1ZT1A

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
273
Chain Sequence
MGPHSLRYFHTAVSRPGLGKPRFISVGYVDDTQFVRFDSDAENPRYEPRVRWMEQVEPEYWERNTQIAKGNEQIFRVNLRTALRYYNQSAGGSHTFQRMYGCEVGSDWRLLRGYEQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGDAERDRAYLEGTCVEWLRRYLQLGNRTDSPKAHVTRHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
total genus 67
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt1A01
1YNKH 5IJVA 3ZE1F 4L8BB 4QF1B 4JM2D 3O6KL 4U6VH 1M4KA 3FO1A 2MOVA 4NBXB 2AXFA 4ZODA 5D5MF 2F19L 4XWOD 4YC2C 5J0BA 4GKSB 3QDAA 2NXZD 4LVNB 5C2BH 2W92A 4RGNC 5GRZA 4UTAH 2XFXB 1RUKH 3I3EA 2FX8H 1XF2B 3CX5J 2FJGA 2BFVL 5KVDL 2AW2A 4L9LC 3R8QA 2EEBA 2VE6A 4R3SB 3PV6B 3KPSD 1RMFL 4P4KC 4D9QE 2IAMA 5IK3A 3V9FA 4P59L 3DSFL 2E7LC 4RGNE 3O2DH 4FMKA 1CG9B 2BOBB 4GBXD 1U42A 2QR0B 5JW4N 2ZCLH 1GGYA 4QOKA 4YDKL 4ZS6D 3OR7B 3SJVD 2C5DC 3E8UH 1XFPA 1BD2B 4LARL 3UTTB 3U4BH 4DVRH 2Z92B 4I8DA 2E7LE 1JVKA 4DOHE 6FABL 3ARGB 2IAND 1T7XA 5DSCA 2X4OA 5C0RL 1ZLVH 2AVGA 1A1NA 1IT9L 4YFLF 5JHLL 2B1AH 4D0CB 2E9JA 3AGVA 3CVIL 4K7PY 4F57L 3VXSE 1Q94B 2O5XH 1OF2B 3W0WE 3FRPG 1G7HB 3SCMC 1NCDH 1HH6B 5BXFA 3WD5H 4P4RB 4CDHA 3QRGL 2EDXA 2R4RL 4RWYH 3O2VH 4S1DD 3UMTA 5CZVL 2J88H 3QNXA 3WHXB 1EHNA 4KDTA 3FFCE 4WIQA 4YBLB 4HWBL 3WUWA 1A4JA 2GUOA 5CHNB 1MUJA 4BQ9A 4XPGH 4GH7B 1DVFC 4M9OA 4PJHE 4MHHI 3VXRD 5KOMC 1L7TL 4R96A 4F9PC 3LKRA 1F2XK 5D1QC 2DIJA 1SYVA 2YA0A 1ZS8B 4GUPB 1D9KB 1VFBA 4WEMB 4JO2L 2HLFC 3G5YA 1ONQB 4NGHL 1UADC 5F7DB 4PGCB 5F21B 1SYSA 5GS1A 3DX7A 2PNDA 4PJGA 1I1AA 5CEZH 3EYVA 5EC1A 5HPMA 5DURB 4FABH 1FDLL 4G6FD 2EH8H 3AAZA 5I1DA 4EI5D 2ADJA 1I9JL 1WLHA 3QUMA 4K3JL 5DMJB 4EN3B 1AGEB 4P3CH 3GO1L 3TZVB 1H15B 4G3YL 5FYLL 5EZIL 1XF3B 2R2CA 2AV1A 2DQEH 1ZVSA 1WZKA 43C9A 3VG0H 2GEEA 5DA0B 4G42B 2EXYC 2YMXL 5LWYL 5HHVH 3MV9E 4X6DB 4JDZA 1FFNA 3S4SA 1S9VA 3L3KB 5C0EB 3KWWB 5FYJL 3P73A 3PDGA 3EJZD 1RULH 3VXUE 2B5IB 2IPKA 2OR9H 2W9EH 1J05A 1FVEB 3RDTA 1MCNA 3E3QC 4NRYA 4GRMA 3GSVA 1TVHA 2W91A 3BESR 1HIML 3V95A 2IBZX 4X4MA 1F90L 1JI1A 4Y16D 2VDLL 4DGYL 4IRJD 3QIWB 3C2AL 3ECBB 2DM4A 3VXNB 4C58B 2ADIB 4XP4H 3SDAB 4WO4A 1OARH 2EDWA 4HZLA 1AR1C 1SMAA 1Y6KR 2F74B 2ESVB 2EZ0C 2NR6C 1ZHNA 4J4PA 1P5UA 3E6HB 5CEYB 1KENH 4JB9H 5HHOB 4JDVA 3B8SA 1MRDL 2H1PL 4Y4FB 4ZFFA 1H3PL 1JYVA 1N7MH 4ZXBB 4NM8H 1CGVA 1OGAE 3GBLA 1V7NL 1YMME 2GYSA 5E70A 3V7AG 1NMBL 4Z95L 3UZQA 3BJ91 5E1HB 3P0YL 1KBGL 1P7QB 5IB1A 4LEOB 4OFDA 3GMLB 5IEHB 1ZE3C 1TZHB 3BPLC 1WFOA 4H1LB 3TO4C 2VLJD 1CICD 1FL5A 4ZAKC 1WVZA 4KRMB 2QKIB 4NKIH 3TV3L 4JRYD 5FA3B 4L9LA 4M61A 4PBVC 4XMLH 5EBWB 5DJ0B 1GHFL 4NKDB 5HDQL 3BOVA 2EDKA 4NNYB 3BKJL 4P4KA 3DETD 5C08D 3RVTD 5GJTL 2EDYA 4NBZB 3V7MA 4L8DA 5IMLB 2YOCA 1BOGB 4J3VA 2X5PA 4P2OC 2E7LA 4XVSH 3SE3C 2XTJB 4LHUD 5MHSD 1NCBH 1DFBL 1P4LB 2R0KH 5T3XD 5EWIH 3U79A 4JVUA 4PGEA 2D0FA 1YYML 3BP4B 1FO0A 3BO8B 2LTQC 5I8CB 4OGAC 2FNBA 2NY1B 2AXGA 3V5KA 2OTPA 3VXSA 1FFPB 3WSQL 2SEBA 3VJ6B 3W0WA 1FVCA 5JIKA 4L3EB 1GCFA 5LAXA 4YHOL 1A64A 1YDPA 4OCXL 3GMMA 4R4FH 5FAAA 4YHIA 3NN8B 1F8TH 1MCOL 2NY0C 1U8JB 2AJYH 4YXHH 1NGQH 2BK8A 5D7IA 2AK4E 1NBZB 2NPLX 2X4NB 4Z7NE 1OTSC 1LO4H 5D71H 1N4XL 1T1XA 3LB6D 3SCMA 2BHYA 4WFFD 1DBAH 1G7QA 2FJHB 3L3DB 4Y5XB 4PJCB 4KGLA 3QUYB 1ADQH 1QSFA 4KGJA 5A3IC 1KTLA 4HGWB 4S0TD 5IMMB 1HQRA 1KPVB 3JTTA 2YUVA 2MPAH 2XN9B 3HKFA 1FNGB 2BCKA 2HT4C 1V3JA 1DVFA 1U8IB 2GK0B 4KQ4L 4F9PA 3JTSA 5D1QA 4QKXB 32C2A 3DYPA 3ILQC 4WFGE 4FZEH 1EO7A 5DDHA 1P69B 1ZSDB 3N1FC 2X05A 1FNSH 3MNVB 4UT9H 3FT2A 4UINH 5DYOB 4F2MA 5F3BB 1UZ8A 3PF2A 4LP5A 3BJLA 4DFIA 4KKBC 2EC8A 4F8TA 2OZ4L 3LZFL 3MV9A 5L0QC 3AC0A 3F12B 4XNQA 4LCIL 5DRWB 2C7UB 1RUAL 5HHXL 4UTBL 4Q9BA 1J1OH 5GGVL 3VD9A 3HPLB 3PG2A 4NZJA 3Q6GL 2HTKC 2DQDL 5J89A 1VERA 3VXUA 4LSQH 4QHNB 1BVLB 2ICWJ 2NY5C 4XWGH 1C5CH 5J6GA 5FO9A 5E8PB 2V2TB 1LO3H 4LRNL 4M9PA 3V0VB 5TJWK 3O6LL 2UY6A 3GJFA 4X5WB 1NANI 2L7JA 3KJ4B 4N90E 4C56E 4CADB 3ZDYE 1KEML 1P84K 1RHHB 1BIHA 3ARWA 4PFEA 3RGVC 4KTDL 1Q9KB 4MXQD 3KPRE 5CP7A 3SY0A 1U3ZA 3GKZA 2XWJA 3OGCB 4IHOB 2UYLB 3O6MH 4BZ1L 5C3TA 5IIEB 1N5AA 3E3QA 2FEDC 3GSQB 7FABL 5DD1H 1ZGLA 2NY6B 5T1DH 4ZFOB 1Q0XH 5D7JD 3V5DA 2ARJQ 3VWJD 1LDSA 2FGWL 4M6ML 1UM4H 5E08L 1QFWM 4CVZA 4LHJB 1EK3A 3EOTH 1A3QA 3DMMC 1AJ7L 5FHBH 1JHLL 3MRPA 5GRVL 1JZ7A 1N6VA 4YBHA 2CK0H 1UJTA 4CGTA 4XCFH 5HYJE 2GSIA 2NCMA 3FT3A 4TVPH 1GGUA 2EXWC 1K6QL 3TIEA 5T1KA 4HKZB 2MHAB 3OKKA 4DVBB 3U48A 1BQHA 2PXYD 5BVPH 1IKFL 4MMZC 4JVPA 3R06B 3RX8A 5HHME 1J8HE 1JFQL 4S1QH 1MFAH 3RUGF 1FE8L 3OAZH 2GJ6B 1EO5A 4OFYA 2P44B 3DYMA 2Q76B 3TO4A 3I6GA 1RZKC 5EU4B 1A02N 3VFNB 5ALBL 5L7XH 4ZAKA 2VQTA 3AREC 4U6VL 3LN4B 4WWKC 4WEBL 5C09D 2O61A 1YPZF 4ETYA 3UTZB 3O3EB 1NCWL 3MX0A 5FECB 5HDBE 2EYSA 1RUKL 3ZTJG 4XCYA 4Y1AE 5DLML 1RAMA 1MHCA 1S7UB 4G43A 4NRXB 4P2OA 2YN5A 4GAGH 2R1XB 4OZFB 3SE3A 2PCPA 2QADC 4EUPG 5JHDB 3U30C 3IFOA 3CAFA 3Q5YA 4MNQB 4Y5YB 3CSBA 3DJ9A 5E5UB 4ZDHB 3KS0J 3RKDD 1OGTB 3RL2B 2BSTB 5HDOA 4D0DB 3O2DL 3CK0H 3L3IB 4P9MH 5JZ7D 1JWMA 1AGBA 2ZCLL 1R3KA 2XYCA 1G9NC 4KJQD 1RZ7L 2HT2D 2CIIB 3B2UD 3X13B 3E8UL 