3FONA

Crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSLRYFVTAVSRPGHGKPRYMEVGYVDDTEFVRFDSDAENPRYEPRTPWMEQVEPEYWEGQTQIAKGNEQSSRVDLRTALRYYNQSAGGSHTIQRMRGCEVGSDGRLLRGYQQVAYDGRDYIALNEDLKTWTAADMAALITKHKWEQAGAAERDRAYLEGACVEWLRRYLELGNATLLRTDSPKAHVTHHSRPKDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC
publication title Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fonA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3fonA01
3W11C 4HAGA 3VGBA 2XQYK 3V4VL 1OF2B 1UJ3A 3O4LD 3LEXA 2DIJA 2IFGA 3V0WH 4P5TC 4XC1L 2YPVL 3CFIC 3HFML 3P4LA 2EDNA 1WFTA 3TV3H 1ORQB 2F8XC 3RWIA 5DMGD 5C9JA 4HJGA 1LK2A 2ZUQC 1UC6A 2BSSB 3FB7B 1AGBB 4HUWB 4XMPL 1G9EA 1EBPA 1HKLL 5DJCA 5IHLB 4U1GC 3QIBB 5CAYB 5I8CA 4S1RH 5D5ME 3U82B 4GQ9H 4UOW0 1C12B 2ERJB 1MJ8L 3P73B 3B8YA 1JWUA 4WO4A 4PV8B 1X4XA 3ALWA 4FTVD 3LPGA 4XHQA 3MJGX 3VD5A 5FO8A 3WNLA 3PWJA 2D7MA 4N90D 4WU7A 4QGYA 4XAKD 1YECL 3ARBD 3SJVD 4S1QH 4OZGB 4IS6A 1BAFH 4PJXE 3OKYA 1N59A 4H8WC 2X9XA 3GBLA 2CKBB 3BI9X 1ZSDB 2BOCB 5C0GA 3BUYA 3TBYB 4QRUB 1B0GA 1S7RB 3H2WA 3O4LB 3QIUC 3L5WA 4KKAC 1XAUA 4Y2DD 1RK0A 3GMOB 4NSKB 5EU7C 3TEUA 1SMAA 5F1IB 2J4WH 4AT6B 1CDCA 4LLVA 3IDXH 3C6SB 4XMKL 2BX5A 3UPAA 3L3HA 3BYYA 3X17A 4CNIB 4YHKH 3O2DL 1W0WA 3N1QC 4WI7A 2ENSA 2VLRD 3V4VH 4YGVB 4KK9D 3SDXF 3NZ8A 3FO1A 4ZFFA 4XC1H 2YPVH 5ITFB 4FQXC 4LNRA 2GTWB 1BBDL 3GI8L 3NIFF 1AQKL 2Z31C 1JMXA 3A6CL 1R3KA 2DYPA 4FTVB 1OD7A 1YEGL 4XMPH 1HKLH 2BCKB 2D03L 2QJDA 3UJTH 1Z9OA 4DN4H 3RIAF 1UGNA 4NCDA 4LMQE 1YN7A 4FXLA 3ARBB 1MJ8H 4KK6C 5ESQB 4G8EA 4IOFD 2PYFB 3ULSB 2R15A 4FZ8L 4BSWB 3RJDA 1LE9A 5IF0B 1CGSL 5C07D 5IBTL 4B5EA 4LRIA 1I7ZA 2FB4H 4Y5VC 2FNBA 1IAII 1IT9L 2LFGA 2UVFA 1WF5A 5D6DC 2VZVA 3CFDB 1TDQA 3CDYA 4HWZA 4JZJB 4M7LL 4Y2DB 1YECH 4PJCE 5JO5B 2YUVA 4OF7A 2VLLA 3D5OF 5I19L 3MSPA 1YNKL 1HQRA 5LAXB 2AJ3A 1E6OL 3PABB 1I3GL 3U9PL 3CZFB 1FCCA 4N0CD 5DF0A 3WS6C 3TYGL 5MEOB 1JRHH 2VLRB 4N0YL 4EOWL 2AQ2A 4PRIA 5BRZA 4HT1L 3MYZA 5HYSB 3BWUC 1NSNL 5F9WC 4WGWB 1EEYA 3R0MA 2CUIA 3MRDA 1DEDA 4XMKH 2KBGA 1P7QB 1FYTA 1MFBH 3VFMB 3F8UB 4Y88A 3BPLB 1RU9L 1ZT4B 1OL0A 3VFPB 3WNPA 3O2DH 1GHFL 3E3QE 3BVNA 3HNVL 5B39G 5ID0B 5EH1A 1EERB 5FA3A 1T0MB 1BBDH 3S36L 3GI8H 5CJXA 1NFDB 1S5HB 1AQKH 5F9JB 5JQ6L 3A6CH 3C08L 3VXOA 1OAXL 2BC4A 4JREC 5C07B 1AHWB 3DGGB 5E5MB 5SWZA 2R29L 3O2DA 5EBMA 5IEKB 1YEGH 2WY3A 5FECB 2D03H 2IPUG 4P3DB 4ENED 2CLVA 3K1KC 4EN3C 4PJHA 4NPYA 4KTYA 3L3IB 1UXSB 4QF1A 4X6CF 5IBTH 3SCMD 4RMSA 1IT9H 3LN5B 1MCHA 1GH7A 4FG6D 3V6OA 3HC0B 4ZODA 4M7LH 1DL7L 1REIA 3SBWA 2CMRL 4GQPH 2VZUA 5I19H 4YFEA 1S8DA 1YNKH 1MJUL 3D25A 1E6OH 1I3GH 3U9PH 1TNMA 3BGFB 2D2OA 3WIIL 2VABA 5D93C 2XPGA 5FYLL 5GRJL 4OZGE 3V4UL 1S9VB 4N0YH 1KN2L 5GGQL 4QRPA 4IIQB 4EOWH 4HT1H 2ED9A 1AGEB 2EH7L 2L0DA 1NSNH 4KI1A 3TCLB 5I71C 3BIKA 1WFNA 4YK4B 2Y4SA 3X13A 1EA9C 1SBBA 4JM2A 3O4LE 3W81A 1TJGL 1RU9H 2R0LL 1ZMYA 2X1XR 1GHFH 4NZTL 4QRSB 3HNVH 5BZDA 1S7QB 3DYPA 3QP3A 3ZDZE 3OJVC 5HHPA 2AV7B 4X4YA 4JFFD 4JZOA 5JQ6H 3C08H 1OAXH 4CKVX 1EO5A 2HLAB 2DLGA 2R29H 3SCMB 1KUMA 2RCSL 4NQEA 2JKXA 1C5BL 1UB6B 4JFPA 2OR8A 4UTBL 2ILLA 2F58L 3QUXD 1MCWW 1Y18B 3LN4A 2IADB 5C3LD 1SYSA 1WT5C 4YIQA 1G7PA 2PTTA 3GKWL 1F4WL 2JLLA 5E2VL 2PN5A 3D18B 5I75C 4MXQA 4MNHB 2ZNXA 2VXTL 4QRTB 4LEXL 3ARRA 3UZVB 4PGBB 4OGYH 4MQXD 3DX6B 4UDUA 1WLHA 1DL7H 3UPCA 2CMRH 2DMBA 1KCSL 3ZSTA 1NEZG 2APVA 4CVZA 2IFFL 2HFEA 5EZIL 1MJUH 2VN4A 4IRSB 5T1MB 4E0RB 1U8HB 3WIIH 1MLBA 1XCQA 5FYLH 5GRJH 1I1FA 3V4UH 1QOKA 1KN2H 3C87A 5GGQH 2CUMA 4RMWA 4Y4KD 5KSVB 4F7PA 2EH7H 1A9EA 3Q6FB 3V9FA 1LE5A 3VE0A 1A14L 3DMMC 3OXSB 3Q48A 4L5FL 2XN9A 3SDCA 1I9JL 3U4EB 1SJXA 2D9QB 4HG4J 2VLRE 4HGKC 4HV8B 4MJ2A 1TJGH 4UBDD 1QSVA 2R0LH 1H5BC 1OAQL 5GIRB 4NZTH 1DBML 1CICB 1JTOA 2CRMA 5DRZB 4O51B 5HVFB 5CP7A 3QUXB 3VJ6A 5KSBB 1UJ3B 2DM4A 2KPNA 2XWTA 3PWPD 4AJ0A 2DQGH 5DJ2B 1W2KT 3HPJB 4ODTL 1TXKA 2XZZA 4LLWB 4JB9H 1ZANL 3QUYA 4ZUVB 4MS8A 2HMID 4JO4L 3RUGF 1C5BH 2HT2C 4KV5F 1AXSA 3O11A 1A64A 4UTBH 2F58H 1UZ6F 3QO0A 5HHNB 3B5GA 2CXGA 5CJXC 4NNYB 4CVWA 1NFIB 1U8MA 1RI8A 4BH8A 3RWDA 1YNLH 3GKWH 1F4WH 2V7HB 2X5PA 1HOCB 2DN7A 4R26L 5I8CB 4F9PC 2ED8A 4EKXA 5JR1L 4XWOC 3EO0A 5DXWA 2VXTH 2LE9A 5AUMA 4IOIA 1S7TA 4XCNB 4JANA 4Y4KB 1BX2A 2H6PB 5IBLD 2QQNL 4FXGA 4HMEA 3T04D 1KCSH 5CKAA 2IFFH 1SM3L 5F9OL 5EZIH 2XY1A 2VC2L 1WISA 1TTGA 4OIAA 4WU7B 2ZG1A 4LLMB 4R90L 1E27B 1QQDA 1WBZB 2FL5B 4TOYL 4M4PA 3W9EA 1NAML 3NFPA 4Q7DA 1VGKA 4WW1A 1OQOA 3S35L 5D7LD 3S37L 1G7IA 4LRNL 3RY6C 3SPVA 1A14H 4OZIA 1UCTA 3GDBA 1B0GB 4L5FH 4NQCA 3M1BA 5MENA 2AJZA 1I9JH 5DEFA 3S4SG 3PWPB 1I8MA 1UEMA 2GT9B 2VDMH 5C0CB 3RVTD 3KPSD 4ORGA 3TPUA 4YDJA 1A6WL 4PTUA 5H35A 1OAQH 5J06A 5ICZA 3MLSH 4TTDC 2IMMA 3GMNA 3C60C 4YHLL 4XNMA 3DARA 3GGWA 2DOCA 2X4QA 4CN1A 5IFJA 3RTQB 4PRID 5BRZD 4JM2C 2JB6B 4WHYH 2E8ZA 3RDTC 4ODTH 1FL6B 1ZANH 4GUPA 1JPTL 2XI9A 5EU6A 3T3PF 3KPNB 3CMOL 4PPTA 4XTRC 1DVFC 3MCKA 4Z6AT 1MCLA 5LXGL 5TH2A 3LQZA 5IIEA 1J9CT 4PJAF 5F6IB 2BHUA 5E8EA 3KLHD 4YFLF 1Z0MA 2DIBA 4LOUD 4LVNB 5F72S 4M61B 4AY0A 1G9ML 4OD2A 3MCLL 1G1CA 4R26H 2APWA 