COQA 3KYMB 2YXMA 4H1LA 3B2UD 5HHPB 4QHMA 2YHGA 2KBGA 1XGTB 1FFRA 1ODAA 3P4OA 1F42A 1ADQA 1FRGH 3GMMB 1NGQH 5I8KH 4RMWA 3CLFH 5KSAD 2EEDA 4MCYA 4GKSB 1FZKB 3GM8A 3BRFA 4MA1C 1FL3A 1K8IB 3MX0A 4OQTH 2NY6C 4OZIF 1EEZA 3FQTA 1RV6X 2B4CH 1H3PL 5T3ZE 4WJ5A 2A9NH 4WDIA 4UI2A 3IU4H 1YNLL 5IG7B 1FJ1B 3G08A 5F72S 1N59B 4RX4D 2AJ3A 3P0GB 1NUGA 1AGDA 1W72A 1X7QB 3KYOA 3WCYA 2AV7B 4RAUB 2BZDA 5C07D 2ESVA 5EORL 1F3JA 4HK3N 4PRPD 3VXMB 2VO5A 4PTUB 2JE8A 3QUZB 1GPOL 1WZ1H 3C8KA 1NCBH 5GGTH 3QIBA 4KI5F 2HKHL 1FFQA 1FVEA 1AO7A 2LTQC 3D0LB 4UU9A 3TIDB 3REWB 3ZYIA 4OGAC 4Q6YA 3IJYB 1A6VH 3C09C 5AWNL 3KPPA 3KPQB 2J88H 1ZT4B 1TVBB 4PGDB 2DLFH 5FOBA 2HA1A 3PWPA 2I5YL 2O5ZL 1NC4D 2E6QA 3LSOB 5BS0A 4ZDHA 5TQ0L 2W0FA 4Y4FC 4I77L 4HMEA 1GC1C 3HG1E 3KPSB 3KS0J 3NFSL 3TF7A 3A6CH 3LKNA 5IVXB 5L88L 4NM4L 4LSVH 3HRZA 1I3GL 1INQB 3DMMA 2V7HB 4ODVL 1UWEH 4X6DE 3W9DB 3ES6B 3L7EA 4X5WB 1I1FA 4C83A 2PW2A 4I13B 2R15A 4GW5B 1YNKH 2IPTL 3QIWA 4CW1B 1S9YA 1G9ML 2NXZD 4YR6B 3NIDE 1J8HD 5SWZD 2AV1A 1KB5A 1A6UH 3HZYB 4LL9A 3U4BL 2HJKB 3H6JA 1I1YA 2WK2A 1I8LC 5ACMA 1G7QA 3GUTB 5FUOL 4EZMA 2HVKB 5IVZA 1F4WL 4M1DL 2WIIA 2MMXA 1KJ2H 1OTUD 2JJVA 1HSAA 1QEWA 5GRJL 1YY8B 1XEDA 5DJ0A 4NQDA 3AM8A 5FKAB 1A1OA 3ARBA 3W39A 4G7VH 5BVPH 4M6ML 2VKXA 3TGXA 3KYMA 5JHLH 2O61B 3BI9X 2DAVA 4ZS7H 5HHPA 3VDBA 5F1OB 1XGTA 4EIZC 4PJ5E 1LILA 3GMMA 4LVOC 5J57B 3CH1B 4GKSA 4YHYB 1FZKA 3MXVH 3N1MC 3PP4L 1K8IA 2UVEA 4YHIB 1AIFA 3UROR 5BQ7B 2WNGA 4WO4D 2OI9C 1DANU 3K8MA 4NQXA 4LCWE 2HRLA 5IG7A 5D7IB 1FJ1A 4LDOB 3S5LG 1XH3A 1N59A 2BK8A 3RRQA 3HZVB 2VLRD 3L3JB 4NWUL 3I2CH 4RAUA 4JREC 2NY0C 3B3IB 1A02N 3RPIA 4Y7MA 1T2QH 4DQOL 3VXMA 3FFCE 2X1OA 3MV8A 4YZFF 4PTUA 4L29B 5HVFB 3LQZB 4GW1B 4G9FE 5JTWA 4HGKC 4PJHA 3QUZA 1LEIB 3P0YH 3AS1A 1MHHB 2BXZA 4X80L 2R0LH 3TBYB 5GJSL 4A6YH 1IBGL 1GSMA 1CVSC 3D0LA 2BJML 1NPUA 5CWSB 3UO1L 4WHYG 5DO2D 1PKOA 4C54A 2HT3D 4JCMA 4DN3H 4P9MH 3KPQA 4ZNCD 4K3DL 2SEBB 3KJ6H 1TVBA 5FYJU 5GPRA 4PGDA 4K3HA 1RSFA 3MRHB 5DJDB 4PFEA 1CQKA 4KY1H 2EZ0D 4Y5XB 4HIHB 4LLMA 3VRLF 2VLJB 5D7LD 4M03A 3HI5L 1ITCA 4G6AD 4OZIB 3DO3A 5ISZA 1CICD 3D2UD 5GGRY 4ODBD 4R90H 5FF6B 3QSKB 2NY2D 3KPSA 3LV3B 4C57C 3V6BR 2BSTB 3MNWB 4I8DA 2PYFB 3QEQB 4RBPH 1INQA 3VXNB 4LPWA 4NZTH 3MUY1 3W9DA 4N0UB 4DFHA 4NRXB 2GYSA 2CRMA 4GW5A 1NCWL 1MCQA 3GSRB 3V6OE 5DK0B 4YHLL 3IDUA 4CW1A 4YR6A 4U3CA 2XRAH 2AJUH 5CJ5A 1XGUB 2NX5B 3P4MA 4JFQB 5I8OL 1UXSB 4HD9A 1LE9B 3HZYA 1PZUB 4M1CD 4KWUA 5HHNA 3HE6D 3O6KL 5AG8A 3O2VH 3SKMA 1KN2L 5KVDL 1Q0XL 2CUIA 4XX1G 2IALB 2DMCA 4XB7A 5GRVL 3GSQB 3M8OL 3VXTB 5GS2H 3PWUB 5HJ3B 2FJHA 4UDUB 3UTTD 3GI8L 5F7WC 2OR7A 4RFOH 5E1AA 3NABL 5FKAA 4NP4L 2BCKB 4NO5B 5KSBB 4HC1H 3RDTB 2B1HH 4A6YB 5IB5B 2NY5C 2O61A 1CD9B 1LP9E 1R3JB 4LEOA 1W2KT 4NC0B 3FAXA 3OAZH 1H0DB 3CH1A 1G0XA 5C0EB 4OIAA 1TTUA 1KLFA 5J11C 6CGTA 4YHIA 3RP1A 4XTRC 2OSLB 1UCBL 1KJVB 5JW3H 2P5EE 3MSPA 2IFFL 2DQHL 5D7IA 1WQVT 3H42H 4HPOL 1J9CT 4ZUVB 4HV8B 1HXYB 5TQ2H 3V4PL 3VMNA 4OB5H 1K6QL 3HZVA 4LSDA 1NMBH 3R8BB 3SJVB 2EDEA 4JDTL 3C5SA 1YUHA 4LKCB 3O0RL 3ARED 3DO7B 1QTYT 4KC3B 4XX1E 3B3IA 4E41D 3QIBC 3DXAD 4MHHG 1BD2D 1EEUA 2UWEE 4GW1A 3PP3H 3C6LB 4QWWC 1LEIA 1MHHA 3G5VB 2V9RA 3DOSA 3MJ6A 1NBVL 4JFDB 5CWSA 5IR1B 5MENE 3U46B 3QDMA 5A40E 1KEGL 1JTTA 3CFBB 1S7TA 5E2VL 1DBKL 4MLIA 2SEBA 3CDCA 5IEHB 3TYGH 1BZ7A 4M43H 4PY7B 3ROLB 3VXSE 1AJ7L 5T1LD 5DJDA 1MCDA 2CK0L 4MYWB 4QO1A 4Y5XA 4HIHA 3K4DA 4NZJA 3FB6B 3UX9B 1NEZG 3P40A 5C6TL 4FZ8H 3IDXH 1TITA 3NCBB 5K9QI 3GBLA 3S9DB 4GAGL 3LV3A 1ZE3C 3WMSA 3MNWA 5JIPA 3FMGH 2PYFA 3QEQA 4MQ7B 1PLGH 1HI6B 3FRPG 5IHUL 1LD9B 5EUOB 1JGUL 1AD0B 4KKLC 2VZVA 1HSBB 3O4LD 3HZMB 5B21A 3GSRA 1SHMA 4DJMA 2P1YA 4Z8FL 5JMRA 4XMKL 2XTJC 1CZ8L 4K8RH 5F97E 1XGUA 2NX5A 2PXYD 4BKLB 3FO2B 1UXSA 2BY2A 4J4PC 5TGBB 4KV5F 1G7IB 3A0OA 3ZE0E 3HUJF 4JVUA 4PTTA 3WFDL 2IALA 3AM8C 1EVUA 3ARBC 4XC1H 4MAYC 3FQRB 3VXTA 1D5BB 4JLRA 4XP9L 3PWUA 3SDDB 4CVXB 2XQBL 3WO3B 1HH6A 4GRLB 3WKNA 1WAAA 1CD1B 4J3XA 3VMPA 1EAPB 4NO5A 3EOTH 5KSBA 3WFCH 1J1OH 3RDTA 5IB5A 2XWTB 5C0BE 2GJZB 1R3JA 5ANMB 3LDBB 2YPKB 1QBMH 1MRDL 4BJLA 3QDJD 1H0DA 2EDNA 2ZPKL 3IFPB 5HPOA 2OSLA 1KJVA 1WZLA 4AIXA 3BDBA 4DW2L 4FQLH 2R1YB 1I9JL 4ZUVA 4HV8A 2DJ4A 2CPCA 4PRID 3SJVA 3EO9H 4LKCA 3LB6C 5DMIH 5F7EL 4DOHE 3B9KA 2ZG3A 3ZE2E 1K8DB 1GZQA 2R4SL 3G5VA 1VESA 2VDPL 4JVPA 4KAQH 4XP1L 3ULSB 2PNDA 4KRPC 2VN7A 4JFDA 1MQKH 1JZ7A 4WHTA 1N4XH 1NLDL 4F80A 4JEGB 3CFBA 2P24B 3G9AB 1V05A 2D3VA 1JNNH 4QTHA 2BHYA 2FB4L 4U6YB 