3W39A

Crystal structure of hla-b*5201 in complexed with hiv immunodominant epitope (taftipsi)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
277
structure length
277
Chain Sequence
MGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-52 alpha chain
publication title Distinct HIV-1 Escape Patterns Selected by Cytotoxic T Cells with Identical Epitope Specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w39A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3w39A01
4KKAD 4FN0A 4OD3H 4EUPB 1INDL 3RTQD 2NY3B 1ZTXL 2YD1A 4L8SB 1AD9B 1JNHA 3KLAA 3G5ZA 4HJGA 1OM3H 4PV9A 3EFDH 5DJ2B 4PJ9A 3WD5L 4R4BA 5JO5B 4NQVA 1PW3A 1XZ0B 3EFFA 4WFFD 3WIHA 4OBRA 4Y4FB 4ENEC 1NCDH 1P69B 2I9LB 1JYXA 3BQUD 1V5JA 3OPZL 1HILA 4P46A 1DLFH 2NYYD 2WZPD 3FT2A 4EQ3A 2KL6A 1MAML 4P23D 1E6JH 2VQ1B 4OT1L 2VIRA 4RWYH 4LVNC 3O2DL 4N0CC 5D7SL 4JFYB 1K6QH 2EKSB 4LF3A 4ZAKD 1RHHB 2P43B 2EDLA 5SX4I 4Y5XB 5E6IC 2VLMD 4OV6F 2C3GA 4Q6YA 4I2XA 1ADQH 4JKPH 4N0UB 3V8CA 2Q7NA 2D7PA 2X70A 4ISVB 2XYCA 5D7IE 3MV9D 1I1FB 3KG5A 4RWHA 2LU3A 1U91A 3Q1SL 4HWEH 1KFAH 2QHRL 3RVWC 5H35A 2H45A 2D4FA 2ITCA 5IVOA 3QEUA 2VZUA 4Y2DB 1YZZA 3T3PE 1U8IB 5KAQG 5DJ0A 3S35H 2BDNL 2AVGA 2GJZA 4JN1L 3GSOB 4PGDB 5IQ7L 4OD2B 5DQ9B 4N8VB 3J8F7 4YHNB 3MRMA 2R1WB 1CDHA 1J0IA 1MUJA 3DRQA 3RVVD 1RZKC 4U6XA 1WTGT 1W0VA 4WFFE 1ES0A 1L4IA 2OSLA 1YEIL 1FSKC 4PB0L 1ZTXH 4JJHA 3NZ8A 4MDJA 3FN3A 3WFBL 3OKDB 2XZQL 3AMLA 2Q76B 3JVGA 5MEQA 2AK4A 3G9VA 1CD9B 3E1F1 4G3YL 1GSMA 2PNDA 4G43A 3BZEB 4KC3B 5F1NB 4TVPL 25C8L 4XX1G 2V17H 3GK8H 1TETL 4M5YL 3CFBA 5BZWA 2HT2C 3BMWA 3OPZH 2NY2D 1Z5LA 3NA4A 3WO4B 1MAMH 2XTLA 2Z35A 3P9MB 5IK3A 2VLME 4XP5L 3LN9A 4LIQL 1ZWIA 5IB4A 3F7QA 3O2DH 1R3KA 4XC3L 4ZDHA 2V2XA 4YDIL 1P7KB 4G6ML 5K93A 5D1QA 3W39B 3THML 1NDGA 1UKQA 3FL7A 3TH3T 2A6JA 3DECA 1EJOL 5E8NB 4IRSD 3BJLA 3RIAF 2R4RL 1HSBA 3K80A 2JTDA 3L3JA 3WJLC 4RFNB 1IJ9A 3IDYB 4FXLA 2EE2A 5T1MB 4UV7L 1NBZB 5KW9L 1X9QA 2Y07L 3LPWA 1X5KA 1ZGLP 3H7BA 3QEHB 2FEEL 2Q8AL 1WFNA 1LEKA 2QHRH 3CSPA 4PS4L 1KJ2L 4Y7MA 1L6ZA 4LVOC 4F7EA 5J3HC 3MJ8B 1P5VA 3O6LL 1FZJB 2BDNH 2WK2A 1DSFL 3ARWA 4ZQKB 4JN1H 5IQ7H 4JFQA 2ZG1A 2JIXD 3TLRA 1SEQL 3EYOB 5F7DA 3JBG7 4HWZA 2PETA 3OKEB 5T3XL 4PY7B 4NO2B 3HE6B 5KSAB 4PB0H 2WMPA 4JZOA 1CICB 2EDXA 1M7DA 2MKWA 3U0TB 1U6AL 5GRJL 3T0EB 3WFBH 5CMAB 3OMZA 5F9WB 3IF1A 2XZQH 1MCWM 3BP5B 4NSKB 1IGYB 2XFXB 3FQNB 4G3YH 5I73C 5L6YL 3RKPA 1T7WA 25C8H 3V5KA 1FYTD 1TETH 4JM2B 4M5YH 1FQ9C 1SEBB 4OCWL 4ZO8A 4ZODA 2QSQA 3IFNL 5I17A 1T6WA 4UDUB 1FN4B 1S9VB 3B3IB 3QI9C 4NDMB 4LIQH 2QR0A 4XC3H 1NFKA 5BVPH 1FZOB 3WCYA 2PXYB 1MCSA 5D1ZD 1G7HB 4R97B 2HRPL 4AEHL 3HRPA 3T1WA 2R4RH 3LKSA 5CJOL 2OL3B 1L0XA 1DCLA 5HYJD 4NZUH 3MCLL 3JUZA 2VLKD 1F90L 5GGSY 3KPMA 1QBBA 2KBGA 3BD4A 3QIBC 3TPUB 4OCXL 5KW9H 4M43H 3S5LG 2CKBL 3UO1L 1N0XL 3VW3H 2PCPA 2Y07H 4O51B 4X4MA 4RMQA 1Q0YL 3V4UL 4YBQC 1WQVT 4PS4H 1KJ2H 7FABL 4Q7DA 2P44B 5E2VL 2JCCB 4KGLA 1OF2B 1DP0A 3DMMB 1U36A 3EO9H 3TWCL 1FL6A 4N1EA 2ZCLL 1DSFH 1S3KL 4PJBB 4MXQA 5I16A 4KJWD 5FAAA 4OUUA 1SEQH 2NPLX 5KG9B 4YIQA 2YD3A 3AU1B 4GKZB 2DMBA 4L4JA 3VD9A 1UACH 4JPIB 4DGVH 1AJ7L 5A1AA 2YD7A 3VRIA 1YEGH 1U6AH 2NY4C 2O26U 5GGSA 1CGSL 2DQFB 4QRPA 2MFNA 3BDYL 5TE4H 3W2DL 4ZXBA 1NGXA 2JJUA 4PGEA 4YK4B 3F7YB 4EUPH 1AI1L 3RI5F 5L6YH 4X9HA 4R7NA 5I1AB 1DUYA 2Z31D 3WFCL 3UBXB 4OCWH 4Z0XB 2H1PL 2FWOB 3NVQA 1ZHNB 1TQBB 4E41B 5LCVL 3LD8C 3WLBA 3P73B 4PGBB 3ZKSD 5HYJE 4NZTH 2EDTA 2VLKE 1C8PA 2FSEA 1UM5L 4MWFA 1OTUD 2HRPH 4ESKA 3DOSA 2J2ZA 3OL2A 1WBYA 5CJOH 3VGHA 4MCZA 4PP1D 2HVKB 2FX9L 3MCLH 1ETZA 1BZ7A 5DJAB 2X9XA 3WXVL 3C5ZB 1YMHA 1PG7W 1QFWM 3OX8A 3QA3A 3QDJE 2V5TA 1I1AD 4JFDD 3QFDB 3A6CH 3SDCB 1JPST 4YJZL 3UO1H 1FPTH 1N0XH 4OCSL 3V4UH 4C56B 1TDQA 5BQ7A 5IHUL 5E2VH 2LTQC 1YNLH 3TWCH 5DRXB 3V6FB 5J1AA 5HYQB 4I8DA 1S3KH 2KKQA 2IH1B 2GHWB 2YPVL 1IGTB 2IGFH 1U3HC 4YFLI 3N06B 3BAEL 1LP9B 1D6EB 3VXOA 3MLYL 1P2CA 3FAXA 1EXUB 4QRSB 1AJ7H 1MRCL 1YEDB 5HI3C 2ARJA 4AIZB 3F7PC 1P1ZB 3Q5TA 1R24A 2FIKA 2H2PC 4APQA 1CGSH 5AZ2L 3G6JB 3LKPA 1XMWA 3BDYH 3HHRB 4K94L 4KXZH 3W2DH 1IT9L 3KXFD 4HJJL 5I9QC 4PJFB 1OAUH 4QOKA 3RAJH 1R5WB 4ONHA 2A6IB 3MO1A 2CIIA 4GXUM 2H1PH 4EKXA 5C0CB 3DV4B 1U8MB 4NFBA 1EPFA 3QG6A 1ERNA 3TCLB 4PJDE 3OJ2C 3QNZB 5GGRY 3GJFB 5LCVH 4J12A 3HI1B 5KVEH 1TZHA 4PTUB 4CMMB 5DZOA 1T89C 3T77A 4FXGA 5K59E 5EO9B 5TQ0L 4JFDE 3LAFA 5E7BA 1QO3B 3W9DA 5D2LE 1VADA 2D0HA 1BZ9A 2FX9H 3RJQB 5EN2A 1D6VH 3WXVH 3DURB 4C57C 5C1MB 3KPOA 3Q2CA 4RFOH 1Q9OA 4X5WA 1HK6A 5DJ8A 4DZ8B 4EIGB 2E7LC 4HCRH 4OCSH 5DRNA 1EFXA 5IHUH 3SKJH 2AEPL 3ULVD 4NM4L 3BO8B 4M61B 3BRGC 4LSQH 4LCCA 1N2RA 3WS3A 2NY5H 5GS2H 4GRMA 1T5WB 1WBXB 3OWEA 2YPVH 3VXTB 2YZ8A 1N4XH 3BAEH 4P3DB 4KVNL 1CVSC 5ICXB 3OKMB 4OI7A 1MRCH 4ZUVA 3CC5A 5BRZE 3DJ9A 3QXUA 3WNNA 3FT3A 5L9DH 5GHWL 1ZV5A 4KHXH 5AZ2H 4K94H 3BKCL 1H8SA 1IT9H 1FLRH 3GMLB 3I3BA 4HJJH 4HF5L 1DBBL 2I5YL 3BRDA 3RZCA 4OFYD 1JV5A 4YXKL 1NCAL 2BNQD 2XZCH 2WSKA 1MHPL 3T1FA 3SDAB 3HPJA 4MD4B 1I7TB 5MP6L 1SYSB 3U4AA 1YN6A 2DL9A 2XIDA 3ULUH 4WFHD 2WBJC 1EEQA 3HCVA 1C5DB 2CUIA 4DQOH 