3FONA

Crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSLRYFVTAVSRPGHGKPRYMEVGYVDDTEFVRFDSDAENPRYEPRTPWMEQVEPEYWEGQTQIAKGNEQSSRVDLRTALRYYNQSAGGSHTIQRMRGCEVGSDGRLLRGYQQVAYDGRDYIALNEDLKTWTAADMAALITKHKWEQAGAAERDRAYLEGACVEWLRRYLELGNATLLRTDSPKAHVTHHSRPKDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC
publication title Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fonA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3fonA01
2VB5A 3ILPB 4GSDL 2UV3A 1CI5A 2FBOJ 4JFFD 5FCUL 5L0QB 4GO6B 4MJ5A 3RIFF 5T3ZD 4AIOA 4NO0A 3CFKB 2FATL 5D2LF 5I8OH 1QSEB 1X5XA 1FZOB 3MRIA 3OXSB 3ROLB 4UINH 3CCHB 1BBJB 4Q6IA 2BDNL 2QBWA 3LS5H 5HSFA 4NGHH 3D85B 3DVFA 3I85A 3DHMA 1HI6B 5A3ID 1RK1B 1IT9H 4YHNA 1L9NA 2ENSA 4P5TC 5EN2A 2EDYA 4Y16C 4G43A 1KLGA 2VLME 4LPXA 2ADFH 2ADGB 2L7UA 3KPPA 2FGWH 3BP6A 5I74C 5KSUA 3NOIA 1JZ4A 2EH8H 4ODVL 3WSQL 4JHAH 5DMGD 3CH1B 4JDVB 1F6AA 3BN9D 1A6AA 3QDMA 1NUNB 5K9QG 2V2XA 4LCUA 3P77B 1KOAA 3K74B 3BPCB 3BT2L 4HWBA 4UB0H 5C08E 1HDMB 4LCWE 5D4QA 1ZHBB 3MGTA 4ACPA 2JB5H 1A6UH 4ZAKD 3VXUD 4L1DA 3QFJA 2EE9A 5JQ6H 1HCVA 2VXUH 5IFHH 2YPLB 5DS8B 1S9VB 4ETQB 2SEBB 3ZHLA 1A1MB 1X7QA 3UBXG 3FJTA 3F5WA 3VG0L 3ZYJA 1MF2L 4OFKA 1N5AB 1SEQL 2X09A 4PR5A 4YFEA 4GRLC 1EFXB 2VDQL 4MXQD 2OMNA 1KCKA 5IB3A 2PYEE 2P5WD 1JL8A 3NIFE 4KKBD 3PQYE 1NAML 5F89A 1P6FA 2Q7YA 4MAYB 2Y72A 3Q5OA 1T6VN 2HJLA 1A9BA 4JFEB 4U3HA 3WLBA 1G7LB 1QLFA 1T03H 1K6QL 1X3DA 4PJ8C 2QEJA 2YN5A 3NCBB 5IMOB 1OWWA 1PKOA 5E5RB 4WHYH 5F7UA 1N4XL 1Z0NA 1BZ7B 5JIKA 1YPZF 4PJEA 4XT1C 2ADJA 3Q1SL 2EDBA 2AJUL 4UT9L 4BUHA 3BEVB 1WIUA 4PB9L 1MWAB 2HTKD 1RZJL 4KROC 5DJDA 1Q1JL 3ULUH 4ELME 5F9OL 1JWSA 5GGSA 3FB8B 4GRWF 5DJAA 3VXNB 4LAQL 3MO1A 3D3VD 4PJAB 2HT2D 1LMKA 1S7UB 1NMBL 3LOWA 5ERWB 2OK0H 2COQA 5T33H 4P49A 1PY9A 1IC4L 1JNHA 5ICZA 2KDGA 2HFFA 4YPGA 2Y4SA 5TPWH 3WNNA 3NGBB 1U92A 2R15A 1UGNA 5D7IA 4ENEC 4XGZB 5D96B 2MQ0A 3DMMA 4JFDE 3FL7A 1WTLA 1NKOA 1Q9KB 3B9KB 4Z7VA 1ND0B 5B8CB 5K93A 3QUXB 4L4VB 4DKFL 1CFSA 2UWEA 4KK6C 5ITBH 2BNRD 3NCFB 4LHJB 4WU5A 2EDXA 4XBGB 1KT2B 4CN4A 3FOMA 1U42A 2IPKA 3MJ9H 5ALCH 1HH6B 4K94H 5E2JA 3U46A 4XX1G 1AY1L 1SJXA 1SMOA 3ARGD 1JMXA 4UILH 1HQRB 3DXAE 3MV01 3GBNH 2V9RA 4IRJA 4YHIA 1OGTB 4Z5RA 4QOKE 3QXAA 5I1AB 4EBQH 2JCCE 2APXA 3TH3T 4DGVL 4OAWA 3C6LD 1F11B 3WLWC 2JJVA 4Y5YB 2D7MA 3MUGB 4FG6D 3VFVB 4P9HL 1UM5H 2AQ3A 4TSCL 2D2OA 1AE6H 4APQD 2IH1A 1INEH 2DQUH 4MX7B 3UCRA 4ZPTA 1EHLH 1RI8A 2DTSA 3OB0H 5EZLB 4G6ML 3GHEH 4N5ED 1WTGT 1WC7A 1HNFA 1QRKA 1NC4A 5EO0A 1PAMA 4L9LB 1TTGA 4IRZL 3EZ8A 1NC2D 5JXAH 5TE6L 2GK0A 2O5ZH 2BSSA 4KI1A 1GXEA 2FBJL 3EFFB 1SMAA 3T3PE 4UIMB 5ECJE 2P8MA 5CIPA 3VRJA 4MD4A 4HFWB 2OR9H 1NCNA 5DLMH 5GS2H 1XH3A 4JKWA 3DROB 5CINL 3ZT7A 2IC2A 4UI2A 1RZIA 4AYFA 2JKXA 1A3LH 1LO3H 3LZFH 3VCLB 2EKSB 5EZOH 4N0CC 1P7KA 3E3QE 2WBJB 3OR6A 5GGQL 3IRZA 1DQLL 1JWMA 2NY5L 3EBAA 2YUZA 2V17H 3QIBA 1TPXB 3QIWB 4LRNL 5IVXA 4ZOBA 2XZAH 1RUAH 3GIZH 2Q8AL 3C2AH 2V2WB 4EOWL 3WEXB 2Y07H 4X7TA 1FIEA 4FFYH 4XPBH 3V6FA 2HLAB 5IHZB 2OL3A 5JZ7D 1VFUA 3IDJB 5JA8B 2QQKL 5CZXC 2IAMD 4C58B 5E2WL 3ILQD 1E4WH 2BMKA 5DRWA 5M95B 3NVQA 1S78C 1YNTA 1G6RA 3EJZC 3U9PH 5E8NA 5SWSB 3QDJD 5DRXA 4Z77B 3RVWC 1PX3A 3BH8A 4MQXD 4YFDB 3SGKC 4Z6AT 1OAXH 1JGUH 4NT6A 4GG8A 1AXSB 1FLTX 4BQ8A 4FQJH 1X4ZA 4Y1AA 3VXRD 5IFJB 4HH9A 4OLYH 4HUNB 1BX2A 1EERB 4MA1C 3GMNB 4M7KL 2XZCL 3BO8A 4PJDA 3RJQB 1BZ9B 2PO6D 5KSBA 1WZMA 4JEGB 3AB0B 1TENA 2R4SL 3PWPD 4PJFA 1B4JH 3RUGA 1KG0B 4EEEA 1HXYB 4KJQC 4TRPH 3REVB 1BVLA 5EOCH 3D2UD 1V7NL 4PBVC 5DEZA 4JY4B 4L3EB 1PBYA 4F3FA 1NGWB 4JGMA 1WV7T 3VXMD 2IMNA 3RVUD 4DQOL 4NN7B 1Z2KA 2IBGA 3GZKA 4IRSB 3BE1H 1PKQB 1J1PL 1P2CA 4PJBB 1F4YH 3H7BA 1KC5L 1J0IA 2GY7B 1JNLL 5I1LA 2YD5A 5BV7L 1NBVH 3WIIH 4JM2C 3FQWA 4M1CC 4PV8A 4W6WB 2CK0L 5F9JA 3L3IB 5JHLL 3S35H 2MQ3A 4GRLA 4YDIL 4N68A 4JPVH 4H1LA 4PRHD 3OSKA 2H3NB 2R29L 5IFAH 2FHFA 4N90D 4D3CH 3MV11 4PJXE 5IMLB 1T7ZA 4EN3B 1BVZA 2YKLL 5KOMC 5EUKB 3RWJA 4LCCC 1I75A 2WWMC 1OF2A 2FJGB 4ONFL 4OLEA 3F7YB 3IKKA 4HF5L 5GGVL 1XIWD 1P1ZB 4K8RC 1RJLB 3BFOA 4NWTL 4ZDHA 2JIXA 15C8H 3QG6B 5JW4R 1VEOA 3MUZ1 3E2HC 3MREB 5JW4M 3T0DA 4XHJD 5LGHL 1CFTA 3OKMA 4RGOL 4XNUH 3TA3B 2FLRT 1A7PL 1NDGA 4LSQH 2AI0H 1FL3A 2I9LB 1CDUA 4GKSA 3WDIA 4U7SA 5FO9B 3MV9E 4BSVA 4NOFA 1I3VA 5DURD 3GHBL 5ANME 5HYJD 4N8VB 3ULVL 2BC4B 2BHZA 2ZSWA 4RFNB 2VXVH 1J1OL 4ODBD 2DMCA 1DEEA 3EOTL 4XHQA 3V4VL 2J6EH 5HHOA 2BOCB 3STZB 4P4KC 1NUDA 5CJBA 1B9ZA 3F8UB 2R4RH 3X3GH 3I75A 4XMPH 4LBEB 5FO8B 1AO7E 4Y4KD 1IKFL 1VGEL 2VJXA 4MD0A 4KZDH 3IFOB 3MRPA 2DQHL 2DQEH 4Z95L 1D3CA 5F9WC 3IDNB 3O6LL 4TPRH 5C0RH 3Q6FB 3MCLL 1ZLVK 5DD5H 5A2LH 5CILL 5F88B 2E9IA 2Z31A 1FN4A 2WUBH 5TDPB 3N9GL 3OL2A 4JRXE 1AD0A 1FORH 1YY8B 4OCNC 1KXTB 4LCYB 1P4IH 1PX4A 3ARBC 4J3SA 3DGCR 4KY1H 1CLZL 3RNQB 1QR1A 2N1KA 4M6OH 2BVOA 5HI5C 5JOPD 2ZCLL 1OLLA 4ZFOB 1ZA3A 4X6EA 1L0XA 1B0RB 4G5ZL 3D85D 2AQ2A 2ITDB 3BQUB 3UBXA 4QTIL 4NIKB 4WHTA 4WW2A 4XCNB 3GBMH 3MNWA 4J3UA 4E42A 1MCPH 3DX6A 2EH7L 1U36A 1PZ5B 2BNQA 1T22B 1K4CB 5IJVB 3M17A 5SWZA 4NQSA 2YR3A 4PBWD 1JPFB 2R0KL 