3W39A

Crystal structure of hla-b*5201 in complexed with hiv immunodominant epitope (taftipsi)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
277
structure length
277
Chain Sequence
b'MGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-52 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Distinct HIV-1 Escape Patterns Selected by Cytotoxic T Cells with Identical Epitope Specificity
pubmed doi rcsb
total genus 62
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w39A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3w39A01
2PETA 5EFIA 4F7TA 4XWGL 5FGCE 1IEAA 2BRRL 3ILPA 3C60A 2JTDA 2LFGA 3CDYA 3D0LB 3VXRD 3EDFA 3WUWB 2Z8WC 1D5MB 3MA9H 3IXAB 4X8JA 2V17L 3R0NA 4WI8A 3WFCL 2VR5A 1S7VA 5MENB 3MRKB 2KUTA 3I02B 1VACA 4KK9D 5D5MB 4TVSa 1HXMA 1QBLH 3ZLQC 4TTGA 1IEAB 2R0WL 3SPVA 2RAMA 5CIPB 2ILLA 4M3JA 4TUJA 3SDYH 1LO3H 5IB2B 4OI7A 4NNYA 5C09D 3D85A 3OR7B 3UCRA 5DHVA 3JTCA 1HIML 3OAUH 3CLEL 3PJSB 1YMHA 5IOPB 5E03A 3D2UB 3A6CL 3SO3B 5JLZB 1GOFA 3K8MA 4QXGL 4ZPTA 4XBGB 1NBYB 1X4YA 1F58H 4U1NB 1T0NA 5D71L 4HH9A 5E1AB 1FSKB 4PRDA 3PQYD 5CUSH 1MHEA 1AR1C 5L6YH 1GAFH 1KTDA 2C1OB 4NPYA 1FNLA 4ZAKA 2ENYA 4LVOC 4P0DA 4OFKA 3VI3F 2BOCA 3FB7B 5EORL 3CFKA 1EVUA 3MJ8B 1UT9A 3SGEH 1GIGH 3BO8A 3L6FA 3RWCB 3KPRD 5L9DH 1OB1A 3TVMD 3KYMB 3BO8B 3MLXH 3PL6D 4OIAA 1S78C 4KKAC 1IT9L 4LSVL 3UTOA 3QCVH 2DLIA 1S7UA 2XWBA 1EHLL 5D2NE 3VXQB 5DEGB 1MWAA 1KCLA 1ZV5A 5ALCL 2R29H 1AE6H 1Q0YH 3NIFF 1MAJA 4EDXA 2OJZH 4MCYB 4X6CF 4WV1B 5GGVY 4DKFL 3U2SB 3SDCD 1FAIL 1RUAL 1YJDL 4G7YL 3MLVL 4PJEB 3U9UB 4MCYA 3U2SA 1XIWB 4OLWH 2AQ1A 4PJ9B 4XC1H 3U4AA 2SEBB 1LO4L 1X6NA 4JKPL 3KPMA 1S7WB 3LEXB 3BUTA 1JMXA 1DJSA 1A02N 2A9NL 4YEEA 1MJUH 3V0VA 3MRNA 3RL1A 4ZXBA 4YHPB 5HI4C 3MREB 1J11A 5EO9A 1FJ1A 5DD0H 1UWEH 3PL6A 2XIDA 3D6GA 1UJ3B 2EDDA 1JZ7A 4Y0GA 3AS2A 1M6OB 1BEYH 3GSVA 2AJ3B 1YDPA 4RX4A 1JZ3A 4QHKJ 2D0HA 5T3XH 3ULUD 1MCPL 5C0RL 3C87A 4LSQH 4LLQB 2IMMA 4EOWH 2QADB 3OKOA 4EI5C 2CGRL 1KUMA 2HFFB 3VE0B 3T0EB 5H35A 5HGHA 2P7TB 1U8QB 4HZLB 5T3XE 5ERWA 4XP6H 3BW9A 3CMOL 5B38B 2DQCH 2XNAA 4M1GL 5GRJL 5HI3D 3IGAA 3O4LD 1YDPB 5K9OA 2NW3A 5IHZA 1RULL 1JN6A 5K9QG 4PRIB 5I30H 2X9YA 2EH8H 1D6EB 1AXTL 2YPVL 1FFRA 4NUGH 2X7LB 2AEPH 1L6XA 2GK2A 2EDKA 2GJZA 5CEZE 2XQBH 2ICES 2A0LD 3LS4L 4O4YL 4P2QE 2WQ8A 1CDBA 4Q9QH 3O11A 4KPHH 4PRPD 3F7VA 4BKLA 2W0FB 4ZS7L 1KCRH 1YNKH 4UT9H 1ZVSA 2H26B 4CUCA 3MBEA 4FQ2L 3RWFB 4M5ZH 3CLEH 3GIVB 4GBXB 5C0CE 4UUJA 3K74B 1A6WH 3BPCB 1J1OL 4P2OC 2A83B 3RIAF 3BPCA 4OF7A 5C07E 4ETQA 3TVMA 4WUKL 2YK1L 4M6NL 3DO7A 4JRXD 3L5XL 2W0FA 2EE9A 1RZKH 2ATPB 3SKNB 1Q9WB 2AI0H 3GMOB 5A2JH 2YXMA 5A40E 1Q8MA 5A1AA 4NPYB 3GSRB 5EORH 3EYUL 1MRFH 3SKNA 2X9WA 5E2JA 3FT3B 4XCEB 2FBOJ 2IMNA 3H7BA 4OUUA 3O3EB 1NGWA 4DTGH 5KSUA 2X7LA 1ONQA 4R7DB 2IFFH 3PDGA 1IAMA 1IGFL 1I75A 4YLQT 4PLJD 1U3HC 3FQRA 4ZS6C 3RWCA 5FUOL 3KS0J 3MLYL 2OYPA 4PJHB 2YA2A 5FGBC 5FA3A 1OW0C 4Z7WF 4K3GA 3EO1B 4LCWD 1XCQA 4WWID 4GLRH 3WDJA 4GRWF 3WLWC 4DW2L 2JJWA 2PO6C 3MLSH 4BZ1L 4W70A 4JJHA 1HEZB 5JUEH 1AI1L 1NDGB 1NMBH 1GGIH 4XNQB 2J6EA 4YIQB 4U1HB 5JR1H 1CXKA 1F6LL 4GW1B 3MCKB 5FK9A 1PYWA 3BJ91 3BD3A 4PTUA 4I18B 4NN6C 4P2OB 4ZO6A 5DYOB 2BSRB 5CEYA 1UWEL 4FQQA 4MJIE 5EU3A 4M1DH 4NNXA 3V7AE 3VXRE 4BUGA 4PJBF 2P43B 4XPGH 5D93C 3O6FB 4HKJB 3NTCH 2Z0BA 2Q3AA 1WZ1L 3REVA 3NH7H 1KN4L 1HKFA 3F7QA 5FYJL 1ND0A 4JVWA 1P84K 3NIDF 4LCUA 5KSBE 3VXPA 1VGEL 2ZUSA 5CBEA 1Z6JT 1JHLH 1YEJL 1YEDB 4EUPB 4MA1C 3HR6A 4GMTL 1FV1B 1B0GB 1BD2E 4I13B 4BFBD 5GS1B 1KJMA 5F7MC 4PJAE 4NQDA 4HFWB 1E28B 1SY6H 3JWOC 4ONHA 2AABL 3B9EA 5JIPA 4P5TA 3VFWA 5I1LB 4OJFL 4OM0H 4H1LG 4BQCA 3MODH 1BX2A 1FN4B 1BJ1H 4M6OL 3TPUA 3DVGA 1J1XL 1WUNT 4HMCA 5I6XB 1T21A 4G8GB 4JZJC 3MOBL 3DI2B 4LKXA 3WIFA 2VH5H 5K59E 2KZWA 2A77H 1J0KA 1QHPA 2J12B 5DMYA 5KSVB 5DEFA 3QG6B 1UACL 5HYJA 4ZUVB 3X13A 1J5OL 1T4KB 5CKAA 2VLJA 1JGDA 3PWPE 4HS6B 3L5WB 3J8F7 4XZUB 2VC2L 1INEL 4UU9B 1TITA 5DWUL 4KRPB 1B3JA 1WAAA 1LO3L 4PJGE 5TF1L 2UV3A 5E94B 4HX1A 4L3ED 5HHMB 3HRZB 4XPFH 5LGHL 4NKOB 3EO0A 5I9QC 1NEZG 1QTYT 5JOPE 5C7XL 5B22A 2OL3B 3QH3B 4IBLT 4LHUD 4YHKH 1F90H 2AK1H 3C6LA 1MJJB 3SDYL 3AAZB 1BLNB 2IFFL 1DEEA 4MA3A 4O02H 3BOVA 3ARDA 4RA3A 3O2VL 4LSPH 3F5WA 2J8UF 4NWTH 5EZIH 2APTA 3AU1A 5DC0A 3RPIB 1K9TA 3HI5H 1YMHB 5E2WL 2EO1A 4H0HB 1P69B 2VDNL 3T3PE 2CH8A 2AP2A 2NX5D 5ADPH 1N7ML 3TBTA 1S7QA 4X6DE 4YC2C 5ALCH 5DS8B 1V7ML 2D4DA 1BFVH 5FUCE 3RVTC 3RIAK 1X4XA 4J3VA 3VA2C 4OLXL 4IMLA 3HRZA 4GG8B 4HC1A 3CK0H 2BVQB 3LB6C 3QEGH 5GGTH 3VGFA 4EI6B 4KI5F 5CGYD 2NY4B 3OKDA 1MEXL 3PGCA 4QHLA 2Y06H 4GAJL 4K7PY 3TBTB 4HGMA 3CDFA 1YUHB 2ADGA 3TNNA 2DMKA 4X0KA 1M05B 3HMXL 4L8BB 2F53A 3S97C 3B9KD 5MEPA 1EMTH 3V5HA 3ZDZE 4V3DB 4MJIA 4EZMA 5C0BB 4U1IA 4LPUA 5IROA 2HKHL 4HUNB 3V2AR 4UT6H 3O0RH 4JKPH 4PJIE 1JHLL 1YEJH 1A9BB 3FOMB 4MNHA 4M5YH 4NBYB 1N3NB 5D6DC 3TZVA 4BSJA 3EZJB 4XCCH 3JWDH 3H42H 1IVLA 1PDKA 4I77L 3D69B 1NJ9A 4NKQB 5D1ZC 5FO8B 4HIXL 2ZNWA 1KIPA 2IFGA 5EUOF 3O4LE 3I75A 3MBXH 4ZXBD 4M7ZB 1I8KB 4Y2DC 2NYYC 1LE5A 1WC7B 8FABB 3QFJB 3QNZB 4NUGL 4XP6L 4Z78A 1SEBB 