3L5XH 4C59B 4V2BA 4OZIB 4N9GB 1P6FA 4KU1A 3MGTB 3SE8H 3SDXE 1ZGLM 5J1TC 1HI6A 1O7SA 4NKQB 4PP8C 4PV8A 5ISZD 1NBYA 3O4OB 2G2RA 5EOTB 3ULSB 1RJCA 1QFPA 3ARFC 5KVFH 4L4JA 2DQHH 1E28A 3LKPA 2B1AL 1TZIB 2DKSA 1U92B 3SDDB 2F5AL 1K2DB 3GMPB 4OM1H 2J6EA 3KDMB 3TF7C 1OL0A 2E7MA 4OCSH 3BD4A 2O5XL 4GS7C 3WD5L 4Y5VC 3GHEH 3PE9A 4R0LC 4RWYL 3O2VL 3GZKA 5C0ND 3VMPA 2ARJB 2J88L 3OHXA 2J2ZA 4N0YH 5FM8A 1S3KL 3WKML 4AG4H 3D18B 1T80A 1CICC 3BKMH 4X99A 2ZUXA 3VFWB 5FUZL 4I0PB 5BV7B 5IVZB 3MRGA 3BVNB 1MREH 1A4KB 1NFIB 4ZYKA 3NCJH 1DEEA 2HN7A 3HMXL 1D5MA 4P5KB 4M1CD 1NGYA 1WCQA 1H3WM 2VSDA 4ZPTB 5EU6D 2QSQA 2DIAA 4KAQH 3VI3E 1XR9A 3LQAH 1BBDH 3QNYA 4PJ7F 4GFTB 4C56A 2DB8A 4LVNC 4MA1B 5FYLE 3X12B 3B9VA 4FABL 4YDVA 4IJ3B 1UB6B 1T83C 2YA1A 4OLUH 1NGWB 1NSNH 1P5VA 3KPRA 4N1CA 4XH2B 2F54B 3HC0A 3BDYL 1HQ4A 1K8DB 4MX7B 5D7LE 4P3CL 3WUWG 4C4KO 3WEXB 3ISWA 3MCLH 1IKNC 3MJ7A 1INEH 2VLLA 5TFSL 4ZNEE 4DFHA 4NCDA 4QO1A 5EULV 4NNPH 2H9GA 5FYJE 3RGVA 3VG0L 5FDWA 1AKJB 3FB5B 3MQIA 3QQ3A 4HDIB 4YXLH 4NSKB 1D6VH 4OCRH 4G9DB 3MNZA 3H42H 1HCFX 4JKPH 1S7QA 5C0JB 1M7DA 1GRWA 4APQB 2YSSA 5F7UA 3BP6A 1S9YA 2Q3ZA 2OR9L 1JIBA 2W9EL 3ARGC 3BGMB 4M4RA 5H37G 3EJYC 3RJQB 1F4WH 5C2UB 1DCLA 1RUQL 2AEIT 1LP9E 4HCRH 4I9WD 3ARBD 4WU5A 3FFDB 3DMMA 2O5YH 1UVQB 4TTDD 3RWDB 2IJ0C 1CIUA 1QVOA 4NIKB 1HYRC 4UDTB 4RNRB 3UTTE 2JELL 4HJ0D 5E9DD 2UZIH 1GGCL 3IETA 4J3SA 1MHHA 4MS8C 3L9RA 4GLRI 1YMHA 3IF1B 1OARL 2Z35B 3X3FL 5DVLA 2P5WB 4PPTA 1I8KA 4NCC2 3S4SG 3UBXI 3TPUB 3PWNA 4XPFH 4JRWA 1UXSB 3FAXA 5IHUH 3S35H 2F9BT 2ZPKH 1MCEA 1J87A 3RBGA 1CWVA 4NM8L 2K7PA 5I74C 4Y1AA 4FZ8L 2VLKB 5LG1A 3BYTA 2B20A 4PB0L 3O3AB 1W72A 5SWSB 4XZUB 1LNUA 1GVIA 3MLUH 4WJ5A 5CEZD 3AREA 1ZHLA 5TE4H 3QISA 2P7TB 2NMSA 3SDCB 1R0AL 4WWKA 2WWMD 2VLME 2VNCA 2N7BA 2R0ZH 5J1AA 4YR6B 4NQVB 3ILPA 1HHHA 5HVWA 5KTEH 2KBGA 4NKIL 4O2FB 2GCYA 4YX2L 4XMLL 3IFLL 4OZGE 4QXTA 5BV7L 1ES0A 1T1YB 1T22A 1A9BA 3L6FA 1DDHA 1NEZB 5LGJA 4XVSL 1UXWA 1NCBL 2R0KL 2XKNB 1L7IH 1I7TA 3M17A 5EWIL 3MBEB 1RIHH 3KS0H 4PUBH 4KVNL 3X14A 1WSST 1BFVL 2QJDA 4HWBA 2PYFA 2I24N 2NY2B 1BIIB 2B5IC 2OQJA 5KN5A 3UROR 1OTUC 3DARA 3S34L 4ZNCD 1S7SB 5K9QI 4R4FL 2AJXL 3ARFA 4F7CB 4X6DE 3O3UN 4LFHD 3PWJB 4OQ1A 5F6IC 5JA9A 4YXHL 1NGQL 3BISA 4M8QB 4Z78A 4K3DH 3TF7A 1BVKB 4LCWE 4F33B 1CQKA 5D71L 1UM5L 1FH5H 5BJTA 1FLRL 4RFEB 4I1NB 4Y5VA 4OI7A 4R0LA 5GRJH 4FRWA 4L1DA 3G08A 1DANU 1TXKA 3FB7A 1TPXB 5SWQB 1CICA 3TN0B 1O5DT 3QH3A 5FKPA 4MA3B 5JW5B 4ZXBC 1S5IL 2C1OB 3T3PF 3WO4B 2XNAB 4K71C 5F7MC 4FZEL 2L7UA 3QEUB 3MRHA 3U4AA 2ESVE 1OAUL 3IDMA 5D7LA 3D3VD 4WFEE 1QHOA 4UINL 1JE6A 1JK8A 5HHOE 3HLAB 3TNNA 2IFFH 4O5LH 1J5OH 3V6ZA 4JEGB 4LHUA 3BD3A 2PW1A 3S88H 4ZNEA 5JQ6H 4B50A 4Z7OE 1YEHH 1X5LA 1XF2A 3RKDC 1T83A 4PJAE 1KLGB 2XI9A 5M95B 2YC1A 1BBJA 2J4WH 4R3SA 1J1OL 1TLKA 4XMPL 5KVMC 5KW9H 5L2KD 4QT5B 3CFKA 4PRHD 1IKNA 1MF2H 4MLIA 1FJ1B 1ZV5A 1H8SA 3O3DB 2JE8A 2WNGA 4Z0BL 3LQZB 3EO1B 1NAMB 4KK9D 2H2PC 1LP9A 2ZG1A 4LGPB 4PJEB 1SQ2N 4M00A 2BVUA 2NY1C 3PJSB 3UTTA 2VITA 3NCCB 4YLQT 4EDWH 2Z92A 5DD5L 3HE6B 3BGFC 4RAUA 2XTJE 4NZDA 3QCTH 3GBML 3O6ML 1AFVL 4H8WC 1JPST 4NOFA 5DD1L 2BP3A 3CH8A 3GUTB 1EH9A 2P24A 4Q9QL 2BRQA 2HJLA 3INUH 5CJXC 3W2DL 3QO0B 1HH6A 4Q0XH 1NDGA 1CDYA 2UUDH 1MOEA 3OKMB 4MS8A 3DVGB 5GJSL 3RTQB 3V79C 3OTTA 4L4VA 3EYUH 1EJ6A 4E0RA 2NXYB 3QCVL 5J1SC 1G7JB 2PTTA 5C0AD 1LK2B 4XCFL 3ZKMD 4TVPL 2ILLA 4Q9RL 4ALAH 4PJCE 4P2RD 3MLRH 4ZS7L 4U1GC 5BVPL 5HHQB 2AK1H 4L3AA 4Y89A 5EC2A 4OCWH 4S1QL 2EDDA 4JM2B 1ONQA 1UWXK 4OZGA 5JPNB 5F7DA 1HWGB 4PGCA 5EN2B 2A0LC 3L7EB 2NXZB 4IRSD 4P49A 3FTGA 5L7XL 2OBGA 1YEIL 4HG4K 5E8DH 3REWB 2FB4H 4ZUVB 5DRXB 1J12A 1KLUA 5GS0H 4XNYH 3KPSB 2VOTA 2FBOJ 4LLWB 5SX4H 2A6JA 2JK5B 1MJJA 4QWWD 3HE7B 3RPKA 4PGJA 4GBXB 2H6PB 2I07B 2YBRA 4G42A 1BQHG 3HG1E 4M1DL 4X6DA 4P46D 2OTUA 4YFDB 4L3CA 1LE5A 4H20H 1IEBB 4ODHH 4OZHF 1ZLUK 1KB9J 4LCWA 3SGDI 3L3KA 1ZT1A 3KWWA 2EE3A 4J3TA 3ARBC 5HI3D 3BPOC 4ZTPH 3SGJC 3GI8L 1QFUL 4FQPA 2IANB 5J11C 3MJ8A 3VWKC 3L5XL 2V6HA 1DQJB 3SE8L 2FX9H 3QPQD 1ZTXH 2NY6C 4G6AC 5IFJB 4DCQB 3BEVA 4JFEE 2V5TA 1XGYL 2DM2A 3ECBA 3I2CL 4GG6F 2IBGA 4IRZH 2DQHL 1NAML 4KWUA 1QYGL 3NFPA 4DZ8B 1MJ7H 4JRXE 2JKXA 4XXCC 1MELA 2ESVA 3HUJB 4IS6A 4OCSL 4JPKH 2P5ED 5A2JH 2JIXD 2FATL 3GHEL 3UBXB 3IXAB 2B2XH 2OR8A 3VXRB 4ZXBA 2EDTA 5MP6H 1KUMA 2C26A 5I0ZA 5C09A 4N0YL 3CX2A 1WBXA 1ZA3B 3FRUB 3HI6H 4PJIF 5F70A 4PJAA 4AG4L 5TE6L 4HMEA 2HYMA 2JJWA 1VPOH 1TCRB 1P7QA 2IG2L 2R2BA 3VCLA 3Q0HA 1UEYA 3MYJB 5IEHA 2XXCB 1MREL 3VDAA 4QHUA 2W60A 4H1LA 1ZT7B 2CO6B 5K9JL 4N5EC 4NT6A 2R2EA 1RK0B 5CD3B 4G6FB 3GSXA 4YFEA 3T65B 4KAQL 4EI5B 3LQAL 3C60C 4QTIL 2GJ6E 1I8IA 1FNLA 2BJMH 4F80A 3EYOA 2P8MA 1SEBB 2BHUA 3NZHH 5IG7A 1BOGA 4OLUL 5BS0D 1NSNL 3H7BB 3O8XD 4L5FL 5A43C 4Y19D 4LSTL 3MV11 4FMFA 2BY0A 2P49B 2BMKA 3UPAA 4ODWA 4Y4HD 5IT2H 3MCLL 4U2ZA 5FUOH 5L9DH 1YUHB 3GSUB 4NNPL 5K9OB 3EYFB 4HX1B 1DQTA 1S9XB 2F5BH 3OZ9L 2X1QA 4OCNC 3MA9H 4FFVC 3VE0B 1S9WA 4YXLL 4N8VG 1D6VL 3PWPE 3RJDA 1OOAA 5FK9A 4NO3B 2A6KB 2YRZA 3H42L 3NN8A 4H26B 2J8OA 4JKPL 1MEXL 4OQTH 3CJJA 