3BUYA

Mhc-i in complex with peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Epitope-specific TCRbeta repertoire diversity imparts no functional advantage on the CD8+ T cell response to cognate viral peptides
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3buyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3buyA01
2W65A 3ULUE 2LTQC 3GGWA 3BZEA 4FQQA 3QRGH 1KTKE 1A7QH 3GMOB 4JCLA 1Q72L 4NP4L 1S5IH 1HN1A 2AK4B 4DZ8B 2H32A 5GZOD 5EUKA 2ZUXA 5IR1B 2RAMA 5F7EH 2APFA 1RK1B 1TFHA 1JNNH 4R96B 5D7LD 1FNHA 5JHDD 2B5IB 4PJFE 3ZTJG 1CIUA 5D93B 4HAGA 1EGJH 3LPWA 2EIZB 5FYJD 5L8KB 15C8L 5DT1H 1MRFL 1QBLH 1VACA 3QH3B 4UQ2B 2C3WA 3LEYH 1KNOA 1SYSA 1CGSH 1A6UH 4Y16A 1NC2A 4ZO7A 3BGMA 3SDDB 1CD8A 2VZVA 5J06A 3P30H 4PS4H 4LVHC 4KRLB 5JPNB 3ZTJH 1RK0B 1I8MA 1N0XL 4MMZC 4KK8D 1IKNC 4F8QA 2RGSA 4QLRA 5EDXA 4UQ3A 1ZEAL 3RWCB 4PJ9B 4NJ9H 5I8CA 1R5VB 1UWXH 1KIRB 3LN5A 1MEXH 3AY4C 2H9GB 1FFNA 3TJHA 3MV01 3TF7C 1K4CA 4ZOEA 3UBXG 4FFYH 3SBWC 2QQKL 1W0WA 1UXWB 4X7SH 4GW4A 4NZUH 4QOKA 1U58B 5C8JB 5HDQL 5BZDB 5T3ZH 1CE1L 2VWEC 3BN3B 3BHBA 4EEEA 3PP3K 2QEJA 4FABL 5GRWA 4GMTL 3L5XL 4JZJC 1QRKA 5JDSB 4E0RB 4OF6A 1X7QA 4C83B 1QSVA 3SOBH 4QGYA 4HUXB 3KVQA 3RPIB 1LDPH 4RQQA 1MIEL 1MJJB 1T6WA 3O4LB 4KHXL 4FZEH 3BE1L 4K55A 3B9AA 1HWGB 3VXRA 3GSUA 3IKCA 3TA3C 1BZQK 2PW1A 1N6UA 4H1LG 1ED3B 2Z93A 1JUFA 3IRPX 5I0ZA 1GRWA 1F3RB 1L7TH 3HUJA 3CVIH 3H8NA 5D7SH 3TO2B 1CFSA 4M43L 1PW3A 1CXFA 3DSFL 5L2JA 5L2KD 1P7KA 4OLXH 4QRSA 4P2OD 3RWEB 2VLJA 3NCJL 2KQMA 4X4ME 2H32H 1QFHA 4H1LH 4EIZC 5D7KE 4KK5C 4E5XA 1QQDB 1K9TA 4KKAD 4ODHH 2KQNA 5DJ0B 4NNPH 1I1YA 1A8JH 4F15C 3S6CA 1GYAA 4ODTH 4MGXA 2WIMA 3RBGA 1T66C 4ODWA 3P77A 4PUBL 2X4TA 2X1QA 1CLYH 4YNYB 2CDFB 4LCUA 1P7HL 1I8LA 3JV4A 4MNGB 1CIDA 5T3XD 4JN1L 3NA9H 1MCKA 3D87B 2YXFA 4OI9A 4ONFL 2Y6SD 4X7EC 4AG4L 1WEJL 3OQ3B 4GFTB 5E6YA 1A6AB 1HXMB 3ARYA 5BV7L 3VFOB 5GS3A 4XAWL 2RR3A 5ITFB 1J0KA 1PG7W 4KMQA 5JXEA 3PWVB 4IDLA 1GZQB 3H9HB 2A77L 4JO4L 2HKFL 1I4FA 3I50L 4RSVA 4JO2L 3RNKA 5I1IL 2G2RB 2IBZY 35C8H 1DANU 3QXDB 1BFVH 3QIUD 4Y16C 3HMXA 2YD2A 4O02H 1JHLH 5C0IB 4KUZL 1QEWB 3X11B 3U4AA 2NQCA 4O58H 2FX8L 1AXTL 5HHOE 3GKWH 1EIBA 2FLRT 2L7JA 2YPKB 2NPLX 5EU4A 3P0YH 3BW9A 5ABDE 3KPNB 4L8DA 1P7QA 1R24B 1QLRA 1OD7A 5HHPB 1EO8L 4ZO9A 4X98B 3EOYG 1KCVL 1AY1L 4RWHA 3MJ8A 1A64A 4S0UC 1OAZH 1VFAA 3SKNA 3LIZH 4N8PA 4PP1C 4M6NL 2IJ0C 2EDYA 2FIRT 4LPYA 5TGBB 2XPGB 4F9PA 3RP1A 4F7TA 4OKDA 4HIIB 5HDBE 1D6VH 2AKRA 2GJZB 5DVNA 2GY5A 2CSPA 4GG8A 4GKSB 5GSVB 3A6BL 2WLZA 1C5CL 2BY1A 4JJHA 1LEKB 1V7MH 1A1MB 3P9LB 1P1ZB 3QCTH 4LHJB 4MQ7B 5IQ7H 5AG8A 4MJ2A 3OGOE 2GT9A 3AB0C 2ITCA 1JBJA 5F96H 3D39B 5EU5B 2IANE 3WUZA 4FQ2H 2DAVA 4NN7C 4HJGB 4YHOL 4LEOA 3VFGL 1J1OL 1G7LA 5GGRA 4OLUH 2FYYA 5E2WH 1S9VB 5DQDL 4ONGL 5GS0C 1MIMH 3D25A 2IMMA 4FQLL 1GHFH 3QWRA 4ODSH 4K8RD 4C4KO 4JPKH 5MENA 1AJ7H 4YZFE 3B9KA 1NGZA 3QDHA 1BIHA 4WU7B 2JJWA 3QRFM 5C0ND 4JPWL 3W9EA 4KMTH 4S1RL 4V1DD 4PJ5B 4JZOA 1EEYB 5HGHB 4S1QH 4BFBD 5BJTA 5DD5H 2HRPH 4JQIH 5F9JA 1CFTB 5FV2A 4UV7H 5CJOH 2GK2A 5EIQA 5E1HB 2FATL 3WDHA 3D1MC 1F3JA 3VFWA 2HTKC 1SEBA 2B2XL 4I4WB 4JKMA 3B9EA 3K1DA 4QNPE 1EJOL 4JFYA 3IETA 4JG1H 2OK0H 4OCSH 1WIPA 4FFWD 1X4ZA 5C3LD 2A9MH 3HMXH 1I8LC 1NQBA 3O2WH 3DBXA 1RHHA 5HPMA 1FIGL 3UEZA 1CE6A 4JFED 5D7LB 1ND0A 1AI1H 2JB6B 1OTSC 3RZCB 3V5DA 2FIKA 2DMKA 3C6LA 2ATPA 3R1GL 3O8XA 1J8HE 4J8RA 4Z7NF 4PJ7B 5GGVH 4UOW1 5CJBA 2JLLA 1BWMA 1S7SB 2VLRB 3O6LH 2QSVA 3L3JB 3WKNA 3RJQB 5CD5D 3U46A 4FRWA 3BZFA 2NZ9D 3KPQA 5D2NE 1KJMA 2AXFB 1BFOA 1RJYB 3GI9H 2VDKH 1ZHBA 5SWSA 2NW3B 2MHAA 1UYWH 1MFCL 3WIIL 4GBXA 4X7TB 2IAND 1QPXA 2OSLB 4HKBB 1J10A 5HHMB 4GW5A 5DWUH 4NO3B 2P8MA 1XCQB 4POZC 1I3RB 1VEPA 1KPUB 2UWEF 2WBKA 3ABZA 1YPZB 3U9PL 3LCYA 1Q9OB 1UGNA 2K7PA 4IOIB 4F9PC 1EH9A 1RV6X 1TNMA 1SVZA 2R56H 4OGXH 1TQCB 3N0PB 5GZNC 3MCG1 4FTVD 2WWMC 2Z31A 5AZ2H 1Z0MA 5GISL 1A7OH 1L6XA 1J0JA 1NBQA 2EIDA 3C08L 5DEFA 4HIHA 3EOBB 4F57H 3MLXL 4ZDHB 2BNQE 5IT2H 2ORBH 4HSQA 4RFOL 1XIWA 3GKZA 4LQFL 2ENYA 5JDJA 3BI9X 1FNFA 1F6LL 4H8WH 3ZKND 2D7TL 4NNYA 3H42H 4MCYB 3IJSB 4HPOL 3MOAL 4U1HA 2P42B 3PWPA 3LKSA 3O3UN 3BZ4B 3D2UB 1NCUA 5HHNA 1S7UA 3WNNA 3B9KC 3MRHA 2FB4H 4ORGA 5FECA 4L8SA 5IHZA 1V3LA 5CZXC 2WW8A 4PJFB 4Y4KD 3MRDA 2IEPA 4JFOB 1FYHB 1DFBH 1VENA 3UJTH 3I02B 1LO2H 2H45A 3AMLA 5CEZL 1QA9B 5DO2C 1G7IB 5CZVL 4POYA 1HQRB 2N56A 4PGEA 3O3BA 2CIKA 1FG2A 1N2RA 3U82B 3ZTNH 1E4WL 2ZUQC 3WEXA 2YSSA 4EOWL 1VSCA 5F7KC 5GJTH 4AM0B 1BVLB 1A6VH 3UC0L 4NC2B 5KVDL 2B39A 4LSQH 4XBEH 1NEZG 4L4TE 5I1DA 3MBEA 3VG9C 2MQ3A 5LBSH 4BM7A 5TQ2H 3TFKA 4M3KB 5DA0B 3C6LC 1KELL 3OMZA 3O8XC 5I9QC 3KPMA 3BD4A 5KVFH 5MI0B 3EOAA 1CXKA 2OZ4A 4WCYH 1FZMB 2VQTA 5BQ7A 4NOFA 4M93C 4JY4B 3CPLA 1FC2D 5HDLA 2XA8H 25C8L 1ERNA 3LKQB 3TIDB 3W2DL 4K9EH 2BNRD 3IU4H 3C5ZD 2PYFB 5I1EH 5F3BB 2DQCH 4Y4FA 3VCLB 4FFZL 4OKVB 4HS8H 2YPVH 1II4E 2V7NB 3CDFA 3OSKA 5BMFH 3U0WL 4ONOA 5IEHA 3R0NA 3GMRA 4M1CC 1EHXA 1AQKH 1ZK9A 5EG6C 4RGOH 5C6TH 1HKLH 1TZHB 3CX5J 4NHUE 1OGTB 1UM5L 4YHNA 4U1NA 1T6VN 5F97E 4OJFL 1M4KA 2V9RA 