1ZT1A

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
273
Chain Sequence
MGPHSLRYFHTAVSRPGLGKPRFISVGYVDDTQFVRFDSDAENPRYEPRVRWMEQVEPEYWERNTQIAKGNEQIFRVNLRTALRYYNQSAGGSHTFQRMYGCEVGSDWRLLRGYEQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGDAERDRAYLEGTCVEWLRRYLQLGNRTDSPKAHVTRHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt1A01
4YHPB 4U1HA 4LPUA 3EGSB 3OKDA 3P0YH 4YPGB 5D2NE 4J23A 5EUOA 3VWJD 4U7KA 4ZXBD 4C56B 1RZ8A 5GGRA 2R0ZH 2B1AL 1K8IB 1KN2L 3TVMB 2ZUWA 3CDGA 4PJEB 2IG2L 3BO8B 1Z2KA 5E99H 2XN9D 3DXAA 5ISZE 3PJSB 5LBSH 5DGQA 1BFOB 1SVCP 1KELL 3FFCE 3MRBB 3UZVB 3UJJH 2DM2A 3A6BL 4MDIA 3IF1B 5FO9B 2X4PA 4ONOA 3MJ7A 2HJLA 1P53A 4Y4FB 1LEKB 3MJ9H 5T5NG 2X89D 4WNQB 3DJ9A 1CGSL 1RUMH 1RUAH 1ZS8B 1G7PA 2H2PD 2UV3A 2AAVA 3ABZA 1E4KC 1NGWA 1KXTB 5EFIA 3GUTB 4Z7VE 1JBJA 3RWHA 1I9EA 2QQQA 3HCVB 5FXCH 1G6RA 3GMLA 2NY3D 1ODAA 4XNXH 1JNLH 2AK1H 2NPLX 3RGVA 3CLFL 5CBEB 5AWNH 2VZOA 3MQIA 3FKUS 5JA8B 1WBZB 4YX2H 2ARWA 4U49A 3ARTA 4F37F 3B4NA 1MCEA 2IALB 5D7IA 2WP3O 5IVZA 4H8WL 1ND0A 2DQEL 4XPAL 1A3LH 5J13B 1N2RB 4R4BB 2R1XA 3S88H 5EU6A 4Y2DA 2WUCL 4ETQB 3VFNB 1LK2A 4NN6B 5H35B 3H3PL 3HR5B 3WMSA 5JW3H 1IRAY 4WI4A 1FNHA 2QSCH 3QPQD 4HEME 2ADFH 1JN6A 3QDGD 1CXKA 3KYMA 5L6YH 3QUZC 3EYFB 2WK2A 3MGOA 4CVXA 3MV7E 2AEPL 1FFNB 3NTCL 1DBAL 4HKXA 5JDSB 4KGJA 4FFYH 2NY0B 4R0LB 2QTEA 5EO1B 4AIXA 1RZFH 4PRHB 5E8EB 3QQ3A 1EVUA 4TULH 5KBNC 1DSFH 3P77A 4MJ5A 2E7HA 4WO4A 4AMKH 3PWPA 3BW9A 5TQ0L 3NCBB 4BQ9A 5JXEC 3IRZA 2KL6A 3BT2H 4YUEH 5I71C 4HKJB 4IMKC 3CLEL 5ESVB 3UTOA 2DQFB 2IAMC 3VU2A 2ZOKB 5H37G 5C6TL 2IQAA 3HI6H 5F21B 4KV5E 3N1FC 1I7TA 1YJDC 3CX5J 2W0KA 2BNRE 1XGQB 5ICZA 2XG4A 1QQDB 3ZLQC 1TVHA 4M43L 3HZYB 3QEGH 1MCPL 2JJSA 4X8JB 5CP3H 5C3LD 3GRWA 4KJPD 4ZTPL 4PP1D 4XNYH 2P45B 3EBAA 1TJIL 3GMNB 1I4FA 3LN9A 4MLIA 3UTSE 4Q74A 5D7LE 1T7ZA 1KJ3H 1F6FB 1T5WA 3H7BB 1IAKA 2DRUA 2OL3H 1OAXL 3SJVB 3V6BR 4K8RH 5F9OL 3DV6B 2O5XL 4X7DC 4PJBB 2IPTH 2R1WA 4D9LH 5D2LF 2VZ1A 1S5HB 1HCFX 1JV5B 5F3HA 4LHJB 5KVGH 3O6ML 3U7YL 2FX9H 2OTWB 5GISL 1PSKL 1W0VA 2NTFB 1MNUH 3GSNL 4HIIB 1RURH 1F3RB 2FIRT 2Y25A 3ZHKA 3ZKXB 4AIZB 1BIHA 4M8QB 6FABH 4PRID 2GJ6A 4R4NC 4X98B 4GKOA 1RUKH 3P11H 4K07A 4DK6A 1NFDB 4OZ4A 3STLA 1TZHA 3FB5B 5KSBB 5GGVY 2VTFA 3G6AA 4M5ZH 1INEH 4ZAKC 1CLZH 2DQUH 5I1CL 3FJTA 3IDNB 4J8RB 4GJTB 5T1KD 5TDOB 3RWGA 3G5XB 3FQUA 1SEQL 2W59A 4GAGH 4Y2OA 1A02N 5BRZA 1QBAA 4FQ2H 5JHDB 4Y89A 5DJDB 5LJYH 5C9JB 5I6XB 5HY9B 3GKWL 4OLZL 4K94L 1ROWA 3CPLA 4YDIH 4F57L 1NGYB 2ATKA 2NY2C 1BVZA 2VQ1A 1F58L 1JZ5A 1P9MA 5EIIB 3I85A 1A6ZB 3P0VH 4ZS6D 3BX7C 3O6LH 3QUMH 4K3GA 4ZOBA 4BK5A 5ALBL 4UILL 1S7SB 2HP4A 5JO5B 3U4BL 4K3EH 5E2WH 1QEWB 5F7FA 2UWEF 4KK5D 3RAJH 3BKJH 2CRZA 2DTSA 3LKRB 3C6LB 5E70A 1XGTA 4U3HA 1MI5A 4H20H 2R1YB 3RUGB 1Q94A 3SDXB 2PYFB 4YAQA 2BC4B 1VADA 3GSQB 3DO7B 1KYOK 3F58H 1IMHC 3BPNC 4JAMA 4DTGH 2GJZB 1IC5L 25C8H 4JO1H 3SDCB 4H5SA 2R9HD 1U8HA 3HLAB 1YECL 3CSGA 4MB5A 4XGZA 5DI8B 5C0BB 2NXYD 2XPGB 1J1PH 1ETZA 1NCDH 4OB5L 2AKRB 3ZSSA 3MLZH 3O6KH 1L6XA 5L88H 1NAMA 2EDJA 5D2LA 2MCPL 4F15C 1CDHA 4XMKH 4Y16D 4DGIL 2CGRH 1LNUA 3ELAT 3VI3F 4Y1AA 1CLOL 1MREH 4P46B 3HMXL 5JIPA 1MFDH 1HIMH 1OARL 4M6NH 1PZ5B 3O9WA 3G5VA 4NCC2 2YK1H 2DQJH 4KPHH 5E56A 2FR4A 4DKDC 4Y5YB 5L2KD 3DVGA 3B9KC 2VDNL 3ARDB 2JK5B 3ZDZF 4RWHA 4JFPA 3L7FB 3GKZA 4JN2A 4JRYD 4PRBB 1R6VA 3KPMB 4P2OC 4OGZA 4LARH 5FGCE 5FHBL 5GRZA 1G9NL 3WFBL 2ADIA 3LKQB 2GCYA 3GMOA 3U0PA 4O9HL 5HYJB 4K7PL 4XVJH 1N4XL 1GZQA 1EPFA 4G80B 4HZLB 4PTTB 2GFBB 2BVOA 5C0JA 4LNRA 4UOW0 4MQSB 5GZNC 4LCYB 3EYQD 4LRIA 4ELKB 3W0WA 4P2YA 4JFDB 1I1AA 3EYVB 4EI5B 3LH2H 2UWEA 5T5FL 2AQ3A 3WJLC 2C26A 1QNZH 1ZVSA 2A83A 2WM0A 4N0FB 5C0NC 1YPZE 1CT8B 1GL4B 5C8JB 5B38G 2PYEB 1MHCA 2XZCL 5C9KA 1GAFH 3LKNA 3EYOB 5EA0H 3MUZ1 1B3JA 2GSGB 2LTQC 3BOVA 3X12B 1CDIA 4FQXD 2HTKC 3L3KA 4OD1H 3UJIH 5I1LA 2GK2A 4RGOH 5D7JD 1T1WB 4QHLB 3WLWD 3BUYB 2W07A 4PRAB 4IOFD 3HNTH 3BN9C 1CS6A 3O2VL 1EJOL 3R1GH 4PB9H 5E2UH 4HF5H 5I74B 3TH3T 3L3DA 3PWJA 4LIQH 3KYOA 5J6HB 1CFNA 2FJHA 4JR9L 1PBYA 4XBPA 3PHQA 3BMWA 1ZKAA 2DIJA 4NC1E 3V7AE 5FOJA 3X11B 1YJDH 2YKLL 1UA6H 4JFED 5ESAB 3O2DH 3EZ8A 1DQLH 4ODHH 4C83B 2CMRH 1NEZB 5H94B 5E94B 2R0KL 1FGNL 1UENA 3ME0A 2Z31A 3F12A 5IHUL 2EKJA 5DO2D 1KNOB 2C3HA 5FHAH 5AZEL 3I50H 4GMTH 4A6YL 4JM2F 3W11C 5D1XA 5F3BA 5MEPA 3MV01 1KENH 1NCUA 5F44A 3MV8A 3NAAH 4OZGB 4H1LH 1T1ZA 5E24E 5T3XH 2VXQH 4FZ8H 3MLYL 1PYWA 1N0XH 1U3ZA 4XC3L 3MO1A 5HDBE 1ITBB 4L4VA 2NXZC 1NUFA 4OZFA 5BCAA 5EUOE 5IIEA 1JMZA 1OAKL 1Z9MA 5I2IB 4O2CB 3DMMA 5C0CE 4WUKL 5C08D 4POZC 2ICWB 3QDHA 2HA1A 4NJ9L 4PJEF 2WUBL 3CC5A 5I1JH 4GRWB 2OZ4H 4L9LB 1OPGH 4KROD 3TA3C 4OSUL 2HWZL 3LEYL 3DX7A 3TBYA 3WNLA 3BRGC 5EB9A 2G60L 1LEGB 3EW3B 2Q6WB 4Q9BA 5I9QB 5BW7C 4MAYC 4KI1A 3Q3GA 2H9GA 4MD5B 4MNQE 3SE4C 3ZSTA 4I2XA 4D3CH 5DR5L 4XP4L 1H5BB 1MH5B 5J89A 3DYOA 3AS1A 3X3FL 1ZVHA 4RWYH 3TLRA 2EIBA 2VLRA 3EJYC 4HJGB 4QWWC 2NX5B 2QV2A 4PJ9D 1HHKB 4OKDA 1II4E 4P23D 4FQLH 4JEGB 1DQTA 2VDKL 4N1HB 5EO0B 5I1DB 5I8OH 4MAUH 1DQMH 3MLWH 1F97A 4HD9A 3NCYP 5D7IE 