3DJ9A 5IEHA 4NIKB 2FEEL 4PY7A 3ROLA 3T0EB 4OI8A 1J5OL 3GB7B 2OZ4A 2NW2A 3FB6A 5AG9A 3MJGX 1I75A 1IZJA 1CLZH 4HWEL 4CU6A 3GBML 4D9RE 4L9LB 1U95B 4Z7VF 4H88H 3HMXH 1OP3K 4ZFOL 4PJCB 5I73B 4BFIB 3IETA 4MQ7A 5DQ9A 2DKSA 2IPUK 2Y25A 4FQIL 5B39G 1EBPA 1BEYL 1O7SA 4EDXA 5J3HC 5IMOB 1HI6A 2V5SA 1QLEL 1NCAH 4M48H 5EUOA 1AD0A 4R2GB 1UG9A 4UT7L 4JPVH 1Y18B 3HZMA 2X4PB 3VE0B 5B38A 4EN3A 4HIEA 1KENH 3PGDB 2A77H 3UTPD 1D5ZA 5C0DB 1AGFA 4BKLA 1T1ZB 2DIBA 4ONFH 1RIVH 1IZKA 3RZCD 3BKYH 3ZTJG 2NLJB 1F4XH 1QPPA 3FRUB 3DUHA 3CX2A 2F8VA 4XCYB 4W6WB 2DLEA 2XZQL 3S35L 3FQRA 4ERSH 4S1QL 3WS6A 1D5BA 3I9GH 2GJ6B 1N8ZA 5ECJE 1ZGLM 2VRAA 3SDDA 4LHQB 2EH7L 2FRGP 4GRLA 5B3JF 4BQCA 4JR9L 4GJTB 5EUKB 1CD1A 4L3EA 3WD5H 4QLRA 2CDFB 1RHHB 1ZHKB 4P3DA 2XWTA 1ZWIB 4Y19B 4CMHB 4WU7B 5JUEL 4NSKB 2YPKA 5EH1A 3B2VH 4XC3L 5E2TH 4IM8A 1XF1A 1P9MC 1NH6A 1YNTA 4ODHH 35C8H 2R0WL 3HC4L 3IFPA 3DSFL 3C60A 3OKDA 3Q1SL 4PGBB 1WWAX 4RGNB 2R1YA 1ZLSL 1EZVX 2VUOA 3ZDZE 5FCUL 4WFEE 2F54E 4JN1L 3IRZA 4U6TA 1BFVH 1TMCB 2JELL 4N8PA 4I0CC 1AGEB 4R8WH 1OPGL 1NAML 4UV4L 1UQSB 2W0LA 4KKAC 4HKBB 4OF5A 4ZO7A 3MMEB 1JI1A 4N68A 5DVMA 3ULSA 1RUPH 1L0XA 2OJZL 3OJDA 3SHSA 1KLGB 4JRYA 4P5MA 5IMMB 5C0CD 2XXMB 3ZMRA 4DTGL 3MGTB 5HGGS 4E9LA 4N9OB 4U6YA 4JY4A 1FFNB 3VA2C 5CZKA 5GS3A 4PR5B 3T0EA 4P2QB 3GB7A 4KK6C 1GC1H 1XR9B 4F58H 2OR9L 2IEPA 5B3NA 2HKFH 2OK0L 1QBBA 5ADOL 1L7IH 4LSTL 4L9LA 1U95A 3I3DA 4NRZB 1CDUA 3OAUH 3QFJD 3MROB 3AGVA 4BFIA 4LEXL 2OR8A 1MWAA 4ZNEE 1UA6H 4J3TA 5MHSE 2X44D 3OZ9H 4MAUL 2Q3ZA 3JV6B 1Y18A 3V0WH 4LVEA 4UT9L 3G9VA 1HCVA 4X6CA 1WT5A 4LGPB 3PGDA 3D69B 5EIVA 5EOTA 1R5IB 4GQPH 1BJ8A 4OZGE 2XZCL 4FTVB 1SBSL 1SEBA 3IDYB 1IGTB 1WIOA 4N8CL 5FK9B 4Z7OE 4UQ2B 1VACB 4B7IA 4MA7H 2VDMH 4QHKJ 1NSNH 2NLJA 5F3HB 5JNYB 4HLZG 3WDIA 4P49A 3FRUA 1LE5B 4FFZL 2XICA 3HNTL 4MA8H 2HAZA 5CJOL 2HH0H 2I25N 2Y7QB 2GJ6A 3NOIA 2DJSA 4WW2B 3MRBB 1ONQB 4ENEC 4OV6F 3MRKB 5EUKA 2Q6WB 3DYOA 2CDFA 1RHHA 2ICES 1ZHKA 4QRRD 1ZWIA 3GIVB 4Y19A 4Z7VB 4WU7A 3E8UH 4NSKA 5F1NA 3CXDH 2Q8AL 3VH8B 1DQLH 2DLIA 1YMHB 4XVSH 2J6EA 1RAMA 4WUKH 3ZLQC 4FG6D 3UZQA 2GEEA 1HH9B 4ZFFA 1F5WA 1QG3A 2PYEE 4PGBA 4A2LA 3GSVB 4GXVL 3RKDC 3GHEL 4F8TA 2DQCH 1S7VA 1F58L 3B9KC 1R5VB 2IF7A 2ARWA 2OQJB 4CMMB 1JZ5A 1EGJA 2FH8A 3BD3A 5JQHC 1AGCB 2K7PA 4PJ7B 5T5NF 1IFHL 2ARJB 3KG5A 1FE8L 1HQ4A 4HXBH 5GHWL 5F1KC 2O26U 4G43B 1A7RH 3GMRB 4RMQA 4MB4A 3FO1A 1AGEA 1CD8A 5D93C 2BNRA 4GKNB 1MCLA 4WWID 4HKBA 2FDBP 3MMEA 1GJIA 1REIA 1ZA6B 5IFAH 1FLRL 1CL7I 1KLGA 2FL5B 3QWRA 5HVGB 4TVPH 5IMMA 5LWYL 3MGTA 3QG6B 1EHNA 1MLBB 3DGGB 5DJ2B 1J1XH 3SKJL 4KKBD 4RZCB 3QUML 1FFNA 4XPGL 5DTFA 1MFEH 4L5FL 4MNGE 4O2CB 1LVEA 4HUMB 5BW7A 1NMCC 3FT4A 5LBSL 1XR9A 5I15L 3RGVB 1ZVSB 1BAFH 3LRSB 3VGBA 1EMTL 2EE6A 5H94A 1M05B 3U9PH 1GGUA 3TT3H 5DHXB 2CO7B 3MROA 4NC2B 5LQBL 3IS1X 5E5RB 3DRTB 4EN3C 3I3BA 3QFDB 3QQ9C 5K59F 4JDZB 2I9LB 1RMFH 3HI6L 5EZJB 1PDKA 4PUBH 1HHJB 3IKCA 3QPQC 4OFKA 4YWGL 5IB3A 2JB5H 3P0VH 1QPXA 1RUKH 3D69A 1DVFB 3WSQH 1R5IA 4I2XB 3GO1H 1SMAA 2DTSA 4R0LB 4OQ1A 4FTVA 3D9AL 4FMKA 3D1MC 3W9EB 1KXVC 2ZG1A 1IGTA 1A3RL 5FK9A 4U1GB 3V6ZB 4UQ2A 1VACA 5IFJB 4EI5B 4BFGA 3O41B 4EXKA 3IJHA 4WHCA 4HG4K 5E4EB 3SDDC 4JHZA 4LCIL 3GNML 2OXGA 5HHME 4C4KT 3RBGA 1FNHA 2HG5B 3AXLA 1CGXA 3F7PC 4M3KB 4P23B 3WIIL 4F7EA 3C87A 3VXPA 3X12A 2Y7QA 5E2JA 3WN5B 1CLYL 2Q3AA 4WW2A 1U8KB 2NY5H 3GSUA 1CXEA 3LDBC 3MRBA 1ONQA 3VXUE 2ESVD 3HNSL 3MRKA 1T1YB 3MLXL 3CSYA 4RGMB 3EOBB 1R0AH 4DGYH 2M8XA 1YMMB 3C60C 1CIDA 4XP5H 4OF7A 3SGDH 3MLUL 1S5HB 1CGSL 3VH8A 1J88A 3QIBD 3PUCA 3WLWC 4LAQL 5CJXC 3T2NL 1AO7D 4JO3L 3TCLB 2VDOH 2VAJA 3BQUA 4IS6B 1HH9A 2C4FT 5EOCH 3G6JE 3IFLL 4K23H 1DEEB 5IJKA 1TJIH 1GAFL 1F02I 3UPCA 3MFFA 1AR1C 3ILPB 4CMMA 2E6PA 2FIKB 3X11B 4PV9B 2YC1B 1AGCA 2D4FA 4PJ7A 1G84A 3PWPD 1E6JH 2AK4E 4YHOH 4YHML 5BS0D 5IF0B 5HYSB 2ARJA 1CLCA 4JCLA 4UV7H 1MFDL 2DL2A 4PBWD 4BK5A 3DURB 3WIFA 4G43A 4I0PB 1B3JA 3GMRA 4TTDC 2BRRL 2BY1A 4GKNA 3L3GA 3NCCB 2WWKT 4U2ZA 3MO1A 3DMMD 4ZSOB 5SX5K 2HLFC 4ZOCA 2X7LB 2FL5A 4OIIH 1KCVL 3WNKA 4XPTH 4Y1AE 4KXZI 5E9DE 3QG6A 4UB0L 5DJ2A 1MLBA 3QIWD 3QNXB 4P99A 4RZCA 5HYQB 5HHXH 5FV2A 1BVKB 1Q1JH 4M7KH 4H0IA 4KKLD 5C0NC 4LNVA 3JV4B 5D6CB 4WRLA 5C3LD 3RGVA 4Z7WF 1ZVSA 3O6LH 1GOGA 4GBXB 5D2NB 1YPZB 4XBEH 1M05A 2ZNXA 3IAQA 2H2PC 3W5MA 3V6FB 3DRQB 4YE4L 5DLMH 4F7MB 2FGWL 3DRTA 4NQDD 4JDZA 2I9LA 3ARBD 5L0QB 1HHJA 2GK0B 4PRAB 5C3TA 2YK1L 1CIUA 3B43A 3VXRE 3QR2A 1AXSB 4MJ6A 4H8WC 1DVFA 1S8DB 3UJTL 4I2XA 2WM0A 