4PJGA

Structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
269
structure length
264
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 264
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pjgA01
2VZTA 3HE7C 5FCUL 1VGEH 2GY7B 4KK8D 2HN7A 3IETA 4HCRL 3VXSD 1KJMA 4L4VE 3OG6B 4XPAL 4L8SC 3ZDXE 5ICZA 3DPBA 3MR9B 1T1ZB 1W2KT 5K9OB 3FTGA 4GH7B 5IHBA 3BKMH 1YN6B 3OAYK 5CZVH 2LFGA 4P5TB 3HN3A 1OP3K 4MNHB 4NZUL 5J1TC 1J9CT 4G5ZH 2VDPH 4NP4L 4HK0B 3EYFA 4KAQL 2W9EH 2MCG1 5JQ6H 3SN6N 5FIEA 5IM7B 4U1SA 5F7UA 3TJHA 3ZYIA 2X9YA 4JLRB 3MRKA 3H3BC 3V52L 1MCQA 3SGDH 1JPFA 2R2EB 1U6AH 5I8CB 2F53D 3U9UA 1LO3H 3MRHB 4MCZB 4YBLC 5JR1H 1HYSC 1IGJA 3QIUD 5D7KE 2VABA 4MLIA 2EDDA 4LCWB 3TJEL 3PWNB 5TDNA 3MRFB 3QJHA 5J9PB 3QIWB 1NMBL 5D7JD 2X05A 4AT6A 3BDYH 2AV1B 3CSPA 4AMKL 4MJ6A 1ZVHA 1QLEL 4HS6B 1NMCB 1RJLB 2AV7A 2P8PB 1QSFD 2D7MA 4Q58C 1JNNH 3BPOB 4OGAC 5CILL 3INUL 2DMCA 4RFOH 5DI8B 5JHDA 2PYEE 3RVXC 5D2LE 2GHWB 4YK4C 5JPMB 3NFPA 3FRUB 1VHPA 4XMPH 4BUGA 1FH5L 3SGEH 4XAKD 5K9QG 4WNQA 4E41B 4G8EB 4APQC 3C6LD 1OHQA 5H37H 4ODUA 2ZSVB 3CFCH 4MQSB 5CEZH 1WBXA 3MRDB 4WTWA 3GMQB 5DEFB 2ADGB 1UZ8A 1TQBC 1T2JA 2WBWB 3V0VB 1X4XA 5SWZB 1ZSDA 2X89D 2HKHL 2AXHA 1GRWA 3PHSA 3I84A 4ZAKB 3BGFC 2VERN 2G2RB 2CKBA 2ICWA 4MA8L 4M6OL 1CFQB 5ACZA 2WBJB 2VN7A 1M1SA 4OLEA 3FONB 4NM4H 1QPXA 3ROOA 4I18C 3P3YA 3BH9B 4HSQA 4AQOA 2CLVB 4EDWL 2HH0L 4R4FL 2YUXA 1T1XA 3BP4A 4JG0H 2FECL 1IFHL 1IEAA 1M71B 3L3DA 4M7KH 4XCEB 1EUUA 4NQDB 2ZPKH 2GY5A 1NGWA 3F7YA 3T2OA 5T1KB 3Q5OA 3P4NA 3O3EB 5F72S 3KWWB 3RFZC 3MUJA 3BT2H 3P40A 2APVA 3PIQB 4NJAL 3H3KA 2DLTA 4BQ8A 3HA0A 4UAOB 2W0FA 1EO7A 2XTJB 1NCDL 4IRSC 2VXVL 4KXZI 1GOGA 1T7ZA 4JM2D 3UTSE 3UTQB 2MCPH 4J3OC 1A6WL 4G8GA 2H26B 1IAKB 1WSST 5GGSY 3SKJL 2CLRB 1AKJB 1AI1L 4MD4A 2WINA 1H8SA 1FLTX 5ADOH 1F4XL 4LNRB 1JGVL 1JN6B 1MI5A 1T0MB 1MWAB 1JGEB 3E8UL 4HUXB 4XNMA 1RJYB 2JCCF 3O6MH 4M1CC 4QHUB 1X7QB 3QDJD 4NM8H 3FB7A 2JCCA 3DURB 1CFNA 4U1HB 1CGVA 3TBWB 4N0CD 1KN4L 4EVNA 4I0PD 3MJ7A 5C92A 3BUYA 4Y4KA 3DXAB 3DUSB 4TPRH 4LKXB 5FEBA 1FNLA 4ZOEA 4JY6A 4RZCA 4P9HL 1VSCA 3QI9A 4WENB 2JJWA 2VNCA 4EI5A 2P24A 3KPQB 1J1PH 5BCAA 4KGJA 4PJDF 2EH8L 4FNLL 3T4AB 3QDMB 3U7AA 1TITA 3WHE1 1B2WL 4XHQA 2X09A 3MZTA 3ULSB 3V6ZA 3P9LB 3OKDA 3QHFL 5E4IA 4PRAA 1V3KA 1WJ3A 3VI3F 4YDIH 3WDHA 1N8ZB 1H5BC 4JFEE 3QNXB 1CXIA 2BVPB 1WBYA 4GKNA 1D6VH 1U3HB 2KQNA 5L6YL 4YUEL 3ME0A 5GRJL 2I24N 3FQXA 2D7OA 2VWEC 3RGHA 5KSAC 2P5EE 3BEWA 4YFLI 1RZKC 2ED9A 3EJYD 4NJ9H 3TC9A 3TNNA 4HGKC 1IQDA 3IJSB 4FQ2H 4PB9L 3S96B 1A5FL 5EPMA 3T0ED 1FNEB 2AI0H 3TBYB 3FO9B 4OZIF 4HJ0C 1G7HA 4CDHA 1A3QA 5IEHB 2OI9B 5I1GH 1Z0MA 2X4TB 4PJHF 5EIQA 4YHYB 2CDFA 3PL6B 1WTGT 4I9WE 4OZIA 2FLBT 1I3GH 4Y19D 2X4SA 1A6TA 5HI3D 3BZEA 3UCRA 4PJHA 1YYML 4Q6IA 2VIRB 4F8QA 5HPMB 2HT3C 3C60A 4ZUWA 4POZC 5H2BB 5CIPB 2GSGB 1HXMB 3U7YH 1QSEB 3HR5B 1MQKL 5I30H 2E9BA 1KELL 4MXWH 5EA0H 4NWTH 3TBVB 1J7VR 5IMMA 3W82A 4OGXL 4RNRB 5JW4N 2WWKO 1AO7D 2B39A 3DLQR 1AGDA 1H3TA 3RNKB 2OR8A 2EH7L 3K1DA 2NCMA 3NA9L 4LAQL 4UV7H 4G6KL 3JVGA 5E2UH 3SOBL 2YRZA 2XRAL 3MODL 4ZS7L 1YN6A 5J89A 1IAII 2JJUA 3VRLF 3BH8B 4JY5H 2VLRB 1LEIA 2HKFL 2FSEB 2VZ1A 1FL6B 1VGKA 2R4RH 3I2CH 3FO2B 4JLRA 4MVBC 4OTXL 2X4NA 4WV1B 5IQ9A 4PG2C 3CZFB 5I1AB 5T1LA 5BVJA 5E56A 1I9EA 3ARBD 3T3PE 1AFVL 3GI8H 3H9SA 5CGMA 4U6XB 4MGXA 5CSGA 1GL4B 5TGBA 1RZKH 3TVMD 1WIOA 3PWNA 3ARUA 1GVIA 1XCQB 5CLWA 2FHFA 2X9XA 3W0WD 4QXTB 2AV1A 4KXZH 4OCRH 1R3JA 4M1GL 3WKMH 2VH5L 1H3PH 2IMMA 2WUBH 4HS6A 5DRZB 4JKPH 4XRCA 3BPOC 3L3JA 2FX8H 1MOEA 2CXKA 4JRYE 5JPMA 1UXWB 2A6IB 3EFDH 2IPKA 5C0FA 3ZDZF 2R69L 5C0RL 1D7FA 1QRKA 3VG0L 1EO8H 4KV5F 1CFSA 2VAAA 2YRLA 3MV7B 1L9NA 4BSVB 4ESKA 1FZKB 4M93B 4ORGA 2ZSVA 3HS0A 4XBPB 1K2DA 2DYPB 5DJYA 3ZL4H 3SE4A 2BX5A 5DEFA 2FHBA 4LCCA 2BVEA 1CQKA 2J88L 2GUOB 3ZKMD 5L2JB 1UWXH 5F44A 2YK1L 3LQZA 3OKEA 4GKZA 3ES6B 4RRPA 2AJYH 1S7RB 4Q9RL 3CD4A 2DQIL 2JIXD 5DJDA 4O2EA 4RIRA 4YWGH 4KHTH 4UUJA 2VISB 3HAEG 1JI2A 4ERSL 5GS2D 2Q76B 5IVZB 4PRIA 2XICA 4U3XA 3PHQB 3L5XL 2FL5A 5D70H 1YC8A 2AP2A 5HDQL 1S9KC 1HQRB 4YHNA 2CH8A 1CXEA 4QTIH 4LARH 4LVOC 1LO5B 3FT2A 4ZUUA 4N0RA 4ZXBD 1E6JL 2ZCLL 1N64L 2JE8A 2XZCL 5AZ2L 3GM0A 4ODHH 3UXFA 5CJ8A 4MB5A 3GBNL 2HFGH 3KXFA 1KTDB 3GEWB 4JZOB 1X5AA 3IFOA 4BFGA 1F00I 2MQCA 4G6JL 4M43H 4BELD 1YPZA 5HD8C 1IGYA 4OI8A 2H26A 3QUXC 1IAKA 4LNVA 5IBTH 3U0TA 3UPRA 1NL0L 4GRLB 1MIMH 2UZIL 4GLRH 4XB7A 2GTWA 5EZIH 3FN3A 4H0GA 2EXWC 1BAFL 4LLQA 1YYLL 2OL3A 3C5JB 5JOFA 1Q9OB 5B3JF 1RPQA 3IT8D 3C08H 2JB5L 2CDGA 4WI5A 4XXCA 4NWUL 5ICXA 1C1EL 5DVNA 3JWDC 1RJYA 1LQVA 3CDFA 5D8JL 4G3YH 3TPKA 1H3VA 4HBCL 1T7VA 2NZIA 3BD5A 5DRWB 5FYKH 3IXAB 1UCTA 1G1YA 1JGUL 4XAWH 1CE1H 3QPXH 4LRIA 3KJ4B 2E7HA 3G5YB 3LRHA 3QZWA 4LLWA 3M45A 3GSRB 1J0KA 5SV4A 3V4VL 1E4XL 1WCBB 5ADPL 1N6VA 4L3CB 5F3HA 2J4WL 4UDTB 2D03H 4Y8DC 5DK2B 1HILB 3LKSB 4ELKB 1EUTA 3MMEB 1J05B 4L8BB 4Z7NE 4HKBB 3QEHB 1TQCB 4ZFOA 3O81A 2OK0H 2HFFB 3KPMB 3EYOA 5HHOB 3MBEB 3BXNB 3T2NH 1C8PA 1KLGB 4OM0L 3QP3A 1TFHA 3BKYL 5ISZA 1K6QL 3QDMA 