1OPGH 3HNSH 4PJBE 2YN3A 4G6AD 3WFCH 4WY7H 5FF6B 4GG6E 3S37H 3PHSA 1ONQA 2GITA 1IC5L 1T1ZA 2Z31C 5E8DH 3E0GA 3GSWA 4P4RB 3L6FA 4Z7UA 4D0DB 4RCAA 3REVB 1CDGA 2PR4L 3TT1H 4U3HA 5TQ0L 3EJYD 2BSTB 4NOBA 5IK3B 5DJCB 4I0KA 5J1AB 2CRIA 3JV6A 3MBXH 1MHEA 4KJWC 3MRKB 4CVUA 3SPVA 4P5MA 1ZVSA 3P9MB 5BV7C 1BIIA 2ILLA 1PD6A 2XTJB 2VSCA 3NIFE 1RZIA 4AY0A 5A16A 3KAAA 1I3GH 3QYCA 5FO9B 4NRYB 2DMCA 3RU8H 2V5RA 1FFQA 3V6FB 4L8SC 1JF6A 4M6OL 2YD6A 2ZZUT 1F6FB 1QUNA 3CXHK 5E95B 4P5KB 4ELMA 4PJGB 4PLKC 5J9PB 4DGVL 3HFMH 4PGCA 5J0BA 2R1WA 3SO3B 2C5DC 1DP0A 3UJJH 2VKXA 1TLKA 1BOGB 2H1PH 2Y5TA 4YC2C 2WINA 4XWOD 1NBZB 3VXSA 5HHOB 4MNQA 3B6SB 1I9JL 2OZ4H 2PKDA 4Z76A 1I7UA 4P9ML 4OI8A 1F02I 2NMSA 4KVNL 1NFIB 3KXFB 4HZAA 4FFEX 3ILQD 1NDMA 1ZHLB 3MBEC 1DN0A 3G04A 4P2RA 3MREB 3QG6A 5M7QA 4NUGH 5KVGH 1A7NH 4J3WA 1ZLSL 3TFKC 1E6JL 3I3EA 1RK0A 4YBLC 5E99L 3HAEG 1QRNA 3EKCA 4G6ML 1WTGT 1DQML 1GL4B 4P2QA 5K9KA 1E6OL 2XWTB 2YWZA 1CI5A 1JNLH 1TJIH 3DUSB 5E7FA 4V3DB 4XMPL 4LF3B 4NZRL 1WWCA 1XF2B 3M1BB 5EOCL 2YKLL 2PTUA 4RMUA 1KIRA 2IH3B 5JPMA 1AO7E 5LQBH 1ZT4B 5EN2A 1ZT1B 2X4PB 3RVTD 5FO8A 4JREC 4Q0XH 5SX4I 3HAEH 4Y4FC 3GMQA 4U1IA 1IL1A 2HLAA 3F7VB 1IT9H 3IXAA 5CSZA 2Q8BH 3RL1B 4P23A 1JGVH 1T2QL 4F80A 3TN0D 5BZDA 5GGSY 3BJ91 1DBKL 2R1YB 4XNXH 4MX7A 3GMPB 2HKHL 1XCTB 3Q6FA 1KJ2B 1IFHL 1QSFA 4K94L 4PJXA 1RAMA 1RU9H 1KSRA 2OXHA 3E6FA 2HJKA 3ZKSD 4EZMA 3VGHA 3P3YA 3AS3A 4RDQG 1J1XL 5ANMA 1GGBH 4K23L 4X9FA 7FABL 4C56E 1FLRL 1T80A 3CNKA 2BY3A 4KRPB 4DK6A 1FSKB 3RUGA 3V4PL 3LAFA 1G7JB 2Y36H 4ZSOA 1BF8A 3U4EA 1T7WA 3D6GA 2D0FA 3K81A 2FR4B 2OJEB 3DV4A 4YFDB 3C5SB 2O5XH 5LGJA 4LMQE 5E8EA 4OT1L 4BSVA 4AIZA 4APQA 2F54E 2G5RA 3U7YL 5KSVB 2ATKA 2B4CL 3RPKA 1CDYA 5F6IB 4OCRH 1FZKA 4OLVL 4P4KB 2ZG3A 2GYSA 1WJ3A 3HNTH 3V7AE 2CGRH 3VXPB 1DQTA 2BDNL 4NNXB 1BPVA 2HFFA 2VLME 1A3LL 1J8HB 3V6ZA 4JKPH 1RZ8B 1CF8H 1DUZA 3LN4A 4NHCH 3HZVB 3HPLB 5GRVL 4L9LA 1K4DB 3QI9B 4PB9L 3QWOA 5K9JH 3QXVA 5DJYA 3TBTA 4Z77B 5E7BA 1N7ML 2FLBT 4YE4L 2OI9B 1CFVL 4BQCA 1T0PB 5D2NB 1AD0B 4JPVH 1I85A 5EZJA 1A1OA 1MRDH 3W0WD 1AO7D 4F7PB 1K5NB 2Y07L 2IG2L 4ALAH 2A73B 5EWIH 2X4RA 3DHJA 1HE7A 5JIHA 3QXDA 1MFEH 2FGZA 3QDJE 2DWDB 3SDYL 3FQXA 3RA7H 5IB1A 3FTGB 4ZFGH 5MEPB 4FG6C 1CTNA 1D5MA 5KZCB 4WFEE 3W11D 1PEZA 1KB5B 4XX1E 2DYPA 3I2CL 4Q6IA 5TE7H 3Q5OA 4IRZL 3MLPA 1S7TA 1UCBH 1YEIL 5FUCE 1KTDB 3O0RH 3O2DL 4P99A 5E0QA 5DK0A 5F89A 3MGOB 1SVCP 4MHHG 2CO7B 3QFJE 3IRZA 3OV6A 3WKMH 5TGBA 3TBVB 4XPTH 5C7XH 5DVOA 4NPYA 4C56D 2CK2A 3QO1B 5ESVB 1JNHA 2BNQB 1WBZB 4ZYKA 4GS7C 4P23C 3M45A 5CGYC 4GH7B 5GGRY 3NIGF 2NY0C 1BQHA 3FRPG 1KJ3L 4PRBA 1JWUA 5TDNA 1JTPA 1A1MA 3MC0A 4U6XB 3RHWK 2F54D 2NY6D 4Y2DD 3HI1A 4F37F 4RFNB 3SDAD 2VZ1A 1UCTA 3OB0K 5I30H 2A6IB 3NFSL 3VXNA 2DQGH 2ZOKB 4OD1H 3RKDD 3CXHJ 3G6JB 2EEBA 4LKCB 3VG0L 5TE4L 1YMMD 4NRZA 3RI5F 5JOPE 4D94A 3RFZC 5CJ8A 1V8HA 3RIFK 4PIRF 5DMIL 1TETH 2WBJB 3O41B 2C1OB 1MSPA 3VFMB 3QUZD 3ZYZA 2PO6A 4JLRB 3GSRB 1C1EL 4OFIA 4LVOC 4Z95L 1SYVA 5FIEA 3NABH 3FT4A 4D8PB 3T0EE 3RGVA 2V7HA 1D5IH 3M8OL 3ULSB 4HS3B 3G6DH 5H8DA 5ESAA 3FT2A 4APQC 3T3PF 5IB5A 4N5UA 1AP2B 4L4TB 1AGCA 1I8KB 1UACH 5EUOA 3BPOB 5E2TL 5EBGA 3C60D 1BLNB 3QXAB 4P49A 4KXZH 1Z5LA 1J18A 5DLMH 1PSKH 3NCCB 3R8QA 3T0VA 2X9YA 4HUMB 4M1DH 2VISB 1HIML 3V0WH 4QCIB 4WFED 4P46A 5C0EA 4I3GA 3QFDB 4L9LC 2VH5L 1R3IL 3L9RA 4OM0L 3TYFB 2DQEH 1FGNH 4R4FL 2OX5A 2P48B 5I19L 2HN7B 4PGJA 5C07D 4GRWH 4LSUL 5J7CC 5JTWA 3RWJB 5JIKA 1FJ1A 1HSAA 4IRSB 2NX5B 3ZYIA 5T33H 5L9DH 4XI5D 4UT6L 1I85C 2R2EA 3BMWA 3QFJD 1HHJA 3F8UB 3BAEH 4NQXB 4JAMB 2EO9A 1CT8B 1BQHG 2JJTA 3ZL4L 1VERA 1CD9B 3DI2B 4S0SD 1A6PA 3BD5A 5ITBL 4QRRA 1XGQA 1QVOA 2J3SA 3MRJA 4WI4A 3VGAB 4HGKC 3G5YB 4PJBB 4Q6IC 3TC9A 4MD5B 2DQTL 2IAMA 3E6HA 5E6IB 4XPAH 2R0ZH 3GJFB 4OLYH 1EHAA 1DN2A 3RY5A 2D3VA 5IQ9A 5E6ZA 1SBBA 4OCYH 1LO3L 3MRPA 5EU7E 1U91B 5FYKL 5DMKA 1VDGA 4YO0B 3OX8A 1XGUB 1A1NA 4OD2A 1N8ZA 3S3JA 3FKUS 2WNGA 4QTIL 1UKQA 1TMCA 1GZPA 3LS4H 3FCTA 1SY6L 4PRPB 3TN0B 4QHMB 1U95B 5INCB 4XVJH 3OKYA 2Y7QA 5F6HJ 1DBML 1QSED 2NY3B 4L3EE 2JK5A 3T0ED 5C08A 3JTCA 1WIUA 3RVVD 1OAKL 4NN6C 3BIKB 4ZTPH 5D1QD 3ZDYF 2A1WL 3MA9H 1A7BA 5E2UL 4LHUB 5CEYA 4OCLC 3DX8B 4RWYH 3WNOA 4OFVA 3B5HA 3NN8A 4M4PA 2ZUTA 3WNMA 2QQNL 1J1PH 2WK2A 3DRTA 4TNVK 4JQVA 2F58L 3UTTB 4W81A 4WHYG 5KG9B 1X44A 3MXVH 3VFPB 2HMIC 3SJVA 3K3QA 3TNNB 5IJVB 5HVHB 3ZSTA 1LP9A 3T09A 1JPST 1NGYB 3X3FH 4CU8A 4DW2L 1TJHL 4X6FA 3LSOA 4WWKC 5DR5L 4CMHC 3LPFA 2DTMH 3RGVC 4LCCA 3CUPB 3OJVC 1GAFH 4JPIA 1KJ2L 4WHYH 3EDFA 5DJAB 4MDIA 3G08B 3X13B 5D72H 1HQRA 4FA8A 4EI5B 2EE9A 3BVNA 3TIEA 3O2DA 4DTGH 3QT2A 4E42B 4JM2D 4Z7VE 4KDWA 1LMKA 3MCKA 4LCYA 5KJRH 4HX1A 1M7IB 1RIUL 4OI7A 1T2JA 3GMMA 4P46C 5INDA 3NGBB 5DJXB 4M62H 2ERJC 1KCUH 2ZPKL 5K9QI 4PRID 1LE9B 2PYEA 1HHGA 32C2B 4OB5H 2W0KA 3DROB 3DXAD 2FNBA 5LCVH 2DJ4A 3U6RB 2BMKA 4WI8A 3LRHA 1IBGH 3QUYD 3ALPA 4NWTH 5TDOA 3B3IA 2E7BA 3IJYB 5EIIB 1A6WH 1DQJA 3K4DA 2HFEA 1LO5A 3FO1B 4FXKA 1JPGB 2P49B 1Y6KR 4NO0B 2JJTC 4QEGA 1LGVA 3IVKB 4AYFA 1WSST 3OKDB 5KW9L 4OLZH 1U3ZA 5K59E 