4QCIB 2OBGA 1A3LH 3IYLW 1YEDB 2C5DC 2CK2A 1K3IA 3W9EA 3MV01 4NCC1 3T77A 3T0DA 3V6ZA 5ABDE 4XNZB 2H3NA 5AZEH 4EI5A 3O41A 1G1YA 5DFTA 4F7PA 1JPSH 2VQTA 3NIFF 4FZEH 1AY1L 2HG5A 4L1DA 2APWA 2OM5A 5EZOH 1HHIB 1YJDH 3LKSB 1YZZA 1FIGH 1ZHBB 5HYJB 5IB1A 3VDAA 3WN5A 5FYLD 5F9JB 1WWCA 3BGMB 4IRSB 4FFVD 4WI8A 1PYWB 4PDCE 3EHBC 4NN7B 2DTMH 3VXMD 3O6FC 5EU7C 4QKXB 3MV8D 3EOBA 1B2WH 1UB5B 3QXVA 4UDTB 1YMMA 2J1KA 3QUZD 5A2LH 4XWGH 1IQDB 3CSGA 4NQEA 1WBXB 4LPVA 2K1MA 4XRCB 1ZVHA 5EBWA 3TCLA 4F2MB 1TNMA 4Z7UE 1YECL 5F7DB 4X7SL 2EDKA 4PJEB 1DEEA 4IJ3B 4R96A 4JQIH 1O5DT 3D3VE 4LARL 5TJWK 2IANE 3QJFB 4KRPD 4IRJB 4GG6B 1UWGH 1G6RL 1INEL 2MTPA 3ILPA 2J8UE 2FIKA 3X11A 1CL7L 2N4IA 4X98B 2F5BH 5D71L 1TVDA 4NKIL 5HDBE 2EC9U 3ZDYE 4WEBL 1I85A 3MJ7B 5B22A 2DBLH 5IF0A 3DTXA 4OF0A 1MF2H 3ROOA 5ISZD 1RZ8B 3DURA 4JG0L 4PJIA 4I0PA 3KPSD 2GFBB 3NFPA 1MIMH 1UENA 1AI1L 4GRWE 2ICWJ 4JRXB 3STLB 5C08E 1EEYB 2V17H 3IS0X 1JF1B 1WITA 3LIZL 4N5EA 2X7LA 1XCQB 2V5MA 1QSEB 5DQDH 4KI1A 5IESH 2CDEB 3LKPB 2Y5TB 3O45B 5HYQA 5I0ZA 3Q5TA 4Q2ZB 1OGAE 2FATL 3BX7C 3JV4A 4NNYA 2NQCA 1VADA 4M00A 5D6CA 4C56B 3R0NA 4R97C 3S4SB 4U0QB 3MLYH 2BVYA 2A9MH 4GBXA 5IT2H 1TZHB 1PQZB 1YPZA 1NL0L 3QT2A 4MQTB 3KPRE 4LK4A 3M45A 1P6FA 1FFPA 2WLYA 4R6UA 1FGVH 1GGTA 5D6DA 4PJGE 3V6FA 1G7HB 3DRQA 4I18A 4F7MA 1MHPL 2XWJB 1X3DA 4XCCH 1U8IB 3NIDF 4DVRH 4LSRL 3U0PB 4PJ8B 4X9FA 4PRAA 3P4LA 43CAB 1AXSA 3CDYA 1X5YA 5F7YC 4OKVB 4PB0L 1RUQH 5D1QB 4QCIA 4PB9L 1Z2KA 1YEDA 3S7GA 2ARJQ 2Y9RT 5DJXA 2VDNL 2ZKHH 3BUTA 2D0FA 1YEGL 5ERWB 5T3ZH 3RWJB 3VD9A 3EJJX 4AH2A 2W38A 4WW2C 3NVQA 2R1WB 4JFFE 2LFGA 1HHIA 3UBXI 1CFNB 4OFDA 3JUZA 1ZHBA 1IGYB 5HYJA 5F9JA 5LAXB 4ZAKB 4JM2F 1JMXA 3BGMA 4IRSA 4OCSH 3CSPA 3JWOH 1RFDH 4S1DD 2N7BA 3VFVB 5EBGA 5FUCC 5C0AE 1UB5A 4UDTA 4N8VB 3OPZL 3BQUC 1KN4L 3MYZA 4P3CH 3K2UH 3D39E 1IQDA 5JHDB 1A47A 1WBXA 1J87A 4JFEB 1EHLL 1D6VH 2R69H 4N0YL 3UDWA 2VSDA 4F2MA 2Z35B 3L5IA 1HKLH 3QDMD 4L9DA 3MA9L 5F7DA 3LQMA 3VGEA 4NQCB 4PJEA 5J12C 1FVCB 1U3HB 2W59A 3JV0A 4IRJA 2BSSB 4XCNA 4GG6A 1SYSB 1E28B 4X8JB 1P7KB 1GGIL 3OAYK 2M26A 1SQ2N 3L3OB 3MJ7A 4O4YH 1OHQA 5JLZA 3RHWK 1E6OH 4Q9BA 3GJFB 1BFSA 3TO4C 1MI5E 2RHEA 3T2PA 1FYTB 2GFBA 1IKNC 4KPHH 3QEQD 2OLDA 3STLA 1JWUB 1EEYA 5CEZD 5DMJB 1JF1A 3CCHB 4OLEA 1XCQA 4OLYL 1QSEA 1Z3GL 3P77B 2CDEA 3LKPA 4AG4H 2Y5TA 3O45A 5I1KH 2X9YA 3ISWA 1NLBH 4P0DA 3RGVC 5J06A 2NX5D 4DEPB 4YBHA 3VG0L 1RZJL 2FJFB 1NFIB 2EO1A 1WBZB 2IQ9L 4TSCL 1ACYL 4NHUE 2XY2A 1UCTA 2D31B 3S4SA 3LRHA 2AQ3A 1TZHA 1PQZA 2EIDA 3WXVH 1S3KL 3WUZA 1KV3A 2FX8L 5E24E 3FQWB 4LLQB 1CK0H 3T09A 5TF0A 2XWJA 2EYRB 2CH8A 4GQ9L 5MEQB 5ITBL 1DVFC 1U8IA 1OAQH 4HIIB 1QR4A 4PJ8A 2FX7H 1KPVA 5F7NC 1F11B 43CAA 4XNYL 2PUQT 1D5IH 3RDTD 2X4UB 3SDAC 4OKVA 1IEAB 5D1QA 3RNQA 2D7MA 3W0WE 3DX9B 3BZEA 4CDHA 4RISH 1V3KA 5EZIL 3U30C 1YEKL 3RWJA 4S1RL 1IGIH 1A7QH 4U1NA 5ERWA 3WN5C 4UTBH 2BNUB 2ZUUA 5F96L 2R1WA 3E3QA 3NCJL 1XF2B 2MPAH 3MLWH 1CFNA 1E4XH 2DQTL 5D7SH 1IGYA 1FORH 1X6NA 4QXGH 5BCAA 2HVJB 3SJVD 4WEUD 1IC7L 3SCMB 5LAXA 2YA0A 4ZAKA 4Q9CA 4NKDB 3K1KC 4TRPH 1ZANL 3B9KD 3HG1B 1UJ3C 3VFVA 4YFLI 1D9KB 4M3JA 5BV7H 3RUGE 5DQJB 4N8VA 1Z9SA 4Y4KB 2DQGH 2YR3A 3B5GA 2KZWA 4X6DB 2LE9A 3TV3H 4XBPB 1GOFA 5JHDA 5JXEA 4JFEA 3ET9F 3CFIC 1HHGB 4U1KB 1KIUA 4JFDD 4DKDC 4LVNB 4M8QB 3RU8H 1NQBA 5I1LA 4NQCA 4HWBH 1SJEB 1FVCA 4NFDA 1I85C 4HJ0C 3TPKA 5D1XC 2BSSA 4G6JL 1E0OB 1SYSA 5JPNB 1E28A 5CZXC 4X8JA 5I18H 1P7KA 5HGDA 3VI4E 1W72L 3NA9H 3L3OA 1H9VA 1JGVH 3FB8B 3BEVB 1Q9KA 3EFDL 2E3VA 3GJFA 2APVA 4JM4L 2EIZB 2OMNA 5GJTH 4KROC 2JCCE 5ID0B 2P46B 1EAJA 1TVHB 1FYTA 3O3BA 3MLSH 1BX2B 1AKJB 3DARA 1T5WA 1JWUA 4EEEA 4K7FA 4YGVB 3VI3E 2V5TA 1QFWI 2VLLB 5L7XL 4WEMB 2FR4B 2VZ1A 3P77A 3WXWL 2WUBL 4OD2A 5FCSH 4EN3D 5FIEA 4GBXC 1J18A 3L3IB 1XF5B 2FJFA 4WHYH 3MV9E 3WNLA 3ZSSA 3VRJB 3MLPA 1AQKL 1WBZA 4NC1C 5IQ7L 3M07A 5DZOA 5FDWB 3PL6B 1S7WB 4M6OH 5DYOB 2W60B 3MNZB 2D31A 1HWGB 3DLQR 2CJUH 3GK8H 5D6DC 4ZTOH 4I18C 3BEWA 4LVHC 1PEZA 4OCYL 4L4TE 1ZA3B 5F70A 5GSVB 3IXTA 2JJUA 5T1KB 2AJVH 1NGWB 5MEPA 2WWMC 3FQWA 3NMEA 1MNUH 4LLQA 2EDWA 3SDDD 3GSNH 3FFCB 5BV7B 1C12B 4OUUB 4GRLD 4HIIA 1PX4A 2Z91B 4G9FB 4L3ED 3ZTNL 2VC2L 5DK2B 1KBGL 4BZ1H 1F11A 3MV11 2BVPA 2X4UA 4GW4B 1IEAA 1JNJA 1HDMB 2BVUA 2E27L 3ZE0F 3SE4A 1KB5L 1SYVB 2J2ZA 3DX9A 3T4YB 4WWKB 4PREB 3C60D 3NN8A 4PJXF 3RNKB 4U1JB 4EOWH 3N85L 5I1CL 1N0XL 5IROC 3WLWD 3GMLB 3DSNA 1J1PL 5GGVH 5I75C 1XF2A 2UUDK 4PGCB 3TH2T 1LEGB 5J9PB 1CFQB 2HVJA 4PJ9A 4RWHA 4KZEH 