1FNSH 4X8JA 4WWKC 1NGYB 1Z9SA 3TO4B 4YXHH 1RJZB 4HKZB 3ULSA 4G42A 1WC7B 3P9LA 2DBLH 5DC4B 4M6MH 3WCYA 4Z6AT 2O93L 3QYCA 3MRNB 1INQB 3MCKB 1TETH 2E7LA 1U3HA 4Y16D 3HLAB 2NY6D 1TPXC 5CEXB 1ZHLA 3S4SB 4GG6E 3HPJA 3DJ9A 1MFAH 3VGAB 35C8L 4M48L 1NLBL 1ZXQA 2H2SD 2ZCKH 2V17L 5J56B 4YPJA 4AY0A 4S11A 4NRXB 1W8OA 4XNYL 5DJXA 4DKFH 3S96A 4H0HB 3BI9X 1VFAA 5CS7A 4I77L 2YN5A 3MUGB 4OKVA 4BH7B 4YHLL 4NBZB 1SYSB 3PQYA 3EYSH 2D9QB 1LQSR 1V3JA 4TULL 5SWQB 3R8BB 4YIQB 1TZGH 4JRWA 4UINL 3JTTB 2HJFB 1BBDL 1RVFH 4NHCL 4PJIB 1MUJB 4CUCA 3O6FC 3CVHA 4NHUB 5E95B 4AEIL 5E6IB 4LDOB 2NXYC 3MRRB 2BY3A 2NQCA 3OF6D 4I3RH 5GQBA 3VFWA 2PCPB 2VIRA 3VW3L 5H2BA 3O4OC 2GSGA 4PJAF 1A1OA 1HXMA 1YNTA 3MJ9L 5CJOL 4Y5VB 4PJAA 2F5BH 3TCXA 1Q72H 3G6JE 4JZJC 1CI5A 1P4LB 2R0LH 3S4SG 3F6IA 4PRBA 4JDZB 1CN4A 1MQ8A 4P2OB 3LB6D 3D0VA 5CHNA 3RNKA 2JTDA 2FX9L 4UQ2A 5D71L 3F58L 3SE3A 3PG2A 3SCMD 3GRWL 1RURH 5EBLB 3A6BH 4ZD3L 1T89A 5ACLA 5J3HC 2V2XB 3H6JA 3PDOA 3TIDA 2BVQB 1OAUH 3S37X 3CX5J 3VH8B 1UB6B 5J6GB 1MVUA 4RDQG 5F3BB 4P3DB 2A74B 5HPOA 4QHLB 1OAQL 4QRPD 4OGZA 1MCSA 5GGTA 2VLRA 2VDNL 5TE6H 1YEEH 1RSFA 2J6EL 2BVOA 4TSBL 2CIIA 1UWXK 2YUZA 4KUZH 1FVCB 4WV1A 5EB9A 1ZLWH 4LASH 5DLML 1N5YL 1KN2H 4WW1B 2V7NB 2VB5A 5H35B 5SX5H 3KNBA 4YZFF 5B38B 3L95B 4OCYL 1KJ2B 1JWSA 1CCZA 5CD5C 4QXWA 1V8HA 1ZT4B 3KPNB 2H1PL 4X7FC 3ABZA 1XCQA 4GMSH 5I0ZA 1I1RA 3GHBH 1EHAA 1RZ8A 3QHZL 3IKKA 2B2XH 3MXWH 4DTGL 4X99B 4L8DB 3DVGB 4LVNC 4UQ3B 5EZJA 4Z9KB 3NCYS 2VXUH 4P2YA 2DF3A 3RGVB 1BIIA 4NRZA 3ARTA 3O2VL 3VH8G 5IQ7L 5JUEL 5HYJE 4YHZH 1TDQA 4HFUL 3RWCA 1T7XA 4M93C 4WUUB 4QRRA 5CIPH 3QWRD 4OB5H 4U1GB 1L6ZA 5BMFH 5HYEA 3BE1H 5D96B 3GSNB 4BKLB 1EEYB 4BFIB 4OLXH 3ARGA 3VXUB 1QA9B 5ID1B 5B38G 3QUZB 1QKZH 3BQUC 4P49A 3ES6A 5C0AE 3UBXB 3VWJC 1BZQK 1PLGL 1LEKA 4XVUC 1T80A 5F7LB 4WFGD 1AY1H 1T04B 2Q8BL 2VISA 3MLRL 3T0WA 3VFNA 2HFEB 2D7TH 3HNTH 1LK3H 5IW3A 1PDKA 2Y6SD 2QTEA 4URTB 3TN0D 1PY4A 2V9QA 2XA8L 4HLZG 3QEUA 4Y7MA 5I1IL 5ID0A 1UM6H 4QWWC 4JO2H 3FFCB 2R2BA 3CVIH 4DOHB 1KT2A 3WNKA 2ZJSL 5ESAA 2BNUB 4ETYA 1T0NB 3UJJH 1I3RB 1WIUA 4XP6H 1JHKL 5HVHC 3WJLA 3SDAA 5EWIL 5H94A 3HAEH 1YMHB 3QIBD 1A7BA 3BD4A 2YD6A 5B4MC 3UBXG 1LO2L 3H7LA 3QFJD 4FN0A 4WO4A 4TUJB 3NFNA 4MAYD 2QQNL 2CK2A 4S1SH 3SGJA 5D1QB 2YBRB 3IGAA 1J0IA 2Q8AH 2DLHA 5DRWA 1IM9D 5B22A 1P84K 4K07A 4DWHA 2Z93B 5DD6A 3FB5A 3QRGL 1EGJL 3OKKB 1Z9LA 3G5YA 4HKXA 1NAMA 4I3SH 1DVFA 4DGIL 4EIGB 5HDBE 3HUJE 4UTAL 3WS3B 3X17A 2DM3A 5J1AA 5DK2A 1HILA 4XP4L 2CQVA 3MMEA 1J05A 1Q0YL 4L8BA 2XTLA 3FT3B 2YPLB 3TV3H 5EOTB 4TVSa 3MBEA 3PWJB 3GSWB 4AENB 3OAUL 3CLFH 3TO4C 1MAML 3ARDA 1ZK9A 3BSZL 4BZ2L 5IUSA 1MLBA 2XPGA 1HDMA 1T1WB 1OAZL 3LDBC 4G9FB 1UFUA 1FVDA 3AUVA 3MRNA 4KROD 4H0IA 4XXDB 5JDSB 1KGCD 2EDYA 2Z0BA 3ZDYF 1OGAD 4LSPH 5TPWH 1JTPA 2G5RA 4LLYB 4ZQKA 1T7YA 3MUY1 1NCAH 4X9GA 1MVFA 1J1XL 2DMKA 3G9AB 5I8OH 2XWBB 4L3EE 3HZMB 5F97E 3ZE0F 2Z91B 1BLNB 4UIKH 2WWMD 1A6ZB 1XF1A 4F2MA 4I0CC 4N0UB 2P49B 3FQWB 3KPPA 4R96A 2HMIC 2E27H 2Z31B 1EO5A 3OMZA 5IB3A 5E9DD 4LCYB 1CXHA 3PP4L 1SYSA 1NFDE 1UH4A 4YIQA 1OAXH 2FYYB 3C5ZA 3JTTA 5FYJU 4PJGE 2F19H 1HEZA 3K7UA 2O5ZL 4EIZC 1FG2B 2RIKA 3STBA 1NANI 4B0MM 4BH8A 3VMPA 2DS4A 4KVCH 3SE9L 2ADJB 4LQFH 4OQ1A 3LEXA 4JR9L 1ZOXA 3ZTNL 1XCTB 1OWWA 2AEWA 1XGPB 1G6RA 3HZKA 3MFFB 1FCCA 1N6QH 4KK6D 1MCEA 5GRWA 3ZYOA 2EIDA 2GSIA 5FUZL 5BQ7B 1JPGB 3I50H 3ERYA 1WFTA 2ZOLB 1TCRB 4NNYB 1HHHA 4R0LA 1J12A 3L5WA 4NC2B 4KRMB 5FYKU 4LDEB 1P4LA 4KKAD 1XF2B 4GRWE 4Y4HB 1NFDA 4X4MA 3REVA 1FO0H 1IC7L 1RHHA 2BP3A 3MNWB 4PJGA 5SX4I 3LS4H 4Q74A 4U1LA 3DI2B 2V2XA 4KRPD 5J6GA 4RAUB 3X12B 5A3ID 3BIAX 4P3DA 2BFVL 3LKNB 4QHLA 3LEVL 1KIQB 3RTQD 2X7LA 4XP9L 3ALWA 3V0AC 1KCUH 3H3PH 4UU9B 1ZANH 4Y0GA 3ULUD 3PABB 3MGOB 5AUMA 4R2GB 1FL5B 1FNGA 5BRZB 2V2WB 4WW1A 2V7NA 2APFA 4OUOA 3TBTA 3TT3L 1LO4L 3HC4L 4PGEB 4OFPA 4P4RA 3RZCD 1LE9B 1KJ2A 1OQOA 4RAVA 3MLVL 3SDYL 1OW0C 3KPNA 5T3ZH 4XPHL 1AJ7H 2IPTL 3RU8L 1RUML 4OM1H 3GBML 5FO8B 1FGNL 4EN3D 3NCMA 1Z6JT 1YMME 1FFNA 5DGQA 2GITB 4X99A 2B4CC 4WFED 4UTBH 4JFZL 4IOIB 5CSZA 5INCB 4KI5E 3VXOB 4RQQA 1YEJH 4KQ3H 1RULH 3RGVA 1AIFB 4JM4H 2PN5A 4P9MH 1U3YA 3IXTB 1P4IH 2NY3C 4FMFA 1D6EA 3Q6GL 1S9WB 1MHCA 3PWVB 4H25A 4Q9QH 1U58A 3SDCB 5IGXH 1SEQH 3GSNA 3VFRA 3MRJB 1EEYA 4BFIA 1YEKL 4F33A 1U8IB 2CR6A 3PGDA 1UQSA 3TBSA 5E2WL 4GAJL 3CPLB 2I5YL 5DUMH 1A6VL 2I25N 5CZKA 1I9RL 1OB1B 3RWEB 1JPSL 1P2CB 4MNQE 3IYLW 4D0DB 4K3GA 1IGTB 3GIZL 4GT7A 4GUPA 5IWLA 1MJ8H 4PLOB 4LU5L 1CTOA 2GTZA 2EEDA 2MSPA 1WK0A 2AJXH 1U8MB 3JTSA 1KCVL 4YHOH 1UWGH 3EHBD 4ENEC 2HJLA 1I1FB 4WJ5A 4JKKA 1XR8B 1V05A 2IAMB 2PW2B 4UNTA 1CXKA 3T0XA 1U91B 4ZMAT 5L7XL 2UWEE 1X5LA 4M00A 4R7NB 4PJ9D 1B9ZA 4L9LC 5B39B 2PYFB 2FRGP 4HUUA 3QEQA 1JK8A 2BRRH 2DQUH 5HHMD 3ULVL 4LEOA 2LV4A 2BMKB 2KUTA 3FMGL 5F1KC 4HFWA 4JQIL 4NQCA 3UP1A 5DMGC 3UTTA 5ITBL 1EFXB 4LHUG 2NY5C 3D3VE 2B0SH 4MA3B 1QVOB 1TIUA 1A0QL 2GJZB 2QLVB 4M5ZH 2OJZH 2ZKHL 4EKXA 4G59A 3WFZA 1DQJB 2B7DT 1YMHA 1JWMB 1CLOL 3AS2A 4DQOH 2J2ZA 2WSKA 4H88H 3GUTB 3CH1A 3B2UC 3DSNA 4JFFA 