5C0EB 5L8LB 3RUGA 4JZOB 3AUVA 2DQCL 3DYMA 4QRPA 2YD4A 2XICA 3VFRB 4D9RD 4JZJA 4P2RB 4JDTL 2ADJB 5IHBA 4PJDE 4B0MM 1D5BB 4J12A 3WBDA 1LP9B 3Q5OA 1J9CT 5F1SA 1FRGH 2BERA 3UTQA 1BMGA 4M8QA 1UXSA 4RWHA 5E8DL 3X12A 2PTTB 1QA9B 3RUGF 4MXWL 1MLBB 1P7KB 3F7YA 3FMGL 3MRFB 1IM9D 4G5ZH 1C16B 1DZBA 4NCC2 1FL6B 1YEKL 4OCYL 2O5YL 1DBMH 2ATKA 2NX5A 3HG1B 4TUKL 5IIEA 4MB4A 2DQJL 4NRXA 3UTTA 3QQNA 2XKUA 2WUCL 4OB5L 1IGYB 2L7UA 5CD5C 1DANT 1YYLL 2YD3A 5BV7L 5KSAC 1JE6A 5I8EA 4J2XA 1R5VB 2WUBL 5EZOH 1OWRM 3DX8B 1F8TL 5D70H 1AY1H 1X5JA 3NOIA 4IRJD 3KNBA 4ELMB 3NMEA 4U33A 5C6WH 2YRLA 4MXQA 3MRMA 4LHQB 5DUPH 4WNQB 1R24A 2PXYB 2XY1A 3BPNC 3GNML 2DDQL 4X4MA 3CK0L 5GGTL 3LKOB 2WP3O 5K93A 4N8CH 1G7JA 5D7JB 3U1SL 3KNBB 4ELMA 1HQRA 1Y6KR 1EEYA 5C9JA 5E8EA 5BZDB 5F96H 5DMIH 2QBWA 3B3IA 3T0BA 1NGZB 2G9HA 4YHLH 4LDOB 1RUPH 1OTUD 1IGCL 1NMCB 4Q2ZA 1OSZB 3SKOA 4JN1H 1PJ9A 1GZPA 5J56B 2G75A 1XF5B 4KMQA 3SE4C 2OTPA 4RMQA 4ELMF 1T5XB 3GZKA 3HUJE 4K3HA 1GGBL 4F7MB 4NWUH 5FECB 3PWPD 5D6DA 4KKAD 1BVKA 3MV11 1JI1A 5LCVL 4KWUA 5EB9A 4I3RH 3WIHH 5IROC 4YHNA 1DDHA 1JK8A 1NCAH 5DZLA 5LAXB 2VZOA 4ZDHA 4OZGF 1Z0MA 4F3FB 2P5WB 4NHUB 3AFLA 2FIRT 3QUMH 4BQ9A 1IGJA 3QIUD 5E8NA 1F2QA 1R3HA 1IGIH 4HHAB 3MBXL 3DMMB 5CZKA 4OJFH 4HLJA 5E00A 3SY0B 5D7LE 1MNUL 4R2GC 3GHEL 2CXGA 3OJDA 4JGUA 4F7TB 3TFKA 5GS2D 4JFYA 4LQFL 5ITBL 1SEBA 1KTKE 4F80A 1VCAA 1UYWL 1JNNL 3IS1X 3M8OH 1SY6L 2JELH 5T3ZD 5I1GH 4PY7B 1A3QA 4JZNB 5JXEC 4UTAH 1KN2L 4Z95H 3B9AA 1FPTH 1Z5LA 4ERSL 5BJTB 5DSCB 4M6OH 1II4E 4W4NA 4AL8H 2AV1B 4PRHD 2E9JA 2GQHA 3MR9A 3BZEA 1I1YB 2EDTA 3BQUD 4UNTA 4CVXB 1Q9OB 1NEUA 2QKIA 5I1DB 5D7LA 1JPTH 3HC0B 2IJ0C 3S37L 4CU6A 4L3EE 3SGKC 1ZLVK 1AQKL 1RJYA 3CIQA 1C7TA 1YYLH 5EU6A 1E27B 3WDIA 1D5XB 3QJFA 3WD5H 1J05A 3X11B 3V5KA 3FN3A 3W2DH 4O02L 5D6CB 2IH3A 3BI9X 5JPMB 1LE5B 2AJYH 2NY7L 3V6OC 5LXGH 1J10A 5DUPL 3LS5L 4AEEA 2DQGL 2P5EA 4NQVB 1IC5L 3N0PB 3QJHA 1UCBH 3S34H 1F6AA 4JKKA 3O3AB 4YGVA 4N0CA 3KAAA 3U1SH 3SKOB 1LK2A 5B4MC 1AHWB 4TVPD 2YRZA 1IAOA 1RZKC 5ILTH 1BQHG 4MD0A 3FB7A 3QDJB 5DTFA 4ELME 1P4IL 4Z7VB 2VR4A 5E2WH 4AENB 4F2MB 2G9HB 3HC4H 3GSNB 4WUUA 5L2KB 1AP2B 4I9WD 2YUXA 4UT7L 1S5IH 2NR6D 1ZT4A 3ESVF 4TNWF 1DLFH 5HVGB 1KJ3H 5MEND 3T0EE 2OMBA 1GGBH 2X41A 3S35L 4BSWA 5DMKA 2B7DT 2QADC 1UZ6F 5F6HJ 3M17A 4QY8B 1GL4B 4LCWA 4PB9L 2PTVA 3ZT6A 3U0TB 1QSEE 4OFPA 4ZUUB 4GBXC 1BGXH 3IDIB 1JZ2A 1VA9A 3CVHL 4RMRA 1H8NA 2VWEC 4XCCL 3ZYJA 1FLTX 3CJJA 3ULVL 2FSEB 2XG4A 5ESQB 3T4AA 2FSEA 2IPTH 2BMKA 2XWTA 2NXZC 3HAEG 3MLXL 5TH2A 5IW1B 1DBBL 3HUJB 4QWWC 3D3VD 4PGZA 3O8XA 4N5UA 3WLWD 1A7NH 3BAEL 2VXTL 4DOHB 3P0GB 2A74B 4HJGB 3NIDE 1BJ1J 4J8RA 4Q58C 1EJOH 3EYVB 2DKSA 2I26N 3ILPB 4GUPB 5FFLA 1YJDH 2R69H 4I77H 4CDGC 3OKYA 3MV9A 4OLWL 4G7VL 4Z95L 4M7KL 1FZJA 1L0YA 3MNWA 1PY4A 2BNRE 3N1FC 3CSGA 3LZFH 4OKDA 1AIFB 4FFZL 1FRGL 4E41A 2QSCH 1KLGB 1B2WL 1U58B 4PRID 5C0DA 3IDUA 5E2UH 3ZDYF 1AGDB 3MUZ1 3WN5B 4BFEA 2Y9RT 3NPSB 4MVBA 12E8L 4XVSH 3K4AA 3ARPA 3MC0A 2NY3D 1KPVA 5AD0B 4QRRA 3D5OF 2WBJD 3W9DA 3NFNA 3EDKA 4Z18A 3VFVB 1R5WA 4KAQL 3AB0C 1YPZB 1FNGB 3HS0A 3RVTD 2X4UA 5H35B 3L95B 1JRHH 3WFHA 1JGUH 3MJ7B 5D70L 1LEGA 4G5ZL 5C0JA 3BPNB 4UQ3A 5I71C 4MA7L 3WXWH 2GTZB 3MRQB 1UQSB 2VN4A 3BEVB 5HJ3A 4N0RA 1TTFA 1JUFB 1BM3H 3HR5A 5T5FL 1YY8B 5F1IB 1GSMA 1OT1A 3B2UD 4DZ8A 5B8CB 4AEFA 3ZL4L 4MNGB 2DLEA 2ORBH 3ZT7A 2BCKA 1JTOA 3FOLB 2RR3A 4EDXB 4M9OA 4CVXA 5I1IH 1BVLB 4MQ7B 4ZS7H 4C55A 1T5WA 1EH9A 4EDWH 1ZLSH 1N5YL 1NUFA 1Y18B 5ICXB 2SEBA 3QXUA 3VXSD 3NCJH 2FWOA 2CUMA 3U7AA 2V7HB 3LAFA 4C56B 4UTBH 2DKMA 2YSSA 3I50H 1NBQA 4MAYB 3LKSA 3O6LH 2NXYD 1VFBA 4HQQH 3WJLC 2OTUA 2F15A 5SWZA 3SQOH 5MP6H 4PJAB 1JZ8A 5LGJA 2C1OA 2BY2A 1T1WB 3LB6D 3BIKB 4XVUC 4PRPB 4IRSC 4M1CD 1FIGL 4KRMB 1F2XK 1T83C 1NCTA 2EEDA 4XNUL 2ZG1A 4HPYH 4P9MH 2Y36H 2YD9A 4W81A 3BH9A 4JHWH 4D0DA 1UWXK 5HHQA 4IIQC 4X99B 3RNQB 3T3PF 5H2BA 1N2RA 3O81A 4A6YB 1QO3A 4NHCL 5T3XL 3S5LA 3E3QC 1HKLH 4C83B 3D9AL 1X7QB 3QUKB 3VD5A 3QZWB 3UZEA 4ZNCD 4ODUB 1FNAA 2DWEB 3GMNA 3GMMA 3D85D 3FRUA 5M95B 2IH1B 4MJID 1DBKH 5FV1L 3GMLB 1H3XA 4I8DA 5CUSL 4I3RL 3VD3A 3RTQB 5J1TC 3F65A 3QNXB 1FNHA 3QO0A 4M1GH 4HG4J 3EYSH 3FQTB 4LSRL 1F97A 3LKPB 1MHHB 2NZIA 1TJGH 4HIJA 4AEHL 5ETUA 3IJYB 4WJ5A 1RZGB 4H0IA 1UB5A 3IB4A 1VFAA 3JWDC 1A7BA 4F9LA 2Q8BL 3DTXB 1NANI 1RMFL 4H26A 1MRDH 5KS9B 2VLJB 3HE6D 4P46B 1UWXH 4ERSH 1AIFA 2ZCLL 3N9GH 1VB9A 2HMIC 5DLML 3QA3B 1BQHB 3WL9A 1A1NA 1HCFX 4MS8A 1UYWH 3OAYH 4XVSL 5D1XD 4NN7C 2Y07L 3RNQA 3V6FA 5E6YA 1GPOH 3C60B 4G7YH 3BESR 2QL1A 5CP3H 3D0VA 3C5SB 5GZND 2MHAB 32C2A 1TFHA 1KJ2B 2GJ6D 4WWKD 5CD3A 3GSXB 4HFWA 1A6WL 5C0AD 1MJUL 4AL8L 1GCFA 5IGXL 4Y4KD 1V7NL 3MV8D 1S78D 3KLHC 4I18C 3BD4A 1CBVL 1ZLUH 3ABZA 4OQ1A 4Z76B 1G1CA 4ZPVA 3RZCC 2J8UB 3CCHB 3LS5H 4LIQL 5KOMC 5CS7A 4OBRA 5C0RH 1MPAL 4LVNC 4QRSB 2K9UA 4JO1L 1UCBL 3TO4B 5M7QA 1J1PH 3HG1D 1ZHNB 4PJ5A 4DTGL 4WI4A 2HT2D 3LRSB 4WW2C 4YAQA 1IL1A 1YA5A 2B2XL 1DQTA 5FYLL 5JQ6L 2NTFB 4X4ZA 3VFSA 3DARA 1MHEB 4ZTPL 4ONFL 2BNQE 5GHWH 1LEKB 3IDJA 5KVMC 1I9IL 5F7YC 2KQNA 4N0UE 4JJ5A 4MNQE 3UJIH 1OY3B 4FQXB 