1ZT1A

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
273
Chain Sequence
MGPHSLRYFHTAVSRPGLGKPRFISVGYVDDTQFVRFDSDAENPRYEPRVRWMEQVEPEYWERNTQIAKGNEQIFRVNLRTALRYYNQSAGGSHTFQRMYGCEVGSDWRLLRGYEQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGDAERDRAYLEGTCVEWLRRYLQLGNRTDSPKAHVTRHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt1A01
1ZT4B 1WZ1H 5JW5A 1R3JA 4X5WB 2AJSH 1DBKH 3L5XL 3JV4A 1A9BA 1YECH 1G7PA 4YHZH 3MLRH 5F3HB 2AKRB 4BUGA 2I9TB 1U8LB 4IIQA 3EYUL 4GW5B 3V95A 4JFDA 5HYJE 2HKHL 2D2OA 2FWOA 1LILA 5EC2A 3QA3A 4P4RB 4JEGB 5CCKH 5CINH 5EH1A 5CEZL 3MYJB 4NN7B 4K7PX 1MFBL 3PV7A 4PTTA 2AK1L 1AY1H 3IDIA 1JPSL 1U6AL 4U7KA 5I30L 5JW4M 3SCMC 4HFWA 1MFEL 3CX5K 4HZLA 5JXEC 4LAJH 4X80H 2NY5L 4JHAL 4LSRH 2Z31A 4NZRH 4LSVL 1HHGB 1JPFB 4M7JL 3QDMA 3DUUA 5SV4A 1U8PB 2VDLL 3G5XB 4WFHD 3D39B 3EDDA 5AUMA 3V6OA 1CBVL 5AG9A 4TVSa 4YPGA 4XP9H 3SJVE 5CZVH 3MTRA 1IGIH 4J7RA 1JI1A 4G80A 4JKLA 4M6NH 2AXFB 1NAML 5BO1H 1F11A 4ELKA 1XF5A 3HPLB 5FA4A 3NCYS 1NCUA 2XQBH 3LS5H 4QTIL 4TVPD 4G6FB 1I1CA 4HV8A 1DVFD 4FZEL 3CLEL 3UTQB 2JK5A 3MRLA 1Q9OB 3S37H 3P9LB 3WV0A 2B8OT 3PWNA 1NCBH 5L6YL 5DWUL 1X9QA 1II4E 5IHLB 1PSKL 4JO3L 1J0KA 3D1MC 4XWOD 3T0ED 5DFVC 3ZE1F 2A74B 2F5BH 2H2SC 2XNAB 2JJWA 5JHLL 3HFMH 1G7MA 1EO5A 3ZKMC 5BVJA 4HLJA 3M8OL 4FFZH 4MVBA 1XF4A 4K9EC 4H26B 3L5HA 4JM2D 3SDAA 1RJZA 3U0WH 5IQ7H 4QRTB 4CW1B 4OQTH 1QPPA 4QRUA 1AD0A 4YDIH 3KPSB 1MFAL 1HHIB 3FCTB 2KZ1B 4PRBB 2OTUB 2GFBB 4HWBL 2KPNA 3HG1E 4XAKD 3OKLB 3GIZH 3SE9H 5JDSB 4ERSH 3VCLB 3U0PA 4ZTOL 2R4RL 5TE7H 3M17B 5BS0A 3CFEA 5DLML 1P53A 4LFHD 1IGYA 4L29A 4KQ4H 1B3JA 2YK1L 1JGDB 2WUBL 4MNQB 5GRVL 2R29H 3ZKXB 3OAYH 4PJ8C 5C08B 2NR6C 3HZMB 1BEYL 4Q58C 1T5XB 4Y2DA 4Z78B 3DSFL 4D9QE 1IT9H 5I8KL 1RIUL 1Z2KA 1SVZA 5J12B 2AQ2A 2APVA 1S7TA 2QTEA 2BJMH 