5DDHB 3BKML 5JR1H 1YN7B 3K8LA 1BVLA 4CU8A 5SX4H 1YN6A 4APQD 3GKZA 3TIDB 3RL2B 5E24E 3BPNB 1T7VA 1G7JB 3QQ3A 1UB5A 5D7LB 5D6CA 4RX4D 2E9IA 2Y23A 2QQNH 1N2RA 2ZJSL 5E4IA 1SM3H 4MXQC 5F9OH 4MSWB 2QHLA 5FGRA 5C0BA 2VC2H 3KPSB 4U1SB 5EFIA 4R90H 1CZ8L 1KXTB 4TOYH 2A6KA 2VLLB 1NAMH 3BHBA 3G6JB 3M17A 1DDHA 3RPIB 2X05A 5J1SC 4KK8D 1Q94B 3S35H 1OSZA 1G0XA 4ZS6C 4MXVF 2N1KA 3S37H 4LRNH 2PW2A 2Y06L 1NGZA 1F11B 1A1NA 1LVEA 3EDFA 1F02I 4NBXB 4PRIB 4U31A 5BRZB 4WTWA 1FFOB 4LMQI 2VXVL 1K4DB 4X5WB 1A6WH 1BQLL 5C0NC 1NAMA 4G8GE 2J3SA 2OSLB 3PWUA 1TCRA 4NHUB 1IM9A 1SHMA 4YHNA 3O3AB 3BVNB 5I73B 5J1AA 3RA7H 5HTSA 1YEHL 3C09C 5GS2H 1MHEA 3DWTA 2CRYA 3EHBD 2PO6C 2R23A 2I26N 5KSBE 1LK3L 2N56A 1SQ2N 2CXKA 2JJSC 4APQB 1P9MA 3CMOH 4ZOAA 4K07A 5LXGH 3E2HC 4Z7WB 2BC4B 1CD0A 5J11B 3DX9B 1KLUA 2DQHL 4JDTL 5I1HL 1TZGL 1JTTA 1SEBA 5EC2A 4JQVA 4ZNEE 3BP6B 3MCLH 1B0RB 1GGTA 2ARJA 1S78C 3ZYJA 3QUYC 4QNPF 3BKMH 3T1WA 4XNXH 2Z8SA 2JELL 4PGEB 1KELH 3MRHB 2W07A 3S34L 1K6QH 4TUKL 5HHMA 4QF1B 4LVOC 4MVBC 2WP3T 1T22B 2AEWA 3FQNB 3KVQA 1JHTA 1T83C 2ZJSH 4R97B 2VTFA 1W0YT 5GGVL 2ICWA 1CZ8H 4JCLA 2X89A 4KI5E 2X09A 3WFBL 1S8DB 3OAZH 1PY4A 2OL3L 3T08A 1GJIA 2XZCL 3CFBB 4JR9L 1D9KD 2Y06H 5IGXL 2P24A 5BCAA 2UYLA 5GS1A 4BJLA 4Q9QL 3O3DB 1HYSD 1DTUA 2VXVH 4D0CA 2MHAA 2H9GB 1FNGB 2NTFB 1BQLH 3GUTA 1MHHA 4F7MB 3NFNB 1A7NL 5C0CE 5TFSL 1LNUB 3T2NL 4OLVL 2Q8AL 1SVCP 1N7ML 5CS7A 3QXWA 1YEHH 4CU6A 4LLQB 5BZDB 2F5AL 1GC1L 2NY3D 1M4KA 1QR1A 5HYQA 3FB6B 5HGHB 3M07A 5IW1B 1LK3H 1OT1A 2P1YA 4I2XA 3VWKA 1JUFA 3V0VA 4JZOB 1G7LB 4KTEL 1FV1B 1KBGL 4ZUUB 2ZOKB 2DQHH 4RFOL 3QDGE 4JDTH 1TZGH 3PDDA 4JFPB 4YR6B 3B6SA 3ZE1E 4RBPH 1OPGL 1MH5B 3RVXC 1WGOA 2I24N 1U8NB 2PTTB 1U8IB 2JELH 2B5IC 3S34H 5HGBA 1ZWIB 3G5VB 1INDL 2DQDL 2ZOLA 5FGCE 1VADA 1D9KB 2EE9A 4MS8D 1T5XB 3IKCB 5EOTA 1KCVL 3SO3C 4FQQA 3Q5OA 1A1MB 2CIIA 4OFKA 2F8OA 1A7RL 4JKPH 4ODUA 2H32H 4GAYA 1VA9A 1K8DA 5D7LE 4Z7OF 5KS9A 3ULVF 3NCEB 3WFBH 4NHCL 4MZ2A 2OL3H 3RL1B 2XZCH 5DUMH 3FZUD 1I8KB 3KS0J 4JR9H 1YQVH 5IOPA 2OYPA 5BQ7A 5IGXH 3PGCA 2LAGB 3ARUA 3L3OB 4P59L 4XZUA 3G6JE 1T3FA 1K2DA 2NY3B 4Q9QH 5FDWA 4PJDF 2Z8WC 1LE5B 1FNSL 2H32A 3D39D 4DKEL 3P40A 1R3HB 2DQIL 1CD8A 2HTKD 3LSOB 5IROC 5HHVL 1A7NH 2OL3A 2NZIA 5TFSH 4ZD3L 3T2NH 2Z8RA 3O45A 4OLVH 2Q8AH 5L6YL 4X4XB 3ULUE 1N7MH 1GZPA 3LCYA 5BO1L 2Q7YA 3S98A 5D2NB 2F5AH 1GC1H 5E8PA 1EK3A 5KZCD 5CP7B 1FGNL 4K94L 4NHUE 4GG8A 4ISVB 4NQCD 5MEND 4Z7UB 2CR3A 4ZDHB 5C2BL 1DP0A 2W9EH 3N1MC 4KTEH 5GS0C 3BQUC 5FYJU 1KTDA 4RFOH 5C6PB 5CKGA 3AREA 3QUKA 1AXSB 3ZKMD 5DRWA 1UEYA 1OPGH 3QO0B 4Z7WE 4Z5RB 4S0UC 3PV7A 4YDLB 4QGTA 4YDKL 2R0WL 5ACZA 5DQJA 3AS3A 4MCYA 2E6JA 1A2YB 5CCKL 2J6EL 4YNYA 1INDH 2DQDH 2UUDH 4OI7A 3EYUL 1IM3B 3V7MA 1S7TB 5HGGS 3PP4L 4PREA 1A7RH 1BX2B 1KJ2B 1A6VL 3D39B 4FXGB 3BUTA 2P49B 4GXUN 2F19L 4NHCH 1WITA 4U1NB 4XBGB 2N4IA 1KIRA 3MLTA 2DQEL 4XVSL 5DZLA 2VXSL 5BXFA 2FD6L 4P59H 3SE4C 3OZ9L 1NKOA 1JWMA 3EDDA 4WW1B 1EBAA 1PEWA 3CFCL 1FNSH 4R4BA 5DFVD 4OZIB 4DKEH 5H94A 1SVZA 1F4AA 3RRQA 4LFHD 4LHUA 1OARL 5HHVH 4ORGB 4ZSOA 4YDJB 1IGCL 2NXZC 5H35B 3QNYB 1XGPA 5HY9A 5C08D 5ICZB 1G7QB 5BO1H 3GMNB 2P43B 3QEUA 1FGNH 3GJFB 4K94H 4XP6H 2R1WB 5IFJB 3O9WC 4B41A 1HINL 5FK9A 1ODAA 1OTSC 1QEWA 5DFTA 5C2BH 1YEKL 4N5EA 1WZKA 1JZ3A 1L0XA 4GUPB 2PUQT 2V2XA 4PGZA 4W6XB 2P8PA 4QRQB 2IBBA 4LNVA 2HVKB 5TH2B 1T66C 3E6HB 1FLTX 3ZHDA 2J88L 2EXYC 4YDKH 1TTFA 1IAOA 1UCBL 2R0WH 4ZPTB 1IQDB 2EXWC 2YRPA 4QYOA 5CCKH 2X1PA 2J6EH 4ALAL 5ENWA 1X5ZA 3P9MB 5DTFB 3TBTA 5EBLB 3B2UC 5T1LD 3V6ZB 1JWSB 1MRCL 2CDGB 3HCVB 3QQ3B 3PP4H 5D6CB 1A6VH 1V8HA 5J9PB 5ETUA 2BP3A 4YPGA 4ONHB 5EPMB 1T20A 4UT6L 3THML 4DGYL 5EBWB 2DQEH 2J6EA 4XVSH 2VXSH 2FD6H 4Q2ZB 1MOEA 1DDHB 5C08B 3OZ9H 5HHMD 1AGFB 3WYRA 5EUKA 3GIZL 5JPMA 5HI3D 3TNNA 4PV9A 3CFCH 4KHTL 3VMNA 2OR9L 3V6FB 3QUML 1JCKA 3A6BL 3V5KA 3QRFM 2X89D 3KPQA 1IGCH 1ZHBA 5E8DL 5GGSB 3MRKA 5DUBB 1HILA 1IC5L 1NAMB 2NY1D 2I9LA 3KXFA 4JRYA 1JJUA 3WXVL 5FYKU 4CVUA 1YPZF 1NFKA 3JVGC 1HINH 2Q86A 4WENB 4WU5A 1YEKH 4Z9KB 1H0DB 5D2NE 3L7EA 3PIQA 5I0DA 1EAPA 4IHOA 4NN7B 4P9ML 3BP7A 4JVPA 5T1LB 5TF0A 3MBEC 1E4JA 4LGPB 4Z7UE 3BD3A 1V7ML 1UYWH 4Z7VA 2R2EB 4TYUA 1UZ8B 1RZKL 1M7DB 3FTGA 5L88L 5MHSE 4CGTA 1UCBH 3ALPA 4FN0A 2O5XL 4FXKA 4AQ1B 1HI6B 2ARJB 4C54A 3T0EA 3IJYA 3DX8A 5ALBL 4K71B 4ALAH 5CZXC 4G42A 3AREC 4KK5D 5CBAB 1INEL 1MRCH 3GSVB 3VWKD 3IDNA 2R9HC 4LEOA 1T7ZA 4YXHL 5C8JA 5JA9A 4KJWC 5DMJB 1JHTB 3MODL 5BS0D 5F1SA 3FFCE 4UT6H 3RJQB 3THMH 3BKCL 3OAZK 4DGYH 1AC6A 3KYKL 3D39E 3RZCA 4GBXC 2NY1B 3ECBA 3H9SA 1YEDA 5KBNC 3VI4E 3B43A 3HR5B 4MB4A 3GIZH 3OJ2C 4KHTH 3QUMH 1AH1A 4JQIL 5GS1B 3MZGB 1NDGB 5CEZH 3QSKB 1EHAA 4D0CB 2VLJA 1F90L 1AR2A 5E8DH 2JB5H 5ICXB 3QZWB 3GSOA 2FECI 1IC5H 1A6AB 2DQFA 1BOYA 2FSEA 4GRWB 3CU7A 3GSRB 4NRZA 4PJ5B 3WLWC 4P46C 1XT5A 3QXDA 1I4FA 1EXUA 2C3HA 1EJOL 3ROOB 1KJ3L 1RUKL 5K93A 3CH8A 3QUMA 1GPOL 1QFUH 5B8CA 3HLAA 3LKSA 4OIIL 4GW5A 3HZVB 4P9MH 1G7MB 4NRYA 5IVXA 3TBWB 3TWCL 5GJSL 5EIQA 4HKZA 3VWKB 1ONQA 1JUFB 1QSFD 1C16A 2HYMA 2GSIA 3EOBB 3CDGA 1BFVL 1RZKH 4RBPK 4N5EC 