4JO1H 1BEYL 2AEQL 2AJSL 5I66A 2BJML 4XP9L 1T89A 1W72A 4FXGB 3HE7B 5I73C 1DBKH 1QFUL 3HPJA 3UJTH 1F5WA 3D5OF 5MERB 1JRHI 1I85C 3K7UA 2I07A 1T3FA 5J1AA 4W4NA 3ZLQC 1BIIB 4NQDB 4PJGE 3CSBA 4YDKL 3VXUE 1R5WA 2JK5A 4S1QL 2H26B 4D9QD 1RIUL 4TN9A 3O0RL 4GKNB 2YPLD 1NBQA 2IADB 5AZEH 2DMKA 2R0ZH 1DQQB 5BO1L 2PTTB 1AI1L 1AXTL 3V4UH 1Q9WB 1WFTA 4HT1L 4G8IB 3BP5B 3P30H 1UWXH 1DFBH 4YIQB 3VDCA 2P5WE 3EOBA 3EYVB 3R1GL 4NQEB 3AROA 3SGKA 1F3JA 3V5KB 5CEZD 1FZKB 1TMCA 1A9EA 5E7BA 3QEQA 4Z7UB 3SGEI 3CFEB 3KS0H 4CN1A 4F9PC 4R90L 2KQNA 1K2DA 2F53D 1DTUA 1OT2A 2A73A 2BSED 3G6AB 4HUVB 3TYGL 3O4LA 2W0FA 5DFTA 43CAA 3LB6C 3IFLL 4CAGA 4NFDA 1GGBL 3PABB 4X6CF 4S10A 4OI9A 2DDQH 1MJ7H 1RZJC 4L29A 2X9WA 2GTWA 2KZ1B 1CD1B 1LO4H 4W6YB 1E6JH 3S37L 5IIEA 4IHOA 1FAIL 2EXWC 3CU7A 5GGVY 4FXKB 3D3VE 4PG2A 3RGHA 3WMSA 1ACYL 1YEKL 4OD1H 3WFDH 1R24B 1AGDB 2JB6A 1YMMA 3QQ3A 2DJUA 3ZMRA 1MFAH 2I26N 1FO0A 1QEWA 3BMWA 1MAJA 2A74A 5EBMA 4KAQL 1SJEA 2H32A 2XYCA 1V3MA 3O3EB 1Q0YL 1LO2L 4G6FD 4PRBB 3B9KD 4DN4L 5HHXH 5JXEC 2VZ3A 3NA9L 4JR9H 3TVMB 3LRSA 5DUML 4I2XA 4HXBH 1C5CL 4MB5A 2BNRE 2X4TB 4JM2A 5AAWA 3IDMB 1S7RA 1ES0B 4BZ1L 1KGCE 2CIIA 1MRFL 2MOVA 4X4MA 3VFMB 1UQSB 5D7JD 2NY0C 4ZFGL 1BJ1H 3VXTA 3V4PL 5DI8A 2Q76A 3EFDL 4OI8A 2UUDK 1P7QB 5TH2B 2CXKA 4KDTC 1YUHB 4NCC1 5FGSA 3LKSB 4CMHB 3I02B 1JRHH 1I1AB 2R23B 3DSFL 3K3QA 5GGUB 4LCCA 3WXVH 5EB9A 2EDJA 4MHHI 4P9HC 4F8TA 4ODSL 3V5HA 1A7RL 3O9WA 3RP1A 4E5XB 1JYNA 3QEHB 3X13A 3U36B 5CZVL 4QNPE 3MRDB 3NABL 4HS8H 3W81A 3SO3C 4XCEB 3UAJD 5IVNA 1K9TA 1T0NA 4PG9A 5D7KD 3MRCB 4X9GA 2ADIA 4X7DC 2X1QA 3ULSA 4U33A 4EDXA 3VXSB 5FHAH 5CJXA 4JREB 4P2RA 3WD5H 3WV0A 3HNTL 3S36L 2LV4A 1UWGL 4OUUB 1UJ3C 4EXKA 1SYSB 1UENA 3SGEH 1HH9A 5CSBA 4QXGL 4OZHF 1EA9C 3I6LE 3VGDA 4X9IA 2FR4A 3FB6B 5JUEL 3GMRA 5B4MD 4EXPX 4CVXA 4LIQL 5D5ME 2ERJC 4P4KA 2VDKH 3VD5A 4NO0B 3RZCC 3G6DH 5C86A 5J57B 1OTSC 2NY5C 1WFNA 3KPSA 1JGLH 2NY3C 2OZ4H 1ERNA 1T2QL 5FUZH 3PDDA 2E7LE 4JQVA 3QIWD 1IKNC 5EN2B 3SDXA 2VLKD 1KLGB 1ZGLA 2UVEA 4K9EL 4FQ1L 3T1WA 1WZ1L 3QDJE 5LCVH 5SWSD 1EJOL 1UCTA 3WIHA 3OGCA 4HPYH 4GQPH 2GQHA 2GAZA 3P4OA 2W9EH 3AM8C 4M7ZC 4NRZB 4F58L 2JJTC 3VA2C 2W65B 3UXFA 1SVCP 5IB2A 4FN0A 4GQ9H 4NN5B 1KELL 3ARBA 3MGTB 1MPAL 1VENA 4OZIF 4QRPB 3T2PA 2Y36L 2HVJA 3ARQA 4P5KB 1DR9A 2EIEA 1TTUA 3GSUA 4KTDL 1DQDH 3F5WB 3CC5A 1QSFD 2IBBA 5IR1B 3VGFA 2K7QA 4WO4D 3TBSA 3MYJB 1J0ZA 3QWRA 1KCUH 3PWPE 4NHUA 1VFMA 4Q74A 3RX5A 2WLYA 3GJFK 5D1XB 1JFQH 3BRFA 3VWJD 2DJ4A 3K4ZA 5MENA 5F89B 4R96A 2NZ9C 2P5EA 2Q7YB 1EGJL 2XWJB 3MLWH 3GSWA 1N6QH 4HK3N 1UA6L 2ZOLB 2X9YA 4I0PB 1EEQA 4JZJA 1T1XA 3EAKA 4L3ED 3WLBB 4QY8B 4KTEH 4P2YA 5CCKL 4K23H 5AG8A 5I8KH 3QCVL 2CSPA 1QBLH 3RWEA 5FHBL 2CDFA 4EVNA 2UZIH 2D7OA 3BW9A 4G3YL 3QA3A 1FJ1A 2ADJB 4OCYL 4YXKL 4C83A 2IEPA 4Y5VA 5BV7C 1X5ZA 1DZBA 4X7FC 3SBWC 2AABL 4PRIE 2JJWA 1WWCA 3CFJB 1BREA 1JWSB 3CZJA 2YD3A 3ARDB 4PRHE 2DOCA 4JAMB 4N90E 3TZVC 3MV7A 4R4BA 1T21B 3DRQA 2E9JA 1CBVL 5ICZB 3PWUA 3J8F7 1U8PA 4X5WA 3KYKL 2I60H 1U92B 4HFUL 3W9DA 5D2LB 4HEME 3D0VA 4F9PA 4O58H 3E8UH 3BZEB 3LD8C 4K3GA 4Z7VB 5DC0A 4HUKB 3OV6A 1JHLL 3W82A 3LEXA 2HH0H 1CFSB 2UWEB 1KUMA 3U4EB 4P3CL 4CUCA 1Z9LA 3BN3B 3OKKB 3LH2L 3I3EA 5C0AD 2IPKB 4XBPB 5E8DH 4X80H 4QHKJ 4WUUA 4NDMA 4CJ1A 3BKCL 2LU7A 3JV6A 5HDBF 5DJ6A 2HLFD 1VERA 2YZ1A 5DR5L 3TA3D 5C0IA 4IRJB 3ZDYF 2OP4H 4YHIB 5JHDB 1N0XH 4OAWB 3KPMA 2YXFA 2HFEA 4PJ7F 3ULVC 1LEIB 4ZXBB 2X41A 2WSKA 2XOTA 1D6EA 4JN1H 4HWUA 1QACA 3OKOA 5D1ZB 3GKZA 1IM9A 3QO1B 2HT3D 4YE4H 1A2YB 4PP1C 4ZPTB 2Q6WB 5CD3B 3VFPA 5JXEA 4TUOB 1QA9A 2XKUA 2ZPKH 5CWSA 3DECA 3I6KA 1MREL 1NC4B 5AYQA 4QHLA 1FG2A 1T04A 3P9LA 2E8ZA 2DL9A 4HC1H 4MDJB 4G7VL 1NCDH 3L5WB 1T83C 4L4TB 2VRAA 3PF2A 4OZFH 2R8SL 4FTVB 3JV0A 4GW4B 5JIHA 3STBA 1YQ2A 2Z92A 3P0YH 3VE0B 5FV2A 5D1XC 3G5ZA 5CIPB 3GSVA 2VQUA 3OAZH 1YEIH 3BUTA 4ODUA 1FL5B 4S1RL 4WY7H 1ZE3C 2VDML 3KPLB 1KIUA 1XH3B 4OLVL 1EEZA 1BJ1J 2VR9A 1MRCL 1FNHA 1KEMH 3IVKA 1JYWA 5C0ND 1D5IH 1YEGL 4NO3B 3HAEG 1ZANL 1YPZB 4WFFD 1OB1B 5IEKA 2EYRA 2AJYH 5GSRB 1KSRA 2CLRA 5I8OL 2P45B 1IGMH 1ZS8A 3GO1H 4NZJA 2NY6C 5GRJH 4E41A 2VC2H 1CTNA 2WLZA 3EO0B 4UINL 3SJVB 5C9KA 2VWEE 3LS5L 4NGHL 1NFKA 1R3KB 3REWB 4KUCF 2VZSA 1IT9L 2LU4A 2OL3B 3TPUA 3MA7A 2VABB 3O8XC 4HIIA 4ZFFB 3SE9H 5DRWB 1E28B 3K2UH 2ADFL 2UVFA 1YNTB 2FGWL 3HN3A 4OF8A 3KXFA 5GGTH 2YWYA 2EH8L 5BMFH 5F93C 3U4AA 2V7NB 3BH8B 4JHAL 4KK5C 3C5SA 1UZ6F 4NT6B 3TO4C 2O5XH 1IGIH 5C3TA 2EKJA 3V0AC 3QWOA 2WINB 3NIGE 2CKBA 1D6VH 4HJJH 4UB0L 4UV4H 4HH9B 1KB5B 5GS0H 3O6FB 2JB5L 4D9QE 1A6UL 2YPLE 1A6PA 1XGYH 1IKNA 1WQVT 2FX9H 5JQ6L 2VXUL 5IFHL 3DO7A 3SDAA 2P1YA 3BO8B 3G5XA 5IBUB 4PJDB 4PLJC 5KBNC 4JFPA 4UU9A 1ZVSA 4ZTPH 3CDGA 2AV1A 2X5PA 3RUGB 3GFUA 4XXDA 5B3JE 3P4NA 2H8PA 3PHQA 3BPOC 5CEZE 2VQ1B 3AM8A 2JJTA 3P0VH 5J8OA 4H88H 4MJID 3OJVC 5AUMA 2R1YB 4UOJA 1A5FH 2F53E 3ARSA 5BVJA 1JYVA 3KPNB 1T03L 4HUWB 3H7BB 1AD9A 3EJYD 1YYMH 4MZ3A 1C08B 1BD2A 5T5NG 4JDTH 4OD2A 5SV4A 2F8VA 3H6JA 3FQWB 1OSZB 4KVCH 4Q2ZA 4EI6B 4EUPH 3RNKA 1Z9OA 3BKYH 2ZUYA 5F7EH 1AFVH 3ULUL 4JM4H 4JHZA 2KL6A 