1NBZA 3MGOA 2X4NA 3L3GB 4Y16B 1D6EA 3DX6A 4EXKA 5CJXA 1PAMA 2A74A 1XF4B 4I3RH 2DLEA 2FJHA 1F4WL 1I4FA 3F7VA 1U91B 1MRFH 1S9KC 1FG2B 4HCRL 2X44D 4HWEH 1VACB 1NLDL 1A6VL 2Q20A 3C5ZC 3P4NB 1KN2H 3RZWA 5HY9B 3LIZH 5B3JE 1U8IA 5D2LF 4XHJD 4NNXB 4KJYB 3KVQA 4XVUD 3FB6B 4XPFL 1IAOB 2ZCKH 3U6RA 5IHUL 2XZCH 3OXRB 3GI9L 1U8NA 1JF1A 4PP1D 1TJGH 4EI6A 2VLJB 4X5XA 3SPVA 2QQQA 3O2DA 4J1UB 4QHKJ 4YPJA 4EQ2A 1GOFA 3HG1A 1EZVX 4JRYB 2BNRD 2JF1A 4HH9B 1FZJB 3BXNB 5ACMA 5DRWA 5DJZB 5JPMA 5E0QA 5DUML 1JP5A 1YYLH 3HPLA 5LGHH 4MJID 5C08B 5CFHA 3R1GL 1U41A 3IXTB 3B9KD 3PQYD 5KTEL 4M1GH 3RVXD 4XXDB 3IB4A 2PR4L 3IGAB 5E8PA 2V2TA 2Y6SD 3QPXH 5IB3A 1FFQA 2GFBB 3PP4H 3BUTA 2FIKA 4ENED 4PJXF 2VDML 4O51B 4WY7L 3HZYB 4FTVB 2NY4B 4JFEA 1U93B 1LK3L 1RHHA 3VXMD 5GXBB 1DBBH 2NTSP 1Q9KA 3ARBA 3RZCC 4LSSH 3K4AA 3SGJA 5I1IL 1TITA 1XCTB 4IHOA 1RIHL 1WC7A 4HWNA 4M5YH 5IIEA 4HAGA 5E9DA 3VWKA 4JRXA 5DJ6B 4M6AA 1VEMA 5F9JA 2XZQH 3CFJB 4APQC 3CXHJ 3DTXA 3MRKB 4LSDA 5BVJB 4MZ3A 2EIZB 4PP2A 4FFZH 1U8HB 3F7QA 1EJOL 1OAYH 1RK1B 4KZEH 1H5BC 3IJHB 3T0BA 3T0EB 3ARVA 4YBQC 3GMNB 4XXCA 3S96B 5E4IA 4JFHD 1QR1B 2EE2A 1NC2A 4R26H 4JZNA 3MRDB 5IF0B 1I7RB 5GRJL 4WUKH 3CFDA 4I5BA 1FGNH 1V8HA 3HZVA 5DZNA 4IM8A 3VFVB 2ICES 4LASH 5FOJA 3VFTA 3MRMB 2ORBH 1J0JA 1U6AH 4PD4K 4FQLH 4N5EA 1CXEA 4NQUA 1C7TA 5J6HA 3B9DA 2P5WE 5D93B 3ROOA 1S7RA 3TPUE 4XBPB 1MCHA 3OSKA 5IMKB 1KGCE 1Z9MA 1AHWB 4NWUH 3S37L 3C60A 1KB5H 3C6LC 3BQUC 5JQ6L 2A6IB 4LGRB 1ZOXA 2VLKE 5JW3H 4NRXA 5GHWL 1RV6X 3PWPA 4NZTH 3MRNA 3WS6C 2DLTA 1MCPH 5F6HI 5T33L 1FPTL 2IBBA 2P8LB 5GIRB 4ZDHA 3LDBB 3K2MC 3O4LD 3BP5A 4BUGA 5MENE 4WW1A 1ACYL 4GKNB 1NKOA 5I1EH 1H9VA 4QTHB 1YN6B 3MBEC 3A6CH 4HPYH 3X13A 3VFRB 5IOPA 4N68A 1KIQA 3MGTA 1RSFA 2NY2C 4LHUG 2D4FA 2Z4QB 2QQNL 4HKBB 3SO3C 4EDWL 1WAAE 3NIDF 5D7JB 1FAIL 3W9EA 3VWJB 3DNKA 2XV6B 3H9HA 2V7NA 2YPKB 5T3XL 5DK3A 4WCYL 5FEBA 1U92A 3GMPA 2CLVA 4Z7UB 1KOAA 2BSSB 4QCIB 3C8DA 4EEEA 1MRCH 2F58H 3C5ZA 1YPZE 2ID5A 1NJ9B 5CGYC 4B53A 4TVPE 1GL4B 1WCBB 3ROLB 4JG0H 4MJ6A 3CVHH 1GPOH 4XPHL 4QRUA 2PXYB 2BRRH 4DZBB 2R2HB 1Z6JT 1EO8H 2AAVA 1RJYB 3C8KA 2YD2A 2Y9RT 3D87B 5DFTA 3G6JB 4FQHB 1U8MB 1A4KA 1U58B 1OHQA 1X3DA 3K80A 3MLRL 1O7VA 5CLTA 2AK1L 5INCB 2BNQB 4OCWL 2YKLL 3IDNB 3DO7B 4JFYA 5JW4M 1GZPA 1KNOB 4EBQH 4NUGH 4GAYB 1T6VN 2EDBA 3FMGH 4RCAA 1QLFA 4JM4H 1M7IA 4GJTB 3LRHA 4J3WA 5EZJB 3LD8C 5BOPA 2CPCA 3GKWH 4PGBB 3CUPB 1J0ZA 5E8DL 1NAKH 2FB4L 4F3FA 2IPUG 2HT3C 2XICA 3H9SE 4MX7A 1AY1L 1KJ3H 3IDUA 5CJOH 3WEXA 4X80L 3X11B 3MXWL 2D9QB 5KVEH 2APFA 4W6XB 3TH4T 1UH3A 3VXOA 3BEWB 4RGOH 4AMKH 3DI3B 4LAJH 5I0DA 2VXSL 1IGCH 4WHYH 3PWUB 2HFFA 3RZCA 5BW7C 3BWAA 2WBJD 4IDLA 2AKRB 5BZDB 1ADQA 2PUQT 4H20L 3VFMB 4U1NA 4PGZA 4ZO6A 2CXGA 5ANMB 4H5SA 4APQA 4HKJA 5ISZB 3BZEB 4NQEE 2ADGB 2LU7A 5T5FH 1FVDB 2NX5D 4ZUUA 1KJ2H 1HZHH 1H5BA 1T2QH 1KJMB 4PY7A 2ICCA 2DLIA 1PD6A 4OF6A 2HJFA 2FHBA 4RBPH 1UVQA 4FQIL 5DJXB 3WNNA 3FQXB 4K94L 4UDTA 4P2RA 4PV9A 3L1OH 4DUWA 4PJ7E 1UT9A 1NMCC 1JL8A 2NTFA 4N0FB 1J88A 3UAJD 3LKQA 4OTXL 3I85A 3KGRA 1MJ7L 2P5WA 2VDOL 2X41A 5B22A 3H3BC 3LQAC 4JPKL 4IRSA 1BM3H 3PL6D 4OF3A 5FM4A 2B2XL 1QPXA 5MP6L 3D5OF 5E2WH 5ALCH 5FKAB 4XC3L 2VAAB 4LLUB 2Y5EA 1HKLL 4HJGB 4MSWA 3JV5A 1VPOL 4XZUA 3IVKB 1Z3GH 4UILH 4HHAA 2HG5B 3U46A 4JR9L 2ICEB 1G9ML 2Y36H 1ED3B 4TSCH 3C6LA 1T0MB 5MENA 4HF5H 3BQUA 4S1SL 5C7XL 1BECA 3KLAB 1QNZH 4M6OH 5IW6A 5KSBB 5FA4B 3NAAH 4DN3H 5KG9A 1VEPA 5GGRB 3WS6A 5I71C 4HIEA 2VXVL 5C0BD 5HD8C 3NPSB 1WAAA 3HE7C 4FQQA 2W65A 4YGVB 1RZJH 2BVTA 2AJSH 4LNRB 3ARUA 3T1FA 1FP5A 3D25A 5KVGH 3MBEA 1DQQA 2QEJA 5FUOL 4H1LG 4O00A 4BQBA 1Y18B 4G7VH 4NQCD 5E2VH 3MA9L 1YPZA 4LMQE 1NBVH 3EO9L 1S7SA 3FO9B 3B43A 4G9FE 5HGHA 1RUPL 3IDYB 4PTTB 3PWJA 4HK3J 4M6NH 4F7TB 1JGDA 4OQTL 5DHYB 4F8QA 5EU7C 4PRID 3GK8L 1TNMA 4R4BB 4MJ4A 1BVKA 3EDKA 4F33A 4XX1E 4ZQKB 5GISL 2VSCA 4G8GA 5D9SA 3KXFB 1SM3L 4MQ7A 2BVQA 3QIBC 1IAII 4NC1E 4MA8H 3RI5F 4HWEL 1HHGB 4LVHB 4WHTB 1CE1H 3MJ9L 5EU7E 3S3JA 1BF2A 4BQ8A 2P8PA 3AB0B 4XMKH 1YECL 5HYEA 4ODBD 4ZUSB 1G7PA 4QRTA 2ZUQB 2KZWA 1T03H 1MAMH 2R9HC 3H9SA 1S7XB 1P6AB 5F96H 4RRPA 2F15A 1U95A 5AYQA 1I3RB 4DJMA 1XF1A 2MQ0A 3FT4B 4K7FA 3U1SH 4RFNC 5JXAH 2AI0H 1BAFH 5LGHL 5E2TH 2BVPA 3NTCH 3WNOA 3C09B 2BVEA 3OX8B 5J4MA 1FJ1A 4NQEA 4M1GL 5SWZD 1IBGH 3P2TA 1KCVH 1P2CB 5C0IB 4UBDC 5MEPB 3PP4L 5BW7A 1BZ7A 3MLSH 4W6WB 3EO1A 3RWEA 2G60H 2YXMA 3WLBA 3MV8A 1A3RH 3DV4A 4PJ7A 4LSSL 4JLRB 4NC0B 5DRNB 5E1AA 1LEKB 4O2CB 1N64H 4ACPA 2PW2A 5KZCD 3GMQB 5ESQA 4KVCH 1S8DB 4FFZL 1DN0A 4LLYA 2VL5B 4KZEL 3PGFL 5GGTH 3OKMA 4FHBD 1AGFB 1IC7H 5FDYA 4HFWA 5FXCH 4GMTH 4K2UH 1G7JA 3W11C 2F8VA 3GRWH 3TA3B 5I1LB 1N59B 5I9QB 1B0GB 3IJYA 3EFFB 1U36A 4WUKL 5SX5H 2BNRA 4LSRH 2YUWA 5TDOB 3VFOB 5DEGB 3QHFL 1FN4B 1DLFL 3BIAX 5HGAB 2D31A 4XPBH 3D3VB 5JPNA 1NGXA 8FABA 3EKCA 4LASL 2EEAA 4WNQA 4LLQB 1U6AL 3QXVA 2ICWA 4KV5E 1JPSH 4JY5H 2JJTA 1X6NA 4XVJH 1CGXA 1S7WA 4BFEA 5IQ7H 4WU7B 2QV2A 3FO2B 3BPCA 4NWUL 1QFHA 3IFPA 5D72H 2Z8SA 1GOGA 1MCRA 1TDQA 5FHAH 3MRFB 1U2HA 1KB5L 4MNGE 2I5YH 3AS2A 3CU7A 2H41A 3C5SA 5GS2H 