4YIQB 5FHBL 4M7ZB 1S3KH 5EBWA 1UZ8A 2ESVE 3B5TA 4Z7WA 5I1JH 2IAMC 4YHLL 5DURB 4WU5A 1G7QA 3OJ2C 1KEML 1CG9A 1G0YR 4OUUB 4LU5H 4R7DB 5EBMA 2N1KA 4YGVA 1UADC 2C3XA 5FDWB 1FN4A 1IM3A 1CD0A 1WZ1L 2CDEB 5C0GB 5CBAB 2X4OB 2NY2D 1QFWI 3LQAL 3H2WA 4IRJB 5HYJE 3VI4E 5T1LA 1J86A 5D7JA 5EULV 3OPZL 4PJCF 4AMKH 5ACLA 2APBA 4X80H 4MDJB 5J13B 2E6JA 2FO4B 4J3VA 1SJEA 3CVHA 4MNHB 4PJIF 2YN5A 4GRLA 4AQ1B 4JVWA 1WC7A 3HR5B 2GEEA 3N1MC 3P11L 1KB5L 2F54B 5CLWA 1DLHB 1CBVH 3WD5H 4LLUB 4KY1L 5EU6A 4G42A 2CIIA 2IFGA 4NQDA 1BD2E 1JHKL 1RIHH 1EVUA 4LLWB 3VFNA 1CFQA 1AKJB 4G6JL 2XKUA 4J1UB 2R69H 3KYAA 4BH8A 5DUBB 3DUUB 4JQVC 5DTFB 1G7MB 5ISZA 5CCKH 2F74B 4XHQA 4TVSa 4MA7H 3EZ8A 3RNQA 4FQJL 1NCCH 3MNVA 1WITA 3G6AB 5LKNA 2B1AH 1EA9C 2DL9A 1F4YL 1F90L 4Y19E 3CFJA 3QZWB 3JTSB 4J6RL 4ODVH 1QLFA 5E2VH 4PREB 3OR7A 3HZMB 3QBTB 1DANT 2CQVA 3REWA 5C0JB 4LCCC 3OXRB 5D6CA 5D1ZD 1G7PB 1PLGL 4JDVB 5DJZA 5E94A 4RBPH 4WGWB 4WO4B 3VGGA 3QDJB 5DEGA 4BQ9A 1C16B 1TIUA 3BOVA 4TPRL 4X7CC 1AIFA 4G8GA 2NLJA 1A14H 3PP4L 1J8KA 4ZQKA 1F4XL 5FA4B 2AS5M 4JO3L 2BJML 2FL5A 4HV8B 4XBPA 2MQ0A 3MV7A 2ESVD 3KXFA 3BZDA 3Q3GA 3SDXF 5T1KB 1UWXK 4QHLA 1LK3H 1KJVA 3G5XB 5JW4N 1DVFB 5DZLA 4AL8L 1YECL 5I8EA 1FVCB 4NBZB 4N0UE 4LP4A 1OF2A 1FNSL 3CZFB 1BVKA 1AD9A 3OAUL 1IMHC 5IGXH 3FFCE 2FWOB 1BJMA 2ICWA 1OP9A 4UBDD 3VRJA 4KKLD 2XT1B 4G8EA 2XYCA 4PG9B 4KJQD 4HCRL 3U2SB 3DYPA 4NM8L 5F8RC 3DMMA 3SHSA 5F7WC 2ADGA 2HAZA 2E6PA 4JDZB 3TBWA 4XB8A 2UWEB 2EH7L 4NWUH 3CLEH 1ZTXH 4LNRB 1OARL 4RMWA 3ROLA 5CBEA 3IDGA 3IGAB 4JO1L 4XNUL 1QR4A 2IPUG 3CVHH 3KPSB 5GGTL 4XCCH 5F8QC 5H94A 5IBUG 2V5SA 5MERA 3JSSA 1IQDB 4K7PH 4KKCD 4N5ED 4WRLA 3CLFL 3QQ4B 2MQCA 3RY4A 4JY5L 4QXUL 3BT2H 1DQLH 3JV5A 1N5AA 4WUUB 3T2PA 1DDHB 5D7IA 2VQ1A 1RVFH 5D7JC 5F7UA 5L7XL 5I1KH 1I9RH 3GNML 3HZYB 1YC8A 4Y19D 1V7NH 5E9DD 3K4AA 4PRDA 4GAJH 1OP5H 3MNWA 4GRLC 4D9QD 1UZ6F 3VXME 4D0CA 2XWBA 5JW3H 4M61A 4R90L 1CZ8L 1PKQE 4YXLL 1H0DB 4LARL 3WHXA 2H6PA 4Q9RH 4HFWA 5EO9B 3SCMD 4JFDB 3QCUH 4L4VD 2V2TA 3VWJB 4FNLH 3EOTH 1OOAA 3G5ZB 4FQHA 3PUCA 3S9DB 3MSPA 4LPVA 3QUMB 4OGYL 4MB3A 4U1KA 1XF3A 3QNZB 1FFOB 3H9SE 2NXYB 4N9GB 3NAAH 5JUEL 4GSDH 1S5HA 1QFPA 3NH7H 2JIXD 3CH1A 4Z5RB 4UT7L 3N9GH 3QIBD 5JQHC 1P4IL 1BEYL 1RZ8A 2DD8H 1FO0B 4EN3A 5MEOB 1RUML 3UTSD 1K4DA 4QRPB 4MJIE 3NIDE 4U6HA 1LILA 3TNMA 4WW2A 4C58B 2O26U 4LP5A 4HHAB 4J3TA 5HGAA 4O5LH 3QDGD 4JB9H 2EXYD 4H5SA 4JY6B 2EIEA 5B3JE 1U93A 4KQ3H 3TVMA 4TUOA 1A21A 5DUML 4JHWH 3PHQA 1RZ7L 2AEWA 2IBBA 3ARDD 4HDIA 3BD3A 4TSAL 1UWGH 1A0QL 4S2SB 4HQQH 1HEZA 3NACL 3X3GL 5J3HC 4R0LA 1KPRB 1E4JA 4YUEH 4YHMH 1MHCB 5IKCA 1JPFB 4KAQL 1IZJA 3BGFC 4M6ML 5AWNH 1CGTA 5B38A 2YHGA 3V4UL 4R2GD 4S11A 3BWAA 1J9CT 3QIWB 1ORQB 1FCCA 2NY5L 4M5YH 3ET9F 2BSRB 4L3EB 2CLZB 3DMMC 3HLAA 4C4KT 2I24N 1MJ8H 2Q86A 4N1CA 4LAQH 3UTPE 3TCLB 1I9IH 2Y72A 4A6YL 4Z8FL 3OKEB 2DKSA 1HDMA 2OL3L 3T08A 4ZNEE 1CICB 3F5WA 3VXMD 1G6RB 3FO9B 4X9GA 1IGCL 1C08A 4RISL 1BBJB 4HW6A 4X4XA 1NAML 3PWJA 4GQ9L 1CXLA 1J7VR 2QR0A 3CU1A 4GXVH 1AE6H 5B21A 1YY8A 1NBYA 1JGLL 2NTFB 2V2XB 3IFOA 1YNLL 4FFVD 4ODXB 4G43B 2G75B 3RTQA 1INQA 4I0CC 1TNNA 5I1LA 3F12A 5CS7A 4GOSA 2Y06L 3LEXB 3H9SD 1MUJB 2Z91B 2UY6A 3GSOB 3L7FA 3WFZA 1YEDA 2L4OA 3HCVA 5EORL 2BP3A 4FXLA 3BDYH 4MZ2A 1MFAL 4JLRA 3EYVA 1QP1A 4Z7VB 3LVEA 2GTWA 5J12C 2WANA 5ADPH 1S7VA 1K8IA 3EO9H 4U3XA 3PDOA 1WWWX 5D71L 3ESUF 4X6CA 3VXUB 3UJIH 5HD8C 4YDJB 2EYTA 5DFTA 1NC4B 1NMAH 1BLNA 1CLOH 1N26A 3PL6D 4G6KL 4OZGE 5L88H 1N5YH 5IP4A 2AEPH 5DJ6A 4CW1B 4HCRA 5DFWH 1WFNA 3LQAH 3PDDA 2UY7A 1FBIL 4PJAF 3QUXD 5D1XD 1ITBB 2F19H 4EN3C 5BO1H 2DBJA 4D9LH 4HF5L 3HI5H 3FT3B 3TH2T 3TZVC 2HT3C 5DFVC 5GGTA 4WW2C 3F7RA 4BZ1H 3HE7B 1QYGH 2CDGB 1RPQA 3GUTA 3JTTB 3H9ZA 3VFVB 1HQ4A 3PF2A 2MCPH 5IJKA 5E8NA 4E9LA 1Q0YL 3FRUB 1OAXH 4OZIF 1NBVL 5HPOA 1PG7H 4I5BA 4TQEL 4X8XA 2RCSH 5FM4A 2B7DT 5EZIL 2P5EB 3TVMC 3SE8L 1H3PL 1P2CB 3LQAC 3KJ6L 1U3HD 3HMWL 3NFNA 3BQUA 5E2JA 3C8KB 2EE6A 1RFDL 4XP4L 2CR3A 1S7WA 4LFHD 3FB8A 1TCRB 4X6DF 1RJLA 1FL3A 4R0LC 2ZJSH 5HYJB 1KG0B 4YDIL 3QHFH 4J7RA 5LGHH 3NTCL 3MV8A 5HI3D 4WV1A 5ENWA 3PIQB 4YXKH 2O93L 5F7DB 3IDIB 4YK4C 2J6EL 4ZMAT 4N0CA 1NCWH 1S9KC 4JFFE 3IDNA 3DX7A 3V5KA 1CDJA 3OAZH 2L7UA 2D03H 1HXYB 1XGUA 5BS0D 3CC5A 5EC1A 1MRCH 3BPLB 4RGMC 4M6AA 2QQQA 2AJ3B 5J6GA 1BD2B 1M05B 4M7LH 3ZKXB 4S10A 3FB6B 1CGXA 3MRMA 1R3JB 2C3VA 5KSAD 1ZWIB 1EXUB 2FJGA 2VE6A 1EHLL 1Q1JH 1TQBB 4LSSL 1XF4A 3T2OA 5L8JB 1F3DH 3EFFA 2R2HB 4Z0XB 4PRNB 4LMQI 5F72S 1BFSA 3RTQC 3S4SA 4G9FD 4Y19B 4R26H 5DRXB 4F58H 5I1AB 2DLEA 4ESKA 2OM5A 5GS1B 3KHOA 3DGGB 4MD4B 4CAGA 1MPAH 4PJDE 4RAUA 3CIQA 4LVEA 3TO4B 4LOUC 2HJFA 1WWAX 4ETQB 1IAKB 2EKJA 2XWJB 5TF0A 1D9KA 1DJSA 1FYTD 5E4EC 1AGFA 3IXTA 4P5TC 1D3CA 3MJ7A 5CEXA 5EZOH 3C09B 4Y4HB 1RUKL 5EPMA 4JM2F 5HSFA 1R5WA 4MS8A 1OCWH 2DI7A 4KROC 5C0AA 2NR6D 2OR9H 5DJAA 1T5WB 3AFLA 2LV4A 1LQSR 5K33A 4RA0C 4ZAKD 2CKNA 4BSWA 1F6AA 3LB6D 4N0UB 4LQ1A 4PV9A 3GSQB 1Y6MR 4A6YA 4PYGA 3D85B 2OL3A 3O3DB 3FFCB 2IQAA 2XZAL 4DVBA 3GM8A 4IMLA 3OJDA 1S78D 2EEDA 2PCPA 1IC4L 2AV7B 2VIRA 3VWKA 1NAMA 