3A6OA 2F5AL 1BD2D 3E3QC 3ARED 3H9HA 3O3BA 3TWCL 4XBGA 4NNPH 1D9KA 4HLZH 3OKLB 5D1QC 4GO6B 5IK3A 3GSXB 4ELMF 4DZ8A 1E4WL 1PKQB 2J8UE 5CEZE 4XGZB 2Z93A 4U2ZA 4D9RE 3OKKA 4RGOL 3U0WH 4ELMA 2YC1A 1C08A 3IDMA 3BMVA 5BJTA 4X5XB 3ALXA 3MSPA 1AR1D 4JKMA 3CNKA 2BVYA 1XF3A 5CJXC 4P23C 5FO7B 5MEPB 5I6XB 4XVTH 1U3ZA 1FZJB 1FL3A 5T5NF 2E9JA 1L0YA 3CZJA 3DMMB 1DLHB 1A3LH 4MYWB 4OZFG 5SX4H 3T65B 4PRPB 5IROC 2F15A 2QSCL 4NZTH 1R3IL 1TVBA 1BWMA 1UXSA 3KYNB 3ECBB 4WTXA 2RGSA 5I1JH 1N3NA 4XXDA 4Y5YC 4LIQL 4M61B 3MZGB 3D39A 4U05A 3G04B 2J1KA 1JHLH 4IRJD 3VWKC 4NO3B 2VYRE 1G7QA 2KH2B 3FJTA 3WNNA 2AJZA 4L8SA 1YECL 2APTA 4ZDHA 3MXVL 3TZVD 15C8L 4Q2ZB 3MRGA 2NY5H 4TTDD 3Q6FB 3WNMA 4GJTB 5EBWB 4Y2OA 3DNKA 2VMFA 2R0WL 4X7EC 2DWEA 4Q0XL 5GS0L 2XYCA 5FA3B 3HRPA 3NTCL 2R56H 3M1BA 2BNRE 1L7IH 5EULV 5DXWA 4JRXD 5GRUL 2W60A 3MACH 1PSKH 4J4PD 1YNLH 1FLRL 3MTRA 3OB0K 1CK0H 2F54A 3PE9A 5GGRY 1P4BH 1TJIL 3VFMA 4TVPD 5F8QC 1KFAH 2AJUL 1FIGH 1GPOL 3CSYA 3IRZA 2A6KA 5E99L 2EDJA 1E4KA 1XGPA 3MFFA 4YHML 4XNQA 3Q3GA 5DJAB 2MWCA 2PUQT 1UC6A 2ID5A 3SKOB 4LBEB 3VFOB 3GGWA 1DTUA 1ZTXL 5AEAA 3ZT5A 1OTSC 3I3BA 4PS4H 1KCGC 2BSTB 3MNWA 3VJ6A 5E00B 2N56A 3WSQH 2IH3B 5AG8A 3BPCA 3R4DA 3RKDD 3JXAA 2IQ9L 1J8HE 5HGDA 2VKXA 2YRPA 1WZ1L 5HYSA 3V8OA 4TTGA 3EDKA 4E9LA 2AK4B 1JZ4A 3KPSD 4NOBA 4O4YH 1J0YA 1LP9E 3P4LA 5GSRB 1I7RB 1YDPB 3MGOA 3EO0A 4FQLL 4KHXL 3DX8A 4NNXA 3SJVD 3WFBH 1VKXB 4XP5H 1G9NC 5D1ZB 1UB5B 2ATPA 5D7LE 5F1SA 3H9YA 4FHBD 4GAYB 1B90A 2NY4B 1TZIB 1SVCP 4PJXB 1I4FA 3EOBA 4QHMB 4WFHD 4JFPB 4Q7DA 3U83A 3QQ9D 3DGGB 1DLFH 1TJHH 4Z7UF 1MEXL 3IAPA 4JO3H 3QJFB 1JBJA 3OWEA 4F80A 4OCSH 3GJFH 2E5EA 4NKDB 1V7MH 4Z7UA 3VXOA 3VFGH 1GIGL 2BZDA 3K0WA 3AB0C 5C0DA 3GKWL 2C3WA 1N4XH 3IXTA 5F1NB 2VO5A 2X1PA 4LSTL 5T5FH 3U9PH 4YBHA 1MCPH 1G7LB 1S9WA 1XIWC 4P48A 3S97C 3DVNB 5GZNC 2ZUVA 4GBXD 3HCVB 2X4PA 2CLZA 3SDCA 3UDWA 2IANA 5DHVA 3AFLA 4C83B 4UOW0 1B4JH 1IGMH 5D93C 3T77A 5BW7C 1J0ZA 2YOCA 3QEGH 3EGSA 1M7DA 4RISL 4CVZA 1RD6A 3EDDA 4PJDE 5HHVL 4RBPK 4XCCL 3ZKNC 2EO1A 1F58L 1RIUL 5KANI 1AXIB 2BNQE 3QIUB 4P4KC 4Z7VB 5IB5B 2IAMC 1XR8A 4D0CB 5LBSL 1B0RB 1BP3B 2XQYG 5D7JB 4KTEH 3TJHD 2Z8WC 2CSPA 1G0YR 1GGIH 5T33H 4Z7OF 3VRJA 5HVFB 4K3JL 1X5XA 5C0GA 3R06A 1QSFB 1G9NH 4UILH 5I73B 4RGMC 4Z5RB 4PP8C 1EFXA 1F6AB 4XB8A 3DYMA 3SPVB 3OPZL 4N0YL 1N2RA 4O51A 1A7PL 1U41A 3C6LB 5IMLB 3OZ9L 3NGBB 1HHIA 3GHEH 1CXLA 2VUYA 1ZHKA 2WV3A 5CJQL 2VQ1B 4XPAH 3DHJA 4H1LB 3U46A 2Y72A 5LQBL 4WU5B 3DVFA 3FAXA 4PJ8A 5E2TH 5KSAA 2A1WH 4JVWA 2JJTC 4P2QA 4Y89A 4NP4H 1HHGB 4YNYA 4HLJA 4KAQH 1AQDA 1HKLL 4AIZA 5IV2B 1GGTA 2AK1L 5D7KD 4PJEE 3V52H 3QWOB 1KULA 1R5VB 1P1ZB 1S7TB 1N7ML 3I3EA 5KVGL 5ETUA 4V2BA 3KLHD 1KCSL 3ISWA 4WHDA 5JA9A 4OI9A 1KIUA 3EAKA 1KB5L 3ARPA 2PO6C 1S7VB 2CK0L 2CDEB 3UTPE 4NQEE 1FZJA 3WE6B 1KLUB 5JIHA 1S7XB 2H6PB 4AMKH 4U49A 3M17A 4OLUL 1ZLUH 3SE8L 2V2TB 1QLEH 1WWCA 2H9GB 2QHLA 1PJ9A 1Q9LB 1JYWA 2NR6D 1QRNA 4JM2B 4HJGB 5CILH 1YY9D 3INUH 4H1LG 1AC6A 3HZVB 4ZOCA 1ZT1B 1SY6L 3Q0HA 4X6FB 4DCQB 3BRDA 5J11C 1FH5H 1QACA 3GIVB 3TM6A 4FFWD 3C2AL 1WFNA 1HNGA 4EBQL 3EJZC 2DQGH 4U1MB 3R8QA 5FYJE 3BPNB 1U8NB 3ARQA 4NBYB 5CP7B 4LFHG 3IJYB 3NIGF 5EBWA 3UZEA 5FK9B 1CBVL 4P9HC 4G8GD 4FQXB 4OZFH 2YD2A 3QDJB 1FZMA 2OSLB 1IT9H 1OARL 1VCAA 3O9WC 4MA8H 5C6PB 4XI5D 5DQJA 1MI5D 3FZUD 1I1AB 2ZG2A 1INEL 5T1DH 3S35L 4B7IA 5FYKE 3SY0A 4E41E 4YFLF 3RKPA 4DGVL 4EOWL 3D85B 4EDWH 2HH0H 1RUKL 4JFDE 1R3KA 4W6WB 1TNNA 4HPYL 4K94L 4OV5A 1IFHH 3B43A 2XKSA 2GQHA 2PTTB 5SWZE 4Y4KD 5B21A 5LG1A 4X4YB 2XY2A 2AEIT 4NJAH 4POYA 4JHAL 1EEZA 1EAPA 1QFUL 3U30C 4F7PB 1F13A 1CFBA 2BSTA 3L3GB 2VXVH 2IALB 3UJIL 4M9OA 4OUUB 2YZ1A 5D6CB 1A6WH 4AM0B 1CICA 1I7UB 4FQJL 4U1KA 3SKJH 1AI1H 5E5MA 1IJ9A 4HS3B 3G6AA 3OKMB 4CBPA 4ZFGH 4XCYA 3VXRB 1F4XH 2ARWA 3HKFA 4NQDE 1OWRM 1DEEB 3VXME 3E8UH 4QRSB 4JFOB 1XT5A 5GSRA 2BOCB 5F71A 3T0EB 3W9DA 5I1CL 1VKXA 4G6FD 1ZGLM 4G5ZL 4YDVA 3D87B 4PJXF 2VDPL 2XTJE 4K7PH 2APBA 5MENA 4Y1AE 1Q9WB 2FDBP 1KN4H 3KAAA 4HUKB 4PJXA 2KDGA 4Y19B 2YD8A 2AJSL 3E1F1 2QADD 1CFTB 4O9HH 2D31B 3DGGA 5GRVK 3TGXA 3NN8A 4FXKA 4K8RH 5HGAB 5JR1L 1AXTH 1ITCA 4AH2B 1I1CA 1RY7B 2EH8H 4NKDA 3CXHJ 3TP4A 5F9JA 3QUMA 1B2WH 5E08L 1NUNB 3GK8H 1IAMA 1NBVL 1AO7B 3I6KA 3BDYL 4PB0L 2FGZA 1KPRA 1X3DA 1UKTA 1IAOA 3QHFH 1RZIA 4PYGA 3MRLB 1GJIA 2G9HA 3VXSA 4Y1AA 3DVNA 3SDXB 1CIUA 2P5ED 3DXAE 4NN7B 4RFOL 4R90L 5L6YH 1EJOL 1QLFB 2VSDA 4AZ8A 5EC1B 2EYTA 3T8XA 1LDSA 5DUBB 1T21B 1A14L 1XH3A 2MKLC 3OJVC 3QNYA 1JTOA 3WXVH 3RY6A 4OLYH 4MA7H 5D2NC 5CEZL 1MF2L 5DJ6A 4UNUA 2F53A 3FQTB 3RVTC 4PB9H 4NBXB 2ERJB 1A5FH 2BSRB 3ARBB 3G5VA 4CAGA 3BEVA 3L3IA 4N5EC 3QIUA 2X9WA 1DBML 4P3WA 1BX2A 3N1MC 3TVMB 2VLKE 4PV9B 5IHLB 2GT9A 2X2YA 4HIIB 5D7JA 3TF7C 3ZYZA 1FVEA 3W0WB 4JO1L 4DAGL 4PRNA 3C5SA 2RFXA 5T1LD 1E4XI 4N1HB 1QSFA 5F7KC 3JBG7 5HBBA 3NH7L 4PJ7A 3B9AA 3H9SD 4WW2B 4WWKA 5CSBA 3M8OH 4Z5RA 2DDQL 3HFML 1XEDA 2OMBA 5I16B 1MQKH 1J87A 4F57L 1KELH 5AYUH 5FGBC 5L2KE 3KYOA 3V0WH 4OCNC 3VFUA 2UZYB 4I1NB 5F6IB 1CZ8H 3CX5K 4NSKB 4QOKA 2EH7H 2AJVL 5J7CC 