4NZUH 1ROWA 4PJAE 1F00I 4DAGH 3MCG1 3MBED 4Q58C 4MNGE 5C0BB 1KPRA 2P49B 4Y4FC 2OK0L 5T33L 4PGBA 4HV8A 4PJ5E 4H25B 1AHWC 5TPWL 2J8HA 1EEYA 4LLUA 1N3NA 2WANA 2XKNA 3HS0A 3LS4H 5A40E 4B53A 1J1XH 2JIXB 1VPOH 1BGXH 5DEGB 2C3WA 1YC7A 4UNTA 2FYYA 3SDCD 4YBQC 4CADA 4OF0A 3NFPA 5TDNB 5T3ZH 4X99B 5ITBL 4JRWA 4LFHD 1JCKA 3B9EA 2ICWA 3MJ9L 2CUHA 5ALCL 5LVEA 3EYFB 4K94L 1IEBA 1WBXA 5JOFA 4U0RC 4MXVE 4UILL 5D7SH 5ESAA 4BSVB 5DJYB 2UY6A 3TM6A 4M93C 3GBNL 1I1AD 4N0UA 3OF6A 4EBQL 3KVQA 2ZSWB 1S8DA 3OR7A 4QRTA 1N7MH 2B5IC 1DEEB 1WISA 4O2EA 3WHXB 1XZ0A 4HS3A 3ZL4H 4OBRA 3QJHA 3PWVB 4ZSOA 1UM5L 2PETA 1AE6L 1MFBH 3QZWB 2R2HA 1INEL 1H3XA 1NGYA 2DQUL 2VLJB 4OI7A 2E9BA 1EHLL 2P8PB 4PV9A 5D7KE 2NW3A 2GCYB 1V3KA 2IH3A 3RVXC 3UC0H 3QUMA 2AJ3B 2RHEA 2NY4C 3I75B 1AIFB 3S5LG 4F15C 4PJIE 3FB5A 3GHEL 3SHSA 5J11C 5E8OA 4ZNCD 3BP7B 1IM3A 3NIFF 1EZVX 1MSPA 2X40A 3B4NA 3DX8A 3TJHD 5DD1H 3MRPB 1WAAE 5JXAL 4GW5A 3QJFA 3Q3GB 3RWCB 2O5ZL 3IS1X 4BFEA 4TNWF 2PXYD 3EYUH 4LLDA 2D7QA 4MNQA 4AY0A 5FEBA 1BWMA 2K7PA 1U95A 2RIKA 1YNKH 32C2A 2Z31B 2OR9L 5JW5B 5J56B 5DLML 5EDXA 1AD0B 1U6AH 1UKSA 2J88H 4NJ9H 1I1CA 4F2MA 4I3GA 1LO3L 1A3LL 3LZFL 4NO0D 1G7JB 4R97C 4JFXB 5EZOL 5JIIA 2BVOB 5FA3B 5BZDA 4X6EB 1LGVA 2WIMA 3CPLA 5F8QC 1T83A 3ZDXE 5JIPA 5KVDH 3UBXB 1FSKC 2V17L 4WW2B 3MNWB 4E42B 2VLKE 4Q97A 1WCBB 5HI3C 2XZAL 3DX6B 3QDGB 1RUAL 3GIZL 3C2AL 4K9EC 3L3KA 4XI5D 1OAQH 2Y07L 5I30H 1BMGA 1AGEA 5KTEH 5D2NA 4XPBL 4FFYL 5SWZB 4X6DA 4HPOH 3BGMA 1KPUA 1E4WL 5I66B 2HKFH 3QDMD 4GG6A 3U9PL 5HHQA 5J4MA 3HPJB 4ELKA 4OIBA 4M5ZH 1OAXL 1JGUL 4NZRH 4ONOA 5E6IC 3T4YA 5FYLD 1GGIH 5GXBB 1NGQH 4FFZH 1IILE 4JHBA 4QRPD 2JK5B 4FQJL 2I9TA 3QFJD 2ICCA 4OB5H 4OLYL 3WXWH 4C4KT 4A6YA 1U8NB 4YNYA 5F7DA 1QSFE 2JCCF 2GSGA 4OV5A 5C8JB 1RJYA 3KPQB 2H6PB 3BVNA 3O8XA 3FZUC 3WS3B 5I75C 2FH6A 3F12A 5BOZG 2AVGA 4MCYB 4P3WA 3SKNB 1GZPB 4KKLD 1NKRA 4Y19B 1UWEH 1F3JB 1B4JL 1YMHB 3TO4A 3NTCH 1F42A 1TMCB 4TRPL 2C4XA 2C4FT 5EOCL 2X4NA 5I6XB 1RZFH 5DJZB 4UUJB 3UTSB 1NFDE 3DV4B 4EDWH 4L3CA 2A73B 1R5IA 3O4LB 2BZDA 2VR4A 5A43C 5E00A 2EDDA 3BE1L 1IGFH 3HG1E 1J10A 5HY9A 2MCG1 3EYOA 1I7UA 4B0MM 1F4YL 3PIQA 4QF1B 1QBMH 5ITFB 3D6GA 4YGVB 4L29B 2GTWB 3UTPD 1NBVL 4U4BA 3WIIL 4P57A 1BQHG 3H3PH 1FCCA 1HHHB 4OZGA 5I8CB 1IGJA 4XXCA 3T2QA 3S35L 5EORH 1ACZA 3BWUC 3F7PC 5E2UH 4JPVL 1L6ZA 2JB6B 4NBXB 5IFAL 4H26A 4D3CL 2A74B 5E94B 3UPRA 2Q7NA 4G8FA 2MPAH 2FSEB 3A0OA 4NNPH 1BAFH 4CJ0A 2ZG2A 3DMMD 3O3DB 2AP2A 5HGBA 3IFNH 1G7IB 2FIRT 3LRSB 1ZMYA 5J1TC 1SEBB 3KDMB 1FNEA 5DDHA 2J8UB 3NZ8B 15C8L 5C0AE 4NHCH 3U7WH 3MLTA 3MOBH 4PTUB 4LHUG 3BUYA 2VZVA 2YS4A 3O3AB 1QHOA 4LEOB 4KI5D 3BHBB 4WEMB 2YRZA 4IRJD 4XNUL 2YPVH 3L3DA 4Z7QE 4LSQL 4X7SH 1KTLA 2AI0L 1MLBA 3TIDA 7CGTA 4WUKH 4J8RB 4Y4FA 4OBSA 3DARA 3V5HB 3V6ZA 3O9WB 3X13B 3HAEA 2C7UB 3KYNB 3JV4B 3L3GA 5FKAB 1CF8H 3C5ZA 2ZNWA 4N5UA 1EAPA 2VXVL 4YDVA 4BFIA 2J6EL 1I1YA 4U1HA 3ZTJH 4PG9B 2DLIA 1A7QH 3MRMB 2R4RL 4YWGH 2ADIB 1INQA 1K8IB 1CXIA 1CG9A 3UO1H 3EGSA 3X3GL 1NC4D 1DBJH 1A7NH 1OTTC 2Z91A 1PD6A 4U1NA 5HGGS 4Q9BA 4XMPL 2YSSA 2GHWB 2PW2B 4YHLH 2NTFA 4LHQB 4FTVD 1IL1A 4M8QA 1W0YT 1O5DT 1Y6NR 5BRZE 4ONGH 4KZDL 3N1GC 4LLYA 2DQEL 1MCRA 3ET9F 5E8EA 1MFNA 1G1YA 3ZE0E 1FFOA 1ZWIB 3MRKB 4TPRL 5C0RL 5DD5L 4DUVA 2IANB 5HI4D 2WUBL 4D0CB 4MB3A 4FZ8H 1UFUA 5DSCA 3LKRB 4W6XB 3SKOA 3VFRA 1FORL 3KPSB 3SDDC 3OX8A 1P4IL 4D0DA 1JPSH 4KY1L 1T1ZA 4M6OL 5EUOA 3C09C 5D9SA 2JJSA 3LRHA 3GIVA 4PJXF 1VKXA 3KLSA 5IW1A 1KNOB 1DQJA 3FFCE 3GBML 1MCPL 5H37H 1X5AA 1S7XB 2E27H 3DYMA 4Y4HA 2GI7A 3BYYA 3OGCB 1HOCA 1JI2A 1ZHLA 3P4OB 3TJEH 4JO1L 1JHKH 5H35B 5JA9A 3EO9H 1VFAB 4X4YA 5IB2B 5E8PB 3S37X 4NQVB 4PY8I 3UPAA 1DBKL 1SBBA 4Y1AD 3UJTL 1J5OH 1QHPA 1I3RA 4CVZA 1AJ7H 4ORZC 2C9AA 1MCIA 4HIXH 3GSUB 3B9VA 1EEUA 1RFDH 4RGMC 4MXWH 5EIVA 3EYSH 5AZEL 3ZE2E 2AS5M 1KYOJ 2R0ZL 4I48A 5DGQA 4Z7OF 1LHZA 5GRWA 3BX7C 2C3XA 3V4UL 4HUUA 1F3DJ 4TQEH 3MGOB 4JO2H 2F74A 4PJ9C 3GSQB 5T1DH 3P30L 3QI9A 3QULA 1OPGH 4DFHA 1DFBL 3FQRB 2NW2B 3GSWB 2YMXH 2YD8A 3BDYH 2MSPA 2BXYA 4OCMC 4JZJB 5J9PA 4MJIE 5E6IA 3IJSA 3RWDA 3UDWC 3QP3A 4GKZB 3ES6B 1FJ1B 1F90H 4EQ2A 2CLVB 3ARXA 3NCYP 4Y5VB 1H15B 2OTPA 4FS0A 3QEUB 3D69A 5J6HB 1AGFB 3IKCA 5GS1C 1QPXA 3AMLA 1UJTA 3OKEA 4PP2A 2DYPB 2DDQL 2JJUA 1MJ7L 4GRLD 3NFNA 1F02I 3ULUC 1ZSDB 4L4JA 1LO4L 2EXYC 1O7VA 1E6JL 3HR5B 2RR3A 3MV7B 3B2VH 3QNXB 3DRQB 4LPYA 5H8DA 5JDJA 5DT1H 4O5LH 1HYSC 3QXVA 4OD1L 3D9AH 3WFDL 1Y18A 1DSFH 5HD8C 3D0VB 4LDEB 3IB4A 1OAYH 1MFAL 1UVQA 2XZQH 2GEEA 3RHWK 3S98A 1ADQA 1I8LC 4V2BA 4QRQA 2JIXD 5T5FH 4HS6A 2VNCA 2IWGA 2IMMA 5HVWA 2BVPB 2CR6A 3HLAB 4DFIA 4DZBA 5HHXL 3ORJA 1G7QB 4JR9L 3HI1A 3S5LA 4KJYA 5IW6B 4RNRB 4HXBL 4HMCA 4LPUA 2Y7QA 2X4RA 5ACLA 3W0WB 4H8WH 3U2SB 3HC0A 4PRPE 3O11A 5DJ6B 4K94C 5BW7A 3H0TB 3G6JA 3MSPA 1JK8A 3ECBB 5DQJA 4ZODA 4YDLC 4EI5A 4PJGF 4HG4K 1S7TA 1TVHA 1ZEAH 1K4DA 1JRHL 3C6SA 4TVPD 3V95A 1D6EB 1PEZA 3OKOB 1DBBH 4MJ4A 3WXVL 4OZIB 4ENED 5JW4N 5HHOD 5CEXA 3CNKA 5EA0H 1NGPH 4HIHA 4GAYB 5CWSB 2YD1A 4HS8L 2GTZB 4M7LH 4QHLB 2YXMA 5I1JH 2ZSVA 5IROC 1ZLWK 4LLWB 3MNZA 1Y6KR 