5HHPA 3F8UB 8CGTA 1JWMB 5FGBA 5ACLA 3OSKA 3PGDB 1B9ZA 5AG9A 3D39A 3GMNB 4OCRL 3MRPA 3ARED 3LEYL 1F3RB 5TQ0H 3GMMB 2YD9A 4PJAE 5EO0A 1RIHL 3BPLC 2VWEC 4KHTL 1ORQB 3K2UL 1I8LA 1JI2A 5C0IA 4M7KL 5C0FB 3OXRA 3ULVE 5ADOL 3RY5A 3OJDA 4L3CB 2OI9B 3DUSA 3L6FB 2OL3H 3NPSB 4BKLA 3CZJA 3QAZB 4MJIA 2AEPH 4NM4H 3RTQA 3OB0H 1AQKH 1QUNA 3IFOA 3ZT7A 4UQ2A 1UENA 5SWSB 6FABL 1XIWD 3PP3H 3PDOB 1NCBL 3T08A 3WXWL 4HKZB 1M71B 4WI8A 32C2A 5EUKB 3G5VA 4WDIA 4F15B 2DQEL 5DUBA 2C26A 2ICES 4KVNH 4LLUB 4WWKC 3BQUA 3C5SA 4KZEL 1UADC 1VPOL 1DVFC 4G8IA 5KVFL 3NFSL 2BNQE 4NN5B 4X98B 5INDA 3BZFA 5GHWH 3DXAE 2ZOLA 2YWYA 2PKDA 1CGTA 2Y06L 1EEUA 3CSBA 4HF5H 1DBBH 3GSWB 5MHSD 3ARDA 4WFHE 2I5YH 2VUOA 2W0KA 2A83B 4NC1C 2V2WB 4HV8A 4YXKH 5DLML 4AQOA 3RNQA 1U8LA 1MCPL 1CXLA 4QXGL 4ZOCA 4U1GB 1YNKH 3CAFA 3ULUF 4LHJB 1OARL 1XGUA 3SDDD 3FOMB 2YA2A 1CLOL 1NGQL 4MAYA 3SE3A 4M7LH 4JO4L 4JDTH 3MV9A 4TTDD 3TBTA 3DUHA 4OCRH 3EOBA 4GKSB 4U1JA 4DGYL 3LEYH 3ARGB 1KV3A 2KDGA 3IDNA 2V5MA 1HKFA 5EU6A 2GITA 4KRMB 1RIHH 1MVUB 5JTWA 3R0MA 4KHTH 2PW2B 4XNYH 1LNUB 3CK0L 3IXAB 3QCUH 1WC7B 5ADOH 1MEXH 3OG4B 1X5FA 2ZWLT 1PJ9A 2ICEB 3MLSL 3X3GL 3QIUB 1RK0A 1AH1A 3QXDA 5ACMA 4JFOA 4JG1L 2NY3C 4PJ7A 4L8SC 4V2CB 4N5UA 4X80L 3CUPB 3IDIA 3O4LB 5HGAB 4Q9QL 5C0ND 2YRZA 1HEZB 4L1DA 4YFDB 3BP4A 5BXFA 6FABH 5ALCL 1NCBH 1VDGA 4LFHG 1GGUA 1BFSA 4NPYB 2MJWA 2DQEH 2YSSA 4U1KA 5H37H 4HWBL 3V6ZB 3ECBB 4YHLL 5GSRB 2R9HC 5MHSE 3TPKA 4N68A 3ZE2F 3GI8L 1D9KD 5FOBB 1VPOH 1Z6JT 2LV4A 5KVFH 2Y9RT 3UX9B 1XF3B 3ARFB 2NXYD 1MCCA 4UT9L 4U7KA 1QR1A 4EJ1C 2RGSA 4CVUA 1T7ZA 1TZIA 3PGCA 2Y06H 5C3TA 4GW1A 1YC7A 2ZJSL 4MNQD 5DLMH 4Y5XC 4JDZA 2G60L 3DRTB 4IOIB 3UJJL 5F44A 4QXGH 4YHIB 1N6UA 1LE9A 3BUYA 3D2UD 1VKXB 2H6PA 1L6XA 1CLOH 1NGQH 2FO4A 4NQCB 5BMFL 1VACB 4JO4H 2EEAA 1IAIM 2JELL 5D2NE 1CGXA 3TN0A 4UTAH 4YDJA 4LAQH 2XV6B 1C08B 2HYMA 1QEWA 2XWJA 2AEWA 4Y2DC 4PG9B 4B0MM 5J6HB 1G7MA 1NC2B 2P24B 1NKOA 5CJXC 1MI5A 1W8NA 3C2SA 3CK0H 4M4PA 3I6LD 1QACA 4NQEA 5D1XA 3QUXD 4ODTL 5KSBE 3VFNB 1U3JA 4P2QA 4YDVA 4LPYA 3L3OA 4JANA 5DFTA 3CH1A 3MLSH 2JIXA 2BSTB 4CVXB 4XP1L 5DJCA 3K3QA 1F8TH 4RX4A 1ZOXA 4YBLB 1C5BL 2DM2A 2OYPA 3WNLA 4TN9A 2FGWH 1IM3A 4X80H 4Q9QH 1WZMA 2GJ6B 5BVJA 1KNOB 3QNXA 4GRWE 5DQJB 3W9EA 4OGAC 4CU6A 1EK3A 1YEKL 4WHCA 4QHNA 5ID1A 2L0DA 1M05A 5IM7B 4G8GE 4UB0L 2WANA 2YEZA 3UTTB 5CBEB 4HWBH 3EBAA 3RGHA 3NN8B 4YHLH 3WO4C 1K4DA 4ZUUA 4EZMA 3GI8H 3ELAT 4OGYL 1FZMA 4PPTA 3GUTA 5C09D 5TDOB 2XPGB 4UT9H 4UBDD 4XGZA 4HGMA 5I1DB 5B3NA 2ZJSH 4NJ9H 3M17B 3GIVA 4MX7A 4CN6A 1PYWA 1QFUL 3G6JF 5D5MB 4QTHB 4Z95H 1F58L 1BFOA 2G60H 1Z3GL 4MHHI 1ZLUH 5DK0B 3UJJH 4PJFF 4YH6A 3IVKB 3UZQA 2BY2A 4RFNC 4Y4FA 4C55A 3QG7L 5DGRA 2E7MA 5C9JA 4PGCB 3IDYC 4LDLB 4P5TB 3T3MF 1E27B 1Y0LA 2JELH 3I6LE 3AAZB 4JFFE 2IANB 5B39B 4C54A 3WL9B 4HPOL 2PW1A 4MQ7B 2EKSA 4H26A 3ET9F 5KSVA 2J6EH 5HHQB 5IVZB 1FZKB 4Y4HD 4JQXC 2AXFB 4FQ2L 4MVBC 3BP6B 4YPGB 3P0GB 3QDAA 3EYVA 4ODTH 4M1GL 3H2WA 1MCLA 2VAJA 3HRZB 4G6FD 4K94C 3HR5B 1II4E 3L3GA 4OQ1A 5IUSA 4LPCA 1C5BH 2PYED 4LAJH 3HE6C 3E6HB 1CICC 5FGSA 1LO3L 3EJZC 4HEME 2Z4QA 4KRLB 5E8PA 4S1RL 3T0EC 1YDPB 4AM0A 4K3JL 1NEZB 2LQRA 4EVNB 2P7TB 2EDYA 5IFHH 1KB9J 1K2DB 1XEDA 3L7EB 5T3ZH 3ULUC 4JM2C 4UB0H 1VGEL 5IF0B 1GAFH 3ARXA 5JOPE 1Y6MR 4XBGA 1RIUH 2VZ3A 2IJ0C 2X1XR 4XMKH 2BOCB 1MHCA 4PGDA 4OGYH 2VLLB 1R3JA 4MA7L 2R1WA 5D7IB 5EOTB 1OSPH 3M1BB 3ESVF 4P5MA 43C9A 5BS0E 1D3CA 1KYOK 4PJ8B 1NAKL 2DLFL 1IAII 4H5SA 5LGJA 1GYAA 3ZKQD 2PXYC 4Y1AD 2BVOB 4R97C 4CKVX 3OKDA 2Q76A 4EI6B 3PABB 2UVEA 1ZLWK 3T2NL 1F58H 2YXMA 2VZ1A 5F1IA 1Z3GH 1G7JB 1AE6L 1EHAA 3QG7H 1S7UB 2VDRL 2P42B 3VXQB 5FDYA 3ETBF 3DVNB 2BX5A 2YOCA 2OQJB 1B3JA 1I1AA 4X0KA 2B8OT 3O45B 4X6FA 5DJXA 3B9DA 4HPOH 4KJPC 1SYVB 2DB8A 4P23B 4BQBA 1KYOJ 5DJ6B 1CFVL 3DMMC 4Y16B 2PYEE 5KN5A 5FEBA 5E8NA 3TF7A 4LFHD 2UY6A 2I9TB 5IEHB 4KTEL 3TJHA 5J89A 2X4TB 4LGSB 2EDEA 3U30B 1GGBL 2X4QA 4HCRA 2R2EB 5CSZA 1A14L 1QZ1A 2EKJA 1A5FL 1LO4L 1MRDL 3CU1A 4I5BB 5C0BD 1JL8A 5IIEA 2Q86A 4Y19D 1LO3H 4XVUC 4M3JA 2EDNA 4S1RH 4XWOC 2E9JA 1BGXL 4YK4C 1ND0B 2HFEB 1MQ8A 3MPCA 3IDMB 1WT5C 4I77L 4XB8A 3IKCA 1VGEH 2Z0BA 4JQXA 4HWNA 2CQVA 3L1OH 4ZQKA 4Z77B 3MC0A 1AHWB 1FFNB 3CX5K 4OV5A 2OP4L 3O2WL 1IQDB 5JHDD 2DICA 3OKEA 3GGWA 3PDGA 1NAKH 5DD5L 2DLFH 3SCMB 4DUWA 3HE6A 1K3IA 3MRCA 3I84A 4KK6D 3TV3L 5KSAA 5F7LB 2F54D 3LIZL 1N64L 3MA9L 3T0EA 3D0LA 4EI5B 4HMCA 3LS5L 3T2NH 4X7EC 3KYMB 4YXLL 4L9DA 3WSQL 1AFVL 1U8NA 5CCKL 2VDRH 1SEBA 3C5ZC 1AD0B 2I07B 2DWDA 4I18A 2BFVL 5IGXL 3SDCC 1S9VA 4JFXA 1OAKL 3IDJB 4PP2B 3BIBX 4NQTA 3CX5J 5I15H 4JKLA 3T4AB 1W0WB 2FECI 2NY2B 3OKLB 3FO9B 4G6KL 3D87B 4BFIA 3MREA 4QHKJ 5FYKU 5CILL 2WW8A 4NRYB 4TNWK 5IVXA 1ZT1A 5EU4A 5F7FA 2VN4A 5E6ZA 2Z92B 1VGKB 3AS3A 3PNWA 3S3PA 4HMDA 3LEXA 4FZ8L 4P9HL 2ZPKL 2CRZA 2ATKB 2OL3A 3FZUC 4XPBL 2ARJQ 1A14H 3K0WA 3WIIL 3QQ9C 4U0QB 3RY6A 2B39A 3BN9C 3TO4A 1UJ3B 4OZHF 1FDLL 2P5EA 5MEOB 4EN3D 2C3XA 3KPTA 4O51A 1FL5B 2A0LD 2ITDB 2LVEA 3DGGA 5K9OB 5IEKB 3VDAA 3W82A 1BGXH 5JHDE 1D7FA 1F5WA 4MB3A 4I77H 3QB7C 5LQBL 3CJJA 4OM1H 3FOLB 2F54E 1R5VB 