2NYYC 5C0EA 3NA9H 5A16A 4LAQH 4P5MB 4G6KH 3SOBH 1HHJA 3MODH 4ZS7H 3WDJA 1S3KL 3RUGB 1A02N 5B8CC 2X89A 3B2VL 1HWGB 1QSEE 2HKFH 4JHWL 2DIBA 1FYHB 4W68A 2JLLA 2Y4SA 4OTXH 3VFVB 1CL7I 5I1DB 3ZZ1A 1UJ3C 4R4NC 1AFVH 2Y23A 3GM8A 3NIDF 2DQEL 1DQLL 3UAJD 4X9HA 1S7VA 3RQ3A 3HMXA 4X9FA 2B8OT 1F4YH 3F62A 4YEFA 1CGYA 2H6PA 4JM2F 5GGSA 4M1GH 5HHXL 4HIJB 1MCCA 1U8PA 3C09B 3G5ZB 5KG9A 1J1PL 1H3XA 4PRID 1Q9LA 2HVKB 2IGFL 4NO0D 3BIKA 5FUCC 3QG7H 3HZVA 3PWLA 3X14A 1HIML 4JZJA 3ILQD 1J11A 1XMWA 3EZ8A 5C0RH 2R69H 3GIVA 2I26N 3VG0H 1OPGL 4RX4A 3TIEA 3K3QA 3CFJB 1FBIL 3RWJA 3QO0A 3MV01 4MDIB 4YC2B 2NLJB 3BPNC 4J7RA 3HI5L 5E94A 1W72B 1FDLH 1D6VL 3IJYA 3V6OE 5GHWL 1EHXA 3SKMA 2ZG3A 1ZHBA 3MYJB 2J88H 1VFBA 4NO2B 4FQXC 3QDJA 3RVVD 2BVTA 2ILLA 3QQ3B 4JVPA 2OSLA 2YK1H 5IHZB 1ACZA 2D4FA 4Z78B 5CEYA 4I0PA 1LO0H 3ARFC 3U79A 4QCIA 4ZNCD 4HK3J 4NJ9L 1W8NA 4H1LH 3P0GB 1I1AC 5HHPB 4NC1C 2PNDA 5DHYA 5GS1C 4Q9CA 1XGUB 5C3TA 3MV7E 4MX7B 4ERSH 2X4OB 4J12A 4F7EB 5I75C 3KPRB 3L5XH 5DFWH 3GSVA 1NCBL 1QEWA 5HDQH 3VI4E 1VERA 3AROA 1JFMA 4ZUVB 1I3GL 2AKRA 2WAHA 4HIEB 3CLEL 4JG1L 5DQ9B 1E6JH 1FN4B 2ZCLH 1N64H 2XZCH 4GAFB 4GKSB 1HI6B 1Y18A 3Q2CA 5AZ2H 5D6DC 4NO5B 3GBNH 1DUZA 4F7PA 3MLZL 4S0UC 3OX8B 4Y16B 1IGIH 1TMCA 1MHEB 3U6RA 2F74B 4G6JH 4N9GB 5ISZD 5D6CA 5EA0L 4NWTL 1JGDB 1NL0H 1VEPA 2HTLC 2UZIH 3MX0A 3WNOA 4WHTB 4HS3A 4X4XB 4F3FB 3IVKB 1BAFH 4FFVC 1KENH 1YYLH 1D5BB 4ODXB 3T0DA 3P11L 1C5CL 1WTLA 3BJ91 2JB5H 3JUYA 1MH5A 1KBGL 4YO0A 1C1EH 5E2UL 3EOTH 3O11A 4ZSOB 3T0EA 5D8JH 2WQRA 3WFDH 4HKJA 1EPFA 3BQUA 5BV7L 1J1OL 4W6YB 2XWJB 3VWJA 2IH1A 4NN5C 3GMRB 1JGUH 3DX7B 4JY5L 1FNHA 4JY4A 3U4EB 3V4VH 2PXYD 1E4XH 4JVUA 2P1YA 4JCMA 4PGBA 2J4WH 4Y19A 4X7TA 4ZPVA 3RVWD 2B1HH 3B6SA 1CFTA 4U1NB 4IJ3B 4ZO9A 1M7IB 1X5IA 1CFVH 1NC2A 1XF4A 2E6JA 5FM5O 3PQYD 1QQDB 4OM0H 4QRTB 3FL7A 4WCYL 5CJ5A 1K6QH 3EJJX 4OD2B 1FHGA 4ZS6D 1U8HB 3BVNA 4XWOD 1G7JB 2HG5B 1MHHB 4PTTB 5MHSE 4JN1H 3FB6A 2NPLX 3MRLA 4OCRL 2D9CA 5HI5C 2WUBL 3ZKQD 3TFKD 5IB2A 3SCMB 3BRGC 4JKPL 4LOUD 5BOPA 2FX8L 5HYQA 1JYXA 1N26A 1Q38A 2X1WL 1S7UB 1QLFA 4KVNL 5IHUH 1QBMH 3EFDL 4PJBB 3V4UL 5HHOE 1XR9B 1CT8A 3S6CA 5IVXE 4QRPB 2DKMA 5FO9A 35C8H 4M48H 3UC0H 1NLBH 1RQ5A 4RMVA 1IC4L 1JJUA 2OR7A 5JOPD 4K3HA 1T03L 3EDFA 3T4YB 4NFCA 2VLJE 1PZ5A 3ZL4L 4XNYH 4U6HB 2IBBA 4P5KB 4PRDB 1SMOA 3HNSH 3NCJH 4HG4J 3HZYB 4YHLH 5I8EB 1S7SB 1NCWH 4TULH 3K4AA 4XP1L 2XN9E 2DJSA 2AJYL 4UINH 4KWUA 3RIFF 2BHUA 5E8NB 1BBDH 5FOBA 4NHCH 3FQNA 3ZE2F 3VXNB 3W0WA 5DUPH 4YWGL 5HI4D 4LSQH 4WW2F 1FO0A 2FZ3B 1FORH 4MJIA 5T3ZE 3VW3H 3OKOB 3O41A 5EG6C 2DB8A 3MJ9H 4CVXA 1A7QH 3Q5TA 3MUZ1 2QQLL 1MCOL 3SKUD 5E1HB 5I17B 1UWEL 3BYTA 1GXEA 2R1XA 1A9EA 3REWB 4ODHL 4PJIE 1T20B 4NCC2 2X1QA 4FG6D 1IRAY 4KTDH 4NHUE 2FX9H 3AY4C 5D71H 1WLHA 4LHQB 3GRWH 4BUHA 2H41A 2JJSA 1FCGA 5FYJL 4GQ9L 5E0QA 4M43L 2QR0A 4U4BA 5JLZB 2DTML 4MQTB 5IB1B 4YGVB 5IBTL 1IVLA 4X80H 2OZ4H 1S7WA 2HP4A 4C4KT 2Z8RA 4I5BA 1OAQH 2VDNH 1DSFL 2JIXA 1ZEAL 4QRRD 4TUOB 3K81A 4KY1L 1RMFH 2OCFD 3VFVA 4TSBH 2WNGA 1JF1B 4NKOB 3HE6D 5DLMH 1N5YH 5EORL 4WWID 3ARGD 4FA8A 3WIHH 5FA4B 3WFEL 5FYKL 5D5MA 3QQNA 4OCYH 3QPXL 3TN0B 3U0PB 2H1PH 1WEJL 5JMRA 5GS3A 1BVKA 1SMAA 2W38A 5EO9A 1ZLSL 4ZXBA 5EZOH 3E2HB 4GW4A 3ARRA 3BIBX 3CAFA 5HGGS 3QHZH 3CDGB 4UT6H 1AP2A 4PJ5A 4DTGH 3TH2T 3G5ZA 4QHKJ 3NPSC 1F3JA 2EZ0D 2C3GA 1ORSB 5GGVH 4FZ8L 1FNSL 3W81A 4HUWA 5I2IA 3O2VH 4X6BB 3QIBB 4AJ0A 5IQ7H 5EO0B 5JUEH 2C1OA 5AZEL 2DBLL 5BOZG 5F7FA 3PWUB 4K3DH 4DZBA 4HFUH 5A2KH 1QFOA 3CFJA 4X6CA 1K5NB 4NQVB 3RDTC 3F7VA 3QFJB 5SWSA 2HT4C 3U2SB 4RMQA 4MAYB 3P9WB 3ILPA 2FJGA 3KR3H 5FGCB 3P0VH 3KLDA 2Z35B 4O5LH 2M26A 1IM9B 4HWEH 3SDAD 3OR7A 4DN3L 3NFSH 3VGGA 5IB4B 2W0PA 1FGVL 1XF5A 5IHZA 1HH6A 1HQ4A 4DFIA 2DJUA 3RPIA 2PKDA 5HHPA 3U48A 1X5ZA 4WO4D 4DKFL 1JZ3A 2Q8BH 3VXPA 4WUUE 3IJHB 3MLRH 3IDUA 2OTWB 4CVUA 3FOMA 2VE6A 3MA9L 4KKCC 5IJVB 3TPUB 2R0ZH 5ALCL 5DVMA 1Q0XL 1JFQH 4LRNL 3EBAA 4ZYKB 1KPVA 1TZGL 3FOLB 1MWAL 1U8QA 2DAVA 3VXUE 1DVFD 5DS8B 2XA8H 1FZOA 1CS6A 5I1IH 4DVRH 1CDUA 5DQ9A 2DJ4A 2FEDC 5DRNB 5GS2H 5CBEB 3GSQB 4KROB 4NO5A 8FABB 2YPVL 2ZJSH 1PQZA 3EYUL 2IWGA 1OGAB 3B9VA 3NCEB 3OX8A 4Z8FL 3KG5A 2F74A 4N9GA 1JHKH 3QPQD 3RL1B 1QUNA 3ARDD 5EWIH 5KSBB 4WHTA 3BO8A 3UYOD 3KYMA 3TYGL 3IKCB 3AS1A 1CE6B 5DJ2A 3V5KA 3KPTA 1RURL 3QCTL 2R2CA 1S5HB 2OMNA 1F97A 1HOCA 5DO2C 2QQNH 3FO1B 3FFCE 3VG9B 5E9DB 1PW3A 2DMBA 2WQ8A 5H8DA 4DOHE 2XWJA 1A6PA 3ARXA 3WUWG 1DN2A 4HS8L 3QRGH 1D5ZB 4PJCB 5T3XE 5KS9F 1L6XA 1BWWA 1YEEL 3IDGA 1UKSA 4DGIH 1W72H 2LU7A 3SHSA 1NGXA 5KS9A 2FEEL 1EFQA 4LLVB 2BHYA 4GAGH 3UZVB 4U1NA 1XAUA 1Q0YH 3K1KC 4JN2A 1E27B 5FCSH 2YN3A 5DURD 5J6HA 1WIPA 4KJPC 3GMPA 4UB0L 2MKWA 4L9LA 3C5ZD 1MAMH 4GMSL 2HG5A 1M05A 2PR4H 3BSZH 4XMKL 4BZ2H 3GHBL 3FN0L 3QAZB 4MXQC 1UZ6E 1R3HB 4LF3A 1OAZH 1BF2A 3EOAB 3RWDA 3SCMC 3DO7B 5F93C 3MNVB 4PJBF 1FNAA 2IJ0C 3L3HA 1S78D 4KRPB 1XZ0A 5C09A 1VADA 2YPLE 3OKNB 4PJBA 1KIPA 1J1XH 5IIEA 3RTQB 4QRPA 3L3OA 4RGND 1K8DA 3O8XC 2WW8A 1ULVA 4Z7WB 3E3QA 5ENWB 4OB5L 5BMFL 3MLTA 1AQKL 43CAB 3J7HA 