1OAUL 5L88H 3V5DB 5BS0B 4U1KB 2O5XH 3B6SB 4ELMF 1N5AB 3MR9B 3AM8C 5ALBH 3MRJA 4QWWC 4WEBL 3LPFA 1AC0A 5CP3H 4YGAB 1INEH 2XNAA 4PLKD 2BHZA 3GHBL 4MCZB 3NPSB 5DYOA 1VADB 4YXHH 4Q6IA 2OI9B 1DQTA 1NBYB 3MODH 4LKXB 4G6KL 2CIIB 3HI6L 2C4FU 1FVCA 2I60L 3BKCH 4JG1L 3CIQA 1HHJB 1KIPB 2RBLA 4R4FL 1N3NA 3SOBL 3KYKH 4Y8DC 1NC4A 5JHDA 3N1FC 5CP3A 5LGKA 4JO1L 3ZYOA 1I7RB 1FP5A 3D0LB 3BIBX 4CN6A 3C8HA 3BXNA 3MPCA 4OBSA 4XZUB 1LO3L 4M4RA 4KZDL 1AGDA 4JQIH 2IGFL 2AI0L 5C08E 4KGLA 4LAJH 1U3HC 2DQTL 2ZCKL 2PXYA 1R5IA 1F90H 1S5IL 1NAKL 1U8QA 3LKNA 1S9KC 2OL3B 1QSFB 5E4EB 2AV1A 4JFOA 3ES6B 3ARQA 1EJOH 1KJ3H 1RUKH 4HUKB 4ZPVB 1TIUA 4NKOA 1GPOH 1I1AB 2ICES 1RIHL 3EFDL 5E8PB 1A4KA 2AJYL 4OIIH 2E7MA 5HHOD 5FF6A 1EIBA 4S10A 3AB0C 3TWCH 3MV7D 4X6EB 5GJSH 1IAMA 3C6LD 3VFVA 5AZ2H 1NANI 4NZUL 4JRWA 3FN9A 5EB9A 1QFOA 2Q3AA 1BFVH 2BFVL 1KTDB 3U1SL 4WW2B 1OAUH 3IXTA 4NQSA 5EZOL 4LLDB 5DWUL 1BQHG 1WWCA 4UDTA 1FVDA 4WEBH 4L1DA 3QG6A 4XPTL 2BNQD 2UUDK 2X4TA 3GZKA 3GHBH 3WD5L 2B1HL 1EGJL 1IFHH 4WJ5A 4MA8L 1NC2A 4ZQKB 2R1YB 2YWZA 4DEPC 3HI6H 2I60H 5HYJA 2Y36L 4JG1H 4R4FH 1U42A 3Q3GA 3SOBH 5HI4D 4OZHE 2CRZA 2VMFA 2FZ3A 5GQBA 2VIRB 5GHWL 4JO1H 1WZ1L 1BPVA 4AENA 3EO1A 4KXZI 5BXFB 2NX5D 2V7NA 4Y16A 1KPVB 1LO3H 4KZDH 1JWMB 1JVKA 3B83A 2IGFH 2AI0H 1BJ8A 4J6RL 2W92A 5IB4A 1B4RA 4R4BB 2DQTH 2ZCKH 5HHOB 3U0PB 1S5IH 1GZQA 4LVEA 4QTHB 1NAKH 5CILL 4YHYB 3MV7B 2VE6B 3C6LB 1KNOB 5FOJA 2ICCA 2Q6WA 5HY9B 4G9DA 2ATKA 1RIHH 3EFDH 4GRWE 4PJ5E 2AJYH 4X7TB 3WJJA 4P4KA 1A1OA 3U7AA 1R5VB 4G7VL 4P5TD 5T33L 4I48B 1QEWB 4LPVA 4NN6C 4IRJC 4PG2C 2BNQB 1DBAL 2Y5EA 4XGZA 2FIRT 3ZO0A 5EO1B 1VEPA 3BIAX 4NZUH 1OAKL 4GKSA 5GZND 3QAZB 3VXTB 1UKSA 1D6EA 3U1SH 2P8PB 5B8CC 1J0YA 4X7SH 5EZOH 4RGOL 4DGIL 3KHQA 3WUZA 2IAMC 2IH1B 1XH3A 1I3RA 1J10A 5DWUH 1CT8B 4M48L 4NKMA 2B2XL 4GMTL 2OZ4A 4OZFG 2OP4L 3TH3T 4XPTH 5BS0E 1LDSA 2R4SL 3BO8A 1U8KA 3WD5H 2DM2A 2B1HH 1EGJH 4EBQL 4WI9A 3GSWB 4MA8H 2NX5B 2EIZB 3PWLA 4DVBA 5CGYD 3KPRD 1RZJL 4Y4FA 1T4KA 2Y36H 1TETL 3OR6B 4HPYH 3SKNA 4M8QB 1BJ1H 4I8DA 1T20B 5GHWH 4LLUA 5D5MF 3RVVC 3LRGA 1WZ1H 2WBJA 1DZBA 4WGVB 1EGJA 2LTQB 1UVQA 3MA9L 5GGUA 5AWNL 5DSCA 3P4MB 4DZ8A 2I5YL 4J6RH 1MVUB 2BSTB 3QIUD 3DLQR 2FX9L 4P3WA 2FHBA 3STZA 5L0QC 4P5TB 3O6FA 2ICEA 5GS3A 4IJ3C 3C8KB 5C0FB 1Q9KA 2VQUA 5LKNA 3FB8B 2XQBL 3KPQB 1ZHBB 3EFFB 1UH3A 2PTUA 3H9SD 2ZUQB 1QBAA 3FOLB 1OP9A 3P9LB 5IBUB 1QPXA 1QSFE 4I3GA 3C5ZC 1U6AL 1H9VA 3MREA 4M93C 4G7VH 5T33H 4WHCA 2XWJA 4O2FB 1MCQA 4FQXD 1DBAH 3L7EB 2VLJD 3QQ4A 4NO0A 5I1GL 1G9NL 1T7YA 3WNNA 2E7LE 1OAKH 5TE4L 1I85A 1PJ9A 1PQZB 2DWDA 3QXUA 1NUGA 5FGSA 3AXLB 5ANMA 1T89A 4F8TA 1WBYB 4RGOH 4DGIH 2VITB 3MRRA 2VDNL 3KPRB 1AIFB 3CX2A 3P77A 3B3IA 3ZT5A 4M48H 4JRXA 1WAAF 4LPXA 2B2XH 1BGXL 2OP4H 3B9DA 4POZC 1FZJB 4FXKB 4JHWH 2R4SH 4EBQH 4HS8L 4V2CB 2BY2A 3BYTA 4TN9A 3I6GA 3C5JB 3IDNB 1CFTA 2YR3A 4F37F 1RZJH 5EO0A 1TETH 2VDPL 3QIUB 3CSPA 1E4WL 3IETA 1MUJB 3DUSB 5HSFA 5JUEL 4PRAA 2C7UB 4WTZG 3WMSA 3H9SB 4ZOEA 5DJDB 1LP9A 3UTTA 1BF8A 2FX9H 2DB8A 4XVJL 3A0OA 4GW1A 1CBVL 4FQXB 4PJCF 2VLJB 1NC4D 1GAFL 2XQBH 1OB1A 5HHOE 2Z31B 1T80A 3GSOB 4X9GA 3HI1B 3VXPA 3BEVB 4XXCC 2VQ1A 2AK4A 3S96A 1O7SA 5JZ7C 4PJBF 4PUBL 4AH2A 1U6AH 1FN4A 2CRIA 4MDJB 1RZFL 4RA0C 1CR9L 3HB3D 5IW6B 2PXYD 3TC9A 5I1GH 1G9NH 4NNXA 1CD9B 2ADJA 2VXUL 1RZIB 4NRYB 1F8TL 5TE4H 3SE3C 4NIKB 3QWOB 4RFEB 3VFTB 3VD9A 2VDNH 2BNQE 3W82A 4TNVF 2X42A 3RNQB 4ZTPL 1GOFA 1BGXH 1URLA 4HW6A 3R0NA 5KANI 4Y5YB 2ZSVA 4G6FD 4X7DC 1CD1A 4D94A 4P9HH 4HS8H 3QPQC 2A2QT 2NW2B 3P3YA 3LKOB 5EOQL 2F15A 5BW7A 5ICYA 2VDPH 1EDQA 1CGYA 5BZWB 5GGRB 4MA3B 5CJQL 3GIVB 2NX5E 3JWOC 4GAGL 5JW4M 1E4WH 5F9WB 2VL5B 1MY5A 2NW3A 1H8NA 4LDEB 4ZYKA 3WUWA 5JUEH 1N3NB 3FO0L 1A6ZA 5IMMA 1YJDL 5AAMA 1WEJH 1C5DA 3SEPA 1TQBC 1F6LL 3G5YA 1WFOA 5F1NB 4U1MB 3QDAA 1K4CB 2OXGA 1G6VK 1GGYA 1I9RL 4HK0A 4OFDA 2DQUL 3GJEA 3MNWB 1DUYA 1QLFB 3RVUC 4XVJH 1CBVH 2P4AB 1QP1A 5HYJD 1TJHL 4Q9RL 5FGBC 2VAAB 5L2JA 4ZTOL 1GAFH 1YC7A 4HKJB 1U8QB 4UB0L 4EDXA 4UZGA 4JREB 2OTWB 2AV1B 4G80A 4OT1L 5FOBB 4PUBH 3IF1A 4RIRA 3FRUA 3B5TA 2R2BA 1XFPA 1C7TA 1RZFH 5INCA 1CR9H 1NCDL 5HJ3A 4LHJB 2VXUH 3MRCB 4RMVA 1F8TH 1WICA 2APBA 1JZ7A 4NQDA 2CD0A 5IB3A 3CFJB 1JPST 4P2QA 4CMHC 2ZUXA 5CWSB 2JCCA 2OJEA 3S6CA 4PDCE 4MD0B 4ZTPH 3HZKA 3D1MC 4E41B 2HJKA 5HBBA 4J8RB 2EEBA 2YSSA 1KCKA 1U58A 3W9DA 4Y4HC 4P4KD 2NYYD 1IGFL 5DVNA 3KPRE 1TCMA 3KLSA 2YD7A 2H1PL 1T89C 2O61B 1DLHB 4MAYC 4TTGA 1IL1A 1E4KC 5D93B 5EOQH 4WJ5B 3CCHB 3ZE0E 43CAB 5CJQH 4GAGH 3MJ9L 3BZ4B 3QFJA 3QHTC 4L8DB 5I71B 4OFVA 5KN5A 1JPFA 3FO0H 1YJDH 3ZDYF 1BOGA 3SHSA 3QO1B 3B9KC 4JJHA 4P23A 3K8MA 4MMZC 3QJHB 3TH4T 5EU7E 3ZDXF 3EO1B 2DQUH 5KSAC 4H88L 4DFIA 4KQ4L 4DUVA 4Q9RH 1TJHH 4Y4FD 3DRQA 4M5YL 5T3ZE 1UADC 3FL7A 2Q76B 1GGIL 4ZTOH 4OUOA 3B9AA 4CRPA 3RPKA 2MCG1 4NKDA 4UB0H 5DS8B 5DZNA 1SY6L 5F3BA 2HA1A 2WBJD 4HD9A 1OLZA 5IEHA 3CGTA 4UMGA 1T0NB 2AERT 5MEPA 3G08A 2D4DA 1NCDH 1F6FB 4ZUTA 1VFUA 1CFNA 2XTJC 1EH9A 5C71A 1JZ4A 3WNOA 5DRXA 5I75B 4UIMA 3O6FD 4QHMA 1J7VR 3TA3C 4LCCA 1Z5LA 3ULVL 4XGZB 4XNUH 1LO5B 4Q9CA 1KJVB 