3U7YL 4YX2H 1PQZA 1FFPB 5GS1A 4Y89A 4HIJB 2OP4H 2K9UA 3AU1A 4WV1B 1W72B 1XCQB 4OCNC 4XCNB 4OF0A 5E00A 3GSRB 5ETUB 1HYSD 1Q38A 4P99A 4JPIA 4TUKH 1P7QB 1AR2A 4I0PA 2BCKA 1N64H 4HC1H 4L3EE 3MA9H 1ZVHA 1NGZA 3CD4A 4FMKA 3AREA 1EAJA 3WHXB 3OJMB 5DHXB 4NBZB 4O2CB 3F7YA 4YXLH 4Z78A 4IRJB 2EXYC 3WSQH 1AFVH 2HTLD 2VMFA 4MCYB 5CCKH 1T7XA 1I8IA 3LKRA 3UBXA 2AS5M 2XZAH 1T1WA 3F12A 4WW1B 1AR1D 2NTFA 4W4OA 2BFVH 5IGXH 5IJVB 1IC4L 3O9WC 4E42B 1OAZL 1OAKH 2YPKB 3U36A 1HDMB 4NQDD 3P73A 3KS0H 5L8LB 4G6KH 3Q5OA 4PJ5D 5T33L 4U6TA 1BWMA 2GTWB 4XNMA 1NAMB 2CK2A 4V1DD 5CILH 5JW4Q 1XIWA 1EZVY 5EG6C 2X05A 4NKMA 1S7WA 1T1ZB 3MXVH 1KTLB 4WO4A 4FZ8H 4P9HH 3KLHC 3OKNA 2ZPKH 5D1ZB 5AAMA 4XPBH 2GY5A 2HVKA 1MCHA 5JZ7C 2GYSA 4W6WB 3WIIH 3C5ZA 1MFAH 4HXBL 4CW1B 1FDLH 1YYLL 4RIRA 1A4KB 5HYJB 4D94A 3FO1B 4KFZC 3GMPB 1KLGB 4P4RB 4WIQA 5SV4A 1YUHA 3MYJB 4L5FH 4OUOA 3BYYA 5HI5D 1ZSDB 4ZFZB 5EWIL 3FFDB 2FR4A 1J18A 1K8IB 5LQBH 3WLWD 1AGDA 1QP1A 4JM4L 5DRXA 2IH1A 4IS6A 3U7YH 3DVGA 5DJDA 1M6OB 4NC0B 1T7VA 3QDJB 2QSTA 3HMXH 1ZA3B 2Q1EA 3CPLB 4POZD 1G9NH 5SWQA 5GJTL 2UWEE 3N1MC 3RL2A 4PJHB 2H2SC 4AIZA 1P1ZA 3VFSA 2C7UA 1F6FB 3SO3B 5E70A 4HGWB 1I7ZA 2I26N 5F1KC 1AXSB 1G9ML 1UCTA 1T7YA 2EH7L 4PJFA 1H9VA 3IETA 5HI4C 1C7TA 4DN3L 5HDBE 3ZE1F 3MGTB 3NCFB 2OI9C 3DV4A 1U8MA 5C0CA 1JPFB 3GMRA 2WWMD 1IC4H 1EHLL 2FEEI 4J4PC 5E5RB 1JHTA 3FQRB 3NPSC 2Z31B 1S7XB 3O3DA 1MY5A 2P8LB 3QAZC 1UKTA 1EEZA 3RL1B 3U83A 3HI1A 2AJYL 1JRHH 2WLZA 5KSUA 5AD0B 4U6HB 5T33H 1VA9A 5T5NG 3ARUA 1JNJA 2P46B 4HK3N 4HLZH 3BT2H 5B22A 2CLVB 1JF5A 5I66B 1QO3A 5DEGB 1HH6B 4Z8FL 4F15C 3OKOA 3K74B 1IAOB 2CUMA 4BZ2H 2ICWB 2W65B 4POYA 2PYFB 5LGHL 2OR7A 4PJDB 3RWJB 3DURA 3HUJF 4HXBH 4JY4B 4QHUB 1G0YR 3MJ7B 4NN5C 3VXRD 2XKSA 1YYLH 4PTTA 3HG1A 1GIGH 4LSDA 4DZ8A 4BELD 5JW3H 2AW2A 4JLRA 2DTSA 4JFDB 4PBWD 3FRPA 1MPAL 5EWIH 3PWJB 2W9DL 3HE7D 4WHTA 1FIGH 1T5WA 4MNQA 3TIDB 3V0WL 4U1GC 3WEXA 1OWWA 4GAYB 2VKWA 4C59B 2K7PA 4HEPG 1UH2A 5ICXA 3QFJD 5A2KH 1QLRA 3I75A 3R0NA 5I6XB 5GJTH 2M2DA 3D0VB 5FB8A 4XVJL 5D7IF 1LEIB 1S5HB 5GGVL 3LQMA 2Q6WB 3ARGC 3QDGD 1XGRA 4JG0L 1J88A 1RMFL 2BC4B 2J7LA 5J56B 3HNTH 2R0LL 3P11L 4FQQB 2IQAB 1LE5A 3GMLA 1NEUA 3AB0C 4M62L 2XNAA 1HQRA 3VH8G 1OWRM 4HBQA 4QCIB 4DN3H 1H3XA 1BF8A 5FK9A 3SDAA 5FO7A 4MD4A 3FJTA 1WAAE 4L8CB 4JRXD 3GBML 3QIUC 3OR7B 3AS1A 2BNRE 2V6HA 1UC6A 4WENB 1KT2B 3HZMA 4K7PY 4YDKL 5BRZB 5DUPL 5TF1H 3GBNL 2J6EA 3M8OH 1E28B 2HT3C 2ORBL 3FN9A 1OP3K 2G9HA 5DMGC 1JWMA 3QXVA 4KQ4L 4NNYB 3QPQC 4HK3J 2NY0D 4PY8J 3LMJH 2L7UA 5HGDA 3MLUL 5EBLA 5GSVA 5DJYB 2LE9A 3VXRE 4V3EB 1XF4B 4FQXD 4Z8FH 5I8CB 4L8BB 3VXMA 2HFGH 4E0RA 3ZT5A 1FFOB 1ORQA 3B5TA 5FGCE 1CF8L 5C92A 5LGHH 1NAML 1ACZA 3MJ9H 4XMLL 3PHOA 1TNNA 3ARFC 4MNHA 1JWUB 2CDGA 1XCTB 3EOYG 5C09A 3QDMB 2F8OA 5KOVC 5IB5A 3LRHA 3FB7B 4TYUA 1MPAH 3AC0A 3QWRA 1MFCH 3QFJE 4PJAB 2H9GA 2W9DH 1JZ6A 1XR9B 3O3AB 3PDOA 3CXDL 3V9FA 1CE6A 1CLZL 3BPNB 5T1KA 3KR3L 1Q9WB 4UTBL 5EUKA 3CCHB 1BVLA 3DUUA 4P2YA 3QDGE 3V0WH 3PV7A 2UZIL 4UT7L 4CDHA 2OMNA 1NCWL 3BGAA 3CVIL 4PRPD 4XT1C 4ZTPL 5GGVH 1EUTA 3MSPA 2BHUA 4JG0H 1W72H 2CD0A 3E3QE 4JRXE 2R0LH 5CJ5A 2AKRB 4XTRC 3ARBD 3KPRB 4M62H 2A83A 2VITA 1FVDA 1AGBA 3QXTA 5A16B 2XA8H 4DOHE 3FTGA 3GBMH 1ROWA 5ISZD 2BNQB 2D7QA 4YDKH 4YBLC 5DUPH 1LO5B 3GBNH 1I7UB 1QHOA 2ORBH 3DXAB 1XF5A 4EDWL 1P4LA 4HPYL 3EHBC 2E9BA 3ZDZE 3MLUH 1NGYA 3DTXB 2XN9D 3Q6GL 3X11A 5I1LB 4NKDA 3S5LB 5B8CA 4GG6E 1MVUA 1CZ8L 5IBLD 2Y4SA 3LOWA 2VZTA 3WKNA 4JVWA 4HKXB 2R0KH 4M3KB 1OD7A 4XMLH 1WWCA 2R69L 2ED8A 4OZHA 2ICEA 5ESVA 4DKFL 3U9UA 2IWGA 3WIFB 1DJSA 4NN6B 1E4XL 1NL0L 3CMOL 4K3EL 3CUPA 5HGAA 1S7SB 5M95B 2NMSA 2I60H 4Y1AA 4PRPE 2GTZB 1T21A 2APBA 1YYML 4OFIA 2CRMA 3ULSB 3QIWB 3RIAK 1VFBA 4ODUB 3MNVB 1BECA 3D48R 3MOAL 4IHOA 3SKNB 4X6BB 4HLJA 1RQ5A 4UT7H 3FN0L 4LSTL 4P5TC 5GSRA 1NCWH 4P9ML 2X89A 3CVIH 3RNKB 2FCBA 3X3FH 1IMHC 2O61A 2F19H 4ZTPH 1RZ7L 3ARFA 4YPJA 3PWNB 2R29L 2DKUA 1X4XA 4UILL 2RR3A 3UDWC 5FHAL 3P30L 4OF6A 4P9HC 2AERT 2D31A 4NQXB 1R3HB 4LEOB 1DUZA 4KKBC 5CP7B 1E0OB 1F4XL 3MA7A 4CN4A 1GL4B 4JJ5B 3TNMB 1A02N 5H2BB 2XN9E 1IGJB 1S78D 1VKXA 3PV6B 1A2YA 1CD1B 1SJEB 4CVWA 2DLHA 4X6CF 3G6AA 2RAMA 3S37L 1VACA 4U1SA 4C83A 5JLZA 5I8EB 1HQ4B 3S36L 1JPSH 5F3BB 3D85D 4YHPB 2CKNA 3Q6GH 4PG9A 4LLVB 1CZ8H 1PZUB 3P77B 4A2MA 3J7HA 3LKNB 1BFTA 2F8VA 4XBPA 2L7JA 5D6CB 5EC1B 4OAWA 4LVEA 5EOCL 3QZWG 1JGVL 3DARA 2R69H 2CLZA 4YEFA 4HKBB 2BSTA 2GCYB 3C6SB 3QEQD 4LSSH 4PJ8C 5D2NB 3KAAA 1E4XH 2XKNA 1NL0H 5CD5C 3N50A 4K3EH 4WGVB 1N5AB 2GJ6A 1R3LB 4UOW1 3R1GH 2F58H 5DQJA 4B41A 5GPRA 2PUQT 2VR5A 3P4OB 2P5WD 1TLKA 3MNWA 1KG0A 1MLCA 3IAGC 2M8XA 5KSBB 4PJXE 3MOAH 3F5WA 4KVCL 3OJVC 2DLGA 3FN0H 1QLFB 3VFRB 5B38B 2XZZA 4P9MH 4K7FB 5JOFB 3OHXB 2IH3B 4HC1A 3ULVL 1RZ7H 4KJYA 2DI9A 1HOCA 1QLEH 2XPGA 4PYGA 2DJSA 5INCB 4UILH 2IAMB 2NYYC 4ZS6C 2HN7B 1MIML 4GRWB 5FHAH 3VRJB 1NBVL 4OZGE 4P23C 4YC2B 1DANT 4PJHF 3LZFL 4Y16C 5K9KB 1C1EL 4P2RA 1F4XH 2YKLH 3RWCA 4G8GB 3ROLA 5EORL 4H0HB 4ZAKC 3IVKA 3U30C 4PRBA 3MRKA 4R2GB 2SEBB 1BVKA 4P5TA 2AQ2A 2W91A 3S37H 1NQBA 3TVMA 1A3RH 3PL6D 