4PRDA 5ERWB 1MCJA 2CKNA 4G9FE 4WUKL 5AD0B 1HCFX 4KZEL 4FQQB 3RZCB 5LXGH 3PP4H 1HSAA 3DV6B 2YUVA 3IFPA 1OTTD 4CMHB 1RZGB 2EKSA 3NMEA 4U1JA 5F6HI 3VE0A 4YHIB 4PTUB 4YPGB 1AY1L 4EN3B 2O5ZH 3X13B 3V5DB 4X83A 5CJXA 4P23A 4L1HA 4V1DA 2BERA 4G6ML 1S9YB 4MQXD 5E8OA 4MXVF 3RWIB 1GSMA 3SE9H 3LRSA 4JR9H 1NFIB 1ED3B 2IG2L 1C12B 3QUYC 4N0UE 3T04D 4R7DA 1JUFB 5FUZH 4S10A 1BQSA 1IEBA 3OJDA 2BJML 5DZLA 4PR5B 3OXSB 4OQTH 1CVSC 3Q1SL 4HWZB 1QNZL 1GOFA 2A9NL 4GW5B 4Y5YA 3BP7B 3KLSA 3P73A 5ILTL 1IC7H 5C08A 4NPYA 3UJJL 3RIFK 5CCKL 3GNMH 2ICCA 4XP6L 3VWKA 5CGYD 4U6YA 5EIIA 1PFCA 2ICWJ 2YS4A 2NZ9D 1DR9A 2C5DC 2BFVH 2LU4A 3LEVH 3OR6B 4XP9H 2MQ0A 1IGCH 1BQHG 1HCVA 2I07B 2XACC 4JDTH 2ESVE 3QCUH 4LGPB 1QFWI 4J3TA 1LD9B 5IR1B 3KPLA 1U8JB 4NKOA 1DP0A 3ULVC 1KC5L 5KN5B 1I1YB 32C2B 3GJFA 1LO4H 1OGTA 3HC4H 4G6AD 2FH6A 3BP6A 1G1CA 1CD1A 1YMMD 3O2DH 4QNPF 2J12B 5KZCD 3MLVH 4S1DD 3SDYH 3TN0A 2BC4B 4NT6B 3WN5A 4PJ9B 1RUMH 4KI5D 1BQUA 5HHMB 1FGNH 3MJ8B 2O5YL 3SKNA 1VFMA 4OZ4B 2Q7NA 3VGEA 4Z0XB 4ONHA 3WO4B 5BRZE 1T7WA 1UJTA 4J1UA 4ETQA 2A83B 1N0LA 2LAAA 4X6BA 4PG9B 3QIBA 4BM7A 3W39A 1WWAX 2Y5TA 3KLAB 3QEQD 1NJ9A 3GSUB 4HEPG 4NQSB 2UVFA 2A6JA 3Q6GH 1CG9A 4EI6B 1YA5A 4YDKH 1BD2B 4GSDH 3AREB 1X5HA 3LHPH 4NQCD 3UTTD 4MAYA 2EYSB 3SDDC 2X1XR 5D1XD 1YEKH 2ATKB 4GXUM 4ZO6A 5CINH 3TH4T 4MS8C 5E2WH 2OJEA 5CWSB 4GAJH 1R3LB 3MREB 1A6VH 1MCRA 3CFKA 3HI1A 1I9RH 4QXUH 1UCBH 4KK5D 1SM3L 3WLBB 1R5WA 5IB4A 4W4OC 5I8OL 2V7HB 3HR6A 1FP5A 1JPSH 1FYTE 4JFFD 2P5WE 1BZ7B 1VFUA 4X98A 2GEEA 4RMUA 1CD8A 2C1PB 2V5YA 4W81A 1N5AA 4LU5H 4WHCA 2QJDA 3IJHA 3H7BB 2KPNA 2R1YB 1D9KD 2X70A 3U36B 3B9KA 5IJVA 1II4E 1TJGL 3GDBA 1KCVH 4LSVL 1WFOA 3BAEH 3T0AA 3TPUA 5I1LB 3JV4B 2ZOKB 4ZODA 1OAXL 1GGUA 1UACL 4O2FB 4Y2DC 2YPKB 5L7XH 1PY9A 1T5XB 5EZLB 5LGJA 3ULVH 4F7CA 5DRNA 5JPNB 5D7IB 5C0CA 4HCRA 2QQQA 1FJ1B 4KVCL 1JMZA 2OR9H 3FMGH 1D5MB 4JQIH 1I8IB 5ITBH 5KSBF 1FYTA 1T66D 4JGMA 1N6QL 3QXDB 1A0QH 2ARJA 2E9IA 3I50L 4IRJB 4OIIL 2VDLL 5GS0C 1WBZA 5I9QC 4OZGA 1NUGA 1XIWA 5E4EC 3TCLB 1A1NB 5KSVB 1QR4A 3L5JA 4WI3A 4LHUA 1EXUA 3N9GL 3TZVB 2VXQH 1KJVA 5INDB 1KNOB 4D9RD 1D5IL 2F5AH 3LS4L 1V7NL 3TA3C 2VRAA 3D39D 4JFXB 5JDJA 1E4WH 4YBQC 3HE7D 5K9JL 5HDLA 4JRXB 1KCUL 5D9SA 4ZTOL 4OD3L 3H3PL 3SBWC 2UYLA 3ELAT 1MJJB 3S7GA 1UENA 3CC5B 3UTZA 4CN4A 1ND0A 3ZHLA 1JF5A 2FGWL 3L6FB 4OD1L 2VL4A 1CDCA 4EDXB 3LN4B 3DUUB 3MO1A 1LHZA 2FX7L 2SEBB 3LSOA 2GFBA 4QRQB 3HC0B 4I2XB 1C7TA 4OM1L 1PKQE 3NBNA 2F54D 1TTFA 2X4UB 4L4JA 3V5HB 5C9JB 1DUYA 1JNLL 5C07B 1HYSD 1HWHB 3L3KA 3MGTB 3EOAA 4JCLA 1QO3B 3MV8A 4A6YA 5F1IB 1CDBA 1VFOA 4UT9H 4FTVB 4AQ1B 4LIQH 1YEJL 5MEOB 1Z5LA 4OZFA 4ZTPL 4HHAB 1YEDA 2Z92A 5BXFA 1MCWM 4P46C 3OKNA 3ULUF 3MRPB 2QEJA 1P4IL 2ITDB 4HT1L 2EE2A 4BSWA 1U92A 4GW1A 2GJ6A 1MCFA 3KPSB 4OGAD 3MXVH 1JTTA 4Q9QL 4LMQE 1BBJA 5J12B 1H3GA 3MA7A 1D5XA 1DJSA 43CAA 3RVXD 1SEQL 5IGXL 1G7PB 1HZHH 3SJVB 4PYHA 4KDWA 4Q0XH 5GS0H 4GRMA 1NC4D 4U3HA 4CMHC 1ZT7A 4APQD 3EO9L 3LKQB 2K9UA 4YHIA 4YPGA 4AEHL 1FLRH 4JANA 4OFVA 1ADQH 5ESQB 4EN3A 2XNAB 1EH9A 3V5DA 4FFEX 3LKOA 1RK1B 1TJIH 2RQ8A 3SO5A 4N8VG 2AJXL 1S9YA 2PO6A 1JRHL 2HJKB 1NFIA 5TQ0L 4XWGH 4YHMH 2DD8H 1NUDA 4XZUB 3FB8A 2FWOB 2C7UB 1AE6L 2NY0C 1SJHA 2GKIA 4CJ0A 1H15B 4XNZC 1ZTXH 1XGYL 4GBXB 3H42H 3O3AB 3ZT7A 4F15B 1KJ2L 1Y6MR 5EU6B 1C5DA 1K9TA 1EZVY 1L9MA 2B0SL 4E0RA 3QXVA 2YZ8A 5EOQH 2AXFB 3MCLH 2OJZL 3VFPA 3QNZA 4G9DA 1I7ZB 5IJKC 4X6EB 5CMAA 5IW1A 1WZ1H 3OR6A 5I15L 4H88L 3WLWC 5D7LD 2HN7B 2CD0A 3VCLA 2I07A 1KJMB 4IRSD 5CP3H 5TF0A 5ICZB 3AM8C 5E03A 3FTGB 2IAND 1B6UA 1QBLH 4NNPL 4FQLH 4KHXH 1I7TA 3OAZK 1A2YA 3EYFB 3SQOH 4ZUTB 1DQML 1XGTB 4LPWA 4U1SB 3S36L 1F42A 5I1HL 1FIEA 4XNXH 3IFNL 3GSNL 3MV9A 5HHMA 3CXHK 4HIHA 2LQRA 1P84J 3U9UB 2FH8A 4XTRC 3MRCA 4M1CD 4NZRL 4OZ4A 2AK4E 3WEXA 2VDRL 1NCUA 1IGJB 4KTYA 3WO4C 1ZAGA 4MNGA 4P2RE 3F5WB 4CGTA 1HXYA 3GKWH 5EUOF 4W4NA 4U33A 3LVEA 4AT6B 4L3AA 3K4DA 4LSTH 2YA0A 1A3LL 1ES0B 1Q1JL 4NQUA 5C6WH 4MJ6B 5EUOA 3QG6A 4KC3B 2AV7B 3THMH 3MNZA 5JHDB 5E8EA 3BKCH 5KJRL 1EK3A 2XZAL 5K9KA 2H32A 1PD6A 2HRPL 5CWSA 1JHLL 3OBAA 4EUPG 3OAYH 1WGOA 5MEQA 3GMNB 4RISH 4JQVC 4M8VA 4ODUB 5FYLL 2B1AL 3VFSB 1WBXB 3DROA 1F58H 4PREA 5T3XL 5ESVA 1UZ8B 1RIUH 1SVZA 2O61A 1OSZB 1NBQA 1ZSDB 5DJ8B 5KSAD 2E3VA 2R56L 1MY5A 2DICA 4P2QD 4QRUA 3JV4A 4KKLD 2CKBB 2ICWB 4WFFE 4O2FA 1E0OB 5LBSH 4PLKC 4YDLC 1YNLL 3MLWL 5ACZB 1BFVH 4NKMA 3VD4A 1T5XA 2BDNL 1P4BL 4HXAH 5EZLA 2B5IC 1WITA 5JPNA 3F12A 5C0BA 1EX0A 2X44D 2Y1VA 4HJ0D 5D2NE 1T1XB 3CFEA 3BP4B 3L3DB 1I8LC 3QXDA 3DHMA 2J5LC 3OPZH 2BY0A 1NGWB 3F7YB 4N0YH 5FM4A 4Z7VE 3P4NB 1PG7L 4HWBH 1IKFL 2PTUA 1A1NA 4POZD 3HMWL 1MREL 5CJQH 5INDA 1MIEL 5EU4B 5LQBH 2OTUA 4G8GB 5GGRA 3H2WA 2FR4A 5C70A 5JXEC 1HKLH 4PJFF 4K9EL 4K94C 4J4PA 1MI5B 4O4YL 1S5IL 3SGEI 4NQED 1MJJA 2D0FA 3D9AL 5J13C 4PJFA 4PRHA 4LL9A 4N5EA 2ADFL 4K71B 5KVGH 4L4TE 3V2AR 1LE5A 4XP5L 1LNUA 3DIFA 4NRYA 3BWAA 3X3FL 5DJCA 3FB7B 1KB5H 5JO5B 2JCCB 4FQHA 1CFNB 3DUUA 5L8LB 4KDVA 3TF7A 2P8MA 4EVNB 3MJ7B 4EXPX 1UM4L 4MVBD 3BUYB 1JZ2A 4Y4KB 2XKUA 