4JZJB 1UCBL 1ZGLB 2PO6C 4O2EB 3NZHL 5DMKB 1IQDB 1IE5A 3HE7A 3LD8C 3OXRB 1Q9OA 1T66C 5GRVL 5GGUA 3S36L 3VFUB 1CGUA 1RJZB 3T2NL 4KKCD 1FNGA 3ILQD 1JRHL 2H45A 3O45A 4JM2A 1W8NA 2XTJB 5FYLH 5EIQA 1I7UB 5IK3B 2EIEA 3E2HA 4TRPL 4NHCL 4ZFFB 1NAKH 4XAWL 2XWJB 2WQRA 3VH8A 5E00A 4TSBH 3ZKNC 3BP6B 3ZE1E 4YHPA 3T77B 4HGWA 2B8OT 3EGSA 1VACB 1NBZB 4FQIH 2JIXB 4C56A 2V17H 1ZANH 5F7MC 3MSPA 1Q72L 1U8LB 1B4JL 1K8IA 4ZUSB 1X5GA 4PJEA 3BO8A 1CGWA 2VXTL 3PWPE 5CS7A 1NSNL 3PJSA 4QOKB 2OR9H 1BFOA 3QH3B 3MRBA 5LKNA 1OP3K 1DFBL 5E9DB 1B6UA 3FQTB 5DGRA 1YDPB 1S78C 3RGVC 4Y4FA 1FFPB 4DUVA 1LEKA 2NR6C 5GGVL 1T21B 1CIDA 4WNQA 4R2GC 2KUTA 2BDNL 2YD4A 3NFNB 4S1QH 5DD1L 1ZS8A 1BVLB 4MQXD 1FC2D 2I07B 2OI9C 4G7YL 3H9HB 3EHBD 4Y2DC 3ZKMD 2YUVA 3VI4E 3AY4A 1M7XA 3HCVA 1YY9C 3F6IA 3QZWG 4YHZH 4OI9A 3WFDH 4GAYB 4LU5H 5EOCL 5CBEA 4YDVB 1J1OH 1MJ8H 1CD8A 2NCMA 1WBZA 1N3NB 2H1PL 1SJXA 1L0XA 2Y06L 4PJBF 3G6JB 5GJTL 4JG1L 2D4DA 2IALA 5GS0C 5DC9B 4UAOC 3CK0H 3KPRB 5ENWB 2VERN 1N2RA 4KI5E 4R4BA 1R5WB 5FYKD 4ETQA 3VFNA 4YH6A 5H35A 4JRXE 1DDHB 3HR5A 4QYOB 3LRGA 1EO7A 5KG9B 4JFFD 5KSBF 2AJYH 3VMPA 1T89A 4M6ML 4N0YH 4WO4C 2AK4D 3QSKB 1I75A 1OM3L 1ZK9A 4KUCF 5GZND 3EYFA 3S96B 2BK8A 5CJOL 3LB6C 3ZHDA 1FFNA 3B6SB 1QACA 1RPQA 3A0OA 4Q9RH 4I77H 4KY1L 1SYVB 4Y4KD 3MLUL 3BGAA 1E4WH 1OCWL 4R0LA 5EO1A 1F00I 4PRHA 5FYJL 5E8EA 5D70H 4PJAE 4NN7B 4JKWA 3VXSB 1TQCB 5D96B 3S37H 4PLNC 2VO5A 4BK4A 1KEGL 1CFVL 3KYKL 5DQDL 1LHZA 2I5YL 5J12B 3VGAC 2X9XA 1JWUB 3MRRB 4LLUB 4C4KO 1X4YA 4JFYB 4YDJB 3TFKD 4Z0BL 1KTDB 3MNVB 5ESVA 2DQFA 1WWCA 2ZOKA 3RZCD 4EUPG 2M2DA 3RUGF 3SDXF 2HVKB 1XGQA 1OTUC 3FQXB 1A9EB 1BD2B 4GOSA 5DUBB 5J6GB 3HZYA 3VRLE 1MFBH 5KSVB 4ALAH 4PP2B 4X8JA 3FB7B 3WHXB 2MNUA 1BHGA 1VCAA 4L4JA 2CJUL 5GRXG 4IRJB 4DW2L 2XOTA 3GMNA 4KAQL 2JKXA 1MCOH 1UJ3B 3H7BA 2QQKH 3D2UD 3P0YL 5D6CB 5INDB 3SJVA 1OWRM 3DV6A 5SWZE 4X7TB 4B5EA 4PJBA 1IARB 1W0YT 2R0ZL 3BYTA 2APBA 1S5HA 5AYQA 1UM6H 1I9RH 1JV5A 3CAFA 3BISA 4G8GE 4Y1AE 4I4WB 2CKBB 3MROB 1AC0A 2NTFA 3RWJB 1JI1A 4HIIA 2HYMA 1JTOA 4AIZA 4M8QA 4X98A 5EN2B 4ZUVB 5LBSL 3FB6B 4XCFH 2HTLD 3BN3B 3UJJL 3HB3D 3TCLB 3FB5A 5KSBA 1NCCH 5FYKU 2EDXA 5IOPB 4ERSH 4KRNA 4V2CB 4LPVA 1ZTXH 4OCXH 3IDNA 2YUWA 4J8RA 5TDOA 2VDLH 3MJ9L 4PLKC 3G5XA 4X99B 1LDPH 2IEPA 4P4KB 1RUML 1RUAL 1NUDA 5JHDA 2QQLH 5DJDA 5C9JA 4ZTOH 2EDOA 5HY9A 1NGYA 4Z7OF 5HJ3B 2ITCB 4NZUL 4YFLF 3SGEH 4XNZB 2AK1L 5EIIA 1A6ZA 5CD5D 5JIIA 1INQB 4XX1G 3GO1H 1U6AH 3V6ZA 2ZSWB 5DFVC 5AWNL 2I25N 1S7SA 4GKZB 5IFJB 2Y6SC 5JO5A 4YX2L 1QUNA 4WUUB 1QEWA 2AV1A 4MSWA 1JJUA 3T1WA 3C6LA 1KN4H 3BD4A 4KMLB 3MBEB 2R1YA 3RUGA 3SDXA 1BQHB 2PYFA 2BC4A 2D0FA 3S88L 3GSQA 2BXZA 3T3PE 1AIFB 2G75B 3QFJA 4N8VG 2GJZA 1ZT4A 2VXSH 1XIWC 1OP3H 5B3JE 1TTGA 3SDCA 4BH8B 4OF0A 5JW3L 3I75B 1WVZA 3HLAA 5C0BA 5DI8A 2QSCL 2XPGA 1JNJA 4LHUG 2ADFL 1JZ8A 3SDDD 4G9FE 1JRHI 3G9AB 1BFVH 3O9WC 2O5YH 5L6YL 2JELH 5TQ2L 4P2QD 3RWIB 2AKRA 3EFDH 4LLWB 4LSTH 5JPNB 4FFYL 2XFXB 2OCFD 2IBBA 3TH4T 3MRGA 1RZFL 1HEZB 4UOW1 3RVVD 4I48B 4TULL 1DSFL 1EEYB 1G6RH 5FK9B 1AJ7H 5CMAB 5IMKB 5SX4H 2VAAB 4P46A 3VD4A 3HMWL 1GC1C 1PZ5A 2QADB 4AMKL 1QHOA 4P3CH 2X1PA 1YN6B 3E6FB 3BT2L 4P2RE 4Y5YA 4OGXH 4TYUA 3ZDZE 4ENEC 3EYSH 4G3YH 5AAMA 3ARDA 3HI6L 3VE0B 2JK5A 4KKBC 2EXWD 5C2UB 3L7FA 1I1AC 4PRBA 4Z95H 3WIIH 2VDQH 3KPMA 3QEGL 2MQ0A 2XZZA 1KCLA 3BKYH 2RIKA 1CICD 3LKQA 1KTRL 4JJ5B 4XNYL 3FO9A 5HYSA 1QRNB 5HYJA 5GS0H 4ZFOB 1QLEH 2OJZH 4JFQB 1KJ3L 4G80A 4HZLA 2FJFB 2GFBA 4PTTA 3R8BB 1ORQA 2OL3L 1VENA 1JI2A 4NNPH 2BY3A 3NFPB 1JPFB 3IDYC 1FIGH 3GSXB 4JFDA 3EYVA 4EI5A 4OQTA 1NCTA 2IPTL 1S9KC 4D9LL 3PGCB 3VXMD 3OKEB 4HWEH 2BOBA 4CMMB 5KVGL 2FX9L 3WFCH 2KQNA 4N0FA 5JA9A 1CLCA 3ARFB 1CT8A 1RURL 5C8JA 1WJ3A 2DIBA 4NRXB 3JWOC 2PYEA 1CVRA 4G43A 4GAJL 4JO2H 1KG0B 5IHBA 1RUKL 3P11L 5IMLA 4GRWF 3EYOA 2GSGA 3O81A 4QHMB 3X12A 2EDLA 1MF2H 2RJMA 4M5ZL 5I1KH 1INEL 5CEZD 1CLZL 1GCFA 2DQUL 4JPWL 1JF1B 3Q2CA 1T1WA 4X5WB 3CGTA 3BUYA 4GAGL 4PRAA 1IC1A 3JV6A 2F5BH 4PG2A 4FQ2L 5CJQH 3RTQB 2A0LD 3GRWH 2Z31C 4OCSH 5JIKA 3BRFA 4YDIL 4X4ZA 5J6HA 1DBKH 4I9WE 4IM8A 2V5TA 3GBMH 4RGMB 4KRPB 2RAMA 4KK6D 5D1XC 2WBJA 1G6VK 4XBEH 3P0VL 5I1GH 3RIFK 3X11A 4QXWA 3L5WB 2CH8A 2J4WH 5ESAA 3O6LL 3QUML 3V4PH 2EDEA 4C83A 4QHUB 4K3EL 3DETD 1NEZA 1PEWA 1W72B 5E2WL 2OMBA 5H94A 5E94A 4HBQA 3RAJL 3T8XB 1OGAB 4OCYH 5DC0A 3SQBA 5GJSH 5DLMH 3O41B 1NBYB 4H20L 1KNOA 3QO0A 4HUUB 5HDQH 3F58L 2NMSA 3DMMC 1ITCA 4DTGL 4TTDC 3AMKA 1EUUA 1UB5B 1FFQA 4WFED 2EDDA 2R0LH 4CW1A 2QHRH 3PV7A 3FL7A 4YBLC 1J1PL 3W9DA 1NCDL 5DD0L 4NN5B 2DKSA 3AB0C 3HAEB 4N0CD 4L3EB 4L4TE 3MLZL 1ORSB 2VYRE 4PGJA 5I2IA 4KXZH 4O2CA 3O6KL 5M95B 1DL7H 1NFIB 5L88L 2ZCHH 2W0FB 3C5ZB 5ERWB 4XMKL 2ESVB 2CGRL 4X0KB 2CRMA 1GGBH 1MCWW 4GRLC 3FO2B 2YK1L 2P7TB 1N6QL 2DQJL 4KPHL 1HCVA 3JTCA 4L9LA 2IANE 4K23H 2UUDH 4FN0A 1FG2B 4JDTH 3OBAA 3UPCA 1LEGA 2Q6WA 1A3RL 2C4XA 4QRTB 1I7RB 5E2VL 4ZQKB 5TF0A 4MD5A 2F53E 5DQJB 5ACMA 4GSDH 1AH1A 4OI8A 3HE7C 4ONGL 5DJYB 4ZO9A 1H5BA 1MH5A 2WANA 3KPSB 4WWKD 5A2JH 4Q2ZB 1UXWA 4XVJL 1FFOB 1V3JA 2VXUH 4N68A 4ODWB 