4EQ3A 5JOFB 2VLJE 2VERN 4O58H 4PRHB 5D1ZD 1MCBA 5JW3L 1MIEL 3OKEA 3HE7A 1CQYA 1JMXA 4MMXC 3LKOA 4FQXD 5FB8B 3IKCA 4G9FA 1QG3A 2CR6A 1JHTA 5AZEL 3MRJA 1HEZA 4HCRA 4LEXL 3MNWA 4NHCH 2DQIL 3BDXA 2DI8A 4JQIH 2NY4C 5I1EL 1OB1A 4G7YL 4P5TD 4JN2B 3MCKB 4OLWH 2GJJA 3QSKB 2AV7A 1XZ0A 4NPYA 3BPNB 2KL6A 4HPYL 4LHQB 1DBJH 4UMGA 5JORA 4MDIB 5JIPA 3QG7H 3BN9D 3QA3B 2VUYA 4FTVE 4LPYA 1IGFH 3FB8A 5BQ7B 2NY3D 2EIEA 3F7PC 4KJWD 5FO7A 3N1MC 2H32H 4R97B 4P2YA 1C12A 3QIBA 3WNPA 4IOIA 4POZD 3T0EC 3JWOL 4EXPX 1CE6B 1NFDB 1LDPH 3AROA 3K3QA 1MRCL 1NEUA 3TYFB 4NQSA 1UQSB 3ULUF 2WLZA 2G75A 4YHKL 2XA8H 2B39A 1A0QL 4WI8A 3CVHL 3T0EE 1I1YB 1I1FA 2BRRL 4JHAH 3CFEA 5EOCH 1M71A 5GS0C 2XWBB 3MV7D 4MJ2A 5FGRA 1P1ZA 4HGMA 1EO8L 4OFKA 4IIQC 3EOAB 2B4CH 2WM0A 1VKXB 3GGWB 5GPRA 3O9WD 1ZT7A 4LLMB 5FYKH 1JWSB 1EEQA 3WYRA 5D93C 3LN5B 3T65A 1MCSA 1N3NA 4J6RH 1AO7D 1AHWC 3D9AH 4EBQL 1OAKL 3G5VB 4NUGL 4K7PX 5DJAB 5C0FA 4JM4L 2IWGA 2FBJL 3EGSB 4R2GB 1T7YA 4ZSOE 1UACL 2PTVA 2Y7QB 4CW1B 1NAKL 4AEIH 4XPTL 1KJ3L 4Q7DA 1HXYB 2OI9C 5GGQH 4HUXA 1PLGL 3DO3A 3SKNB 3LDBC 2W0FB 1CFQB 1XGQA 5E8EA 4RGOL 1YUHA 3KR3H 5LVEA 1S9XA 3JV6B 2C4FT 2YA2A 3Q3GB 4JY6B 4PRPD 3EO0A 1ORSB 5CD5D 5FUCC 1F4AA 1QQDA 3QJHB 3AM8C 1E4JA 4NO3A 3B2VL 4PJIE 2Z31B 4LCYA 3GDBA 4G6ML 1GC1H 3DI2B 1EHXA 3RU8H 5LCVH 1HHJB 4RISH 4JCMA 4KUZH 4P99A 5M7QA 4UB0H 4X6CB 4JKKA 1LD9B 3KPMB 5T5FL 3ZDXF 2VDQL 1YJDH 1SBSH 4X7SL 2X2YA 4JZOB 5FUCE 1F11B 1ZLWK 2HFTA 1R6VA 1E4WH 4FQJH 1QSZA 3L1OL 1QA9A 3D6GA 3TBSA 2P5EB 3F5WB 3CMGA 2EYRB 1J7VR 2JIXB 1EX0A 1OP5K 3DX9B 4XAKE 5TDNA 4CMHB 3QXAB 4OD2B 1L0XA 3TWCL 1LVEA 1J0KA 4HK0B 4PREA 1BM3L 4Z7UE 3QDMB 4MNGA 1ZVYA 5CZKA 1UYWH 5J56B 4BKLB 1MCFA 2FJFA 3NOIA 3MBXH 2X4UA 1IGYA 4LSUL 4J1UA 3RKPA 1TQBC 2KQNA 1TZGH 4X98B 5DR5L 1NUNB 3T2OA 1Z3GL 3U0WH 2OK0H 3F58H 2EIBA 5DJ2B 1RJLB 3GIVA 2EDJA 3WIHL 2Y36L 4A6YH 5LBSH 3KYOB 5IB2A 1ZLVK 3HN3A 4W4NA 3G04A 3OBAA 3P9LA 4Z7VB 4Y2DC 1I8LC 3BHBB 4KI5F 1NGPH 3NFNB 2BNQE 1QNZL 3MR9B 4M6OL 3PABA 1GGBH 3WXVH 1RPQA 4JPIB 4Y19B 2GFBA 5IEKB 1O0VA 4ZUWA 1T04B 3VRIA 1MH5B 4KPHL 4FTVA 5E6ID 5L8KB 3FQWA 1U93A 3IJSB 3CLEL 4ORZC 3OAYH 3MXVL 3ZYIA 4M62H 2N56A 5KVGL 2FD6H 2HTLD 3SKMB 3B9EA 4PIRF 3VFPA 1OTTC 3FHQA 3LS4L 3HCVB 4G7VL 5E2VL 2E7BA 3TJHC 5BVJA 4PJGF 5HPOA 2EIZA 3H9YA 3QT2A 15C8H 2FEEL 3RWHB 3LH2L 3MODH 4YIQA 3IRPX 1MHEA 4IEFB 3T0EA 3F7RA 4M6NL 3WUZA 4WUUB 4BSWB 3HFMH 3DBXB 4CUCA 3RWIB 1H8OA 5L6YL 3O6FC 4OZHA 5KSVA 5I1CL 4XB7A 1I7RA 4MA8L 2VLRD 2O26U 5EBMA 4ZO8A 2VXQH 5K93A 2FGZA 4GOSA 1JJUA 4UOJA 5CILL 2NZIA 1CE1L 1UCBH 1VGKA 4HJJH 5HHPB 5IBUB 5JOPE 4IIQA 2AXHA 4ZSOA 3MRMA 4X0KB 2ZSVA 3QI9D 4Y4KD 1ULVA 2AJZA 3V2AR 1CFTB 1MAML 2VDPH 4GG6A 4XVTL 5D1ZC 5F96L 1AHWA 3WJJC 5MI0B 5JXED 5ID1B 5DQ9B 2I9TA 4OT1H 4MDJA 1CDIA 2VTFA 4XRCB 4MJIB 5I6XC 4GQ9H 4QNPE 4DKEL 4I13B 3B9KB 2J5LC 3TBTA 2YPVH 4YDLB 2D0GA 1MI5E 4ZUTB 3G6DH 3U9PH 5DGQA 5JXAL 2AI0L 3SGEI 1NC4B 1BAFL 2APWA 4PJIA 1HDMB 4KDWA 1V3KA 5E2TL 3NTCL 2OI9A 5GIRA 4OD3H 4M3KB 3S36H 1NMAH 1IGIH 4U1JB 4JPVH 4AM0B 3VXMB 4B7IA 1IBGL 1KCVL 4K8RH 3UTQB 4QTHA 2H32B 5F89B 1EPFA 5KSBE 1YN6A 1T20B 4OUUB 3T2NL 2NW2A 3AY4C 3AM8A 4RRPG 4F58H 2G60L 3QEQB 2D0HA 3MOQA 4AEEA 5MERB 4U05A 2D7QA 2YD5A 2KKQA 2IH3B 4JFZH 1PG7L 3CCHA 3QG6B 1ORQA 3LKSA 5F1NB 4XP1H 2ZSWA 2DI9A 3PV7A 1N64L 5DT1H 4KK8D 4R4NC 1YY8A 1XMWA 4HWUA 1F3DJ 3C9NA 1AI1L 2BSSA 4QCIA 5CCKL 1U8KA 3FZUC 1IGML 4UIKL 4PRDB 5C3LD 3KYNB 1IM9B 4LF3A 4PLKC 3TC9A 2X4TB 3ROLA 4JE4B 4GRWB 5J3HD 3EAKA 1IC7L 4KK5C 4GMTL 5ICYB 4K2UL 4DZBA 3CX5K 1OPGH 3RNQA 1TQCC 5H35A 3GRWL 4PJ9D 1OAZH 4H25B 4PJBF 3H3PH 2CIKA 4U0RB 4FA8A 2R69H 1NCNA 1U8LB 3OJDA 3KXFE 1P4IH 4ISVB 3CSGA 4KH2A 2A1WH 3LSOB 4I3GA 4E5XB 2GY5A 3FQUB 3J8F7 3SE4C 3VXPA 3HS0A 3UCRA 2BNQA 3GIZH 3UJIH 1TVBA 3HTLX 3HZKA 4QHMB 5E94A 1L6XA 5DMGC 5SWZA 2VR4A 1KPUB 1OSZA 1G0DA 4KMTH 3THMH 4ELMB 3SKOA 2X09A 4RIRB 1JPSL 1KXQE 4PJHF 3PGCA 3ALWA 3NIDE 4XVJL 5E5MB 3GNMH 4EDXA 4PGBA 4Y2DA 1I8LA 1F3RB 1HOCB 2OL3H 1HH9A 4X8JA 2P1YA 1A2YB 5D72L 2ZOLB 3P77B 1H0DA 2I5YL 4HEME 1JRHH 4D9LH 5EU5B 4OQTA 4Q2ZB 1MWAB 3BP7B 3C09C 3D85A 3EZJB 1FYTB 3VGAB 1Z0NA 3TVMD 1A22B 4C57C 2FSEA 3P0VH 1KXTB 5GRXG 4D3CH 3PWUA 4JZJB 2G9HB 5I66B 1DQDH 1QACA 2MKLC 1NDMA 3BZFB 1QO3A 4NHCL 3WE6B 4JQIL 4J8RB 3D2UD 1FIGH 4DKFH 2YUZA 2NW3A 1A7RH 3RL1B 4OFVA 2CJUH 3TJHA 5DJ8A 1TVDA 4RX4A 2DTSA 5JLZB 4YHNA 4YWGL 3UPCA 3TBVA 4BM7A 5BOZG 3TBWA 43CAB 1DBJL 2E6JA 1R3LB 4UOW1 1NGZB 1IGFL 2E5EA 1XGRB 1QP1A 4L29B 4S11A 4K9EL 4HC1H 3T0VA 1FZMA 1L6ZA 4PJXA 3O6FA 4NM4L 3WLWD 1D7FA 4JHWL 4M7KL 1SHMA 3MSPA 3RWGA 5SV4A 4LKCA 4TPRL 5EIVA 5M94B 1B90A 5GSRA 3CFCH 1T1ZB 3CDYA 2GT9B 4S0SD 3O11B 4KROD 3QDJD 2NYYD 4XX1G 4DAGH 4FXKB 3D39D 4PB9H 5IVXB 1CL7H 5EIQA 2P47B 3HPJA 4LLUA 3O0RH 4WHCA 3IDIA 1INQA 5EOCL 4LVOC 5H2BB 4X7DC 1MI5A 2A6DB 4E41E 1YEGL 5D1ZA 3HR5B 3QFDA 2HG5A 4X6EA 3WJJA 2CO7B 2B4CL 3O3BA 1RZ8B 1ED3A 1JZ8A 3GEWB 4NO0D 4QRSA 4AEHH 5FYKL 2VABA 1FORH 3ARYA 4PJDB 3S35X 3C2SA 3ETBF 3RY5A 4BQ6A 4XBGB 5FA4A 2JB6A 1KG0B 1QRND 1ZGLP 3DXAD 3I6LD 5GRUH 3U7YH 2OS7A 