5IMKB 4HPOH 1JMXA 3FO0H 1I85C 1ORQB 2VZOA 5C9JA 4OLUH 4JY6B 4RZCB 5C2BL 3QI9B 2FIRT 3GMLA 2V5SA 2P24B 2AJ3B 2VXTL 1J0JA 4Y88A 4OCSL 1NEZG 1CDGA 4GRWH 4ZFFB 3JTCA 5E7FA 2P45B 1GZQA 5JMOC 4PP1C 3V6ZB 3STLB 1S9VA 3OKDB 3C2AH 4XPGL 4PRAB 3LPWA 4EBQH 5ELIA 2XV6B 4U31A 3U82B 5DFVC 1AGCA 1ZS8B 4GKNB 4MDJA 1WBYB 3ZO0A 4HF5L 3FQUA 4O02H 3SJVA 5B8CA 2XI9A 4G6FB 4GG8A 3FQXB 3CIQA 1OT2A 4MWFA 5FYKD 3UO1L 4NCDA 1QP1A 3QEGL 5FUCE 5C0JA 4JFDD 5DMJB 3TNNB 5DEZA 1CU4H 2QADB 1RU9L 1IQDB 1INEH 1IARB 1UJ3A 3S35H 3MOBL 5SWZD 5EPMB 4DGVH 3VXQA 4EOWH 3OKYA 2RAMA 5GRVL 4HH9A 1EVTC 4M7ZB 1G7HB 1T22A 2O26U 5MEND 4IMKA 4K94H 1A3RH 2IMNA 4KTEL 1J0HA 2CDFB 3V6BR 3K80A 4OZIB 1A6TB 5T33L 5HGHB 2JELH 1MCIA 2WIMA 3BZEB 5F7HA 4B41A 3O0RH 4Q6IB 2VDKL 3BZDA 1QFUH 2P5EB 3C60B 4GBXA 4UILL 4ZUWB 2DIJA 2XIDA 4NC1E 1M7XA 4NQDD 3UJIH 4RMTA 2YWYA 3D1MC 3VXMD 5DSCA 4FQJH 2BSED 1BOGA 1I7ZA 4UBDC 1P7QA 4QTHA 1AGDB 1FAKT 2NXZC 4CN6A 5MI0C 3GHEL 3SO3C 43C9A 3BHBA 4QYOA 4J8RA 4Y1AD 3RWGA 4BYHA 4U7KA 5HD8D 4BJLA 3QUXD 1H9VA 1OSPH 1PX4A 3H0TB 1L7TL 1FPTL 5E2TL 3I6GA 5I1CH 3N50A 3LD8C 2A1WL 3G9VA 5JORA 2EXWD 1F11A 3X3GL 4C56E 3O2WL 1LEIB 1EHLL 4ZUTA 1L0XA 1XGTA 1PBYA 1JL8A 1VGKB 5GS1A 3S88H 1E28A 2ORBL 2ADIA 2X4NB 2AJSH 3FFDB 3IDNA 3T1WA 5IQ9B 4ZNEE 3RAJH 4PBVC 5T1LB 4CDGC 5BVJB 2ZUQB 3VXRE 3WJJC 1TTUA 3ZDXF 3H9SB 1FSKB 5TGBB 4RFEB 1WT5A 4R97C 3DECA 4L4VA 3F5WA 2FIKA 2OXHA 1Q9KB 5E08H 3IDXL 1NBVH 2EXYC 4AYFA 4PB0H 4RFNC 2N7AA 1ES0A 1R3JB 3O3UN 1YY8A 4C56A 3IF1A 5IG7A 3LN5A 4XRCB 4IIQC 4CVWA 3ESVF 4QGTA 3L3JB 4YDJA 4NUJB 4R90H 4WWKD 3MRBA 3T0BA 1EJOH 3RPKA 3P4MA 2IPKB 5C0FB 4DK6A 5C86A 3MJ6A 4JREB 3QFDA 3GMNA 1A14H 4MA1C 2DQGL 1CFSB 3UYPA 2VAAB 5LKNA 4HG4K 2ZNWA 4QOKD 4TSAL 4ORGB 3HS0B 2LTQC 1AO7E 1K2DB 5DJYB 2VLKD 1MF2H 3VFSA 4Z76A 1DDHA 1NKRA 5KOMC 4GMTL 4LCCB 2L0DA 1CGSL 3FT4A 1P5VA 2DWDA 1JPTH 1Z2KA 1OSZA 1IM3A 2MMXA 3CCHB 3MLYL 1D3CA 3SDXE 5DJ8A 4LVHB 2I9TA 1DBMH 1N59A 4LSSL 3I6LD 3P9MA 3LQZB 1IT9L 3OKEB 4GKZB 1MJUL 1U8KA 3DWTA 5HTSA 2X4QA 5HVGB 4J6RL 5DJDB 2VQUA 3RRQA 4O2EB 1ZA6A 2Q3AA 2PYEA 3F65A 4JO1H 4O2CA 4RIRB 5D2LA 3BJLA 5T1DL 4DAGH 2OQJA 2VITA 1KG0B 1U0QA 4UUJB 4KH2A 4OCLC 5L2KD 4OCWH 4EUPH 4U1IA 1P5UA 3QRFM 5E7BA 4PRIB 1HNFA 2EDOA 3NH7H 1NDGA 3MROA 2FL5B 2C26A 2DDQH 3HFMH 3QULA 3O6FD 2HVJA 4YHNB 3K2MC 3LMJL 4F57H 4KUCD 2NXYD 1AGBA 3FT2B 4ZUUB 1BECA 3IB4A 5L8JB 1ETZA 2J6EA 4RWYL 1FE8H 2AJVH 1IL1B 3KXFB 4MD5A 1X5FA 3IFOB 5EU4A 1KF9B 2BOBA 1RZ7L 5HVWA 1YPZB 1C16A 1IGYB 1S3KH 5F9WC 3U0TB 3UPRB 3QXAA 2EDRA 4LDLB 2GTWB 3B2VH 2E7CA 3HC3H 4ZFGL 4LLQB 3STZA 4RX4D 3VD9A 2OL3B 5JOFB 1JWUA 4JHWH 3RL2A 2CDGB 5J3HD 4WGVB 2HLAA 4KJYA 5ICXB 3PV7A 3CMOL 1GZPB 2H2PC 2APWA 3CGTA 3WFCL 2DQEH 1DQLH 5ECJE 4KJWC 4K7PL 5JO5A 2WMPA 1F6LL 4LLWB 3QZWB 3LPGA 1QR1A 3UTSA 5F3HB 3RUGE 1BREA 5IMKA 3RHWK 1JNHA 4DN4L 4O9HL 1ORQA 4LCUA 2A73A 3QI9C 4EI5C 4OFKA 5HHXH 4K8RL 4ZFOB 3WDIA 2ICEA 4BQ9A 1AXTL 2AJ3A 2VLLA 3EYOB 4QGYA 5KAQG 5CD5D 2IGFH 1BVLB 2CRYA 5ISZB 4ZFFA 1HIMH 5K9QI 4X8JB 1ZV5A 3LKPA 3GK8L 2AAVA 4G42B 5BV7C 3STLA 1OPGH 5IOPA 5A2IH 1FBIH 2G75A 5TJWK 5HJ3A 3HI5H 1ZS8A 4MMZC 5FF6A 3HRZA 5GHWH 3U7WH 2FO1A 2DM7A 2HT2C 3S9DB 4JFYA 1ZHLB 2CUHA 3MV7D 5EOCL 3HPJB 4C59B 25C8L 3FRPG 3H9ZA 2PXYB 2VSCA 3QZWG 3SGKA 3WXVL 4OLYL 4GLRI 4M7LL 4MA7L 3RI5F 5DA4A 5DJXB 1ERNA 1UH2A 1VFAB 2NY2C 4V2CB 4OKVB 3PQYB 3BQUD 2Z4QA 5I1EL 3BFOA 3VWJD 4JFEA 1NCBH 4XVUD 5LGHH 3KGRA 4C55A 3CVHB 1I8MA 4DKDC 4X6DE 4JG1H 3CLEH 4Y4FC 5HGHA 4PLNC 3WYRA 2VTFA 3VFWB 2AQ3A 4Y5XC 4JPWH 3C60C 2RB8A 2P5EA 1NC2D 3MLZH 4PV8A 1A1OB 1KCLA 2NY1C 1YNTB 1FNFA 3M8OL 12E8H 3HG1E 4D94A 1CTNA 5AYUL 4HBQA 4PJAB 2J8OA 1EGJA 4PDCE 3KPRE 4QWWD 3RDTA 1MCDA 3V0WL 4PRBB 5BS0E 1J86A 3MC0A 1CZ8L 3D0VB 3P11H 5CHNB 1C5CH 2DQCH 4UQ2B 4CU8A 4HAGA 1KBGH 1MCBA 2XT1B 3JVGC 3PDOB 3TIDB 3H0TA 4P5TC 5JZ7C 4M7JH 1MVUB 5BV7H 4J2XA 5DGRA 1J1OH 5KW9H 1YNKL 5B4MD 1RZFL 4BK4A 5DMKB 2XWTA 2OTPA 1EAJA 5E2JA 2YUWA 5F21B 1UVQB 2AGJL 2BVOB 3FFDA 3TNMA 2CIIB 1JZ6A 4GS7B 2RJMA 4UMGA 5LCVL 3KNBB 2YWZA 5GJSL 1ACYH 3V6FA 1JWSB 4S1RH 5F88A 3U1SH 3PP3K 4RFEA 4WCYH 2OX5A 1F4YL 2I9LA 1Q9KA 5I76B 1CR9L 2EC9T 3QIWC 3RVUC 5C6TL 1FFQA 4EQ2A 1YQVL 3T1FA 3EO1B 1RZ8B 2LVEA 1NMCC 4MJID 2BSSA 2ZG1A 5EZJB 4HV8B 2EIZA 3QXWA 3QG7L 2GCYA 4NUJA 4X5WA 3T3PF 1BIIB 2KKQA 4NRZB 2VLJD 4KVNH 4JREC 3V4UH 1QD0A 3FN9A 4OCXL 3CK0L 4MJ5A 4HMEA 3W2DL 2YD7A 3RWCB 5DDHA 1IC4H 1ZKAA 1NUFA 4QRRB 2WP3O 3B5HA 2XN9D 1T03H 3V4PL 4CN1A 2DQJL 1FDLL 4LCCC 4M02A 1A8JH 1U2HA 3ARGB 4HIXH 1WVZA 2Q20A 3CCHA 2OYPA 4ZAKC 4CADA 1MFEH 4XP1H 1VDGA 5ANME 5T3ZD 2R1WB 1KB9J 1LO0L 3MRMA 1NCNA 2RBLA 4YXLL 1LEKB 1KCKA 1IAIM 2YD1A 1IGFH 4XPFL 5GGQL 1DFBL 2WBJC 2F8XC 4JRYA 1EHNA 2ZCHL 1KG0A 4Z18A 2HMID 3JV5A 2AABL 4TN9A 3D2UD 3VFNB 1P7KA 3MRIA 3AAZA 1U95A 3VD7A 4NO0A 2EECA 1A21A 5IBLC 2FEEI 3CX2A 2G60L 4D0BB 2MHAA 2KZWA 4G7VH 2W9DL 1EDQA 2QQLH 1MCOH 4MXQA 3QEUB 5ID0B 1UWEH 3PV6A 3ZE1E 1YPZF 2L7UA 2DLGA 2R2BB 4UAOC 1KT2B 4PJ5D 1IL1A 4QY8A 5ESAB 2XTJC 3HMXL 4LSRL 1IGIL 1JHTA 1KTLB 5FYJH 