1HHHB 1PZ5A 4NKDA 4WTZG 1OP5K 2ZUTA 1DBAH 3ZKND 2OXHA 1AR1D 4HAGA 1D9KA 1VGEL 1I1CA 4MS8A 3IFNL 5DQJA 3UDWC 3TM6A 4HXAH 4Y4KA 4Q9QH 15C8L 4X6DA 5JQ6H 1CR9H 5EZLB 3EOAB 4OZFA 4U1KA 5D2LB 3KLHC 4M4RA 1HINL 1RIUL 3QCUL 4TTDD 1RZKC 4JRYD 1N5YL 1SJEA 4FFWD 3LPWA 3BXNB 1W0YT 1EJOL 1XZ0B 4OCXH 3T0ED 2A74A 1OSZB 3LEYH 2VH5H 4RFNC 1N6QH 3FB8A 3NCEB 3BEVA 5GZND 2DM4A 3DI2B 3QWOB 4X7FC 5C0ND 1IEBA 4JVWA 4XNUL 4OD3H 4KTDL 5ID0A 1Q9OB 1TVHA 4DK3A 5MI0C 3MV7B 3KLDA 2GTZB 1BX2A 2YBRB 1AKJA 3DHMA 5FYJL 4HT1L 2NTFA 4YGVA 5ELIA 2WLZA 3UPRA 1LP9B 4RIRA 5FYKH 2H2PD 4R2GD 2X5PA 3QUKB 5C2BH 2FR4A 4LF3A 3BT2L 2E7LE 4HEME 3V4VL 3CJJA 3VWJB 1NKOA 5SWQB 1Z5LA 3L3IA 1XF5A 1UXWB 3VRJA 3SDXF 1A7NL 5FDWA 5DYOA 1S7WA 2W60A 3BSZH 3MNZA 4WY7L 1IAIM 1Y0LB 2ADFH 3T0XA 5GSVA 1OAYH 2AKRB 5T1KA 2CLVB 1NGWA 4EUPB 2GJ6D 4E42B 3FFCA 4MZ3A 2KL6A 1C12A 4KH2A 2UWEB 5D1QC 4G9FA 1M7IA 2VLMD 3UTSA 3QH3B 1FRGL 5DK2A 1MEXL 4Y88A 3CLFL 3C2SA 5I1HL 4GW4A 2GUOA 1HDMA 4Y19D 3V5KA 4WNQB 3SQBA 1C8PA 5IFHH 1W0WB 3EHBD 4NZRH 5MENB 1DN0B 1SYVA 2BSED 4V3DB 1JHTB 2B4CL 2A9NL 3E3QC 2CLZB 3T4YA 5AAWA 4WWKA 3IU4L 3L3KB 4PREA 1I8KB 3RNKA 5D1ZB 4U1JA 2IMMA 4Z76B 3GKZA 2QSCH 4DKFH 1X5FA 3GMLA 4YC2C 4ZAKC 3VXSB 3SO3C 3AFLA 4RGND 5DJ6B 5EBMA 3RVXC 4PGCA 2PTTB 2OTPA 4P5KB 1LEGA 1QSFB 3S88H 1HHHA 3OJMB 5DD0H 5C0RH 5IMLB 3S3PA 4OF6A 3T0BA 3BMVA 3GKWH 2RCSH 1WZ1L 2V6HA 1NCBL 3DECA 4ZTPL 5GGTL 5E70A 2NY7H 1EFQA 3P9LB 4ORZC 3ARFB 5EZLA 2BNRD 3EOAA 1WVZA 1A6VL 1VKXB 5D2LA 4HF5H 4Z0XB 1U41A 1NMAH 4P2RA 3QWRD 2J88L 3ZDZF 3S96A 9CGTA 1T0PB 2DLFL 4QGYA 2YD7A 2DQDH 3BXNA 3H9ZA 3VW3H 4RMTA 4AEIH 4XPFH 4JN2B 4LPUA 3CMOH 5GGRA 3A6CL 4LSVL 4RAHA 3QWOA 3UCRA 2ED9A 1Q9OA 3MCG1 3MV7A 4O51B 2YBRA 2X1PA 1IT9L 2VMFA 4XCEA 5D8JL 1YNKL 4L1HA 3MBXH 1XT5A 2VXTL 1CFVH 2NYYC 4AENB 4XPBL 1MELA 1LP9A 3H3KA 1KC5H 5C0BB 2YA1A 4JE4B 2FJGB 3QUKA 3VFUB 2XN9B 5T3XD 3ZL4H 1TJGH 3VWJA 5HI4C 3HZKB 1T1XB 4R7NA 1VPOH 2VERN 4FTVD 3EO1B 2GW5A 1UXWA 2NY4B 4MQXD 4YBLB 2G5RA 2WIMA 1YN7B 4K3EH 1L6ZA 1Y0LA 5D5ME 1A4JB 1EK3A 1KPUB 1BF8A 2DLHA 2AI0H 2CLVA 4G7VL 4UOW1 4EUPA 4KJQC 4DOHB 1IC1A 3WIHH 4E42A 5E5MB 5JHLL 2GY5A 2UWEA 4ZS7L 5E4IA 4OZGF 1FO0H 1D6EA 4CADB 1SM3H 3GFUA 4P9HC 2XG5A 4GAJH 2YD1A 2BNQE 5CD5C 3H9YA 5C07E 1DUZA 2IPUG 3MXVL 3DX6B 4WNQA 1T20B 2XV6B 4OCLC 5MENA 1DN0A 1JHTA 2XT1B 3L7FB 2Q7YB 1PEWA 2CLZA 3FQXB 3BQUD 1I8KA 3FB7A 5D1ZA 4OM1H 4P59H 5JR1H 4PJ9C 3O3DB 3JUYA 4IRZH 4PBXA 3VXSA 3EBAA 4BSJA 5DJ6A 1S5IH 1BZQK 4UILH 4P5KA 2PO6B 4LQ1A 5JW4Q 1D9KC 1QSFA 1VFBB 4MS8C 3WV0A 4GMSH 4YO0A 3MXWH 3PGFH 2VR4A 4ELMF 1JHLH 3P0YL 4WW1B 3HPJA 4G8FB 1WFNA 2R0LL 4A6YL 5HD8D 3P9LA 1OW0A 3JV5A 1HYSC 5D4QA 4R4NC 6FABH 4HH8A 4LKXB 4DN3L 1VKXA 4FFEX 4P9ML 4Z0XA 2IH3B 4UIKH 3P30H 4X6EA 3ZT5A 3CVHH 1R3KB 1TTGA 3WO4B 4LP5A 3SGEH 4PJBE 5I19H 4IDJL 3WUWG 5FYKU 1EO5A 4JN2A 3P9MB 1CXFA 2ED7A 2HMID 1CYGA 4R90L 1BQHG 2Q8BH 3RGVD 5A2FA 1U58B 5SWZE 2YSSB 1HIMH 3HLAB 1JPGA 1RULH 4QHKI 4YFEA 4WIQA 4NZTL 5EO1B 2AXFB 1CXIA 5F8RC 1KB9K 4X4YB 5C2UB 3ARUA 4HUVA 4AENA 4YDLB 5C0JB 2RAMA 5C0BA 2AJUL 2O5XH 2XN9A 3RJDA 4NGHH 4L3CB 5F93C 1DVFD 3O2WH 1YEEH 1PKQE 3HZKA 1I1AB 3QUYB 4TOYH 1IVLA 3EO1A 3O2VL 1QVOB 3JBG7 1XIWB 1ED3B 1KTKE 2OZ4L 5DA4A 1FNGB 2QV2A 4EI5D 1YN7A 4FHBD 4NO3B 4U0RC 1CFTB 1VDGA 1BZ9A 1A4JA 1KG0B 1JZ8A 4KDWA 2BY3A 4W68A 1KPUA 3R06B 4RFOL 3OKEB 5C9JB 1KIRA 5DUMH 3REVB 1AP2A 1OD7A 4HS3B 3ARSA 5E5MA 4HC1L 1A8JH 2VQUA 3NAAH 4MD0B 4CADA 1P4IH 1I7RB 2XPGA 2VLRE 1A3QA 4X6BA 1U8PB 4WWKC 4MA3B 1J10A 1G9MC 1T1WB 1YMMD 4TUKH 1T20A 4BZ2H 4NQED 5DDHB 2MOVA 3L7FA 5JW3L 3P11H 2Q7YA 1LO5B 4POZC 4XVTH 2ZP0T 3VXQA 4UTAH 3FQXA 4ZD3H 4YBQD 3ULUC 2GI7A 3H42L 2J5LB 5TQ2L 3O3DA 3TNMB 4OB5L 2JJSA 1NCDH 5I17A 3RJQB 3RA7H 1NMBL 3ZKQD 5F7HA 4X0KB 5D70L 4LOUC 1CLOH 1CWVA 1OGTB 2PO6A 1T04B 1VFBA 1RU9H 2GT9B 4K55A 1TZIB 1V3LA 4X4ME 2WWKO 4HLZH 3RIAF 2L4OA 3SDYH 5CZXD 1MCWW 4WW1A 5TE7H 1HQRB 4G8FA 3INUH 5DVNA 4I0PD 5FKPB 3I75B 1RIHL 2UZIH 5TFSH 5HHQB 3G6JF 3DROB 4Q9RH 2C7UB 3QXTA 2AK1H 4LKXA 1GIGL 4KROD 2IH3A 5IIEB 1BVLB 5TE4H 4N5ED 4XVJH 1R3KA 3FN3A 4HUUB 4OZGB 1MHCB 2BVQB 4HKXB 1LK2B 3C08H 4OI9A 1WIUA 4HJGB 2ZCHH 2ITCA 4I5BB 4FQJH 5DRZB 3UP1A 3P9MA 4JFXB 4FZ8L 4G59A 1DTUA 1FVDB 3BW9A 1U58A 4GBXD 1KOAA 1BM3H 3FMGL 3HLAA 1EV2E 5FA4B 4D3CH 3IVKA 3OXRB 5EC1B 3RWEB 4L4VE 2AXFA 1MCSA 3H9SB 3PABB 1JIBA 2R2BB 3VWJC 3SGJA 4NRYB 3KXFE 2A0LC 5CP3A 4PD4J 2X4RB 5C0JA 2WWMD 4LMQI 3ERYA 1NAMB 4NJ9H 3D5OF 5EA0H 3UTTE 4FQQA 3MOBH 4L3CA 