3CFKB 1N7MH 4I8DA 2X4OA 4XBGB 4XPGH 3E2HC 2LQRA 2F8VA 5EO0A 5I1DA 2Q8BH 5GS1B 2DLFH 1DVFB 1NAMH 1F90H 2G5RA 3LH2L 4JZJA 2K1MA 1ZGLA 4O2EA 3G6JF 5DMKA 1IQDA 1BF2A 1XZ0B 1WEJH 3U36B 1WZMA 1QNZL 5F1OB 1ZLSH 3MYJB 3VFUA 3S3SA 3TYGH 2CSPA 1RJZA 2FSEB 3JV0A 1RUQH 4Q9CA 3HUJB 1FZMA 2HJFB 1KT2B 1KCSL 4OIAA 1GAFL 2AVGA 3MUJA 1I7UA 5TFSL 5IK3A 3QEQE 4OD1L 4UU9B 3O3BB 4LVHC 3BD5A 4RGOL 2XWJA 5CGYC 1VPOH 4XCNB 4HIJB 2D9CA 4IOSD 4NYLB 3BP6A 3PWVB 1WITA 2V7NB 3T77A 3HNTL 5JOEA 1P4BH 1VACA 4LSUH 3R1GL 1NBZA 3TO4B 4PB9L 1K4CB 5E2UL 1NANI 4FNLH 3V52H 5GQBA 1LO5B 1GC1H 5K59F 2JIXA 5CIPB 5I0DA 3SGKA 2DB8A 3DI3B 3OSKA 2N7AA 4LIQL 4OUUB 4RDQF 1U8LA 4C57C 4Y4FC 4ETYA 1P84K 4RQQB 5EOCJ 3SQOL 4ZUSA 4AY0A 5F7HA 1UVQB 1P4LB 1MJJB 1YJDL 2DQTH 4QOKA 1UA6L 3VXRB 1FL6B 2X4NB 4OLVH 4B0MM 1DQLL 1NJ9B 2DLGA 2DMBA 3QH3A 4ODHL 3HI1B 2CMRL 4MNGB 5AAWA 5I76B 1WWWX 5FEBA 3LS4H 5E9DA 1RIUH 3FQTA 1YC7A 1YDPA 1MCFA 3HE6A 3VGFA 1MFAH 1FFPA 3H9SB 2J1KA 5FHAL 2J5LB 3I50L 1T21A 1YA5A 2XZAH 4GMTL 3V95A 1NKRA 1Z9LA 4WI6A 1BVLA 3VXUD 1T2XA 3NAAL 4HEPG 3ZDYE 2VLJB 3S7GA 4M1GH 3IDIB 4YO0B 3H9HA 1ZSDB 1XF3B 5T3XL 2VXQL 5F9WB 4FZ8L 3VFSB 2XKUA 3MGTB 4NN6C 1N0XL 1JNNL 3OJVC 2DI8A 4X6EB 3O3AB 4HK0A 4GAYA 2WZPD 3JWOH 5DURB 4YDVA 3KPNB 1OWWA 1JF6A 1T89C 3ZT7A 3G6JA 3WIFB 2V9TA 1RK0B 1MAJA 3UTTA 2KDGA 4FABH 1J86A 5ENWA 1JYNA 3W0WD 4U6YB 4G6AD 3KGRA 3BVNB 1R5WA 3FN0H 5I1JL 2NY0C 3C09C 4R0LC 4NKDB 4E41B 1DDHA 3RDTD 3VG0H 4QYOA 1OPGL 4BZ2H 5KG9A 4R7DB 3W81A 4I0PD 3VMNA 5I75B 4ODSH 2EC9U 1FE8H 5I17B 2JB5H 2WBWB 1DP0A 4XWOD 4YQXH 3S96A 3MA7B 3MFFB 1QSEE 4QEGA 1SYVA 4MJIB 3HG1E 3W2DH 4RWYL 4NQTA 1PW3A 4X80H 4OFDA 5DA4A 4M1DH 3VXSA 1PZUB 3N9GH 3VG9C 4OAWB 4PRDB 2FHBA 3MRJB 5DHYB 3RU8H 3ZDXF 3MNWB 1S9XB 1EH9A 1T20B 3MRRA 1JWUA 4LLUA 4MAUL 5I8OL 4S0SD 2EKSB 4KKLC 3MLWL 4JFYA 5FUCC 4Q58C 4YDJA 4ONFH 4L3CB 4UDTB 1FBIH 1KTDA 4RGND 3KHQA 3OAUH 4B7IA 3MNVA 5IBLD 1YY8B 4X83A 2VLKE 4DQOH 2JJWA 2HVKA 3QFJE 3NOIA 4NQXB 1FN4B 3FQXA 1A9EA 2DS4A 4R26L 5GSRA 1BD2A 5DUBA 4KMTH 3FTGB 3OMZA 1EHAA 4PJHE 5KSVA 3U6RB 4PP2A 4NZDA 1I1FB 3WHXA 4N9OB 5T3ZE 1NAKL 2X4RB 4X5XB 3ZKXC 4IRJA 1WCBB 4QT5B 3EUUA 1QPXA 5C07D 1L6ZA 1UJ3A 4BELD 3IFLH 4I0KA 3N1MC 1AQKL 4DJMA 5D6CA 3QYCA 4Q97A 5INDA 4FQIL 2I60H 3ARBD 2ZG1A 1LMKA 4X7TA 1AXIB 2V17L 1LO0H 3QJFB 5DDHB 3CCHB 1F13A 2OLDA 1BBDH 1I8IB 1IQWH 3NIDE 1QFUH 3ARZA 4UT9L 4JQIH 1RZJC 2FYYB 4I4WA 4WRLA 4S0UC 3QIBB 2CKBA 1KXVC 3MROA 2HKHH 3RWJA 3QNXB 5ECJE 4TTDD 5I6XC 5EN2A 4ZUVA 2OR9L 1EFXA 2H41A 3FAWA 3TCLA 1H8SA 5HGAB 1AKJA 3QUXB 5C09E 3VGDA 5IOPA 4G6KH 2XZQH 2HG5B 3NMEA 1IVLA 3B8SA 4X99A 3QUYB 4S1QL 4P4KA 2GTZB 1E6JH 2YS4A 3DYPA 4DAGL 1IAIH 3C6LC 1YEHH 2YD9A 5DYOB 3WN5B 3C9NB 2F58H 4PJ5B 5HJ3A 4ZSOB 2ITCA 2D7NA 5A3IC 2HT3D 2E7CA 2EDYA 4XMLH 3SDCC 4AT6B 5MHSE 1INQA 3DUHA 5DEZA 1UEYA 5DRZB 4YHZL 1R0AH 3WFDL 4HCRA 4LU5L 4XP6H 2ZSWA 4R9HA 3P73B 1J1OL 4GKZA 1MJ8L 3RPKA 4DZ8B 2B2XL 2P42B 3F7VA 3S3PA 4WUUA 5T1DH 1RZ7H 5D71H 3CXHK 1HE7A 3C8KB 5DZNA 2Y23A 3MBEA 3WKML 1BQHA 1G7QB 4NBXB 1AIFA 2G75A 1P7QB 4NQCB 3D5OF 4U6VH 2CUHA 4BH8A 1FZJB 4PJ8C 3I75A 5I18H 3FQNB 2E27H 3KXFD 2AJYL 2VSDA 4JM2D 1U0QA 4P46C 1XF2A 4N0YL 1YYMH 5F6IC 4U05A 3WLBB 1IGIH 3S8WA 5F7WC 3RWIA 2R4RH 4X4ME 4Y5YC 4LLWA 4Q9RL 4I77L 3SE3A 4PBXA 5JPNA 3D25B 2HMIC 4L1DA 1E4WL 2XFXA 4X6FB 3ARDC 4XTRD 3MV11 3O3DB 5EU4B 5D70L 4I48A 1YQVH 1IBGH 4XMPH 4DN3L 1EEYA 3S37L 5FK9A 5BO1L 5IMKA 5CJBA 2VAAA 4O58H 4ZO8A 5ETUA 1DBBH 5FM8A 3K4AA 5D5MB 3TVMD 4KZEH 4FTVB 4PGDA 4LSPH 1YN6A 1NGPH 3E6FA 3ULUD 4UNVA 4OCMC 3S5LG 4D2NA 3OXSB 2UZXB 3H0TB 4MXVE 3VE0A 1BFSA 2XN9B 3DVIA 3A6CH 1S7WB 1ZHKB 2EH7H 4EI5C 1T04B 1Q0XH 5SWSE 1AD9B 1MFBL 4KU1A 4LP5A 2C3VB 4TSAH 3OF6D 3OWEA 4JJ5A 2D03H 3WL9B 1QRNA 4RAUB 4UV4H 1PDKA 4ZFOA 1MCOL 4JFQA 2FJFA 1ADQL 5A43C 4UTBL 3W9EB 2QQKL 4UTAH 3NFPA 3T0AA 1JPFA 2YD8A 1LQSR 1PY4A 3GSXA 3IXTB 2EH8H 5A2IH 3PGCA 5IHLB 1GGIH 1I9RL 1UM6L 1F6LL 3I3DA 5KVEH 4CMMA 1JZ3A 2NY3B 4RAVB 4JFXB 4PG2C 3RNQB 5JLZB 3BKCL 4AJ0A 4NRXA 4HK3N 2P43B 5I74C 1FC1A 1KG0A 4XCFL 1J9CT 1VFOA 4D0DB 5DZLA 3AC0A 4QHMA 1NCCL 2A74B 2WBJC 4ERSL 4YXHH 3GI8H 3J7HA 1ZTXL 5KOVC 3MREB 1JF1A 3QDJD 4X5WA 3GK8L 2VDLL 1LDPL 3CFCH 1ZHLB 4LLAA 2CQVA 3QG7H 3MV9E 4Y5VB 4I1NB 2B7DT 2DDQH 2QQLL 3RTQA 4ZTOL 2ZUSA 4KVNL 5C6WH 3VRJB 5ACLA 4MB4A 4PRPD 2D7OA 3QDGB 2QSQA 3UCRA 2B0SH 3B83A 3RWFB 3OG6B 1J0KA 1JFMA 3LRHA 3NABH 3TO2B 1C1EH 3L5WA 1U6AL 2DD8L 4QHUA 1W72A 3STBA 2D4FA 3T8XA 3TNNB 3B43A 1OGAA 3FFCD 3M17B 4JE4B 3GJFB 4LOUC 1NBYA 5TH2B 2QEJA 5JHLL 4YZFE 4OFPA 1OSZB 3HUJF 4HUUA 3QQ9D 2CDEB 1WF5A 3HZMB 4BFBD 5I30H 3I6KB 2VXSL 1U93B 2MJWA 4DCQB 4DOHE 5TE6L 3MOBH 3NPSB 1UB5A 1C08B 5D1QC 4M3KB 1UZ6E 3DOSA 2NZ9C 3WS3B 5ANMA 4OFKA 3HFMH 2DQGH 2C7UB 4GQ9H 4KTEH 5J57B 1BFVL 1KIQB 2O5YL 1K2DB 1L9NA 1RZJH 2JELL 4L3EA 2IWGA 3T65B 4L9LC 5L0QC 1ORSA 3GSOA 4LSTL 4LQ1A 4S0TD 4LEXH 2DWEA 1I8MB 2W0FA 4ZDHB 3C5ZA 5ERWA 1UQSB 2ESVA 3K2MC 5ADPH 4YBHA 4X0KA 1G6RL 1JGVH 2Z35B 1AJ7L 4F9LA 5J1AB 3WBDA 3O4LE 2NW2A 4P3CL 2P7TA 2VWEC 2DLTA 3B9DA 5DVNA 1UT9A 5IQ7H 