4GQ9H 1FFOB 4IS6B 1FFPA 2DTMH 5TDPA 3SDAB 2HYMA 4S0TD 3WHXA 5H94B 1R5IA 3O8XA 2XA3A 5DYOA 1KENL 2GAZA 1VESA 4AG4L 3ARSA 1UG9A 1DSFH 1ZEAH 1GGCL 5SWSD 2UZXB 1DQTA 1I9IH 4KY1H 2DI7A 3PHOB 4WO4B 3NFNB 2VL5A 3EOTL 1Q94A 4OF3A 1GZPA 3WFDL 5EORH 2DQTL 4XVSH 3IGAB 3IDYB 3WFEH 4ZO7A 5DD6B 3FB5B 2XFXA 3MPCA 1F3DH 1MCLA 3QR2A 4M62L 4HKXB 1NAMB 2VR9A 2EIBA 1DVFB 1EBPA 1WEJH 5EO1A 4KKBC 1ZLSH 1OF2B 2B1HL 5J1AB 3TO2A 2FJFA 4OLVL 1UADC 2A0LC 4WFGE 2RCSL 1CFVL 3QUYA 1V5JA 4JGJA 1BVLA 4JB9L 1NAKL 2GW5A 4FZ8H 3ULVE 3G08A 3LQAL 3PWPE 2XQBL 5ABDE 3ARDB 1S9XA 4OIAA 1MLBB 2XPGB 5AZEH 1BGXH 1HDMB 4JN1L 5ITFB 5LVEA 1FVDB 4D9QD 4KFZC 5I1KL 1U3HC 3OTTA 4Z7NF 3VRIA 1F4WL 3HUJB 4ZQKB 5TDOA 1QBML 5IHUL 3O6KH 4FABH 1IQWH 1LWRA 2NY3D 4WUUD 4DN3H 4PGCA 1FGVH 3UC0L 5FUOL 1X5KA 2PXYA 4TQEH 4FMKA 1QSZA 4YJZL 3P30L 5DEGA 4F2MB 1CGTA 3PWPA 4M6NH 3VXUD 1QHPA 3DBXA 3FQRA 3KPPB 4R96B 2M1KA 3QDGE 3HNSL 3NCJL 5DT1L 5IB3B 5DK3A 1K8IA 3MA9H 4WHYG 3GKZA 1NCWL 5ALCH 1AD9A 1BFTA 1Q0XH 1FC1A 1A6UL 4LRNH 2OL3H 4HX1A 2OI9C 3C5ZB 5FKPA 1HEZB 1MWAH 5FGCE 4YHYC 4GG6F 4HUVA 3PL6C 4LLDA 3ET9F 4O00A 5DUPL 2W65A 1XGQA 4LSQL 4BH8B 4GG6A 1CVRA 3TFKA 1FORL 3GZKA 4ENED 2YPVH 2NY7L 3LEXB 2Y7QA 3ALPA 1T6WA 1T4KB 2MTPA 3EYUH 3HZKB 4G7YL 1G6RB 4Z8FH 1A7QL 1MJ7L 2GSIB 4Z7QE 1INDL 2Q7YA 1HHHB 2WBKA 4R0LB 1QLRB 3RI5K 3L5WB 3FFCD 4RGNB 1QG3A 3MRQA 3TYGH 1NFDB 4LIQE 5DZOA 4R8WL 4KTDL 3REVB 2QKIB 5DMGD 2P4AB 1RHHB 4PJGB 1G7MA 3QCTH 1NCCH 3MOQA 1T1YA 3MLSL 4U1LB 5K59E 4MS8A 5F7YC 3TT1L 5C09D 3DO3A 4X80L 4W4OA 2OZ4L 2E6PA 1J5OH 1MRDL 3GSOA 4NN6B 3S35X 4HS8H 2X7LB 5DMKA 3B2UD 1PKOA 5I74B 5KSBE 1RMFL 4WV1C 1UVQA 5AUMB 1EMTH 2EO9A 1FNGB 5D1QD 1DBAH 3G6JA 3DVIA 3WUWA 3WIHL 3TBTB 4F9PC 3LIZL 1R6VA 4JFHD 4K3EL 4P4RB 1AD0B 4U0RB 1Y0LA 4RAVB 4Y2DA 3G5XA 4UB0H 3GMMA 2V9RA 4PLJC 2RR3A 5E9DE 3SEPA 3B5GA 5I76A 1SBBA 5E1AA 3ARWA 5EU3B 2XZZA 5FECA 4XMKH 5GXBB 5EZOL 1K85A 3V6OC 3ZKXB 3FN0H 4P23D 3EO1A 2YPLD 4PJCE 4LSUH 4V1DD 5DC0A 1FFNB 2YXMA 4UT6L 1ZMYA 2E7BA 4MAUL 4HV8A 4ONOA 5CSZB 4F9LC 2BK8A 4RQQB 5GGVL 3N06B 4KK9C 3CVHH 1LK2B 4OF6A 3ORJA 2ZUXA 5KTEL 4K3DL 2IPUK 1D6EB 3JSSA 1MHCB 4H25B 2KBGA 2LAGB 3TA3A 1U58B 5MP6H 5C08D 1AQKH 3UROR 1KEML 3HE6A 3VFRB 4HZAA 4F33B 3U4BL 5IEKA 3PGDB 3KR3L 4WUKH 1UQSB 3P0VL 3TBSB 3VWKD 4KZEH 4O5LL 1MELA 4HWEL 2EC9U 3NFSL 3SBWA 5KZCB 4V3EB 1AHWB 2R1WA 4PGZA 3KYKL 1RIHH 3P77A 4MHHG 4OSUH 4G80B 3IDIA 2G5BA 4GUPB 5IW6A 1X5JA 3K4ZA 3DRQA 5CGTA 1JF6A 2GTZB 4OCMC 4G6MH 4FQ1L 4R26H 1W0WA 4Z7WE 5HYJA 1NBYA 5EDXA 3JTSB 2R0ZL 3C87A 1JFQL 2HJLB 4TOYL 5GGTH 2IG2H 4WJ5B 4D0BA 3WHE0 1H0DA 1NEUA 5DA0B 2BJMH 3I75A 1AXSB 5JW4M 4HUUB 3QEQB 1JK8B 4DVRL 3Q1SH 3WUZA 4LEOB 3CU1A 1QNZH 1A7RL 2A9NH 5CP3A 3B9EA 1ZHNA 5C0AA 3UPCA 1F8TL 5ILTH 4HFWB 4NQCB 3UTTB 1A9BA 5D1XB 1KTLA 3LH2L 4P46A 5CCKH 2ESVD 6CGTA 1FFOA 4IS6A 3BP5B 5C8JA 4GRLC 2AQ1A 3BW9B 2R23A 4BK5A 3WFHA 1KYOJ 1TZHA 1KXTB 1OTSD 4H26A 1BJ1H 3CH1B 4JFFB 5L0QB 3PHOA 2UWEB 3H9HB 2MOVA 3O3BB 4XBGB 1IC5L 1KC5H 1D9KB 5IF0B 1B4RA 1RV6X 5IK3B 4DZ8B 1BQHA 4IMLA 5J1SC 3KJ4C 1TVHB 1MCKA 1YQ2A 3D18A 4OZHE 3ARYA 4LP5A 4ELMB 2YC1B 5EOCJ 1G7IA 1W72L 4DEPB 1C08B 2CJUL 3IDMB 5BRZD 5BJTB 2DLIA 1OF2A 1E4JA 2O5YH 1OVZA 3WKNA 4GAGL 3I9GL 3QUKA 1TQCC 1XF3B 1WFUA 5C2UB 3MBEC 3B9KD 4X7SH 5TH2A 2Q87A 3MLXL 1FL3B 1DCLA 1H3UA 1RUAH 3F7PC 2PR4L 3KS0J 3EOYG 4LLMA 5FDWB 5ITFA 1SEBA 5C0CD 1TVBB 3R0MA 1BZ9A 5HDBF 1UXSB 3HUJF 1YN7B 4YAQA 4P57A 1CLCA 1N3NB 4LPCA 4EXKA 4AL8L 1FYTD 3D39B 3HUJA 2P5WD 1FAIL 5EFIA 2IFFH 4FQIL 4JJHA 3IDJA 2K7PA 4LLUB 3DTXA 3HE7B 5F7EL 3VGAC 1SM3H 3PDDA 1XIWD 1G7QB 4QLRA 5DD5H 2Y25A 2AJZB 4L8SB 4IRZL 5GZND 4ZDHB 3AM8A 3VGDA 4LHUD 1GAFL 4N0FA 3MRGB 5DC9B 1BOYA 1A6AA 4XCNA 2AXGA 2DWEB 4YE4L 3BWUC 5LXGL 4HUNB 1BD2E 1X5YA 1TJGH 3AGVA 4LSVH 3M1BB 1UACH 3RWHA 4G8IA 5KSUA 2W60B 3ZKND 5E6IC 2F54B 3V9FA 3AU1A 4IOFC 4ODTL 1UEYA 3VFMB 5CKAA 4YBLB 1N6UA 3S5LA 5T5NG 4P4KD 1J88A 5BZDA 3CSYB 4L3EA 1KACB 2A6KB 2IAMD 3FCTA 5E24E 1T4KA 2WWKT 3BN9C 1EZVX 5EBGA 5F7DA 4XNQB 3Q3GB 4Y5VC 2NX5E 2FCBA 3L5HA 1NFDF 3AXLB 4OIIH 4R0LC 5HHNA 2VDLH 2DQHL 4RGNC 1QLRA 2VAJA 3UBXI 2D2OA 4OQTL 3GGWB 1DZBA 4PJGF 1G9EA 5JW5A 4P2OC 3O4LE 4WHYH 5C7XL 3N9GH 3EFFA 1QZ1A 3NOIA 2VJXA 3QISA 4K23H 2QKIA 3MV8D 5DJZB 4RWHA 1D5IH 1PVHA 4YK4B 4OLWL 5CBAB 3VJ6B 1V7NH 3FKUS 5D7IE 3GNML 3BPCB 5CUSL 1KB5A 5HGDB 4APQB 5HYSB 5K9JH 3IS0X 2BCKA 1IGCL 4ZTOH 4OD3H 2GJ6D 1BPVA 4JDTL 3QCUL 1O0VA 1TQBB 3EO0B 4GRWF 4ZUSA 3D0LA 3OB0H 1I9JL 1CXFA 3DX8B 4NNXB 3PNWA 2C9AA 2FGWH 2OLDA 2ATPB 4OD1H 1ZGLA 1AD0A 3O2DL 1SY6A 5E6ZA 2FX7H 5ICYB 5HGBA 3S8WA 4I18B 1I4FB 5EU3A 3EOBB 1WWBX 2ED8A 5E70A 4JRXE 1JNLH 2DKUA 1AC0A 2PO6D 2ZZUT 3PF2A 1GHFL 4ODVL 1BIHA 4Z7UB 5F7WC 3BOVA 3DSFL 1DE4A 4O58H 3RGVC 5C0DB 2NZ9C 3DGCR 1LK2A 4QT5A 4ZTPH 3WXWH 5F96L 4HT1H 4HDIA 1GCFA 5D7LB 1GGBL 4IRSB 3EKCA 2WIIA 4I2XE 4U1GC 3KJ6H 2X4PB 4YDKL 2CLZB 3HB3C 4GSDL 3LHPL 5D96C 2A9ML 2IANB 5DHVB 2JK5A 5CINL 5C07E 5JXEA 4WRLA 3T77B 4KI5F 1BFSA 3EJZD 1YMMA 3QUZC 4QXUL 1BM3L 1UCBL 2ITCA 1ZVSA 3OJMB 3EO9H 