2HJFA 4PTUB 1FORH 4ZPTB 3MJ8A 4LSSH 3MRMB 2X4SA 2X09A 1LNUB 5HYSB 4G9DB 3WFZA 4MNGE 1F4YL 2HRLA 5HYIA 4U1GB 2EICA 3S35H 2P1YA 5CJXA 3SDAB 1X9QA 5BS0E 1KPUA 1MIML 5F7HA 4FQXC 1MCOH 4OLUL 1HH9A 5FF6B 2VDPL 4MA8H 4U49A 1DQLL 1KCRL 5CCKL 3O2VH 3AU1B 5IOPA 5D2NB 3O4LB 3QUMB 1VACB 1OSZA 4WW2B 1KJ3L 5HGAA 5E6IB 4ZUSB 1NBVH 1BLNA 5H37H 4MD4A 4OLYH 2Z8VC 4H5SB 3TO4C 1CLYH 5IBLC 5DMJB 2ADIB 4GQ9L 1CE6B 4F33B 3HC3H 3BP6A 1NCDH 5ADPL 1IARB 1K2DB 2OJEA 1VSCA 4HF5H 5TE4H 4K3EL 1AGEB 1BVLA 1EAPA 3DUUB 3K4DA 4RISL 1MI5E 2YPKB 4X9FA 5CZVH 4PR5B 4XCNA 1KJ2L 4Z7WA 4PP2A 4EUPH 1V7MH 1TJGL 3OPZL 2VXQL 2VIRB 3TVMB 3TPUB 5D5ME 2AS5M 4KDWA 2PUQT 3MBEC 4JHAL 4NKDA 3ZKND 3BMWA 1A1NB 3K0WA 4MAUL 3IU4H 3Q6FA 3EGSB 2ZSVA 3VGHA 4QRQB 3L3IB 5KVDL 1LP9F 2GSGB 3EYFA 4PP2B 1I1AC 5BO1L 3N85L 2P8MB 2RIKA 2PCPB 1QLEL 3JUYA 4OGAC 2DLFH 1B2WH 4JDZA 3D2UD 1CR9H 3P4MA 1N3NA 5D93B 3TZVB 4Z7OE 1ZHLA 1T21B 3Q6FB 3QXDA 4Y4FC 3MRFA 2H2SD 1DCLA 1FG9C 2F58H 2NY0D 2VLME 3GBNL 5DJ0A 1X3DA 4JREC 3KG5A 3LY6A 2ZJSH 4JB9L 1A7QH 3G6AA 4ONHB 4Q9CA 2ZUYA 3F62A 4ODSH 3ALXA 3HA0A 1MJ7L 2MKWA 4XPFL 1EEUA 1X5HA 5GGTA 1WWCA 4XPAH 1G7HB 5GRVK 4PJHF 4LIQH 4FABH 2VDRH 3BZ4B 3OQ3B 4PJXB 4IRSA 1MPAH 5HDQL 3JVGC 3TPKA 2E7HA 4M7JH 1NC4B 1ZEAL 4RMSA 2DICA 3C09C 4DN3H 3FCTB 5C0CB 1MCHA 5E8OB 4E41D 3F8UB 5EPMA 1P4LB 4Q74A 4OZIF 5JHDA 3TJHA 4XWGH 2YN3A 4DQOL 1G7MA 3HI5L 4ZQKB 2A6IB 1FGVH 5DJAA 5AYQA 1G7LB 4TVPL 4ZNEE 3BQUB 1MSPA 3V4UH 3DWTA 2BJMH 5EWIL 1AJ7L 1TENA 3KDMB 1M7DB 2NY6D 5E2VH 2OL3L 1OAUL 4XMPL 1LNUA 1P2CB 4LHUG 3EO9L 1HHKB 4V1DD 5IB3A 1A7OH 3WE6A 2IBGA 5JA8B 1MCOL 3QCTH 5B8CA 1C5BL 3QIWB 3F5WB 1C5DB 4X4XA 4JO4L 5I16A 3ET9F 4JRXB 3UYRH 4ZFOA 1W0YT 2DWDB 3QXWA 5BS0D 4NQCB 1WFUA 3QXAA 5A2FA 2FEDD 3AVEA 1WWAX 4HUUB 1MCQA 1UM4L 4G9FE 4D9QE 5EU4A 2HKHH 2Q20A 4R8WH 3ULUL 3IJHA 3HC3L 5CGYC 1J8HD 3L5WA 1EAJA 3GMOA 5JTWA 3KHOA 2YUZA 4QRPD 1A4JB 4OGXL 4KMTH 3UTPD 1S3KH 5B3NA 5I2IB 1E4XI 1TQBC 1UZ6E 4O9HH 3H7BB 1ZANL 4K71C 3E8UL 3LIZH 4S10A 3QEUA 4KJWC 5EBLB 3TYFB 1Q72H 5ACMA 4CRPA 4JN2A 4MAUH 4QRTB 1S8DA 4AT6B 1I1FB 1XF2A 4GKNB 3RGHA 3V0WL 4AIZB 3E6HB 3NN8A 4HIXH 1Q94A 3HNVL 3EGSA 2O5ZH 1TCRB 3VFMB 4IRJB 1AE6L 5BO1H 1PKQB 4H8WL 1UVQA 1R3HB 3K8LA 1HXYB 3HUJF 3ARDD 3FFCA 4RGOH 3T0AA 3CNKA 1OAZL 2DQTH 2B4CH 3VW3H 4NYLA 1HOCB 1MCWW 5E7BA 5L0QB 1LHZA 4RGND 4PJEF 4IRJA 2V2WA 1LVEA 1OAYH 1KG0A 2WBWB 5ITFB 4Z78B 3QUXC 1NAMA 1RUKL 3U46B 3T2QA 4RBPK 3QB7C 2IPKB 3ZE0F 3RBSA 4XPAL 4ODVL 1OGAD 1CFQB 2VDRL 1A3LH 2CJUH 3EYOA 3G5YB 4OZHA 3MA7B 5CHNA 3KPNA 3WJLA 1I9RH 1O5DT 2GJJA 4E42A 2COQA 4OGZA 1WQVT 1CICC 3E6HA 3NN8B 2D4FA 5EBWB 4F8TA 2B39A 2FGZA 1YEEL 4X7FC 5DEFB 1CDCA 2Y1VA 3PP4H 4JPKL 3QDJE 3GM0A 5DJDB 4LLVA 4ZUWB 1I1AD 3CU7A 2HT4C 2LVEA 5CWSB 3RWJB 1QLRA 4R96B 1PG7L 1OLLA 3NZ8A 1PGRB 1N59A 3JVGA 3SE8H 3V4VL 4H88L 3TO2B 1U8NA 2HG5B 2P8PB 5CEZL 2C9AA 1OGAA 5TDNB 1JGLL 3PGFL 2X1WL 2OSLB 1K8IB 5C0CD 1A14L 5TDOB 3EOBA 2C7UA 5DJCB 2NY3C 4OFYA 4U1MA 1IFHH 3LHPH 1JP5A 5GRVL 3E3QE 2OI9A 4KUCF 5IFHL 1LGVA 5E5UB 4X5XB 1FFPA 5LWYL 1QSFA 2VDKL 1OM3L 2XFXB 3B4NA 5FYKE 5CD5D 5F96L 2NY4D 3V4PL 3FOLA 4GKOA 2H1PH 3C08L 4RAVB 2BNUB 4HT1H 5DHVB 2XN9A 1MAKA 3MUHL 1ERNA 1XMWA 5J1SC 3VJ6A 5I0ZA 1T80A 4NO3A 4BZ2L 3NBNA 4TNWK 1KPRA 2LAAA 4NZRL 2K7PA 4KROC 4G8GE 5T3XD 4PYHA 1FO0A 4GQ9H 1DBML 4OLUH 3KPQA 3VWKA 4NKMB 1FZKB 3BPOC 1X5XA 3RIFF 1RFDH 3QWQB 5MEOA 5IMOA 1M4KA 4MD0B 5E99H 1IMHC 3EO0B 3EBAA 5BV7H 3T09A 3ZDXE 4JG0L 3VFGH 4NP4H 3V5DA 2EZ0C 4NN6B 4XMKH 3PV7A 3OKMB 5FCSH 3S96A 3MGOA 1T5XA 4JZNA 4RISH 2VABA 3BWUC 4J6RL 4Z77A 5FO8A 1JNNH 4IOIA 3CUPB 1U0QA 5HYJE 1MVUA 1RK1B 4QGYA 4DN4L 3FQWA 4J1UA 4ODHH 1BAFL 5DZNA 3C5ZD 3ARGC 5F3BA 7FABH 1WZ1H 1BIHA 5A2LH 1XZ0B 3DMMA 3LRGA 3ZTJG 1G6RB 4ODTH 3P73B 2D7MA 5GXBB 5IVXE 2IBZY 1NGXA 3GSQA 1CL7I 1NFKA 2V2XB 3ARDC 4I5BB 1W8NA 4OAWB 1RIHL 3PABB 1U92A 4FXLA 3AS3A 1UG9A 2P48B 1LQSR 5ACLA 3MR9B 1F3JA 4JY6B 3LMJL 3T4AB 2VLRB 5EZLA 4JFFB 2P5WA 4NHUA 2X1OA 5F9OL 3BP4A 4NWUL 4U6YB 4QRPB 6CGTA 5IW6A 2GK0A 4PG2A 1PKQA 3VXSB 4AIXA 1T0MB 4ODSL 5K9JL 3IDGA 3V6ZA 3QRFM 4HUWA 1W0WA 4AZ8A 2EYTA 5IHZB 3SE3C 2RGSA 1HHIB 4NO5A 5EU5B 1RULH 1AHWA 4GLRI 2XN9D 1AKJD 3CC5A 1DQQB 1NUNB 4RQQB 1TVBB 2BVUA 2BJML 5EWIH 4DN3L 2QSCL 2Q7YB 5F7EH 4Q0XL 3C9NB 4YDVB 1DLHB 4Y19E 3MRCB 2XACC 5IQ9A 1IKFL 2ZSWB 3V4PH 4FP8L 5L7XH 4YDVA 2HVJB 4DQOH 5BV7B 2VC2H 1P4IH 1P4LA 4XCYB 5L2KD 1LP9A 2AJUL 4ZFGL 3FL7A 3QDME 4LEXL 4PGBB 3TBVA 3TIDB 4ZAKB 3ME0A 4KQ4H 1OTSD 3BYTA 1JV5B 4QOKE 4G8GD 1JWUB 5E2VL 5FOBA 4K2UH 3C9NA 4PD4J 4MXVF 3PWVA 1FZMA 1FL3B 4HEME 4KY1L 4KDTA 3QDHA 5GGRB 3T0EC 1YJDC 1MI5A 1ZXQA 4NN7B 5HYSG 1J8KA 4S1DD 4PJFE 4EI5B 1H8SA 4PFEA 3MV7B 4KPHL 1OCWH 2ED7A 3HPLA 5LVEA 1CIUA 2FO4B 3MGTA 4PS4H 5T5FH 2CMRL 3OB8A 3NCYP 1LO2H 2J1KA 4HULB 1S9YA 1VFUA 2H3NB 4P23A 3ULVH 4EUPG 2FHCA 4NP4L 1DVFA 1TZGH 3H9SE 3NACH 3WFBH 5ICXA 4LSUH 3ZT5A 4AM0A 4OUOA 4EDWL 1N7MH 4WCYL 5EDXA 1D5XA 3QJFB 2NY7H 4ZSOB 3OJVC 5JNYA 5DURB 3AC0A 3TH3T 3MRBA 3SE9L 5D1QD 5ANMA 2BNRD 2Q8AH 2XTLA 4R3SB 4EBQH 4RNRB 3U4EA 1OSPL 2PXYC 4TPRL 2YZ1A 4NT6B 