4PY8J 4U6TA 3HI1A 2FH6A 4NZUH 2I26N 1HHIA 5ADOL 1RJZA 5B38B 3UP1A 4W70A 2Z8WC 4B5EA 3P4MA 1A47A 1DL7L 1JV5B 1ND0A 3DRQB 4X9BA 2WBJB 3RY4A 5B39B 5ELIA 2Z91A 3N06B 3AY4A 4PLJC 3ULUD 4XT1C 2OP4H 1OQXA 1S78D 4CU6A 3GBNH 1Y18A 3F7YB 5F7WC 3RBSA 2HWZH 1A9EA 2J12B 3QNZA 4R8WH 1KT2B 5C86A 5FO8A 5I19L 4PTTA 4RQQB 2HJKB 3T1WA 1GC1L 4GXUN 2AEPH 3RU8L 1MWAL 1Q9WB 3BH9B 1T2XA 4ZTOH 2H26A 3NGBB 1FAKT 1ZHKB 4KTEH 4UB0L 3U36B 5KSAB 3ULVH 4ZQKA 5I8KH 4LCCB 1R3HA 4LKXA 1W0VA 2Y1VA 3KXFA 3GSWB 1SBSL 4ZFGH 5HVHB 4JHZA 1EUUA 3RWCB 3KNBB 1D5BB 3BKYH 3DROA 5CINH 2HKFH 1F3DH 4FQJL 2F53E 3EYQC 4WI6A 1EAPA 4E42B 4WHTA 5DTFA 1KB5A 3PL6B 4M93B 1RZFH 3I50H 2B7DT 3QIUB 5C6TH 4CU7A 5JXEC 2H45A 3QFJB 3REVB 3SE4A 3MLWL 2VXUH 3CFIC 4P23B 3WDJA 3KYAA 3ULVF 3S6CA 3QEGH 3PUCA 3KG5A 4NJ9L 4KXZH 4XNMA 1EFQA 1I3RA 2RB8A 3MBXL 3FOMA 4JFDE 5EOQH 5DD3L 5GGUA 5IM7A 5T3ZD 3TIDB 1EEUA 3J7HA 2MTPA 2QQLL 1TZGL 1RZJC 2PYEB 2DQFB 2R4SL 2VZ1A 4QXGH 1CLZL 5CBAA 2C9AA 1X5YA 1FFOA 1VFAB 2HFGL 2FR4B 3OF6A 4KK6C 3CDGB 1RZIB 5LBSL 3PDDA 1TENA 5C0BB 5AYUH 1HE7A 1R3IH 4U1MA 1WIUA 2KQMA 1NGPL 5F1OB 4MLSA 2BERA 5C0IA 3T04D 2OJEA 5CWSA 1BX2A 2IAMD 5EG6C 1R5IA 4Y2OA 2I9LA 1X5JA 4ZO7A 4YGAB 4N8PA 3BRDA 4QOKD 1Q0YH 2EKSB 1YY9D 4JY4B 4NQCB 5HYFA 1UKSA 4M62L 2X4SB 3BUYA 1LEKA 2Z31C 3KYMB 4NKOB 3CVHA 3GSRA 1DE4A 2P45B 4O2CA 5ABDE 2W9DH 3MRBB 1AC0A 2V5SA 3S5LB 4BH8B 2QQKL 4PRIB 4I77H 3GMQA 1LILA 2HRPH 2VQ1A 4KJPC 4HBCH 3ZDYF 1S8DA 4YO0B 3MODL 1CZ8L 3M8OH 1MVUA 1T21B 3WV0A 1G7MA 3X3GH 1PFCA 4ODTH 5JUEL 1HYSC 1GGCH 4E41A 5DMKA 5HVFB 5T1MB 4XGZB 2ERJB 2DWDA 3CFBB 1B0GA 4HUVB 1MQ8A 3EFFA 2V2XA 4CMHC 2F19H 5TDOA 5HHNB 5EPMA 2VXQL 2V7HA 1FN4A 1R24A 3ZYZA 2H3NB 3LV3A 1UCBL 4HJJL 1CLOH 1J1PH 4AIOA 4LBEB 2BFVH 4J3XA 2YN3A 4OGYH 2ATKB 5KVDH 2XIDA 5D96B 5EA0H 1AIFB 1JPGB 3K81A 1IVLA 4QHKI 3VD5A 1BZQK 1F00I 5HGBA 2VDPL 4OGXH 4WW2F 3DSFH 5E2UH 3L3HB 2IADB 2ZZUT 1MQKH 3SBWC 3S98A 3QDME 1N2RB 2MQCA 2PF6A 1I1AD 2ED7A 2FWOA 4OT1L 2ZCHH 4O9HL 4R7NA 1PKQE 2EDHA 5ESAA 1Z9SA 1MLCB 2YPVL 3KPQB 4LARH 3U2SB 2WIIA 3U9PL 1KJ2A 1I3GL 3MRQA 2J8UF 2F8OA 4QGYA 4WDIB 1P7KA 1HXMB 2Y25A 3RPIA 4Z7WB 5C0RH 1T7VA 1LEIB 1XCQB 5MEQA 1IT9H 5ICXA 2CXKA 2WWKT 4WTXA 2YEZA 4BK4A 4Z77B 5JHLH 5KBNC 3ME0A 4JN2A 4K8RL 1T5XB 2R1YA 4F57H 4XCNB 1DLHB 1QLRB 1C5DB 3V5HA 2RHEA 4TNWK 3QEHB 1S7VA 2A77L 3IYLW 5FYJU 2R4RH 5F1IB 1C16A 1ZA6A 2F53A 4ONHB 5CIPH 5KZCB 2CLRA 5JDSA 3RDTD 5HXMA 4QRRD 2J1KA 3CPLB 3LKNA 4HS3A 4G5ZL 3LN9A 5IVNA 1XEDA 2WK2A 1LO5A 4U1HB 5DUBA 3T4AB 3LPWA 1IM3A 2C3GA 3SDXF 1F4HA 1ZLSL 1QSEA 2CDGB 4P57A 4JO2H 3TYFA 3FQNB 4WO4D 4Z76A 3T8XB 4JFDA 2E9IA 8CGTA 5GZOD 1IMHC 4J4PD 5JXEA 5IV2B 5E00A 4WUUE 1N6UA 1IGTB 2XQBL 1OPGL 5DO2D 1FDLH 1D5XB 4FFWC 2K3TA 5DJYB 3A67L 1I9JH 3GGWA 2R69L 3FKUS 4LLMA 1JTTA 3D1MC 4G3YH 1DUYB 5EZIH 2W0PA 3GIZL 2OMBA 1OM3H 1AD9A 3G5VA 3MGAA 4D9QD 5IW1B 1Z5LB 4O4YH 3DUUB 3Q5TA 5CEXA 4U1SB 5LWYH 4RGND 3BWUC 1FBIL 1FL6B 5HYQB 5C8JB 1YEEH 3G9VA 3QUXC 1EA9C 5GSVB 3QUZC 4CN4A 2CD0A 1IZKA 3PGDB 3CMOL 4CW1A 1TNNA 1K3IA 4FQXB 4MAYC 3L3JA 3OR6B 1G6RH 4P4KD 3VGFA 1T66C 1JRHL 4D9LL 2W0FA 2HFEB 25C8L 1FYHB 2Q86B 4MJIE 4CMMA 1KN4L 4P5TB 1UJ3B 1HIMH 5IHZB 3WFHB 1F90H 4JKWA 1N5YH 5HTSA 1DQDL 1I7ZA 3EYSH 3C2AH 3QJHA 4HUMB 2X89A 4AT6B 2Z31A 3JVGC 3VXSD 3B3IA 5HGDA 3W0WD 2R0WH 1FIGL 1K8IB 5KSUA 2CKBB 1A7RL 2CJUL 3ES6B 5HI4C 2NY3B 2A83A 5CJ8A 1LD9A 3KPMA 4U1LA 2FYYB 5D6CB 1MCWW 4V3DB 4LLVA 1H3PH 3QEQE 2BSED 1E0OB 3NCYP 5GGVY 5IR1B 3ARZA 4OUOA 1U3HD 2GK2A 5AEAA 1V7NH 4ETQA 3SCMD 1NMBH 2B4CC 4OIAA 4Z95H 4NQDE 2UWEB 3NCYS 2YPLE 1KBGH 1MY7A 1EXUB 1KCGC 4NO2B 4URTB 1QSFD 1IQWL 3DX9A 1XH3B 3CIQA 1X7QB 4U49A 4C54A 5IQ9B 4F7PA 4XCEB 2FIRT 5F9OH 4KI1A 4AQOA 4OD2A 3V6BR 3CFCL 2MCG1 3MV7B 5B8CB 5IMOB 2V5RA 3QDMA 3CC5B 1DVFD 4U0RC 4BKLA 4BH7A 3MJGX 4DEPB 1Q72H 4OSUH 3O9WB 5D1QD 1PKQA 4X9HA 5FYKE 1GHFH 3U9UB 5JMRA 5HDQH 3GJEB 3EIFA 3MRCA 4XP5H 2HLFD 2XQYG 2CRIA 4NOBA 1AO7B 3DVIA 5DJ2A 1RJLA 3WN5C 1FGVL 3DOSA 2OJZH 3SBWA 3UTSE 4AEHL 3JUYA 4Z5RB 1FORL 4GMSL 4QRQB 1YYMH 1JGUL 4JANB 5DMYA 4ODUA 2ZUWA 5J13C 3MV9D 2BXZA 3NFNA 2A73B 3VXQB 4JPIA 5IEKA 1GC1C 3L5WA 4OCXH 3MLTB 1REIA 2BX5A 1T04A 3VXUD 1NL0L 2AJ3A 3ARXA 1T1WA 4MD0A 2XXMB 4NJAH 3DRTA 4UUJB 2EXYD 3IJSA 4PRPB 1YJDC 3QUKA 5GGTA 3LEVL 4A2LA 5FGBA 4WEUD 3P9MB 4TUOA 1XGUB 3OPZL 2OP4L 1ZWIB 1X5IA 4NRZB 3UTPE 3GBNL 1FYTE 4D9RE 3GRWA 3QDGE 4LPTA 1RHFA 5C9JA 5I76B 2BC4B 5I73B 1FCCA 4I18C 1Y0LB 1JTPA 2D3VA 4KI5C 1AE6L 3PP3K 5CZXC 4CVXA 4WUUA 4OF7A 1ERNA 2AEPL 3IKKA 5J12B 2L4OA 3VU2A 4HW6A 2EYTB 3ERYA 3KHOA 4KTEL 7CGTA 2D7OA 3DBXA 1FRGH 5I8KL 3DV6B 3FJTA 4GO6B 4LDOB 3I02B 3MRLB 4N0UE 1AR1D 2HKFL 5CBEB 2EZ0D 2NR6D 4KI5E 4HIJB 1XIWB 4LPXA 2XACC 4NO0A 4HBQA 2CKBL 3ELAT 1HNFA 5HHPA 2OZ4H 3LZFH 1KCRH 1RZFL 4C55A 5T1KD 4LCIH 3QZWA 4PJ5B 4S2SB 1KPRA 4UOW0 2EECA 5HHXH 1JUFB 4UTBH 1JZ4A 3VA2C 4ELKB 4RFOH 4L8CB 1JNHB 1CFTA 3Q6GH 5EFIB 2DQDH 1WISA 1T6WA 4OFYD 4X4XA 3QEGL 2YWYA 3TO4D 3RVVD 4LRNH 1OT2A 2AQ3A 1TMCB 3H3KA 4OBRA 4XRCA 5EOQL 1P4BL 4ZAKD 4HIIB 3QUXA 4KRPC 3QUZA 4W81A 1VENA 1KEMH 