1IGFL 3BH8A 4Q2ZB 1N59B 4IOFD 3UTSB 1EVTC 5HYIA 4E0RA 1JGEB 5KSAA 5DZOA 4RRPG 5TFSL 3VXRA 1SY6L 3FQTA 5T3ZE 4X4YB 4RQQA 2OK0H 3E3QC 3HAEG 5GS0C 4XH2A 1QO3A 2R1WA 4L5FH 4QYOA 1MY7A 1AO7E 4LPVA 5I74C 1BQHB 4XB8A 1OP3H 3RWEB 5FA3B 5HHMA 2BVQB 3JWDL 3S34H 1J1PL 4LQFH 4P23D 4FTVB 4M1CC 4NQDD 5CBAA 4JFZH 5IB3B 3H42L 4G3YL 3TJHC 5C0AD 1HWHB 3ETBF 1PZUB 5EORL 2BOCB 2Z35A 4I1NB 2X4UB 3OG4B 1TJHL 3MRJB 5BQ7A 5E8OB 1OGAB 4XWGH 3PGDB 1KJ3H 4LDOB 4PGDA 3KYOA 1K6QH 3RUGE 4PB0L 4HBCH 4WUUA 4MLIA 3VG9C 3Q2CA 5D7JA 3RWFA 1GC1C 1ZS8B 3OKOA 2Y36L 3OR7B 3D85B 4RGMB 5HYJB 2NY7L 4GKSB 3OJVC 4GAYB 4NM8L 3FFCA 1FV1A 5IG7A 5DTFA 4EXKA 4NFCA 1YEFL 2Z8RA 5I6XC 2VL4A 3RGVB 3T0WA 4MQXD 1ED3A 3NCMA 1A1OA 3LKQB 3QULA 1N5AA 4UAOC 1X4XA 2Y07L 3IXAB 3BZDA 3ZZ1A 3I6GB 4R97C 2ADJB 4I8DA 1XF1A 4Q6IC 2ITCA 1VFBA 2YXFA 4YNYA 2EH8H 1BLNB 1EVUA 2DL9A 3ROOB 1SYSB 4YDLB 4RCAA 4WEUD 5IBUG 2LU7A 3CZFB 4QHMB 4XRCB 4OTXH 5K93A 3RWJB 4UDUA 4ZTPL 3KYNB 4F7EA 5AWNL 4KKBC 4OI9A 2PYFA 4PRPD 4LOUC 1NMCB 3IKKA 3BEWB 1NBZA 1U0QA 2NNAB 5DJCA 3TIDB 3V6FA 1A7NH 3S5LB 5HVGB 4ESKA 2EEDA 3AVEA 5AAWA 3SDYL 4NP4L 4Z6AT 3K46A 3SE8H 3STZA 3MRKB 1KF9B 1P1ZA 5GISL 4X6EA 5GS1A 3QEQA 2MSPA 3ULSB 3O8XC 3CDYA 1A1NB 1JN6A 4DW2L 4LLVB 2AW2A 3TCLA 3CSYB 3H3PH 4RBPH 4F58L 1FJ1A 3OB0H 5SWZD 3V2AR 5KVDH 5EZJA 5F70A 1E4JA 3H9HA 3UAJD 2ENSA 4WTWA 3L95A 5EZOH 4PGCB 1YPZE 2ZOLA 1NJ9B 4PJ7B 3GSVA 2AJUH 2GY7B 3MV9A 4WW1A 4ZXBA 1WCBB 2YMXL 5GGUB 2BY2A 1D5XB 4LLWA 2Q76B 3WNMA 4JQIH 3RWCB 3MV8E 3D0VA 2PXYB 1AH1A 1HH6B 1YEEH 4ZFZB 4JZOB 3P2TA 3Q48A 2H6PB 3GRWA 3M1BA 4NNYB 3JTCA 3SE3C 1Q0XL 4PJXB 5E9DD 2FZ3A 5MERA 3LD8C 2VITB 2HKFH 2BNRE 1B0WA 1HQ4B 4NQSB 5CUSH 1RAMA 5T1LA 2Q7YB 1S9VA 1OPGL 2VZUA 4PRHE 1FZOB 4Z77B 1DCLA 3RNKB 3GMQB 5E2UL 4ELMF 4KDVA 1W0WB 3PDOB 4NKDA 4OCRL 