3VG9C 1NGWB 4X6CB 1XH3B 3ARDC 1ZA3B 2BHYA 1JNJA 5IB1B 4EI6A 1IGFH 3DJ9A 1GVIA 1OGAD 1TZIB 5ESAB 5I1CL 3G5XB 3OGOE 2RB8A 3FONB 3MTRA 3L9RB 1NUNB 5T3XD 4XVUC 3R8BB 2NY0D 4KDVA 2AEQH 1I7UA 3BMVA 2V2WB 4JM4L 1KACB 5K59E 3UBXG 1KF9B 3RAJL 3PWLB 3BZEA 3I9GL 2QQKL 5I9QC 3MJ9H 3DMMB 4Y4FB 1TVDA 3DYMA 4EI5A 4JRXD 1VGEL 2E6PA 1QZ1A 1DANU 4YX2L 1J18A 3S7GA 4HUUA 3EGSB 4O2EA 4NUGL 5TPWL 4OFYD 4FFYL 3HZYA 3MJ7A 4H88H 4KQ4H 3MJ9A 4JFQB 4UU9B 4M5YH 4YAQA 2FLRT 1O5DT 4P9HC 1IMHC 1GGIH 1A5FH 1P2CA 5JA8B 3O6FB 2RAMA 3EZJB 3B5HA 4M7LT 5DHYB 1GSMA 1SY6H 1YUHB 4BKLB 2IPKB 1Q9KB 4O2CA 1QD0A 1RURL 5GSRB 3KNBA 4B50A 4TTDD 4ZFGL 3SDXE 3C60D 3QULB 2JF1A 1MIML 5L2KB 4P49A 3BAEL 4KRMB 3LKRB 4QHKJ 1F3JB 5J7CC 1OGAB 1E0OB 3NIFE 3O3EB 2YXMA 3K4AA 4LPYA 2HT4C 4XP9L 1IKNA 4F80A 5F7DA 1SY6A 2NY0B 3QQ4B 5F88B 3BZFA 3IFOA 5J12B 4J3VA 1ES0A 5CEXA 2X70A 4DK6A 5SWSA 3MRRB 1S9YA 3LD8C 2FWOA 2WV3A 4PJGA 2NNAB 4TNWK 1FVEB 3B3IB 1W72L 4HIEB 5IV2A 4WV1A 4P2RA 4JRXB 4U6TA 5I1CH 2R1XA 2CPCA 3QDME 2K9UA 4E41E 3I6KB 2OJZL 5ALCL 3ROLA 1AR1C 1Z9LA 4JM4H 1GIGL 3O3BB 1LQVA 2DIAA 3RAJH 4R96A 3I9GH 2QQKH 2B4CC 3CUPB 2ZPKL 2RIKA 4EUPB 2C26A 2LVCA 1VGEH 4RGMC 1AI1L 1JF6A 4YX2H 1CGVA 1MFDL 4W4NA 4M62L 3RU8H 2RGSA 4LBEB 4O5LL 4OUUB 3C60B 4FFYH 1H3WM 3G9VA 4N8VA 1LP9B 2QQQA 1YNTB 3QDJD 3HG1D 5E00B 2C3WA 4OFIA 2G9HB 3F7VA 3VH8B 3MRPA 4PRNA 3RDTB 3T77A 3U79A 1KG0B 4X6DA 4ZNCD 1CDBA 4GW1B 1HHIA 1NBZA 2X1QA 3MBXL 3DXAA 5DHVH 1NGQL 3TIEB 1P4LB 2E7CA 1RURH 5ADOL 1DVFB 4UV7L 4NYLA 1MIMH 4KJYB 2HKFL 2VQTA 3RUGB 1XF2A 4AH2B 4XI5C 1FN4B 5C1MB 4NJAL 2PO6D 4L8CB 3GSNL 5D2LF 4XP9H 5DHVA 2E7HA 4LDLB 4NNXB 1DEEA 5FYJD 1HXMB 2ADJB 2GY5A 5JQHC 4XXDA 1ZEAL 1ZA6B 3BKYH 1RULL 4H26A 1X5GA 2YA0A 5EOCL 3EIFA 3TBSA 4M1CD 4LSPL 3FRPG 1W72H 1XIWA 3JV0A 4C4KT 1S78D 4CAGA 2FEDD 3GSQB 4X6CE 1YA5A 3SGJC 3LZFL 2OJZH 2AEPH 1GIGH 2XA8L 4NQDD 1ZHLA 2A6IA 3V6BR 4P2QD 4KKBC 5I2IB 5ICYB 1HQ4A 4XP5L 5C0EB 4KUZL 4RAUA 4Q74A 2ZPKH 4OM1L 1CIDA 3QHFL 3QDJB 3HG1B 4P2OA 5ISZA 4LPWA 3QPXL 1W72A 5DMKA 1MRDL 4F2MA 2BSED 5F8RC 5FO9A 1DN0B 2NW3B 2K3TA 4ZYKB 4M62H 5DD5L 2X10A 5IMMB 3BZDA 5C9KA 1FCGA 2VZTA 4MQ7A 4O4YL 2AP2A 4O5LH 1DSFL 2C5DC 1AO7D 4PJFA 4HK0B 3T2OA 4JFEA 3MLVL 2F5BL 3DGCR 3DURB 2NCMA 2PO6B 2VLKA 4IM8A 3MBXH 3QFJD 3NA4A 2R8SL 1NGQH 4KI5F 2Z91A 4E5XA 2BZDA 4LLYA 1X4ZA 4YEFA 3E2HB 4UV7H 3SKJL 3U2SB 1YY9C 4G8FA 2DJSA 4P23D 5IK3A 2HKFH 5FCSH 4G80B 5LBSL 3DV6B 3LOWA 4KRPC 5FDYA 5I1AA 1KXQE 3IAPA 3MXWL 3DVGB 4NJAH 2DLFL 4PJAB 3GSNH 5L2KE 5HJ3B 5MP6L 2M2DA 2BNRB 5IMOB 4ZAKC 2VDKL 3IDMB 3Q5TA 2VERN 4MJ6A 5JIPA 1OGAE 4HJ0D 4NQDB 1RULH 3BW9A 4M1DL 5C0AA 4LVOB 4P2QB 5INDB 1JYNA 5T3XE 4JVUA 2IQ9L 4LSPH 5I76B 1P69B 3ZTJH 3ZZ1A 1EEUA 3UPRA 1XGUB 4PLNC 1IKNC 2DTML 1C8PA 2Q20A 1MHCA 3GSNA 4KDWA 2YPKB 2UVEA 1MI5A 1TVBB 3WFHB 3LZFH 1DBBL 1MJJB 1JL8A 4NJ9L 2Q8BL 2XA8H 1L0YA 2EEAA 3QJFA 1IL1B 1P1ZA 2UWEA 3FQRA 4XP5H 1I7TB 4KUZH 1AO7B 5DURD 2I25N 4OM1H 3QHFH 3BDYL 1WSST 1MRDH 4MJID 3HN3A 4POYA 5ECJE 1XMWA 1IEAA 2EE2A 1BZ9A 3QFJB 4P4RA 4FQJL 4W70A 2QADD 1ZT1A 1JP5A 2R2HB 4O4YH 1H15A 3IFPB 1DSFH 2WIIB 2GAZA 2OK0L 1JI1A 3K46A 3MLVH 2F5BH 4HFWA 1QLRB 5DO2D 2CDEB 1IAIH 3TJHC 2R8SH 4EI5D 3BJ91 5A16A 2A73B 4PRBA 4BQ6A 4R4NC 3DTXB 3HE7C 4P2CG 3PDOA 3SKJH 5HDBF 5F3BB 3VD4A 2ED7A 4RSVA 2PETA 5B39B 1ZGLA 2CLRB 5F7UA 3MXWH 4BYHA 4TSBL 3G08B 2DLFH 3PHQA 1Q1JL 2IQAA 2V17L 2EO9A 1BP3B 2NY5L 3DV4B 5D4QA 4ZFOA 2VDKH 1WJ3A 3RUGE 2B5IB 1KIQB 2WANA 2OTUA 1IGML 3STLB 3OJDB 2RQ8A 1UZ6E 3OJMB 4M1DH 3S5LA 3BQUD 2YRZA 5MI0C 4FMFA 5F97E 5DURB 5E9DD 5FHAL 2IQ9H 5EO9B 4ODBD 5F7NC 1M05B 5C0IA 2DTMH 4MJIB 3G6AB 2MKLC 5LVEA 5IG7B 1KJMB 2VDOL 1H3PL 5EUOF 5AZEL 2GSGA 1DBBH 4PIRF 4NJ9H 4PRDA 5CMAA 2Q8BH 2ZSWA 3QEHA 2HJLB 3RGVA 4MYWB 4YXLL 3D2UA 3WS3A 1I7UB 1XIWC 2XIDA 5EIIA 3BDYH 4JFXA 4PJ7F 3HS0A 4Y19A 3GFUA 3BZEB 1A7OL 1JF1A 1YMMA 2BSRA 4U1HB 3LN9A 2O93L 2CR6A 4E42A 4EI5B 2QR0A 4FQJH 4BH7A 3TFKC 2ESVD 5I6XC 3QDJE 3HG1E 2COQA 1U9KA 2FHFA 4HHAB 4L3ED 3ULVD 4LVHC 1NUFA 2OK0H 5IM7A 3VGFA 3ARFA 3OKEB 1UA6H 2Q7NA 4ZOCA 4BFIA 3DVNB 3F7QA 5J4MA 1FFPA 3FQTA 2WK2A 3STBA 3WDIA 2Y07L 5HVHC 3HI5L 1JZ5A 5IB5A 2NXZD 3BQUB 4O2CB 1AGCA 5E2JA 2ZCLL 5E9DB 1FFRA 5FYJE 4KKLD 4NO2B 5DK0B 3SDAA 3MLUL 1D5ZB 3VFNA 5J56B 4Z78A 2J7LA 4JAMA 3J7HA 1Q1JH 2V17H 3O9WD 3TP4A 3UP1A 2NY5H 2EO1A 2X4RA 3T3PE 3RX8A 1I8IB 5DJ8A 1IGMH 2VZOA 2CIKB 1CLZL 3IDJA 3FOMA 3MV9D 3JWDL 2AXFA 5FHAH 1ES0B 2BNRE 4NUJB 4PJ9A 1JPGB 1PX4A 1D5MB 2X70B 1R24B 4LCUB 1IZKA 1GGBL 1S9YB 3NN8B 3BN3B 4HKBA 3WFDL 1RPQA 3MRMB 1FFNA 1KOAA 2VDOH 1H3PH 3HUJA 4FQHB 3RZWA 5AZEH 1QNZL 3VI3E 1NDMA 2ESVB 2WUCL 3FQUB 4GFTB 3U48A 3MJ8A 3VXUA 4N68A 3CVHL 4L3EB 2W0LA 4YXLH 4BZYA 2PTVA 4K9EC 1NEZB 1DCLA 1A7OH 4NKIL 4U4BA 3SN6N 4X4ME 3VXNB 2X41A 3MA7A 3RWJB 4PJDB 1OW0C 4ODWB 4U6VL 3VFWA 5FUOL 2NXZB 3CSGA 2C1PA 2RR3A 3QHZL 4P5KA 1Q9OB 4KMQA 4MQTB 1KEGL 2IALB 3O9WB 3BP5A 2DKSA 2A9ML 5ISZD 1T1WB 4WDIB 3MRPB 4PD4K 4K23L 2Y07H 3KPMA 4HZLB 1NBZB 3HI5H 3NCMA 5TF1L 4F58L 4HAFA 4O58H 5TE6L 3MV9B 1CFVL 4URTB 2ZCLH 4R6UA 3VGEA 4RFNB 3MLUH 