5D7KE 3ZHLA 3DURB 1BMGA 3TNMB 3FN0H 2ZG3A 2APTA 4MAYA 4Q74A 1R5WA 1OD9A 1HDMA 3UX9B 4NUJB 3WKNA 5AYUL 4BZ1H 1EV2E 5DI8A 5CIPB 5DQJB 3FQRA 2MCPL 3K74B 3IS0X 4P2OD 3LHPH 2ED9A 4I2XB 4HKXA 3EOBB 5L88L 7FABH 2ZNXA 2ZNWA 4F15C 4Z7OF 2H32A 4WI2A 1T20A 3HMWH 2AK4D 2FGWH 4FN0A 3QEQA 4OGAD 1JZ2A 5E08H 2MMXA 3JVGA 5J9PB 5HI5C 1INDL 4M4PA 1L8JA 2X7LB 5C0CE 2E27L 4NQDA 1AJ7H 2RCSL 2WAHA 2YPLA 3BAEL 3U4EA 2H2SC 4J23A 1JHLH 3QQ9C 2X4PA 2FL5B 2DI7A 1CFSA 3NIGE 4TOYL 3CH1A 2NY0D 5GZNC 2E3VA 5IBTH 1CBVL 4IOFC 4NQXB 5HVGB 2VISB 1G7IA 1OTSD 3I75A 3GMRA 5I8OH 1BJ8A 2BOCB 1AXSB 5L2JA 3DUSB 4GAJL 4NN6C 4WFGD 3M8OL 5D2NB 4DUXA 4Q6YA 3KYNA 5A3ID 4CN6A 2VLRB 3X3GL 1I7UB 3MRIB 5E4EC 3STLA 4HIHB 5ICYA 1IFHL 2FO4B 1FV1A 5ALBH 4G80B 2HT4D 3UTSA 5ESVB 1MFCL 3GM0A 3NABH 5DK0B 5JNYA 4CJ1A 1CVRA 3N50A 3QIUC 4WEBH 1U8LA 4YPGB 4ISVA 5F93C 2A38A 3ILQD 3BT2H 3FQUA 2RFXB 3QI9B 4Y4KB 1NCWH 4GW4B 5DLMH 2XY1A 1CLOL 1J1PL 1G6RB 1LEGA 3PHOA 3NZ8A 3LEXA 4OGYL 5EO9A 3WN5A 4KKBD 3BZ4A 5EA0L 5E7BA 1R5VB 4U6YB 1A1MB 1BJ1H 4KUCF 4HUUA 4RIRA 5IKCA 5E5MA 4LK4A 1AD0A 4K8RC 3QFJE 4OGXL 3OV6A 4L4TE 2V2WA 4PJCF 4XP6L 5E2UL 1LGVA 3QXDB 1MQKL 1A2YA 3PNWB 4N90D 4C56D 2JCCF 2VZUA 2UZYB 1RZ7H 2YD7A 2ZCHL 1MJ8L 2RBLA 5EU5A 2VWEC 5BZWA 1Z9LA 2HTKD 3JTCA 3BP7A 1AGCA 3C6SA 3V6OC 1FYTA 3KPRD 2M26A 3QDGA 4EKXA 2WINA 2PYEE 5IESL 1S7TA 3UJTL 1A6AB 1EFXA 3MROB 4Q58C 1V05A 3BZFA 5MEOB 5I1HL 3MCG1 1SJHB 5C0BE 3RGVD 3QR2A 2VWEE 5TGBB 5JMOC 2F5AH 3V6OE 2Q3AA 4G8FA 4PJBE 3IRZA 1U3HC 3MMEA 4WHYG 1JWUB 5JLZA 2EDNA 4I18A 4N0UA 43CAA 4U0QB 5HGGS 5C70A 2FEDD 3PDOB 1KJVB 1FL3B 4GW1B 1RZGA 2CDFB 1DP0A 4AIXA 1R3LA 1NGZA 1U8OB 2GAZB 4U3HA 1S3KH 3FCTB 4L29A 5IB5B 3WKMH 5HJ3B 5AUMA 3L95A 2CUMA 5ITFB 4XHQA 5FUZH 3OKDB 4BQCA 4NN5C 2AQ1A 3FQTB 3DMMD 3PWLA 5HHMD 3L7FB 5T1LA 4DWHA 4XAWL 2X4RB 1T5WB 3HMXH 1UB5B 5DUPH 1I85C 4A6YA 4PJ9B 2EXWD 12E8L 3CZJA 3IDGB 3BRGC 3FONA 3T77A 1U2CA 1EEYB 5I8EB 5A16B 5FGSA 3OJ2C 3EZ8A 4NQTA 2JJVA 1ZHBA 1WBYA 3CSYB 3GSOB 3NA4A 1EHLL 3BDYH 1ETZB 4TQEL 1A7NL 4UI2A 4Y1AD 5TH2B 3WS3B 4P3WA 4TULH 1KB9K 3QWOB 3ARED 3DSNA 3KJ6H 5TFSH 5KS9B 3H0TA 3MA7B 4WWKD 1OM3L 1MFEL 4XBGA 1NLBL 5D1XC 4O4YL 1IC4H 1XGPA 3I6KB 1KLFA 5I1AA 1YEEL 3WMSA 1F6AA 1UZ6E 4MA7H 5C0CA 5I1GH 3OKNA 3TVMB 2Z93B 5B38A 5JQHC 3P4OA 5K59E 2DLGA 2QADD 3G6AA 5ID0B 3M1BB 4P5MB 1JV5A 3DRQA 3QQ4B 4TVSa 1G6RL 3UC0L 1FC2D 1MLBA 5GGSA 4N0RA 5CSZB 4OZFH 4QRRA 3ZKXB 3O41B 3D2UB 3MRRB 1RUQH 3A6OA 4HV8A 3DVNB 4G8EB 4D0BA 1OWWA 3F7YA 4ONGL 2JELH 1FSKB 1N5YL 4QYOB 3EYSL 2Y07H 4OLYL 4RAHA 2Y06L 1AQDA 2R0WL 5EO0A 5C07B 3X3FH 1YEDB 2G5BB 4P3DB 3BH9A 5IHLB 3U36A 4MJ5A 3ARFD 3ARRA 1CFBA 3FL7A 1G0YR 4NKMA 2GTWB 4UAOB 4DK3A 1RIUH 5D70L 3G5ZB 4OI8A 1D5BA 4NWTL 1F13A 4FZ8H 5CJQH 1X5FA 4JFQB 5TE7H 2Q7YA 4PB0H 4MZ2A 4E42A 1YNTA 4FXGB 1N0XH 2N7AA 4EVNB 3QDJB 3HB3C 4OAWA 2GKIA 2DIBA 4N0CC 5HYSB 1R0AH 3QIUA 5F9OL 3NACL 5DHVB 3RVVC 3QFJA 4J3OC 4L4TA 3U7WL 1MCCA 5BRZE 4OZIF 1EGJL 5EZLA 5FYLD 3MUGB 4PJFB 5DF0A 4YX2H 1YN7A 1Q72L 4OSUL 1AP2B 3IFLH 1GGIL 4OB5H 5BV7H 4R9HA 1LE9A 4UDUB 3ALPA 4BSJA 3B83A 4X6BA 4XP5L 5B3JF 5D7LD 4CDGC 4NP4H 5K9KA 3X17A 4PRBA 1VFAA 2OJZL 4JJ5A 4YDJB 1EERB 2Y4SA 4UIMB 1QRNB 1EEZB 2EICA 5FYJD 3DXAB 2E6QA 4KVNH 4Z0XA 4FP8L 4M7LT 1BFVH 3N0PB 5EO1A 3V6OA 3WFBH 4PJBA 1C08A 3BE1L 5E95B 4KTYA 3CDCA 5FOBB 2VDKL 1OP3H 4HUKB 3TGXA 3TCLB 2B1HL 2BVOB 2YR3A 1T3FA 4XNZB 3S34H 4WFHD 4MCZB 2AJXH 5LKNA 1PYWA 3ULVC 3OKOA 4GG8A 2EDEA 3FFCA 1C7SA 4NJAL 2GITA 2VL4A 5EH1A 3WIFA 5CKAA 2YZ1A 4D94A 3P0GB 1UM5H 1U3HA 3Q2CA 4KY1L 1FLRH 4PJHA 3AMLA 3BMVA 4JAMB 3UTTD 2DTMH 4G8IB 4V1DE 2Q6WA 3MRBA 4LSPH 4G6JL 4OIIH 2JCCB 3ULVE 2C3VB 3ARGD 1UWEL 1KC5H 2ATPB 4MVBC 1Q9OA 3DHJA 3EJYD 4XB8A 1U8PA 4M7JL 1QRKA 3LRSA 4D8PB 2LFGA 4HZAA 1S5IH 1QFWI 1T4KA 1MCKA 3RHWK 1FRGL 1I85A 3U0TA 1MCLA 2EH7H 4DN4H 4ODVL 5T1MA 3NCMA 4MS8D 1B6UA 4X7TB 1OAUH 3BW9B 3T4YA 4GRLC 2ZOKB 4L4VD 3DHMA 4R7DA 5ACZB 1DQLH 1B0RB 1KIPB 2OSLA 5F71A 4EUPB 3E6FA 2OL3A 4NHUB 4OZ4A 3V6FB 2IH1B 4BSVB 5AD0B 2VLMD 3BKCL 1JN6B 1KCRL 2E7CA 3MOAH 2ATKA 2X1XR 3PHQA 2GSGA 1D3CA 3MJ6A 4XBEL 4YK4C 3ARDC 4F7EB 4XMPH 4RFOL 3MACL 1AH1A 3W39B 3WDIA 1IL1A 3FO1B 2DD8L 2AXFB 3H7LA 5C0DA 5D1XA 4Z0BH 5I2IA 4N8CH 5DRZB 3SGKC 2FJGB 1NCUA 3CXHK 2W1NA 4RBPK 4U3CA 2VE6B 3FN0L 5DD5H 4ERSL 2ENYA 4WDIA 5IK3B 3GBMH 2MQ3A 1LEIA 1X44A 5IUSA 1AFVH 4PJ8B 3LHPL 4HC1A 3BH8A 2OMNA 3QZWG 4QOKB 2WW8A 4MD4A 1AGDA 1QSVA 5DWUL 3EDEA 4Q9QH 2J7LA 4XCNA 3W2DH 1DLHA 3HMWL 1NANH 4BYHA 5ENWA 4WW2C 1MFDL 4LCWD 2CH8A 1OGAA 5GJSH 4HXAH 1YMMA 2IPTH 4ONHA 4CKVX 1OTUD 3O2WH 3HC3H 5DFWH 1SJEA 3QCVH 3NA9L 2C1PB 1MNUL 5DSCB 5DC9B 2QTEA 3CPLA 1HKFA 1A1NB 4LIQH 3M07A 1XF5B 5IBTL 2VXTH 4Q9RH 3AUVA 5BRZA 5LQBL 3DGGB 2WUCL 1MCIA 4ZS7H 5I8OL 2PO6C 5BXFB 1WAAF 3MUZ1 3QNXB 3T8XA 4N0CA 1MCQA 1JZ6A 1RD6A 2ESVD 3WUWB 1A4JB 2GUOB 3FN3A 1OQOA 3PWVB 3MREA 1YEIH 2J8UE 2XOTA 2EO1A 4ZXBD 3BGAA 2P4AB 3NABL 2DKMA 2APVA 1WV7T 4P0DA 1SYVB 3RI5K 4PR5A 3BT2L 1PSKL 1JNNH 1P7QD 1BFTA 3WNKA 4ZG1A 5F88A 1BWWA 5GS1B 2UY7A 1RURH 3DUUA 4M1DH 3EYVB 4HQQL 5EC1B 5HPMB 