1S9YA 2ZSVB 3PXHA 1K6QH 3QP3A 3FOMB 4JFFD 4WW1A 3EO1B 4TVPH 5D5ME 3TPUE 3SKMA 1JRHL 5IJKC 2CLRB 3ULVH 1HYSC 3R4DA 4JM4L 3BO8B 2DKUA 1I8IB 3CSYB 3D18A 3T8XA 5EO0B 2W9LA 5GGUB 3U1SL 2CUIA 5DJ2B 4J4PD 3GIVA 1LK2B 3BQUC 3O2VL 4FXGB 5FCUH 4UILL 4OTXH 1OTTD 2P4AB 1MCPH 1FO0L 3L3HA 3SGDI 4FQ1H 1UKTA 3GJEA 1OSPH 3HC4L 4WV1C 3KJ4B 4ZXBD 4KJPD 1IGTB 5A43C 2P5WB 2A38A 4N0CC 1RUPL 1WLHA 1P9MA 1AFVL 2R0WL 2HH0L 5J1TC 3QDME 6CGTA 2Z0BA 5HHXL 3NZHL 1X4YA 3VXMB 2CDEA 1D6EA 2HT2C 3C2AL 1PKQB 2Z4QB 3DJ9A 3EDJA 4MAYB 1V3MA 2MMXA 5IVNA 1P4BH 4H20L 2YC1A 2RQ8A 1KT2A 4MA8H 5HYQB 2AJYL 1I3UA 4L3CA 3MRGA 3O9WA 2IADB 4TUJA 2I9TB 3BKCL 1TVDA 3GBNL 4U7KA 2OTUB 4O2EA 5FM5M 4HUVA 2YPLA 3FO0L 5EFIB 2AQ3A 3HPJB 3QEGH 3FQWB 3FQNA 4NKMB 3KGRA 3P73B 4BQ6A 4O2CA 4OQTL 3CU7A 1AHWA 5FO7B 3RX7A 4OZ4A 4L29A 1KGCE 1WUNT 4Y1AA 5BCAA 1NCTA 1DQQB 1F2QA 1G6RL 1D9KC 4YDLC 1NGWB 4DAGH 4MJIB 3BUYA 4XAKE 5IHUH 2ZUWA 5E00B 1JRHI 5IFHH 4HIXL 3NBNA 1IM9B 4K3JH 2C1PB 1W0VB 2YK1L 2CK0H 4MS8C 4QXGH 3TCXA 3WO4B 4HXAH 1F4HA 2BVTA 2ZOLB 5C0BE 1KTLA 2KKQA 2P8LB 4G80A 5HJ3A 1NEUA 4JRYA 1A3RL 5SX5K 3LKRB 3SQBA 4YAQA 5AYUH 1G7HB 1MH5B 1HHHB 1UWEH 1G9ML 2DQDH 4X99B 4JFZH 2YBRA 2AXGB 3GK8H 2HLFD 3Q48A 4RA3A 4WDIA 3BEVB 1UM4L 1RZGA 2ZUVA 1QNZL 3V52H 1MHHB 3CFDB 4TULH 3WSQH 5IVZB 2DIAA 4UTAL 3H3PH 4F2MA 1WISA 4WIQA 4XNYH 1HOCA 4XZUA 5FUZL 3BWUC 4I0PD 3CXDL 1J88A 2VXSL 2IMNA 2F53D 3VWKC 1MHPH 3N1PC 2VWEE 5FYJL 3ZDXE 4RX4A 1X5AA 4OV5A 1IAIH 4NO5A 4U1GC 5FYLH 3MNZB 5EIVA 3EHBD 3EGSB 3SE9H 4PG9A 5F1NB 2AK1L 4XP6L 5JO5A 2VL4A 5F44A 3UO1L 2FECI 3MRQA 2OP4L 4BZYA 3QQ3A 5IEKA 1D5XA 2XI9A 5DYOB 5IM7B 7CGTA 3EYOA 2UYLB 1I1FB 1S7QB 4BK5A 1EAPB 2A83B 5FFLA 3HG1E 1YEKL 1P9MC 2QADB 2FGWL 3DVIA 3ZDZF 2YEZA 4XNMB 3MLYH 1T1YA 4IS6B 3EDKA 3ARPA 2V2WB 3ARTA 3S36H 1P6AB 2NY1C 2PXYA 4NQEA 1AGBA 4OF7A 3RIAF 2AP2A 1JF1A 3QPQC 3ARGB 1KN4H 5EA0H 2O5YH 1T89A 4OZHB 4QO1A 1RQ5A 1U42A 2NYYD 3O9WC 5C0BD 3CDYA 4RGND 1YEEL 1FVDB 5JMOC 1T83A 3WIHL 4KKBC 3GI8L 3ZE0E 2X44D 1RURH 5E4IA 3CFEA 2AEIT 2EXWD 4D9RE 2D7PA 1QR1A 5F1SA 2G60H 2DN7A 4MA3A 1AHWC 5I1CH 5CIPB 5EOQH 4XMKH 5DD6B 1MCOL 3BKJH 4Q2ZB 1ADQL 1WBYA 4U0RB 4PJEB 5DC9B 4B53A 3WFBH 1S8DA 1JHTB 1IGJB 3X12B 4L5FL 5JW4M 6FABL 3DX9B 3B43A 4IJ3B 4ZS6D 3SDDC 2YD3A 2HVKB 4HKJB 4QRQA 1GGCH 3OF6D 1T20B 2IC2A 2A6DB 1FO0A 3PNWA 2H2SD 4QYOB 3V6OA 5ID0A 3OKKA 3N50A 4U6YA 5SWZB 2GI7A 2WAHA 4YWGL 4YBHA 3MMEB 1KCSL 2GK0B 5DD3L 1UVQB 4HS6B 1T21A 3B9DA 3H3KA 1MWAA 1D5ZB 4HXBL 5T3XL 3QG7L 3G5VA 4P9HH 1N59A 1T4KB 4BK4A 2HRLA 3C6SB 3LQZA 3SDCD 2QLVB 4JFFB 4S1DD 5HI4C 4HWZB 2DIBA 4UNUA 1FL5A 4QOKE 4HKZA 4X5XB 3HG1D 1U6AH 1H15A 2ZUSA 4WUKH 4EBQL 4ETYA 5CMAA 1VKXA 4KZDL 4F7EA 4LSTH 3S96B 4MVBA 3UXFA 5FUOH 1MCHA 5EB9A 4NKDA 3HE6A 1RZKH 2A6JA 2BSRA 2AI0H 2CLZA 4OQTA 3ARWA 2VMFA 3VXRE 5IMKB 3ROOB 5BRZA 5FDYA 3MLSL 1WZLA 1G6RA 4UU9A 2ITDB 4WEBL 3VE0B 2NY7L 2XY2A 3K0WA 2ZKHL 4PV8A 1HZHH 3PXJA 4XTRD 1JPSL 3HUJE 1TVBB 4YFLF 5HYSA 1DL7H 2JB5L 5ECJE 3JZ7A 3L5HA 4PJDB 2E27L 1BP3B 5IFAL 1B0GA 2AABH 5DD0L 3ARBA 3NPSC 4D9RD 2ZNWA 4FMKA 3H0TB 2VLJE 4XCNB 2BRQA 3VDCA 2PTVA 3ES6A 1FVEA 4HIEB 4H88L 3VJ6A 2PXYC 2NXZC 1NFDF 1AGDB 2EYRB 5JXAL 3QEQA 2R4RH 4RDQF 4X9IA 3VXOA 5HVWA 1JZ6A 3UAJC 2BC4A 3LZFH 1VGEH 1SM3L 1T89C 4NFCA 4DGIH 2EKSA 1NCBH 5E8PA 3IF1B 2CKBA 4Z7OF 2FHFA 5D9SA 4NKQB 3QHZH 3AU1B 1T83C 5CGMA 1E28B 2BFVL 3BEWB 2F5BH 3WFDL 3GMLA 2PW2B 1X5KA 4XVSH 4QY8A 5BXFB 5JHDA 5F9OH 3D3VE 4E41D 2Z35A 1J0ZA 3OKMA 5I15H 1CU4H 5ALBL 3GSVA 1WIOA 4M5ZH 4PTUA 2EDDA 4XP5L 3TJHD 3VD5A 2HJLA 4G3YH 2DQJH 3S5LB 4RAVA 5SX4H 2R0WH 1YJDL 2OMBA 1ZS8B 1NUNB 1MWAH 2FO1A 1XGRB 3VRLE 4U7MA 5F71A 3P4NB 4JRXB 4EUPA 4LSRL 2FX7L 5D5MB 5I2IA 4MA1C 1YEFL 4P3CH 3BPNB 4HBCL 4KKNA 1UQSA 3VI3F 2LABA 4TNWF 3V6OC 3ARFA 3U30C 2AGJL 1FNAA 3HN3A 5IW1B 3LHPL 1YQVL 4JN2A 4TSCH 4EDWL 2AJVL 2Q3ZA 4PY8J 4LLDA 4LSPL 3RKPA 3LN9A 3RDTD 5HYSG 1FE8H 4MXQD 1F45A 2AJSH 1CXIA 3DIFB 1T04A 2GJ6D 4O51B 2H41A 1Q9KB 1DE4A 3QEHA 1EFXD 4Z18A 2JJUA 4OGAC 1KPVA 2BVOA 4DN3H 3QDMB 3OKOB 4RAHA 4BUGA 1T1WB 4L1DA 4M00A 4F3FA 3LV3B 3A6CH 4XVTL 5B22A 4G7YH 1R0AH 5TE6H 2JCCB 4MVBC 2XXMB 2EZ0D 4BZ2L 3D69B 3SY0A 4N0YL 3ZKMD 4UIMB 2LTQB 4GW1B 3HE6C 5C2BH 4AEHH 2QL1A 4ZO6A 4FMFA 3LKNA 4AEIH 1BM3L 2W9DL 1MVUA 3GSNA 1CDCA 1ZGLA 1JPTH 1ETZB 1ADQA 2W92A 2PF6A 4FQCL 2IQ9H 3RWFA 1W0YT 3I6KA 2QHRH 3CK0L 2XFXB 4YR6B 5L2KA 3UTQA 2W60B 1OAYH 1EEUA 4P2OA 2L0DA 1AXIB 2CKBH 5IMOA 3B4NA 4Y0GA 2PTTA 3L5WB 3ARBC 3D3VD 3S35L 4C59B 3C9NA 5GJSH 4LKXA 2N7AA 5E5MB 5DRZB 2EDTA 4X0KA 5JXED 5IMLB 1X5XA 3LPGA 4EUPG 3MRIB 1C8PA 1YDPB 5I75C 1G9EA 3LKOA 4WHTA 1Y0LA 3U7AA 4J3SA 5KS9F 1REIA 4HFUH 1MNUL 3WO3B 2FHCA 5AZEL 3ARED 4Z9KB 5F6HI 4LVHB 5C0BB 3WLBA 4BJLA 4Q74A 4ETQA 2AXJA 5IVXF 3V95A 1UA6L 2ZCLL 4EUPH 4QXTA 5GZOC 1WVZA 5F1IB 2VAAA 1FORL 5C0DB 4K2UH 1R3HB 5IOPA 1XR9B 1YQ2A 5F7MC 3BH9A 4GRWF 4LCWB 3QIUA 4NQTA 2DQUL 3MRRA 4UTBH 4JHAH 2GTZB 5H35A 1XGPA 2WWMD 1VADA 3DHMA 4JZJB 3MLRL 2VERN 4KK8C 4NRXA 1MAJA 5EH1A 2P1YA 3L3OA 4I18A 1SJHA 1OGAE 3NCYP 3U0TA 3RWIA 1NJ9B 4KVCH 