5TPWL 4HCRL 3B9KC 4HUVB 1KLUB 4WFHE 1OAZH 2WBJA 2ZOLB 1CFVH 4XBGA 4CDHA 4YR6B 4NKDB 4YE4H 3MNVA 1QVOB 1MF2L 2AXGB 4NQEB 2H6PA 3H9HA 4CU8A 4WRLA 3GSOA 1RUKH 2AXJA 1TCRA 4LVNB 2A6DB 4DW2H 1WTLA 2W91A 2O93L 2A6DA 2XA8H 4X9IA 3IDIA 4KHTH 5ADOL 3TFKD 4LPVA 2GAZB 3LD8B 5AYUL 4MYWB 5FYJH 4LRNL 2VL5B 5BVPH 4FQ1H 1T04B 4JAMA 5D7SL 1JHTA 3K4ZA 1D5MA 4XNXH 1U8QA 4HZLA 1IQWL 2EC9T 1S7VB 4WVRA 4AH2B 3GK8L 5AEAA 1HILA 4F3FA 3E0GA 3CGTA 4KAQH 4MNQB 3ROOB 4MS8D 1V5JA 2WINB 3JV0A 4ZFZA 2OR9H 1I7TA 1RPQA 1CE1H 3QQ9C 5C0FA 4XTRC 5SX5K 3IVKA 3MRRB 1VGEH 2ZCLH 3N9GL 3HI1B 2VLRE 3UTSE 5CLTA 4GRLD 1DE4B 1YEEH 5BS0B 1W72H 1IKFH 1M7IB 3WS3A 5L2JB 3CH8A 2IALB 1TTUA 1RU9L 3FB5A 1U8JA 4UDTB 4G6JL 3LKNB 1B4JL 1T2JA 2DMBA 1AGCB 1N4XL 5I74C 4L8DB 3U36B 4JPIA 4LDEB 2UZXB 2G2RB 2JCCE 3RQ3A 3RVXC 4EIZC 1S7SA 2LTQB 3RL2B 4KJYA 4KVNH 4HGWB 2O5YH 5ABDE 1MI5B 4ZFOL 1OCWL 4EN3A 5F1IA 1HE7A 1BBJB 2XZAH 2VKWA 4PS4L 4LLUA 2VB5A 4ORGB 2APBA 1UJ3C 3RWGB 5F70A 3QI9C 1ZHNA 2OZ4H 3DIFA 2BY3A 3REWA 5DC4B 4UNVA 3MJ7A 2QQLL 5E1AA 1MHPL 2H26A 1L9NA 5DWUH 3LSOB 1JYWA 2PO6D 2OTWB 1YC7A 1WV7T 4UB0H 4RMTA 3CFEA 5AUMB 2WK2A 3L3GB 2VWEE 3MACH 5JW4R 1A2YB 2HFTA 2PYEB 43C9A 4LKCB 5IR1B 4HWEL 4ISVB 2CD0A 4IOSD 4K07A 4LCCA 3S4SA 3Q0HA 5EG6C 1GGYA 1D9KA 3FO9B 5IB2A 1Z0NA 1DQML 5DD3H 2IQAA 1JNHB 3ECBB 4D8PB 5EOTB 1FNSH 5T1KD 2IF7A 1OAQH 1XF3A 1QVOA 5ENWA 1IGCH 1IAII 1U6AL 4NQVA 4IJ3B 5E2TH 3OKOB 5ISZD 4NQSB 1R3KB 5IFAL 1NH6A 4DOHE 1FYTD 3MLRL 3WHE1 2VO5A 3KLSA 5DJYA 3MRPB 5J1AA 1NAML 4P5TB 3NAAH 2DI8A 5HY9A 2NNAB 2J8OA 1WVZA 1R3LA 1E4KA 2NY5L 2FDBP 5ENWB 4NUJB 3O6FD 3QUMA 5LCVH 2GJ6B 4XCNB 1QQDB 4WU5B 1RJLB 4N0YH 4K3EH 2NR6C 5F89B 4KK6C 3GHBH 5HHOA 4GAJH 4GKSA 3BQUC 3LEXA 4MQSB 2NY4C 3V6OE 2FX7L 3LEYL 5IVOA 3D87B 4F7PB 5DHXB 4R4FL 3ZKMD 3DTXA 5EIQA 3RY4A 3K2UL 3N1QC 3DRTA 4J3SA 5F44A 3X13B 5CIPH 1EO5A 4O58L 4Q6IB 1JF6A 5EC2A 5IW1A 1JF5A 1JF1A 4FXKB 5GSVA 1XCTA 3GFUA 1IQDA 4W4OC 1ND0B 1N64L 3BSZL 4B41A 1MI5D 5CEYB 1N6QL 3T04D 1Q38A 3RX7A 5CEZD 4XMLL 1QFPA 5DI8A 4XI5C 1OP3H 1LEKA 2HTLC 1GZQB 4OI9A 1YEGH 4JFHE 2WIMA 1MIEL 4HGWA 3INUL 2GW5A 5C3TA 5MEQB 5ERWB 4GT7A 4HAFA 3PHOA 1QSEB 1ACYL 4M48L 4I48B 1BBJA 1E4XH 2C1PA 3QEHB 4CAGA 5JHLH 4LLWA 4AEHH 4KV5F 5I76B 3NABL 3GI8L 5IM7A 4LSTH 4LLQA 4TN9A 1A7QL 3G5XB 1G9NC 4EUPA 4BKLB 4JFED 2WW8A 2PNDA 4N68A 3TM6A 4OQTH 4AQ1B 2FL5A 1KXTB 3C8DA 4GS7B 1A5FH 1P4BL 4Y4FB 4N1CA 2GTZA 3S37H 1E6OL 5I8OL 1F4YH 5IBLD 1M7IA 2XN9E 3WS3B 4WEBH 3CSPA 3TC9A 1CGYA 4YDIH 1FJ1B 3ARWA 2BSTA 4KVCL 5HHMD 5IIEB 2BSED 5I19H 5D72L 1U8KB 3SPVB 4MA8L 1INQB 4CMMB 3T1WA 2ARJB 2Y7QB 4X6EB 3DXAA 4KQ4L 2FBJH 2CMRH 3IDJB 1CDIA 2IH3B 5GRJH 2YEZA 1VEOA 1R3IH 4WHCA 5AZ2H 3U0PA 3QEQB 3CLFL 1AY1L 5IB5B 5KSAA 1NBZB 1T4KA 3TH2T 1PEZA 1BWWA 2IEPA 4RAUB 1F13A 3HMWH 4H1LB 2EYRB 4LRIA 2GFBB 2Z91B 3RIFK 2YXFA 1OB1B 4X8XA 4XMPH 1KPVB 1CG9A 5DD3L 5T3ZH 1OD7A 4OCSH 1FFOA 1UXWB 3LKOA 2XQBL 5ILTL 2DQUH 3GNMH 2Z8SA 3BRGC 5B38G 5IJKA 1FH5L 5I8KL 4P4KB 3G9AB 3RWDA 3D18A 3DXAD 4KJPC 5HVFB 1CVRA 1ZWIA 4OD2A 4YHIB 3P4MB 5JXEA 1Q9WA 3TV3H 2AV7B 1FV1A 5HHOB 2OJZL 1SYSA 3D69A 2Q8AL 1YMME 4TULL 4PB9H 4XRCA 4WV1A 3LN9A 4LMQE 5C92A 1OP5H 2ZOKA 4F57H 3L5XH 1INDH 1CFQA 2XY2A 2R15A 3RVVD 3MJ9A 1CFVL 3G04B 1CDGA 2BNQA 2X4TA 4C54A 5CEXB 1JI2A 4NSKA 3DVNA 4YHLL 2EYRA 4BH7A 2AK4E 1RAMA 5EIVA 4IMKA 1MFNA 1XGYL 5FYKH 4G43A 1CZ8H 1TJHH 1FC2D 2HTKC 5FXCH 5GRXG 3S5LB 3TNMA 4C83A 5CCKH 4MSWA 1DBBH 2Q6WA 5GS1A 5GGVL 5BW7C 1JNHA 1OTTC 2FJGB 2H2PC 2X4OB 2D03H 4U3HA 4CN6A 3BRFA 2P4AB 1SHMA 4P3DA 5E6IC 3GHEH 5GRYA 4N9GA 4J8RB 1XGUB 4PRIA 3QWOB 4M61A 2NPLX 2DJ4A 4HG4K 3FO2A 4KQ3L 1MCLA 1UFUA 1WFTA 4FOMA 5C0AB 3BH8A 4HKJA 2FLRT 3FQUA 4ZXBB 3SDAD 1ZAGA 2XKSA 5HDBE 5C0AA 1JYVA 3M8OL 4GRWE 2EDWA 1VFOA 3UJJH 5F9JA 5FM5M 1JPGB 4TVPH 1DUYA 4PRAB 3CH1A 3G5XA 1MNUH 4NRZA 2IAMA 4Z7OF 2XWJA 4NZUL 3HZKB 5HI5C 1OF2A 4YX2L 4PBVC 1U8MB 3JBG7 2EDXA 2Q7YA 4I2XA 4KTDH 2VLRD 4GG6E 3IRPX 1P9MA 4DZBA 1SJXA 1CDJA 1EO7A 4AEIL 2PR4H 1CR9L 1N4XH 1IJ9A 1F6FB 3X3GH 5J13C 3MJ6A 4YAQB 1TLKA 1XCTB 3MLUL 1ZGLP 4XPBL 2I9TB 4HX1B 4RFEB 1QUNA 1I8MB 2JCCA 4UB0L 5BRZA 4K55A 4ZUVA 1P2CA 4QNPF 4Z7QF 3EZ8A 4B5EA 2VLJE 4LGRB 1M7DA 2BZDA 1JPGA 1MRFL 1B4RA 1GRWA 2CRYA 2YBRA 4GJTB 5E6ZA 2UWEA 1ES0A 3X17A 3N06B 5I1IL 3DLQR 4G8GA 1J5OH 1ZLSL 2CRMA 5CIPA 3RHWF 1N5YH 1ED3A 1EIBA 4LLDA 3GJFH 4HV8A 3TV3L 1RUMH 3BPLC 1FIEA 4Q6YA 4MS8C 2M1KA 3ILQD 5EUOB 4A6YH 1GYAA 4KROB 1MVUB 1RK1A 3HC4L 3ARVA 1M71B 3MRIB 3O6LL 5F3HB 4HW6A 3RWEA 1AI1H 2DQTL 5TFSL 3FJTA 4P2CG 4JFFE 5IK3B 3CVHB 4OCRL 1HHGB 2ZOKB 2J8UE 2DQEH 1FHGA 1QBBA 4YUEH 4HV8B 3QBTB 3CDGB 3JZ7A 4IOIB 4XNUH 3RDTB 3O2DA 4GKNA 4M1DL 4N0CD 5E2TL 4ONGL 1KIRA 4TOYL 4CU7A 1SJHB 4TNVF 4OGAD 3UYOD 1MREH 4U3XA 1J7VR 1KB5B 3SKMB 3BP4B 3NH7L 4XP9H 2ICWI 4G80B 1HHHB 1BWMA 4HPOH 2W65A 3IU3B 4O58H 5HGGS 4JLRB 1UVQB 1MAML 1EEZA 2QADD 2V2XA 3RVXD 3K8KA 4U1HA 2YUWA 2VZ3A 4NC1E 3EYSL 3FQNB 1I4FA 5ID1A 1Q94B 2VITB 1BVKB 5JXAL 1B6UA 2LABA 4UBDC 2BVPA 5FCUL 5BW7A 4KDTC 5LQBH 3I6GA 3OG4B 4OV5A 3VXNA 1QNZL 4BZYA 3QG7L 1WBZA 4Z8FH 3J7HA 1K5NB 