3G04B 7FABH 1I1AA 3QUYA 4P5TB 5F8QC 3MJ9H 4AQOA 2C3HA 2DYPB 2PYEB 1QVOA 1XIWA 1DQMH 1FNGA 5DD6A 1AC6A 5GGQL 2OYPA 5I9QC 5I1JH 4NO3A 1DL7H 4N90E 1CFTA 1NFDF 1KG0A 4JPIB 5FHBH 1SY6A 3SDCB 5ADPH 2XA8H 3R8QA 3LS4H 4W6XB 5C9JA 2QBWA 2UY6A 5TH2B 3PHOA 5HYJD 4LLUA 3G5ZB 3REVA 1UACH 2BSRA 2LQRA 3IB4A 3WFCL 5KW9L 1IGFH 4IRSD 2L0DA 2LU7A 4TPRH 1A6ZB 1E4JA 2BP3A 2OS7A 2BOCB 3VA6A 1I7RA 3VRLE 5HBBA 2A1WH 1T1WA 1BLNB 3KJ4C 3QNZB 3DXAE 1BD2E 1JFQH 1FNAA 5HY9B 5GRZA 1YA5A 1JWSB 5FGRA 2Z4QB 4FQLL 2PCPB 3TNMA 1N3NA 1RUMH 4MNGB 3UJIH 4IOFD 2BC4B 3BPNB 4IRJD 5DMIL 4IOSD 1T04A 5EU5B 1FC2D 1LK3H 3N9GH 2GT9A 1TZIA 4PG2C 3TFKA 3MRGB 3VWKB 4HKZB 1HQRA 4G5ZH 2NZ9C 4KAQL 1FNEA 3L5HA 4FXGB 4ZNEA 3FT3A 5LVEA 1EIBA 1MQKL 5FKPA 1N4XL 3I75A 5HHQA 3DROA 1FNSL 3VGDA 2C7UA 1RZKH 1FCGA 5IIEA 5MEOB 5DRNB 1BVLA 1JNNL 4ZPVB 3RY6A 2V9TA 3ULVD 3WNMA 4EI6B 1QSED 4HUUA 1MHCA 2BVQA 4HKXA 1LK2A 3TBSA 2Z8SA 1C5BH 1T21A 4I5BA 3RI5K 4OGXH 2Y6SC 5CMAB 5GGUA 1CLZL 3D85B 2RJMA 3HMXL 5B8CB 2FNBA 4GRWF 5ENWA 2VSCA 2ENSA 3W81A 4KQ3H 2R4RH 3OXRA 5EC1A 5JW4N 3RWEA 1MFCL 1EHAA 4X8XA 1K2DB 2FHFA 5DT1H 3H9SA 3VXUB 3PABA 4M48L 4UUJB 5I71B 3AS2A 5LGHL 4NRYA 4G3YH 1WTGT 3ZT6A 5HVHC 5IGXH 1KENL 2X4RA 3CDGB 1FAIH 1GOHA 2A77L 3PNWB 4YUEH 4PJ8D 4CN4A 1FL6B 4DGVL 1JJUA 1NAMA 1CE1H 1NUNB 1FN4B 4ONFL 1RIVL 4WI4A 3P2TA 3RQ3A 2FEDC 3SN6N 4TSAH 3MLVH 3JWDC 5D1QD 1HXMB 3BP4B 4P5TA 3BKYL 4HKJB 3UTZB 3H7LA 2B20A 1F4XL 2DYPA 2PYEA 2BERA 1T7YA 4BUGA 1LHZA 4PJDF 1IC5H 3TP4A 3QUMB 4OGYH 4PJGF 1XGYH 1A4KB 4ERSL 3I6KB 3I9GL 4JPIA 4KK9D 3SDCA 3FTGB 2XG4A 2YZ8A 5C0FB 2YPVH 2AK4B 4TYUA 5TH2A 3WKMH 3G5ZA 4G9DB 3GI9H 2AW2A 3WD5L 1ZTXH 5FUZH 3EJYC 4ZAKD 3MRIB 3TIEA 3HE7B 4AZ8A 3OB8A 4O2FA 2X1WL 2BOCA 3B2VL 5E2TL 4S0TD 4LSPH 1TQBC 4HWUA 5T3XL 3QDAA 35C8L 3M17B 4TNVF 3QNZA 1MRFH 4HIXH 5JHDD 5JXED 2JJSC 1NGXA 4JFED 4Y1AB 1Q94A 2WQRA 5HY9A 1JWSA 4P4KB 3EYUH 2E5EA 3UAJC 1BWWA 2ICWI 1KELH 4NQCD 2VITA 3SGDI 1YEIH 4MNGA 5INDB 3ZO0A 3GMPB 2BC4A 1QYGL 4PGEB 4X4XB 5DFVD 1VFAB 2Q1EA 2BOBB 4M93B 5KVMC 5EU5A 4UAOC 1G7PB 2XZZA 3RWDA 2Y06H 1BFVL 1L4IA 2EC8A 2J4WH 4U1SB 4XCFH 4GG8B 2BDNH 4XP6L 4Z18A 3VWKA 4RQQB 2XFXA 4HKZA 3HUJE 4R8WL 3CVIH 5A2KH 4FXGA 3MOAH 1EZVY 5BOZG 1FYTD 5I0DA 2DLTA 5JW4M 1YEHH 2B7DT 4R4FL 4GRWH 1R5WA 3PF2A 1D7FA 2QJDA 3VXRB 2VZUA 5DRNA 4ZPVA 1FDLH 4UT6H 1YYLL 4F9PA 5I1EH 4LHJB 4L8SA 2EE3A 2P44B 3MA7A 1H3UA 4F58L 1L0QA 4P2YA 2H8PB 5CMAA 1L7IL 3LCYA 3Q6GL 4FP8H 3UTPE 3D85A 1NGZB 3OKMB 5HI4D 5B8CA 4LRIA 4J1UB 1C5DB 4YXLH 2VL5B 3M1BB 1P84K 5DVOA 3EAKA 2GCYB 1K2DA 3R1GH 3CU7A 1R6VA 3OZ9L 4K9EH 4DWHA 5IJVB 5KSAC 5JIKA 5EWIL 1T6WA 4NKMA 3V0WL 4HFUH 5BO1H 4HK0B 3OGCB 4FQXB 4YEFA 3CDGA 3PNWA 4Z7NE 1FL6A 1UM5L 3OHXA 3WLBA 1VB9A 1UVQB 1XIWC 4DN4H 1FN4A 5E08H 1S7XB 1V3JA 4D0BB 4YHZL 1FBIH 1HXMA 3BP4A 2VDML 2VXQH 3L9RA 4Z7UB 4Y5YB 1NSNL 5ICYB 4QTIH 2DM3A 1PSKL 4Z0BL 5CD5D 3QZWB 2GITB 3O3AB 3D3VB 2EO9A 2G60L 4BQ6A 3QUMA 2IANB 4TQEH 1G9EA 2HH0L 4WCYH 2XY1A 3C8DA 2RFXB 1ZHLB 2J8UB 2YN5A 3FTGA 3MRJB 1T7WA 4S1SH 5CLTA 1SVZA 2OL3H 4NN5B 4PJ9D 4G9DA 3MRIA 8FABB 3U36B 3HE7A 3NPSB 4RA3A 3E8UL 3IDJA 1KCLA 3CXDL 3P73B 3ZKXB 1D9KD 3O4OB 4MS8D 2G9HB 1F90H 4KUCF 3WL9A 4Y4KD 5C08B 3M17A 2F19H 4WUKL 5EG6C 3GMOB 3OG6B 4Q0XH 1LMKA 1ZLVK 1OAZH 1KCRH 1WEJH 4LIQH 4XPAH 5KN5B 4Y1AA 2DQCL 3UC0H 4M7LH 5I74B 1HYSD 1QLFA 1QKZH 5GS0H 3U1SL 1OGAB 5INDA 3TFKC 3GMPA 1A7PL 4X4XA 5A16B 1P4BL 2BOBA 1B0WA 4OF8A 2YKLH 3C5ZB 1G7PA 4ZFGH 2N56A 4V3EB 4GG8A 4HXBL 3RUGF 3GRWA 3QI9B 1FPTL 5EC2B 5TF1H 3ULUF 4RWYH 1A7RL 1Y6KR 1UFUA 4PJGB 2IH1B 2YA2A 2ZUQC 1I9IH 4NJAL 3X3GH 3RY6C 5ICZB 4GRMB 4RA0C 3E6HA 5IFAL 2HLAB 5JIHA 5DEGB 1JYXA 1AKJD 4V2BA 4AIOA 1VHPA 4TVPL 2WBKA 4GOSA 1V5JA 1J1XL 1Q72H 1EX0A 1YNLH 3CAFA 2E7CA 3QFJE 3IRPX 2MHAA 1MFEL 1DBMH 3GIZH 2JIXA 4CN1A 3BRDA 5EORH 1OTUC 1BAFL 5E8OB 1CBVH 3CIQA 4WU5B 4AEHL 1NGZA 1UEYA 4JGJA 3TT3L 3U9PL 4G6KL 1G6RB 2OL3B 4J1UA 1C5DA 4KVNH 2VL5A 4QXTB 2YD8A 3KR3H 3VI3F 5TDPB 4XAKE 5T1KD 3QHZH 5IJVA 2KQNA 2PKDA 1EXUB 3B4NA 4PUBL 5TPWL 2PTUA 4KKCD 4X9BA 5AWNH 4RDQF 1MCPH 2MWCA 3FFCD 3BP6A 5EBLB 5C0AB 1H3TA 4LPXA 3EZ8A 4KUCD 4Z9KB 2AJZA 2JB5L 3P0VL 1RUKL 4G9FD 3UTSD 3WSQL 3GO1L 1UVQA 2VABB 5GRWA 3D39B 4HPYH 3AVEA 4D0BA 1JGDB 3MJ8B 4UNUA 2GAZB 1ZAGA 2MQCA 4Z7UA 1L6XA 1P7QA 5ICYA 3SDCC 1DEDA 5HHOB 3QZWA 2GITA 4WWKD 3O3AA 3D3VA 1NFKA 2IANA 1TJHH 1RPQA 4KDTA 4PJFF 5J1SC 3B9AA 2GTWA 2J8UA 3MRJA 4POZD 4ISVB 5J0BA 2E6JA 2NY5L 5JOFA 5E6ZA 4XVUD 4YHNB 4OD1H 4Z5RB 5H37G 