5IW6B 4OGXL 1FG2A 5CGTA 3EYSL 1NMBL 1RJYB 3S34L 4HLZG 3TV3H 4QRTA 4ZQKA 4PRIB 5HYQB 4CUCA 5IVXE 1FLTX 2XWBB 5DQJA 5ESQB 4Z95L 4JZJC 2VDQL 1KLFA 1WFUA 3ETBF 2PXYD 4Z7NF 4X6BB 3B8YA 5DJYA 4XT1C 4KUCD 2AJ3B 3QI9A 2ZJSH 3MV7D 4LAJH 3KPSA 3BP4B 4KJWC 5T3ZH 3WV0A 4Q2ZA 5T1KB 3NH7H 1FFOA 1QLEL 2OJZL 1OTSC 4ODWA 4R96B 5DHVB 3CFKA 3MRMB 3PL6D 4OF7A 1AFVH 3VRIB 4XBGA 1U8QB 3SBWA 4L8CB 4NNPL 2D7TH 1QFWM 1FIGL 3A67H 2M26A 3MOAH 3UTTE 2ZZUT 4YIQB 1XZ0A 4OZHB 3U36A 3U2SB 5KW9L 1TCRB 3MYJA 3WFCL 2FSEA 4X9BA 5E6ID 3ESUF 3HUJA 2GTWB 2HJFA 1KT2A 5C7XH 5EZJB 2HH0H 4JO2L 3SGKC 1KEML 5EU7C 5DJXB 3VD9A 4NQDE 4KKAC 2BNRD 3K46A 4UU9A 2EDWA 3P9MB 1MF2L 4PTUB 5I1KL 2YPLE 5JTWA 2VISB 3RY6A 3SDCD 4XCNA 4HIJA 4NYLA 4L29B 5HVGB 3PWVA 2V7NA 4GKSB 1F3DH 3TO4A 1K4CA 2JJTA 3UTSD 1LO5A 5D7LD 5CIPA 3GRWL 3HE6C 2NXYB 4Q6IB 4OCSL 2CIIB 3MXWH 4OUUA 1DBKL 2ERJB 3GBML 4RQQA 1Q9KB 3I2CH 4JO3H 4P48A 3V6FB 2AXFB 4PJ7E 2R69H 5I1GL 1UVQA 4N1CA 1P4LA 1MJJA 3PNWB 2J4WL 1FVCA 3VXRA 1FL6A 1NCWH 2X4NA 5HI4D 1A6AB 3V4PL 5HVWA 1NJ9A 2XG5A 4TQEH 3HI1A 4MNGA 1YNLH 5I76A 4HBCH 4EEEA 3D39A 1B0GB 3EOAB 4P46D 4Y16B 4Z7WF 4OCYL 5GJSL 5DLML 1UZ8B 1D9KB 4JVUA 3MRKB 1R3IH 4Y5XC 4LDOB 5DD3H 2BERA 3H9SA 2B4CC 2EYSB 5HDQL 3ULVF 3QO1B 4NUGH 4UI2A 1B0RB 4L8BB 3OB8A 2VLJA 4PJDB 2R0LL 2R4SH 3BRDA 4LCUB 3L3HB 4PJGB 3IDIA 4O51B 4YO0A 1ZSDA 1XF3A 4PRNB 3QPXL 2V5SA 2XNAA 3I84A 3VFSA 3MGTA 4JRYB 1B4RA 1CD1B 1FNLA 2K3TA 3BE1H 4LVNB 5DXWA 5EU5B 4X6EA 2FIKB 3O3AA 5FGBC 1DL7L 3ZTJH 4MA3A 2ZCHL 1BFTA 3WIFA 3LPWA 2A9NH 1RK0A 3QCTL 5E4EC 5IBTH 2Z8VC 2DKUA 2P5WB 3MLVL 1WAAE 4U6YA 1GGBL 1CDYA 5KVMC 3BVNA 5KANI 5BQ7B 4P99A 4NKDA 4XH2B 2E7LE 4NN7C 4K23L 4WGWB 5D96C 2JCCE 2JTDA 4JDTL 1YEGH 5I17A 5J12C 1FCGA 1FNFA 1J8HB 3GI9H 3OAZK 4XHQA 3BJ91 1P7HL 4LBEB 1MOEA 3MA7A 3MFFA 4DEPB 4MJIA 4PV9B 1E4JA 4WFHE 4FQXB 2VL5B 4ELMB 2NY4D 5D7JB 1TJGH 4F33B 3LKPB 4J3XA 2LE9A 2VXUL 1RUPH 4EXKA 1N7ML 4OAWA 4PRDA 4PJCB 3MRJA 1P6AB 5DHYA 5IB3B 1M6OB 4XPGL 1E4XH 3MNWA 1U8OB 1S9XA 3VD3A 4C58B 1T20A 2Q8BL 1FAKT 4DUXA 4RZCB 2EKSA 1WTLA 2DLFL 3IDMB 1NAML 3B2UC 4L3CA 4UDTA 4IRJC 4Z7WA 4F7EA 5KANG 1WEJL 3SGEI 1UJ3C 1YY8A 4G6MH 3MYZA 1ZLSL 2RR3A 3TYGL 1J0YA 1RUQL 2E9IA 2J8UB 4NQXA 1FN4A 1L7IH 4GRWH 4NM4H 2VOTA 2AJZB 1FORH 5SX5K 1N5YH 3FTGA 1DLHB 3U6RA 4HMDA 1EEZB 1I1FA 3THML 5IMMB 2X4RA 1BZQK 1VPOL 3PGFH 3UTPE 2EE6A 2IH1B 2L7UA 1WCBA 4QT5A 1ZVYA 1WC7B 1GGUA 1S9WB 1P4BL 4LSUL 2OR7A 3OTTA 4FNLL 3JZ7A 4Q9QH 2H32B 5DDHA 3CCHA 3D18B 1I8IA 2WINB 2E8YA 3LEVH 2FYYA 4NC0B 1PKQB 4APQD 4P4KC 3GSWB 4MXQD 2YRPA 1A0QH 3FFDB 1OAYH 3QNXA 3WKNA 1T2QH 3FOLB 4OCLC 2DQTL 5DMGD 1G7MB 2WWKO 5D5MF 2NYYC 5C08B 1RZKC 3LS4L 3REWB 1T1YB 5HGAA 1RIUL 5IKCB 5FF6B 4PBVC 5SX4I 4XNZC 5K93A 3WJJA 5CWSB 2HG5A 4FQPA 3T0EB 1JNHB 1MFAL 5F1SA 3OAYK 3I6GB 2XZAL 3QXDA 2DKMA 1A7OH 2GTZA 4KROB 4B53A 2AS5M 7FABL 1MIMH 4M1GL 3MBEC 2GK0B 5DYOA 1UEMA 3WN5A 3C9NA 2EXYC 3DRQB 4PJ5A 5CCKH 5E08L 3PHOB 2F54E 1TXKA 3FOMB 1I8LA 4ZSOA 5JIHA 3LMJH 1ZHBB 4QXUH 4AT6A 4OM1H 3T0WA 5DRZA 4CL7A 3JWOL 2NX5D 4HS3B 5C0FB 3SGDH 4DZ8A 3U79A 3RKDC 3C87A 5DJ6B 4PJ9B 5HYEA 3IYLW 5EO9B 4FABL 4OLYH 4F3FA 3C8KA 5ID1B 5A2KH 3SE3C 5I8EB 1G7QA 4WV1B 4TVSa 1BWWA 3BZEB 1P7QA 4NQCA 5E2TH 1VESA 5IP4A 1S8DB 1Q0YH 1R3JB 2PETA 4BZ2L 5L7XL 5IMOB 5IB2B 4M6OH 1T22B 3FQNA 5JOFB 3P9WB 4ODSL 4HFUH 2VIRB 3GJEB 1FE8L 3QR2A 3LHPH 2JB5L 2XTJD 3CDCA 2H6PB 2QADC 3WLBA 5INCB 4FHBD 4TVPH 3JXAA 3ARGD 1MCRA 3D25A 4GG6E 1AGDA 1TFHA 2UY7A 1U41A 4X6FA 3LDBC 3W2DL 4M3JA 1Z9OA 3O3DA 4KMQA 5EU4A 5KZCB 1LD9B 4X80L 4M1DL 1A4JB 1XR9B 3N9GL 3CZFB 5C0CD 2JIXD 3RU8L 3NCMA 5GGQH 3G04A 2B4CH 5D5MA 1VGKB 4K9EL 1SY6L 2YXFA 4FTVA 3O4OB 1EEUA 3U1SL 2YZ8A 1FBIL 3L5HA 4HWNA 4DVBB 4BQCA 3UAJC 3OAUL 4WW1B 3LQAC 3OXSA 3H0TA 3RGHA 5B4MC 4DQOL 1SVZA 2XN9A 4M9PA 1T04A 1EHNA 3U0WH 2AJUH 4KMTL 1AD9A 4NSKB 1X5AA 5ANME 4CJ1A 4OLWH 3ROLB 4FG6C 1CXIA 1FV1A 1U8IB 4RAUA 3NCYS 5HD8D 5F89B 3ZYJA 2X89A 4YK4B 3IFLL 3W9EA 2I60L 1BQSA 1LO0L 3IXTA 4OTXH 3IVKB 5JMOC 1BBDL 5F8RC 1IQWL 2I9LB 1QFUL 4JQIL 2WMPA 1QSFE 1QYGL 5FFLA 1QRKA 3BWUC 4JZNB 4RAVA 4JFXA 5JLZA 3RNQA 2DIAA 2J12B 3RTQC 3JWDC 3F7RA 3KPOB 3IB4A 3MJ6A 3V5KB 1EXUB 3GSNB 3V8OA 5IT2H 3KPRD 4D0DA 4TN9A 1OAUH 1D5IH 4PGBB 5I15H 4QRRE 4RGMC 4KRPC 4G6KL 5HHNA 1H0DA 5H2BB 4RSVA 2XZQL 1GH7A 2CUMA 4UNUA 2CLVA 3MREA 2OXGA 1KCVH 3DX6B 4NPYB 4ZMAT 1ZHLA 2BY2A 5SX5H 1HN1A 4Y5VA 1IAIL 3TCXA 1EVTC 4GXUN 3VRJA 3RI5F 2OBGA 2DYPB 4R7NB 2D0HA 2F58L 3QDGA 2GYSA 5MEQB 5IVOA 3RWFA 3N1PC 4XMLL 3GDBA 2X7LB 3TO2A 1ZLWH 4NUJB 1R0AL 4Y4KB 4MMZC 4XP6L 1P7KB 4QRQB 1F8TH 4NN5C 5T1DL 1RZ7L 2YWYA 5D71L 1JZ4A 3TNNA 4OZHF 2CKBH 3M17A 4MJ6B 3GJFA 4GUPB 5TH2A 1Q9LB 4V1DE 1CBVH 2DQIH 1OSZA 1U8JB 4GT7A 1RVFH 1T3FB 3I6KA 4U6VL 2FGWH 1U93A 5BMFH 1MEXH 3T0DA 1C08A 2E27L 3N0PB 1GGTA 2HN7B 3IU4H 1KC5H 3WS3A 4F9LC 2Z4QB 2C7UA 1YYML 1K2DA 2VLME 3OAYH 4Y19E 2AQ2A 1FDLH 2FCBA 1IGIL 2NY1C 4LF3B 3T65A 3QZWB 2R4RL 3RVWC 5JXAH 1WZLA 5F7LB 1ZA3A 4QF1B 5HHME 3TN0D 2RFXB 3P2TA 2F8XC 2ZUTA 4ODBD 1MFCH 1I8MA 4ZDHA 1RZKH 2OTPA 1UQSA 2HT4C 1CGVA 