1E4XL 4HK3N 1AGEA 5C2UB 1JF1B 1M7XA 4UINH 3BAEH 1SYVA 4OF6A 4HFUH 2HLAB 3UJTL 1OF2B 2UY6A 3WJJC 4LSDA 3QISA 4GXUN 2BNUA 5C6TL 1E6OH 4TSAH 4HMDA 3WIIL 4GRLB 1I8MA 4LNRB 3R8BB 4WEBL 2D7QA 2ICWJ 4UMGA 2GSIA 4PJAF 3LMJH 5GGQL 1Y0LA 1G9MC 2APFA 4NQCD 3FO0H 2PXYA 2F5AH 4M02A 5MERA 1V3MA 4EIGB 3FQXB 1T7VA 3FONA 3N50A 5C0ND 4NC2B 3B6SA 1RSFA 4HC1H 2ZUXA 2FL5B 1DEEB 4ODVH 1C16A 5DK3A 4O2CA 4U1SA 1I9EA 4HLZH 1UQSA 4Q7DA 1SEQH 1BECA 2YD7A 1ORQB 3I6LD 3L3JB 4P2YA 3G9VA 3DV6A 3ZDXF 2DYPD 2FEEI 2V5TA 3H9ZA 4R0LB 1RJYB 4GRMB 5C07D 3QQ3B 3G5YA 1XGPB 3S4SG 4NNPH 5KW9H 3DRQA 2X4RB 4ZQKA 4RSVA 1RIUL 3N1GC 2DQUL 3OKKA 4NWTL 5EZIL 1WFOA 3KYKL 5AZ2L 4KKNA 3D85B 4QF1A 5L0QC 4PLKD 3ARUA 2ENSA 3HE7B 5JPMA 5DQJB 5C0EA 3UBXI 1R5VA 4POUB 1CD0A 4K23H 2CR3A 2B8OT 3FRPA 4UZGA 2PYFA 2FIKA 1WBXA 3Q5TA 3RAJL 1G84A 4MWFA 4O2FB 5T3ZL 3IFOA 1EFXD 2IG2L 3DRQB 3O3DA 3G5ZB 1BFVL 3EJYD 3V6BR 2R23A 2VXVH 5HVHB 2EIZA 3VWKB 1FVCB 1IFHL 1U8PB 2MCG1 1W72A 5C86A 1FNFA 1A64A 4ODHL 2VISA 1N0XH 4HS8H 4N1HB 3ARFA 4LLYB 4ZUTA 2Y4SA 4CN4A 3HMXH 5HD8C 3LKQA 4JG1H 3NCJL 1N5AB 3ARBA 2BFVL 4WI2A 4X80H 3PNWA 4YHML 3WEXB 4JHWL 1CVSC 4UTBL 3CFJB 3ERYA 1CZ8L 1ES0B 2AJSH 1MCKA 3C6SB 3RY6A 5LAXA 5C0BA 2UWEE 4F57L 1S7TB 4PBXA 1MFBH 5C9KA 4FXGB 1RY7B 3MUJA 3VFTA 2EKJA 2A73B 1UC6A 2L4OA 3GBMH 3HLAA 3DBXA 2R0ZL 3U0TA 1E0OB 2AJZB 3KLAA 4QCIA 5F9DC 3T77A 4L5FL 3OKLA 5F89A 3KWWA 1UKTA 1LDPH 5DXWA 5HI5D 4Y5VC 4KQ3H 1HDMB 4OGYH 2EXYC 4NNXB 1KULA 2IALA 4PTTB 5GGSY 2NTSP 4ZDHB 4XPTL 2BNQD 4ZG1A 3NCCB 3BZDA 3KPLB 1GJIA 1Q0YL 1IC4L 5IWLA 1KIUA 1JTTA 1OL0A 1QLEH 2G60H 4NN5B 1C5CH 1CS6A 1MLCA 4OZIE 4MDIA 5MERB 3UMTA 4KROD 4OSUL 2DYPB 2APVA 4X4YB 2Q76A 2AAVA 1YEHL 1U3HA 4S0UC 2DJSA 2PW2A 1QSZA 2XPGB 5E5MA 2BRQA 3O6KH 4HEPG 4HZAA 1G0XA 2PYEE 5DRXA 4KUZH 4OZFH 4YHOL 5DQ9B 4MXQD 4PYGA 2OS7A 3FQXA 3BVNA 5B21A 1HZHH 3IETB 1QFWM 4R97B 2P8LA 1RVFL 4K8RH 3T65B 5SWSA 3OKLB 1L8JA 1HHIA 1G7PA 4I0CC 4ODTL 4KJYB 1P7KA 4L3CA 5I8EB 3SCMB 1F4XH 1PKQE 2LU3A 3EJJX 4J23A 3LQZA 5FYJU 1HI6A 4NQUA 1UCTA 2GSIB 1WBZB 4F7EB 4X5XA 5CZXC 4NRXB 4P2RE 5D5MA 5ITBH 4LP4A 3OJMB 4UIKL 5IBUB 4JY4A 1V7NH 4XHQA 4K94L 4GG6A 5DK0A 1FP5A 1U8NB 3MJ9L 1U92B 4R3SA 1T1ZB 2BHZA 4GSDL 2B2XH 2PTTA 5FUZL 2QR0A 3SEPA 3QNZA 2OR8A 4WGWB 4X4YA 1NDMB 4RGNB 1CLOH 1EXUB 4Y4HB 4N0FB 4QXTB 4LNVA 5DJDA 2R2EB 4O4YH 1YEIL 4F58L 1DN2A 3NFNB 4AM0B 1P7HL 4Q9QL 2XG5A 4D9QD 5CP7B 2YBRB 2VLLB 2XZAL 1N0XL 1WTGT 2X4UB 5FUCC 4RMUA 2DQFB 5B39G 3VXUB 4NOFA 4NQXA 3A67H 4U0QB 5DMIL 3G6DH 4G6MH 2R0WH 4P4KA 1MIMH 5GJTH 5DQJA 4YHMH 3BDXA 1XGQA 2VABB 4UV7L 3F7PC 5AZEL 1CFTA 1RJLA 3RTQA 1XGQB 1A1MB 4MJ6A 4KH2A 2JIXB 4H1LH 2AJZA 4I0PB 3RU8H 2HVKB 4N1EA 2ZCHH 5GGSB 1HN1A 4K2UL 3ZYIA 2X89D 3VFNB 1ZT4B 2UUDK 4OGXH 4HJJH 5C8JA 3C60C 4XNZB 3LSOA 3CAFA 3RVWC 3VWKC 3E1F1 5KN5B 4S0SD 4R90H 5DTFB 3PXJA 3P3YA 4R4BB 3WIHL 3CXHK 4L4JA 4V1DE 1LDPL 1A1MA 1KGCE 4MJ6B 4YBHA 3X14A 5M94B 2ICWA 1UZ8B 2A2QT 1QFUH 4BH8A 3OPZH 3QZWG 3MLWL 5IKCA 2VL5A 2NLJA 2EEAA 3BH9B 4D0DB 5HHQB 5SV4A 2WMPA 4UV4H 1CE1L 1GIGL 5CILH 4Z0XA 2ICCA 5JOFB 3IU4L 2LQRA 1IGTB 3MRJB 1JWMB 1U8PA 3SE4A 2R9HC 1FQ9C 3DSFH 3OF6A 3VDBA 2EDQA 1NCDL 3Q6GH 4MB5A 3O3BB 3DROB 2ZCKL 4DGIH 1WLHA 4OZGB 3BKML 3BXNB 3ZE2F 3V6ZB 2IC2A 1DVFB 1J86A 4Y2DB 1RHHA 4U6HA 3NCYS 2HWZH 1S7SB 2NY5H 3VD4A 3MLVH 1B4JH 3PWLB 2DJUA 1GGTA 1F4AA 1S7UB 2XWBB 1LO4H 4LEOA 5E9DD 4UOW1 3TBSA 4PJDA 2DLHA 1ZVYA 2VMFA 4RAHA 4YDKH 2H2PD 5FM8A 4K3DL 4KKBD 5HGBA 3U0WH 2AXFA 3U4EB 3L1OH 5DQ9A 1QACA 3QHZH 4MHHG 2EDLA 3RA7L 4MD5B 1I9RL 3HAEH 3JV4B 4YDLB 5CMAB 4WFHD 3KPOA 2UZYB 1K6QH 1AQKH 1JL8A 4E9LA 4TYUA 4LSQL 2CUIA 2IADA 3D3VB 4KC3B 1HYSC 5GGQH 4OF0A 4M7JL 2ITCA 2QQLH 3Q3GA 1TMCA 3TO4A 2DM3A 5DFTA 5ICYB 2EDYA 2R8SH 4DUXA 3F7VB 4QLRA 2DQHL 4UQ2B 3D39E 4FFYH 3MV7A 3CFBA 3HTLX 2DIAA 4PV9A 1ACYH 1N0LA 4W6YB 5AD0A 4U1KB 1A14H 3NABH 5ECJE 1DBAH 3CC5B 3IDXL 4DK3A 5IB4A 5FKPB 3E3QA 4EQ2A 4L3EB 3C8HA 5J6GB 1EHAA 1AJ7H 5LWYH 2X4SB 2Y23A 3TH4T 3RAJH 3GMQA 1H15A 1JN6B 5HBBA 3LOWA 3RJDA 3EO9H 1FNSL 3FT4A 5H37G 4MGXA 1QPPA 3BZFA 2ZUQB 1QSED 4MHHI 4P57B 1A1OA 4PJ8A 3TBYA 4L3EA 3UTZB 4LLDB 3V4UL 2FBJL 4C57C 5EOTA 1ZLVH 1UM5L 2PYFB 1JPFA 1HQ4B 5FYKD 1J1OH 5IHUH 4UIMB 5C7XH 1EK3A 1TQBB 1RZGA 2UY7A 5GZOD 4MAYA 4M7LT 5FB8A 3G6JB 1NGQH 3QUKA 2AI0L 3CVHH 4Z7VE 3MLWH 3BGFB 3P11L 4M6MH 4TVPE 5FKAB 2YHGA 1XGRA 1G9NH 3B83A 3MNVB 3RWDB 3GMMB 4AMKH 1AXIB 4QT5B 2VNCA 4YJZL 1JZ5A 2A0LC 1CG9B 3ZKXB 4OD2B 2F5BL 1CTOA 5D96C 1UA6L 3O6MH 5F7LB 4HXAH 1N2RB 2NZ9D 2O5ZL 4BSWB 3B9KB 3LVEA 1RJZB 3ZYZA 5F21B 1CYGA 3QEGL 2YPKA 3KR3H 3WNPA 1T1XA 4XNQA 3WUWG 3R06B 1MFEL 2XWJB 1I8LC 5MP6L 2Y06L 3U9PL 5F7DB 3NFSH 4IMKC 1CCZA 4PLJC 5E8PB 5EC2B 1ADQH 2FX9H 4JR9L 5IMMB 2R1XA 4L29B 4PRBA 3MV8E 2D7NA 1VPOL 5BXFB 2P49B 3G5VB 5FA4B 3MRRA 3IFNL 1SBSH 4HD9A 3GSUB 4HIHA 5DUMH 2IWGA 5E0QA 5BS0A 4LFHD 3FN0L 2ZWLT 3EW3B 5BRZB 3QUYA 1HH6A 3RKDD 5A3IC 5EZLB 1CFNA 4L8SC 3OR6B 2LV4A 3C5ZB 3ARBC 4RGNC 1RD6A 1WJ3A 2DQHH 3EYQC 5DEGA 2KPNA 3LPFA 4ETYA 1T0MA 3RY5A 3PDOA 3P4LA 5JXED 2VRAA 1I3RA 1ROWA 1A3LL 2KBGA 3QDAA 3QH3A 4FNLL 