2ZUWA 2IPTH 2VIRA 4UNTA 4W4OA 1R0AL 8FABA 4ALAH 4K07A 4DGYL 1I3VA 1G9MH 5DO2C 2IBZX 4XP5L 1RD6A 1MI5B 2E9IA 3P73A 4MJ5B 4MVBA 5IWLA 2G9HA 1CTNA 2PW1B 2ZSVA 1T0MB 1R3HB 5C08A 3WFBL 2YWZA 3V7AG 2VDOL 3PXHA 3VFRA 4NQVB 3ULUH 4NNPH 4TVPE 5EOCL 1QFUL 2P45B 5KN5A 3JTTB 4K23L 1HWHB 1TJIL 1P69B 5HGAB 5KVFH 4P2RD 3BHBB 3KHQA 4OV5A 4QGTA 2FH6A 4P48A 4M1DH 4H1LG 1CTOA 4KQ4L 5GRJH 5CGMA 2CKBH 2NY2C 1E6JL 1A64A 4NHUB 4NM8H 4YHOL 3C5ZA 1G9NH 4YXHL 1YQVL 3QCTH 1RURH 3QI9A 3RX7A 2YUXA 2VQ1B 1M6OB 4N1EA 3BGFB 3QP3A 3MRQA 4GXUN 2X9WA 5C09E 2XKNB 2IH1A 2BHZA 1U8LB 1QFPA 4GRMA 1DSFH 3PP4H 3MV7D 2HLAA 5DEGA 4KFZC 4OIIL 1NEUA 4L8SC 2AXGA 3PGCB 4M1CC 4LNRB 3HB3C 5CIPH 3AB0B 5AUMB 1Y6NR 3HE6C 3LPFA 1Q1JL 4GUPB 2W65B 3VWJD 2UYLA 3MTRA 4LSSH 3W0WB 5KSUB 4CU8A 3VD4A 5EN2B 2PETA 3O6LL 4LRIC 5E8OA 4PJAF 3K8LA 3QAZB 5BVJB 2ZOLB 1CFBA 1G6RA 4X80H 3NTCL 5DLML 4QXTA 1IBGH 5TDPA 3BH8B 3UO1H 1CDIA 2ERJC 4IEFB 3Q5OA 4S0UC 1EXUA 1Q9LB 3WFEH 3F6LA 5DVKA 5EBLA 5C0AA 2VDQL 2WY3A 3VFMB 1RJYB 3ULVL 3LKQB 1I4FA 2CXGA 1T66C 1A3LL 1OAXL 2QHLA 5C70A 3LEXB 4D9LH 4JFOB 1JGDA 3MJ8A 2ESVE 2XWBB 3ALXA 5AZEL 1UM6H 5MEND 4O9HH 3HI5H 1X5LA 4R26L 5HHOA 1F00I 2C3XA 1T22B 4FZEL 4YHPB 5D96B 2VAAB 3T2QA 3TYFB 5D1ZD 2D2OA 1YJDL 1FIGL 5IB2B 3VXSD 5CSGA 4ISVA 1AD9B 4M8VA 4BSVB 1QSFD 5HYFA 4Z5RA 4UMGA 5MP6H 1QP1A 1C16B 2ZCLH 1DFBH 4J6RL 1B2WL 5J13C 5LGJA 2JCCB 4Y4HA 3MNVB 1MI5A 3QDGB 4MJ5A 5I8OH 4LFHD 3SQOL 1E4XI 4NWTH 1T0MA 2DS4A 3PWPE 4HCRH 1WC7A 4NQVA 5EU4B 4APQB 1TXKA 4GH7B 3T3MF 2IBGA 3RWCB 1KN2H 1MUJB 4HAFA 1Q0XH 2DRUA 1I8IB 1OVZA 4M93C 4LASH 3BHBA 3UZVB 4MSWB 3MLRH 1UWGL 5CILH 3M8OH 5DMGC 3MV9B 2F5BL 3Q2CA 2FX9H 4NHUA 4TULH 2DBLL 4LLDB 4DUVA 1CGYA 2VQ1A 3VFGL 3BKMH 2ADIB 1MIML 5MERA 5C0GA 2XKNA 4K94H 2EYSB 2Y6SD 2R8SH 2GY7B 3GJFK 1U8LA 5ICXB 2FO1A 3KPTA 1G0YR 2EH8H 2XTJE 5KJRH 1TPXC 4EKXA 5DQDL 4LNRA 5IESL 5AUMA 4NBZB 1M71A 4GAFB 1A1MB 5C0BD 4HPOH 1AQDA 3V4PH 1ZSDB 1ZVYA 4GUPA 2W65A 4GKZB 1JYNA 2XN9D 4JDTH 3W0WA 4XZUB 5KSUA 4M6NL 5FA3B 1YYMH 3MLYL 2NY4D 5IT2L 1SJHA 4XBGB 3MLTB 1B4JL 3LH2H 3UTOA 5BVJA 5AZ2H 2P5WB 1FGVL 5LGKA 3O2DA 3WJLA 3HAEB 4JO4L 4NT6B 3BH8A 2W07A 5K9JH 3RKPA 1Q9LA 1QRNE 3UPAA 3GGWA 2CIIB 3CZFB 4M7ZB 5KANI 4TUOB 1Q0YL 3VFMA 1U8HA 3JWDH 1KCSL 1AJ7H 5FYLE 2HFFA 3EJYD 5CUSH 3BZ4B 3LEXA 4JFOA 1AH1A 2CK0H 5KS9A 5C6PB 4OLVH 4YDKH 2XWBA 4KDTC 4MQSB 5D5MF 1DBBH 1HKFA 2ZKHL 4I48B 3MV8E 5T3ZL 5C6TH 4CVZA 4YHPA 3VG9C 4P4RB 2VAAA 4PJHE 4MZ2A 2BVTA 2DKMA 5CLWA 4HS8H 2ZSWB 5IB2A 4BSWA 1OOAA 2XNAB 4LLWB 2VLKB 2APFA 3ZYOA 1AD9A 4OCSL 1LO2H 2PO6D 3JWOL 4XXDB 4BH8B 2FO4B 2NTSP 5FEBA 1IC4H 1TFHA 3O4OC 5BJTB 1A9BB 4K71B 3OKYA 4D9RD 2JCCA 3W2DL 3X3FH 4IMLA 3MNVA 4Z7WE 3QDGA 3K2UL 4GKOA 1C5CH 1D6VL 1HHKB 2R69L 2F8XC 1R3IH 5EU4A 2FWOA 1HKLL 3IF1B 2NPLX 3RWCA 2AP2A 2VN4A 3R0MA 5ISZE 1MUJA 3UBXB 1DQQB 3ZYJA 1I8IA 4MSWA 3MV9A 1C7TA 1J0KA 4H20H 1T2JA 1TNNA 3QJHB 4WV1C 1UH2A 4MNQE 4O4YL 4LLDA 4BQ8A 1S7UB 1C1EH 1IGJB 2P8LA 5JIIA 5I8CB 3BH9B 5FO8B 4WI3A 2EDLA 5F9OH 2W9EH 4KPHL 2EYSA 2EXWD 2GQHA 3S97C 2ZPKH 3NIFE 5ICXA 2VOTA 5CINH 4M7JL 2CGRH 4JKKA 2DI8A 1YDPB 5GIRA 2EKSA 4PJBF 1H8SA 1KIQB 3MODH 4AG4L 5E0QA 4DW2H 5I1KL 1A1MA 2JJWA 1NLBL 1I9JH 4LHUA 3RZCC 1ZSDA 1AFVL 5FHAL 4GKZA 1TTFA 4FS0A 1NGPH 1RUAH 4KK8C 5IOPB 4XZUA 3MRDB 4HZLA 4AK1A 1I1AD 4MHHI 5FA3A 3QUYD 3UXFA 4XNXH 1XIWD 4XBGA 1MRCH 3WXVL 3MLTA 1JFMA 4I3RH 2P5WA 2CUHA 3VXOB 1FV1B 1CK0L 4XP1H 3HAEA 1P53A 2IAMB 4WI5A 4WFED 5D7JB 1OAQL 2ZJSH 4Z7QF 4HMCA 3U2SB 3SKUD 4Q6IB 3DETC 5I76B 3CZFA 3MRCA 1D5IL 4WGVB 2AERT 1FZJB 2W92A 2VDRH 4TUOA 3T04D 4XT1C 2X4NB 4XP4H 1J5OH 4YDJB 3VJ6A 1ZKAA 4RISL 4LGSB 2CO6B 1YN6B 1DN2A 1IGIL 1A7QL 4HWEH 4UTBL 4P4RA 3VMOA 3EYOB 3PXJA 3MLWL 5I1DA 4I3SH 3VGFA 5DRWA 1E4XL 2ZSWA 3CFKB 4LLWA 4FQIH 4U31A 2VLKA 5HTSA 2IPKB 3BESR 2X09A 4Y4HC 3FO0H 4XXDA 4BH8A 1P5VA 3QDME 4TRPL 1WTLA 1A9BA 1QFWH 5L9DH 3TFKD 5BV7L 3LKRB 1NBZB 3H7BB 5TDOB 2R2EB 1YEFH 2DQGL 3U0WH 1BOGA 4NFCA 4Y16A 2V2WA 4NKOB 3S37H 2YEZB 1HHKA 1EO8H 1XF3B 3E0GA 3TZVA 1T5XB 3IF1A 3RU8L 4AM0B 1B0RB 4HWBL 3UBXA 1DQQA 5ACZB 2E7LA 1MVFA 1KF9B 3FT2B 4MCZB 1OP3H 5SWSE 3VFWB 3G5XB 4ZYKA 2Z92B 1YEJL 5E8EB 5I18L 1ZT1B 1IKFH 3TH4T 5CEZE 2EH7H 5L8LB 3NA9L 4Q58C 5E5UB 1JGVL 2IGFH 4JR9H 1S7UA 3S37X 1IGJA 4U1LB 4U1IB 2YMXH 5GJTL 5I8CA 4DKAA 3BH9A 3GDBA 5FO8A 1MVUB 4I0KA 4N5UA 1H15B 1B6DA 3KLSA 3HC4H 4IIQB 3DSFH 2YD2A 3H9SD 1UH4A 1YDPA 1IAMA 1FAKT 1KIQA 4KTEH 3HRPA 2EIEA 3CFCH 2NY1B 1JTPA 2BNQB 1ZLSH 5C07B 1MREH 