2Z92B 4PGDB 4QRRB 5D7JC 4EVNA 5D96C 1NCCL 4J7RA 1BWMA 4S2SA 4OLXL 1VKXA 3FFDA 1HDMA 2FLBT 1A0QL 2J5LC 3WHE1 3PL6A 1CLZH 3NCYP 5DHVB 4K7PX 5EU6E 3JWDH 3MBED 4ELKB 1NLDL 5HGDB 1PAMA 2VWEC 1NL0L 5GJTL 2JTDA 3UC0L 2MTPA 1GGBH 3ZKNC 4Z8FL 1Q8MA 3WFDH 1JN6A 1QNZH 1JYWA 4FFWC 2DTSA 2WUCH 1HSBA 3VRJA 1M71A 4DAGL 3PQYA 4RWYL 2EYRA 5TDNA 1F3DJ 3DRTB 5CIPH 4TVPL 4XBPB 1WK0A 5JLZA 5C0AD 3T0WA 1HH9A 4NKIH 2ATPA 2XQYG 2FYYA 4KJWD 4X5LA 1T21A 4W4OA 4AEHL 2GK2A 5ISZB 4YHOL 4X5XA 2A83A 3TF7A 3RI5F 2YD1A 3HE6C 1G6RB 4U6VH 1WWBX 3BDXA 4JVWA 4WIQA 3QHZH 1NKRA 5CIPA 3SKOA 5A2JH 4HK3J 1J8HD 4UAOC 5K9QI 3S4SB 1KEGH 2PW1B 4IMLB 2WSKA 5FYKE 5FO7A 2A9MH 2FO1A 2VSDA 1MPAL 4XRCA 4K23H 4G6JL 3QISA 5JHLL 1S9WA 3QH3A 3CAFA 2DWEA 5TF1H 4F58H 3REWA 5TDPA 4KRNA 5TE6H 1CFVH 3MBEB 4E5XB 3D3VA 1YQ2A 1P7KA 1E6JL 5C7XL 1MELA 4P46D 2OQJB 4G8FB 5IK3B 5KOMC 4HGWA 4HCRL 1NCCH 4I5BB 4ONOA 3GMQB 1JYXA 3BEWA 4OLXH 5E9DE 8CGTA 1T04B 5GGTL 1A0QH 1DUZB 4M3JA 4WI3A 5H2BB 3IYLW 3RWHB 1NLDH 2NQCA 3SDAC 1ZVSB 4MJ6B 1NL0H 4OF8A 2BVOB 4OAWB 2BRRH 4U3HA 5GJTH 3UC0H 5C0AB 3F12B 4Z8FH 4H1LH 4N0FB 3TT1L 5TGBB 5D7IF 1GOHA 3UPRB 4N9OB 2J8UF 1CVSC 1HEZA 4RWYH 4DAGH 1MHCB 1XF4B 4QWWD 2K7QA 2ESVE 3NGBB 5E7BA 1J8HB 5DHXB 4BZ1L 3FO2A 1P1ZB 4QHUA 2RJMA 1NH6A 3NIDF 4Z7OE 2D7TL 4H1LA 3ULVE 2AKRB 4AEHH 4YHOH 4LP5A 1BM3L 2GUOA 3WO4C 2DM3A 4YDIH 5AYUL 4D0DA 5DUPL 4GH7B 1X44A 1ZT1B 1FNFA 2ARJQ 4P46B 3RGVD 4PJDE 3AFLA 4PJXA 1XR9A 2UZIH 3O6ML 4KTDL 1WZLA 1OSPH 3PHOB 4Y19D 3F7YA 5KG9A 2VDRL 1VACA 4KH2A 2CJUL 1FZMB 4HFWB 5IHUL 4G6JH 4QT5B 1U3HD 2DKUA 2F54D 5JHLH 3GMRA 3FHAA 1IRAY 3KWWA 1YZZA 1X9QA 3NZHL 4D8PB 5A16B 2GCYB 5BV7C 3D69A 1CGUA 1E6JH 1JNLL 4F7TB 5C7XH 3CFKA 3PDOB 3MACL 3MYJA 3WLBB 4S11A 4HCRH 1U91A 1K8IB 2PR4H 5B22A 3MV9E 3TO4A 4AQOA 3ARFD 3L3JA 2GYSA 5GGTH 2VO5A 4KZEL 1WCBA 4L8SC 4QRRE 5IVOA 1MQ8A 4BQCA 4NO3A 3I50L 1FL5A 2ADIA 1AKJB 3OAUL 1CFQB 4HCRA 1BD2E 3DX7B 3TT1H 4I4WA 5F71A 4FS0A 3CC5B 3H8NA 3G04A 5CSZA 1QBBA 3EYVB 1RQ5A 5DVMA 3PWVA 3MGAA 3D85A 1J12A 1MCIA 1MEXL 3O4OC 4PRDB 4PJIF 3UDWA 2VJXA 1MLCA 4RDQG 3RGVB 4BZ1H 5LGJA 4XPHL 3FN0L 2D7TH 4ZG1A 3ZYIA 5CUSL 4D9QD 3HS0B 3E6FB 5JOFB 4RISL 1U3HB 1BM3H 1HH6A 2F54B 5AYUH 2Y6SC 3L3DB 4Y89A 2IJ0C 2CKBL 4PJEF 4I18C 1G7HB 5DUPH 3L95A 3OX8B 5E6ZA 2X4UA 2V9RA 4PJCA 5J6HA 3VXUD 3KDMA 3ZL4H 5JDJA 3RWFB 2YK1L 1I9IL 3O6MH 1RUPL 4KTDH 5SWQB 3AMLA 2RFXA 5IM7B 1D5XA 3ARFB 2VDRH 3BGMB 4L8BB 3KJ6H 2CJUH 4HPOL 5IHUH 3RHWF 1KSRA 3BT2L 5ITBL 4PP2A 1VEOA 1LO4L 4XCEB 4L4VB 3NZHH 4JPIA 4OZHF 2Z35A 3FQTB 3JV5A 1JNLH 1OGTB 3AAZB 1T7XA 3MACH 3HA0A 1X4YA 3LRSA 5ACMA 1AGCB 1S7UA 2HFFA 4HLJA 5B4MD 4HEME 3OB0H 4WVRA 2EICA 3E3QA 4J1UA 4DUXA 4KZEH 2XZAH 3H9HA 4PJ8C 5FB8A 5I1LB 5T1KB 3MV8D 4ELMB 3I50H 1KEML 1SJHB 2AJSL 2D31A 5K9OB 2K1MA 3OAUH 1QRKA 1P5VA 2Z93B 4KAQL 4DEPB 1WIUA 4HKBB 2HLFC 1TQCC 2YN5A 1ORQA 4PY8J 1NDMB 1MEXH 5T5NG 2BSSA 1AGBA 4HUWA 1X5FA 3UZEA 3PJSB 4XPHH 3FN0H 4RGNC 3QIBA 4D9LL 4RISH 1C12A 1ND0B 3OPZL 4HFUL 1J8HE 3P73A 1GYAA 2CKBH 3L5IA 3PQYD 1INQB 3K7UA 4YFLI 3CK0L 2YK1H 1I9IH 4YBQC 1RUPH 3RWCB 4J3XA 4FFVD 2EDQA 1BIIB 4HPOH 3VGHA 3BT2H 4OD1L 4OZGA 5DVOA 5ITBH 1LO4H 4Z7QF 3MV8B 1OTTC 2CKBA 1ZSDA 2BOCA 4NN6B 2GJ6D 4POUB 4IRJB 4W6WB 1PZ5B 1K5NB 2DBLL 3LH2L 1YPZE 4QRUA 4C57C 1S7RA 3O4LA 1IQWL 4NC0B 2KZ1B 2CO6B 2IAMB 5CHNB 4QTIL 3GMOA 4NSKA 2X4PA 1RK1A 1NQBA 3OG6B 4P99A 2KKQA 3C5ZD 5F1IA 2P48B 4FNLL 4AT6A 4EVNB 5IQ7L 3C6SA 4XP1L 2CK0L 3LEVL 4CNIA 2AJSH 4BK5A 3RIFK 3UAJD 3BN9C 4YGVA 2EE3A 4YHZL 3DBXB 4KAQH 1P4IL 2AS5M 2OLDA 5ITFA 1MF2L 1F42A 5JXAL 2AXGB 2GTWA 1FBIL 3G9AB 4NNPL 1QKZL 4WWKC 4X6FB 3ZHKA 3CZJA 4GRLC 4WI2A 3MRGA 5AD0B 1X5HA 2YUXA 5GRXG 4HS6B 4JFDB 1DQDL 4D9LH 1KTLB 2EDKA 4WNQB 3ARBA 4HFUH 3OPZH 3O3UN 5CGMA 1SYVB 5ESQA 2DQJL 3VXME 1T21B 4DK3A 2PYFA 4RAVB 3N50A 3OMZA 5I8KL 4BSWA 5IF0A 2GJ6B 4IJ3B 5C70A 1FL3A 2F54E 1I8LC 3CVHB 4X99A 3AMKA 3CK0H 3CFDA 3MRQB 3SKOB 3O8XD 4JZJA 3GSXB 3UYOD 3VFRA 4Y2DA 5JO5A 1F4XL 3FAXA 3C5ZB 3R1GL 3PABA 4NWUL 4CL7A 1JGDB 3RVWC 1EZVY 3CZFA 5MEOA 2DBLH 3LH2H 3GEWB 3X14B 2VLRA 5TDPB 5HI5D 5EG6C 4AEFA 4L4VE 4Z95L 1IQWH 4TVPD 3KXFE 4JRYE 5HYSA 4NBYB 4QTIH 2HRLA 2P7TB 4L9LC 4HGWB 1DQQB 4KU1A 4FNLH 3KYOB 4XP1H 2CK0H 5I30L 1KFAH 1P7QA 3LEVH 3DO7B 1A4JB 1ZT4A 3VFPA 1HNGA 4CADA 4XH2B 1FZKA 4JPKL 3TVMD 2J8HA 1MCDA 3ALXA 3EYOA 4D3CL 4YHZH 4ORZC 2DMCA 5ID0A 3AVEA 4JDZB 1MF2H 4WI8A 4ELME 5F93C 4X9HA 5JXAH 1T0MA 5IMLA 4N8PA 1KT2B 3EZ8A 1NFDA 1EX0A 3TO4D 1S5HA 2R0ZL 4NNPH 1QKZH 4D9QE 1HEZB 5C07A 1T1ZB 1AHWA 3DGGA 5E5MA 5IEKA 3V95A 2PYEE 1FNLA 5D5MB 2DQCL 1LEIB 1F2QA 1XGTB 3O8XB 2CH8A 1DQDH 3UTZA 4HWBL 4HIJA 2VN7A 2FHCA 2DQJH 1GRWA 1U3ZA 1J0HA 1N8ZB 2HG5B 1X5IA 3UMTA 3L3IA 1UXSA 2XACC 5I8KH 3QIWC 4N0CA 4MA1C 5F96L 1N5YL 4MAUL 3LN5A 4D0DB 4Z77B 1KLGB 2R0KL 4D9RE 2KUTA 1M7IB 2ERJC 4JO3L 3HC0A 4YHIB 2V2TB 3R1GH 4K7PL 4OJFL 1P5UA 4LCYB 3RVUD 5KG9B 4O02L 3DUUA 2NR6D 1ACYL 1S9VA 3WCYA 3TVMB 1U0QA 5E5RB 1PDKA 4IIQA 4Z95H 2MQ0A 1AGEA 3MV8E 4XCCH 2F53D 3CFKB 3QQNA 3MYJB 2P8MB 3TCLA 4JKLA 3TYFB 2XKUA 3QI9A 2OCFD 3MUGB 4KFZC 3TO4B 