2ZZUT 4IMKC 3D2UB 2IANA 3S36H 1MREH 1A7OL 2O5ZL 2X4SB 3O6MH 1ZEAL 3MV7A 4AQ1B 1CT8A 1FZKA 4QRUB 3H7LA 1F6AA 3RI5K 3PJSA 5DF0A 2NTSP 4K3GA 1UG9A 3BP6A 2IFFL 4WUUA 4BSWA 2BSED 4DKEL 1C5CH 1I4FA 2QLVB 5EOCH 1AHWC 3HUJA 3UTZA 1JGVH 3JTTB 43CAA 1KPUB 3HRZA 3RGVB 2X41A 1UVQB 1G9MC 4LLWB 3EYQC 4PJDF 4JFFB 4ODHL 4X6EB 2EEDA 4BK5A 4MA1B 4U33A 3MUZ1 4GS7B 4F58H 4J3OC 1G7IB 4Z7NE 3V5HA 1GZQA 1Z0MA 2A2QT 4YHOL 3HMXA 3MROB 1UB5A 2FLRT 3MGAA 4KVCH 3RWEB 4UINL 2BSSA 5F9OL 1NCUA 2BOCA 3UYOD 1J1OL 3ARTA 2VLLA 5C7XL 3ULVH 4PRAB 2WM0A 1EFQA 3M1BA 3T0BA 4NRXB 2NY2C 1HHJB 1MIMH 4NQDA 4UOW0 4BQ9A 4J2XA 2R56L 1NBVH 3CFEB 4X6DA 3VGBA 4PJ5A 1C1EH 4Z0BL 1JGEA 3PABA 5F6HI 4LNVA 4XP6H 2X1OA 3W0WD 5F9DC 1AY1L 1F3JA 4H0IA 3VXNB 2B1AH 3KYOB 1U3ZA 2VB5A 4JKMA 2AXHA 4BM7A 5BS0B 1UJ3C 4ZYKB 1NFIA 3VXSA 2AJZA 1U3YA 4U6YB 1EDQA 1NUGA 4X7TB 2XQYG 4U7MA 5IMMA 4IBLT 3A0OA 5F96L 4UNTA 2O5ZH 4NNXB 4O2FB 3O0RL 1SYVA 3B6SA 5HVHB 4XHQA 1IM9D 2OCFD 1K5NA 5EZLB 1IC7L 2I9TA 2IFFH 3SEPA 5IMLB 3G6DH 3VXPB 5DRWB 2JKXA 4WTZA 1X5IA 4HS6A 5L2KD 5HYSG 2LABA 3DO7B 4WV1C 4Z7OF 1ZGLA 1N5YL 2XT1B 2VLJA 1J8HD 4MYWB 4O00A 5ICYA 1EA9C 4ODHH 3RWFA 2Z93B 3NFPB 3S7GA 1KIPB 3GIZH 3MMEA 3V7MA 4G6FB 3U1SL 3TZVD 3C87A 5D7LB 1BD2E 2PYEB 3DPBA 2GJJA 5I1GL 3V8OA 2W9EL 4YHOH 4GQ9H 3KLDA 4FP8L 3O8XA 3QUZA 4UINH 5F9OH 1IAKB 5I76B 5C8JB 4IM8A 4ODVL 1OB1B 1KJ3L 3ULVF 4WJ5B 4J3UA 5C7XH 5BV7L 3W0WE 5TH2B 3N1QC 3SCMA 2FL5A 2GFBB 5GRXG 3WUWB 3CFDB 5DK3A 1T6VN 4LBEA 3CLEL 3ME0A 3LB6D 2CGRH 4EI5A 4RFEB 4Z0BH 1S9WB 5IMKB 5I71B 1WK0A 1JWSB 5IKCB 5D1ZC 2VLRA 4PJGE 1UXSA 5MENA 2P45B 1AY1H 5GISL 1AD0A 4Z7WA 5GS0D 3LV3B 5EZIL 3TBWB 3VI4E 1JJUA 2VISB 4POUB 3SJVA 2WP3T 2BP3A 4YUEL 4NCC1 2HG5B 1T0NB 1VERA 4ELMA 4UDTB 1KIRB 3PWPA 5L2KE 3TBSA 2R23A 4P4KD 1J8HE 2XTJD 1AKJB 3I9GL 1IKNA 3BH8B 3MJ9A 1IC7H 4L29B 3DV6B 2GY7B 4XNQB 5FV1L 2HKFL 4GAFB 2ADGB 4LCYB 4QGYA 3MYZA 3CFKB 4UNUA 4I13B 2BVTA 2OJEB 4RAVB 2FEDD 4KJWC 3MRQA 1YMME 1D5XB 3CFJB 3BEWB 2ADFL 5MEOA 4NWUH 1E6OL 4XP9L 1EJ6A 3U1SH 3BZ4A 2EIBA 5JORB 5I1GH 1TIUA 4OZ4B 1EGJL 4WFGD 2W9EH 3RHWF 5I75B 5L2JB 4M9OA 1G84A 5DK2B 4DCQA 4GKNA 4J8RB 4LRNH 2QV2A 4FP8H 1HXYB 3UCRA 1F6LL 4ODVH 1H0DB 4KK9D 3LPFA 2DQHL 1G6RB 2XRAL 3MRBB 1W72A 2Z31C 5C07A 5JMRA 2R15A 2XY1A 1KULA 4CU8A 2W0FB 1OGAD 1QRNE 1CD0A 1I3RB 3GHEL 5IQ9B 4AENB 1A0QL 1RD6A 4EEEA 3D25B 3ZDXE 4HD9A 1KIUA 4DEPB 4IRJA 4M6NL 4OM0H 4X6CA 3UTSA 5GISH 2XTJE 4HJ0D 5EZIH 5JW4M 4LNRB 4FMFA 5KZCD 4PJCE 4B50A 3EOTL 4YUEH 4PP1C 2IG2L 4PRID 2YPKA 4NHUE 5CGYD 3DX6A 4L3EB 4LLYA 3SDYH 1MWAB 2FATL 2GEEA 5EC2B 3ES6A 3IGAB 2FHFA 1QNZL 3MQIA 4NP4L 4LU5H 3EDJA 3GO1H 1V7NH 4LQFH 1KTLA 2PTVA 2F5AL 2BSRA 1IEBA 1U8OB 3ARQA 4D9RE 3TYGL 4WFGE 5ITFA 2G75B 5ADPL 5I6XC 4LLDB 5D6DA 3PG2A 5GGTL 4CW1A 2ADFH 3D3VA 1L0YA 1DLHB 3N9GL 3QRFM 2DLTA 4PY8I 1OPGL 1Y6KR 3MRFB 3EZJB 4XP9H 5ELIA 3FO1A 1LD9A 3GMPA 3X14B 1A4JA 1UJTA 1WZ1L 1Z2KA 5IROC 3MYJA 4NOFA 5C6WH 1YY8B 3H9HB 1ZT7B 1K8IA 1PX4A 1OGAE 3UC0L 3ARBA 1I85A 4GXVL 4PYHA 1ZVSA 2QSVA 3VJ6A 1A6AA 1M6OA 2UZXB 5KSBF 3QDJA 1RJCA 5SX4H 5BW7A 5ISZA 1J05B 3EYUL 3NCEB 2Z91B 4N0FA 2X4UB 1FJ1A 3GHEH 3BH9A 4PJHA 5DMJB 3OB0K 5DMIL 3FQTA 5F21B 4QNPE 2BERA 5IHZB 3PP3K 6CGTA 1CN4A 4JCMA 5DRZB 4KAQH 4N8CL 2DTML 1WIUA 1M7XA 5CEZH 1AXSA 3TA3D 4PRIE 1R6VA 1CTNA 5JA9A 2YD2A 4M6NH 4ZD3H 3E6FA 1CFSB 3DI3B 4LP5A 4PR5B 5CHNA 1UH4A 4AZ8A 5F7HA 1MHEA 1WISA 4EIZC 5HHVL 3EOTH 2UWEB 1P9MC 2IG2H 2VZSA 1S7XA 1I3GL 1LEGB 4NJAH 4RNRA 2FZ3A 2FATH 4U6HA 4MXWL 3G08B 1JK8A 1KLFA 1ZHLB 2CDFB 1QNZH 3MGOA 1REIA 5T1LB 3BPNC 5GGUB 3V6OE 5F9JA 3SKUD 2AV1B 3ULVC 2AJXL 1F3DJ 1QD0A 4FS0A 5AUMA 2ICWA 2W65A 2MQ3A 1JHKH 3MRRA 3TYGH 3GJEA 1DN0B 3MRHA 2WLYA 5T3XE 3RWJA 5E4EB 1VFMA 2R0ZL 3RVTD 5EA0H 1Q8MA 5GGTH 1MCEA 3MJ7A 5EZOL 1WCBB 1OPGH 1YC8A 3OV6A 3CFCH 4TULL 2J8UE 3L3IA 3QQ4A 2R1YB 1WZ1H 1LO2L 4PG2A 5IB1B 5ILTL 2CRIA 1BIIA 1TJIL 4MS8A 4ZFOB 4WNQB 5T1DL 3UC0H 4GXVH 4BSVB 2W0PA 4LEXL 3VGFA 3IJSA 4KMTL 1MH5A 4RISL 2AV7B 4WI6A 4RAUA 4LSVL 4OQTH 3EYUH 4MMZC 2BVQB 5DXWA 3D0VA 5EUOE 1T5XB 4HAGA 5DMIH 3VXUA 1BOGB 4I48B 4N8CH 3IRPX 5GRYA 1HKLL 5F7KC 3D18B 5C0EB 2HMIC 1TVBB 4JHZA 1GJIA 4QCIA 4CADB 4BFBD 1G6VK 4P0DA 3WS6A 1ODAA 4L8CA 4XVSL 5HHVH 5J9PB 3STZB 4DK6A 4NN6C 2X44D 5GZND 3QEQA 4WEBL 1E28A 2VYRE 2RQ8A 4MD0B 4MXWH 2D0GA 4P2OD 5DJYA 4FFVC 5FHBL 1O5DT 2YA0A 3QIWC 2GSIB 2P5WA 1ED3A 2FD6L 4L8BA 1MWAL 1PEWA 4Y5YB 1UGNA 3E2HB 4W6YB 4GRLB 4PLJC 3IAQA 5E94B 1CQKA 2R2HB 3VH8A 5FKPA 1FNGB 1XF2A 3QUMA 2BNRB 3VFTA 2GT9A 3RX8A 2R0ZH 2HLAB 3H0TB 3TP4A 3SPVB 5EZOH 2YUXA 1S7TB 1BX2B 4TULH 1J87A 3QDMA 1RUQL 4MQSB 1CR9L 1X3DA 2N56A 2V9TA 4DKAA 1KN2H 4U49A 2X4NA 3FB8B 4I3SL 3VXRB 9CGTA 5ILTH 1QKZL 5ID0B 1E4WH 3INUL 4S1QL 4ZPTB 3O3AA 4JHBA 3RDTD 3MRLA 2WV3A 5FGCB 3NAAL 1Z9SA 4Y4KA 4NQSB 2J5LB 3CDGB 3FQUB 4KMTH 4JHAL 4RISH 3U0PB 4LSVH 3BRFA 3VWKD 5C0AB 3ZL4H 4KRPB 3RX5A 35C8H 2BVPA 4UOJA 1U8PA 5DHYB 4ETQA 3SDDC 4ZFGL 3AY4C 3PL6A 4XB7A 3NCCB 4LARL 4BFEA 3QFJB 1G6RH 3MUGB 4YNYA 1HKLH 1OCWL 2QSCL 4HFWB 4WW2B 4TTDC 1IRAY 4KKLC 3KPRA 1VFUA 5J8OA 3QDGB 1N59B 