3AC0A 5DUBB 3BWUC 2QHRH 1RI8A 2NXYB 5IOPA 3MRDA 1SBBA 4BH7B 4ZTOL 2CJUL 4P5TD 2A6JB 3QO0B 4LCUB 3BP5B 1KFAL 5KSBE 2PYED 2DYPD 3WJLC 2R2HB 3S34H 3VFNB 4KJYB 5E00B 3VXOA 1FV1A 2AJVL 4UV4H 1MNUL 3SDCD 1X7QA 2IAMA 2AV7A 3F7VB 5DD1H 5D7KD 4OLZH 5D7JA 2Y72A 4U7KA 1MQ8A 3U2SA 4ACPA 4Q6IA 5I76A 4BZ1L 3EYSH 1A7OH 4JB9H 1FZJA 4FG6C 1LO3H 1FP5A 3PHSA 4RMVA 3IXAB 5GSRB 2D0HA 2HRPH 1JUFB 4YDJA 1QRKA 5ESVB 3TIDA 1RZJC 3REWA 3IJYA 1YN6A 4EOWL 2OK0H 2RIKA 1NGYB 4LSQH 4LSTH 4PJBB 5GGVL 2X6MA 1BJ1H 5FOJA 4PLNC 1ZT4A 3DWTA 1GL4B 3OJ2C 4HGMA 1HEZB 5I6XB 3CFKA 5B38G 2IPKA 1KLUB 4JFDE 1TQCC 1PG7W 2AXJA 3QDHA 1PW3A 3ARQA 4LDEB 2NXZB 3LSOA 5BMFH 4ZUWB 5SWZB 3TLRA 4AIZB 3Q48A 5LKNA 1KJ2B 4HS6B 3NA4A 3LKRA 3BDXA 3N50A 2W0KA 3H7BA 1IM9B 1H8OA 4HXAL 2R2EA 5TDOA 3VWKD 5I66B 4XNQB 3K80A 1ZLWK 5IVXA 2XZCH 4OCRH 1CR9L 5JQ6L 3FO9B 1FSKC 4NKOA 1SBSH 5GRVK 1T4KB 2YEZA 2LV4A 4KKBC 2V7HA 4HUXB 4WFGD 1JF5A 3ES6A 1XF3A 4X5WA 4ODTH 4MX7B 1T5XA 3KGRA 2DL9A 2YUVA 3QEHB 4X4ZA 2JKXA 3FT2A 3VFWA 1NKRA 2Z92A 4V1DE 4YQXL 1ZT1A 4OQTA 3BD5A 2NCMA 4OCXL 1U3ZA 1TZGH 2HJKA 3HB3D 2VR9A 3WUWB 1T89A 5GGVY 2EDHA 5F9WC 3GUTA 4U1LA 4U1IA 2VXVH 4Y8DC 3SGEI 4OD3L 1A5FH 3D85D 3SE8H 2HVKA 4OTXL 4RGOH 4ZOBA 2Q8AH 4D94A 4Z77B 5F7UA 4J2XA 1JZ6A 1J11A 4WO4B 4QOKE 2XZAH 1YY8A 1M7DB 4IIQA 1XGPB 3U9UB 5KVEH 1T0NB 5FYKL 3HMWH 4NN6C 5GGTA 1KSRA 2VLRB 4YNYB 3KLAB 2BNQA 1T80A 3BIBX 5DUBA 3F58L 3ESVF 1JWMB 1W8OA 2NR6D 1PY4A 3QHFH 4ZXBB 1JTOA 5I1IL 4PRHE 3BSZL 5BRZB 4JZJB 4BH7A 4L3EE 5BQ7A 3SGKA 2A6JA 3QO0A 1NCTA 4MJIB 1T66D 5FGSA 5FGCE 4OCMC 2R2HA 3V8CA 2ADFL 3VFNA 2K7QA 1OAYL 4NBYB 5E00A 5SV3A 3GEWB 1EDQA 2CSPA 3RVTD 1X4ZA 1XGRB 3L3JA 3ARVA 3F7VA 1MCRA 1JYWA 1FLRH 3PJSB 1V7MH 2EDDA 4QRTB 1BQLH 4L29A 2MFNA 3LQZA 3SKJH 3VD5A 3HE7D 4UINH 5IFHL 3RWHB 3IXAA 4NZRL 5GSRA 3TBYA 4IBLT 1A22B 1IGCH 4AEEA 2Y4SA 5LBSH 1CICB 3D2UB 4WI6A 5ESVA 2VWEC 4ONOA 4PRDB 4ODSL 1LDSA 5FFLA 4Y1AD 4DKFL 1DLFH 1NGYA 1ORSB 3QIUB 5T1MB 5HSFA 1V7NH 4NYLB 4LP4A 3Q5YA 1DQTA 2J8HA 3SE3A 3RVVC 3S88L 2M1KA 1SVCP 3MRHA 1S7RB 5DD0L 4M9OA 3T0AA 5I30H 1XGQB 3OGOE 4Y16C 3TF7C 4YDIH 4JRYE 2VLJA 2RCSL 2PR4H 4ZUWA 5HI5C 5SV4A 4OZIA 5DMGD 4R3SB 4HJJH 3DMMC 4OIBA 4AIZA 1KJ2A 1IM9A 2NY7L 5FF6A 2FGZA 1F97A 3MGAA 2BSTA 3TZVC 3TT1H 1EVTC 4L4VB 3FO9A 3D9AH 1D5MB 3MBEB 3QQ4B 1T7ZA 3VGAB 4PG9B 3QIWC 4I9WD 3VXNA 4HUXA 3HPLB 4UNVA 3OMZA 4N0UA 5GRUH 3KXFB 4NRXA 5FYKE 4MX7A 4RMUA 2XYCA 3QEHA 3BPLC 1JGLH 2AJYH 4X7TB 5DK0A 2DQDL 4M5ZH 1CFSB 4JFQA 4R4BB 4AEIL 2IBBA 2P49B 3KDMB 4XPFL 1LE9A 2JIXD 1WFUA 1BJ1J 3L3DB 2XTLA 4YH6A 1G7LB 5E03A 3B9EA 1H5BB 2R0ZH 3HNSH 4K3GA 1ZEAH 3CMOL 3MLXH 2CKNA 1RHFA 4YLQT 2E9JA 5BXFB 4JG1H 4X6CE 5E2UH 2WBJB 1GH7A 1MJJB 4PJXE 3MLUH 4Z77A 3GSQA 3MREB 2OCFD 5HJ3A 4UDUA 4LQFH 4Z6AT 1IJ9A 3MBXL 1CFVL 1XGPA 3U9UA 1T0NA 2QADB 2B39A 1KC5L 5C71A 2BCKA 5DWUH 3V0VB 5DA0B 1GAFH 3ZL4L 4YNYA 4A6YA 1TJGL 3MUGB 1JPTL 4G80B 4KRLB 2EC9T 1OCWH 4J3WA 1VPOL 1JWMA 1GVIA 4ZXBA 3RWFB 1BD2B 5C0EA 2F8OA 4BYHA 5BRZA 4JZJA 2VLME 4MJIA 1HNFA 1P7QD 2MQ3A 2NY3B 3BP7B 2IAMC 5E8NB 2CXKA 2E8YA 4FFVC 3D3VD 4OT1H 3PV6B 2IAND 2AI0L 1HXYA 3LMJH 3MZTA 4P2OB 4AMKH 1JYVA 2VZTA 5EU7E 1XGRA 3WIHL 2R39A 1MY5A 3DO7A 3QUZC 1EBAA 1MLCB 4Z7NF 4D8PB 3OR6B 1SM3L 3PWLB 4P2CG 3FOLB 4GAJL 3C6LA 1RJCA 4HBQA 1AHWB 2QQNH 2YD3A 2ADJB 4MVBD 3RWHA 3PWVB 3QUXB 1KCKA 5C08D 2AJSH 5IR1A 1MCCA 3U46A 3FN0H 4OM1L 4P59L 2H32H 2A83B 1ORSA 3QIUA 5BZWB 5T1MA 4J3SA 4GSDH 2ENYA 4NYLA 4TUJB 4UILL 2BNRE 3L5WB 1SY6L 1KGCE 1A6AB 5SX5H 4GMSL 3MXWL 2DWEB 3PGFL 3TO2B 1JHLL 3C5ZD 4R3SA 3RL1B 3SDXE 3QI9D 3LRGA 1XFPA 2D9QB 4L4VA 1D5MA 2G75B 3MBEA 4PG9A 6FABL 3OXSB 3HPLA 4HC1A 2AEPH 3K4AA 4UIKL 3P30L 2C3VB 3KXFA 1LD9A 1KYOK 2HYMA 3CVHL 2HJFB 2B4CC 1HSBA 5HDQH 5F6IB 5I19L 3CX5J 4X7TA 3BKJH 2I24N 3FO2A 2VZOA 3B9VA 3KDMA 3L3DA 3MCLL 5TGBA 1OP9A 1G7IA 1G7LA 3GMQB 3VH8G 3H9HB 2ILLA 3GBNL 1H5BA 2Q8BL 3KWWB 4ZO8A 5BXFA 1HIML 3UJJH 1RULL 2WBJA 3I50H 4IIQC 4KK8D 1MJJA 2DQJH 5K9KB 3LQAH 3LD8B 3MREA 3BN9D 2P8PB 4CVXA 2ZCKL 1F3RB 5GS1B 1IAKB 4OLUH 3V0VA 1EAPA 5FAAA 4YHYC 1J0ZA 3MUGA 5C0AD 4G80A 2GJZA 5ANMA 3O2WL 4HEPG 1YEEL 3QCVH 4MXVF 2MCPL 1IAOB 4FQ1H 2FZ3B 4PLKC 4ZFZB 2R56H 3SPVB 3E2HB 3DETD 3RWFA 4NKIH 3WHE1 4PP2B 3NGBB 2E9WA 1FGNH 4JJHA 3H8NA 3TNNB 5HDLA 3BP7A 5HHOD 5E8NA 4YXKL 1E4KA 2FYYB 3PV6A 3ELAT 4S1DC 1J0YA 2DQUH 2X10A 2YD5A 4P2OA 5DFWH 4OFIA 5DUML 5FUCE 4GLRH 1X4YA 3SE9H 1TETH 1MLCA 4KZDH 3NAAL 4D8PA 3HUJB 3GHBH 1K8DA 1UZ6F 3FOLA 3QRGL 4OZHF 3DUSB 