5FHAL 4JJ5A 1I7TB 3GSVB 1QP1A 3WD5L 4ODUB 5EULV 4DZ8B 3VFSA 2B2XH 3WLWD 3WN5C 2VDPH 3P73A 3GMLA 5C9JB 2X44D 3RVTC 2Z31D 3LN9A 3UYPA 5F1NA 3Q48A 2VAJA 5L8JB 2JE8A 3DX9B 1KTDA 2E3VA 4IJ3C 2GUOA 3X12A 3I50H 2VDKL 2D0FA 2CLRB 2R0LH 3G6DL 1JGLL 2OZ4L 3D39A 1H3VA 5FUZL 1DE4A 3S96B 3TPUB 5CLWA 4JRXA 4HIIB 3TBWA 3MCKA 2BNQD 2V5MA 3SGJC 2X89A 1OM3H 5SWZD 5JORA 3D25A 4G9DA 1TVDA 4PJCA 3U30B 4JFQA 5EBWB 4P2OA 3QDME 1K8DA 1X9QA 5CJQH 5LCVL 4IS6A 4NO2A 3VW3H 4HPYL 1U93A 3QWOB 1LO0H 3ARYA 2W9EL 2CKBB 3JTTB 5FYLE 1IGYA 2EC8A 2HKHH 1P5UA 1AC0A 1MUJA 4JY6A 4GQ9L 4ZUTA 3EHBC 1KJVA 3C5JA 1RHHA 1S9XA 5ESQA 3QFJE 3ZKXC 2LVEA 2DICA 1BJ8A 3BJ91 1G7HB 5CSGA 4Z18A 3DO7B 3SDAB 4KK8C 5KSAB 3QUYC 2XA8H 3X3FH 1C5DA 4OCRH 2OJZH 4Y2DB 1DQDL 4UV7H 5CZXD 3DV6B 1BQHA 1CQKA 3CDGB 2AV1B 5ICXA 1HXMA 4PJ7B 4K71B 3GGWA 4QHMA 1ORSB 1KCUL 3QUKB 2W0LA 4RSVA 4LARH 4OFYA 1JFQL 2I5YH 3TV3H 4C57C 4UOW0 3MLWL 2ZOKA 4JG0H 1N6QL 5AUMB 3TH2T 4C56E 2HN7B 3S3PA 3JBG7 3CMOH 3CZFB 4KTEL 4K23L 4YFLI 4NNXA 4PJEE 3O4LD 5I8KL 4R4ND 1U91B 1QBLL 2DQGH 5IQ7H 1UB6B 2DLFH 3D48R 2UZIL 5I18H 2F5AH 1X5IA 3LKPB 4OD2B 2QV2A 3VMOA 4HCRH 2CH8A 5ENWA 3S6CA 2GJJA 3UTPE 3RNKB 5EU3A 5BXFA 2WNGA 4LHUA 3H2WA 5KVGH 3WS6A 2BVTA 3FAWA 3GSRB 3BJLA 4PJ9A 4I1NB 2DKUA 4KJQD 5D5MF 1GYAA 3SO5A 4ZUVB 1YMMD 2J7LA 4HIEA 1JIBA 3DVIA 1CICC 4L8BA 4PGBB 1ZT7A 3K1DA 4XH2B 1OP3H 3AS1A 3O4OC 5D7IE 2I60L 2J5LC 3UDWA 3SKMB 3WDJA 4LLUB 1N3NB 1IQWH 2XKNB 3HS0B 4BZ2H 2FL5B 5DHVB 5MEPB 1P69B 8FABA 4Z7VE 4O58L 3E8UL 2NXZB 4L8DB 2UWEE 3SCMA 3BKMH 1XR8A 3LDBB 5IB4B 5F97E 2AXFA 2QQLH 4CADB 2HH0L 4JM2D 3T0VA 5GS1A 2Z93A 1MEXH 5MEOA 2LABA 3HE6C 5E8DL 4X80L 4KI5E 5C0FA 5ID1A 1R3LA 3FRUB 1JV5B 2HA1A 2K9UA 2R2BA 5EZJB 5I1CH 1B88A 1SM3H 4PGDA 2OP4L 4N0UB 2OM5A 1N0XL 1T20B 2WWMD 4R4FH 2J8OA 1UEMA 1R0AH 5CGMA 3O9WD 2FEDD 3CFBB 4JN1L 1CVRA 3CDFA 1I8LA 4K8RD 4IMKC 5ETUB 4YE4L 5I0ZA 3DETC 1D5ZB 3QUMB 3B9AA 2DLGA 3ELAT 5C0DA 2ZPKL 3HUJA 4OLXH 1MY7A 4U7MA 1HK6A 1IM3B 3EYQC 5HBBA 2VLRA 4CDGC 3M07A 4HC1L 1SJHB 1QRNB 2RBLA 1NCDL 3HFMH 1DANT 3OKDB 1V3JA 1UC6A 3BZ4B 3TCLA 1RUKH 1WCQA 3QQ9C 3GRWH 3P0YL 4KUZH 3AU1A 4RGNE 1QO3B 1YEIL 3AXLA 4MJ6A 32C2B 3MROA 1AKJB 2PKDA 4PGJA 3D0LA 2YD7A 4WY7L 3TBTA 5E56A 4P4KD 1KEML 1D5IL 3MRLA 4JO3H 3KPSD 4X6BA 3MFFA 1T7XA 2WM0A 2D03H 2AJYL 1MFDH 4LMQI 5HHNB 1S9WA 4UDTA 3CPLB 5IGXH 5J12C 5IVXE 1RVFH 4JKKA 1IGML 3GO1L 5GRJL 3RBGA 2X4QA 3K0WA 2VC2L 1AQKH 4NKQB 5L6YH 4X6DB 3E6FB 5L2JB 5EU6A 4JPIA 3SE9L 1ODAA 3WN5A 3K2UL 1YDPA 2ARJB 1V05A 2QSCH 1FDLH 2HVKB 2CXGA 1N59A 5GGTL 5BMFL 3TBYB 4RDQF 4GAJH 3OXRB 2DS4A 3ARBD 4OGYH 2O5XL 4MWFA 1IGIL 2Y6SC 4Y1AE 2FWOA 1D6VL 4HJJL 4UV4L 3V7AE 3DO3A 5GS0L 4A6YB 4YNYB 3TN0B 4F8QA 1QVOB 5GRVK 1UYWH 5DUBB 3VFGH 2LAAA 4OGAD 1XGYL 4PJDE 3HNSH 2FX9L 3G5YB 3VGEA 1RJYB 3E6HB 5C08B 1AP2A 4HAGA 4HJGB 5KSBE 4LCWB 4QHUA 3WFHB 3F12B 4MS8C 5E7FA 1MLCA 4PJFE 4GXUN 1VFOA 3RUGE 4LVOB 4ZTPL 1F45A 3LN4B 3H3BC 5MEND 2ICEB 1CGWA 2P5ED 3QH3A 3ZYZA 1MCFA 5A2IH 5DQ9A 1LP9A 2V5TA 4IDJH 1IAOB 1UH2A 3P0VL 4HEPG 4H88L 1H3GA 5INCB 1A6VH 4POYA 2ZKHH 1R5IB 4GW1A 5GS3A 1A5FL 5ESVB 1X4XA 2YRPA 2PYEB 2H2PC 1A14H 1I7UB 1QNZH 3MRJA 1CWVA 2GYSA 1JJUA 1YYML 3PQYB 1DCLA 3Q2CA 3DVNA 4JDTL 1KCVH 4P57B 4WDIA 3P9MA 2W60A 4P2QA 4KVCL 5DZLA 4JRYA 2DYPD 4RAHA 3DURB 1B2WH 5DJXB 3BKYL 3SOBH 4HD9A 1UXSB 5EPMA 5F7EL 1AFVL 3MV7D 1AQDB 4WTZG 4JM4L 4NZUL 1U8OA 4DAGL 1OGAA 5BJTA 3RTQC 2WK2A 3UPRB 2HYMA 1UEYA 2NY1C 1XGTB 4G8FB 4MLIA 4X5XB 4M3JA 4BH8A 1KIQA 2Y23A 4FQCH 3GMOB 4ELMB 1U3HA 2ATKB 2F8OA 3TP4A 3C9NA 2V5YA 5HGBB 4WI2A 4POZC 2YEZB 3LS4L 2H9GA 4HGWA 1J1XL 1IARB 1VPOL 1BGXL 3TIEB 3OJ2C 1XF1A 5FO7B 2XN9E 4CDHA 4WUUD 3OHXB 2QADB 3BUYB 3IFPB 5T3ZL 1XMWA 4LLVA 3CDCA 1H5BC 4NKIH 4JFDB 1TZHA 3NIGF 4F33B 1KTLB 4K7PY 2CPCA 4N1CA 3TIDB 5D7SL 1CICA 5JPNA 1XCTA 4YHMH 1GRWA 3L3JA 5AD0A 4TVPE 2RFXA 2D31A 4ZUUA 3ZKMD 1X6NA 5GRXG 4YC2C 1IM9D 5HHOE 2CJUH 4AH2B 3C5ZB 1DDHA 1N7ML 4YDVB 1Y6MR 4KQ3H 4BFIB 3ZL4L 2XWBA 4RA3A 4U1HB 1MFBL 3TN0C 3L3HA 1INQB 4QOKB 1CFNB 2JCCB 1I9RH 1KN2H 3UC0L 4TYUA 4U1NB 5B3JF 3PE9A 3QT2A 2NY0D 1B0WA 2XZZA 1FZMA 1URLA 2KQMA 1J86A 3HE6A 4ZO9A 4DK3A 3BZFA 5EFIA 5DHYA 4HKBA 5DD1L 1D5MA 3VRLE 5F1IB 1A47A 1NLDH 3VA6A 2AV7B 3EYUL 1BF8A 4I5BA 3OJDA 4I3RH 4NFCA 1YNKL 2N56A 4FQ2H 3S88H 2ESVA 3FN0H 1BHGA 4HBQA 4QHNA 1LEGB 4IMKA 2J6EA 1E4KA 2MKLC 3SKOB 1U6AL 4I0KA 1Z5LB 2J88L 4NJ9L 4I8DA 4W4OC 1JHTB 1T1ZB 4S1SH 4PJHE 4ZPVA 5EUOB 1WF5A 4K7FB 3KYAA 5GGRY 2OXHA 1A1OA 3UX9B 5F7HA 3U0TA 4PJAF 5CSZB 2D0HA 3GIVB 4EIGB 3HRZA 5KVDL 3AREC 1U58B 4LKCA 4UBDD 4V3DB 4ZO7A 2BNQE 3PV6A 3AS0A 1I4FA 4Y4HB 5SX5K 1UKQA 1OAQL 5KN5A 3TF7A 4JZOA 5I30L 5KTEL 1UZ8B 3ARVA 3KXFD 3QFDA 1NJ9A 4HPOL 5IJKC 2F54E 3S4SB 5E24E 1EDQA 4OZ4B 3GJFB 2PTVA 2HKFL 3GM0A 1IVLA 4S2SA 2VIRB 3T04D 4JKPH 1WT5C 4R2GC 3G9AB 4RFEB 3S35X 4M5ZL 5JO5B 5INDA 4NZRL 1CL7H 1GGIL 5C0JA 5CD5C 5IVOA 1NGXA 2E7CA 1NGQL 3MRFB 3FAXA 4FFZL 1IAKA 4GXVH 1MH5A 4OB5L 3SDAD 5GRYA 1CGSH 5KSAD 4MCZA 1R5VB 4L9DA 1QBAA 3WXWL 3MV8E 1WZKA 4Y2DD 3MLPA 2GW5A 3PWNA 4TNVF 3ERYA 2GFBA 3VD9A 