4KK8D 4LLQA 3S96B 3HB3D 4CUCA 1KXTB 1FL3A 3MR9B 1NDMA 3NCBB 4XBEH 3HI5L 3FT4B 5D2NC 1IARB 3OF6A 3U48A 5DHVB 5D7KD 1KPRA 4JRXB 2DKSA 1BQUA 3O2VL 4HULB 5LXGL 3QO0A 4KI5F 1AGFA 5IW1B 1V3KA 3ILQC 4MA3A 4UQ3B 2J88H 3QDHA 1AO7D 3A67H 1XGPA 1ZLUK 5EU7E 5C0NC 1NLDL 1MWAH 4HMEA 1S7QA 3S8WA 4XAWL 3H9SE 3UJTL 4DOHB 5BV7C 4Q9RL 2HA1A 3EO1B 3WDHA 4FQXB 2X7LB 3NABL 4L4VD 3P4MA 1LDPH 3HAEB 3WIFA 2OXHA 5IFAL 4F33A 2CJUL 3LKQA 3DIFB 2DKMA 2IAMC 3CH8A 4LSUL 5JPMB 1CR9H 5MEPB 5IFJB 4JZNA 4S0UC 4I3SH 1S7SA 4NRZB 1QKZH 2NXYC 3INUH 4S1QH 4GG6B 2XXMB 1S7VA 1S8DA 4F7MB 5FKAB 5D71H 4PBXA 4MJ5B 4HIIA 3ZDYF 4XHJC 4R2GC 4KJQD 2F53D 4DK3A 4GMSL 3SGKC 3L5IA 5HHMA 5E0QA 4PGJA 5TGBB 3MRGB 3VWJD 4Z5RB 3PWNA 4OLUL 4XCFL 4ZO9A 4H20H 4LQ1A 4O58H 4LARH 4P57B 3RFZC 1DBMH 1EAPB 5LAXA 4DGIH 1M7IA 2QSCH 2JJTC 5FDWB 2AJUH 1DTUA 5C0DA 4IIQC 1QYGL 2RB8A 5D7KE 3PQYA 1PZ5A 4GBXD 3TNMA 2F9BT 4NOBA 4N90D 2NY7L 3RGVC 2VC2L 5E5UB 1PY9A 2XWTB 3PV6A 1KEGL 1CD1A 3VD7A 3QUXC 1SM3L 3JXAA 5F7EL 4JFPA 4MA1C 4JQVC 1PKQA 4Y5VA 4M48L 3AMKA 4GS7C 2F74B 3MRNB 3O2VH 5HGHA 4EBQL 2ERJB 1HQ4A 5ANMA 1BWWA 1FSKB 1RZFL 1WV7T 4L4VE 4L4TB 2PO6A 1T2QH 4TOYL 5E99H 1NLDH 1BF2A 5EO1A 3TM6A 4XAWH 1OP5H 1KLUB 4D9QE 4Q9RH 2A9NL 2XN9B 2VE6B 5DD3L 3VFUB 1RJYB 4ZG1A 4CNIA 3SKMB 4P46D 3X13B 2V7NA 3VFPA 4OZFB 2CJUH 4LSUH 5K9QI 1OW0C 4HH8A 3FFCE 4YXHL 2F53E 3BP7B 1U92B 3ALXA 1NANI 2XACC 2YC1B 5HVFB 1ZHKA 1QFWL 3IXTB 2XWBB 4UBDC 1YQ2A 1BVZA 4HIXL 2ZCKL 3NZHH 1DANU 3OGOE 3WFEL 4P59L 3G5YA 2BK8A 2VDMH 5CEYA 4GMSH 1KELL 2EDBA 5JXEA 3VFRA 1MCDA 3ZTJH 3RJDA 1X7QB 4MJ2A 5JOFA 4CDGC 3QZWA 1X44A 4HDIB 4NC2B 3RWIB 4C58B 5D8JL 5EU3B 4D3CH 4OLUH 4NUGL 3QUYA 4GAGL 4ODWA 2DS4A 4ZTOL 5EFIB 5ACZA 3ZSTA 5HYIA 3V6BR 1EMTL 5DWUH 5EIQA 1JFQL 1HSAA 3C8KA 4AH2B 1NGWB 2MWCA 1ZS8B 5D70H 4PJXB 1QYGH 3L95A 4G8GA 5E03A 4HS3B 5F3HB 3VFVB 4YDLB 3SGJC 1HE7A 3CZFA 3MNZB 3WE6B 4D8PB 2VC2H 3JV0A 5JIIA 5C0GB 1KEGH 1SM3H 4I9WD 4AIOA 1U95B 2X09A 3QBTB 3LN5A 4YFLF 4XZUB 3OTTA 4P5KB 3WUZA 3IKKA 4M48H 5F9AC 3EOAB 4OZGB 5FO9A 2F5BL 1RZFH 4TOYH 5FO8B 3DX9B 5IR1B 2AK4D 2CDEB 4R3SB 3BSZH 2MHAA 2VDKH 5EBWA 4LGRB 5I73B 4D0CA 3MODL 2R1XA 3RVUD 5DD3H 3O11A 1N8ZA 3LRSA 4C4KO 1CDJA 1CFNB 1HH9A 4FTVA 3AROA 5DEFA 3RGVA 4IMLB 4ONOA 5TE6L 3RUGA 2BXZA 5DVNA 3QT2A 2Q7YA 3GSXA 4G80B 4Y8AA 4FQHB 3VFGL 1OTSD 3B9AA 4YXHH 3QJFB 1AGEB 1CFTB 3QULA 5D1QD 4LVHB 1QFWH 4OIIL 1LK3L 4D2NA 5I71C 2ZCKH 1BPVA 1RZJL 2OZ4A 3KNBA 3WFEH 5TDNB 1FNLA 3VGAC 3QXAB 1UB6A 1C12B 5D8JH 2OK0L 2VR9A 4H1LG 2W92A 1YNTB 3L3DB 1R5IA 2DQJL 2Q8BH 5I18L 1RZ8A 3CVHL 2Y7QB 1Q9KA 4TVSa 1KJMB 3U9PL 1IQWH 1P7HL 1EMTH 3IFPA 1JFQH 4I9WE 4Y88A 3KWWA 5FECA 4D0DB 3ROOB 3S3JA 2O93L 2ZUXA 2J4WL 4JPWL 3KYOA 3HZKA 5BS0A 1DR9A 4LKXB 4R96B 3ALWA 3GHBL 4DFIA 4HG4K 2GSGB 3MOBL 3GMQA 4CJ0A 3MBEA 2J1KA 3B9KA 1EH9A 1MELA 2NCMA 3DETD 4NNXA 4O2FA 5I75C 5DHVH 4NKQB 1J10A 1WVZA 3F7VA 4X99A 4PRHA 3HA0A 2EDQA 1IGMH 2OX5A 5DFVD 1JPGB 1NMCB 1VESA 4G9FA 1FO0A 5TE6H 5CLTA 5IJKA 2NW2A 2KPNA 2DI8A 3BHBA 3GEWB 4JFEA 3VFGH 2GK2A 4O4YL 2UYLA 3BVNA 3HAEH 1S9YA 4OIIH 1LK3H 5D7LA 5DI8B 3T2QA 3GI9L 4HG4J 1A6UL 4KK6C 1LHZA 3MLXL 4S1SL 4DEPC 1Y18B 5C0JA 1NMAL 4OQTA 1TJHH 3ZKND 1IAKA 5I76A 5C8JA 1G0DA 1EVTC 1RAMA 1RJLB 1H15B 1UXWB 5GQBA 2CR6A 3TBYB 4M93B 4F57L 2HH0L 5FYJD 5CIPA 5HYSA 4B7IA 5HVWA 1TFHA 4X7CC 4OKDA 2DQJH 3BKYL 5I18H 3EDFA 1U8HB 2DI7A 2GFBA 4OFDA 3WUWA 1BD2B 1D5MB 5FF6B 3ILPB 4RFEA 4JY6A 5I2IA 1J5OL 4FQ1L 1NGPH 1CIUA 1FV1B 4MXQD 5E8OA 2V9QA 1QPXA 3C8HA 2A74B 5JDSA 2J4WH 4JPWH 1N26A 3LV3A 5FCUL 2E9IA 3TBWA 4X4XA 3OAZH 3IJHA 4X7SL 3W0WB 3MOBH 4UUJA 1T0NA 1U42A 1DEDA 5D7JA 4UDTA 2C9AA 4XXDB 1TTFA 4QRPD 1FNEB 4ZXBD 4EN3C 4M7ZC 1G7PA 2A0LC 2VUYA 1RZKH 1MOEA 3MRIB 4PJGB 2FYYA 1JUFB 3MLZL 5EIVA 4XNQA 1IM9B 3VFWB 4FFWC 1LGVA 2OJZH 1QVOB 1TMCA 2AJ3A 4ODSL 5EIIB 4XPHL 1P4BL 4HX1A 4J23A 4O4YH 3BEWA 4I3GA 4GG8B 3O3EA 1CGUA 1RJZA 2ZSWA 3NBNA 1HYSC 3C9NB 5CZKA 1WWWX 1J8HB 1ZT4B 4YHZL 4OZFH 5HHOD 3GI9H 5FYJE 1A6UH 1FNFA 4OIBA 1YPZB 5L2JA 4X9GA 4XH2A 4LDOB 5HSFA 4J8RA 1MCOL 4GG6F 1HXYA 4JEGB 1H0DA 3I6GB 1JF1B 1IEAB 4R7DB 2ZUQC 2DQCL 2VL4A 2HH0H 3WKML 2ARWA 4H8WL 1YMMB 4KUCD 1QTYT 1G6RA 3U79A 4X9FA 1MF2L 3O4OB 3GMOB 5IBUB 2WIMA 1B4JL 1AR1C 3QI9D 3BKYH 4U1NB 4ZSOA 4QRRA 5IQ9A 2B2XL 5MERA 4QHLB 4BFGA 3EYFA 4X83A 2YPLA 4WU7B 1BMGA 4YHML 4J7RA 4Q9CA 3GSNA 3T8XB 4MA8L 4QRPE 3GDBA 4F80A 5D93B 4KV5E 5E4EC 1A3LH 3AGVA 3HC0A 3BEVB 3PE9A 5FCUH 3WJJA 2G5BB 1QRNB 2EE6A 3TT1L 4FOMA 3ZKXB 1J0JA 1IC5L 2AGJH 5FYLD 4APQD 4UV4L 1I7RB 1FAIL 4LHUG 2WIIB 4NQUA 4YBQD 3GRWL 4QOKD 1DQQA 3MFFB 3VDBA 1BLNA 1IAIL 4X4YB 3BW9B 1YEHL 4HUVB 3RWHA 5HI5C 3MLZH 4ALAH 5IESL 4QF1B 4P4KB 1SHMA 2GK0A 2XTJB 4XAKD 3WLWC 4U1HB 3OAUL 2OMBA 5FUOL 5IMOA 4QHMA 3OXSB 4PJCB 4ODSH 3IDUA 3MV8A 4K71B 1P4BH 5FA4A 2HJFB 2PTTA 4NHUB 5HYFA 3S4SB 4JGUA 3DROA 1DLHA 2BVYA 3GB7B 3QPXL 4G9DA 1JBJA 4NHCL 5GIRB 3UPRA 4POZC 4YHZH 3QP3A 3G5XB 3IU4H 1SBBA 2EYSB 1JGDB 3MBXL 1MCOH 1JYVA 2X4PB 4XI5D 3TFKA 4J3XA 5MI0B 1T3FB 1F11A 1N7ML 1A9EB 2DQCH 2X4OB 4CU7A 3WKMH 4H8WH 1A7BA 2LU4A 1MF2H 