4YDJB 5I1JL 3TF7C 1OHQA 4OZ4A 3QULB 4JE4B 2P24A 1D5IH 1F02I 5IB4B 3O9WC 4I0PD 2RJMA 3GIVA 4GBXA 5I1DA 1WZMA 2E7LA 2I24N 3QCUL 5CJQH 3MLZH 1H0DA 3HKFA 5E8PA 1KEGH 2LVCA 3O11B 3GGWA 4X7TA 1X5LA 1G7IA 3UPCA 4XMLH 2NW3B 3CU1A 4P3CL 3VRLE 1RURH 4LEXH 1NBYA 2Z93A 3UPRA 4WHYH 1NCNA 2F74B 1KFAH 1T89C 1ZE3C 2PKDA 3VI4E 3FB8A 5DVMA 3RVUD 4G6ML 3L3GA 2P47B 1T2QH 4EQ3A 3G6JA 4NM8H 5KJRH 4UV7H 4MJ5A 1MH5B 1KJ2A 1S5HA 1C12B 3NCMA 4OKVA 5CD3B 1AC0A 2JB5L 4NZDA 4YXHH 4X0KB 3TIEA 2B1HL 2QSTA 3DX7A 4W6WB 4PGEB 2Q6WB 4PPTA 1EFXA 5EO1B 3HS0B 4I3SL 2DAVA 1D6EA 3K7UA 5KG9A 1C1EH 2ARJQ 4YHKL 1A9EA 1S9YB 3S36L 3CVIL 4V2BA 3QUZB 2VYRE 1F3DJ 1TJHL 2RBLA 1EGJA 2FWOB 1QFUL 4NHCH 4XNYH 2ZCHL 5C1MB 5F6HI 4X7TB 5TQ0L 2P5EE 4L4VB 1ZSDB 4UIMA 3O4LA 5GHWL 3OXSA 3UBXG 4TSCH 3H0TB 3QFJD 5HGAB 4JRYE 4FG6C 4NZRH 3BEWA 4R90L 1BF2A 3L3HA 2ZUUA 1A4KB 4M4PA 5EBGA 4N8CL 1QBAA 3GMLA 1NGPL 4APQB 4M93C 1AD0A 4YO0B 5EBMB 3U9PH 1C8PA 3G5VA 1ZWIB 2GUOB 4YHIA 1JWSA 5J8OA 2AJ3A 2CKBH 4KKLD 4OLXH 1VKXB 4AK1A 4QOKA 5IR1A 5IBTL 5JW5B 2EXWD 1EO8H 5CILL 4BM7A 1A4JA 1WICA 4WENB 4KHXL 3MV7D 1QO3B 2BDNL 3IFLH 1U91B 3W0WA 3ARSA 1A6VH 5F1NA 1LK3L 4QKXB 1K5NA 5JIHA 2A9ML 1AD0B 4YO0A 1GVIA 5EBMA 3MOAL 5JDSB 4IDJL 2Y25A 2WLYA 5CBAA 2C1PB 4YBLB 4FQ1L 2FB4H 1OGAB 3WJJA 3MRDB 4JCMA 4X7CC 3FQNA 1TXKA 1J8HA 3HZKA 3H0TA 3TBSB 3V8CA 2BY0A 4RX4D 5DJ0B 1ZHLB 2J8UA 3CCHA 1E4WH 4JLRA 5FCUH 4FNLH 5I1JH 5MI0C 4Y8AA 1CGSH 4OD3L 1F4WL 2ZKHL 3U6RB 4YHYB 4GW5B 1VFMA 2G5RA 4UDUA 1K4CB 3OX8A 1BJ8A 1RIHH 3HCVA 3GRWL 1UGNA 5DMGD 4WTZA 1K8IA 1MLBA 1W0VB 5EO0B 3TA3A 2GEEA 2P44B 4QRUA 1FL6A 4J4PA 2JELL 5F1NB 2R2HA 3HZYA 4J3XA 4PRAA 1I3GH 3BKYH 3RI5K 3AREC 2P5WE 4NHUE 3P4NA 1JNJA 3QUZC 4R96A 5GQBA 4JQXC 2E7LC 3SGKA 2MCPL 3CSBA 2VDLL 2F54B 4OTXL 3T0XA 3WHXA 1FO0L 1T7YA 5IESL 1OW0A 1RZIB 4HKZB 3EAKA 3WIHA 3QFDA 1OD9A 4UAOC 3OKEB 3QI9D 4QRRE 4XP5H 1VERA 3O9WB 4PJDF 4IS6A 5GGUB 2A38A 1YN7B 4M7ZC 4UU9A 5HSFA 4KDVA 1H3TA 2WWKO 3OKMA 1MCCA 4LPYA 1L6ZA 5DDHA 3S36H 4F7CA 4TOYH 2JJTC 4PJHE 1ADQA 2XXCB 5DZOA 4CGTA 3AGVA 2EDNA 2YD8A 1JBJA 5D1ZB 1ZHKA 3OBAA 3L3DA 3RFZC 3K46A 1I1AA 3MLUH 5L2KA 4C56D 3G04A 4OLYL 1WBYA 2ZUQC 5EUOA 1DEDA 3EOAB 5GGSA 4NO3B 5D9SB 3D25A 3I2CH 3IJHB 1S9KC 1C5DA 4LLAA 5CZVL 3DETC 4JQVC 3DXAB 4LCYA 3PIQA 1PY9A 4P4KD 4KRNA 1KCGC 4PJAA 4DKFH 3OWEA 3S36X 4EBQL 4MJIB 3HE7C 3O3EA 1DQJA 3T8XB 1EUUA 5GS2H 1IRAY 2DM7A 5HHVL 3PGCB 1RZJC 4QHLB 5KSAB 5JA9A 3WNKA 1L7TH 4JN2B 3ZO0A 4LSVH 3BN9C 2EIZB 4L4VA 5IEKB 4NFBA 3STLA 4LCIH 5C08D 2X2YA 2VXUL 4HIEB 5D4QA 3SKJH 3L3IA 5DD0L 5LKNA 3REVB 4O5LH 4WFFE 2CKNA 1PQZA 3M07A 3QEQE 3DOSA 3WN5C 5JMRA 4GAGH 3MRDA 2HH0H 2DOCA 1U8IB 2F19H 4YZFF 1KB5H 1QA9A 35C8L 3OG6B 2IAND 4AIOA 1OGTB 3VRJA 1U9KA 4IRSB 2XPGA 3EHBC 2W65B 3CMOH 3IU3A 2UZIL 3VRJB 4RGNE 3QAZC 1T3FB 1G1YA 1NCAL 1A4KA 3FCTA 3BGMB 1Z5LB 5BJTA 1NDGA 1SEQL 2P8LB 1OGAE 5DJXA 4WIQA 1UM6H 3JV6A 1SBBA 5DEZA 4BK4A 5I15H 4EN3D 5T3ZE 3VXUE 3ARFD 4UOW0 3PWPB 4YBQC 5DFVD 1RIUH 1Y0LB 4XCFL 1VESA 3GKWL 2NXZB 3UZVB 4D3CH 2X4PA 3UDWA 1AGCA 4YWGL 4IS6B 1IAKA 1QRNA 4FQHA 4OQTL 3Q48A 5F6IC 3RZCA 1MUJA 4LVOB 1J0JA 3QEQD 2J5LB 3MGAA 2PW1A 1A5FL 1P4BH 4JDZB 1FPTL 2OL3H 4P9HC 4JQVA 3DGGA 3OHXB 3B6SB 3MFGB 4LKXB 3WIFB 3IAPA 5MEOB 4DGYH 1DSFH 4QXTA 2EXYD 3W0WE 5C71A 4WTZG 1LD9B 4P2RA 1CQYA 5K9KA 2R2EA 2HVKA 4QNPE 4HUXB 4JFQB 1WBYB 3MUGA 1A7RL 3RGVB 3UYRL 1KELH 4O2EA 1XF5A 2BFVH 3TZVD 4QOKD 2E6PA 4GO6B 3FB8B 4YHZL 4I4WB 5KANI 4K94H 3OAZH 4E5XA 4F7EA 3QEQA 5CJ5A 2DTSA 3RWIB 2WY3A 1WBXB 1PZ5A 2PYEA 43C9B 3T2PA 2B0SH 5CEZH 3FAXA 5BZDA 3P30L 4ENEC 4DVRH 4F9LC 1JGLH 3PGFH 5GGUA 3CX5J 2AGJL 3P0YL 5IMLB 1T20A 1NAKL 2VUOA 2NXYC 3DVIA 4YNYB 4Y4KC 1BF8A 2HFEA 3GJFK 1FH5H 2CR6A 3RKDC 1A6ZA 1YMMD 3HE7A 3M17B 4QY8A 4LCWE 3CVIH 3P2TA 5IMOB 2QQNH 4JM2F 1W72B 5TDOA 1U95A 4PJ7A 1OQOA 7CGTA 4K8RC 5FYLE 1SQ2N 1KCSH 5D1XC 2VE6A 2OQJA 3TBWB 1IC4H 2DYPA 4HT1L 5F3HA 4E0RA 4WUUE 1AXSB 1KT2A 4G80A 1ZGLM 4PD4K 3ZSSA 3SJVB 5HPOA 2W07A 4N5EC 3MRBB 4JM2A 1BQLL 5IEHB 3IKCB 2D7OA 4N8VG 3D39B 1U6AH 5C70A 2CSPA 5CINH 4Y16C 1FDLH 1TQCB 5IMLA 3V0VB 3WO4B 1AO7B 5T1LB 3VXMD 3DHJA 4HS8L 4PTTA 3WN5A 4F15C 3S8WA 3QIWC 5HXMA 1HKLL 5E99L 1YNTA 4M43H 4V1DA 1WSST 2A9MH 3RWHA 3TCLB 3HLAB 2GTWB 3UX9B 3MFFA 4IM8A 5DUBA 1G7JB 5EUOE 1DQJB 5C9JB 4XB8A 1W0WB 4HUWB 3KVQA 4KTEH 5E70A 5KZCB 4PGDA 1J1XH 1S9XB 1HOCA 1W8OA 4JFDE 4AQOA 4L4TB 1DE4A 2VXTH 5FOBB 4FZ8L 2A77L 3VRIA 2X5PA 2VLRA 4XAKD 3P73A 3K2UH 3EOBB 1RHFA 4HJ0D 3INUH 4GSDH 1YY8A 1ZHBA 5DD1L 1QYGL 3VFWB 2Y5TA 3MODL 1SJEA 1A6AA 3FKUS 3EYVA 2HVJA 2HG5A 2P8PA 2VDLH 2VLJD 2FECI 4OTXH 5JHLL 2HLAA 5DSCA 1XR9B 1N6QH 3RA7H 1B0RA 1S7RB 2ITDA 4HWBH 4F37K 3PHQA 3B9DA 4Q97A 3HI1A 3LQAH 3U30C 2IBBA 3I3DA 1MIEH 4DK6A 3D2UA 3D3VA 3O2DH 3GGWB 5EUKA 1KELL 2WNGA 3WV0A 4M48H 2C4FU 1LO5A 2BC4B 3RPKA 5I19L 3KPOB 1GHFH 3FT4B 3BE1L 3KPNB 4G8FA 3OAYK 2E6QA 3QNYB 4HKZA 4PBWD 4MNQD 3TBYB 5K9JH 4FQLL 3U0PB 4R4BA 5EOQL 5AUMA 3VRIB 2GY7B 5A2KH 4HJJL 4M3KB 2RHEA 3ZMRA 3BFOA 2NY5C 4O2FA 3GSNA 5HDOA 1F90L 1UB6B 2AK1L 4WEUD 4PB0L 2DI9A 2FEDC 4GAYB 5D72H 3O6FC 1RFDL 