5I1DB 4OZFB 1AXIB 2L4OA 3VWKB 4JKLA 1PSKH 3PDOB 5KS9A 3QI9B 3QULB 1RULH 1QLEH 3WHE0 3OAYH 4LLMA 1UWEL 3NTCL 3QEQE 4HZLB 4IIQC 4WFED 4F37F 3RWDB 2V7HB 4PJIF 2OJEA 1RZFL 3F7QA 3T65A 2OX5A 4M7JH 5FXCH 5C0GB 4URTB 4EDWL 3GEWB 4OFPA 4LSSH 1WAAF 1JZ2A 2NX5A 8CGTA 1BD2D 2FO1A 4LLAA 4XP4H 4XCCH 2VAAA 5IVZA 1IGFL 4YXHH 5FKPA 4HDIA 3G04A 1T1YA 4Z0XB 1QBML 3NFNB 4MS8A 4XX1E 1HQ4B 1HHJA 2ZUQB 2ARJQ 2EDWA 5CZKA 1IEHA 3M45A 3H3PL 5KAQF 1B3JA 3IDIA 4OQ1A 5EORL 3RWIB 4MD5A 1RZGA 1YMME 5E2UL 5F70A 4XVUC 2HFGH 3C87A 1Y18B 3QEGH 2Y25A 2BHUA 4HKZA 3ZDXF 3AFLA 3PGDA 2MPAL 4NNPL 1EV2E 2Z8WC 1BAFL 1MI5A 3GK8H 4ZS6C 4I2XE 6CGTA 3IFNL 1I8KA 4OCXH 1OT1A 3S5LB 1S9YB 3B8YA 3RDTB 4YAQA 1I9EA 4X4ME 2QSVA 4ZNEA 3HC0B 1FVDA 4P5MA 5FOBA 4NHCL 2KBGA 1HILA 3U7WL 3MOBL 4I18C 4PJ5A 1L0YA 4QXTA 5H94B 4KWUA 2NXYB 5EOQH 1JK8B 3BGAA 4LP4A 5DTFB 4EI5B 3IAPA 4PP8C 2C4FU 1H0DA 2YPVL 4MA8H 3OF6D 4X7SL 3RTQA 4UDUB 2NR6D 3T4AA 5HDLA 1U8MA 4WUKL 5FYKU 1PQZB 4AIZA 1KTKE 3MC0A 2XTJC 1U8JA 4AENA 1YEEH 4FQQA 4FQXB 1RJZA 4BYHA 2E7MA 2FCBA 3DRTB 4HIHB 1IGCH 1CF8L 3HMXA 5EO9A 5M94B 2VDLH 4YFLF 3U1SH 1T0MB 3MV9B 2E5EA 1RUPH 1OWRM 3RPIB 5ANMB 5I19H 1A7QL 4L8SB 3P0GB 4YWGL 4U0QB 1JTTA 5F7FA 3UO1L 5T1LA 1DBJL 1A7NL 1OD7A 4FFVC 4P2RE 1H5BA 3LIZH 3FOLB 4YHLL 4AEEA 1DBAH 1J88A 4D9RD 1NFDF 4XB8A 3VFWB 2ED8A 4LPCA 5HGHB 3DYPA 4ONGL 3ULVD 4MNQD 2BSRA 2E6PA 5TDOA 4NRXA 4Y8AA 2OXGA 3TNNA 5F1NB 2VR5A 5C07A 5EO1A 4YHYB 1I9JH 4HK3J 4K07A 5SV3A 4QTHA 5LGKA 3L95B 4YBLC 4ZUSA 3X12B 4JFOA 4P0DA 3VJ6A 1WK0A 4FZ8L 3VGBA 1MOEA 1S5HB 3KPSE 3RGVB 5CUSH 5DMJB 2ZUUA 1J0KA 4F9LC 4P46B 3D39B 1JPSL 5DF0A 1J0JA 1DE4B 3O6KH 4HUXA 1FFPA 3SDXE 4JCMA 4JRXB 4O9HH 1S7VA 1NCTA 1F97A 4LVNB 3WYRA 3RJDA 4S0SD 3GB7A 4G9DB 2E27L 4P2OB 1K8DB 1DVFC 1MJJA 3MRNA 4Y89A 5DK0A 1FIGH 4NO2B 1R3HA 3FQUA 3TJEL 1P6AB 5KG9A 1JHKL 3VG9B 3EO9L 1IGYB 4U6TA 1C16A 4X4ZA 1KJVB 4W4OA 3C5JB 1S9XB 2BFVH 4ORGA 1T66C 1J5OL 4GBXC 2OZ4A 5GS0C 2VH5H 4ALAH 4C55A 4N0RA 2CDGB 1JPST 1AJ7L 3PJSA 1U3ZA 5FUCE 1A6ZA 3GSNA 4HIXL 4Z7QF 3B43A 3AREA 4RCAA 1HIMH 3JTSA 3U7AA 3U7YH 1RFDL 3NH7H 2X4SB 4MXWL 1MCWW 1RZ7H 3EYSL 3O8XD 3V79C 1JWUA 1BQHB 4LCWD 5ICXB 1ED3B 1FZJA 1EO7A 4NHUE 1IAMA 5CJ5A 3VXUB 2O61B 3VD3A 1KTRL 4TQEL 3MJGX 2R2EA 5MENE 4KK5D 2OSLB 4JO2L 4WTZA 2P5EE 2APBA 3HZMA 5T1DL 1CT8A 1FYTE 4H5SB 1LE9B 1OPGL 2LTQB 2YPKB 2ZOKB 3H9ZA 2YMXL 2VLLA 3BDYL 1CD0A 5AG9A 4WNQA 4OD3H 3BD4A 4FFWD 4K3EH 4NYLA 3I9GH 1NDMA 3MNVA 3IDXH 5TGBB 3WFCH 2BOBA 2FB4H 2R56H 1F90L 2PYED 2P5WB 3L6FB 1JN6B 4PLJD 5IHUH 3V6OC 4YX2H 3PP3H 3QRGH 4D0BA 4RFOH 2XQBH 3SE8H 3ZE0F 3QQ4A 2PCPA 4JANA 1HNGA 3H42H 4NCDA 5JMOC 4NO5A 5DJCA 3C60A 5E2TH 1TFHA 3BPNC 3HG1A 1XF2B 4HIEB 3B2VL 1TNNA 5DUPH 5A16A 4ODWA 4IIQA 3FTGA 5DT1L 4O5LL 1C12B 3IETB 3D9AL 5D1QA 1H3PH 5CIPH 1DSFL 4MVBC 1OAYL 8FABB 2XZQL 5ALBH 3D3VB 4P46C 3SCMB 1FCGA 3Q5TA 3VI3F 1MY5A 4CNIA 3BXNA 4PLKD 2DIJA 4MDIB 5T5FL 3ZYIA 4NBZB 3VD4A 3ARFA 3S8WA 1QFWI 4G9FA 1MCDA 3OJMB 4WUUE 3HZVA 4M9PA 5GZOD 1J18A 1PDKA 5EIQA 2LAGB 3U0PB 5C0FB 4H8WL 3WFZA 5GQBA 1KPVB 1K5NB 2OI9C 4JFDD 2G2RA 1D5BA 3F58H 5L8LB 2VL5A 4GFTB 1OTUD 2C1OB 2VMFA 1RIVH 3NACH 4Y4FD 3VG9C 2DM3A 2OL3H 4KTYA 2M2DA 4P23A 1ZEAL 4NN6B 1T7YA 3EW3B 4PS4H 2BY3A 3C5ZD 3ARGB 1DBBL 4DOHE 4JFYA 3SPVA 4DEPB 5DMGC 1UB5A 3BN9C 2DBJA 5C0DB 1CE1H 1NGPL 5EA0L 1CE6A 2W0KA 1H8OA 3C6LB 4G42A 2X6MA 4LPVA 3FO9A 4PY7A 1AH1A 4M7LL 3ARRA 2NNAA 2VLRB 5I1JL 4QT5A 5E03A 4I18A 1FPTH 4APQB 1KB5H 2WWKO 3CXHJ 2DQDH 1SBSH 4ZAKC 4HUMB 3TCLB 2R1XB 2EIZA 5FDYA 1D5XA 4Y88A 1T4KB 3N50A 4MJ6B 2IPUK 1LD9A 2B2XL 3D0LB 3NIDE 3TBTB 2VDPL 1HWHB 4ZQKA 5DEFA 3IXTA 2AK4A 3QRFM 5I71B 2GK2A 3UTOA 1QLRB 1EMTH 2DD8H 1OP9A 3HRPA 5TQ2H 5BRZA 4XMKH 3T0EA 3I50L 4KKBC 4YEFA 2X4PB 3FT3A 4E41E 2NY4D 2IALA 1TZIB 2R0LL 2A6IB 3PGFH 3QAZB 4KFZC 2X4QB 4HC1A 4M7LT 3R4DA 1MHCA 4YPJA 5K9QI 1HHKB 3LEYH 3TPUE 1IGTA 2X9XA 3S34H 3BD3A 5D5MB 5DRZB 5C1MB 5I1HH 4JPIB 4Y4HD 1RZ8A 1YDPB 2CMRH 3KXFE 3T0AA 3GUTB 2QL1A 1OM3L 1JMZA 5GIRA 5EU4A 1N59B 1LDSA 5GSVA 2HTKC 3IJHA 2BY1A 3KG5A 4Y5XA 5CJQL 2MWCA 1WBZB 3K1KC 3UBXI 3VW3L 4MWFB 3LPGA 1LO0L 4Z7WA 1KLUA 3FFCA 5TE4H 5F8RC 2IAMB 1W8OA 2HT2C 1QFWH 2HKHL 2CRMA 5EU5A 3ZTJG 5K59E 3QNYA 4DUXA 3QDJB 4ZOAA 5CBAB 5FGBC 3KJ6H 5L2KA 2P8LB 2WBKA 1A21A 3GMPA 3LN5B 1AP2B 2XA8L 3X3FL 1CFBA 5F3BB 4G6AD 4OCRL 4RAVA 2OJZL 1TQBB 4G8EB 2B1HH 3DTXA 4UV7L 3ETBF 3WDHA 4NSKA 5D6DC 5ACZA 3VWKD 4I4WB 1DVFA 3QI9D 5GGTA 3LQZB 3TESA 4U1GB 4CVUA 5DQ9B 1LP9B 3FO2A 4QEGA 4S1DD 3V52H 3DOSA 4UAOB 3ARWA 4LARL 1D9KA 2I5YL 4WFEE 5E6ID 3TCXA 1EBAA 3MLZH 4WJ5A 3TV3L 5CHNB 4JG0L 1KN4H 2ED7A 4GBXA 4DTGH 2D4FA 3CMOL 4B5EA 1BD2E 3MA9H 4TVPH 3C2SA 1JZ6A 3D18A 2DQGL 5IQ7L 2DLFL 5JNYA 3U9UA 5D6CA 4R0LB 2F5AL 4UZGA 5I18L 3FONA 1MFCH 1F58H 4HCRL 3FZUD 2W60B 4XCFH 4JLRA 2VDRH 4JRYB 3OG4B 5I2IB 3DUUA 4WI9A 3FFDA 4UQ3A 1DN0A 5DMKA 3FO1A 4JDZA 5EPMB 5KVGL 4M4RA 3I3BA 3MRQB 3V7AG 3CFCH 4LSTH 2GSIB 3L5JA 3L3OA 4K3JH 3V7MA 5BJTB 2VKWA 4PRIB 3DHJA 2ZUTA 3T0BA 5IMMB 2VSCA 1U3HB 4OKVB 4LNRA 1S3KH 3CX5J 5DMIH 1IQWL 4BZ2L 5LQBH 4R3SB 2X4UA 2KUTA 