5LKNA 5DD6A 1J05A 1KB5B 4F2MA 3H3KA 1B4JH 3TJEL 2X4UA 3HNVL 4DAGL 2WWMC 3TIEA 1EFXD 2H3NA 3H42H 2JJSA 2A38A 4YHMH 4YAQB 1WEJL 1OGAB 3KVQA 1A6ZA 2Y5TA 1AO7A 3BX7C 4U1IB 4Y5YC 4JPVL 3BWAB 3E2HC 4GRLC 1UZ8B 3C6LA 5FYLE 5I1KL 4MA8H 3LY6A 3RVXD 4PJXF 1OT1A 4HGKC 2QQKL 5DS8A 2NR6D 2N1KA 3IU3B 3T4YB 5KS9E 4QOKE 2ZUYA 3RZWA 1LEGA 3REWB 4R0LB 4ZOAA 4UV4H 4Q6IB 4KWUA 5J6GA 4PRIB 2NY6D 3WFDH 1MCIA 3LKOB 4YR6A 3RZCD 1IAIH 2FHBA 1XR8B 1QSEB 1YEHH 2J5LC 5IESH 1JIBA 3MXWL 4PJIB 3L5WA 2DLEA 3HE7C 1RSFA 3QQ3A 5GXBB 4U3XA 3OAUH 2BJML 1T83C 5FUOH 2XG4A 1U3HD 2EIZB 1U93B 5I1IH 4KRPC 3EGSA 1D5BB 2HJKB 4EUPG 3VWJA 2VDOL 3QPXH 3P0YL 2DDQL 4G8EA 1JNNL 4MLSA 3ZO0A 2YN3A 4O2EA 4R9HA 3D39D 3HN3A 1DQLL 4WW2C 5GS3A 1I8MA 1Q72L 3QEGH 4GH7B 4JRWA 4ZFOA 3MBXH 5F7UA 4GOSA 4J3VA 4N5EA 4F9PA 4L3AA 2OTPA 3QXWA 5C86A 2RFXA 1DDHA 1FRGH 2AXGA 4BH8B 5DTFB 4J1UA 5LWYL 3QO1A 2AV7A 4N9GB 2YN5A 1BQHB 4AT6B 4HIEA 1KSRA 4M5ZH 5ALBL 5L88H 2VRAA 4X8JA 2HRLA 2ADIA 3H9YA 3KPLB 3HNVH 4DAGH 3E3QC 5C6PB 3V4PH 2J8UB 4HUMB 3KPPB 4MJID 1C16B 2FJHB 2ADJB 3I3DA 1BOGA 5DT1L 1INQA 2IEPA 1QQDB 1J1PL 1JPTL 3V0VB 3HPLA 4Z7NF 4JPVH 4HXAL 4HHAB 2NY0C 2AJSL 7CGTA 4MZ2A 1I1YB 4FABL 3SO5A 3SDXB 2QQKH 4FQXC 3TA3B 1MFDH 1SJHA 4JY5H 5J9PA 3IFLH 3OKYA 3STZA 1F2QA 2GW5A 5EUOB 1E4KC 5ITBL 2EDDA 2UVFA 4MD0A 1S7RA 2BNUB 4GFTB 1EEYB 1BBJB 5E1AB 3ARDD 1HHKB 5E7FA 3MXWH 5GS0L 1KC5L 1HHIA 3D39E 3E2HA 4GRLA 1FFRA 1QSZA 3OKKA 1FNGA 1UEMA 2JLLA 4N8VG 2CKBB 1OY3B 2WWKT 2FBJL 4UZGA 3WN5B 4MAYD 4RMUA 2VDOH 2BMKB 1S7TA 3P0YH 1H5BB 2YD5A 2DM3A 4D9LH 4HKJA 2C1OA 4MQXD 5HTSA 5EU6D 2FB4L 3SQOL 5EZJA 4TUJB 1SY6L 3ZSSA 2ZSVB 1RK1B 4XPGL 4DZBA 4DTGL 4MJIE 3FQUA 5IG7B 5LWYH 1EO7A 3KPSA 4FG6C 4CVZA 2ZCHL 2A77L 3N1PC 3VFOB 3V52H 1T4KA 1WWAX 3LS4L 4JRYD 1AP2B 3L9RA 5C0AA 2FJFA 4Y8DC 4UIKL 1UCBL 4MMXC 2P8MB 3BGMB 2FH6A 5ENWB 1MFEL 5TQ2L 4X5XB 2ERJC 1INDH 4NO0B 4YE4L 4YWGL 4MJ6B 5DT1H 5LG1A 1KB5L 4K3DL 1TCRA 1JPTH 1Q0XL 2YZ1A 4HXAH 4TNVF 1XGQA 4KRNA 3WD5H 3JZ7A 4D0BA 2AJSH 1N59A 1IILE 4PJEF 3HNSL 1CCZA 3S96A 2NQCA 1OSZB 4A2LA 1N3NB 3T0DA 1FVEB 1Q9LB 2Y25A 5IBLC 3ARPA 3FT4A 5L0QB 3HS0B 2NX5B 5ITBH 4ZUSA 3O6FA 4OT1H 2IPKA 3CSYA 3IRZA 3WNOA 2ICWJ 5D7SH 4S0SD 3LN4A 3SBWC 5SWZA 1Q94B 3MV9E 4HUXB 3F62A 5GS0H 1KC5H 4P2OB 3C09B 5CBAB 4RQQA 4CJ1A 4PJGF 5EU6E 5H94A 2YBRA 1A21A 2FBJH 5KBNC 3VE0B 2X42A 4W81A 4ORGB 1CDBA 3VI4F 3D69A 2C4FT 3DIFA 3TN0D 2DM7A 5JPMA 5CWSA 3PWVA 1ZA6B 3Q1SH 5J11B 4N0CA 2YRPA 2X10A 4KDVA 3VFMB 1B2WL 3TYFB 2VDNL 1SY6H 1X5GA 5FKAA 1MI5D 1OGTB 3KPQA 4XPGH 4PJ7E 2YMXL 3H9SB 4YDLC 4NQED 1YPZF 5D1XD 4YO0B 4WWID 2HTKC 3QCTL 1CDIA 1NBYB 4P2QD 2KUTA 3PIQA 5HHNB 5E6IA 4BUHA 2A77H 3RDTB 4XPFL 4JVUA 4LCWA 3LS4H 1JZ8A 2OTWA 4UIKH 4RX4D 4Z5RA 3MRJB 3QHZL 5C08D 1MFEH 4YGVB 5TQ2H 2O5XL 3C5JA 5JPNB 1YEIH 4YE4H 3VWKB 3KYAA 5DZLA 4OKVA 3BWUC 1KB5H 4K3DH 1RHFA 1KCGC 1WIPA 3JWNC 5DDHA 2NW3B 4HUWA 3U2SA 3RWDA 2GAZB 2QEJA 4RRPG 1U8JB 5A40E 2CMRL 3HNSH 4RA3A 4GW5B 4TVPH 1N6QL 1MSPA 1RZGB 2F8XC 4J3WA 4RGMB 1MLBA 1HHHB 1ONQB 3H9ZA 4F37F 1HI6B 1XGYL 1XF1A 3KDMA 4XP5H 1L8JA 2VAAB 4LVHC 4YDIH 4G6MH 4G42B 4L4TA 1LQSR 2X4RA 3THMH 1D5ZA 4H8WC 2MCG1 3IB4A 1EJOH 3FO0L 3KJ4B 1A7QL 3MLTB 1ORSA 2Z8WC 4HFUL 1KLUA 2JE8A 4DVBB 4Y4FD 4JN2A 5E6YA 1RJYA 5CEXB 2UY7A 1V3MA 3PUCA 3B2VL 4TSCL 5ERWB 1LK2A 2R9HD 2A1WL 1JNLL 4G7VL 4ZO6A 3N85L 2V7HB 2FJGA 4UU9A 4NQEE 4PJCF 3KYNB 4UV7H 4E9LA 4IOSD 4OFVA 4P2QE 3HR6A 3BP7A 2Q8AH 4L4VB 1NC4A 4NCC2 2YC1A 1YEJL 5IW6B 4ZFFA 3KPNA 3O6LH 3UBXG 1S9XA 3QCTH 3M07A 3NIFF 2DBLL 3BYTA 4XPFH 1TVHA 1U8QA 1X7QA 4L9LB 4X8XA 3WJLA 1KTDA 3QHZH 3X12B 5T3XH 3FFCB 1CFQB 4FNLL 2F53B 3BPCB 4LPXA 1FYTE 3FQWA 3UROR 1FHGA 4F8TA 3RPIA 3VCLA 5B3JF 5GRJH 3IYLW 3RHWK 1JHLL 1ZE3C 3U46B 4N0YL 4PBVC 2CMRH 3TNNB 1N6QH 3VFVA 3V5DB 1NMCC 1FGVL 3ORJA 3WE6A 4NYLB 3I6KB 3HZYB 2DQUL 4HUUB 1BAFL 3IFNH 1CG9B 4GBXB 4XZUA 5HGGS 4QYOB 4HW6A 3WV0A 4I1NB 2NLJB 2NXZD 1TITA 2H26B 3U6RB 5H37G 4QNPF 2HJLA 5HHOA 5FO8A 1FGNL 4NT6A 4OGAD 3SQBA 4AEHH 1A7QH 1VFAA 1JNHB 4YEEA 4HFUH 1MQKL 3KLAB 4XNXL 2ZKHL 4M93C 4PV9B 1A9BA 4PJ9B 4PJIF 4FQLL 4R4BB 3MLVL 1F90H 2A1WH 1JNLH 4G7VH 5C6TL 2B5IB 3RRQA 1NMBL 4OCXH 3UJIL 3MRDA 2CKBH 1X5YA 4M8QA 3QI9A 4P46B 2LAGB 3QJFA 3FT2B 1Q0YH 4A6YA 1AGEA 1DE4B 7FABH 1BM3L 2JF1A 5JXAL 1IBGL 3P4NA 1YEJH 2VIRB 1B0GB 3BUTA 3T2PA 2ZCLH 4ZOBA 3TJHD 3GKZA 2WINB 5TDNA 3O3BB 2DBLH 3DSFL 2DQGL 3QXAA 4QT5A 3PHQA 5AG8A 3TO2A 4LPUA 4PREA 3L5JA 1C12A 1S5IL 2HLFC 3HC4L 4FNLH 3QIBA 5GS2D 2X70B 1KJMA 2J8UF 5ABDE 1KJVA 1AI1H 4N0YH 1U91B 1C7SA 4MVBD 4FXKA 5H35B 4PFEA 3MZGB 5CJ8A 3WFCH 1FGVH 1ZHBA 3C08L 2DQUH 2APFA 3LQAL 4TUOA 1OTTD 3QH3A 1CS6A 5DJ0B 5TF0A 3SDXF 1QR4A 4R96A 2GJZB 2WAHA 2IALA 1KF9B 2G2RA 2LFGA 2ATPA 4YHYB 5ESQA 3HE6D 3B2UD 5KSAD 4FQIL 2I24N 4GLRH 4H1LA 3MRMB 5EUOF 3FRPG 3QNYA 3C60B 4F7CA 1QSVA 3T0ED 4BJLA 1MUJB 4U6XB 4NKOB 1UM5H 3DX8B 1ES0B 2OSLB 3Q6FA 5E2UL 2D7OA 3NZ8B 1UFUA 2NZIA 1CXIA 3NFNA 4MDJB 3WFHA 3ULUD 1NLBL 1K8DA 5MEQB 5FV2A 4FQLH 4G43B 4GAJL 3MLVH 1IVLA 5C6TH 5HDQL 3O4OC 5E08L 1NMBH 3O9WB 3CFBB 3UJIH 2QBWA 1Z5LB 4WU5A 