3JVGA 4BSWB 1YQVL 4JVPA 4XMPL 5HI3D 1BIIB 2Z35A 5J1AA 4O58L 3D2UB 2EIZB 2YWZA 4F7TB 1DBBL 3OPZH 4HCRH 4PG9B 3SO3B 3QI9C 1T4KB 5J1SC 4KZEL 3IFNH 4LSPL 4FFWC 1NGPL 4KI5D 4JKPH 4HIXH 1J1XH 5IW6A 1HHGB 2ITDB 1FZOB 5CLWA 3DO3A 5KAQF 1RJYA 4JRXD 2OTUB 3SBWC 3SEPA 3A6CL 4PRIA 5HYQA 1FAIH 1U42A 2XWBA 2EH7L 5ESQA 1Q0XL 4X6DE 5D1ZD 5I16B 4Z77B 4X6BA 1AGEB 2AJ3A 4PJDF 5JUEH 4TSAL 4JANA 4N8CH 3V0VB 1BVKB 4PJGF 3WEXB 3BP4A 2O61B 5T1KA 1XGPB 4UV4L 5DHVA 2YXMA 1C12B 1FHGA 3MRMA 3TBSB 3VRIA 1AE6H 4UTAL 3J8F7 2EYRB 1U8QA 4L8CA 1DQDL 3QEUB 4XX1E 1IJ9A 3BKMH 2Y72A 4YHMH 2EH8L 3RY6C 3STZB 5DVLA 4YIQA 4OZHA 1GGIL 3K1KC 5KVEL 1JWMB 3U2SA 1MQKH 1TCRA 4N5ED 1KIRB 5HDOA 5JOPE 3TO4C 2GTWA 4EUPB 3V6OE 2JJTC 3MUY1 1MCJA 5EZJA 4XI5D 3B9AA 1HYSD 1H3GA 3VDBA 3ARQA 4C59B 1HXMB 1PX4A 5DJXA 3FT4B 5LVEA 2DM3A 4PTUA 1FP5A 3GI8L 5KOMC 2VISA 1EX0A 4L29A 3QCUL 2H2SC 3CFCL 4Y0GA 2DL2A 3RWEB 4GKSA 5D8JH 1A6VH 2MOVA 2AABH 2DDQL 3FO0H 4RFNB 1J0IA 2ZUQC 3VA6A 4LCIH 3L3GB 4Q6IA 4ELMF 2CIIA 4M93C 1DQQB 3SDDB 4YBQD 2B0SL 1Q9KA 2J5LC 4KRLB 3TBWB 5CFHA 1HOCB 1XFPA 3LQAH 3V6FA 2AXFA 3WE6B 1OHQA 2HLFC 2E9JA 4PJCF 3NABL 1NMCC 1QHPA 1AQDB 1C1EL 3K74B 3PNWA 4G8GD 2G9HB 4G5ZH 2W9DH 1LP9E 1A6AA 3CD4A 1H15B 4TUOA 3GGWB 4Z7WE 4KFZC 2EC8A 2UZIH 1K4DB 3EOAA 5F9WC 4Y16A 1XMWA 4IS6B 1UZ8A 1D9KA 1C7TA 3MRKA 3I9GH 3S4SG 5LAXB 2J8UF 3PV6B 2EYSA 1A1MB 3MA9H 1IZJA 5I30L 3QO1A 1GGCH 1B0RA 3OHXA 2ORBH 1AXSB 4PJDA 2AXGB 2AI0H 1PKOA 4LCUA 1U3JA 3L3HA 5AD0B 4PJGA 4O51A 4P57A 2DQGL 4GQ9L 4JPKH 4KTEL 4PRNA 3V6OC 1RZJL 4NQEE 3W39B 4JRYA 1CD1A 3BP7A 1IT9H 5EU5A 2FIKA 2GSIB 5CKGA 3WFZA 4DKEH 2JLLA 3JWDH 4U1MB 3NA9H 4LEXL 5DTFB 3ZE0F 1I9JH 3EJZC 1CICB 3ARRA 2FRGP 15C8H 3EDKA 4PUBH 5ADPL 2P5WA 5HGHB 4RMWA 5BS0E 4N0UB 1C5DB 4KQ3H 5BQ7A 3IJSB 4N8VB 1W72H 3ARFD 5J0BA 2OX5A 3VXMB 2GIYA 5IQ7L 2BHZA 1T0MB 2W91A 4LHUB 1HSBB 5A16B 3TPUB 3C2AH 1J8HA 3TV3L 5EWIH 5C0EB 1G84A 3ARPA 3O2WH 1YUHB 4LBEA 4LKCB 3CNKA 4G9FD 3RVTC 4PV9A 4YHLH 3AAZA 5CEXB 4FQXA 2VL5A 2D3VA 4ELMA 1AD0B 2ZJSL 3C08H 5D7JA 1KLGB 4P5TD 4F33A 3LKPA 5T3ZL 3ULVC 3NH7L 1QO3B 1H3XA 2APTA 3L3JA 4HH9A 4PJCA 1IAII 5IB3A 1QSVA 1U8OA 2P46B 2D7TL 3OKKA 2XWTB 3A67L 5EZIH 3IDMA 1KACB 3MOAL 1ZXQA 5JR1H 4ZODA 4RMSA 4WIQA 1CVSC 1L8JA 4MMXC 1KPRB 4NO3B 4P2RD 2J8UA 5IGXH 1F02I 5TF1H 5C7XL 4M03A 2HH0L 1M7IA 1OGAD 5IEKB 5A40E 1TVBB 2AJZA 2EDRA 2AEQH 1DLHA 4JGUA 1ZT7B 5IMMA 2YN5A 4FOMA 3WD5H 1UM5H 2IH1A 1WC7A 4LASH 3O6FD 3N06B 3SHSA 1S9WA 1L0YA 3V4UH 2IH3B 1CFTB 3QQNA 3WJJC 4RIRA 3HC4H 2H32A 3IDXH 5BVPH 3MXWL 3D18A 1Y18B 1C5CH 2E6QA 2WINA 4RFEB 3I2CL 4MGXA 5ADOH 5IHZA 1PKQA 3VH8G 4JO3L 3GSWA 2Y36H 4EN3B 5FYJE 3UEZA 3C5ZD 3FOLA 4FMFA 3CDYA 5IV2B 1YNKH 1G7MA 2FDBP 4TQEL 4JGJA 3WN5C 5C08A 1YNLL 3RL1B 3REWA 1T1YA 1I8LC 3V79C 5IKCA 5FF6A 5IW1B 5CWSA 5EOQH 5KS9E 4RNRB 1JNHA 1R3IL 1X7QB 2IGFH 1TENA 1YEJH 3RVWD 1NDGB 3I6GA 1CGTA 3F7YB 2ZUXA 4F8TA 4NUGL 4WI9A 3T08A 2R4SL 2GK0A 3VD7A 3MZTA 5DJ0B 3RIAF 3BDYL 3DRQA 4G9DB 2GI7A 3PHOA 3KLHD 3FOMA 3BPLB 1KIPB 1ZHBA 4I9WD 2MCG1 1XT5A 2V5YA 5T33H 3L6FB 5SV4A 5CIPH 4KTYA 4S2SB 1RK1B 4HS3A 5C0FA 2N7BA 4WWKB 3S37X 4PJ9A 5BVJB 5EO9A 3PQYE 5IBTL 3GZKA 3X17A 1IGYB 5ID1A 1DVFD 4NNXB 5I8EA 4P23A 4HXBL 3BP5B 3I3BA 4WV1A 3BZEA 1DBMH 1S8DA 4KHTH 1R3JA 5IMOA 5IB2A 5JOFA 5TDNB 1DQJA 2VIRA 4M1CD 1YEGL 3AS2A 4PYGA 5FCSH 2H6PA 2NQCA 3GI9L 3MZGB 2NY7H 3VWJC 3PWLB 4J3UA 5INCA 1MLCB 3N85H 2BNQE 4FFVD 4I18B 4L4TD 3DARA 1TJGL 4FRWA 4LSQH 4M8VA 4HGMA 1LD9A 2W38A 3DGGB 1A4JA 1RUPL 1XR9A 3CZFA 4B7LA 4UB0H 5DRXB 1E4XL 3IDGA 2M8XA 1VGKA 4JHWH 5KSAD 5FIEA 1D6VH 4GW1B 4DVBA 4P2CG 4D9QD 4G6ML 5BOZG 2H2PC 2IAND 1FLRH 1XH3B 1WIPA 1TMCB 1B0WA 1L7IL 4NM4L 1A4KB 1FORL 2KPNA 1N5YL 1A1OB 5GGTL 4NSKA 3DNKA 1N6UA 2C4FT 4G8EB 2NY3C 4ZPTB 1ZGLP 4K71B 4AENB 3SKOB 2YUZA 1U8IA 2HLFD 3B3IB 5GSVB 5F89A 1LGVA 3X3GL 5L8KB 1DEEB 3FN3A 2X4UB 1SJHB 1DZBA 3LCYA 3M07A 3QHFL 3VWKD 2YEZA 2HFGH 2FO1A 5C2BH 4HXAH 4Q9QL 3OR6B 4U31A 3IVKA 4JPIB 4OZIB 3LEVL 5IG7B 2HRPH 3Q5YA 4JZNA 3S97C 1A0QL 1OAYL 4Y5VC 1T2QL 3KPOA 1H3WM 3V5KA 1EXUA 3GSNA 1FL3B 3QPQC 4J2XA 2GEEA 1P69B 1V7NH 1JGDB 1TTUA 4PGBA 1WIUA 5FO7B 3GMPB 1MQ8A 3VFVB 5H2BA 4W4OA 4RISH 4E41D 1FYTE 3DX6A 3QEQD 4NPYA 4PGCB 3CFEB 3ULVH 3DGCR 1LO2H 4JZOB 2DQDH 4WGVB 2D7PA 3PF2A 1A7OL 3RDTB 4NFDA 4Z7UE 2FBJH 1B2WH 4I0PB 4BKLB 4JFFA 5HHVH 2NY6D 1G9ML 4R7NA 5CCKL 2AK4A 3VFTB 5MEQA 1D5XB 1A47A 4M7JH 3AFLA 3LMJL 3S35H 1IEAB 2X7LA 3T2PA 2VDMH 1F4WH 3NPSC 4NUJA 4Y4KA 3RBSA 1P7KA 1VKXB 5C0AE 1NCNA 2VR9A 4QRQA 5BZDB 2CXGA 1MHPH 3R4DA 2R56L 4GUPA 4M7LL 1EMTH 1Q9LA 1OTTD 3DRTB 5CBAB 4U1GC 1U8JA 3SGJA 4KJPC 2IPKB 5E2TL 3TFKA 4PP1C 5MENE 2OK0H 3QIWB 3JVGC 1Q0YL 2R2BB 4RGNB 5DRNB 3LOWA 2X4QA 2ZSVB 5EH1A 4UQ2B 3WSQH 4QO1A 5IM7B 1AP2B 5KVFH 1DJSA 4LF3A 3QZWA 1Q1JL 4TVPL 5F1NB 1EZVX 4L1HA 4ORGB 4LMQI 4QF1A 2RFXA 3WUZA 2DM4A 2SEBB 35C8H 4BSWA 1BJ1H 4X6CB 1WIOA 5C07B 5F9AC 5F88B 3QDMB 2X4TB 4UIKH 3T0VA 3HPJB 3V2AR 4DGYH 3D2UA 3E0GA 3L95B 2EIZA 3OB0H 4HJJH 5GGQL 4F7TA 4PJXE 3ARBB 4PG9A 1I3RA 1T4KA 1ULVA 3B2VH 4ZUUB 3HMXA 4TUKL 