4FTVE 1AHWA 3EGSB 1M7DB 4NYLA 2MJWA 4CVZB 4G80A 4AEHH 1SYVA 3F8UB 1U2CA 4K7PY 5EBMA 4TNVF 3C2SA 1JZ5A 5CZXC 1JRHH 3WL9B 3QQ4A 3O9WD 3BAEL 1OLLA 5TQ0H 2UUDK 2MFNA 3GB7A 4M9PA 3DV4A 2D0HA 4N8VA 1I85A 1AXSA 1AE6H 1IZKA 3VRJB 3MV9D 3GFUA 5C0GB 3R06B 1QSVA 1XGYH 2OR9L 4ZFZA 3DX6A 3NACL 2CIKA 1KJ2H 2BRQA 4WFHE 1W0YT 5D1XA 4CJ1A 4MNQA 3BZ4A 2VN4A 3BP5A 4YHPA 4KI1A 1N2RB 3BW9A 3GJEB 1RFDL 4O51B 4XC1L 2UWEF 5I15H 1ONQA 1HHIB 2VXQL 1ZHKB 5L0QC 4XBEL 2WANA 1VEMA 2IQAA 1J18A 3U46B 3WS6A 1WAAE 3WBDA 5BZWA 2UWEA 2W0KA 3VD5A 4RBPH 4PJ8B 5IF0A 5KSAB 4I0KA 4XH2A 3NIFE 3S37H 4P2QB 5EU6E 1WZLA 4I4WA 4YNYB 4AIZB 1AQDB 1CLYH 1CDJA 1X44A 1TVHA 1DQMH 3BKJH 1HSBA 4KPHL 1JV5B 4LGSB 3S36H 5I1HH 4M8QA 4W70A 3D3VA 3IFNH 4P2RD 3GSNH 4P59L 1MAKA 1F3RB 5B39G 1T3FA 1XGRA 5IMOA 4TUKL 4EEEA 4XT1C 4DVBA 4NZRH 5ETUB 5IKCA 1DBBH 2VDRH 1MLCA 5A40E 3MBXL 4K7FA 1A22B 1R24A 1YUHA 2Q86A 1Q1JH 5GZOC 3M17B 3P0YH 4K9EC 2FO4A 5FDWA 2J8UA 5C0BD 1YN7A 4UT9L 1QRNB 4WU7B 3E0GA 1G9MH 5KJRH 2FBJH 3RJQB 2XZAH 2VZSA 4I48B 4NQXA 2HRPH 2NW2B 5FM5M 5C0NC 2QSVA 4LLUA 3HE7A 2C3XA 4I8DA 3N85L 4NQEB 5FYLH 1PAMA 1KPUB 3IU3A 1DL7H 3D25A 1RHFA 2B1AH 4WFFD 5T3XH 4EUPA 1HZHL 1LGVA 3UEZA 2Z31C 4F58L 4AIXA 5JW3L 1FZMB 5GIRA 4ZO8A 4MQ7A 5JHDE 3L7EA 5FDYA 5DQJB 1R0AL 2VDML 3MLWH 2EKJA 3IFLL 1CIDA 1ADQL 3VXTA 2A6DA 3RVTD 3T08A 2BDNH 3SY0B 3WJJA 4PRHD 4N5ED 2VXSH 1OP5K 4JFQB 1DBJL 1E4KC 1R3KB 4XWGL 4OV5B 3QBTB 2DD8L 3KPOA 3W5NA 3AXLA 3KDMA 5FGRA 2DL9A 1PG7H 4UT7L 1IKFH 5CD3A 3HNVL 4Y4HC 3BPLB 4IIQA 1U42A 3HMWH 1EEZB 1EAPB 2BNRA 3H42L 1I8KA 1MREH 2Y9RT 5DJZA 1MIEH 5CBAA 2DM2A 3E6HA 7FABH 5FHAL 5EOQL 1CICB 3MCLL 2FBOJ 4U1KB 1NC4A 5E5MB 3TESA 5DK0A 4APQA 1WV7T 3G6AB 4L4TD 5DVLA 3FAWA 4OF8A 4XCYB 4K9EH 4JFDB 1TCMA 4A6YL 2NYYD 2R29L 1PEWA 1JP5A 2LABA 1S5IH 4WEUD 4NDMB 2CMRL 3D9AH 2DN7A 4R2GC 1TTGA 1E6OL 2ADFH 1QBLL 3W9DB 5CAYB 3PJSA 2Y06L 1SQ2N 4YDVB 3X3FH 5MENB 5F7MC 3SQOL 4G8FA 3ULUL 4G8GE 4LFHD 3QO1A 1UM4H 5ICYA 3O6LH 4XNXL 1DANU 4I18A 1U8OA 2DKSA 1BMGA 5C0IA 1CGUA 2FB4L 4R4ND 4M1DL 3GBLA 1J8HA 1LP9F 5C2BH 3NN8B 4FXKB 1NSNH 1NGQL 1MI5E 1KXQE 4PBWD 2VXTH 5DVOA 4IHOA 4LAJH 5E8PA 1LP9A 3VXMB 5F9JB 4LVOB 3QUMB 1PYWA 4CU7A 5AAWA 3FHAA 4LKCA 3ROLA 2ZUYA 3I6KB 2D7PA 1KPRB 1IAOB 2JCCE 1RZIB 2FECI 4XPGH 1NEZA 2G9HB 5D7LA 4B5EA 4HC1L 3VXSB 3RWFA 4IRSA 4Y1AB 3SDCC 3THML 3UDWC 4WDIA 2DM4A 4H8WL 2CGRL 3QUXB 3BKCL 4HF5H 4ISVA 3LV3A 1O7SA 2P8LA 3DRTA 3UO1H 2EYTB 3T8XB 3EYVA 3CDCA 4CKVX 3B3IB 1P7QD 1XH3B 1H3WM 2N7BA 2W91A 4KDTC 1KCRH 2W0LA 3QNYB 4LMQI 2C4FU 4ONFL 4J3UA 5DJ6B 1RU9H 2F53B 4BQCA 3RBGA 3MOBH 4FFZH 4FQXD 3G5VB 4RMRA 3TYFA 3BEVB 3L3IB 3D69A 1IBGL 4LEXL 3WL9A 4HGWA 4PY7A 1NBZA 4WTZG 3VI3E 5E6YA 3ARFD 1JYVA 1BX2B 1BF8A 4WEBL 3IAQA 2GT9B 1I1AD 5IT2L 3NCFB 1FVEB 1BFVL 1RIVH 5EU7E 2R8SL 4PRNB 4HXAL 3D85D 2HLFC 3C5SB 2RFXB 5F8RC 1ZLVK 2VDKH 1DBKL 4CMMA 5FKAA 2C3VA 2H8PA 4PJ7B 1UA6H 4WWKB 2DLFL 5F9DC 5DD3H 3B9DA 4PJDA 3W11C 2CO6B 4L4VD 3QXUA 4BZ1H 4DKEL 4OGYL 2ENSA 4ALAH 4Z95L 1K4DA 1HH9A 3CSBA 3PXHA 3GJEA 4HWBL 3KYOB 2NW3B 2BNQA 3VFUB 1ODAA 4TNVK 3C6SA 3ZSSA 1H5BA 1CF8L 3IU4H 4QOKB 2YSSA 5C0EB 4KU1A 4C56D 2VLKB 2Y07L 4OZIE 2XG4A 1TPXB 4Z0BH 5A16B 1HHJB 2DQFA 1OTUC 3E6FA 3B8SA 4PJ8C 4PJHE 2HTLD 1L7TH 1FPTH 3DETC 4XPTL 4DW2L 1T5WA 4FFVD 3I02A 2PW1A 4KKLC 1OM3L 3VXRD 3X3GH 3O2WH 1EHLH 3KVQA 1JV5A 2ORBH 5DHVH 3LZFL 5JHLL 3ZSTA 2Q6WA 4MZ2A 3S34L 5L2KB 2GK0A 1U93A 1OL0A 5I6XC 2R9HC 2H3NA 2R0KL 5HXMA 3O6FB 4OBSA 1MHPH 3K2UL 3IDXH 2NXYB 1K4CA 4Y4FA 3DMMC 4HPOL 2PYED 4Y5XA 3FO0L 1NGZB 4HJJH 2XXMB 5EU5A 5GGSB 4PJEF 3O4OB 3MGAA 3VRLE 1U8PB 2FD6L 5KG9B 1U8LA 1YEFL 4N8CL 3BIKB 4S1QL 3WIFA 1HINL 4K2UH 4WU7A 4PJEA 3PWLB 3X14B 3HPLA 2DI8A 4JZJB 4I48A 2NW2A 4JKWA 2RHEA 2HTKC 3H9SE 2Q1EA 4KKNA 5HI5D 1RUPL 3TIEB 4LCWE 3RWJB 3QO0B 4UIMB 3MR9A 1T1ZA 5K9OA 4N68A 4NQEA 4TSAH 1T6VN 1KPUA 5E94B 5AWNL 4P5TA 4MNHA 4WI2A 4GMTH 1KB9K 4O02L 3SKMB 4GOSA 1CGSH 1ZHBB 1VFBB 4HK0A 4OLZL 3MLYH 4K8RC 4RSVA 4LSSH 1MNUL 5IM7A 1MJUH 1OCWH 5CEYB 4I0PB 4QCIB 4MVBA 2R2EA 2EDQA 5I8CA 4J6RH 4PG2A 1CU4L 5DHYB 3MRHA 4MCZA 2VQTA 2UV3A 2BXZA 3ZDZE 1UH3A 3NABL 1CLZH 4JFQA 4LCWA 5F89B 4KV5E 3A6CL 4RCAA 3MRFA 3GSVB 3QDHA 5J9PA 1QEWB 3QIWA 1A3RL 4TSCL 2QV2A 3LMJH 3MJGX 3HAEB 3S3SA 2IBZY 3UTSD 4TVPL 1DQQB 1H8NA 2AKRB 1RJLA 2JELL 2P8PA 4LCIL 5GGVY 3BPLC 2Y36L 4LVNB 1Y18B 2EC8A 3O0RL 4RWYH 3NPZB 5GGUB 3ARVA 5DI8A 1DUZB 4YXKL 4H20L 3N0PB 3FRUA 1TMCB 3EYQD 3U6RB 1RZ7H 2X1OA 1CICC 4FRWA 4E41A 1NMAH 4PRIE 4G8EA 3UYRL 5IFHL 4JFDA 3MRDA 3UTOA 4PIRF 5LWYL 3GMQA 2ADGA 4NDMA 5DR5H 3S3JA 1MH5B 4YO0B 3V0VA 1A4JB 5SWZA 3O11B 1PEZA 3CMOH 1KIRB 1OSPL 1BVZA 4HKJB 4ZAKA 4MB3A 5GPRA 3BQUB 2G2RA 1Q8MA 5D1ZC 3KXFE 5GRZA 3WFCH 3VWJB 2IH1B 1I3VA 1T2XA 1CFQA 4JY4B 1F45A 2WBJA 1YPZE 2NY4C 3UMTA 4JZNB 3FONA 1SJXA 3S88L 1EBAA 4PGBB 3T3MF 3C8KB 4X7TB 4ZPVB 3BH9A 3B6SB 4DN4H 4R6UA 2CLVA 3RAJL 4OV6F 5DTFB 3TH3T 1NC2B 1XF4B 1M71A 2IC2A 4XCEA 4NQDA 3ZTJG 4PUBL 5KAQF 3VXMA 1ITBB 4JFED 5T1KA 5B3JE 2IFGA 4XHJC 3O3EA 3KWWA 1RUQH 3N1PC 3BVNB 3PIQA 3T2P