4OI9A 3VFGL 5I30H 3AU1B 4WI5A 5DC0A 1VESA 1T2QH 3G5ZB 5I1DB 4PG9A 4JPKH 3CNKA 4GS7C 4QRSA 4D3CH 1S7SB 3LS5L 4PGCA 1FL5B 4OQTL 4ZUWB 4KY1L 2AV7A 4NFCA 2YA2A 5DMGC 4GAJH 4AIZB 2GK0B 1PGRB 3BH8B 1ZGLM 2R0ZH 3G04B 4Y4HD 3DROB 4AEIL 2HLAA 3SCMA 3Q0HA 1UB6A 1IKFL 4MAYD 4N0UB 3K81A 2DQCH 2WM0A 2CDFB 1L7TL 1MLCB 1Y18A 1J1PL 4QOKD 3B4NA 2IADA 2JE8A 1BZ7B 2P5WD 3MLYH 3FT4B 4RZCB 3D18A 3KJ4C 2ID5A 4OLWL 4RDQF 4YUEL 4KVNL 3OKDB 4MNHA 15C8L 1HH6B 5F96H 4JFDE 5DD6B 2Z4QA 3KPPB 1N5YH 4MAUH 1LD9B 2VKXA 4QRTA 2R0KH 4PGBA 3L95B 3M45A 3DX6A 4PJCB 5F70A 1B2WL 2F53B 2GJ6E 4UT7L 1U8OB 4N1EA 5KSAD 4K7PH 5GPRA 3U46A 1ULVA 4OJFH 2RFXB 3ZYZA 4XBEL 3CSYB 3U9UA 4IRSA 3SE8L 3DPBA 5DA0B 1ZGLP 5T1MA 4E0RA 4O02H 4JZNA 1X5XA 4PJBB 5C0DB 5IJKC 2P44B 1CK0L 1SMOA 1ACYH 3IS0X 4FQ1L 4PY7A 1JYVA 4JZJC 1I9EA 5KSVA 1J88A 3Q6FA 5FM4A 2ICWJ 3OB0K 3WN5B 3QFDB 3PF2A 3OXSA 1F3DH 4G8GA 3U4EA 4KGJA 4WI4A 3WEXB 2HFFB 1UKTA 1MIEL 3VFGH 1OHQA 4HV8A 5CZVL 1LO2H 2JJTA 2QLVB 3GM0A 1JPSL 4Y4HB 3V5HB 1ZLWH 5GIRA 3B9VA 4UNUA 5FB8B 1KYOK 3WHXB 3TA3D 1CICA 3LEYL 4MAYB 5ADPL 5DRZA 4O51A 3LS5H 2C9AA 5FKAB 4OQTH 5KSBA 1U8JB 3MJ6A 4QOKB 4KY1H 2P5WB 3QWRD 4GLRI 2P8LB 1QHPA 3FMGL 5DJ2A 3HPJA 3ARDD 4YHPA 3O41B 4GG6E 4LLWA 3UTOA 4AEIH 4ZUVA 5B38G 4ZNEA 2W1NA 3QNZA 4PRHD 1IKFH 1JGVL 1EVUA 3S3PA 1L7TH 4OQTA 5HHNA 1J1PH 4IMKA 3VXRB 4XWGL 4NNYA 1NFIA 5T5NF 5KSAB 2V7HA 5C6TL 2GHWB 1HOCA 3JV4A 5JOPE 4YUEH 5DD0L 1AHWC 4KVNH 3X3FL 15C8H 2HH0L 1CYGA 2FIKB 4HIIB 1FNAA 3AY4C 1U92B 4XCNA 1FLRH 1V3JA 4Y4KA 2H6PA 4K3GA 4FFZL 4UT7H 1A9BB 1VFAA 5K59F 4XBEH 2R2CA 3SE8H 4TVPE 5F7KC 5DLML 3ULUL 2APTA 4LLMA 1E27A 1WBZA 2FL5A 3DIFB 3MV01 1CK0H 2FJHB 3SDDC 1R5WA 3TA3B 2W65B 2D0HA 2GKIA 3T4AB 2OBGA 2BJML 2MQ3A 1CU4L 2E27L 3VG9B 4LQFL 2FBOJ 3PWPA 5E2UL 2XT1B 2GT9A 3VG0L 5C0CA 1MIEH 3KPOB 3MRIB 5CZVH 1S7XB 5GRWA 3ARDB 1JPSH 2X4PB 5E8OA 1RK1B 5DEGB 4PLJC 2K7PA 2B0SL 4PRHB 5FUZH 3LEYH 2HT4D 5ADPH 2LV4A 1ZK9A 1SJEA 4MLIA 3RTQA 1U36A 1ZV5A 2JB6A 5EBGA 1WAAE 1RD6A 3FMGH 5JXEC 1LMKA 5I9QB 5BVJA 3HFMH 1MCKA 4F33B 5HHQB 1FL6A 3L6FA 4QXTB 5L9DL 5M95B 3KPNA 1P7QD 1JGVH 3S97C 4XWGH 1AR1D 2HFGL 3AC0A 3MRGB 4X80L 1C08B 3U6RB 4M61A 3MLWL 5C6TH 1A3QA 1MCSA 1NANH 4N0UE 1G1YA 5DD0H 3X3FH 2QKIB 5DDHA 3SCMC 2BY1A 5I74B 3TIDA 3RL2A 4FG6C 1RZ7L 4KRLB 1LO0L 3T1FB 1AQDA 2YN3A 4HEPG 1G7JA 1S7WA 4NKQB 4R0LC 5D7LA 4KDTC 1FL3B 4FFZH 4X99B 5DC9B 1MAKA 5D1ZA 4MSWA 5C6WH 3KPSA 1UJTA 2IMNA 4U1SA 3VFRB 5DLMH 3ULUH 2F53E 4ODXB 4V1DD 2P5ED 2YPLB 1YYML 3G6JA 3RPIA 1Q94A 1NGXB 1F11A 3IKKA 4PJBE 2BJMH 2E27H 4LQFH 3S88L 5E2UH 1OOAA 4XNYL 4G3YL 1FFOA 1PVHA 2V6HA 3RNKB 1K4DA 4LSTL 4KXZH 4X5WA 4XI5D 2B0SH 4OCRL 2D7NA 4U3XA 1NMBL 2OSLA 1MCFA 4NHUA 5E2TL 2D3VA 1OVZA 4CADB 3O3AA 1FZKB 3EYOB 1IVLA 3RWGB 2JJTC 3FT3B 1RAMA 1HHKB 4H5SB 2H2SD 2L7JA 4OGXL 5E7FA 3P0YL 4OZFB 1CTOA 5D1XC 3VXSD 5IMLB 3OKKB 4QOKE 5L9DH 4APQA 2P5WE 3QI9D 4RGMB 3BH9A 3QUXC 4Z7WA 3CJJA 2NZ9C 1UJ3C 4RX4A 3DX9A 4LF3A 2EEDA 4FZEL 2HFGH 5HD8D 3GK8L 3MLWH 3BP6A 1B0RA 4KKBD 4B7IA 3UTZB 5CZKA 5EU3B 3VXRE 4HIJB 4V1DB 5E1HB 5CFHA 2P5EB 4PGEA 3MRHA 1RZ7H 4MQXC 1R3JB 1LO0H 3FT2B 1IBGL 4FZ8H 3N0PB 1CGSH 1M1SA 4PRPD 1T22A 2WLYA 3FQNA 4QY8B 4FRWA 4FOMA 4WY7L 1O0VA 1S7VB 3BPOC 4XHJD 5CGTA 1W0VB 5E56A 3H3KA 4HUXB 4WO4C 4QLRA 5C3TA 1YYMH 1PKQB 5E8NB 4NC2B 2FBJL 3ZHLA 3DUUB 3CFBA 3TYGH 1KCUL 3DO3A 2UZYB 5BOPA 2G75A 5L7XL 2IWGA 4XNYH 4G3YH 4FQCL 3O3DA 1YY9D 5AEAA 5JMOC 1J05B 1CL7I 2H9GA 4Y2OA 1FNGA 5LGHL 3VXSB 2NTFA 5TQ0L 1L9MA 1RJYB 4F3FA 1E28B 3QI9B 4OCRH 4R2GD 4F7MA 3NFNA 4IRSD 3MQIA 5I1KL 1NMBH 1LNUA 5E2TH 3SKMB 2WZPD 1KB9K 4ZAKD 1ZT7B 4MNGB 4PG9B 1BREA 2FX7L 3IS1X 4LLQA 4NP4L 3NABL 1EJ6A 3KAAA 1A3LL 4PGCB 4PRHE 4LSUL 3FQXB 3UTPE 3FB6A 2Y9RT 5HGHA 4OGXH 3P0YH 4G8GD 5IW1A 1HXYA 3S36H 2A6JA 1G7LA 1DBJL 4GXVL 3VRIA 4I3SL 1FV1A 4ZUUA 3VFSA 4DUWA 4BK4A 3QCUL 4PRPB 2ZOKA 4FZEH 4Y5XA 2LU3A 1CFSA 4I0PD 4YR6A 4N0RA 1CICD 1MCNA 2EZ0C 3CDFA 4C59B 1KJ2L 1MH5A 2O5ZL 4LGRB 1A7BA 1WWWX 4BZ2L 1U8NA 5CLWA 1N6VA 1U8IA 3ZDYE 2YD6A 1V3MA 1IBGH 4BQ8A 1NCWL 1ZWIA 3G5VA 4LU5L 4LVNC 1D9KA 3V52L 1T5XA 2ADFL 2Z4QB 3IKCA 4PJHF 3ZDXE 5JORB 2BVQB 1A1MA 1OTUD 3ARGA 4WY7H 5A2KH 1YYLL 4GKNB 5B3JF 5EC1A 4MD4B 3BPNC 3JUZA 5E94B 1RZGB 5T1DL 3U46B 1U8LB 1XGQB 4HH8A 2FBJH 4R2GB 3U9UB 1XEDA 4OCLC 4LRIC 3RL1A 4JZNB 1CVRA 4DOHB 1I8KA 2O26U 1KCUH 5A3ID 4ZAKB 4R4ND 3L3OA 4PY7B 4K55A 3RVTC 3QQ9D 2YPLE 5D2LB 1ZHNB 5L7XH 5CD5C 1HIML 4KI5D 1FJ1B 3F5WB 3CH1B 4GKOA 4G8GB 5LGHH 1R3HA 5TQ0H 2MCPL 3LSOA 1DQJB 4QXUL 4RMUA 5I1KH 1YY8B 5DZOA 2A6DB 4JCMA 4X4XA 5IHZB 1NCUA 2FX7H 4JM2F 4I0PB 5D2NA 3QEGL 4NP4H 1F6AB 3NABH 4LSUH 1VB9A 4ISVA 4F7EB 1MFAL 5I66B 4Z7UA 5DJYB 4KKCD 1ZS8B 4Q6YA 5C0CD 4EIGB 4ZDHA 3U0TA 1DBJH 4GXVH 4I3SH 4YHPB 4I0CC 3KLHC 4E9LA 5JPNB 5I73C 3QCUH 1D5IL 2RCSH 3QNZB 5DD3L 3CX5J 1NMCB 5GSVB 1FSKC 2I07A 4F7CB 1GCFA 3MROB 1KJ2H 4DZBB 4Z5RA 2O5ZH 3RTQD 3ZMRA 4JKKA 1UWXH 4BZ2H 4X0KB 4HLZG 5E2VH 2YEZB 4DKDC 5J11C 3CDCA 3JV4B 1A2YA 1OAYL 2BVEA 5ERWB 1RHHB 2GW5A 2WLZA 3QDGD 4NT6B 3V52H 2ADFH 3TFKD 1DBKL 3KYNB 4V1DE 2B20A 4M00A 