3RZCB 1U8OA 4Q0XH 1ZLUK 5D2NC 2OTUB 1OP9A 3MMEA 3QHFH 1DN0A 2DBLH 4QHMA 5EOCJ 5KVEL 1HH9B 1CLCA 5FF6A 1KOAA 3LCYA 3KPPA 2VDMH 2I25N 1NC2D 5A16A 3NZHH 4Y4FD 4CW1B 3IDNA 3UBXB 5IKCB 3REWB 3S7GA 2FATL 3VG9B 5I17A 4JRWA 4OT1H 4PY8J 3IJSB 1EMTL 1X7QA 1WAAF 4LCWB 4Z7VF 2R4SH 2C4FT 1CD9B 1A7PH 3M45A 4AG4H 2GCYB 3MCKA 2DQDL 2EDOA 1T1XB 8CGTA 1I7UB 4M00A 3G6DL 3BN9D 3X3FH 4WNQA 2VXUH 1JGEB 3SJVE 4QHNB 5SWZB 4MB3A 4PJDB 4RFOL 2IANE 5BMFL 1FO0B 3DROA 4G59A 3FB5B 3PP3K 5HGBB 1LP9E 2BMKB 1XF4B 4GAGL 2Z9TA 3E2HC 4U6HB 3IDGB 2HH0L 2OP4H 1IILE 1KJ2H 2NY1B 3TFKC 1KB5L 3D39A 2NLJB 4PRNA 1FVEA 4TRPL 4WO4A 3PDDA 4V2CB 5JMOC 1TZIB 1WCBA 5C09B 5I17B 3VXNB 1YEFL 4KK5D 1EZVX 5F9WC 1Q9KA 4HXBL 5ANME 4N8VA 3R06A 4U7KA 1A6TA 3N85H 4L3AA 1FNEA 1QG3A 4X4ME 4Y1AA 1J05B 5JDJA 1UZ8A 3QA3A 4P57A 3BZ4A 4PJXA 4LBEA 1TVBA 2WIIA 5DLMH 2EDEA 3UTZA 4PJBE 3FMGH 5HPMB 5JW3H 4QRPE 4D9LL 1KIQA 4ZFFA 5D1XA 3QDGD 2V5SA 3CPLA 3GBNH 4OKVB 3OAZK 2YWYA 4JDTH 2Y07H 2EDRA 4P46A 4CL7A 4YWGH 4N8VB 3FO0L 3DURB 1CIDA 3RHWK 3DX7B 3X3GL 3VDCA 1Z3GH 2VQUA 3UTTD 1TETH 3H8NA 3BP7B 4XVTH 3U0WL 1QBML 1IM9A 5FO9A 5FKPA 4LL9A 2MMXA 4DGYL 1Q9OA 4NGHH 1F3JB 5TE7H 2NXYB 2OTWA 5D71H 4JFEB 5LBSL 3H2WA 1ZEAH 5E1HB 4PB0H 5GSRA 5L6YL 4NKIH 2ADFH 5K9OB 1JFQL 1IC7H 2HJKA 5ESVA 4X98A 4W4OA 3MGTB 1GGUA 1A6AB 1WIPA 3V5KB 1S9VB 4F9PA 3RGVA 1S9WB 2CLRB 4Y19A 4G6KH 2D31A 1HHJB 3DUUA 3I6KA 1H0DB 4ZFOB 2H9GA 1HSAA 4JQIH 3QR2A 1IZJA 3T2OA 2W9EH 3CFIC 1A21A 3N1MC 4K71B 4H1LA 4C56A 4NDMA 4AYFA 2G5BB 5J57B 3QNYA 2EZ0D 4JANA 2FECL 2OJEB 1MWAB 1PD6A 3TCXA 1BBDH 3MXWL 3VXTB 5BQ7A 3MZTA 4JG1L 3IXTA 3L5HA 4GRWH 1RUML 4A6YL 1I1FA 3KYMA 1YYMH 5BOZG 3IFPA 3OMZA 1RQ5A 2XZZA 2FH6A 3EOTL 2DD8L 4OZGE 1FVEB 3WO3B 1HIMH 5DGRA 5DGQA 1IGTA 3MROB 3MRJA 5D2LE 4PGCA 3VCLB 1U8OB 3U7WL 2GIYA 5C08B 4PJIA 4EOWL 3BUYB 2IGFH 3WUZA 1TZHA 5C08A 5ACZB 1EEZB 3IAQA 3DV4A 4WW1A 1QSFE 3GJEA 4KTEL 5EU7E 3AB0B 2WSKA 2F54E 1U93B 2HKFL 4DKDC 3NIGE 3SDDA 1NGQL 3B43A 2DM2A 4YHPA 2IQ9H 3P11H 4M6ML 1EUTA 3VFNA 3BH8B 5HI4D 4HH9B 3BP5A 3ARGD 1D9KB 1G9NL 4GW4B 1M1SA 1NFDF 4MXQC 4NZTL 5DA0B 2Z92B 2EH8L 4JM4H 4O00A 5B39A 2QV2A 5HHNB 2JJTA 3IFLL 1XIWA 4G6AD 5EN2A 3THML 4LFHG 1IT9H 3IGAB 4TSBL 4MA1B 5F71A 5D7KE 2B4CL 5GSVB 5HI3C 3VW3L 5DRWA 4P23C 4FRWA 2MFNA 4XVJH 1FE8H 1NCBL 3SDCA 2X9XA 1L9MA 3BKCL 5JORA 3IS0X 3LQAL 3DRTB 1I7ZA 4JRYD 4QRQA 4FQ2H 4Z8FL 1Z3GL 5I73C 1YQVL 2N56A 3E6FB 3FTGB 4I0PC 3MBED 4PY7A 5DD6B 3R1GL 2X40A 1LO0L 2N7BA 1EHXA 1TIUA 2EYSB 2P24B 4Y19D 1UXWA 4GKZA 3NFPB 4NC1C 3D0LA 2ZKHH 5LG1A 1MJ7H 3DXAE 1I7ZB 4RWYH 4WWKB 4WEMB 4DEPB 4TSAL 1KIQB 4RBPH 4HBCL 1MQ8A 3LDBC 4P9HH 1BD2A 1H15B 2OXHA 2P5ED 4UIKH 5KS9A 3WDHA 5EU7C 3S34L 2VLKA 4UDUB 4PJGA 4ZUSA 4PLOB 2H2SC 2X4RA 1A6TB 3V4VH 2JB6B 4PJ8C 4F33A 4GXUM 4TQEH 5TGBA 3FO9A 5LXGL 4QTIH 4JKMA 1GOHA 5C0NC 4JPVL 3OKEA 3DYOA 4ZFFB 4QRTA 1ZKAA 4ZYKB 5B38A 5I75C 3NZHL 2GFBA 2Z91A 3LHPL 4HLZG 4RAUA 3EDEA 1FVDA 1KXQE 1RK0B 4KGLA 3G6JF 1KPRB 1KTDB 3MLZL 1AD9B 3QIUC 4U1IB 3AAZA 5GJTL 1A7PL 3KXFB 5MHSE 1HQRB 1ED3B 1HEZA 3KPSD 3PP3H 3EOTH 4K8RD 1FL5B 4ZO7A 4U05A 4FFVD 2RB8A 1A6VL 4S1QH 2WLZA 1I3VA 3WO4C 3I9GL 2AJVL 2I07B 4CADB 4X80L 4OF8A 5I66A 4XT1C 1IEBA 3C8KA 3BP6B 2DQIL 2JB6A 3FAWA 4RFOH 5BMFH 5E95B 4KI5C 4OUUB 5E9DE 3SJVD 2Q86A 2BVYA 2FEEL 1YZZA 4PJ9A 1CXHA 4HUUA 3VFUB 1PKOA 3HE6C 3T77B 1JPST 4YFLF 3NA9L 2YA0A 5JW4Q 2E7CA 1CGSL 4MDJA 1NLBL 1PG7X 5IMKA 2XXMB 1TNNA 3VXMB 5IEKA 1KNOA 1GZQA 2AJSL 5IBUG 2PTUA 3ZZ1A 3L7EA 5JDSA 3K80A 3L9RB 3W0WB 4Z7NF 1RJZA 2NNAA 1D5BA 1YPZE 3MX0A 1EJOL 2HT3C 1VKXA 3LKRA 4TUOB 1D7FA 1UXSB 3K1DA 3BKYL 4U6XA 4NYLB 2JJSC 2W0PA 5E2UL 3RZWA 3ULVC 2AV7A 2EIDA 4GS7C 1Q9LA 5IFJA 4JPWL 4GXVL 4F7PA 5JR1L 2BXZA 3L1OL 5J12C 1XH3B 12E8H 5KANG 5KSAD 2GJZB 3GRWA 5TF1H 3RX5A 2ARWA 2P8MA 5B39B 3UTTB 4LCUB 4ESKA 1XGYH 4U1GC 5FYKL 1JIBA 5B4MD 3VXPB 3DX9A 3IRZA 1TETL 4KJWD 4QTHB 4XP5L 4HS6A 1B6DA 4KZEH 3PWJA 4E41B 3T3ME 4IRZL 1JPSL 5GJSH 1KG0B 4OSUH 3MRGA 3EUUA 5F8RC 5TGBB 4AJ0A 4DZBB 2Y6SC 3ARQA 5I15L 1JYXA 1A3RL 1PZ5B 2APXA 4MSWB 3DV6B 2HAZA 3ULSB 1NBZA 1M71A 3MRIA 2YKLL 4KUZL 4YHOH 5D96B 4JM2C 1FN4A 3LN4B 5F8QC 1UKSA 1ZA6B 3CLFH 1SMAA 1JGUL 3PIQB 3R4DA 2IPUK 4NRYA 1W0VA 5EO0A 3FONB 3LPGA 3RUGB 2C26A 4NO0A 4KK8D 2XN9B 2ICEB 3V6FB 3TYFA 3C5JA 5J6GA 4AT6A 2HFGL 1MCSA 4MWFB 3FQRB 5I1LA 2R2CA 3MOBH 4HDIB 2J88H 3UO1L 5EA0H 2F53B 3N1PC 4X7EC 2PW1B 4YFEA 4KTDL 1UH2A 2GI7A 2Z93B 3A6BL 3FT2B 3UROR 5IB3B 4LIQE 2DQFA 4XCEA 5T1MA 5C0IB 3AROA 5DDHB 1JZ4A 2PR4L 5DJCA 3EFDL 5DVKA 2BSSB 5EOCH 3KDMA 2HT3D 1AR1D 5D2NA 5E8EB 2MCPH 2F53D 5CZXD 1QP1A 2KQMA 4Z7WB 4CKVX 3QXAB 5LJYH 2X05A 5HVHC 3O0RL 1OAKH 4F58H 4MZ3A 4L4TE 3C8KB 4W6XB 5JHDB 1R0AL 4MZ2A 3D25B 5MEPB 5IEHA 2CLVB 2GTWA 3QDGE 2CDGA 1EBPA 4U0RC 3ZHKA 4QEGA 4XTRD 1JWSB 3ORJA 2VTFA 3OKDB 5FIEA 3O8XD 1ZA3A 2F5BH 4B50A 1V8HA 2CKBA 5HHOE 4FQIH 1H3GA 3L3KA 4WDIB 4JFXA 1HHHA 2W60B 4U2YA 1IEBB 3EO1A 2M26A 4Y4KB 3TWCH 4KRPD 4C4KO 3TA3D 3RRQA 1VEPA 1RMFH 4B53A 3T0DA 2NY3B 3SDXF 3FT3A 3O3BA 2CIIB 4TPRH 4UOJA 3TESA 4FFVC 1DBKL 2GAZA 3I2CL 5EU5A 1KC5H 1MFDH 