4PBWD 4MNHA 4PJ5E 4AENB 2AK4A 5JO5A 3TJEL 3PGDA 3QUMB 3JWDL 4V2CB 5F7EL 3OR6A 3GI8H 1QFUH 2VZTA 5I1KH 4V1DA 4P9HH 4XTRC 1KIRA 2AV1B 2HFEA 1ZVSB 1W8OA 43C9B 4W4OC 5T3ZL 2IQ9L 5TQ0L 1CD8A 1AXIB 1CDUA 3S4SB 1A3LL 4LP4A 2H2PD 1XGYH 3I2CH 1S9VB 2NY1D 4I4WB 1NAMH 3P73B 5DK2B 5DVNA 2P46B 1QYGH 2IPKB 1G84A 2CDEB 1J05B 3RDTB 4JGJA 5ILTH 3OXSA 4MVBA 4NRYB 2FYYA 2YWZA 4GRMB 2FATH 4P2QE 4WTWA 1TVHB 2VKWA 2OTWA 3PXHA 5CSBA 5TDPA 5IR1A 3IU4L 5TE6H 1QBLH 3RAJH 5T5NF 1LO0L 4ZFOL 2IG2H 4WO4B 5H8DA 5C6PB 5D2NC 4NO2A 3QULA 4GRLA 4HZLB 1BHGA 1A6ZA 2DMBA 3KPLB 5K9JH 1ZHNB 4LU5H 4I48A 5DUPL 4ESKA 4PJEF 4N8VA 2BNUA 2G5RA 5F3HA 4ZFFB 2OCFD 3AS3A 4O02L 1MHPL 4QTIH 4YEFA 1BLNA 4NDMA 5D2NE 3ARDA 2D03L 2YZ8A 3EDDA 2I60L 3I3BA 5E8OA 4JFFB 2HLAA 4L5FH 2A0LD 2DYPA 3CXDH 1FNEA 4YC2B 4LSTH 4Y88A 5ETUA 1FL5B 4RGNB 2GTZA 4TULL 3CZFA 5ICZA 3HG1D 3VFUA 1IEAA 3SGKA 3KJ6L 1XGTB 1J1XH 1A14L 5B21A 4WI7A 2ZKHH 4L9LB 4M61B 3OZ9H 3TP4A 4LAQL 1FZKA 4MYWB 5DFVC 2VAJA 5DC0A 1IC4L 4P4KB 3R8BB 1PDKA 5AZ2H 5DD6A 1I9IH 3MLTA 4L8DB 1ZKAA 4MA7L 5I1GL 4UU9A 3UO1L 1MEXH 4UUJA 5H94A 2VIRA 4MCYB 5GRWA 5HYJA 3TFKC 3WO3B 1NQBA 2YD4A 4JM2F 2AXGB 4JFED 4WW2A 1T7WA 5SX5K 3VXSB 4DW2H 4RZCA 1FVCB 3F8UB 1E27B 3VRJA 1BD2E 1J8HA 3VXTA 1NLDH 5HHMA 1A6VH 3VFSB 3QUML 5I76A 2WANA 3GMMB 3VD4A 3D69A 1BQSA 4YHIB 4I3SL 4MB5A 2Y07L 3C5JB 1U8QA 4JRXD 4NBYB 3VWKD 1CXIA 1E4XI 5D7IB 4X6FB 1KCSH 2NY6D 4G6AD 4UV7L 3ZL4L 3N1PC 3QO1A 3G9AB 4OV6F 1T1XB 4YBLC 1QBML 1WFUA 2EYTA 2J8UA 1BFOA 4CNIA 2PO6A 1PZ5B 1G7QB 5B38G 3QQNA 4MQXC 4X83A 1QSFB 1KTLB 3D0LA 1RIUL 2R23A 3FN9A 1JNLH 3GI9H 2UV3A 2VZOA 3JTTB 1II4E 1A6WH 1PQZA 1NC2D 5CJQL 5TE7L 1D9KC 2BCKB 3GHBH 5DQDH 1FNAA 1N0XL 4QRPB 3HA0A 5E2JA 1DVFB 3SE9H 1C1EL 5E24E 4GLRH 1ZXQA 5D1QB 3KPPA 4PJ5A 32C2B 2A2QT 5DDHB 5DUMH 1F3JA 4MB4A 5EFIA 3R1GH 1IC1A 5EZOH 3CDFA 3RWJA 1UZ8B 2V9QA 2O5ZL 2PR4H 3RRQA 4EN3C 4YUEH 4N5ED 4OB5L 3TZVC 2VDMH 3SDXA 4WY7H 4NP4L 4LPCA 2BY3A 3MV9B 2HH0H 3C60D 1LK3H 1CLYL 5DMIL 4JO1L 4TUKL 1WWAX 1OW0C 1A5FH 3HUJF 5I1IH 1CGSH 2F8XC 4NUJA 1IEHA 5CIPA 5DQJA 4GXUM 3WFBL 2IMMA 2FH8A 5J6GB 3EOBA 4H0IA 1TCMA 4W4OA 3PWPD 3G5XA 3GJFB 4P2QA 2DMCA 4AH2B 1EJOH 1D5ZA 2A9NH 5CMAA 3ZKXC 3DLQR 5FCUH 2VB5A 3V4VL 3WFCH 4FFVD 5CP7B 3SY0B 3IAQA 1FCGA 3KPTA 2XWJB 1FSKC 3QIWC 3S36X 1K5NA 3L3OA 3O45A 5CKGA 3KLHC 2DTML 3SDAC 4IMKC 4K55A 4OKVB 2AABH 1WICA 1FZOA 4LSPL 3V5DB 4OIIL 1I75A 4QHLA 1B2WL 1SY6H 1G7LA 3FOLB 1VADA 1KC5L 4CVZB 4Y4FC 3C8HA 5D2NA 1WGOA 4OV5A 2M2DA 3MRPB 1X5GA 5C07E 3C5ZD 2FO4A 4L8BA 4DN4L 2EH7L 4UNUA 4QF1A 3FT3B 4MGXA 3S37H 1JZ5A 2ZJSH 5T1KB 3OKKB 3PXJA 1BQHB 2MNUA 1DQLL 4GKSA 1GXEA 4WV1B 4GW4A 1LQVA 2XFXA 1H3TA 1A21A 4ZPVB 3QCUH 1G6RA 3S5LG 4CAGA 5GHWH 2PKDA 3MOAL 3TO4B 4FFEX 1QFWL 3PV6A 5T33H 1FPTH 4U6YA 1A1MA 1BFSA 1ACYH 1UWGH 1CD1B 1CG9A 2BOBA 2QR0A 2XTJC 4I0CC 4N8CL 3VMOA 3OR7A 2EYSB 3QHZH 4K07A 4NO5B 4XCYB 1MHCB 1K4DB 4G43B 5D7SH 1PEWA 4P2OB 1BD2A 2OXHA 4FQCH 4LQFL 2PCPB 4KV5F 2QQNH 3LQMA 1G1YA 1FAIH 4OIBA 3Q1SL 3ARGA 1FLTX 3TFKA 2LTQB 1QRNE 5I16B 5T3XH 3I6LE 4WCYH 1JWMB 3TYGH 1AGBB 5TGBA 1R3KB 1AKJD 3RZCD 4D0CA 2E9WA 3MLXH 1Q94A 3MYZA 1OF2A 5F1SA 1JWUA 3D0VB 1G7HA 4TSAH 4L3EE 3M45A 3PDOA 2NY0B 4P4RA 4Y5XC 1FL3A 4C83B 3QUYC 4APQD 1GGTA 4HXAL 2IPTL 3WHXA 3O2WL 3HC3L 4XPHH 5IB5A 1KFAH 5HJ3A 2G2RB 1NBQA 1A7OH 5CHNA 3RX5A 1QBAA 1JHKH 1E28B 1WZLA 3LKPB 4LIQL 1DBKL 2VXTL 4YBQD 5DD0L 3FO0H 3ORJA 1ZS8A 4GUPA 4M48H 3WFZA 1NCTA 3E1F1 1D9KA 1UENA 3ZTNL 4BA8A 3P4LA 2JCCE 2YKLH 2EDLA 3VDBA 3HC4H 2XN9E 2P5WD 3OHXB 4R90L 1CR9L 3H2WA 1KGCD 3MO1B 3HNSL 1KYOJ 5JR1H 4JCLA 1ROWA 3SOBL 1KSRA 1IE5A 4RDQG 1IQDB 3CSYA 3OAYK 4ZYKB 4OLXL 3WFDL 1DEEB 1AY1H 4EN3A 2HN7B 5TH2A 2VLKD 1D5MB 1AGEA 3TZVA 1NGYB 1H15A 4X80H 3MXWH 1JNNL 4B0MM 1XF3A 2K9UA 1XR9B 5L0QB 1T0PB 2CGRH 1QEWB 3QNYB 2VXSH 3C6LD 4C56B 1RURL 1OW0A 2FX7H 5MEND 3BQUD 3I6KA 4YDVB 3SJVB 3KJ4C 5ECJE 4P48A 1WK0A 5C0EA 4OM0L 3M1BA 3QQ4A 3L5IA 5I1KL 1FVEA 4P9HL 5CSZA 2VLLB 1F97A 3MLYL 3PHSA 3O41A 2H9GB 4PJ8C 2CLZB 4NN7B 2CQVA 3MRRA 1KCUH 3DVNA 5FDWB 1CFVH 4FQIH 4K94H 3MBED 3RIFF 3QIWA 4QYOA 3MNZB 3VXNA 1RUML 1D5IH 2ADIA 1S7QB 2NY2D 4OTXH 3SDAA 2YSSB 3SGDH 4IMKA 5C07A 3BP6B 1S9YB 4AZ8A 4PGDB 4RWHA 2VDOH 4P3DA 2F74A 4TVPD 2OZ4A 1I9RH 3E6HA 5ILTL 5CEYA 3B4NA 5HHOA 3NIFE 4Y4FA 1X4XA 1LO2H 3ZKNC 4XC3H 1QVOB 4JPWL 2D7TH 4JFQA 1B4JH 4G8GD 1HKLH 3IETB 1QBLL 4FXGA 3RAJL 1MHHB 4EVNA 5CGYD 4LEOA 1YMHB 3V0AC 3GMLA 4JR9H 1I8KB 1TZHA 3TEUA 1G9MH 3RQ3A 2X1OA 4TNVF 4LU5L 4BFGA 3PWNB 5ITBL 1CK0H 4QXUL 4S1SH 4BELD 1JNJA 5C7XH 2Q8BH 2BSRB 2JTDA 1P53A 2QKIA 2DKUA 5FA3A 5EBWA 4Y1AB 1AP2A 5DJ0A 4HULB 4NKDA 2VXVH 2LU3A 1W72B 4NNYA 2DOCA 1LNUB 3H9SD 4WJ5B 1ZHLB 5IMLA 4WWKB 3CXDL 1P4LA 2Z8VC 2KUTA 5J1AB 4LLDB 4Z7UF 5GRYA 1EEZA 3ILPB 4Y5YC 1HHHB 3BP4A 1DBMH 3BO8A 5F7NC 5I8CA 1J1XL 2HT3D 2ZKHL 3NPZB 1FFPA 1Y6NR 4QXTB 3VJ6A 4L3EA 3U30B 2XG4A 2Q7NA 3TCLA 3TT1H 1K85A 4WGVB 5AZ2L 1T22B 3EHBC 3EO9H 1EBPA 1A9BB 1I9IL 1RUPH 3L6FB 3QXWA 4NQED 4ONOA 5JHDE 3TCXA 1DDHB 5LGJB 4KZDH 3G6JF 4MNQE 1U8JA 1UXWB 1VDGA 1JI2A 1DSFL 1F5WA 3GK8H 