1AY1L 2P5EE 3IU3B 4LEXH 4XNQB 1IM3A 4WTXA 2BNUB 1FC2D 1CE1L 3QUZD 1KJ2A 3D39A 1VFAB 5T1DH 4KK8C 2R39A 3MXVL 2IAND 6FABL 4OZ4B 4U1NA 4XBGA 4Q58C 4ZUSB 1FIGL 1X3DA 3H42L 4R97C 3EDJA 1T2JA 3V6OC 3DHMA 1PKQE 1R5WB 3SBWC 3N1PC 2C3GA 1WWAX 3GJFH 5IFHL 5MI0B 1HIMH 3PP3H 2OTPA 3PGDB 4PP8C 3OKMA 5D1ZD 2MCPH 4QXUH 3VFOA 4ERSL 2EDRA 4JY4B 3VRLF 5E8OB 1G0DA 3Q1SL 4ZO7A 3QNYA 4G6AD 3VXSE 1DBMH 1G7QA 1WCQA 2ARWA 3L5XL 2FEEI 4JJ5B 1QPPA 5CLTA 3GJFA 1SJEB 2R1WA 3ZT6A 3V7AG 1MFAH 2D7PA 1RJZB 4MNGE 5F9DC 2H3NA 2MQCA 4K8RL 2VISA 5BVJB 5IQ9B 3ULUD 3L6FB 3F6IA 3QDGB 1IE5A 1D5IH 2C4XA 1KTKE 5I6XB 4JO4H 4G7YL 4QRQA 5DD3H 3LKPA 2HVKA 3IGAB 2EDFA 3E6HA 5E99L 3QUZB 4LVHB 4PRPE 3DI2B 4WHTB 4ZPTA 3ILPB 1IQDA 2IANB 4JGMA 5FGCB 1OAYH 1TLKA 2WWMD 3P9MA 5DTFA 5EBLA 2ZUWA 3V6ZA 1JWSA 3VI3F 5EZJA 4LAQL 2CDGA 1DBKH 3IRPX 1AQDB 1AY1H 3HCVA 1S7WB 4HH9B 5HVHB 1X5JA 1EFXD 1CE1H 1D6VL 3OHXB 5J9PA 4LIQE 4MA7L 4QCIB 5D1ZB 3MXVH 4ONHA 5EPMA 5HPMB 4S0TD 1AXIB 6FABH 4MQSB 2FO4B 5EBWA 2WQRA 4HMCA 4LKCA 1FIGH 3QXAA 3H42H 4KPHL 4Q2ZA 1ZLVH 4DVRL 5EIVA 5C08A 5J89A 1UM4L 2H2PD 1AGFA 1YMHB 4PYHA 2EDLA 5IFHH 3UZQA 3V6FA 4DOHE 2RHEA 3JXAA 4XNZB 1CXFA 1HHHB 4J2XA 3TT3L 3A67L 4ERSH 5F7MC 4NWTL 1J87A 1YEIL 5D2LE 4LHUG 3HPLA 4LHQB 4OZIF 2X44D 5JW5A 3NACL 4XPFL 5GGSA 3MMEB 5DUBA 2NY3C 1M6OB 5FKPB 1IEBB 4YHLH 3L5XH 2GIYA 3I3DA 4ZS7L 4BSVB 3SDCC 3JV6B 1EHXA 3ZKND 4K8RH 5HYIA 1H0DA 4PJGE 1QFWM 5F9AC 5T1LA 4PJ7B 1KB5L 1JPTH 4FFWD 4G7YH 1N64L 2EC9U 3BH9B 3QEQE 4YWGL 4ODSL 4JY6B 2R2EA 5E99H 1EFXB 3UBXB 1FG9C 1UZ8A 4LF3B 1M7DA 4F9LA 5E08L 1OWWA 4JFHD 3WIFB 1G9MH 1HI6A 3NCCB 4MJ5B 4O9HL 2C3VB 4MS8C 3JTCA 4Y1AE 3V8OA 4LAQH 3GSVA 5CBAA 1NGPL 1Y6KR 4F8QA 1P4BL 1D6VH 2PNDA 3N1GC 2HAZA 3FCTB 4I3RL 4JE4B 4U6HB 3ARTA 5J8OA 4MA7H 4NDMB 4NM8L 2R56L 4YO0B 1H8OA 4WCYL 3L3KB 1O7VA 5D96B 3TESA 4GRWH 2EYTB 4EDWL 2J5LB 4U0RB 4ZFZA 1UM4H 3HR5A 3TNMB 4YZFF 2HTKC 1OAZL 3ARGD 3TT3H 3A67H 2G75B 5DK2B 1EHLL 4NWTH 4GKZB 1NDGA 3F7PC 3LIZL 5DD1L 3NACH 4XPFH 5ICXA 4F3FB 3QZWA 1J0JA 1A6AA 1A8JH 1U8PB 1P84J 3GSRA 4PJ5A 4ZS7H 3RY5A 4F15B 3W5NA 3ROOA 1LEGB 3PNWB 2EDBA 3VWJA 4U0QB 1BJ1J 3UTQB 4XPAL 2XZQL 4HULB 3HZVA 1G7MA 2GITB 1HXYB 3TBWA 4IOSD 2A6JB 4R3SA 3W2DL 1IGYA 3NIGF 2MNUA 5JNYB 1N64H 4YWGH 4ODSH 4W81A 3VRIB 3IRZA 4JY5L 3QB7C 3VFSB 3EOBA 1TVHB 4Y5XB 2W60B 4LCWD 1CFSB 5I1HH 3V5DA 4J4PA 5E08H 5BS0A 4U1KA 4UAOB 1DE4B 3FB5B 5F7EL 1N5AA 1NMAL 1RV6X 3MR9A 4O9HH 4BFGA 3MRBB 3WE6B 3RKDC 1VEMA 2YXFA 1EVTC 1BVKA 1NGPH 3OF6A 3L3GB 3PXHA 4MCZA 4TUKH 4UT9L 2IANE 1F45A 5MHSD 1P4BH 2OI9A 4I3RH 1NBYA 1NBQA 4LKXA 1KCRL 3ARGB 4NM8H 2R56H 5E6IA 4WCYH 5GGVH 1HHJA 3R06B 1KIPA 5EC1B 4I13B 4U1LB 1XZ0B 4EDWH 5DMIL 3LQAL 5DFVC 5HDBE 1I7RA 3D0LA 5D1QD 5GGSY 3FFCD 1OAZH 2HVJB 1EHLH 4KWUA 4G43A 3LIZH 5KVMC 5DD1H 2HTLD 2X7LB 3I3BA 1QSFA 1UENA 5J6GB 3ES6A 1ZTXL 1LWRA 4LCWB 4ZPVA 4WUUB 2YC1B 5JW3L 1I1AA 4XPAH 1E4XI 1F00I 1D3CA 3ARPA 5EUOE 1F5WA 3TBVB 4UUJB 4G9FB 1JF5A 4B7LA 1NGYA 3LY6A 4RRPA 4X6EA 3W2DH 3U0TB 3T65B 5DEZA 3WO4B 1KBGH 4JY5H 5DI8B 3PV6B 3CXHK 2NMSA 3V0AC 4WW2A 4PJ7E 2PF6A 1UWXK 2I07B 4NN7C 5F7EH 2UWEE 1NMAH 4LLDA 1Z9SA 5HXMA 1P9MC 2KQMA 3UROR 1JHLL 3EO9L 1GXEA 3TLRA 1QFWI 4OTXL 4OI8A 4UT9H 2NY4C 4F9LC 1WBXB 3EBAA 5D1QB 5F44A 1KPRB 2GFBB 3EJJX 4JQVC 4ZQKA 5BV7B 2R1YA 1KCVH 2CGRL 3FFCB 4NZDA 1HSAB 4K71C 4RQQB 2X9YA 4CBPA 3U4BL 5A1AA 2VIRA 4M7JL 5DMIH 3C9NB 3FO9B 3LQAH 5KS9F 5IWLA 3NPZB 3GJFK 1KPVA 3PP3K 1G9MC 5I16A 5IB2B 2JIXD 5HHOA 3U0PA 3OKMB 5DJZB 1X5AA 4QTHA 5D72L 4QHNB 2DQIH 2VWEE 1QHOA 3VFOB 3EJZD 3MV7A 2VE6A 2X40A 2NY7L 3MFFB 3C6LA 3JBG7 4N1CA 1KNOA 4R7DB 4ZD3H 3MFGB 5D7IB 5L6YH 3O4OB 5GS1C 1ZTXH 2J8UB 1JBJA 2NY6D 5JW3H 2ZUTA 4OIBA 4X7TA 2YKLL 1PKOA 2FJGB 1YEFL 5FIEA 1R5VA 1X5KA 1JGLL 3VFUA 4I48A 2H3NB 1YEEL 2EYSA 2EE6A 2BNQA 3MNVB 2VISB 4JFHE 4NM4L 5EO1A 4JN1L 4H8WL 3C5SB 3VXTA 1PEZA 4QHLA 3LKPB 3UYPA 1T5WA 1UG9A 4U1IB 2IH1A 3ME0A 4TUJB 4KJPD 32C2B 3W39B 5IVZB 1CT8A 4KK5C 1TZHA 1HNFA 3VWKC 2DLIA 2G2RB 3EO9H 5D8JL 4ETQB 4ONFL 1MREL 3GMPB 4OTXH 3DHJA 3GSWA 4PGJA 2NX5A 5EZJB 4OQ1A 2CGRH 2EIZA 5T3ZL 3EYUH 5F6HI 1PY9A 3JZ7A 1JHKL 3ABZA 2JIXB 3OR6A 4YBQD 43C9B 2H8PB 4U49A 3U4BH 4M8QA 2F19H 5HVGB 4M02A 2X4NB 4M7JH 4K8RD 1ZLVK 5GGVY 1CI5A 3VD3A 3E1F1 4PJ8B 4JHZA 4LKCB 5F3HB 3QXAB 4S1DC 4GW4B 3WJLA 2E9BA 5C0JA 3P4MA 4M7KL 2NY6B 1MVUA 2WWKO 4ODHL 2BSTA 5D72H 4P5TA 3RWEB 1IC1A 1OARH 2NY7H 5TE7L 3HPLB 3C8KA 3HZMB 5C0FA 1BBJA 1BLNB 1TQCB 3FB8A 3MGOB 2V9TA 3EFFA 3O2WL 5JW5B 4QXGL 4Y8AA 3V4PL 3NOIA 3FOLA 5E0QA 3F7RA 1BWWA 3P9LA 3BN9D 2YKLH 1MQKL 3UX9B 5L8LB 5ESVB 1YEFH 4PJIB 1MJ7L 2FATL 4XCFL 4O2FA 1QBLL 5EN2B 1TPXC 4LCWE 4QO1A 1YEEH 4WUUE 5E4EC 5K33A 4NM4H 4JN1H 4H8WH 1PQZA 1YEJL 2W0FB 1DANT 4WWKD 3AXLA 4G9FE 1WBYA 4PJ5D 2APFA 3TO2B 2VITA 4UINL 3DETC 4OKDA 3ESVF 3KPRA 1AIFA 3U36A 4PJEB 1IARB 3ILQC 3VWJD 2J88H 2C1OB 5D8JH 1FZJA 4ONFH 1MREH 1F3RB 3I02A 1A21A 5IESL 1Z6JT 1GC1C 3C5JA 1DJSA 5T3ZH 1QRND 4PTTA 1QG3A 3IVKB 4OZHB 3QIUA 4J4PD 2W9DL 1MUJA 3DUSA 2NTSP 3X11A 3K4ZA 1FNEA 4C58B 3EYFB 2X4SB 1P6AB 3BESR 2Y7QB 2C7UA 