4PRNB 4YE4L 2F8VA 4OLVH 3WCYA 5DVOA 3TO4D 2DTML 4LHUB 1A6PA 4Y5VA 5HDBF 2XKNB 3U48A 4G43B 1JMZA 5JZ7C 3VGBA 3O4OC 3SDXE 3RGVC 3S37X 1WITA 2FD6H 3CXHJ 4TSBH 1G7QB 2JLLA 3MYJB 4PREA 1MHCA 4XP9L 1IC1A 4G8FB 2BNQB 4QWWD 3O9WD 2MPAL 3LKRB 4TUOA 3GJFB 3TO2A 3K81A 3HZVB 3TA3B 2NY1C 2DQJH 3QXDB 3BHBB 1K6QL 3VD7A 1J12A 2IAMC 5D7IB 1PX3A 4M5YL 5FGBA 1RZ8A 3Q1SL 3VWJB 3SCMD 5DD6A 4NCC1 4MX7A 4EVNA 3PE9A 4Y1AD 1DP0A 3GIZL 4UQ2A 1I3UA 1A6UL 5F9WB 2YUVA 3VH8G 4CNIA 2R8SL 4Z5RB 1A0QH 1BZQK 3IETA 2ESVD 4O2EB 3KLDA 1W72L 4PP1C 3KPPB 1I9IH 1NAKH 1DR9A 4X4XB 2FZ3B 3QXVA 4QHKI 1U3ZA 3NPZB 1BZ9B 4JVUA 1I7RA 1WT5A 5J6HB 2ZUTA 1ORQA 5JO5B 2XZQH 3BT2L 5C6PB 2ESVB 2LTQC 4LVEA 4JRXE 1MY7A 3OXRB 3BZFB 4NQCE 3L5JA 1INQA 2CDEA 4UAOB 5E5RB 3GKWH 4QTIL 4XCYA 2GITA 4L3CB 3RUGE 4LK4A 3ZTJH 4D3CL 2IANB 1T6WA 1MRCH 1U3HD 1FZKA 2AJUH 3BQUA 4L8CB 4NOBA 4P4RA 4WO4C 3QQ4B 4X6CA 4HIIA 2V17H 3EDJA 4Y5YA 1BOGB 4XXCC 5AG8A 2AJVH 2FHBA 1OPGH 2F53E 2M8XA 3VJ6B 3HPJB 4PJ7F 4PV8B 5EZJB 1F6AB 5F7WC 3MXVH 1VFBB 2DQIH 1A6ZB 4IRJC 5C09E 2CO6B 3CSYA 4LLMA 4JFXB 1T1YB 1VADA 1WF5A 1GAFL 4OFIA 4JFHD 5EBLA 3GBLA 3DX6B 3CD4A 3FO1B 1ZK9A 2D3VA 2OM5A 3KXFA 4S1QL 5KSUB 4NNPL 5KW9L 5FO7B 5HHXL 2VE6B 4ZAKC 3L3JA 1K4DB 3STZA 1OTUC 1I7RB 2P45B 4LF3B 3QYCA 1WK0A 4NQSA 3BX7C 5SV3A 1ZVHA 3AMKA 4OCWL 2XRAL 3L5IA 2FH8A 4PJBB 3SN6N 2W9DH 1CGVA 1HDMA 1RZ7H 4Y16D 3K3QA 4BFIB 2W9LA 2VAAB 2MQ3A 5D7JA 1WEJL 2D7TH 1BHGA 2VXQH 5L88L 4XNMA 2AEWA 1PLGH 2VXVL 4X5WB 4JFDD 1AP2A 2X4TB 3U83A 1MFEH 4J3OC 1KCUL 3E2HA 1A47A 2WBKA 4Y5XB 5ISZB 1L7IH 5EBWA 5D2LA 5FDYA 2CLZB 4JFFA 4QGTA 4Z7NE 4P4KC 2ZJSL 4HFUL 2A73A 2Z31D 4HWBL 1YNTB 3GO1L 2MPAH 3GMRA 3QSKB 1DVFC 1EBAA 4G3YH 5FA4A 1BOYA 3SDAC 4OAWA 4U6TA 2E9IA 3VWJA 5J9PA 1P7QD 2X4PB 5C2BH 1URLA 1BEYL 5DRWB 1NPUA 4XI5D 5C0DB 3WEXA 5C0JB 3V5DB 3UTQB 1DTUA 2P7TA 3LEYH 2R0ZH 3TT1H 4OZIA 3OHXA 1A3RH 5HDLA 4PP1D 3H9SA 4GQPH 4TRPH 1IGJB 2R0KH 1P7QB 3E6FA 5D7SH 2F5AL 4JDVB 2C5DC 5ESVB 1IQWH 3WLBB 5J6HA 4Y5XC 4KZEL 1YNLH 1TQCC 1FBIH 2QHRL 3BJLA 2G2RA 4FABL 3NFPA 5CJOH 1A8JH 1N64H 3BSZH 1O7SA 4OZFB 1IC5H 3O2WH 4X5LA 1I8KA 1HI6B 1U58A 3MV9E 2QKIB 2OCFD 3CXDH 4PJCB 2DIBA 4NQDE 5I0DA 3NCBB 1KTRL 3GMQB 4R0LA 1FZMB 5IT2H 3LS4H 2HA1A 1EEQA 3LKSB 4HK0B 3OKKB 4OCXL 5CP7A 1FYTB 4LMQI 1RZIA 2I9TA 1B88A 1EERB 5C08E 1B9ZA 1MOEA 2YPVH 2QR0B 3P0VH 2ZSWA 3KS0H 1RVFH 4K8RL 2UYLA 1QR1A 2VLKD 5GRWA 4JCLA 3OGCB 1ZTXL 4R8WL 5E6ID 1YN6B 3VGEA 4LLUB 1AFVH 3LDBB 3QPXL 2JB5H 3OGCA 1JPTL 3PF2A 4NJ9L 1JFQH 4JFZL 2VSCA 4DZ8B 2YD2A 3QIWA 4PJBA 1RZJL 3GI9L 4PJCF 2DLTA 3LIZL 1NGWB 2YD6A 1AGFB 4PRIE 5DK2B 2E27L 3CFKB 1HHJA 4WUUB 1D9KC 1WZLA 1K4DA 3STZB 4Y2DA 2IPTL 4QT5A 3KPMB 3RWIA 4GH7B 3VH8B 1WGOA 4NM4L 1OARL 1R0AH 2AXGA 3MACL 1MFBL 4NQEA 3IJSA 2WWMD 5EOQH 2HMID 4PV8A 1BFTA 2FX8L 1XR8A 2FR4B 1JZ6A 5CSZB 4HUVA 3KPRA 3ROOA 1JWUA 2BXYA 5I1HL 2ICWB 1JPFB 2VIRA 4V3EB 1MFDL 4F15B 4P2QD 4ZSOA 5JNYB 4IIQB 5TDPB 1U36A 1YN6A 5IVXB 2GHWB 4TTDD 1P6AB 4IJ3C 5IQ7H 1QZ1A 4RGMB 4G3YL 4N8PA 1LE9B 3SJVA 4KHXH 2CUHA 2AKRB 2X1QA 4JGMA 2H8PB 3SDDD 2D7PA 5TF0A 4U7SA 4OCMC 1XIWC 3U7WH 1Z9MA 1KJVA 5EU6E 1KN4H 3ARGA 4IDJH 4LDLB 3VMPA 3JTSA 3VXSE 4Z9KB 4LAQH 1G0YR 3BGAA 4K7PL 5INDA 2NXZD 4QO1A 4OD1L 5E4EC 2EE3A 2VDQH 3PWLA 3PP4L 4JPKH 4P2QA 4ODUA 5DO2D 1OQXA 3WLBA 4X9BA 5IV2A 1UWGL 4FXGA 4UI2A 2EC9U 5T33H 3BGMA 3UTSA 1QQDA 4WU5A 3KYNA 4OD3H 1QRND 4OZFA 2ZOLA 4YFLI 4LBEB 4NKIL 1E6JH 4Y1AE 25C8L 5FHBH 4ZD3L 1ORSA 1G9ML 4Y7MA 3ZL4H 1MH5A 3P40A 2AEIT 4XVJL 3DSNA 1GXEA 5DD5L 4P2OD 1XFPA 5D1XB 4YXLH 2HWZL 2VQ1B 3PQYE 4HHAA 3GDBA 4XHJD 5C0BD 2YSSB 3ARZA 1ZT1A 2ADJA 4PUBL 4HWUA 5TE6L 4BQBA 1D9KD 4DAGL 3UPRB 3QIWD 4DFHA 2X89A 5JOEA 1KEML 4K3DH 1G9EA 1CK0H 3OB0K 4OF3A 1MRCL 1FCGA 2J6EL 4U0RB 3PWVB 1F5WA 3SCMA 3UEZA 1PBYA 4HQQL 1T7ZA 4FFZH 4P5KA 2XZQL 3BT2H 4NJ9H 4PG9A 1OM3H 2IPUG 1A7RH 3MYZA 1YECH 5AWNH 3V6OA 3QULA 4P9HL 4GRWB 1NCCL 1CXFA 3UBXA 4KK8C 2E27H 4OIBA 1I8LA 4JFDB 3SDDC 1EFQA 4L9LB 1TZHB 1BFSA 4RIRA 3V7MA 3QPQD 1TVHB 5ICZB 2BSRA 5JW5A 1JFMA 3MXVL 1KLFA 5DR5H 5FA3B 3H7LA 4IRSD 3ZHDA 1Q1JH 1F3RB 1KNOB 4YC2B 1T0NB 1JNLL 3KPRB 1J0ZA 3L3HB 4XP1H 3NVQA 1WEJH 2D7TL 4PGEA 1NL0H 4LSPL 4OCSL 4JANB 1S7XB 1ONQB 4P5KB 3VDAA 3IXTB 5J06A 5GRZA 5DQDL 2XRAH 1OTSC 2ATPA 1MEXH 3THMH 2HJLA 3MJGX 3GSRA 4PJ9D 5FHAH 4EJ1C 3HE6A 5DRZB 1BQLH 1CICB 4R7NB 5ALBL 3S3JA 1IBGL 3SKJL 5I71B 3EYFB 1GGCH 4ZOEA 3B9KA 2DQEL 4LLWB 5I76A 1T5WB 2F54D 3BD5A 1FFNB 3QO1B 5I9QB 3T1FA 1PW3A 1NFDA 3QI9A 4ONGH 3PV6B 1FNEB 1L7TL 2CK0L 3QAZB 4FG6D 4WWKA 3KPSB 5F88A 5IGXH 3QHZL 1NFDE 1UEMA 5HYQB 5JORB 4KJPD 3VXUD 3C5SA 1E28A 3ULSA 1XZ0A 2UZIH 4O5LL 4OBSA 3UTSB 4FXKA 2DD8H 4FN0A 1MAMH 4LASL 3VXRB 1YY9D 5J9PB 4XHJC 1ZVSB 4QOKB 4X6EA 4KJQD 5FDWB 4KI5D 2LU4A 4S11A 5JIKA 2D03L 1NQBA 3QFJA 3BP5B 3LH2H 3ARRA 5A3ID 5F7EL 4D0CB 2BVEA 3QG7H 5FYLH 2MOVA 4PY8I 4XVUD 2F8XC 4S1RL 4DUWA 5GIRB 2N7AA 4R4NC 4YDJA 5D8JL 1FBIL 2QHRH 4H0GA 2VN7A 3WHE0 3CFBB 3WKNA 1I3RB 4P48A 4OFVA 4UINL 5FDWA 4Y1AB 3UJIL 4JHBA 5T1KA 1OOAA 3S88H 1ADQL 2FX9L 4JR9H 4LSSL 2FGWL 4RMVA 1U93A 3WKMH 1EDQA 4PLNC