4J1UA 2GJ6A 1IZJA 3V6OA 2NY7H 3CK0H 5K9OA 3BKML 3F6IA 2QQLL 1JPGB 4EUPA 1F13A 1ZVYA 5CAYB 4LVHC 1MEXL 4S0TD 5CP7A 1UM4H 1XIWB 4V2CB 3O3BB 3PHOA 4N0FB 2E7LC 1QTYT 4EI5D 1FVCA 3L3JB 5I1CL 2RFXB 1SM3L 2XFXA 1EPFA 2D31B 4ZUUB 5JZ7C 4KV5E 4XC3H 2IAMC 1DDHB 4R4FL 3V5DA 3ILQC 3GMMB 4ZSOE 1R0AL 4U6VH 3GKWH 4FQXD 2XWBB 4H1LG 3B6SB 4WGVB 2EC9T 3KLAB 4MQXC 2GITB 3ZYOA 4ONHA 4OLXL 3HTLX 5E95B 1F4XH 3BZFB 1QSVA 4HKBB 4R26H 3DNKA 2OI9A 3HFML 1D5MB 4D9RE 5E0QA 5HGDA 3W9EA 3ULVE 1ZTXH 4MNQE 2OTUB 1RUKL 3TLRA 4XRCA 1KIPA 3GRWL 3WO3B 4KUZL 3LV3A 4I5BB 3QUZC 4XP6H 3OJDB 3FO0H 2DL2A 3IF1A 3S97C 2PO6C 4X8XA 2IPUG 3FRPA 3JUYA 4H0IA 4N8CH 4ZFZA 3FT4B 5LXGH 4R7DB 4RQQA 4XCYA 3CFDA 3WE6A 3V8CA 3NN8A 1FAKT 2DM2A 4JO3L 3QIUB 1H8NA 1OTTD 1A1NB 1LNUA 3D39D 2D03L 3WJLC 1MFDL 1AR1D 1O7SA 4XNQB 5IGXL 1LWRA 1NLBH 3I6GA 2F58H 1RVFL 4LKCB 2W38A 2Z35A 4JRXD 1AQKL 5EG6C 5D2NE 2YRLA 3GJEB 4X6DE 2X89D 1XCQB 1LEKA 5KN5B 5LWYH 4BH7B 3P4MB 5D7IF 5L6YL 1FE8H 1V7MH 5C09A 3PL6C 3PWJA 3M1BB 4P2OD 2P24A 5I1EH 4Z7VF 4GG6E 4KXZH 1NMCC 1A0QH 1TTFA 2P48B 4GMSH 2QSCL 1IFHH 1E4XI 4DW2H 2UWEF 2BCKB 1FDLL 1Q8MA 1HSAB 5C92A 4NRYB 4GAJL 1JGEA 5J3HD 1DQTA 2AJXH 3SN6N 1ZGLP 4OGYL 5DFVD 4WV1A 1NGXB 3THMH 4CMMB 4KI5F 4WHCA 1IAKB 2VXQH 1PG7X 2NMSA 1RQ5A 2V2TB 1VFBB 2GY5A 1DANU 4JQIH 1UYWL 2NY2C 3VFGL 3PWNB 2GFBB 3HNSL 3KHOA 3VXOB 3HZYB 3MGAA 5F6IC 5E08H 1OP5K 1G6VK 4OFYD 4U6YB 2P4AB 4XHJC 3PWLA 4WVRA 4XNMA 3RWFB 4OJFH 4LKXA 4IDJL 4M9OA 1FNLA 2OJEB 25C8H 2C1PA 3ZE1F 1CLCA 2DQFA 2QQNH 5J0BA 1A6VL 1QFPA 2ZKHL 1S7SA 1XF5A 5FGBA 1U3YA 4U2YA 3H9HA 2YN3A 4KRMB 2LQRA 1A14L 1QNZL 1FNGB 3G04B 4Z78B 3VGAB 1G7PB 4O51A 4LHUD 3O45A 4U6HA 1KCVL 4OZGE 4BQ6A 4YHPA 3DUHA 4C56A 4P4RB 2F53B 1KEGH 3K8MA 4PJ9D 5IG7B 2A6DA 5D6DA 1KCGC 1B2WL 3IDIB 3SOBL 2FX7H 4MD5B 3MLXH 3O3UN 1FFRA 2W9LA 1X5HA 2ZP0T 1MAMH 1YY9C 5E4EC 5KSVB 4Y4KC 3WFBH 1P84K 4NKOB 4NPYA 4WWKA 4HKZB 5IVXF 3MRHA 2WIIA 3VFUB 5FGCE 2BXZA 4FQCL 4WI8A 5A2KH 3SCMD 1XGQA 1ZK9A 5A2JH 1FNFA 4UOW1 4MNGB 2AEPH 4XB7A 1H8SA 1FVEB 2WZPD 3TEUA 1LK3H 1YC8A 4PYGA 4KJPD 3KNBB 4P5MB 5FOBB 5L0QC 5DJ8B 1U8KA 3KYMB 4PJ5B 3ULUD 4U2ZA 4H8WC 1WICA 1RMFH 4G6FB 1E4XH 4J3WA 4NKIL 4ZFOL 1X5GA 1FV1B 1HYSD 4AEFA 3BIKA 4X83A 5HD8D 4QXUH 1CLOH 1QR4A 3VFTA 1N6VA 4YHML 4ZYKB 4J4PA 1KGCD 4KVNH 5D7JB 4AM0A 4HX1A 3EOYG 5FYJD 2EICA 1VGKA 4P3DA 4PJDF 1MVUB 4QCIB 2CJUL 5IKCA 4KQ3L 1N5YH 4BM7A 4XPGH 4F80A 4GRWE 4P99A 5BZWB 4CRPA 4PJFF 1YEFH 3RUGF 3EDEA 1QFWM 1I9RL 1KN2L 2VLRD 4JVPA 4U1KA 1CDBA 3MXWH 1N2RA 4QRRA 4LGRB 3HKFA 1BBDH 3IDGB 5E9DA 1MQKH 1XGRB 1NLDL 5TDOB 2APFA 4NRXB 5C07B 2Z4QA 4U31A 4PJIB 3MOAH 5HPMA 4JQXC 2HJKB 4QTHB 2OQJA 4ZUSB 2EEDA 4I3RL 4PRNA 3S88L 4FQ2L 4B7IA 3ARUA 3FN0L 4UIKH 5SWQA 1N26A 4PD4J 5FDWA 3KPOA 1DP0A 3BH9A 4M02A 4MAYC 5EUOE 5DJ2B 4S1SL 3X11B 5IQ9B 1CZ8H 3I6LD 3QNZA 1MCBA 1T6WA 5C6WH 4U3CA 2YBRB 2UYLA 3DLQR 5FOJA 5HXMA 1S7VB 3O2DA 1AGCB 2A6JA 5EU6D 3AMKA 4WWID 3GB7B 1CIUA 2F5BH 1VACB 4HKXA 3G9VA 3RVTD 1ZT4A 3MRNB 4LU5H 5DK0B 3QUZA 4UQ2B 1R3HB 3FQXB 3PNWB 4TTDD 4GLRI 2DWDB 2VLKB 2NYYD 1U8IA 4KKAD 5EZIH 4JKPL 1YEHH 5CBEA 1HWGB 3D2UA 1CL7L 3WJLA 3PJSB 5F1KC 1NL0H 1A6ZB 3GSNB 3NGBC 1R3JA 4J3TA 3VXMA 3TO2B 4GXVL 1WGOA 1CGSL 5FYKH 2DI9A 1ZHNA 5D96C 3G08A 3B9KC 1FZJB 2QQQA 5IBLC 2PW1B 5B8CC 5H2BA 3QUXC 1VA9A 3SY0A 3STLB 3PL6A 4AQ1B 1NCAH 1UH3A 2AJVH 2R2EB 3LPFA 5F3HB 4X0KB 1OW0C 1PSKL 3W11C 3OBAA 1DUYA 1RULL 1NEUA 2WY3A 1QLEL 4P5TA 4CKVX 1QSFB 4Y16A 2VLLB 2IQAB 4WO4B 5CEYA 2VE6A 1C1EH 1A6TB 2FJFB 2X4OB 1T5XB 3EJJX 1NCWH 1NDMB 2ZCKH 3MNVB 5MEQA 3INUH 4M1GH 4CL7A 4M7JL 2MFNA 1U8QB 3VWJB 4Y5YC 1U8HB 3O41B 4LSSL 4OQTH 2XPGA 3VRLF 4F7MB 1M71A 1IC5H 1Z6JT 4XP4L 3DBXB 4XCCL 3WIFA 4ISVA 3LKQB 3TH4T 4JVUA 4KRNA 4YXHL 4P2QD 1NQBA 1NFDB 1T5WA 4DWHA 1G0XA 4JRYD 3VFNA 5D71H 5FM5O 4JCLA 3QO0B 4O2CA 4NO5B 3UAJC 4F7EA 4KJWD 12E8H 5DHXB 5DJCB 1MCLA 3C60B 4R7NA 4MMZC 1FP5A 4FP8H 3HG1B 4WI5A 5IEHA 1PEWA 2P44B 4L9LC 2V9QA 1OGAD 1TCRA 3U6RB 4GS7B 3BPLB 4MA3B 4TSAH 1W0VB 4PRID 4IMLA 2HFGL 3QEGL 3MJ7A 4FA8A 1DLHA 1OARH 1U3HD 4TUJB 4WW2F 4M03A 1LVEA 4NQXB 2HTLC 5B3NA 3RWGB 4M4PA 4CNIB 1FFNB 4FFEX 5DFWH 5F72S 3GK8L 1BM3H 4PREA 3ARFB 4G9FB 1Q0XH 4OCXL 4HKJA 2C3VB 3HZVB 2R1WB 4QRSA 4U49A 2WBJC 4PJ8A 2Q3ZA 5K9KA 4Q9RH 3R06A 3G6JE 3HC4H 3CVHB 3DX7A 2CLZA 1CQYA 4QRUA 5EOQL 3TBVB 1TPXC 3QIWC 1ZA6B 4XNYH 1I8MB 1CICD 4PRAB 3MRRA 2FJHA 4DKDC 1OL0A 3CJJA 4IM8A 5C0AB 4P23B 1HEZA 3IYLW 4MA8L 2XN9A 2EE2A 1P9MC 1U9KA 4OLWH 3NCCB 2Q1EA 1M7XA 2B0SH 2R2CA 2ICWI 3SPVB 1G84A 1MCKA 1UB5B 1YEEL 4IOFD 2AEWA 5DQDH 4CU6A 1M7DA 3WNLA 1IGCL 4G42B 2VDLL 4PY7B 3VXQA 3U1SL 3ILPA 2CKBH 3IU3B 1RUPL 4QT5B 5I19L 3HE6D 3CFKA 3DUSB 1KCSH 1QSEA 2GT9B 5ID0B 1S7QA 1G9MH 1NBYA 2XXCB 3OXSA 4AMKH 2EIZB 3CCHA 3LIZL 4XVSH 2DWEA 2A9NH 1JUFA 4XP5H 1DBAL 3HI5H 1RK1A 5HHPB 1A64A 2HMIC 1BVKB 2ADGA 3IXTB 2ESVD 2AK4B 3DPBA 1PVHA 1I9JL 3CXHK 1V8HA 3AB0C 1CVSC 4FRWA 5BRZB 3CH1A 4JDVA 3T0EB 3VWJC 2X10A 3FT3B 2IALB 1HKFA 3P77A 5CUSL 2HWZH 3QIUD 3D39E 5I1GH 3BPCA 5DK2B 2ITCA 5CMAA 1K3ZA 2IJ0C 1ZHBA 3HC3H 4NN7C 3CSPA 3O6KL 