1Q9WB 4M7ZB 1FBIH 4PJCF 4LCIL 1LE9A 4GKZB 5DQJB 4D0BA 1BD2D 1P5VA 3HZYB 5HD8D 4ODVH 3WJJC 4D0CB 1E27A 2UWEE 2WINA 3RKPA 5CD5C 3OGCA 1FCGA 1TTGA 4XNYL 3F7RA 3MA9H 1VDGA 2WM0A 4YUEH 1SBBA 2NTFB 3RAJL 4G6JL 1G7LA 3VE0B 1F13A 1YYML 5L2JA 1C08B 3CUPA 2D9QB 2SEBA 3OKDA 3GBNL 2DM3A 1B88A 4IDJH 4YQXH 4KKLC 5HHOA 3KNBB 3TNMB 3RL2B 1PEWA 4HT1L 4TULL 2X05A 4BH7B 4M6AA 1AO7B 3LZFH 3S36H 3O6KL 3QEHA 4TPRL 1CF8H 1FH5L 3RWGA 2VLRE 2A83B 4PRAA 3TBTB 5F3BB 3NCCB 3DURB 4WUKH 4A2MA 5E6YA 4QXUL 1BGXL 4EVNA 2PETA 2BERA 4LCCC 3CVHB 2G5BA 1KJVA 3ARFA 1RV6X 1A7OL 2C1OA 3O3AB 1I8LC 3P0VH 3KAAA 1N4XL 4Y5YC 5CBEA 3HC3L 3RUGB 3O9WD 2GT9B 5KSBF 1UXWB 1RZIB 1BFSA 1RUMH 4G42B 4P46C 3WIHL 4ODTH 2AJXL 3ILQD 2WP3T 4NJAH 1S7RA 5J13C 2DRUA 1B6DA 3MXVH 5FKPA 4D2NA 5EU6D 3TBWA 4I3GA 2BRRL 4N5EC 4LVNB 3BPOC 2AJVL 4TVPL 32C2A 4M1CD 1OLZA 1RQ5A 4JDTL 1DLFH 4Y8DC 1ZEAH 3KYKL 4QRPA 3SCMA 3TJHD 4Z0XA 4R7NB 3U4BL 3WUWB 3I02A 5IMOA 5JXEA 4PUBH 5C0CD 4OAWA 5ICZB 3LRSB 4AEFA 3VD5A 5H35B 2NTSP 3FKUS 3MJ9A 4OUUA 4X7SL 4JCLA 3VI3F 1NLBL 3LPWA 5C7XL 3UYOD 1KOAA 2LFGA 2Q86B 5HGHB 4EQ2A 1H3TA 3H3KA 4MXVF 4F7MB 3S8WA 4I48B 5JIHA 5IM7A 4BSVA 4WFFD 1T0NA 5HYSA 1V7NL 2X89D 1PX3A 4J1UA 2IH1A 5EN2B 4IEFB 5JHDE 2XY1A 4JO2L 5FGSA 1UM4H 1CFQB 5FYJH 4ONHA 4KV5E 5HDQH 2X4PB 5INDA 2CJUL 3E0GA 5IMLB 1HINL 3STBA 2HH0H 5EDXA 1QEWA 4U33A 5C0DA 4NRXA 2QQLH 2ADGA 4WO4C 2DQHL 3MRHB 5GRWA 4N0UB 2D9CA 4P5KA 4EN3B 1FAIL 2ZNXA 5BZDB 3P4OA 8CGTA 2F53E 2H1PH 5C8JA 3KYMB 2DKUA 4JY6A 3H9SE 1HYSC 5L0QB 1PLGL 2VRAA 2BZDA 3BAEH 4MB4A 1N0XL 2GTWB 4LOUD 2VL5A 4OZFB 3BPCB 1BOGB 1AQKH 5DD0H 3D18A 1LK3L 3NABH 4PG9B 5IMKA 5I73C 2IBZX 3HCVA 4HHAB 1OTSC 3MV8B 3T2QA 3QWOA 4MA8H 1C16B 1PW3A 3HNSL 4OM1H 1EHLH 3VFVB 3UBXG 4M62L 1KCKA 4MHHI 4N1EA 1JPGB 3O8XD 2WBJC 4P2RE 3MBXL 4L3EE 