4XX1E 3R8QA 3L5XL 4OF3A 1BM3H 2Z35B 5AYUL 5IK3B 5JXAH 1IBGH 4ELKA 5F88A 1BJMA 1ZWIB 2IADA 1X5AA 1YJDL 1R3KB 1Y18A 4ZDHB 2V2XB 4KY1L 2BY1A 4GMTL 3LB6C 5D93C 5CZVL 2AP2A 2A6JB 2DQGH 1VSCA 1H15A 1UXWA 2MTPA 3D5OF 4WRLA 1HSBB 3KXFE 4H88L 3K4AA 3ZKXC 3MLYH 1S5IH 3TO4D 2P5ED 3HC4H 5HGBB 3L3JB 3L3KB 4RGND 4NZRL 5GS0C 5DVKA 1U8HA 3Q3GA 4J3SA 1NUDA 2CRYA 2E8YA 4R90L 3MZTA 3P9LB 4JKKA 4B5EA 2R8SL 5FF6A 3V4VL 4PJEA 2RCSL 2D03L 1MFBL 1LEKB 4P4KC 5GRVL 2XTJC 2FHCA 4YZFE 3C08H 4TSBL 4F7EB 2A74A 2OBGA 3M45A 4K71C 4RMSA 5E2TL 1U3HA 2YUZA 3L7FA 2LAAA 5DURB 5FCSH 1QFWI 4OB5L 4JFQB 5FFLA 4I0PD 4FQIH 3IS0X 2NNAA 2FEDC 4HWZB 3VG9B 3PHSA 1FNEA 3RWGA 5CFHA 1IKFL 4JZOB 1NFDB 2B0SL 5E2UH 1ITCA 1M7DB 5MI0C 1ADQA 1XH3A 2A6KA 4PD4K 4ZUTA 1XGTA 4KROB 1UM6L 5IVXE 5HDQH 3V5KB 5E08H 1GGCL 4KK9C 4E41D 1T22A 4GG8A 1DN2A 5I17B 3L5XH 5AYUH 5EPMA 3WIHL 1YPZA 1T89A 2P5EE 1YJDH 4YHKL 2ZP0T 2QR0B 3F7RA 4KY1H 4RGNE 4WO4D 4Z7UB 3QHFL 5I1CL 3DYMA 1GZPA 1WSST 3I6GA 3DI2B 5D72L 3C5ZD 3QCVL 1YMMA 3LKSB 4ODXA 4XXCC 4R0LC 4NZRH 4HJ0C 2K7QA 3ZE2E 1OLZA 3ZMRA 2HWZL 4Q6IC 3GSQB 1A22B 3MACL 4ODBD 4R90H 3KPMB 1AGCA 5FA3A 3QYCA 2E7LA 2R8SH 3BKCH 3V4VH 1QSFB 1RURL 5CGYC 1MIEL 2RCSH 2PCPB 2XQYK 2D03H 2CIKA 4X9BA 1NCAH 1MHPH 4PRDA 4O02L 5IOPA 1UZ6E 1KN4L 4TSBH 5DMKA 1HWGB 5MP6H 1FL6B 5E2TH 3NCMA 4UT6L 3BEVA 2QTEA 4QXUL 3O2DA 1IGCL 1RY7B 4JM2F 1ZLWH 2X2YA 1L9MA 1QRNA 5I16B 3T0XA 2B7DT 4OB5H 4LOUD 3BN9D 3U82B 1PVHA 1JN6B 4YIQB 1GOHA 4PRNA 4F9LC 2DWEA 1I7RA 3LSOB 4R4ND 3V6OC 2B0SH 2CUHA 3VRIB 4AY0A 2Q3AA 4Z18A 4QWWC 3AB0B 5GGSB 1IL1A 3K2UH 4ZXBB 4M7KH 1NGXB 2K3TA 4PGEB 5IBTL 2HFFB 5DVLA 5C0CD 1GOGA 3OXSA 4O9HL 1DQML 4PJCA 2B4CL 5F7WC 4CL7A 4KKCD 1DUYB 3I85A 4LCUB 4JRYA 1MCKA 2WBJA 4TTGA 2BHYA 4HS8L 1N6VA 4U31A 2Y72A 1U2HA 3ISWA 3G5XA 3WIHH 2BVEA 3UTPD 3DBXA 4LHUA 2JB5L 3WLBB 4YHKH 1JGDA 2A6DA 3WXWH 2JCCF 5I1CH 2FSEB 3CDCA 3TA3C 1HYRC 1M4KA 1T3FA 4MWFB 4NO3A 5JUEL 1ZLSL 5D72H 5JW5A 4PJBF 4KZEH 1WBYB 1FC2D 4K2UL 3NFSH 4MCZB 2VJXA 1SJVA 3HG1D 2HWZH 3MACH 1YMHB 3OX8B 1A7NL 3VD3A 4EDXB 4M1CD 1UKSA 1DBAL 1RURH 5AAWA 1MIEH 3BGFB 5BQ7B 4HIHA 4O02H 1KN4H 1MCPH 4ZMAT 3KLHD 3ZLQC 5TFSL 5AEAA 4PUBL 1MFNA 4G8FA 4XCYA 1X6NA 4UT6H 3T4YA 3WN5C 5J1AB 4QXUH 1IGCH 1OARH 4U2YA 3FMGL 4WWKA 5E9DA 1H5BC 1YY9C 4U1LA 2ESVA 5ESAA 1DVFA 3T3ME 4AJ0A 3QUKB 3RVTC 3TCXA 5C0CE 4Q6IA 3VXOB 4DGYH 1P2CB 3ZE0E 3HI6L 4NO5B 3ARZA 4GO6B 3GJFH 3ZYJA 2ARJB 4P2CG 5EBMA 1NCTA 1R24B 2FIKB 1QSEA 3VG0L 4APQB 3LKPB 2H41A 4DUXA 3CDFA 3SDAD 4PJIA 5IBTH 4S0TD 4H25B 5KS9B 3UTPE 4QOKB 3U7AA 4O9HH 1DQMH 2B4CH 2DIJA 4ONHB 3X3GH 3MO1B 3MCKA 4G7YL 1KJ2A 3VU2A 1O0VA 3PWLA 1DQJA 4JG1H 5C08A 4HH9A 4HS8H 3QG6B 4LRIC 4IOFC 1UYWL 5DSCA 2CPCA 4RMTA 1T20A 1J7VR 2NY1B 2JB5H 5ALCH 2BOBA 3UZEA 1IGIL 1OAYL 3HG1E 4ZPVA 3VXMD 1JCKA 2DYPA 5FM5O 4G59A 2D4DA 3T77B 5HI4D 3NTCL 4UNVA 5JUEH 4QO1A 4MNGA 1F00I 4N9GA 3W9DB 2FRGP 5L0QC 1BQHA 4K2UH 4MNQE 3F6LA 1QBLL 4J4PD 4K8RL 4XCEA 5B39G 2VL5A 2J8UA 5EN2B 1LP9F 3FCTB 3KPPA 1A7NH 3KPOB 4EUPA 5T3ZD 1Q9OB 3QWRD 4Z7QF 5GZNC 4L8SA 1AD9A 1X5LA 5SWSD 1JTTA 3B8YA 5DJ8B 1QQDA 2AQ1A 4P2OC 5T1KD 1EFXB 4HHAA 5DJ2A 1ZK9A 3C09C 5FYJL 5JO5A 1BZQK 5GGRB 4LCCB 1XZ0A 1N2RB 3WS3B 4PUBH 1NSNL 3SDXA 4GUPB 5JR1L 2I9LA 4GRMB 2FLBT 5HY9B 3FMGH 5BMFH 5CINL 3AM8C 4G6JL 3RA7L 5EUOA 1I1CA 4WI4A 3WMSA 2VQ1A 2CLRB 1NEZG 2DMCA 5J11C 1L7TL 1J0KA 4JFYA 5EU7C 5E1AA 1MJ8L 2BY0A 3CC5B 4KDTC 1RHHA 3DWTA 2HKHL 3UPCA 8FABB 4Y5XA 2NY6B 1RPQA 3RDTC 2CKBA 1G1CA 3RZCB 1JV5B 4RGOL 4XP1H 2NZ9D 3VXME 2O5YL 1TZGL 4G7YH 4N0UA 3HPJB 2DQTL 4ISVA 5BJTB 2OM5A 1I1FA 1FFQA 3VWKC 1YN6B 1QFHA 1FG2B 3O41B 3HCVB 1GVIA 1UT9A 1IGIH 5HHPB 1YEKH 1OAYH 3LQAC 2XICA 4TUJA 5C09E 1RUML 4RBPH 4Y2DA 3D39B 3RIFF 1A47A 5CJXA 5LVEA 1U8IA 5T3ZE 4RGMC 3X17A 4KK8C 3VFOA 3GSOA 4HLZG 4OD2A 4N8VA 4YHNA 5DQ9A 4TRPL 3QR2A 3HB3C 1QBLH 5C0IB 4K8RH 3OXRB 2P8MA 2QADD 3BGMA 3CXHK 3OJDB 5DR5L 4NUJB 3KJ4C 1QFUH 1X5ZA 4LP4A 1JE6A 4MJIB 5DUML 1NH6A 1JI1A 1J1XL 3RTQB 3BZEA 3IFOB 4WTZG 5A2LH 4UQ2B 5F1NA 1NSNH 1OSZA 1N3NA 5JR1H 1F4AA 1Q9LA 5E8EB 1F2XK 2X89D 32C2B 4WDIB 2EDWA 4P48A 5DUBB 4F7TB 3RA7H 3ARFD 4NWTL 2NX5A 1OLLA 1YJDC 4JKWA 3P9MA 3BQUB 4AL8L 1L7TH 4G8IB 3GSUB 5J1SC 1P7KA 3CXHJ 3W39A 5INDB 3BZFB 2ZOLB 2HKHH 4FQ2H 1I9IL 1NFDF 4MSWB 4M1GH 5CBAA 3ARDB 1KTKE 4ZAKB 3FRUB 5GRUL 4L9LC 5FYLL 4ONGL 1U8LB 4NFDA 2DL2A 2O5YH 1TZGH 3VE0A 2DQTH 1GGIL 4KJQC 5T1MA 1NBZA 1XGUB 4ETYA 4MAYB 4OZHE 4K3JH 3QEHA 3N1FC 3B43A 3MV9B 3TYFA 2UUDH 1DEEB 1RUMH 1P4IL 3TBTB 3EOBB 3OAYH 3H9SA 4MD5B 3MJ8A 3IDNB 5DC0A 3MV11 2GQHA 1FZJA 5EU6B 1A7PL 2GITB 5E4IA 4MVBA 4Y1AE 5TE7L 1I9RL 1AXTL 4Z7UF 3C8DA 5HDOA 3EYOA 4TRPH 4MA7H 4GBXC 3E8UL 4G6AD 3JUYA 5IWLC 4PY7A 4NO2A 2GJ6D 1CICA 5DR5H 3QXDB 1X6LA 3EHBD 4GXUN 3U0TA 4JFOB 3WYRA 1QFOA 5CMAA 4PJ7B 5DUMH 5DA0B 3BP5A 4NSKA 3IDIB 1GXEA 1J1XH 1IGYA 2XFXA 3FQNA 4RMVA 1CL7I 1J0HA 3GSVB 5BXFB 1AE6H 2AEQL 4PJ9C 4JM2A 2PF6A 2B5IC 2ZUVA 2QHLA 4JZJB 1MY7A 1F4YL 4NWTH 2YSSB 4U1KB 4UDUA 1FN4A 4ZS7L 3B3IA 2C3VB 4P46C 4NDMA 2ZUUA 2VAAA 4AL8H 1X4ZA 1PY4A 5DA4A 4U0RC 1FZOA 2EE9A 2PXYA 