3QIBD 2BRQA 1TNMA 5LWYH 4PJFB 1M1SA 2P8PB 1HHGA 1CQKA 1V3KA 2ITDA 1FZOA 3LQMA 1RU9H 2OTUA 4AEIH 1G1CA 3IAQA 4YDLB 2K9UA 4Y4HD 3WXVH 1VFBB 3QUXD 2NTSP 5JQ6H 3RHWF 2BHYA 5I16A 5L2KE 2XY2A 3U0WL 2AJUL 4Z77A 4MXWL 1WT5A 4MD0A 1AGEA 1DE4B 4XNUH 4NHUE 1T5XA 4KGLA 4OLWL 3V0VA 1BVKA 3QUYD 4ZS6C 4BSVB 2O61A 3HKFA 3GM0A 1XGPA 3HG1D 4LPYA 1C12A 1Y6KR 4HIEB 4OBRA 3WDIA 2EYRA 4KK5C 2ZWLT 1MELA 3QEUA 3ZYOA 4OTXL 5TPWH 2MSPA 3STZA 3UYRH 1JWMA 2YA2A 5HYSG 1ZEAH 5C3TA 1MSPA 1FGVH 4EUPA 2R9HC 2NXYC 1IM3B 4Q6IC 1HXMA 5IQ9B 2VLKD 5IT2L 3FT4A 3CJJA 3NIGF 1OAUL 1D5IL 1SM3H 5I15L 4Z6AT 4GMSH 1QBBA 1P7QD 4NQCD 1BLNB 1MFNA 3QHTC 1KCVL 2AP2A 2PNDA 3VGEA 1V7MH 2K7PA 1IC4H 2JB6B 1HILB 1U95B 2XI9A 2ATPB 3RWEA 2Y7QB 4XXDB 4Y16C 1EO8H 2ZPKH 2B39A 1JL8A 1P4IH 4X5LA 3KXFB 1D9KC 3L3GA 1OP5K 1DQQA 3SDDA 5L8JB 4M5YH 5FO8A 3TBWA 1HOCA 3TWCH 4P2QA 1D5MB 1RJCA 1AQDA 5IBUG 2G9HA 1DANT 4IOIB 43CAB 1H15A 3GGWA 4MS8D 1K4DA 1F8TL 4IS6A 3ZTJG 2Y5TB 3U83A 2IBGA 1T7XA 2CKBL 4UQ3B 4LVNC 2C4FU 4FTVD 1E4XI 4HAGA 4R90H 2ZUYA 5LGJB 3CXDH 4JFEE 2DQIL 2Z92B 5E1AB 5LAXA 3PV6A 5C09D 3CXHJ 1A1MA 4PB0H 4HPOH 2I27N 1KUMA 1RVFL 2YHGA 3QXTA 2FGWL 1T1XB 3MRHA 3R0NA 5CZVH 1BF8A 1CR9H 1AXSA 2AXGA 5E5MB 3IU4L 1NEZG 1VERA 2R0WH 1KC5L 2X9WA 2V2TB 1AGCB 1UGNA 2PR4H 1K8DB 1WK0A 3EYQC 3CH1B 1OAZH 3W39A 1JHLH 2QSTA 1RZIA 3D6GA 2GSIA 5JXAL 1IEBA 3GNML 4U1MA 5DTFA 2HFFB 2DBLH 1CICA 1MFCL 4DKFH 5MHSD 5DJZB 1MPAH 1RZKL 1S7UA 4CMHB 1O5DT 2QBWA 5J1TC 1TDQA 1VDGA 4LIQE 4DEPC 1MCLA 4OCWH 4QXGL 4W6XB 5HHQB 3IU3B 4FQXC 3OPZL 4HCRL 4N0UA 4H88L 5D7JC 3IFNL 1J05B 3IJSA 3ZE2F 4N8VA 3RVUD 4JKPL 1CTNA 4HIXL 1A7RH 3VXMA 5F9JB 3MRPB 1J1XL 3WLWC 4IOFC 4YHNB 3GJFH 1T0MA 4LHUA 1HSBA 5A16A 3VCLB 3TPUA 5C0EA 4Z18A 5JW5A 1FAIL 1YUHA 4LKCA 3DROB 2YUXA 1T7WA 4NQUA 3OGOE 5CEXA 4D0BB 4UZGA 1AD0A 2P24A 5JUEL 1KLGA 4N8CL 3B9VA 1INDH 4FXGB 1F3DJ 2BSTB 3QDJB 3Q48A 1QO3A 3K1DA 2Z8SA 4UT6H 3VMOA 2B20A 5T3XE 2FEEI 1IILE 3V5DB 4Z7QE 4PRPB 2XWTA 3BKML 4R6UA 5ILTL 3SOBH 5D2NB 5DO2C 3VFGH 3U4AA 5D72H 3S5LB 4QY8A 4HUXA 1MQKL 2VH5H 1KPRA 3O8XD 4NO3A 5F7DB 4BFEA 2BJML 4WTWA 2WWMD 3KJ6H 4S1DD 5IEKA 3UTZB 5L9DH 4DZBB 4M7LT 2AGJH 5J9PB 5ISZB 2WSKA 2B5IC 3FFCB 1ZT7A 2YSSB 5F7KC 1NC4B 2GKIA 1AO7E 5SWSD 4MX7B 4LP4A 5HTSA 3MLRH 4PLJD 4YHKH 5IWLA 3MX0A 1A6VL 2FL5B 2AABL 4MVBD 2IH3A 4IRSD 1CFTA 3E3QE 4XPBH 2YRLA 4C4KT 1JFQH 4LCIL 3GBNH 1Y18A 3HRZB 4LSVH 4RFEA 4ZFOL 2P5EE 3OKOB 3T3ME 4N0CA 5HYFA 1CZ8H 4KROC 4Z7VB 2ICEB 4KH2A 5IV2A 4G5ZL 2W9DL 2UZIL 3MOQA 1OD9A 2A6DB 4L9DA 2VABB 1H8NA 5IW1A 4GW5B 4Z78B 4RNRA 1X7QA 5ICXB 3H42H 3I9GL 3CH8A 1NDGA 3Q5TA 3MA9L 4PS4H 4P5KB 3F7YA 1GGCL 4F58H 2ORBL 4PJ9C 3VFRB 3CU7A 2AI0L 4JO4H 5FYLE 5DJ0A 3BH8B 4P23C 3MV9D 4JPKL 4WV1C 1KJVB 5E8PB 1KIPA 4JKLA 1IT9L 2XIDA 2ZNXA 3D0VB 2DWDB 4HDIB 1GSMA 3L6FA 7CGTA 2C3XA 2PXYB 4WFFE 1RFDL 3JWDL 1JZ2A 3NA9L 1YQ2A 1I9JL 4S2SA 1RK1A 3MV7B 3T09A 3IJHB 1OP5H 2LFGA 5ALCH 15C8L 4KKCC 3AGVA 5D4QA 4WWKA 1IFHH 3ILQC 3AROA 5BVJA 1XF5B 3PL6B 3EIFA 1IGYA 1Z6JT 1ZA6B 4NNXA 4U1SB 3DIFB 2UY6A 4HT1H 6CGTA 3BP5A 4HJ0D 3NIFF 5TDPA 4KQ3L 1NBVH 2F74B 3E3QC 4XP1H 1EK3A 5FKPB 4IHOB 4JHAH 3MCLH 5TDNA 3F5WB 5HHXL 1OY3B 4AM0B 5E6IB 1K9TA 4J12A 4X7SH 3C2AL 5EWIL 3PWLA 3O4OC 3O2WL 1MLCA 4JFFE 4ACPA 5HI5D 4ODTH 1Z5LB 2BNRB 4CNIB 4I18A 5HHOE 3C08L 1KLUB 2AK4E 4LCWE 1A5FH 5DD6B 3QXUA 2BNUB 4BUHA 3QHZH 3I6LE 3DGGA 2OM5A 2EDQA 1N64H 3X14B 4P0DA 1OT2A 1DUZB 3UTSB 5D7LB 5E0QA 5EZIL 1U8PB 2R2HB 4GW1A 5JR1L 3O4LD 2WV3A 3VXNB 2FH8A 4MQ7B 5IGXL 1XH3A 4MQXC 1TNNA 5TF1L 1TMCA 4O4YH 4X4XB 1VFUA 1A4KA 1EFQA 5I0ZA 32C2B 3EHBC 1D9KD 1A1OA 3BQUD 3SCMD 2HKFH 2AEQL 3ZKMC 2XXMB 4ZPTA 4G8EA 3MBXH 1YMME 4N1EA 4AENA 3WD5L 1UM5L 3LRSB 1MRFH 3B3IA 1OB1B 5B3NA 5GSVA 4LASL 2E8ZA 3HNVL 4I13B 2X4UA 3V4UL 1SJHA 3VXUA 5J3HD 3BEVB 2CD0A 4W4OC 2AEWA 3FHQA 1A7PH 3OR6A 3IDXL 4L5FH 2K7QA 1R3HB 1DBJH 4X6CF 2COQA 4KDVA 5ADOL 4G6JH 1BBJB 2Y36L 2DQCL 1X5IA 4QCIB 4G8FB 3B9KB 1FVEB 1B88A 4CADB 1FL3A 3BH9A 4L3AA 4D94A 1GJIA 4UMGA 1JGDA 2DAVA 3BWAB 2P5WD 4NKMB 4PJFF 4M62H 3GMPA 5FO7A 3FZUD 4YXLH 1EA9C 1S7TA 3VFVA 4ZPVB 5EOQL 2DM7A 1EV2E 2XT1B 4NQDD 4Y4KC 2IGFL 2WQ8A 1RMFH 4PGCA 1YEJL 3CFEA 3FRPG 1QBLH 4JZOA 3D3VE 2YPLD 3RDTA 4XPTH 5FM5O 4BKLA 4I0PA 5CILH 3ZZ1A 1J8HD 3BPOC 1WBXB 1PJ9A 3QWRD 1JP5A 3VFTA 1D5XA 3JV4B 3SGJC 1MVUB 1ONQB 4WEBH 5E8NB 3TFKC 1GRWA 4PJIF 1IEAA 5CP7B 1HHJB 3QT2A 5T33L 1VKXA 1AHWA 2H32H 2NY4B 3RZCC 1P5UA 2RQ8A 5BZDA 5GGSB 4G59A 2GY7B 3TJHA 1JK8B 4JKMA 4X7EC 1CFBA 2BY1A 2ED9A 3DRTA 2ZCKH 4HC1A 1CXHA 2IG2H 1M4KA 5DK3A 2IPKA 1I1RA 1DBML 2IC2A 1RD6A 2R2BA 1OLZA 4KHTL 5DRNA 2VLLB 1F4HA 1FVDA 3BZDA 2ZSVA 4UQ2A 4N5UA 3REVA 4U33A 3SO3C 2NY7L 5IM7A 1AP2A 1BQHG 3U9PH 4WTZA 4TNWK 3N85L 5F1NA 4EOWH 4N0RA 1CG9B 4ORGA 1FNSH 2R2CA 1WSST 1W0WB 2LAAA 3C8HA 3C60D 3K8KA 3CVHA 4LSQL 2PUQT 2SEBA 5FGCB 4XPHL 5F8QC 2Q1EA 4X6CA 5C07A 5F88A 3QDMA 2HTLC 2X4TA 4P2QE 4QRPE 3HPJA 4MWFA 4FFEX 3HB3C 2E7BA 4FXKB 2IMNA 4HW6A 2X70B 4UB0L 3L95A 1WT5C 2CR6A 3ARBA 4ODUB 3G6DH 4ZUUA 2VN7A 4JHWL 3MJGX 2DLHA 3QJHA 1WQVT 4P49A 3TZVD 4CJ0A 