4ZUWA 1RIVH 3VXQB 1MNUH 1WIUA 2FX8L 1T20A 4OZGA 4C59B 2VZ1A 4ALAH 1Q38A 1P7QD 2HVKA 3L7EB 5E7BA 3TIEA 3PWUB 3QHFH 1S7VB 4PRHB 1A1MB 1EEZA 1FNLA 2BCKB 1KIRA 1U8JA 5E7FA 4YDVB 4PJ8A 4HS3B 4QY8B 4APQB 1RFDH 3GMPB 4NKOB 5I2IA 2XN9A 4WFEE 1JNHA 1EUTA 4DGIL 3BPNC 1WAAA 2BX5A 1HCFX 1P7KB 1NDGA 4OUOA 1DFBH 4S1QL 4I0PA 2EH7L 2EECA 4K23L 2VZVA 3TZVB 4MCZA 3E3QA 1U8QB 1F4YH 4GS7B 5IEKB 4HJJH 3IT8D 2ZCHH 2Z4QB 4LL9A 1GZQB 2KQMA 2PN5A 3L3DB 2XKNA 2QHLA 3IU3A 4BM7A 2ZZUT 1BMGA 5D7SH 1HKFA 3QSKB 1MCWW 1QSFA 3MLWL 1FO0A 2YWYA 3BWUC 3NGBC 4GMSL 5DXWA 1Y6NR 1X7QA 2VLRB 4D94A 1BM3H 3I6KA 2FL5A 4M3JA 5AZEH 1MJ7H 3QP3A 1Q1JH 4GG8A 3GSNA 5E2WH 3Q1SL 3UTZB 2DBLL 1DBAH 3QXAA 4L8SB 3V4PL 2GTZA 5CD5D 3DRTA 1LP9A 2X44D 4MXQA 3TFKA 5D7LE 3IJSA 3QUML 5CHNB 3NPZB 5DYOB 4M1DL 4U49A 5DI8B 4JN2B 4CU8A 5ICYA 5TH2A 4KKLD 4XPFL 5IT2H 4O5LL 4NHUA 1NMAH 3T8XA 3U7WH 4XPTL 4Y4KD 5GXBB 3TVMB 4TTDC 1ZGLM 3QAZC 1BVKA 1JZ7A 3GSOB 3WBDA 4JREB 2CUIA 5SX5H 5JR1L 1KTDB 3WL9B 5EZLB 4JFED 3LEYH 4YPJA 2HRPH 1G7IA 3MBED 4HPYL 4ZODA 2IMNA 4NZUH 4HH9B 4HQQH 4TQEH 1S9XA 5D72L 4EIGB 1HNGA 1W8NA 4G7YL 5GZOD 5E99L 4MCYB 1KPRB 3V79C 2ZG1A 2N4IA 4HS6A 2P8LA 4Z7UA 2BP3A 5FHAH 4PGBA 1VFUA 5IFHH 4FNLH 4P46D 4X8JB 2FJFB 3ZDZE 2J88L 4K07A 5C0NC 5F9DC 3TN0C 3NAAH 2IQ9L 3B5HA 5I75B 1WIOA 1M4KA 1IM9D 3OMZA 3FHQA 4RA0C 3BGFB 4Z95H 1AGCA 4LPXA 3PJSA 1L7IH 1DBMH 5DUPL 4E41D 4XCYA 1F4HA 5IVXE 3BEVA 1XF2B 5IBTL 4B0MM 1K8DA 2XZCH 4OF0A 1A2YB 5JHDB 5C0RH 3PWPD 1UXSB 3AS1A 5C07D 2W1NA 5GRYA 3R0NA 4HKXB 1JHKL 1FYHB 3D2UD 4MDIB 5DFTA 4Q9RL 1HQRA 2QSCH 4NO3B 5BV7C 5FB8A 5IK3B 4KRPC 2PKDA 1KIPA 3UO1L 2P5WA 1FC1A 1RZFH 2B39A 2IADB 2LU4A 2IAMA 4X7CC 2F53B 2XXCB 5INCB 4FFYL 5FIEA 3H9SB 1ITBB 1QFHA 4DKAA 4FQXC 3SO3B 5HY9B 4PJ5A 5C09E 1AD9B 3ULVH 4WI4A 2XZQH 1IL1B 1QQDA 