4IRSC 3ZTNH 4W68A 2VTFA 3QQ9D 3T8XB 4CN6A 1S9VA 4O9HL 2SEBA 1A1MA 4PJCE 5E5MB 5GIRB 1C8PA 4PJHA 4TOYH 1Z3GH 1OD9A 1WSST 1N5AA 2X2YA 3QR2A 4Y5XB 1FIGL 1EFXA 4JM2F 4U3XA 1PG7W 2J8UF 4KRPB 3FFCB 4NUJB 4MA7H 2F19H 3UP1A 2CUMA 1W0WB 5ISZA 4MAYA 4EN3C 2BFVL 4KHXH 6FABH 1KBGH 3RZWA 2VH5L 4RMUA 2F54A 4ALAL 4JFEA 1G7LA 3VH8B 3E1F1 5DHVH 2BVUA 2GKIA 3VI4E 4RAVB 4N0CA 1HIML 1BZ7A 2AXGB 3LPWA 3U7YL 3NH7L 3FHAA 3DTXB 1RZ7L 5GGRB 5ACZB 2EE6A 4U7KA 5HYSB 5T3XD 1MWAA 1D9KB 2EO1A 3HPLA 4U1LA 3IAGC 2JF1A 2HLFC 3MV8A 4NNYA 3T3ME 3VXNA 3TA3C 4PPTA 3GI8H 4OD3L 4K3EL 3I2CH 1QSZA 3RVVC 3OPZH 3I9GL 2NX5D 3IDXL 3WFCL 3HB3D 2FB4L 3IXAB 4E0RA 2RCSH 2R56L 1ZLVH 3AY4C 4RFNC 3N1PC 5DD0H 1D7FA 4MJIB 3MMEB 2HT3C 4JLRB 5IHUL 3EOAA 3CD4A 4MS8D 1GVIA 4YX2L 3QRGL 1ND0A 3H3KA 4MLSA 1BF2A 2AQ1A 1JF5A 1DN0B 4RFOL 4WGWB 2XQBL 5B8CA 3QUXA 5GJSH 2A0LD 3FO1B 4L4VA 1IE5A 3QUMH 3SE8L 5IESH 3WO4B 3H42L 1H3UA 3GNMH 1LE5B 1KT2A 5E2TL 5EWIH 4OFDA 1HH6A 5KVMC 1IQDA 3L7FB 2NPLX 1CGUA 1P5VA 5DUPL 5J6GB 1HQRA 1NPUA 3SDXF 3TYFB 1H3PL 2J4WH 1C7SA 1MI5D 2H2PD 1F11A 1GZQB 5ALBL 3MBEB 1KENH 1OQXA 2ARWA 1Q72H 3FCTA 2QHRH 1QBBA 1QUNA 3KPTA 4MX7A 2O5YH 4HULB 3ULUE 1MNUH 4FQHB 4KKCD 4PJ5D 5I17A 2APTA 5IWLC 1B0GB 3CX5K 1DBMH 5LBSH 4U1IB 4WFHD 3P2TA 4PGZA 4GH7B 4HAFA 4BQ9A 5EOCJ 1HYRC 3PHOB 4L9LA 3KR3H 3T77A 3BQUC 3SDCB 5KVFH 3F58L 3RTQD 5HHMA 2NY1D 1RIVL 3NACL 1KJ2B 5FYJE 2OL3L 4PRPB 4HFWA 1BQLH 4POZD 4OGXH 4PS4L 3MFGB 4PGCA 1X5FA 3DROA 3MLUH 3HUJE 3RA7H 1BFOB 3TT3H 3MZTA 3HE7C 1CE1L 1HN1A 2G9HB 2EKSA 3EO1B 2VLRE 1Z9MA 5T1LD 2Z9TA 2WBJA 4OSUH 3MJ8A 3N1QC 1JF1B 1REIA 1FPTL 2Z8SA 1KB5L 4KRLB 4A6YH 2DQDL 1SBSL 4L8CB 5DXWA 1UKTA 2M8XA 2V2WA 3E2HA 5C07D 3QISA 3SE3C 5IHZA 2HLAA 2GJZB 1P9MA 4RIRB 3RBSA 2EYTA 4N9GB 4ZFZB 1HSBB 2YA0A 4GOSA 4BKLB 5SWSA 4RQQB 2PXYB 1J0YA 3KYOA 4XCYB 3CFDB 5IF0B 3WE6B 5C3LD 1EMTL 2DD8L 5TQ2L 2EZ0D 2EDLA 2ZUXA 3DVGB 1LNUB 4XMKL 3NFSH 3AAZA 1AXSA 2AK1H 2E6QA 1WWWX 3PGFL 2Z35B 5IFJA 4MJ5B 5E99H 3LEYL 3S34L 5EU6E 3WNPA 3EJYC 3GMNA 2EYSA 3MRIB 3GRWA 1EH9A 1ZXQA 2P24B 4Q6IB 5I1HL 5C2BH 1IAII 2CMRL 2OCFD 4YHNB 1NSNH 2ZUVA 1ETZA 1MCCA 4G43B 1Z9SA 3KPPB 3BP6B 4ODXA 4G80A 5KSUB 1DEDA 1KG0A 3K8KA 1HXYA 1IC1A 2C3HA 4WV1B 3REVA 5TE4L 2UUDH 3M8OH 5I15H 1MCOH 1QFWL 1F6AB 1A6AB 2R39A 3OAUH 4HQQH 3QDMB 4L3EA 1RZKH 5EC2A 2V2XB 4LCUB 5C0CA 2X70A 3ARED 3KJ6L 3BGFB 4IRSA 1L0QA 3HA0A 4GXUM 4PJBA 3TNMA 1VCAA 2AW2A 3TVMC 5MI0B 3WKMH 3QFJB 2B1HL 2VYRE 3CLFH 1NBZA 1NEZG 1LP9E 3PWLB 3L3IA 1X7QB 3A6CH 4XNMB 4AEIH 2HRLA 1NFIA 1B6UA 2UZYB 4R2GD 3V52L 4PR5B 2H3NA 5IOPA 2BY0A 3MLZL 5CD5D 5IMLA 5IB3B 4AZ8A 4EN3A 4CMHC 1I1AC 2DM7A 1KN4L 4DTGL 5EUKA 3H9HB 4KH2A 3MA9L 2ATPA 2FJGA 4TVPL 1RIHH 1TNMA 1FYTA 3F7YA 2HJLB 1A9BB 4P2QE 1I85A 4JRYE 1MFCL 1F58L 1QLFB 1RJLA 3EDJA 4C56B 4XCFL 4V1DA 1Q9LA 2VDRL 2A6DB 3S3JA 4PJEB 3C60D 3LY6A 4OIIH 3O2WH 3HG1D 1OGAE 5ABDE 3CFCL 3HHRB 4HIJA 3TJHC 5HYQA 4LSTL 4HJ0D 3B2UD 4WWKB 4JREC 5IP4A 4K3JL 5DJDB 3MRHB 3TA3A 5D1QD 4OM0H 2I9LA 5GGSB 5FO9A 5DJAB 2X05A 3MO1B 1T0PB 1S3KL 1XF4A 3MJ6A 4HLZG 5DO2C 3RKDD 1NAMA 1E4JA 5DMIL 2BC4A 5LQBL 1WBYA 3Q6GH 1CXHA 1JNHB 3ARFD 3BDBA 2HFFB 4G9FD 4YPGB 1MFEH 2NY7L 2BOCA 3CK0L 3STZA 1GL4B 5TFSH 5D7IB 1IAIH 4OV6F 5D93B 3NCEB 3DMMB 4G6JH 1L8JA 1G9NH 3ALXA 1T1WA 1UM4L 5L88H 3CAFA 1FFQA 4XVUD 4WU5B 4UT6H 5K59F 3KS0J 3FOMB 3PXJA 5J89A 4P23D 4KGJA 4HX1B 4XI5C 3IDYB 4GT7A 5KANG 1VGKB 1YA5A 3LQMA 3U46B 3HNVH 3BOVA 1RD6A 4M5YH 3JVGC 1CDGA 3KWWA 3IDNA 4XC3L 3CMGA 4Q9QH 4ZS6D 3Q6FA 4U6VL 3GKWL 4Z5RB 3MXVH 3QXAB 3S3SA 3GJFH 4ZD3H 1UH4A 3A67H 2VDNH 2ZG3A 1JFMA 3BGFC 2P46B 4LCYA 1SHMA 4NN5C 3UYRH 5JW3H 1TJGH 4OF3A 1UXWA 2IH1B 3J7HA 5GRUH 1MELA 1F4XL 2YD6A 4ZFOA 4R26L 1EJ6A 4YJZL 1B0RA 3NPSB 3U83A 2B1AH 2ITDA 3BQUA 1MJ8H 1WC7B 2XG5A 4XCNA 5EO0B 1ZTXL 1JE6A 3CVIH 5FB8A 2ESVE 1PZ5A 2XTJD 3R0NA 4XP6L 2AK4D 3D87B 1T22A 2GK0B 1K4CA 3FO0L 1A4JA 3ME0A 2BSSB 5CGYD 5SWQB 1JPFA 1HHIA 2P8MB 4KKLC 5BRZD 3VRJB 3T0ED 4KDTA 4MD4B 4YK4B 4N8CL 5LXGL 5HDBE 3IU4H 3SKJH 4MSWA 4RGNB 4FXGA 3HE7A 5I9QB 2VERN 2D0GA 4I0PC 3KLHC 5MERA 1RZIB 5F7MC 2OLDA 1BIIA 4NQDA 4WFGD 1NLBL 2F58L 1P7KB 4HMEA 3OR6B 2A9MH 1M05A 2PNDA 2XY1A 5B39G 1JWMB 4HKXB 3QQNA 4BJLA 5I1KH 5LWYL 1DQMH 4RMRA 3QIBB 2PTTA 3SE3A 5IVXB 1FE8L 1V7ML 1Q9WA 5I1EL 4CBPA 4Z7NE 1A0QL 4G8IA 4GMSL 3BP5A 1IFHL 4X7TB 3SDYH 3V6FB 4DW2L 1TQCB 3ARDC 4KRPD 3FFCD 2OR8A 4YIQA 2BMKB 4XP1H 4HW6A 2EC9U 5CBEB 3EYVA 2AJXL 2CRYA 1UJ3A 1G6RB 4NQEA 3V5KA 3QPQC 5E8NB 3QCUH 5DRXB 1FZKA 3THML 4GAGH 3GDBA 1R3JB 4Z7UA 1CGTA 5L2KD 1MJUH 2VXQL 4GG8B 4K7PX 1ADQH 1UM6H 4HUVA 4M6AA 3G6AA 3RZCA 4JQIL 4Y1AB 1BX2B 5KS9E 4BELD 1DVFD 5CJOH 4KKNA 1CTOA 5T3XE 1DUYB 1L7IH 5E08L 1CD1A 4Y16B 1Q94A 1BECA 1FG9C 5CEYB 1D9KD 4M61A 4DK6A 1GC1H 5I74B 2H1PH 4FXKA 5KSBB 4OLZH 4OJFL 1EHAA 2W07A 2CO6B 4IRJC 1J8HA 5I1IH 4GBXD 2XRAH 5GS0D 25C8L 1R24A 1AGDA 4PJFB 5DZOA 2QQNL 1KV3A 2NX5E 2ENYA 2XPGB 1BVLB 4ZXBC 1M71B 4O2FA 1JGDA 3ULVF 3ARZA 5D1ZC 4F3FB 3O3EA 3VFNB 1X5KA 5HJ3A 2EDKA 4PRBA 4JFZH 1YEDA 4F7EB 3TVMA 1YQVH 4I3SH 1KEGL 5K9JH 1P2CB 2H41A 1BOYA 