4HG4J 4Y4HD 1AHWA 1MI5D 4ONGH 2IG2H 4TUKL 4F7CB 5F88B 1A0QL 2ADJA 3PWVA 4BZ2L 2P42B 3QUXA 2DB8A 4PJ7E 3P11L 1FH5H 4XVTL 4UTAL 2P24A 4U1HB 1Z9OA 5IMKB 2A83A 5E2WH 4MB3A 1LWRA 1XMWA 5BZWA 1NCDL 3RA7L 5KTEL 3SOBL 4Y5XC 2LAGB 1F6LL 4OBRA 4TUJA 4O58H 1CLOL 2QEJA 4DGIH 4PS4H 1RU9L 1A6AA 1MHPH 5CZVH 4ZQKB 2OTWB 4MD4B 5KVGH 2OX5A 5CJQH 3TO2A 3TA3B 3NZHH 4PYGA 3SDYL 5D72L 5TE7L 3RL1A 1LGVA 3INUL 4JKWA 5CJBA 3D18B 3JWNC 3RHWF 1GGBL 4PJCA 4ELKB 2UZIL 5TFSL 3OR7B 2I07B 2G75A 3HS0B 4JHAH 4Q9RL 2AK1L 4DCQB 3OXSA 4P3WA 5K9OB 5IMOA 3KPOB 2X89A 1HE7A 1RZIB 1U91B 4MA1B 2HJFA 1YEGH 2NY6B 4KI5C 4BQBA 2X4PA 3VE0A 5CAYB 3B8SA 3C08L 5J1TC 5KBNC 2QQQA 5DD3H 5C0DA 4D9QE 3T65B 2ZCHL 3VFSB 1T1ZA 4F9LA 2CLRB 3GMQA 3W0WD 1GZPB 4U6VL 5DGQA 5F9AC 5FV1L 4N0FB 5AYUH 1BM3L 1T83A 4XCYA 4I2XE 1KN4H 2JJTA 4K2UH 3S3SA 3V95A 3C6SB 4G8IB 3VU2A 3RDTC 4NO2B 2WP3T 5I8EB 4RCAA 5GS1A 1IAKA 3QA3B 4JPWH 3DUUB 3C09B 3MOBL 5HYSG 2HWZH 3LPGA 4K7PH 7FABL 5L6YH 4ELME 1IAOA 1WZMA 1FCCA 3OF6A 4ODXB 3SPVA 3MJ9L 1MFAL 2V9QA 4PP2A 1DQML 5DHVH 3OKNB 5I1JL 1EO7A 5FHBL 4Y4FB 1YMME 2XA8L 3EYQC 4XAWL 2FYYA 2WSKA 2MCG1 1OARH 4NQEE 4WI9A 1S7SB 4PP1D 4HZAA 2HFGH 3C6LC 4FQ2L 4K7PX 4G8GE 4TPRL 3CX5K 3HMXA 2VXUL 3T08A 2R23B 1TMCA 1Z3GH 3HUJA 3DUSA 4OKDA 5IVNA 3O9WB 3OAYH 1K4CB 4F7CA 3QDGD 5F88A 1UQSA 2YRLA 4XHJC 2JK5B 1ACYH 1I7ZB 1W8NA 4YX2H 1BBDH 3CC5B 4HWZB 4JJ5B 5JOPE 1A6TB 2QTEA 3D25B 4U1HA 5IMKA 1IRAY 1RUML 1S3KH 4PJIE 1CS6A 3GZKA 3UJIL 5GGSB 3GSXB 2FCBA 4PR5A 3HFMH 1LK3L 3N9GL 4LPTA 4FMFA 3MV9D 4FFYH 4P2QA 4ZQKA 1DCLA 5M94B 4GFTB 3TA3A 3AS0A 4G5ZL 4U6HB 3CGTA 4ZUSB 3D18A 4NRZA 5C0IB 5C7XH 5HI3C 4ELKA 3OR7A 2I07A 1WWBX 1RZKL 4LVOB 5H37H 2VZSA 1RZIA 1U91A 4QEGA 3JV6A 3LN9A 2OI9B 4NC1E 1BFOB 4LHUD 5IW1B 3WNPA 3T65A 4JPKH 3TBTB 1C5BL 5LCVH 3VFSA 4ZPTB 5ILTL 5IEKB 2CLRA 3DV6B 4GMTL 3OL2A 1OF2B 4JREB 1VA9A 2NY0B 3WS6C 2VE6B 5F3HA 5JNYA 1DE4B 1CI5A 3Q3GB 4OM0L 4YAQB 4N0FA 3BZDA 4KQ3L 1LE5A 3GRWL 4H1LH 2X4QB 1T3FB 4GRLC 2R4RL 3A6BH 3OX8B 2P5WD 1ADQH 1A14H 3C6SA 2Q7NA 3CD4A 4G8IA 4U4BA 5DT1L 5T1DH 3PQYE 3ARRA 4NO2A 1OTSC 4G3YL 2GSIB 1EERB 3ARZA 1RZ7H 1U3JA 1FAIL 3QA3A 4YUEL 2Q6WA 3DUUA 1CE1L 2CR3A 1PAMA 1CDCA 3GIVA 4Z7VA 3MLVL 4ODXA 2UZYB 1W72H 1YMHA 5J8OA 1ZGLP 1L7TL 3H3BC 3NACH 3ZT7A 1IC5L 4P2OC 1IMHC 3DVNB 3OKNA 4HUWB 1XGYL 3V8OA 3GSVA 3T1WA 4Y4FA 3ZKNC 1R5VA 1QBLH 2OQJA 2YPVL 1PG7H 4OCNC 3T8XB 3WKML 3B6SB 2VLKD 1ZTXL 5FUZL 2KH2B 1B0GB 5LJYH 4PJEE 3QUXC 1G0DA 2WUBH 5C09B 3RVVD 3S4SG 4FRWA 3O9WA 2YOCA 4OBSA 4Y16D 3S98A 4HIXL 1MRFL 1TENA 3NH7L 2X2YA 5HI5D 1CDHA 4FFWC 5IQ7H 1I7ZA 4PJHF 1IQWH 3CK0H 1ZA6A 3ALPA 3CC5A 4HWZA 4JJ5A 3BVNB 1NUFA 4KRNA 1OTTC 3F12B 1PG7X 3D25A 3TZVD 3T0EC 1I8LA 4XI5C 1KELL 2PF6A 3I6LE 3DGGA 1YEIL 5EDXA 1RJLB 1QR1B 3GSOB 4F8QA 2PTVA 5GZNC 5E56A 4OJFL 1QSZA 5FGBA 3RGHA 4O2CA 4L9LC 2Y06L 4XCFL 1ERNA 2BDNL 1IGML 3ZE1F 5I73C 1INDH 1KCUH 4Z78B 3LRSA 2EDTA 1UYWH 4U6HA 3CVIL 4MCYB 4ZUSA 3MOAL 4R2GC 1FL3B 1KB5H 1NFDE 1YEHL 4PY8I 1WT5C 3BN3B 2ICWB 3QFDA 5DGRA 5F44A 1OD9A 1FDLL 3U7WL 5EZJA 5J11B 5A2JH 1N0XH 4F9LC 2DD8H 5CEXB 4HLJA 1AGDB 1J1PH 2OI9A 2EDBA 3QEUB 1ULVA 1BFOA 5IW1A 1BGXH 3TBTA 4R0LA 3DX7B 1ES0B 1G1CA 1F3JB 3K74B 5ESQB 3TVMB 4ZPTA 5JMOC 2WQ8A 4N8VG 5IEKA 1U8MB 5J1AB 5J6GB 5IFJA 2JJTC 4L8CB 3LD8C 2VE6A 1DE4A 3DVIA 3Q3GA 4YAQA 1VGEH 4EVNB 2DWDB 4YXLL 3IFNH 4J12A 1T3FA 1QFWM 3OX8A 4P23A 1DZBA 5AEAA 3R1GL 3O3EB 4XB8A 4K9EL 2IAMD 3KPPB 1OQXA 1U8KA 4HFUL 4EQ3A 4CMHC 5D7JD 5BO1L 3FCTB 1HINH 2LVEA 5C9KA 1T1YA 1N5YH 4LU5H 2YPLE 1UWXK 1F8TL 2UUDH 3E3QE 5E08L 3BPCB 2N7AA 3HTLX 3PWPB 1FBIL 1S5HA 5FYJD 2VXQL 1NJ9B 2W0FB 1X44A 5FYLH 4QTIL 4RGNC 4KMLB 1OP5H 3C2AH 1QUNA 1I8MB 2W91A 4IS6A 3DVNA 4TQEL 4HUWA 2XKUA 3LKNB 4HX1B 1GGCH 2BVEA 4KTDH 4W81A 1A9EB 3CFJB 2OL3L 3T8XA 3B6SA 2AEIT 2DDQH 4PV9A 2YC1A 5JXAH 5D7IF 2FIRT 1OM3L 5HYSA 1B0GA 3PE9A 1NDGB 2AV1B 3BT2H 5C09A 1F90L 2DBJA 1UM4H 1I1RA 4Q0XL 2XTJB 1OAZL 1O0VA 1KCRL 4WFHD 3D48R 4ZSOA 3BVNA 5LXGH 1OWRM 3UC0L 4R9HA 4M7LL 4Y2DB 5CKAA 2ADGB 1QKZL 5GS0L 5BW7C 3G6DH 2WIIB 2I27N 1RJLA 3CDFA 1QR1A 3GSOA 3QNXA 1HSAB 1SEQH 5GISL 1BVKA 2Y5EA 1A1OB 3ARBB 3DPBA 4MAYB 4ZFGL 4M5YH 5C86A 2VJXA 2XQYK 3TBVB 5TF1L 2X1QA 1H3VA 3H2WA 4RWYL 5D2NA 1OT1A 4Z78A 1MEXH 2FBJH 2D7TH 5I1HH 1OSPL 1A21A 1I9IL 2NMSA 3X3GL 4PJDE 3ARYA 3RBSA 3IDNB 2E8ZA 1AIFB 1LQSR 5T33L 1QRNB 2ZUVA 5JPMB 4NQXB 1LNUB 2ICWA 5IBUB 1Q72L 1FL5B 3RZWA 1XH3B 4NZUH 2GK0A 4QRUB 3IDYC 4OCWH 3TWCH 1DBML 4MQXC 5CEXA 3GIZL 1ZK9A 2NY1D