3KLDA 4XP1H 5SWSE 2CMRH 3ARFC 4QRUB 4AJ0A 4G9DB 2CRZA 3EBAA 5TDPA 4DCQB 3B2UD 1KENH 3NCFB 1A7RH 3TA3B 1OSZA 1EZVY 1TTFA 3A67H 2YS4A 3IT8D 1A7PH 3ULUH 2D7NA 3QNXB 4BKLA 5ESQA 2FEDD 4Q9QL 2R29H 5BVPL 4GMSH 2I9LB 1NGQL 5KVEL 3GSNH 5GRVK 5ACMA 3HZKB 2R0KH 3TT3L 3HI6L 1TZIA 3UTZA 4N0FA 3VRIB 3CDCA 1FGVL 4MD0A 1FAIH 1KC5L 1QBMH 4ZFOA 1E27A 2C4XA 2J88H 2Z8SA 2DBLL 1IGTA 1KLGB 4X6EB 1LEIA 4HPYL 4F15B 1VFBA 2GFBB 2X4SA 3PGFH 2VABA 1X5FA 2W65B 3DVNA 2W38A 3GGWB 3VFUA 3BZEB 3MO1B 4FQQB 2D4FA 3T1FA 2AJUH 4OCXL 4LGSB 3OL2A 2FJFA 4QGTA 1NMBL 2VDML 3PWPE 3MLUL 2YD9A 2H32B 1JTOA 4R6UA 3WFHA 3QQ9D 4H1LB 5EUKB 5EUOF 3FZUD 3FN0L 2WM0A 3HA0A 4UAOC 4P2OC 5J8OA 2CXKA 1QFUH 4V1DA 1JZ4A 4IIQA 4O4YH 4LDOB 1C12A 3O8XD 4LSVL 1EK3A 4KKAC 1INEH 1VACB 1VA9A 4G8IA 4NZTL 4PP2B 1KNOB 1U8IA 2VXQH 1SYSB 5IBLD 3S98A 4Y16B 1I1AD 1NC2B 3P73A 4FZ8L 3BGMB 5T5FL 4MLIA 5JA8B 5E5UB 1I8MB 1T2XA 2OTWA 3MA7A 4XC3H 3WNKA 1J0YA 3GB7A 4G8FA 5CAYB 1OGAD 3S3PA 2HFGH 2WBWB 4JFEA 5E08L 2Y6SC 5SWSD 4UQ3B 5I8CB 1FZOB 3U4BL 4LIQL 1A47A 3CSBA 3HKFA 3LN5B 1KACB 3MCLL 5DHVA 1FFNB 1G0DA 3PABA 4GBXD 5D96C 4FQIL 1L0YA 5IW6A 3DPBA 2GQHA 1UJ3A 1K4CB 1W8NA 2XZZA 3K8LA 3Q6GH 3QUKA 3K2UL 2GAZA 3RVWD 1G7HA 2XQBL 3E8UL 4ISVA 3QIUC 1W0WB 4GW4B 4AT6A 2VITA 1MQKH 4QOKB 1E4XI 2V5YA 4IDJL 4L8BA 3BHBB 2Z31D 8CGTA 4ZO8A 3V4VL 5CFHA 5I18H 1MFDL 4I18C 1RUQL 1X7QB 2VC2H 3AB0B 3HHRB 4TVPD 1QBAA 2IPKA 4RQQB 1FQ9C 1ZAGA 4NN7B 4YEFA 4P48A 1XIWD 2VDPL 3VXRB 1UH3A 3GSUB 5D2LF 4B0MM 1RJCA 2UZIH 1U8QA 4NSKA 1MI5B 3IKCB 3WS3A 4JFXA 2PW1B 3UP1A 2VB5A 1JUFB 2Z93B 3L1OL 3GHEH 3HUJB 4RZCA 4WJ5A 4FTVA 5IESH 3MROA 3ZE1E 4I3SL 5ERWB 1CFSB 4HGMA 3T04D 1ZV5A 1NGXA 1P7KB 4K8RH 4QRSB 1T22B 1GC1L 2VLJB 5TH2A 1TZGL 1FRGH 3BP5A 1IAOA 1OVZA 4NN5C 5EOCJ 4Z7UE 1P4LA 1K3IA 3P0VH 2DIJA 3UYRL 1OTUD 2IPUK 1I1YB 5K9QG 5MP6H 2J8UF 4ODWB 3JWOH 2VZSA 3P77B 2X4TB 4XNMA 2Z9TA 2DQIH 1N6QL 1YNKL 4LCUB 2A0LD 2BCKA 1ZHKA 3BDBA 4NM4L 1L8JA 1YJDC 1FFPA 3C8DA 4Y4KA 3MLWH 5C0NC 4ZTOH 5MHSE 4NKIH 3LH2L 2VDQH 4IIQC 1IC7L 4HWBL 4P57A 1I4FB 4YBQD 4ELME 3LS5H 3RNKB 4O2FA 5ETUA 4CVXA 2NY4D 4OZFA 3BX7C 3FQTA 1B9ZA 1K2DA 4KHTL 5CILL 2P44B 1MFBH 4XP9H 1AR2A 3THMH 4FFWC 4NQCA 4MNQE 3VXSE 1RMFL 3OXSA 3BP4A 5EU4B 5F88A 1KIQA 4B5EA 2VUOA 3BW9B 2X9WA 4L8DB 3UPRA 1P7QB 1QLRB 1YN6A 2IFFH 4PY7A 3Q2CA 3X12A 3MJ8B 1VFAB 4P2RE 3SKNB 2YMXL 1V05A 4HIJA 4CN6A 3QNYA 2Q6WA 3QO0A 1UJ3C 3PV6A 1QRNE 3QRGL 1A7QL 5AUMA 1BJ1H 1QFWH 4F7TB 4P2QE 1IKFH 2ZUUA 1A5FH 3NZ8A 4ZS7H 5CD5C 2AKRB 2FBOJ 1S5IL 2APWA 2GK0A 1B6UA 2BNRA 2NZ9C 3C5ZA 4GG8B 2K9UA 5F7EL 1BOYA 3MV9D 1U8NA 1VPOH 1JNNL 2G9HA 1PX4A 1LO0H 4JGMA 5I8OH 4HWEH 1EGJL 5L6YH 3I85A 2E7CA 4X5LA 1QBLL 5DT1L 1QZ1A 4F8TA 2ITCB 1BAFH 5F7LB 3LEYL 2VXVH 1FLTX 4LEOB 1CGSL 1G7LB 1A6UL 5GGRB 5CD3A 5FYLD 2F9BT 1UFUA 2VZUA 3P4OA 3BIBX 3P30L 4PS4L 3D25B 3WXWH 1EPFA 1QSFE 3S96A 1JGEA 4LLYA 4PJXE 5MENB 1JN6A 3BRGC 3DVGA 1CL7I 3ZE0F 4Z78A 1IARB 3B9KB 4AEFA 4KK6D 3DO3A 3L3KA 4EIGB 1NGZB 4UOJA 1NDGA 3O6FD 4ENEC 4Y7MA 1KXVC 4NJ9L 3W9EB 2IGFH 4YHYC 2I5YH 3E2HA 1CVRA 4OZFG 4JZOB 5ANME 4PJCA 1MEXL 1EERB 1HILA 1J87A 2OQJA 5BJTB 2DQUH 2BHUA 5F9JB 5EZLA 3RUGE 3VFWB 1HH9A 3U0PA 4KH2A 4PJIA 1SEBB 4J3UA 3ZKNC 4FFYL 3IDMA 3DURA 2ZUQB 1RZFH 2K7QA 4KDVA 3MOBH 4X7SL 2A74A 3X17A 4NZUL 4JFYB 2GY7B 3I75A 3IETB 5T3ZL 5HBBA 4O00A 4OZFH 5J6HA 1G1YA 3E1F1 3T0AA 4MQXD 4ZODA 3DBXB 1RHHB 5HPMB 3VG9B 5FHAH 1CE6B 4JDTH 4CKVX 2DJUA 3OGCA 3TJEH 4Y4KC 1ND0B 4I9WE 3SOBL 2FIKB 3C6LB 2ATPB 5C6PB 3O8XB 1DEEA 4LGPB 1LDPL 5I9QB 3U83A 1JVKA 4J8RB 1IEBA 4JJ5A 4FZEL 4WI3A 1MLBA 5I76A 1KCRH 3C8HA 4XPFH 4MNGE 4M93B 2RJMA 4JG0H 2R39A 1L7TL 2FX9H 1FV1A 4WEUD 3U46B 1JZ7A 2F8XC 4DEPC 4PJ9D 3CVIL 4P2YA 5D7SL 1ZE3C 3BZFB 3H3BC 3KPQB 2P8PB 1KJMB 3QXUA 1BFOB 3PGDA 2X42A 4OLXL 1S7XA 2R0LH 1ZHBB 2FBJH 2EDHA 2MHAB 3BMVA 4GAYA 3RAJH 1ZS8A 1U8JA 4ODHL 4JRXA 1IAIM 4ONHA 4RMTA 4NNPL 4IEFB 1U8LA 2VJXA 4NHUA 1WAAE 4GW5B 1A4JA 2Z92A 2FH8A 2P8MB 4IMKA 4ODTL 5LWYH 3SDXA 3MRBB 4R9HA 1CLYL 1X5IA 5CEZD 3F6IA 1QSFD 2CUHA 3V8OA 4F7MA 5DVKA 4XH2A 3NA9L 2Z31B 3A6OA 3C5ZC 2OMNA 4LLQA 3O4LD 1HSBB 4UIKH 3ECBA 5ICXA 5F1OB 3TGXA 5IFJA 3AM8A 4ACPA 5DEFB 4HIHB 4PRHA 2VO5A 4DZBA 3OAZK 2H26A 1T5XA 4XXCA 2NZIA 2W9EH 35C8L 1AQDA 4HZLA 5BV7B 1BFVL 3ILPA 4NNYB 3LV3A 4WTZA 4U1HB 4O02L 4D3CH 1JHLL 1CGWA 3PWPB 1FFRA 3LKSB 4G6AC 4HWBA 1VHPA 1XGYH 3PWUA 4O58L 5HHNB 5CKGA 3GKWL 4KI5D 3P0YL 2X70A 1S7UB 5JR1H 3MRHB 4ORGB 5FECB 4L8SB 5IHZB 5FYJU 4GW1A 5FOJA 4KZEH 3MRDB 4YJZL 1LEGA 1U92A 4NCC2 5C92A 1OAZL 3E2HC 3LIZL 1LD9A 3EJYC 2FEEL 1KCKA 3WS6A 1IGIH 2D7OA 2HWZH 4PGEB 3O3BB 2A2QT 2CIKB 2Q8AH 1FG2B 4YDVA 4YC2B 4B41A 4AH2B 4I1NB 2ID5A 3EW3B 1D6VL 3WEXB 3TYGH 2YSSB 5KANG 1GPOH 4PGBA 5CUSH 4N68A 5D70H 2GHWB 1ACZA 2DQFA 2F5AH 3NFPA 2R4SH 3BN9D 3FQRA 1V7ML 5I1DB 3MBEB 1ZA3A 3WCYA 3QCTL 5IQ7L 4DQOH 1WCBA 5F96L 1IEAA 2HT4C 4YBLB 4FQ2L 5BOZG 5JIPA 5CP7A 5EU3A 3KPMB 4OLUL 3ZT7A 4Y5VA 5E2WL 3EOAB 3IS0X 1UC6A 2XQYK 2OTPA 4ZOCA 5BQ7B 1MIML 1IC1A 2VN4A 1IEHA 1UEMA 2LAGB 1GHFL 4ODSL 4L8CA 4JPKL 3ZMRA 4X4YA 1AJ7L 3W0WA 