3OF6D 1ZXQA 4ZFZB 5DJDA 2EDOA 2BVPA 1FDLL 2EIBA 4ODHH 2OR9H 3EYQD 1NCBL 1UXWB 4LPUA 5E6ID 3A6BH 4FQXA 3P4OB 5IWLC 5TE7H 2FX8L 2DI8A 4C56B 4JFYB 2Z31A 4QXGH 1QSED 3HI1A 4K7FB 4WWKB 3V4PH 3IAQA 3BEVA 1OY3B 3LDBB 3WXVH 2EDYA 5I8EB 3IU4L 2H26A 1XGYL 1MQKH 3V0WL 4HSQA 5E1AB 4MX7B 4YHYC 4MHHG 4MDJA 3VWJB 5D7IE 1MJ7H 2FATH 4XCFH 1QBLH 5IW6A 3ELAT 1VENA 2J8UE 5FFLA 5MEQA 1RZIA 3AUVA 1YEJH 4R3SB 5IT2L 1IGYB 3OXRA 2L4OA 1V7MH 3QWOA 4RFEA 3VFTA 1QRNB 3LV3B 4RAHA 4Y5VA 3S9DB 1VERA 2BERA 3NIDE 5CD3B 4LSSL 2APXA 3JWNC 3RNQA 1I1AD 4Z7VF 4Y5YA 3WL9A 4XB7A 1PW3A 5IESH 3ZT7A 2OMNA 1KB5B 1QVOB 1BVKB 1R3LB 2NW2A 3LKOA 4K94C 4OV6F 2X1WL 3BJLA 5EZLB 2FR4A 2X9WA 5BZWA 5GGRA 4MA3A 3GIVA 1Q0YL 2W9DH 2DLEA 5E6IB 3S3SA 2VL5A 4L9LB 2GJZB 3MOBL 3T0VA 4KUCF 5DJAA 4OF0A 1QSEB 4YEEA 5F1NA 4U1MA 2Y5TB 1K4CA 2W9LA 1FDLH 1LEKA 5IMKB 3MNWA 1NCBH 1QLFA 1V7NL 3HHRB 5LJYH 1QO3B 4HF5L 3FQWB 2VAAA 2AABL 4G43B 3KHOA 4FMKA 3T8XB 2FX8H 2LTQC 3T0DA 5DMYA 3R4DA 3SDXA 4HKJA 5KSUB 3FKUS 4GXUM 4NZJA 4X6BB 4NN5C 3IU4H 2OTWA 1XGYH 5FOBA 3TN0D 4CMMA 5MERB 4J23A 3GB7A 3VDCA 4JDVB 3VD7A 2VB5A 5GZNC 4EN3A 5IJVB 3MRCA 4L4TE 2ITCA 4RGNE 3WFEL 1NGYB 4PJIE 5IT2H 1A7QL 4KMTL 3QIWB 2D0FA 3CFJA 4MA1B 3UTSE 5CWSA 4ZXBD 5IVXF 3UJTL 4LSSH 2FJFA 4DN4L 3O0RL 4MD0A 3JTSB 5HGAB 3QDMA 3IJSB 1VCAA 4E41A 4J8RA 4OF3A 4PD4J 3ARWA 1XF3B 4PJEE 2O61A 2FB4L 1DLHA 2XG5A 5CGYC 1TMCB 5J3HC 2VSCA 1Z0NA 3CCHA 4M9PA 3NCYS 4PBVC 43CAA 1ITCA 3T0EC 4G6KH 1Q0YH 5TQ2L 1MFEL 3SY0A 3SGDI 2AW2A 2YD4A 3BZ4A 4BQBA 3MOBH 4HS3B 4L8DA 1ETZB 3WUWG 3VMOA 4NQXB 3QO1A 4CUCA 3EAKA 1JRHL 1ROWA 3QJHA 4JKWA 1Z3GL 2D7OA 4GS7B 3TN0B 3MV11 5I16B 1V7NH 2VDLL 5DR5L 3IDYB 2I9TB 4I0KA 4FA8A 4HF5H 3CSBA 2AABH 2Q76A 1MFBL 3RZCC 3UBXI 4OKVB 4S1SL 4BSJA 3IJHB 1U2CA 1CG9A 5T3XL 5DS8A 3EJYD 4DGVL 3PWNB 2E3VA 2YUWA 4ZXBB 2EKSB 1RHFA 4K3JL 1A47A 4C56E 1T0NA 3TZVD 3ESUF 1F97A 3W11D 1WT5A 3HMXL 3T4YB 3KJ4B 3VFUB 3WFEH 1A7QH 1U41A 4KMTH 1YDPB 2EYSB 3X12B 3G6DL 1LO5A 3I2CL 1KJVA 4OV5B 1PD6A 2BFVH 3O0RH 4NO5B 4ODVL 4QHLB 2MSPA 5C09D 1NGWA 1T5WB 4X6CA 3I75B 2LVEA 4XC3L 3SJVB 1ZA3A 1QRNE 5IB1A 1TZIA 2W0PA 3K0WA 4N9GB 5ESAA 1TZHB 5GGRY 3ZKXC 3G5XA 4PBWD 3FONA 3L9RA 4GG6F 3SE9L 5CEYB 1IGTB 2DJ4A 2V2WA 3GSUB 1RFDL 2X2YA 4Y5YC 5AAWA 5TQ2H 1MFEH 3DMMA 3SQBA 3IDIB 4Z7QE 3OKLB 1FFQA 3GHEL 4DN3L 1H5BA 4Q6IC 5EOCJ 2BVUA 3OR7B 1RZKC 1Z3GH 2HT3C 1XCTB 3EGSA 3SDDD 5K9KB 3P4NB 1TJIL 2HFTA 3H7BB 3WXWL 4ZO6A 2VDLH 5C0JB 5DR5H 1AD9B 3TZVB 1QSEE 4HKXA 5IKCB 1I1YB 3OGCB 4JFQA 4UU9A 2EDJA 4P57B 2X4OA 4KKAD 4S1SH 1NEUA 2A77L 5CILH 1ZHKB 1T1XB 5T3XH 4Z7NE 5BMFL 5DHYA 1YUHA 4DGVH 4PLJD 4BKLA 4ZMAT 4MNQD 1BBJB 2IPKA 4WWID 5FHBL 5GSRA 1CDJA 4K3JH 4NCC1 2EIEA 3HB3C 3QULA 5C09B 5L2KA 5T3ZD 3QXVA 4U2YA 2PXYC 3SO5A 5DJ6A 1MWAB 3LKRA 1IGJB 3HMXH 1F3JA 2DLTA 1OGAA 4U1GB 1RSFA 3O3EA 4M03A 2HN7A 5JXED 2A0LC 4F9PA 2YWYA 2ZWLT 5M7QA 3G6DH 3I2CH 5F88A 1Y0LB 1EEZB 3IT8D 5I1JL 1AFVL 2Z31D 2BRQA 4HC1L 4ODVH 1U2HA 4R7NB 4XC3H 2VNCA 4EUPH 1CWVA 2NNAA 3U36B 1FVEA 3HMXA 4HIEA 3FAWA 4HUMB 4GMTH 4Z0XB 5HDQL 2G5BB 3BPCB 3SE9H 3I6KA 4KK6D 2W38A 3I02B 4OGYL 3SDDB 1XR8A 3AS2A 1RFDH 3O3BA 3SGEI 4OFYA 4HIHB 3RY6A 4PTTB 3CUPA 1ZE3C 1WUNT 5I1IL 1XF5B 3WDHA 4EUPA 5I17A 1B88A 3GHEH 1QSZA 4L4JA 1AP2B 4MDIB 5JIKA 4DN3H 2DI9A 5TDOA 3X11B 5FYJL 1FNEB 4MNQB 2AVGA 3KPLB 5JW4R 4LBEA 1TJIH 4H25A 4OUUA 1S9XB 3C60A 3WXWH 3MA9H 5AWNH 3CX5K 1Q9WA 2I5YH 3IXAB 2BVPB 1YNTA 4L3CB 4JFZL 5E00A 5JDSB 2G9HA 4G8IB 3VH8A 4XB8A 3RDTA 1KG0A 2A77H 2VR5A 5BMFH 4EEEA 1LDPL 3TIEA 1P4LA 4Y16C 5FHBH 5HDOA 1DVFA 5FXCH 1N26A 2VLMD 3LKQB 4X7CC 2QL1A 4KJYA 3W0WD 2H26B 3RUGA 3NAAL 2DQGL 3HRZB 3E8UL 3OB8A 3DOSA 4JB9L 4L8CA 5B38A 2NLJB 5KVEL 5D1XD 4NFBA 1GGUA 5I1EL 5MEQB 1HXMA 5I1JH 1AFVH 2EDWA 1ZA6A 2GTZB 3QA3A 4HC1H 2DF3A 2NZ9D 4R0LB 3OXRB 5GRYA 3TPKA 4FTVE 3REVB 3QYCA 3WJJC 4P4KC 2NYYC 2BY3A 4Y5VB 1YNLL 1IAKB 2QQLL 1CCZA 3BP4A 4HGMA 4N90E 5HDQH 1U95B 4XAKE 1PYWB 3GSQA 3WL9B 4DCQB 1WC7B 5HPOA 4QXWA 3SJVE 3MCG1 4EN3D 5B3NA 1BFOB 2HP4A 4U6XB 1VFBA 2XFXB 4N1HB 1NJ9B 5F1OB 4HC1A 3VW3L 5I2IA 5C0EA 5F89B 5I1IH 1CE6B 2FR4B 3QDJA 3HG1A 2VL4A 4TRPL 4XAWL 3QDMD 3KLAB 4EIZC 4E41D 3H9YA 1DN0A 2XWBB 4IDJL 4WO4D 3IDGB 5FYJH 3X3GL 5AYQA 5DJAB 5JMRA 3MO1B 4C83B 4FFEX 4ZO8A 4TNWF 4Y4FC 2VDML 3W0WB 4JFFB 4N8VG 1LEKB 1MFNA 4JFZH 5DQ9B 3DURA 2PO6A 4Z0BL 2XOTA 2WBJC 1LP9F 3K80A 3RIAK 1LDPH 4BUGA 5D1XB 3MLSL 2JJSA 4M7ZC 2CLZB 3SDXB 1HK6A 4OGZA 3HR6A 3E2HA 3U2SA 2HJFA 3LEXB 3WIHL 3DV6A 1A6TA 3NAAH 4OCNC 4CMMB 3DVGA 3O6FC 3GB7B 3C2SA 4X9FA 3E8UH 4RCAA 4U7KA 4PJAA 5C09E 4NBZB 5KVEH 3RWIB 4G6ML 4EN3B 2BNRA 4G5ZL 5IMOA 5C9JB 5I1EH 3IDMA 1NFDE 1R6VA 4HJGB 4BELD 5IUSA 1LK2B 2ITCB 2DICA 5C07E 5INDA 1N6QL 4MVBA 5DJCB 5I76A 1T83A 2QQLH 1H3GA 2FJFB 2EZ0D 4BFEA 1XGUA 3BPOB 3QDMB 1I1RA 1J0KA 2NY0C 3DSNA 5J12C 5LWYL 2YPKA 1TVBA 1I85C 1JWUB 4WO4B 3WFHA 2QSVA 1MJJA 4UQ3A 2DYPD 3T2PA 5FYKL 1RUML 4X4MA 3VW3H 2WUBL 5FO8B 1I7TA 1AO7A 1EEQA 3PWJB 2ZUSA 2M8XA 4TRPH 4XAWH 3SY0B 2MKWA 4IS6B 1CXIA 1N59B 3H3PL 4IDJH 2DD8L 3UJJL 3X3GH 5C0GB 5H37G 2R2HA 2YOCA 2JJWA</