4XVTH 1T03L 4PJFA 2A2QT 2P8PA 1MCQA 2V2WB 5FOBB 1CIUA 5HVFB 4APQB 5HDLA 1BX2B 1XGRB 5DRWB 4JG0H 1U58B 1YPZB 1G7LB 1YEFH 2BVUA 3DXAE 2WUCH 3ULUF 2C9AA 4TNVK 3T0ED 1DE4A 1EAPA 3R0MA 4QHKI 5I19L 4HFWB 5CD5C 4KK8D 4HIHB 4YPJA 3GIVB 4BSVA 4WFHD 4Z5RB 5H8DA 2WBKA 4PJIA 4HIEA 1TLKA 3KWWB 3AU1A 1U3YA 4HXAL 3LPFA 1CDUA 3IKCB 2HRPL 4XXCA 4IDJH 5CZXD 3FQWB 2R29H 3KDMB 3RY4A 4RFNC 4RCAA 5GXBB 4WJ5B 3VW3H 5CEYB 1V7NL 5IQ9A 3SDDC 3GIZH 4M48H 4UV7H 4FQCH 2BZDA 4QXTB 3VXOB 2X10A 3CLEH 3C8DA 1BLNA 2W9EH 4JY6B 4RISL 4WI7A 4YHIB 2BCKB 4J1UA 1DCLA 3ULVL 1U95A 2DQDL 4U7SA 2ATPA 4NO0D 5B39B 1NC2D 2Y7QA 3UTPD 3RVVC 4XXDA 5EU6E 2FBJL 1B2WL 1A6WH 4KC3B 5FM4A 4LCCA 3KXFA 5HHVL 3KLSA 4DN4L 4XHJD 1Q9WB 4TUJB 3EOTH 3OZ9H 1EJ6A 5JW4Q 4HMEA 4M7JL 3U48A 1NLBL 1DN0B 1IC7H 3UPRB 1TJIH 5KJRH 4JDZA 1D5MA 2VDML 1F4WL 3NPZB 5DEFB 3ARGB 5KZCD 4IOIA 43CAA 3SDAD 3NCJH 5EUOB 2EXWC 4YPGA 1MHPL 1RZ8B 4KVCL 2Y5TA 2GY5A 3LIZH 3H8NA 4UQ3A 3PDDA 5C0CB 2FBOJ 5LGJA 2AJVH 2EYTB 3KS0H 3MRQB 3O6MH 3U7YH 2Z92A 4LFHG 4MD4B 5E1AA 1PSKH 5GISH 1MCNA 3TVMA 3CFDB 1CICC 1HZHH 4AIOA 1T1XA 2OK0L 1L7TH 4M7ZB 4BQ8A 1LEIB 4EIZC 3VJ6B 5E5MA 2V2TA 1AGCA 4MDIB 3WSQL 1KCRL 4U4BA 1K8DA 2DI7A 3CH1A 5FYKH 5MERB 2CDFB 1O0VA 3IF1A 5KVFL 4CU8A 5FO9A 1S7XB 1VA9A 4JJHA 3MODL 2O5ZH 2HFFA 4MNQB 2R39A 3OF6A 4OFYD 1OGTB 5DJZA 1MWAB 2QL1A 1UB6B 35C8L 4F57H 4UIKL 5IB1B 4DGYL 4Z7VF 3GUTA 5HHQA 4HJJL 4NKIH 3IU3A 3BZ4B 2E9WA 2GQHA 3RGVB 4U6TA 3B2VL 1J05A 2XRAH 1SQ2N 2ZG3A 4YC2B 5LWYL 3LAFA 3HHRB 5F9JA 3MRPA 4QKXB 4NBYB 3U4BH 1CXFA 4YHNA 5J4MA 5D7IB 1RU9L 3VCLA 4AEIL 2OSLB 3QBTB 2A0LC 3WXVL 2OI9B 3DROA 5JQ6L 3OKLB 1M71B 3SKNB 2GJ6E 4D0BA 4KK6C 5KSUB 1T2JA 2HJKB 4FXGA 2BSTA 1NCAH 1NFDF 1U3HD 3QDJA 4MLSA 2AEIT 1MIEH 3NA4A 3TIDB 4ZNEA 1PLGH 2XA3A 5BV7B 3DETC 2DYPD 1OVZA 1ZT1B 1CDGA 4LFHD 3V5DA 4CVXB 4HK3J 4PRPA 2PKDA 1IM9D 4DKAA 1T0NB 4MJ2A 5BRZE 2Q7YB 3LQZB 5D2NA 4OF5A 5TPWL 2HT2D 4EQ2A 1X4ZA 3ZL4L 3EFFB 5JDSA 1X6NA 3S5LA 4YGAB 3LSOB 1ZEAL 5FUZH 1FGVL 5F7DA 1BZ7B 3EDJA 1CLOH 1Z0MA 1HWGB 3NCCB 5D9SB 4QHKJ 3UTZA 3BGFB 4MJ5B 4WO4B 4DZBA 1R3KB 2FEDD 3DURB 3PWPB 5ISZA 5DJ8B 5J9PA 1J12A 4P9HC 1SM3L 1OW0A 1J18A 4N0CC 3FFCA 5DUPH 2JJSC 1GPOL 2YSSA 4GMSL 5I8KL 3M8OH 5KTEH 4MX7A 4U6XB 1DN2A 5FA3B 2YZ1A 1PY9A 4HKJA 1V7ML 1IC4L 1MI5E 1I7TB 2DOCA 4MA7H 2FL5A 4KV5F 5ICZB 2ZPKL 4YWGH 1X44A 1ACYH 1L4IA 1P4IL 5GS2D 4CGTA 3HRZA 2IBZX 4XC1H 1QQDA 4M5YL 1S5IH 3OKOA 5FAAA 3TWCL 3HTLX 1GVIA 2D0GA 4WWID 4Z7VA 2ICEA 4K7PH 2A38A 3LZFH 2FATL 4XPFL 1QSFD 3TN0B 3NFSH 3IETB 1NPUA 1F45A 3MGAA 2A6DA 3UMTA 1ZAGA 4NIKB 2VUYA 3BPLC 4UIMB 1F6AB 5D2LE 4Z78A 3CXDL 3U30B 4EUPH 4F37K 3KJ4B 5ICXA 1Y0LB 4QRRD 1W0VB 4NCC1 1UJTA 3BSZH 4PB0L 4HPOL 1YNTB 4P5KA 3B5GA 3QXAB 2OTWA 1JHTB 3AUVA 4WWKC 5E99L 3VFRA 1XGUB 1CR9L 4OZ4B 3ARED 2PCPB 4JRXB 3BH8A 1NFDA 2PR4L 1JGLH 3B5TA 1FL5B 3H9YA 3QDAA 1OAZL 2BMKB 1JHLL 5E8PA 3VXUE 4LVOB 5D1ZB 1SJEB 3D0VA 1P9MC 3ALWA 2DWDA 4KJQD 4HDIA 4CN1A 2PXYA 5CLTA 3O2VH 1AGBB 3MV7A 2DBLL 3IJHA 4DWHA 1TITA 2FZ3B 4DKFL 3CPLB 1XF5A 5E95B 3PL6A 1ZA6A 4JR9H 4U1SA 3DIFA 4PJAB 4RA3A 1KJ2B 4I18C 2F74A 3WNNA 3MRDB 1RI8A 4V1DD 5FKPA 4IHOA 1JNLL 4XNXL 4M7KH 1EHLH 1A7RL 4ZG1A 4CU7A 3W0WE 3F5WA 4AM0A 2YD7A 5E6IA 3UDWA 2LAGB 2CRIA 2UWEE 2XQYK 2UUDK 4XVUD 3HRPA 3LKRA 3V5HB 3EOYG 1A3LL 2YD5A 1Z5LA 2BNRA 2VLMD 4CNIA 2W92A 4H5SB 3DO7A 1KLUA 1INDL 3VXTB 3DI2B 4OJFH 5DD6A 2BNUA 5HHMD 1WCQA 3ZYZA 2VQUA 3IXAB 3L5IA 4UT6L 3ZKSD 5F7UA 4WW2B 1S9VB 3FQRB 4OIIH 1DUZA 3UTSA 5D7LA 4K71C 1U9KA 4BYHA 1OAKH 3SOBL 2R2HA 2N1KA 2ILLA 4XCYB 3VFGL 5D72L 5SWZB 3RPIB 3VXNA 1J88A 1XIWB 2ZOLB 4MQ7A 1MHEB 4NJ9H 1LILA 4XP5H 4G8GB 4Y1AB 3VI3E 4X4XA 4MNHB 1GOGA 32C2A 4JLRB 1TTFA 2AGJL 3O9WB 4OM0H 5EZOH 2BVTA 2C3GA 2EZ0D 5IFHH 3LRSA 3MLRL 4Y88A 2Z91B 4YHKL 4YUEL 5CAYB 1I9IH 1Y6NR 3PWNB 3BEVA 4LRIC 5CEZH 1JFQL 1PD6A 1R3HA 3ARWA 3GBNL 3MV8E 4G6AC 1NQBA 2EEDA 4GKNB 5JMRA 2ADIB 3L9RB 1BBJA 3RDTC 1CZ8L 4OZGF 4I0PC 1FVEA 4X7CC 4CADA 1N0LA 2J8HA 4L4VE 4PV8B 5HYIA 3BWAA 5JOPD 4FQQB 1U8MB 3U46B 3EDEA 4NKMA 2W60B 4WU7B 3CSYB 2KH2B 4X4YB 4XWOC 1X5KA 4LCYA 1HINH 4K8RL 4XCEB 3NGBB 4ZPVA 4ELKA 1MFEH 3S36H 3UBXI 3H42L 1UYWH 3T2NH 4M9OA 1AHWC 4PS4L 5DFWH 1P2CB 1UACH 1YPZF 4LHUD 1MNUL 3LKNB 2MFNA 1FCCA 5AG9A 4YHOH 4JO4L 4H0HB 1WBXA 1FQ9C 3GEWB 4QRSB 5I1LB 3IDYB 4PJIE 1CDBA 3JV4A 1MVUA 1ONQA 1XCTB 5E8NA 4G9FB 4RGNC 5CP7A 3FRUB 5DVOA 1HHJA 4IIQB 1JHKH 3MC0A 4LVEA 1VFMA 5IBLC 2OMNA 2QKIB 3R06B 4QHLA 4I2XE 4P5TB 4RBPK 5ALCL 4K7FB 3LKSB 4P9HH 3L3DB 1IFHL 4EI6B 4LDLB 1QTYT 1JK8A 2OR8A 4N90E 2VLRE 2X1WL 3QG6B 4U1NB 3HZKB 4J4PD 3S4SB 1NBVL 4XP1L 5GGSY 4MJ4A 3R8QA 3UBXG 4JHAL 4MA1C 2VLLA 1MCIA 3MCLL 1FNAA 3QCVH 2MTPA 2XA8H 5HXMA 2P49B 3PGDB 4P2RB 3OR7B 4X7SL 1CQYA 2JJUA 3ARBC 4LGRB 2B1HH 3BKJL 1N26A 2FWOB 4U1LB 5GGVH 1CG9A 4ODTL 1W0WA 4JQVA 1EAJA 1XCQB 25C8L 4JO1L 2APVA 1FYHB 1MCHA 1UXSB 4U3XA 5C70A 4OZGA 3O6FB 1N64L 4BM7A 4FXKA 2X70A 5D93B 1PYWB 4OD3H 2YOCA 4ODUA 1URLA 5HDBF 4EN3D 5BS0D 3L5XH 2BRRH 5HHPB 4M6AA 1ZLUH 4UINH 1SEBB 4E0RB 2V2WA 5FOBA 4C56E 4APQA 4UBDD 5DJAB 