3GJFH 3OR6A 5BVJA 4ZNCD 5KVMC 1YYLH 4JREB 4PJ7E 2RFXA 4Y4FB 2D9CA 1WZKA 2PETA 4KMTL 3ILQC 5ICYA 4S1QL 4DJMA 1URLA 2CLVA 2IH1A 3KYOA 5I71C 5IEHB 3GMRB 5DD5L 4Q9BA 3WHE1 2HRPL 4JQIL 4UV7L 5CJOL 5IBTH 1ZVHA 4POUB 4QRRE 5E1AA 4UNVA 1HYRC 4U1NB 1U8MA 3WXVH 4IMKC 3K4ZA 4R4BA 3V8CA 2UUDH 4JG1L 2OK0L 4OCSL 4MSWA 4KWUA 4QRUA 3KLSA 2A9ML 2QQLH 3HAEB 3HMXL 1ONQB 2GITB 2JELH 3O2WL 5KN5A 1T1ZB 3D39D 3RVTC 4Z7QE 4ZPVA 3GSWB 3L6FB 4Z7UB 3KDMA 1AI1L 4C56A 1ES0B 3MRNA 4PTTA 3OAYH 1JF5A 5GGVL 3QNXA 3HS0A 4JRWA 5DUPH 3JV6B 3CMOL 3ZHKA 1MHEB 4PGDA 5C0FA 5ADOH 2PO6D 3O6LL 3SPVB 4P5MB 1ZVSB 3UBXA 1OQXA 3S88H 1PVHA 4XXCC 1BIIB 5C08E 4Y2DA 1RZIB 4TUKH 4KJYA 4U49A 5A16B 4PJ5D 4R3SB 3SDAA 1CR9H 5GRYA 2EDBA 5HGBA 3GI9L 2VDKL 1GCFA 4EXKA 1K8DA 1LHZA 1UYWL 1YMMA 3MO1A 2X05A 5JHLH 9CGTA 1ZSDA 2SEBA 1QKZH 5DMJB 4ELMB 3QUZA 4JQXA 4YHIA 5DWUL 3MLVH 1QPPA 4PGCB 3WS6C 4XT1C 2R1WB 3KPLA 4X6CF 2LQRA 1L4IA 4H1LA 1LP9E 2Y5TB 3DNKA 2YZ1A 5C0RH 5EO1B 2WINB 5GSRA 3OWEA 2R56L 4OGXL 3VXSB 2ADFH 4MNQB 1U8HA 4Z76B 3RZCD 5AZ2L 1I7UB 1A7OL 2X4QA 2R15A 3C60A 2VLKA 4PP2A 4O9HH 1ZMYA 4ZUWA 2VLRD 1NDMB 4RIRA 5HVGB 4F57L 1DN0B 3G04B 3INUH 4P2RB 3QG6B 2E7HA 4HLJA 5IT2L 3MACH 2ORBL 3TEUA 4UV4H 1IGMH 3F6LA 3VFTA 3KYMA 3GHBH 1QRNB 4H8WL 3FHQA 5TF1H 3H42L 5CHNA 1HI6A 4P2QB 5K9KB 4Y5VC 5MEQA 4Q9CA 5C07A 1P6FA 3D0VB 5ICZA 2PYEE 1FZOA 4PJAA 1SMOA 1GGIH 2AJXH 5JPMB 1EUUA 1I7TA 2FB4L 5EN2B 3AS1A 3WL9A 2R1XA 5FO8B 5HHMD 1DBAH 3GMQB 1DFBL 4U1IB 1IL1B 2HLAB 4HEME 3UJTL 1LO2L 3IXAB 1FZJA 5CSZB 4QHUA 4GS7B 3FOLA 4IHOA 1TJGH 4P23B 2OBGA 3VW3H 3ULVF 4XC1H 3ARVA 1U41A 4OZIA 2NY0B 3W11C 4MX7B 3ZTNL 3V7AG 1NCAH 2EDWA 3Q6FB 4AENA 4PR5B 5FGRA 1QSFB 4PJXB 2VN7A 1OB1A 2ARWA 5GJTL 3E6FB 1A6VL 2HJKB 5KAQG 5KSBF 4LSQL 4XBEL 2OXGA 4X6DA 3KPRA 3KPTA 4YH6A 1F3DJ 3ULUD 8FABA 1BMGA 1MI5A 5LBSL 5ANMB 3EDEA 4HAFA 4XNZC 4WEMB 5TQ2L 5GHWH 5GGQH 3RUGB 4D0BA 3D2UD 2APXA 3ZE2F 4ZSOB 5ERWA 4LVOB 2YRPA 3U4EB 5KVFL 1QSEA 5DZNA 4GKOA 1DBBH 5H37H 3T0EA 4WCYL 3DV4B 4DVRH 3O45A 1T22A 5LGJB 5FEBA 2HYMA 3FB5A 2XA8L 5E8EB 5BOPA 3DETC 5D1QA 1L6ZA 2IBZX 1VB9A 1PQZA 2NY6C 3MLTA 4Y2DC 4QWWD 4AIZB 4APQB 4BSVB 4ZUSA 4K9EL 2ATKB 3IU4L 3SDAC 5I1EL 1FZKB 1C5BH 4NQDE 2DQCL 4K3EH 1NL0H 4XX1G 1OLZA 4HS8L 2PN5A 2YPVL 1WFUA 2YD1A 3S34H 5BMFL 2HFFB 3RKDC 4OFDA 1AQKL 3T4YA 1YYMH 3V6ZB 4JFHE 4RGOL 1U8PA 5C6TL 2XTJE 5SV3A 1B88A 1DUZB 1HKLL 3RVXD 3LN4B 1MQ8A 3R8BB 1TVHA 3QUZC 4L9LB 4JQXC 4WTXA 4MJ6B 3QWOB 1GIGH 3HNSL 1OPGL 4RMSA 5DJYB 3TBTB 1WBXA 5C9JB 1KLFA 3WFCL 1UM6H 5HGDA 4MCZA 4WY7L 4K7FB 3S37L 4OSUH 5EZJB 4U4BA 1A1OB 1Z9SA 1XGTA 5E8DL 3KYKH 4PJGE 2VRAA 3C60C 3CD4A 1PJ9A 2X4RB 4WFHE 4JM2A 1CLZH 4KK9D 1ACYH 3TT1L 1N6VA 2WUBH 1UJTA 3FQXB 5IB1B 1NAKH 4G8GE 3CCHA 3MBXL 4BQ8A 1KLUA 1D5MB 5FYKE 3CSPA 1OL0A 5IV2A 4M4RA 4FP8H 2DYPB 4Q6IB 4PRIA 1MJUH 5GPRA 1S7TB 4N90E 3SGDH 5FUCC 3MV7E 5T1DH 2YA1A 3KXFE 3DXAA 5JQ6H 1NGPH 5DK0B 3ZE1F 1I3GL 5F89B 4M7LT 4XI5C 3T1WA 2BVPA 3RU8L 4GAGH 1QTYT 1YEGH 3BKMH 1WQVT 4NPYB 1JNHB 1ZGLM 4EQ3A 1QBBA 1FCGA 4ZYKB 1BZ7A 3HFML 3ZZ1A 3QAZC 2MNUA 3UJJL 3FHAA 2H1PL 1TENA 5T5NG 1BQHB 4NN6B 4PRBB 1JWUB 5TDNB 4CMMA 3HI1B 1H3XA 2OZ4L 5D7KD 3NA4A 4XNQB 3UX9B 3QCVH 4DUVA 5DD1H 4NDMA 3VXNB 1K3ZA 3H7BA 3CX5K 4U1MA 4X4ZA 1U3YA 4NRZB 4NUGL 5KVGL 1A7NL 4JFHD 1PYWA 2XTJD 4HG4J 5D7IE 4DGYH 5C2UB 3IJHB 4TOYH 1CK0L 5KBNC 5I74C 2PO6B 4Q97A 3MYJA 5I1HH 4WWKB 3QUMH 1SYVB 4CMHB 1JNLL 2JF1A 3FT4B 3T0EC 1TJIL 5A2KH 3RGVB 2V7HB 3RVVC 3ARQA 2WUCH 4KI1A 1MAMH 2EH8H 3M17A 4Y5YA 5D1QC 5ESAB 3FT2B 4R7NA 1EEZA 5IB5B 5LQBL 1AGCB 5EUOB 2R9HD 3OKLA 4Q0XL 1LO4H 3FN3A 4LGRB 1IT9L 1Z5LB 2Q8BL 3IDYC 2A9NH 1JGVL 1OY3B 3R0MA 5FYKD 4LL9A 5HHOD 4P46B 3SEPA 5C0EB 4PJHF 3MLZH 4XNXL 2ERJB 1R5IB 3L9RB 4KV5F 4XRCA 1HHIA 2X7LA 2X6MA 3KXFD 1VESA 1RU9L 5IVOA 1FJ1B 1HSAB 5FKPA 5J3HD 5D1ZA 4AEEA 2R2EB 1HHJB 4M02A 5IB3A 3CMOH 3DVFA 1RULH 3TBYA 4PD4K 4DKEH 1GGBL 4JM2C 2UVEA 3HC0A 3B83A 4CVZA 1BX2A 3QJHA 2JJVA 2Y36L 1BZ9A 4K71C 4QRRB 5D4QA 5DMGD 3ZYOA 2P7TA 3FO2B 1XGQB 1QVOB 3MRJB 2P8PA 2XTLA 3DOSA 2ESVA 2V17H 4LNVA 2O5XL 3SKJH 3E6HB 2IAMB 1UENA 1YEJH 2EDLA 4W4OA 4HUWA 4DN4H 5IQ9B 4OCRL 3MRPB 2XG5A 4LCIH 5DMKB 1NEZA 1ULVA 3ALWA 3QUYC 5IHBA 3HNTL 3OX8B 2CGRL 1A1NB 4OD2B 1N8ZB 4XB7A 4JFPB 3MRBA 4NGHH 4OIIH 2NW2B 1TMCB 4JKPL 4OCMC 2KL6A 2COQA 1GZPB 1CF8L 1A9EA 3BSZH 4NHCL 3FCTB 4YX2H 4NJAH 3VH8A 4Z0BH 4U33A 5BZWA 3KLAA 2XNAA 5K9JL 2Y7QB 5C0CB 2ARJA 1U0QA 1HSBA 2JK5B 4BYHA 5C08B 3O11A 1B0RA 3HC3H 4U3CA 1NANI 3MGAA 3ALXA 1FPTH 1KIPB 1U8KB 1CD1A 2QKIA 4JPVL 1MRDL 1Z6JT 5CEYB 4KI5F 4KRPD 4N5EA 4ALAL 2WP3O 3NN8B 1RHFA 4RMVA 5EWIL 4EKXA 3DRTB 4PY8I 3KR3H 1MFEL 2NY2C 5TFSH 3RA7L 5B39A 5A2JH 3SJVB 4ZFGL 5GRZA 3L95A 1N64H 5TE7L 5E9DA 1LP9B 1UCBL 4P4KD 4X6FB 3LSOB 3O0RL 3T3ME 3WUWA 4DFHA 5IB2A 1G9NH 3MXWH 4LCCB 4JPIB 1EEQA 1J8HD 3G6JE 3EYSH 4MDIB 4Y5YC 5JW5A 5FB8B 4H8WC 1DEDA 3WKML 4QTHA 3SCMA 3BVNB 3QB7C 3TIEB 5ILTH 4XPTL 3AS0A 5C7XL 4L4VA 2HT3D 3PE9A 3AS2A 3QI9D 1AGEA 4JCMA 4AH2A 3MCKB 4LCYB 1GGUA 1CFNA 4QT5A 2W91A 2DB8A 4HX1B 5JNYA 1Q9WA 2ZWLT 3GMMB 