1CFVH 4P2RD 2MSPA 4JAMB 5C0BE 1G7HA 5DYOB 4Y19E 4EQ2A 1I9IH 1TZIB 3PGCB 2G5RA 4GW1B 4KTEH 4RRPA 4DVBA 3BDBA 1ZKAA 5GRUH 1OM3L 3BN3B 1GGBH 4JDZB 4P5TD 1A1OB 4IRSB 1HXMB 1A5FH 1GGIH 3TVMD 2VXUL 1JFMA 1LO4H 1MRDH 1WGOA 2D3VA 1LE9B 5H8DA 3BUYB 3KYNA 2WBKA 3TPUA 2IAND 2H6PB 1T66D 4OF8A 5CGTA 3S98A 4WHYH 4WTXA 1T2XA 3MV7D 1E6JL 4N9OB 2JCCA 1OF2A 3TN0B 2YHGA 1P4IH 4YDJB 4RWYL 2J3SA 1V05A 3DMMA 4WUUD 1NPUA 1H3WM 2GJ6E 1A7PH 5I0DA 4PJBA 3QSKB 5TE7H 1JZ5A 1I9RH 1G7MB 5KG9A 3O2WH 2XA3A 4NQEB 5D1XB 4GKZA 3X12A 4P2QB 4YHYC 2W59A 4YDVB 5DD5H 3MLPA 3FFCA 5KANI 3B9EA 3L3OB 4JANB 3C60C 3CH1B 2JIXB 4HUNB 3TV3H 5A2JH 3LIZH 2DQFA 4OGZA 3K46A 2F15A 3LS5H 2B4CC 3H3BC 4IDLA 1T1YB 1BP3B 3QNXB 3W9EB 3TNNA 3WDJA 4M6ML 5E2WL 2AEQH 1WT5A 5I1AA 3JVGC 4OLVL 3BZDA 4QHNB 5ID1B 1GC1L 4Z0XA 1M05B 3I6KA 3WDIA 4P2RE 2D2OA 4HUUA 3ZE1E 2FWOA 2YS4A 1ZHNA 3K7UA 2L4OA 4ZS7H 1YN7B 1FYTB 2EDKA 1JF6A 1K4DB 4ZUUB 4E41A 1FZMB 4PGBA 2VXVL 2VERN 3GUTB 1OTSC 3LHPL 2Z8RA 4XGZB 1F97A 2J8HA 1JZ2A 2RHEA 2IANE 5D1QC 1ACYL 1U8KB 3CU7A 3JV6B 3GIVB 4MX7B 5GJSL 1PYWB 3MV7E 1CGWA 1KGCD 3OAZK 1BFOB 3S34L 5DJAA 3DX7B 3VXSD 2VXUH 5KS9F 1W2KT 2V17L 4KKNA 3GK8L 3QFDA 4WUUE 3TH4T 4MZ3A 3SDCA 3HUJE 4W4NA 5C9JB 5E2JA 1MJJB 2VLKB 4ZS6D 3K8MA 4C56A 1DE4A 1Y0LB 4QEGA 4P3CL 3BKML 4Y16D 1B0GA 2PW1B 1G7QB 1FIEA 1TCMA 4H26B 3V6FA 5HYQA 5KSVB 4F7PB 2EECA 2WINA 3O3BA 1IGTA 4GT7A 5I1JL 2Y6SC 2VLJD 2J12B 1AC0A 1OT2A 3EYVB 1LP9A 1D6EA 1EXUA 4QRSA 1YEDA 1RZIB 2X1PA 2IPTL 3EIFA 3L3GB 3VG9C 3ZYZA 5IB3A 3G6JA 2VN7A 2JJVA 4DFHA 2Z4QB 4JR9L 5E8PB 4AM0B 3DETC 4NQDE 3O8XD 3QUZD 4M6MH 2X9WA 5E2WH 1R5WA 4KROC 2UZYB 4OLVH 3TBVB 2A6IA 5C9KA 5D5MF 4X6DE 3TGXA 2YA1A 3EDDA 1GC1H 4PJ5E 1CXEA 4BA8A 4M00A 4V1DE 4RMRA 4UIMB 4XBGB 3TCLA 1OAZH 3QNZA 5DFVC 3EYQD 4F3FB 1MHCB 3GJFA 3SCMD 1A6TB 1R3JB 2ID5A 2VXVH 3C60A 1KGCE 4P5MB 43C9B 1YQVL 1KCUL 4PTUA 4CMMA 3LHPH 3VXSE 3FB5B 4NKOA 4EI5D 5EO9A 1W0YT 3DX8A 4H5SB 4K07A 5LGJB 3MV01 3UAJD 1I8KB 1ACYH 2OXGA 2A73B 2NXZB 2VLRD 4K8RC 5GJSH 5MEND 4GW4B 5GZOC 4OJFL 3NACL 4ZNEA 1S9KC 3S34H 5F1IB 3ZKNC 3SJVD 1K85A 2KQMA 1KXVC 3O9WA 1ULVA 3PWPD 1KXQE 4M4RA 2VLJE 1I1AB 4P3CH 3BO8A 4M61A 4X0KB 5B21A 1A3QA 3BKMH 5D96B 4HWBA 3OR6B 4X6FB 5DJXB 2IQ9L 5D2LB 4JM4H 4WHDA 3HTLX 5BVPL 4RDQF 1WBXA 1X5XA 2EE3A 5I1JH 5KN5B 3VXTA 4P3DA 1JTPA 4MXQC 2W07A 3OKMA 4TSAL 1SJXA 5HGBA 3L3KA 4NZUL 2X4QB 5BCAA 2IBZY 2IPTH 5CSZB 3P9LA 3BMVA 1IZKA 5IIEB 2Q86B 4M43L 1G9MH 3VW3L 4JR9H 2D9CA 2YD8A 2EH7H 4YGAB 3DNKA 4ZXBC 2ILLA 3T3PF 3IDGB 3NIGE 3KXFB 3IKCB 1I7TA 3EO9L 1SYSA 5C07D 1EHLH 2R2CA 5DEZA 2VLRE 2GIYA 1P7QD 4S11A 3KHOA 5MENE 5HPMB 2ZNWA 4OV5B 1C5DA 2AJYH 3FONB 3PDDA 2MPAL 3PGDA 1YQVH 4Z7WE 1KCUH 3GMNA 3GGWB 3T0WA 3WBDA 3SJVE 1UACL 3GMMA 4DGVL 3MRCB 1NFDA 2IFGA 4IRJD 4ELME 2APVA 1YEGL 4N1CA 4OI9A 3PWPE 3D0LB 5TE4L 4OJFH 4OCYL 5C2UB 3NACH 3UTSD 4Q0XL 5C0FA 3K2MC 4N0RA 1I3UA 4L3CA 1U8NB 2OI9A 3L6FA 5FYKD 4J4PA 2DWDB 4I18B 4JFXB 1WLHA 1G1YA 2HVJB 3EAKA 5SWSA 3BGFC 4U05A 2IQ9H 4HKZA 1M71A 4BFIB 4NZTL 4Z7UA 3MREB 5IVXB 1ZT1B 5EU4B 4GLRI 4LLUA 1L7IL 4TSAH 3PNWB 3LEXB 1TPXB 1VEPA 3D3VD 1NKRA 2GUOB 4XVJH 4X98A 4L8DB 1W8OA 3GSQA 4PDCE 3U7WL 1RMFH 3TO4B 5C07E 3A6CL 2P5EB 1A8JH 1QSFA 1UEYA 3P11H 2D0FA 1FPTL 2VABB 1X5HA 4JGJA 4RGNB 3GSWA 4APQC 3DGGB 4IJ3B 2V2WA 1FAKT 4MXVE 1NANH 3SE4C 4PJ7F 1EERB 3JV4B 1KCLA 3ZYIA 1YNLL 3QDJD 4WFED 3JTSB 3STBA 2EC8A 3CDYA 3FOMA 5HJ3B 1PQZB 5GS1B 1JN6A 2IGFL 4QRTB 4X6CE 3UTSE 2MPAH 4KQ4H 4RAHA 5E00B 3LSOA 2NY1C 4GKSA 3ARGA 4I0PB 2MQCA 3S88L 5FYKE 4TNVK 2W0LA 2BCKB 2E7BA 4MQTB 2YD4A 1NGZB 2PW2A 4DW2L 3AREB 4OCYH 1CF8H 1LNUA 3MLWL 3IXAA 4Q0XH 1WC7A 1NAMH 2HFFA 4Z78B 3BI9X 1OAUL 1PBYA 4XI5C 3RAJL 2QJDA 1K9TA 2H32B 4LCUA 3QIUA 1I8IB 3LKRB 1IE5A 3F12B 1T1WB 4Y0GA 2NTFB 1WFUA 3NIDE 3NCYP 1Q1JL 3O4LA 5KTEL 3U36B 1HEZA 1OAXL 2VO5A 3D3VE 3CXDH 5KVEL 1CLZH 4I0KA 3KR3H 4UTBH 3MJ6A 4LCCC 4NPYA 4XNMB 5E5MB 1XIWB 2UZIH 3V6ZA 3ECBA 3SN6N 1L7IH 4NKMB 1S7WB 4WO4B 3RVXC 4R26L 3OKNB 5FOBA 4UI2A 2NR6C 2LVCA 1CWVA 1XF3A 1WF5A 2OR9L 3RKDD 2D7TL 1D6VL 3JWDL 3U7WH 4RFOL 4WFEE 4EDXA 3R8BB 5DMYA 5ISZE 4RIRB 4MS8D 1PEZA 4HCRL 1YUHB 4PJHE 3EDEA 3SKJL 2NY6C 3DRTA 4LSQL 2FR4B 4IOIA 3RZCC 4YHIA 1M1SA 2NY5L 1AGDB 1OHQA 5M94B 1NBQA 4IS6B 3MCG1 1BJ8A 3DVGB 5DJDB 4NQCA 2I27N 4OFKA 4Q9BA 1CK0L 1N4XL 2QQNL 2R39A 4EDWH 3VXUD 3QUKA 5LBSL 4HPYH 3SDDB 3LDBB 5SWQB 1PG7X 5AYQA 4NO5A 1C08A 3KJ6L 5ICZB 5FGBC 3S88H 3RL2B 1KCVL 5J6HA 3EW3B 3VFSB 3TH2T 1NC2A 2C7UB 2P24A 5L9DL 5DGQA 3S3SA 4KHXL 4DW2H 1I7ZB 3WO3B 3MLWH 2CH8A 3SE4A 1FLRL 2FIRT 4H25A 4IRZL 5B38G 3VFNA 5KS9A 3KLSA 1I8LC 3IETB 2AEIT 1T80A 4F37K 2XZCL 4CVXA 4DKFH 4LCIL 5BRZD 2WUBL 2IPUK 5FM4A 3GMRB 3PP4L 4FFEX 3CMOH 1Q1JH 1JHTB 5KTEH 1EZVX 3O3DB 3ULUL 3E0GA 1KNOA 1OAXH 4XC1L 1GC1C 2ZUTA 4KKAC 1EEZB 2MCPL 4DQOL 5KSUB 2JK5B 1YYMH 3RTQC 1SBSL 5IM7A 2PTUA 3UTTA 5CBEA 5BV7B 3NN8A 1XFPA 4LSTH 3SE9L 5J0BA 4NGHL 3OKOB 4R26H 4OF7A 4URTB 2OR9H 3BQUC 2D7TH 5TDOA 3T0VA 2R29H 3QDMD 3JWDH 3UPAA 2EYTB 3FCTA 3P30H 1D9KB 3FHAA 2EZ0D 5I1DA 1EHXA 4PTTB 3HG1B 2OL3L 3FHQA 3M17A 2NXYB