3QDGE 3EDKA 3H3BC 2OR9L 5C6TL 5D1QC 4XP6L 4GKOA 1XH3A 1DLHA 1KB5A 5HVWA 5FKAA 2QSVA 2NLJA 4P2RB 5DJDA 1KEMH 1WWBX 3MLSH 3QUKB 4MAYB 4YZFF 1ZVSB 1J1OL 5D6DA 4LCUA 3ZO0A 4Y19D 4R7DA 5KOVC 3IDGA 3ZT5A 4YWGH 1MAJA 2DQIL 1U9KA 4L1DA 1E6JL 2EICA 1C5DA 1IKFL 2PO6D 4Q0XH 5DT1L 1BWWA 3EJZD 1M71B 5GGQH 3GK8L 4NRYB 4Q74A 2QQNH 1K8IA 1QRNA 1IEHA 4YO0B 5I17A 3T4YB 2VE6A 4U1LA 1MWAH 3UTTE 2AV7B 3GIVB 3OKNB 5FK9B 3RZCA 1UJTA 3VRLF 1IEBA 2OL3L 1U93B 2VLKE 1J0IA 4DQOL 5FM8A 1DQLH 3JUYA 4DEPC 3T2PA 5CLWA 1G7QA 2NY4C 1MSPA 4Y5XC 2MKWA 3C87A 1KT2A 5B8CB 4PD4J 3CDCA 4HIEA 5DC0A 3KPMA 4MMXC 4YFLF 3GSUA 4ZFOB 1KYOK 3P40A 2WW8A 2P44B 2AJYL 5AD0A 2APBA 2R2BB 2WBKA 3ARGD 4QHKI 3U9UB 4XNQA 4UIMB 1BZ7A 3LEVL 1F02I 3D87B 1I1AC 2R1XA 1VADA 5T1KA 15C8L 3MLYH 1EMTL 5HGAA 2VAJA 5IW1A 1BECA 5H94B 4BZ2H 1HYRC 5E8NB 5A16B 3TC9A 3X12B 1H3VA 1U8IB 1LVEA 4UOW1 1AGBB 1HXMB 3OKKB 3CFDB 4F80A 2I07A 2R8SH 4EEEA 3QH3A 3CFJB 1KNOA 4WTZG 4ODXB 5HHVL 3R06A 2PW2A 4MA3A 1G6VK 2FEEI 3RUGF 3MLVH 5IR1A 4QEGA 3D9AH 1MCRA 1CGVA 1R5VA 1IE5A 3OXSA 1T7VA 2IGFL 2I60H 2PCPB 5SWSE 4NQEA 3WS6C 1ZHLB 1PKQE 4ZPTA 2Q8BL 3MV7A 2QADB 2ITDB 2PYEA 3GI9H 1B0GA 4NGHH 4KK5C 1ORQB 2APTA 4C83B 4MJID 5ELIA 1Q9KA 3QJHB 1XT5A 2FX7H 3N85H 4WY7H 3TV3H 4MAUL 5T3ZH 4XNZB 3FQRA 2IANB 1GVIA 4PBWD 1K5NB 2AEQL 5CILH 3CDGB 3EFDH 4LRNH 4I2XB 4KRNA 4M6MH 2Z91B 4R8WL 5DA0B 3PQYE 5HGGS 1NL0H 1KPVB 3TH2T 1PDKA 4O9HH 2JB6A 5J57B 1ZLWH 5B39A 1EBPA 3EYVB 2GJ6D 3LPGA 1BAFH 5DEGB 1NUNB 3MRCB 4GRWF 3V6ZB 5M94B 4WGVB 5F9AC 4TTDD 3L5XH 43C9A 4ZUVB 4NNXB 5IVZA 5IVXB 5MEOA 3EYUH 5JUEH 2HKHH 2NXYC 2HLFD 1WSST 3VD3A 4HX1A 1RJLA 2ESVD 5CMAB 1NKOA 1S7WB 4WO4A 5CEZH 3C8HA 3QHZL 2O26U 2FIKB 2VLJE 1CLYL 3VXME 1MFBH 3H6JA 5C92A 2AK1H 3QXWA 1JPSH 1U6AH 5I30H 4J3VA 2ATKA 3ZYJA 1MFEH 1YPZF 4EOWH 