1I7TB 4WVRA 3O4OC 5GISH 4IRJB 3X14B 3SQBA 4UNVA 3MV8D 1SM3H 4JDTL 3L3DA 4Y5XA 2PYFB 4PJCA 5F7KC 4DW2L 4TTGA 4M7ZB 3QUYA 5I18L 3SDDC 4XPAL 2OQJB 1W8NA 5KN5B 4HGWA 5IMMA 2JCCA 4OZIE 2NY5L 1KPVA 2C3VA 1CD9B 2XN9A 5ERWB 4YHYB 3MJ9H 1FNGA 1MCJA 1AR2A 4M5ZL 1YECH 2GK0A 4E9LA 1KCSL 4YXKH 4Q9CA 4KKCC 3K7UA 4M7LH 4PLNC 5AAWA 1T89C 2NNAB 4YQXL 5J06A 1ZSDA 4Y5VB 4X7TA 3BW9A 4I0PC 3MNVA 1UKQA 1KV3A 5DYOA 5BV7C 2AEQH 4ZOAA 2ZOKA 5F3BA 1FNHA 1JNLL 3G08B 3FB7B 1A6WL 1CICB 4O2EB 4DUVA 2CKNA 3GHBL 5DQDL 2IH1A 4BSVA 3ARQA 1MIML 2FLBT 3SE9L 1E4XL 1JGVH 1GZQB 3F12A 2FCBA 4YFLI 3H8NA 2C7UA 4AL8L 4F7EA 4MA1C 3MRHB 2BZDA 3W39A 3GJFK 3IDMB 5D7LB 4IJ3C 1FNFA 5EZOL 1JK8B 4QHNA 3TNNB 1BVLA 1MVFA 3QAZB 3ZT7A 1QUNA 1DANT 3V6ZB 2RIKA 4LHUB 4YUEL 2PW1B 1KIUA 1ZLWH 3V0VA 4X5WA 5DRZA 1IAMA 4CADA 2HH0L 2YC1B 1BBJB 1OP5H 5DVOA 1KTKE 4JO4L 4JFFE 1A5FL 1MFBL 4RMSA 2F54E 1CGSL 2YRPA 3BSZL 3CFKB 4PYHA 2YD1A 3OGCA 5HD8D 2UYLA 2UZXB 1F58L 2VDNL 3C08L 1A1OB 4J3UA 1RZKL 3HE7D 4PJ8A 1W72L 3BYYA 3GSQA 4G9FD 2KH2B 4QNPF 3AVEA 4ZFOA 2DLFL 1LP9B 1J0YA 2A9NL 2NQCA 3PGFH 5FCUL 1B9ZA 2VITB 2CUHA 3HMXA 4TN9A 3WFCL 3VI4F 1IARB 4RAUB 2C1PA 2CR3A 1OSPL 4JGMA 1XF5A 5KSBF 2AABL 3T3MF 2P24B 3S8WA 1SY6L 4HKZA 2MHAA 3DGGA 2HJLB 5EUOB 4DVBA 1RFDH 3QHFH 4MD5B 1TTGA 1NDGB 2FZ3B 1DLFH 1CIDA 3R06A 1G9NL 3QIBD 2GJ6A 4L4VB 1F45A 2Q76A 4E0RB 4TRPL 3OKLB 5D7IE 2Y5TB 2PTTB 4X7CC 5EU4A 1UEMA 3VFNA 3PWVA 5B4MC 3OG6B 1CDBA 2UVFA 3LN4A 3SDCC 5I74B 2ARWA 2ZJSL 1QR4A 2JB5H 3DPBA 1QSFE 3UTZA 3O3EA 4RGMB 5EC2B 1A6TB 3AU1B 5FECA 2R9HD 4U1IB 4OZGB 5IBLC 5TF1H 3QCUL 1MIEH 1S7UA 3ZSSA 1PG7W 1G0XA 4QRPE 5SWSE 2R1XA 4OZFA 4K3HA 5AZEH 5JHDA 3RVUD 2QSTA 3FTGB 2CUIA 2WWKO 4MNQA 4LEXH 4Y5YA 1JBJA 1Z0MA 1OGTA 2DQIH 4AENA 3RL2A 4OJFL 5DZLA 1UWGL 2BSTA 1KLUB 4FG6C 4D0DA 3L3IA 4G7YH 3UYRH 4UZGA 2A6JB 3QHZL 4YZFE 4HT1L 2CIIA 1MJJB 5KANI 5DVMA 5D7SL 5IW3A 1XR8B 4OZIA 4N9GA 2YBRB 1PEZA 4FQCL 4ODSL 4UBDD 3TPKA 1CU4L 2OTUB 2X6MA 2XA3A 4L3CB 1LE5B 5EOTA 3ULSA 4I4WA 1N6QL 4LCWB 1ZT1B 3JWOH 3TESA 2VH5H 5EUKB 3TYGL 1TZIA 5DK2A 3MC0A 3SDDA 1K2DA 2EEDA 4YAQB 2WIMA 2CDEA 3KDMA 2IGFH 3MLXL 4TSBH 3MJ8B 2VRAA 4TSAL 1JGLL 1MCWM 4LIQE 5F6IB 1OAQL 4S1RH 4YHKH 3BEVB 2ARJA 3ZHKA 1A0QH 4KKLC 2AGJL 2WBWB 1KFAL 1TPXC 3D18A 5TPWL 1T89A 1TETL 1A7OL 3TN0C 1JHKL 3VFWA 4I0PA 3NFPB 5IVZA 3BVNA 4XI5C 3E3QE 2YS4A 1NFIA 3KPLA 4IS6B 3WO4C 3FO0L 4M48L 3W11D 4P5KA 3K2UL 1MFNA 4LSVL 2J8HA 4X5LA 4ZPTA 3TH3T 3P9WB 4EJ1C 3HC4L 1OAKH 4JQXC 4QEGA 5C09B 3VGHA 1WBXB 4K71B 4K7PH 4PJAB 3V0WL 4WV1C 3X12A 2FBJH 3P40A 4Q6IB 2R2BB 3VCLB 1UACH 5JR1L 1UB6A 4JFFA 1NGWA 1YNLL 4DQOH 4QHUB 2W60B 2F54A 4XH2A 4P9HC 4XPTH 4WI4A 1K8DA 4NT6B 2R2EB 4NYLB 3GSXB 1PLGH 5A2KH 3P3YA 5FFLA 1VEOA 1XGTA 1A7BA 1WFTA 2CGRL 2NY7L 2Q8AL 1AKJA 1I8IB 2FX7L 3FB5A 4HDIA 4YHZL 4H88H 3EYOB 4NSKA 2ED8A 1EIBA 2P8MB 1N8ZB 4G9DA 5IG7B 3B2VH 5F7YC 4G6MH 2E8ZA 1NCAL 5C0JA 3HE6C 2BMKB 4ODWB 4EOWH 4FS0A 4IMLB 4MCYA 1CXKA 3BGMA 1BGXH 2ZUUA 1L9MA 2VDQH 4FTVD 2QSCL 2NY4D 4X7SH 2RGSA 1KCUL 4PJEE 1E27A 5D5MB 1S9WB 1VB9A 1FFRA 3FFDA 1CFVL 3F6IA 4ORGB 4UT6H 3RWDA 3BGFB 3VFSA 4RNRA 2EIDA 5FK9B 2WQ8A 3C5JA 1D5IL 3RTQC 4X6FA 3MGOB 2Z35A 3IF1A 4F7MB 1D6EB 2J3SA 3DX6B 2NXYC 3TPUA 3TWCH 1I9RL 2A74B 4PG9B 1PZ5A 3N85L 2PETA 3V4PH 5AWNL 1I4FB 3F7VB 1UXSA 3T0ED 1LO2L 5LGKA 1J86A 1QTYT 2P48B 3EOYG 2VLKA 3MFGB 2D7TL 4LSUH 1B4JL 3O3AA 4QRPA 5DR5H 5SWSA 5EU6B 4JM2C 4JGUA 1ZK9A 1CLCA 2P7TA 2BVYA 3SDCA 5JW4Q 5E03A 3WIHH 4H0HB 1PKOA 4QGTA 4XWOC 1SVZA 4U1GB 2NXZC 3IDJB 1CK0L 4NFCA 5GS0D 4YR6A 4JREB 4NQVA 3U6RB 2Q8BL 3JZ7A 4LRIC 4KKNA 4S10A 1U8NB 1JF1B 4EI6B 4O2FA 4X5XB 4HLZH 3SPVB 4ONFL 3GM8A 1T1YA 2X1WL 4JG1L 4KPHH 3HG1B 3QWRA 4CL7A 4GBXC 1IAKB 2ZUTA 1NEZA 5JPMB 3CLEH 1NFDF 4ZS6C 3MXVH 2XKNA 2R56L 2VKXA 4WHDA 2WUBL 1DBML 3KPSE 3WFEL 5HYSG 3EDFA 4AIZB 5IB3B 3LS4H 1BIIA 3RIAF 2FIKB 3DWTA 5E99L 3TT1L 3WNLA 4MWFB 2X4QB 4NC1C 1CFNB 5C1MB 1BVZA 4AH2A 5LXGL 3LH2H 5DEFB 3F6LA 4F7CA 4JFEB 3RVWD 4NC2B 4NN7C 3NH7H 3SJVE 4KZDL 3ARBB 3BPOB 1K9TA 4M8QA 2AJVH 2Y23A 1WC7B 4QY8B 5J11B 1JFMA 5E9DB 3VWKB 4RFEA 4JRXB 1R3JB 5F9JB 5L6YH 2HVJB 2IANE 5I1CH 4S1DC 3DTXB 4OKVA 5D4QA 5EORL 1BEYH 5C0GB 4PP2B 4HWZB 1HNGA 3FOLA 5CILH 1M7XA 4XAKD 2WP3T 5EOCJ 5SWQA 3TN0A 3BN3B 4WI9A 2X9WA 3NCFB 4MA3A 5JW5A 1NCCH 4YXKL 2C1OA 4M7LL 3GB7B 3WXWL 1I3VA 1NC2B 2XNAA 4PRNB 2IEPA 3F62A 3JUZA 4XC1H 3QEUA 4JZNB 3AXLB 3HUJE 3I3DA 4XVTH 3T08A 1IAIH 2AEQL 3CFDB 4HGKC 3HLAA 1BZ9B 4I5BB 4JQXA 1K4CB 5DA4A 3HZVB 2FLRT 3EUUA 4H8WL 3VXRE 4WV1A 3RVUC 4DKEH 2BXYA 4UV4L 1QFOA 4ZPVA 1GH7A 1KLGA 4EI5C 4M02A 1JGVL 3VFTB 1NUFA 5CUSL 1YNKL 3LCYA 3UEZA 4X6CF 5J6HB 3ZE0E 2BNQD 3ROOB 4QT5A 1S7RB 3ZSTA 1B3JA 3C60B 1CD1A 3O3DA 4FFYH 3LQZA 5C2BL 4UTAL 2ZG2A 1NAMA 4NO5A 2FX8L 3T2NH 1C8PA 4CBPA 1K4DA 4PJEA 4Y2DD 2VO5A 4CRPA 3HRPA 3PJSA 3PWPB 1HWHB 3MRNB 3EJZC 1B88A 3HE6A 1F42A 1PG7H 2QLVB 3BP5B 3D85D 4J7RA 1ZEAH 4K3GA 3QHTC 4WW1B 5I16A 1E6OH 3GUTA 1QBBA 1AI1H 2IPUK 4Y16C 5D8JH 2OX5A 4IRJC 5CCKH 3D0VA 4KHXH 5IOPB 3QO0A 1IGMH 1KIQB 5AAMA 4C83A 4UIKH 1OTTD 4M7ZC 3DVGA 3U4BL