5INDB 2R8SH 3A0OA 4L3AA 2PYEB 1HHGB 2JIXA 1LNUA 3QIBA 3RWGA 2BMKB 1FNGA 1QFWM 2X89D 1INDH 1L0QA 4MXWH 5I30L 3UTSA 5D1ZC 2ED8A 2DQGL 3VH8G 2EDOA 5AEAA 5TDOB 5KZCD 1RSFA 4OD1L 3B3IB 1B6DA 1DQJB 2Q20A 3QXWA 2HFEB 4LDEB 1LO5B 4FXKB 2Z8WC 1TETL 3FJTA 3QDGA 3K1KC 4G6FB 3DECA 2W0PA 2NNAA 2NX5E 4OFPA 3CDGA 1CCZA 3NABL 1U36A 5EBWB 1KN2H 4AIOA 1UZ8B 1D5IL 3ARDA 4Z7WB 1JYXA 3G6DL 2V5TA 4WU5B 1G7QB 4W4OC 1CG9B 5FGBC 2ZSWA 2BNQD 5EBMB 5B39G 1UACL 3DYMA 3PWNA 4YGVB 1FN4B 1IM3B 4CVWA 5DLML 3MZTA 1PSKL 2VDLH 5IIEA 5T1LB 5I73C 5D7JB 4UBDC 3MV8E 3B2VH 4M1DL 4H25A 3WUWG 4KKLC 3V0WL 4K9EC 5E5RB 4HWNA 4KJQC 3HAEA 1NPUA 3CFCH 1SBSH 3W82A 1S9WA 2DQEL 4N0RA 4XPBH 1FGNL 4YHZH 4M8QA 1SJEB 3CVHB 4ODUA 4GRLB 1WC7B 4JKLA 1JYNA 3SQOH 4YPGA 5T1MA 2WLYA 1ES0A 2Y1VA 5EU6B 4G42B 2CIIB 5L9DL 5T33L 4LRNH 4NQDB 4X6BA 5FA3A 2WBJD 3L7EA 3VFNB 3BAEL 4PRPE 2ENSA 4U6VH 4KKCC 3PV7A 1CFQB 4N5EC 5HDOA 4B50A 3CFBA 4MHHI 1R6VA 4M1GH 4MMXC 3KPPA 4BH8B 3CFKA 3OB8A 5ISZB 5IBUB 4OUOA 3RNQB 3PWLA 3MNVB 4LEXH 1JWSA 3H9SA 4R3SA 3L3IA 3CFJB 2WQRA 4L4TD 1A02N 3T77B 3QPXH 5A3ID 1QLFB 4XPAL 2R0ZL 3OR7B 4OLYL 1NLBH 1Q0XH 3REWB 4XVUD 4OCYL 2OR8A 2DS4A 3UTTE 1NFDA 5I8KH 5JLZA 5D6CB 4PD4J 5DJZB 4HLZG 5E94B 4X7DC 2ZCKH 3JBG7 3SCMC 4MJ5A 5DEGB 4N8CH 4U1LA 1TPXC 4H26B 1A4KA 1AIFB 1C7TA 4G8GB 4XMLH 5EO1A 3LS4L 4NO2A 2NLJB 3T2NH 4ZQKB 5C0AE 4IRSD 2NX5D 4XVJL 4L9DA 2G5BA 2FL5B 4XBPB 3MV7B 3UROR 4HLZH 3PL6A 3Q0HA 3Q3GB 4KXZI 4ZTPL 4QHLB 4GXUN 3GMNA 1KJVB 5FGCB 4EVNA 3BPCA 1B2WH 3MA9L 4KGLA 3QIBC 5I8EB 3QUXA 5D1XA 3IU3A 4RWYL 2DM2A 2XKNA 3QA3A 1BWWA 4DKDC 1J1PL 5F93C 1EAJA 1CK0H 1OF2B 1BVKB 4XCFH 3BGFB 1AD9B 2DLHA 2ICWB 5DSCA 3MXVL 2EDRA 3D0VA 1YPZF 4ERSH 3VRJB 5E6ID 4XHJD 4UDUA 4G8EB 4HC1H 3I3BA 1DUYA 3DMMB 4GKZA 2ADGB 5TPWH 3X3FL 2EXYC 3TBWB 4UZGA 5JW4R 4F33A 2DTML 3F7PC 4CN4A 1U3HA 4OD3H 3ARDC 4QXWA 3ROLB 1GAFL 2CJUH 3EJJX 4HK0A 1SEQH 3IDGB 5CBEB 3FAWA 5H2BA 5F7YC 5H94B 1T0MA 5D72L 3OHXA 5MERB 5JOFA 4PRPD 4DTGL 3ULUF 3MR9A 2NY3D 4YLQT 2KZWA 5KJRL 1N5AB 4PR5A 5D7IB 2VQ1B 2YA2A 4R2GC 4N9OB 4WENB 1BFTA 5IF0A 4XPGH 1FL6A 4M62L 4LHUD 4AZ8A 4F37K 1KCUL 5BS0A 4KTEH 4PRDB 3CGTA 4OB5L 3MNWB 1FAKT 3T4AA 1EX0A 1L9NA 4PJFF 4D0CB 5LCVL 2XWBB 4M61B 1ZLUH 3UTTD 1IBGL 2XZQH 1MJ7H 3RI5K 5KSAA 1NKOA 1BBDH 4NWTL 4EDXA 3WHXB 2H6PB 4HFWB 1A6WL 5J12B 1JL8A 1J05A 2YUXA 3FMGH 3LD8C 2V2TB 3PHOA 4FFVC 4FQHB 2MWCA 1CDBA 4G9FA 4U1KB 1XF3B 3AXLA 4OLZL 1J5OH 1KBGH 2WMPA 1S3KL 3FRPA 4OZGA 4EI5D 2YPLE 1IGFH 4RNRA 4QHKJ 3D48R 1XAUA 2EDJA 5I1JL 1S5HB 1WK0A 4PGZA 3CH1B 1XH3A 3JWNC 4D2NA 1FYTA 4LU5L 2VDOH 3K74B 4Y1AE 3U36A 2MFNA 4EN3B 5DEZA 2F8VA 4KQ4H 2VTFA 3WE6A 4PLJD 3TZVB 4MJ6A 4U6HB 1ZT7A 3WLWD 5KS9A 3JXAA 3TNMB 2M2DA 4WW2B 4XWGH 1UB5A 5C9JA 5HGAB 2DQHH 4AMKL 2MPAH 4K7FA 1X6NA 4X80L 1NMCC 5DF0A 5JORA 5IVXA 5DDHA 5J1SC 4H5SB 1EFQA 1U93B 4LFHG 3TVMB 4TUOB 3MRFA 3PHQB 3KHQA 4JRYE 3N1FC 4ZAKA 2DLFH 3PL6C 4HDIB 5IB4A 1CBVL 3WD5L 4YHPA 1RIHL 5C9KA 1HEZB 3V0VA 2BVQA 3MRCA 4NO0D 4Z7NE 3QUXC 2K3TA 4IOFC 5D1XC 4R0LB 3MJGX 5IKCB 2R69L 1XR8A 2DI8A 1L9MA 3MODH 5CCKL 1RUAH 4YK4B 3OTTA 1V5JA 4MA7L 5B38B 2WY3A 1NCCL 3L3DA 1XF1A 5F9AC 3P40A 3BWAB 5DURD 3MPCA 2B1AL 2BRRH 2AXHA 2VDRH 3HLAB 4Y89A 4ODVL 4PJ8A 2Q86B 5E2VL 4RGMB 1HDMB 1EMTH 3F5WB 5A2FA 2Y9RT 5GIRA 4DKFH 1U3HC 4S1SH 4IRJD 4J4PA 1C08B 1YZZA 4G5ZH 4AIXA 1X5ZA 4X4XB 4LPUA 4IOSD 2OS7A 2W0FA 3PWJB 2X2YA 4M48H 2QR0B 3OB0H 1YY8B 4HJJH 4PLNC 4U1SA 1NBYB 3IFOB 1XEDA 2D31A 2UWEE 1A14L 4ZXBA 3RTQB 1INQB 5FXCH 4TYUA 5I1LB 3F12B 4XNQA 3BH8A 3W5MA 5ALCH 3CMGA 3KPSE 2YPLD 3EUUA 2IALA 1GOGA 1PY9A 1LK3L 3L7FB 1AKJD 1RIVH 1YEDB 3V7MA 2VLMD 2D7QA 3KLHD 3D9AH 5E4EB 3HCVB 4U1JA 4U0QB 4ZFZA 2D4DA 4WUUE 4NQEE 5B3NA 4UB0H 4P5TB 2Q76B 4R4ND 3IJHA 5GRJH 5KSAC 3EYVB 4U2YA 5F7FA 3N85H 1OW0A 5CIPH 4X8JA 5IGXL 2C9AA 4WWKA 2GTWB 4KROB 5E70A 5I17A 2X41A 1S7VB 1XF5A 2LVCA 1K8IB 43CAA 3PDOB 4ZPTA 1T03H 2I07A 2DDQH 4X6CB 1A3QA 2EYTB 4NWUL 3TH4T 3VFSA 3CLEL 1ZTXL 1AC6A 5DJ8A 3B5GA 4WO4D 5DJ6B 3QDJD 4JFDE 3K2MC 1MCSA 2RB8A 3CVHL 4XCCL 1E4XH 5AD0A 4QRTA 3MJ9H 4K7PL 4OLWH 2MKWA 5FCSH 2GUOA 2DI9A 3SKOA 1R5IA 2GSGA 3RBSA 4FN0A 3BT2L 1DQLL 1JK8A 5HDBF 5C09B 1RVFL 2B0SH 4UINH 5T1KD 1BGXH 5I1KL 3GUTB 2NR6C 1DVFD 1I7RA 1HQ4B 1I9RL 3TPUA 5E8NB 2R23A 1IQWH 1V7NL 1KULA 4TTDD 4I5BB 4GAJL 4YQXH 3V6OE 2O61A 5LJYH 2FD6H 3IFNH 1PKOA 4QRPE 1M71A 1H5BA 3IDXH 4ZAKC 5IROA 3TWCH 5JW3L 3LB6C 5EOTA 3NFNB 4I2XA 5HY9A 3BQUB 4GRMA 5CJXC 4Q9RL 1WFTA 1S7WB 3FB8B 1CYGA 4I77H 1RJLB 1FL3B 3FO2A 2V9QA 3QCUL 1P69B 5CSGA 4FNLL 3EOTL 3MV8B 4Y8AA 4WV1B 1JFQH 5ENWB 5JA9A 3HB3D 4N1EA 5DHYA 1ZOXA 1S78C 3N1GC 4I0PA 5DHXB 4JFQA 3WFEH 2F53A 1U2CA 4YZFF 4JR9H 3KPSD 3IDNB 3TV3H 3DX7B 4YDKH 3V5KB 2OLDA 4PJ8C 3NAAL 1OD9A 3CC5B 2I26N 3GRWA 4GSDL 5EC1B 3NH7L 3MRLB 4JFPA 4I48A 3N9GL 5JOPD 5J6GB 2NW2A 2DD8L 4WUUD 1F58H 4J4PC 3U7WH 4KTDH 3MRMB 2C3VB 5D2LA 4CJ0A 3I3DA 1JGUH 2FJGB 1OTTC 2VE6B 4XCYA 2WSKA 5C0CA 1XF4B 4QNPF 3IFLH 3EFFB 4ZD3H 1KIPA 1U8KA 4ZXBC 4KJPC 1JWMA 2FDBP 4O5LL 3S4SB 4JB9L 1OAUH 3SO5A 5IG7A 2O5ZH 2AVGA 4KQ3L 2OR7A 