4MXQA 4OQ1A 1BX2A 2ICWA 4O4YL 4PJEE 1XGRA 4K3HA 5DRWA 3ULUE 1U58A 5I1HH 1YPZA 3X13B 1G7LA 2VMFA 4BUGA 2HKFL 1MREL 3Q1SH 1CL7H 2HT3C 1MFDL 1HIML 2BVEA 3MBXL 4M6NL 4HFWA 1PEZA 3DVNB 4HIHA 3GIVA 2AJSH 3L3OB 1MRFL 3EYUH 4E9LA 4M6MH 3KWWA 3IGAB 1CGYA 1ADQA 1A7PL 4L5FL 2BSSB 1MCDA 3K4DA 4WHYG 4GRLB 3SPVB 1OCWH 3IKCA 4MCYB 5CJ8A 4LARL 1DBJL 2W0PA 4G6JL 3BDXA 3HZVB 2VNCA 3FQWA 3PE9A 4W6WB 3QIUD 3KDMA 5DJCB 5BOPA 5I1IH 4HJGA 4WJ5A 5DQDH 2OP4H 2NX5A 2I5YH 4LCCC 5CEYA 3T0BA 4JM2C 1HHKA 5LG1A 2J6EA 3PWUB 3QWQB 4MA8H 4PIRF 5C0DB 2GJJA 3KNBB 4YXLL 4M62L 3RZWA 1LE9B 2VZTA 4HKBB 3SKJH 5DSCB 4JY6A 3KAAA 1NUGA 3T0XA 1RMFL 2KQMA 3OXRA 5JZ7D 2PTTB 1QBLL 4XTRC 5B39A 3O45B 4XPTL 4IEFB 3S3JA 4B41A 3RNKB 4OD2B 4TUJA 4AQ1B 1X3DA 5EA0L 3TVMC 3VA2C 3UJIL 1DN0A 3VH8B 3UPRA 4DW2H 3ZHLA 3ULUC 4ZFFA 1BJ1J 5DEFA 3ARGA 4KHXH 3ZE1F 4HGWB 5GZOD 3K3QA 4V2BA 4L4TB 5FYJD 4BFGA 1GHFH 2EDTA 3L1OH 4HF5L 2NNAB 5C0CA 3ALXA 3ALPA 3VFPB 4QGTA 4FFZH 2EYTA 4PRHE 3MRQA 2EDBA 3H6JA 2ZCKL 4DVRH 4MD4A 2JJVA 3D85D 3UTQB 4LVHB 1F5WA 3CFDA 5F6HI 5KSAB 5GGRY 4CMHC 1LEIA 3VJ6A 4CDHA 4LLQB 3O2DL 2ZCLH 5J11B 5CSBA 2IANB 5MERA 5T1LD 2CDFA 4WFGE 1MJUH 3AY4C 3U9PL 1S7XA 1QFPA 4HPYH 3BUTA 3PIQB 4EOWL 1FNSL 1JZ7A 4MNQA 2F53B 1OGTA 1MWAA 3NFNA 1UB6A 1KENL 2M1KA 2AJXH 5FUCE 5IB1A 4EDXB 1ZMYA 3MCKB 2I07A 5J13C 1LE5B 1UKTA 4NZUH 3BZ4A 3VWKB 3PQYD 1UM4H 3G6DL 3VI4F 3S6CA 4BJLA 4RBPH 3SJVE 4XVTL 4RA0C 4PJBE 3CFBB 1KTKE 2A6IB 1N3NA 2OSLA 4HC1H 5T1MB 2OI9A 4JG0L 5B22A 5D2NC 1ZE3C 3WNMA 1YEFL 2P44B 1M71A 3OKLA 3KPRA 3SKNA 3LN4B 4KI5F 2W1NA 5J7CC 1NFDE 5KSUA 3CZJA 2HJKA 2PN5A 3JSSA 5KSBE 2OZ4L 1NANH 2BNQD 5DWUH 1N5AB 2AXHA 3QEQB 3TIDA 2HFEB 4JVWA 3PP4H 5C71A 2BSED 5IROA 1CFQB 2MKWA 5I8CB 1ZT1A 3BHBB 1KB5B 1OW0C 5TQ2H 3EO1B 5JW4R 1ZV5A 1T0NA 1EZVY 2NY6B 2Q7YA 3LQZA 2EIDA 3CVHH 1A7NH 5JHDE 3B6SA 3C09B 1KGCE 3QQ9C 3EFFA 5KN5B 4D3CL 4LAQH 2Z9TA 3LSOA 4IDJL 5FYJU 3UC0H 1BZ7A 2R29L 4PJAF 3VW3L 5D9SA 3TJHD 3HMWH 2KBGA 5F7EH 1R3KA 3DURA 4OZFH 2FB4H 5DJ8A 3GIZL 3ZT5A 4M48L 1FZKB 4EJ1C 4FQLL 4UV7L 4ORZC 4FQCL 4W4NA 4W70A 4RMRA 1DQML 2W9EL 4U6XA 3CSBA 5FA3A 3QIWD 2XYCA 3RUGE 3SDXE 1AR1D 3VG9B 1A6WL 1MAMH 4AH2B 3EOTL 4XCCH 5FYLL 3OZ9L 3VRLF 2X9YA 3H7LA 5EORH 5J6GA 5C0BE 3BXNB 4V3EB 4LK4A 5I66B 1IC7L 3FB7A 4G6FD 5KJRL 1NUNB 4GBXD 4WW2F 1GXEA 4P5MB 3TN0A 4TSBL 2X1XR 3CDFA 3IETA 3QDMD 3NCJL 5F97E 1HXYB 1JMXA 4RX4D 3LIZL 5JW4M 3WUWG 4UIMA 1F6AA 3OL2A 2AJVL 1ZANL 4E42B 5KVDH 3BMVA 2PXYC 1Y0LA 4FQHB 1A3QA 1LK3H 1YNTA 1HZHL 3W82A 3EKCA 3QXAA 1YEKH 1JHTA 1NLDH 1FYTD 4GAJH 1QP1A 1L7TL 4DGVH 3H3KA 1TETH 1XGUA 2ADJB 4J3SA 3D69B 5I1EH 3PL6C 2PCPA 3FB6A 4JRXA 1FL5A 4U2ZA 5KAQG 4KRMB 4Y4HB 5FYKL 2BMKA 4LMQE 4JPWH 1H3PH 4PD4K 5D1ZA 1SJEA 2Z0BA 4BH7B 2O5ZL 1AGBA 5E6IC 1QSEB 2WNGA 1IKFH 2WWKT 2FZ3A 3UDWC 3IS0X 2UYLB 3UYPA 4G7VH 3BD3A 3HG1B 5C0AD 3W5MA 5F6HJ 5SWQB 3WCYA 4Z7OE 3HPLB 4K8RD 1OF2B 4NKIL 4PJAA 5HYJE 1M7DB 1KJ2A 4OIBA 3NVQA 2XRAL 3MRDA 4AEHH 5FA4B 3V6ZB 3VFOB 3DVFA 1EGJA 4JFDE 4N5EA 3RWDB 2AV1B 5MEND 4MSWB 5IFJA 2XXCB 1FO0B 1PAMA 2BXYA 3KHOA 2VLKB 3CK0L 3V5HA 3ULUH 2PYEE 4LPTA 3QFJB 2MHAB 1CE6B 4I3SH 4NNYB 1ZT4B 1O7SA 5E4IA 3T3PF 4WHDA 3VXTA 5B3JF 1A1NB 1EIBA 5SV3A 1NCAL 4PJHB 2P48B 1MIEL 5HI4C 3IXAA 5DD0H 1PLGL 3EDFA 4WW2A 3TH2T 1S9VA 3FQRA 3V0WH 2YD2A 5EC2B 4PY7B 1BZ9B 5FUOH 3HS0B 4Y8DC 3BYYA 1JYXA 4KK9D 4XCYA 3KG5A 5SWZA 3RPIA 3MRGB 2ZOLA 1XIWA 4LSRH 4KKNA 4PJ8B 5FUZL 1MHEA 2BOCB 3Q6GH 1HEZA 4PPTA 4G8GA 1JTTA 4MNHA 5E7FA 4JLRA 2ZUVA 3OKMB 2J7LA 3RIFF 5FB8B 5F6IB 5CMAA 2P8MB 1N6QH 3PUCA 3EO9H 5KTEL 5DUPL 5IESH 3M8OL 1QKZH 3TC9A 3AXLB 5C09B 2Z91A 1OT1A 3VGBA 1A3RH 3VFMB 4RRPA 5AEAA 5E2VH 3PWNA 4MA7L 4IMLB 1A22B 4YWGL 2FGZA 5GRJH 1ACYL 4ONGH 4JCLA 4S1RH 4XC1L 4GKNA 1CLYH 4OZGE 3GMRB 3L9RA 1KB9J 1S5IL 4ALAL 3FO9B 3TP4A 5HYSB 4JN1H 3LZFL 1RULH 3VGGA 4HG4K 4U0RB 1ORQB 3NFSL 4PV8A 2G5BB 4FQQA 1U8MA 3U46A 1HQRB 2W60A 3WDJA 4WU7A 3CSYA 4F7MB 4X4YA 4JDVB 4XCEA 2ADGB 5E7BA 2A6JB 2BOBB 2BX5A 3BSZL 3OKEA 1CXLA 2NY4C 2WY3A 1FRGH 1P2CA 4MB3A 1KCSH 4G43B 3ARFA 4ZS7H 5IMLB 5TFSH 3WFEH 4GRWE 4LL9A 5IJVB 4QRSA 1JGLL 4H26B 4M4RA 2XACC 3MRLB 1G0YR 5BJTB 4RMVA 1V3MA 1XCTA 1R5IB 2FD6H 4QLRA 5ACZB 2XY1A 4G9FA 3FRUA 3EAKA 4IIQA 4LSDA 4OCXL 3JV6B 5DVKA 5IBUB 1MHHB 2QKIA 3R06A 4PREB 4P5TA 4EBQH 4K7FA 2VJXA 3LKOB 3LKSA 4EI6A 2XKSA 1MCBA 5J56B 2VWEE 3TIEB 3SQOH 3QG6A 4U1NA 2F19H 3HZKA 3PDOB 2NX5E 3S4SA 2WBJB 2RB8A 4H1LG 3U7WH 5EZLB 3BEWB 2XKNB 3IKKA 4JQVC 2FLRT 4NOFA 1EHLL 4M7KL 3MUHL 1NBQA 1MCWM 2HVJB 3GO1L 5DK0B 5E8DH 2Q76B 3O8XB 3PGDA 4P2RA 3OR7A 1KFAH 5ISZD 3QUZD 1RIHH 3QO0B 1KN4L 2FWOA 4U1LA 1NC4D 3O41A 1I85A 5DMIH 2W9LA 1FSKB 4APQC 2XTJE 4MXQC 5L2JB 3KPQB 4P3WA 4WTXA 3K4ZA 5SWSB 4OJFL 4CW1B 1XCQA 1CN4A 5DMGC 1UXSA 3O6FA 3W9DB 3RX7A 4OIIL 1JNNH 4IRSB 3RJQB 5JXED 3HAEA 2DICA 3U4EB 3GMMB 3GHEH 3MJ8B 5TE7H 4K2UH 5HHPA 1SY6A 3EFDL 5DJ2B 1SEBA 4E0RA 2IAMD 5EU7E 1MJ7H 2P8LB 5DJAA 1NFIA 3QP3A 5D1QB 4JPVH 5I9QC 2CDGB 1S7QB 4XP5L 5LQBH 3X13A 1G7IB 4NC2B 4OM0L 4QOKE 5EZOL 3UPAA 2ZKHH 1H5BC 5L0QB 1TZIB 1TIUA 3FO2A 5GPRA