5I1LB 1ES0A 4HHAA 1UQSA 4KMTH 2FX7L 3MLXL 1RV6X 4JN2A 1QQDA 3GBLA 1MAML 4PV8B 4XVTH 5F9JB 2CD0A 1DLHB 4GRLB 3WFBL 4NP4H 1P7QA 5TH2A 4H1LB 1MI5E 1KJMA 3I02A 4YGAB 4DJMA 1VHPA 2EDFA 5GGUA 1QYGH 4KK9C 4RZCA 2GJ6D 1PG7H 4X6DF 1XT5A 5F96H 4E5XA 4HKJB 2V5SA 3QEHA 3RWJB 5FF6A 3MLYH 4ZNEE 1OF2B 2AEPL 3MRDA 4GG6F 2EDEA 1FGNH 3PV7A 1LK3L 2Y9RT 3R06B 4KC3B 4WFHE 2XG4A 3MRCA 4EQ3A 2CLZB 4ZDHB 3FT2A 1OSPH 2ILLA 4RWHA 1RMFL 3L5XH 2F8XC 1E4XL 2OTWA 1HINH 4LEXH 2DTMH 1CGVA 3VXSA 3MRRB 3SBWA 3TJHA 1HEZB 4KROB 2XN9B 5EOTA 1CFTB 4QXUL 1CLOL 5L7XH 3OKMB 4PRPD 4KVNL 1A7OH 4OUUA 1SYSA 1NDGB 2PTUA 2W59A 1FL3B 4GKSB 3TZVA 5M7QA 4LSPH 5DVNA 2VL4A 3VXQB 1N5YL 3FB6A 1BLNA 4XPGL 1JTPA 3NBNA 1YEFL 5HYFA 3QZWG 1S7QB 2EECA 1NBYB 5HHOB 3RL2A 3HMWH 4J3OC 3O6FC 1IMHC 4I0CC 2DWEB 5CKGA 2NLJA 3MXWL 1JUFB 3MLSH 1BBDL 3X14A 1NUGA 1MQKL 5C07E 2Y5TA 2CK2A 3MOAL 4I77H 4MD0B 1IEAA 3JVGA 2B4CH 1X5LA 5HYIA 1CXLA 3U4BH 5DC9B 4G6KH 4OZGF 4UIKL 4NRZA 2W65A 4ZTOH 2ITCB 3NZHH 5CMAB 1FN4B 2YC1A 2MNUA 1CZ8L 4QRPA 1AGBA 4RMVA 1EVUA 3MRGA 2VDOH 4P5KA 1QR1B 4ETYA 1ZA3B 5C09D 4ELMF 4PJHB 3JWOH 5IR1A 1FH5H 2F5BL 1NEZA 4JB9H 5DA4A 2J12B 3MYJA 4JPKH 4LU5L 4WHTB 4RMQA 2DN7A 3OGOE 4NZTH 1P4LA 2BNQB 5D1XA 2KKQA 5SX4I 3M17B 4NQSB 5ISZB 5EZIL 1B90A 2XWJA 1CS6A 1FQ9C 1YEHL 2IBZX 2Z8VC 4NJAH 1GGYA 2ZOLA 5DD3H 4I0PA 2F54B 4QY8A 1W72B 1NL0L 1WVZA 5HHVH 5I0DA 2XXMB 3OB0K 2I07B 1T3FB 5J1AB 2WP3O 5FYKL 2ORBH 1R5WB 2ZJSH 4XPHH 3MR9A 4N8PA 2HG5A 1IAIM 1YNLH 3A6OA 1I1FA 4EZMA 4KDVA 1NCAL 2AJVL 2YA1A 3CFJA 3HPLB 2DJSA 4U1LB 2E7HA 3ARDA 3MV8B 2E6JA 4JAMA 4NNYB 3RFZC 4X9FA 2VZOA 1C1EL 5D8JH 3P40A 4LOUD 1T21A 4G8GA 4MZ2A 1NCWL 2ZCKL 3EOBB 3INUL 4M1GL 1A6WH 4E0RB 5D2LA 3LRGA 5FYJH 1KIRA 4BA8A 1A9EB 4OQTL 1S9KC 3EOAB 3QEQB 1IC5L 3BZEA 4X4XA 4FQPA 4MGXA 5C0EA 2EIDA 4C56D 1K2DB 4MA1B 5D71L 3U4EA 4WCYH 5GRZA 2W0FB 43CAB 5IUSA 2CGRH 12E8L 3OKKA 3WKNA 4LDOB 3B83A 5CS7A 4XBPA 3T3PF 5I16A 3E0GA 4BQCA 4FP8L 1IQDB 3V0WH 3N0PB 5EUOF 1RAMA 4WWKD 3ALWA 5CFHA 4TSAL 5IIEB 4IHOB 5JHDA 5C70A 4HBCH 1OARL 5EC1A 5ACMA 2VZTA 4XPTH 1LEIA 4ZXBA 2Z31C 3R0MA 3FCTB 4NC2B 1YMMB 3QQ3B 4G9FE 5D1ZA 4AT6A 3QO1A 4J3VA 1A2YA 1BM3L 2C26A 3L5IA 2Q6WA 1FO0B 1QEWB 5CD3A 1HE7A 5EBMB 1Q0XL 4JGJA 5I17B 1SJEB 2QJDA 2H32B 4TUOA 1IC7H 1QFOA 5LAXA 2YK1H 2Y06H 4ZG1A 4Q9RL 4MDJA 3UTTE 2VXTH 3HC4L 4I2XB 3T77B 3L5WA 5GZNC 4L4TA 4JM2B 4WW2C 5HHMB 5KZCB 4FTVA 1S7RB 5SX4H 4GW4A 2CIIB 4XNYL 5T5NF 4J4PD 4HWEH 3VE0A 1HCFX 1Z0MA 3VXTB 4FQIH 2OYPA 1FL5A 5DI8B 2Q76B 4OLWL 5DC4B 4M62H 2B0SL 3KPLA 4PGCB 4M6NH 1CDYA 1T89C 4FOMA 1SJVA 5DQDL 3OB8A 4LCCB 4NO3A 1YPZA 5TQ0H 1OB1A 2BNUA 3GSXA 1AHWA 2CKBL 3MJ8B 1BWWA 3WFEH 3MPCA 4H0HB 5GSRA 4QRRD 1KCSL 5BS0E 3NMEA 4WHYG 5E9DD 4XBEH 1G9ML 4NWUH 5B39A 3SJVA 3EO0A 1IZKA 4AMKL 1T0NB 4XVSL 3E2HB 1R3KA 2A9NL 4XP5L 5DJ0A 3REWA 3HI5L 4Z0BH 3ULSB 1MHHA 4EDXB 2VABA 5FGRA 2XTJE 4OF5A 4FNLH 2AK4E 2X1PA 5MP6H 4ZFFA 1E28A 1UG9A 2EYTB 1YJDH 4P2RB 3P9WB 4N0YH 1RSFA 5D7LA 3KYOB 4K3DH 3T0EE 1TCMA 4D8PA 4YH6A 2V7NA 1VESA 1HH9B 1BIHA 3CIQA 3AAZB 4X5LA 4RGND 5FA4A 5I6XC 3OKLA 2WINA 2HWZL 2FR4B 5FM8A 5I1GL 4RAUA 4XWOD 3GMRB 3F7VA 4WFGE 1DN2A 2EO9A 2PR4H 4CVXB 4P4KB 1KB5A 1A8JH 3O6FA 4JFHE 3HC3L 5IB5A 1EFQA 4R4NC 2EYSB 3ZTNL 1MVFA 3QUZD 2YUWA 3QIBD 3BDXA 4JO4H 1ETZB 1Z3GL 4TOYL 3W5NA 2VN7A 3SDXB 4NC1C 4ODXB 4Z7WE 1ZGLB 4G80B 4PG2C 2ICES 2IG2H 3LHPH 3H7LA 5F9WB 2VQ1A 4MA7L 1EAJA 2F19L 5E6YA 4RWYH 1SY6H 3G6JF 4U1MA 2GAZB 5EC2B 5L2KE 4KHXL 2X70B 4TSBH 3MBXH 5C0CB 6FABL 1KBGL 2R1YA 3KPNA 3ARBB 4HUWA 4EKXA 3TNMB 1G7MA 2WBWB 5DZNA 1C08A 3N85H 2V9TA 2FD6H 2HVJB 2KH2B 3PL6D 3TT1H 1OSZA 4L3AA 1MIEH 1NBZB 4EI6A 1N8ZA 4P5TD 1KACB 3CC5B 5ICYA 4Y16D 1NFIB 2WUCH 3TBSB 4XTRC 4DCQA 2OMBA 5IOPB 5HGAA 3UYOD 1KULA 4JJHA 5JDSA 4NHUB 1XGPA 5C0BA 3GI8L 5MENB 1KJ3H 3I2CL 4R96B 5TE7H 3U82B 2P5EB 5L9DH 3OPZL 2ATPB 5I73B 1FYTB 4H25A 3O9WC 1MHEA 2A83A 2NY2D 1JGVH 2FEDC 5LG1A 1T1XB 2RCSL 5DD0L 2EDHA 3I3DA 4V1DB 1Q9LB 2HT4C 5DEGA 3RWEB 4EVNB 2CDFB 3BW9B 3QA3B 4M43H 2LU3A 3LKNA 5GJSL 4C83B 5D70H 3QUML 5TDNA 5IESL 3RRQA 4X99A 3GNML 2YD4A 5HYQB 4HIJB 4PB0H 5CJXC 2PF6A 4KQ4H 4LVEA 5EWIL 4P59H 3EYFA 1IRAY 3TWCH 3SE4C 1RURH 5KJRH 3PDGA 3AS3A 5HVFB 1CK0H 5DJYA 4J3XA 5FECA 3ZO0A 1XF4B 4Z7OE 1NAMB 2J4WL 4R4BB 1EGJA 1WBYB 1TDQA 2GJ6E 4AQOA 3V6OE 2M26A 3PWUB 1U8PB 4X5WB 1KENL 2RAMA 3B5TA 3WHXA 1Q72L 2VXSH 4PJCF 4HWZA 3W9DB 3MODH 2QHRL 3PWVA 4YHKH 4PJ8D 3QZWA 1CCZA 2VLJA 1A4KA 4LP5A 2O5YL 4M1DH 5F44A 2P8PA 2GCYA 1MNUL 3LEXB 3CXDH 3OQ3B 4F7CA 1T1WB 2AJ3A 1DBML 2Z8RA 3BMVA 4QHKI 5LBSL 1AIFA 3VFOA 1FC2D 1KF9B 4JQVC 1YY9D 2DAVA 3BP7A 3RL1A 3KR3L 5KVFL 4KROD 4WUUB 2XN9D 4NDMB 1F4WH 3Q3GA 3RWCA 5LGJA 1UWXK 3JV6B 2R69H 4XC1H 3L5HA 3KWWB 2G5BA 3L1OH 5C0IB 1BQLL 3VI4F 3B8SA 4OGXL 5JW5A 3KPMB 2HFEB 3K4DA 4JFFE 5T3ZE 3MLUL 3RA7L 3TT3L 2VOTA 5BVPH 3T2NH 1UXWB 1G7JA 4JFXA 43C9A 1IM9B 1QSED 1QG3A 2YWZA 5FA3A 4OSUL 4DOHB 3VFPB 1YYLH 1WUNT 1QA9B 1XR9A 3LVEA 3T3MF 4KK6D 2DBLH 4A6YL 3I6KB 4HGKC 5FUCC 2XV6B 4OGAC 1FG2B 1T04B 3P9LB 5FB8B 1WCBA 4NZDA 3QDGA 4JVWA 2NY0B 1A4JB 3MRBA</