3VD7A 1LE5A 1IGYB 3BKYH 4JHWL 4RAUB 5I6XC 1W72A 1UWGL 4JFDD 4WNQB 2HJFB 1H8OA 4FOMA 1F11A 3VWJD 1D9KB 4HQQL 1NLDH 4YDLB 2FSEA 1RZJH 1AGFB 2PNDA 4YUEL 4YHML 3LEVH 5J57B 4NT6A 3IXTB 2J4WH 5HI5D 2J8UA 3MJ7B 5CWSA 5CEXB 1N4XH 3TESA 5EPMB 1FG9C 1OW0C 2NXYD 2H2PC 1R5WB 5AWNL 3EYQD 1H3VA 2AW2A 5C0AB 4M5YL 4OAWA 3WDIA 3TBSA 3WMSA 3BDXA 2Z8RA 5FB8A 1MJ8L 2B1HH 3GFUA 4LAQL 1I9IL 2GSIA 1KF9B 2E9WA 4QRPD 3GIZH 4BSWB 1F6AB 2IBGA 4PV9B 5FYJE 5GRUH 1BJ1J 4GXVL 4A6YB 2DWEA 4HMDA 1AE6L 2OL3B 3JWDH 4ZUUA 1B0WA 2IQAB 4DVBB 3VXUE 4IMLB 3OJDB 2PCPB 1HNGA 2VIRB 3VWKB 1NAMB 1S9YB 3I9GH 3QJFA 3RZWA 3OF6A 4WW1B 3SKMB 1QACA 4U1GB 3OZ9H 2IPTH 3VFRA 3D18B 3T8XB 4OM1H 5B4MC 5IROC 1H5BC 1KEGH 3EIFA 3BDYL 3GIVB 3GRWH 1CL7H 2ICWI 5HHQB 3WDJA 2HLFC 3QIWD 4OCNC 3AAZA 1EBAA 1DSFH 4L3ED 1Z9OA 3L3HB 4X5WB 5ADPL 1AXSB 2UUDK 3GJEB 2P5EE 3SDCA 3GSXA 4IM8A 1CICD 3EO9L 5IHLB 4NC1C 1F8TH 4I0PC 3T0DA 2VDNH 3UJIL 3RWHA 3DRQA 4I13B 4FS0A 3HG1A 1CDIA 3KG5A 4QHNA 1MLCA 2A6KA 4MAUH 1NMAL 3RQ3A 1CLOL 1HHKA 2AAVA 5L88L 1N5YL 2AEPL 1JZ3A 1D6EB 2NY1B 3OAYK 3G6JF 3IDUA 5FV1L 1L7IH 1W72H 3K8KA 1OWWA 2F19L 5BO1L 2YC1B 4D9LL 5ID1A 5HHVH 1KT2B 3HI5L 4GAFB 4NZJA 3I6GA 2LFGA 2EYSA 4L3CB 3MRGB 3O9WB 4BZ1L 4TUJB 3C5JA 1QYGL 1BQLH 4BQBA 1YC7A 4GKNA 3R06A 2MCPL 1WTLA 4G7VH 1M7DA 2QSCH 4O2EB 4HUVB 1OAXL 4UOW0 2BY0A 3WJLA 1PG7L 2YPLB 2RCSL 3FQNB 2PUQT 5L2KE 1DBJH 4QF1A 4UDTA 4O2CB 3MUGA 1JCKA 2M1KA 1AHWB 4LLVA 4OZ4B 4L29B 4XXDA 1UB6A 4Y1AB 3VXTA 4TRPH 1NCDH 3IFPA 3E3QA 3HRPA 1ODAA 3BUYB 1Q9LA 4RFEA 5DA4A 2ZJSL 1MF2H 3VXUD 3QHFL 4P59H 5LGHL 1PX3A 2YZ8A 1MREH 3T77A 1NC4D 4YXKL 3BRFA 3KPOA 2D7MA 2NYYC 2VL5A 1X4XA 1NCWL 2AEQH 1NSNH 4PJHB 4RGNC 1QLEH 5DRWA 1KTLB 4NFDA 5DJDB 4NFBA 4G80B 5HJ3B 2D03L 4YXHH 1GOHA 5T3XE 4JRYB 4YAQB 1Z2KA 1MRCL 1WF5A 3ARFD 2EXWC 4E41A 4M7LL 4UUJA 4H26A 3DO7A 2YBRB 2P24A 3HE7D 2MCG1 1LDSA 2XIDA 4BH7B 5C1MB 3F58H 3FQUA 3GO1H 4WDIB 1Q1JL 2HP4A 1J11A 1RZGB 4JKKA 5F21B 3O3AA 2XRAH 1JV5A 2P5ED 4H0HB 4PJBF 4LASL 4F2MB 1HOCB 4XZUB 4ZS6C 4GG6F 1H9VA 4R26L 5F3HB 2X1XR 4NYLA 4F58L 3U9UA 1CS6A 3UZEA 1MPAL 2H2SC 1FNEA 4OV5B 4NO5B 4DK3A 1ZGLP 2AV1A 5I16A 5HYJD 1G0XA 3QULA 1C5DA 4ZFFA 2HTLD 1IRAY 1FHGA 3D0LA 3RDTA 5JO5B 4MXQA 3OG4B 4OCWH 5EZOL 1IVLA 5GGSA 3MRQB 4XPHH 1CGYA 3EFDH 1OCWL 3QQ3B 2GJ6A 5IEKB 3NIFF 3MGTB 4LVNC 1D5XB 2OJZH 2OR9L 3WN5A 3F65A 1EFXA 3L3GA 3O6KH 3SDCC 1PZ5A 4S1DC 1BD2D 3EYOB 2XN9A 1JGDA 1G1CA 1YEHH 1ROWA 4K3DH 3NPSB 43C9A 1T1XA 1ZHNB 1J0HA 1DQDH 2YEZB 1T1YB 4HT1H 2PXYB 2NXZB 2EC8A 4NQEB 1AGBB 4KPHH 5CJQH 3DWTA 1N3NA 1JF1B 2P5WE 1F4WH 3NIGE 4PB0H 3TO4D 2BXYA 4ZUTA 1IJ9A 1K6QL 1DLFH 3LMJH 4XTRC 4TVPL 4KRNA 5FAAA 3ULVL 2IWGA 3WJLC 3ZT5A 3CFEB 2YWYA 4W6WB 3S8WA 5FM5O 3D3VA 3MFFB 4UI2A 4Y4HD 1QR1B 3W81A 4V1DE 1Y6NR 4MA3B 1JZ2A 1ZA6A 5FCUL 2C26A 3EJZD 3E3QC 4OTXL 1HINH 4M7KH 1MCPL 1WBYB 5J11B 4FQ1L 1T3FA 1S8DB 2BNUA 4GXUM 1OSPL 1KFAH 3AREA 5KTEH 5K9OA 3Q1SH 4FQXA 5E8OA 4MA1B 1QOKA 4QRQB 3V5HA 1NFKA 3T3PE 3PNWB 5ID0B 3OKKB 1KB9J 4U6YB 3U30B 3TZVA 3D85D 2MTPA 3FFCD 4OIBA 4JFEE 2GKIA 1EO5A 2J2ZA 1H3GA 4UT9H 3WIFA 1P4BL 1T21B 5LG1A 1FDLH 1MWAB 2DMBA 4MA8L 4PBXA 3LRSA 3EYUH 3TJHC 3PGCA 3G5VB 2XZCH 1N59B 4ODBD 1ZANH 3LQZB 3P4LA 4M7JH 4I3RH 1RY7B 5GS0H 1FL5B 1LWRA 4TSBH 4HKZB 4OF8A 3QEGL 3IAGC 2KDGA 1Z3GH 1H15B 4GUPA 5CMAB 12E8H 1VKXB 3PQYB 4MLSA 1AR1D 4F7EB 3IS1X 3NPZB 3O6MH 2E9IA 3BXNA 1ORSA 4DAGL 4NKDB 5IHUL 3HE6B 2VYRE 2A6JB 2P5WD 3RDTC 4JHZA 3ZHLA 5IFHL 4F7CA 1PZUB 4ZUVA 4MXQC 1A9BA 4K3JL 2AJZA 3W39A 2CK0L 5BRZB 4QXGL 4HXAL 4UU9B 4PV8B 3WN5C 2ADJA 1QO3A 5HYSB 1B4RA 4FTVE 4MAYD 3QEUA 2E7LA 1HH6A 5AYUL 4EXPX 1B0GB 1UWEL 3ARBB 2KUTA 2DQDL 1VEOA 3PJSA 5B8CA 4JFZL 1OAQH 1KTRL 2E6QA 3ES6B 5DGQA 1FVEB 5KAQF 3IKKA 2DKMA 1B4JH 3GK8L 3VJ6B 3J8F7 2EZ0C 2WZPD 3QEQB 2ICEA 5I75B 1MY7A 3VXOB 1Z0NA 3ZKMC 3V52L 4XCEA 4TULL 2BC4B 3WSQL 3H3PL 2E9BA 4XNYL 1S7RA 2EKSB 5E8PB 5K93A 1MHPL 2CKBB 3F7YA 3ZDYE 5D9SB 1OP3H 4NQSA 1X5GA 3KWWA 4P5TA 2Q76A 1LQVA 3C87A 5KOVC 1IAIL 4MJID 3WBDA 3GMLB 1Z9LA 4QY8B 3FN9A 5FYLL 1O7SA 5JHDB 4OFYD 4NBYB 1IM9D 1PFCA 5E56A 2Z35B 4OZHE 3SE9L 1JMXA 1WT5A 3OKMB 5JXEC 2D0HA 3GSVB 1RI8A 1NUGA 4PTUB 2HJLB 4JVUA 3M07A 4HWUA 1OM3H 1I1AA 4CU6A 4RAVB 1CGVA 4R8WH 3EO0A 2XXCB 5LXGH 3AREC 4EUPB 5I1GH 4M8VA 4NZDA 4FQXC 3O3EA 3GBMH 2LE9A 5I2IB 2H8PA 5D8JH 2UZYB 4YHKH 1UQSB 4NQCE 1OGAA 1Q94A 3HNVH 5ELIA 4X9BA 3MLYL 3ARFB 4PJEE 1M7XA 3DARA 2VLLA 3S36L 4JN2B 5C09A 1I9EA 1YY9D 4LLDB 2DM4A 2VKWA 4W68A 3FB7A 1Q72H 4NP4H 3KYNA 1KN4L 2BOBB 5EA0L 2O5YL 2GCYA 3UTPD 1T04B 5SWZE 3BFOA 1DE4B 3QEHB 4BFIB 1KPVB 2BVOB 4R97C 5FK9A 1RURL 2BNRE 15C8H 1MRFH 1YNTA 3DV6A 3T65A 4ENED 4F3FB 2WP3T 3LOWA 5JZ7D 1UXSA 1W2KT 1JYVA 4MWFA 2BSED 2G60L 4HGWA 1BQSA 1DCLA 3BP6A 5I1CL 1X5LA 5EOQL 1T0NA 2KPNA 4XMKL 3BKJL 5DQ9A 3SY0B 2JJSA 1YMHA 3B2UC 1N0XH 2AERT 3WFBL 2P46B 4XGZA 3WV0A 1IAII 2QADD 3LKNB 3MRLA 1MVUB 3GSNB 1ZEAH 4W6YB 1ZGLB 5KSBA 1GGCL 1TCMA 2FEDC 3RWFB 3I6KB 5L2KB 3O4OC 2X1WL 2XACC 3UTQB 4EI6A 4UAOB 4P2OB 5T5NF 2E7LC 5IMOB 3ARGD 5GS2D 1MCCA 2R2BA 2PTTB 4Y5XA 2ARJQ 3C9NB