4ZUTB 5C0ND 2NY5H 3TN0D 1RZKL 4JHAH 4EUPB 1Z6JT 4LSVH 2YD9A 3CGTA 4M7JH 5MENE 2GCYA 2VDLH 4NUJA 5C09B 1CBVH 2EO1A 3GKWL 4NN5B 5TDPB 2C3VA 3QDGB 4KMLB 5DHVH 3M45A 3PHOB 4X98A 5GGTA 1D7FA 1WBXB 5DQDL 1SJHB 4IRJC 5EBWA 1FL5B 1NAMH 1WF5A 2WBJA 4WEBH 3RVUC 1QSED 3WFDL 1RUQH 4F9LC 1G9MC 4QTIH 1UWEL 4W6YB 1YJDL 4YFEA 3QCTL 4MD4B 4OKVB 4XC3L 4FZEH 1X44A 1KJ2B 1BBJB 3CLEH 4GRWH 4MJ2A 4ZUUB 2AJZB 5JOPE 4QXTA 3CPLA 3B9KD 3SPVB 3DI2B 2OI9B 3KG5A 4FQ1L 5L6YH 5DWUH 4PJAE 4X6CA 2YOCA 3H9ZA 3HB3D 1PSKH 3KPRD 4JO3H 1OTUC 3RY6C 1U92B 3BUYA 3PWJB 3GMLB 4YGVB 1NMCC 1JUFA 4R4NC 3NIFE 2UWEF 3O4LA 4YC2B 4PJGA 2Z9TA 2J6EA 3IJYB 5D1QD 5JHLH 3QWQB 1FFPA 2VLKB 1MUJA 3M8OH 1NPUA 3GSQA 4K7FA 5HHNB 2MTPA 1QACA 2VSCA 4JPIB 4U6TA 2NY1D 4QRRB 5L8LB 3SGEH 4TUJA 4YHPB 3L3GB 4PJBE 3IKCA 1MFAH 5EPMB 3VD7A 2YBRA 3UPRB 1QKZL 4HH8A 3DV6A 4HWBH 4L4TB 1KC5L 1B0RB 1QZ1A 1Z0NA 3OPZL 1OWRM 5L2KA 2DDQL 1Z9LA 3TJEL 3DPBA 4ZTOH 5E8DL 4Z8FL 2R4RH 2GITA 3DUSB 5DLMH 3PWVA 2R69L 1GAFL 4IOIA 3IFLL 4U1GB 3UJTL 3LKSA 2YK1H 1OSZA 2ZG2A 4NCC1 2WUBH 4HXAL 5JORB 2E7LE 3VDBA 4UT7H 5E4EC 1QA9A 2J3SA 5D2LA 2GHWB 1FG9C 2F9BT 2OCFD 2DJUA 5C0BB 5FECB 1R3HA 3WE6A 1BEYH 4QRQA 3NPSC 3O2DL 3DSFH 4JB9H 5I8KH 4HBQA 1RIUH 2AXGB 2JCCE 4N90E 5FDWB 1NBVL 3CC5B 3D3VD 4JVUA 4Q6YA 2LVEA 1FVDB 3VRIA 3B9DA 5FCSH 5A43C 5TFSH 3QIBD 1SJEB 1SY6H 1UB5A 4DTGL 1N8ZA 3O45B 3T1FB 3MA7A 4CNIA 2CUMA 4YBLC 4GKNA 1JK8A 1YEDA 4FQJL 4L9LB 3GDBA 4FMKA 2PTTA 3JWDH 1NAKL 1J1PH 3MJ7B 4PJFA 3R4DA 3H42H 4XP5L 5JDJA 4XNUL 5EORH 4HKBA 3PQYB 5KW9L 1DQQB 3CCHA 1QYGL 1CD8A 4RZCA 4H5SB 2WANA 2BC4B 1ZHBA 2VJXA 3EKCA 4RISL 4KMTL 2IQAA 4KK5D 4FXGA 2P24A 1YMMA 2BSSA 1KEGL 1P9MC 3H7BB 2OYPA 4KV5F 4HIHA 4R0LA 2Y36H 4H88L 5FDYA 1I3RA 3AU1A 2NY7H 5DVMA 3DRQA 1FL3A 3CK0H 4NM8H 4QHLB 4YHIA 5KSUA 1Z3GL 1ZT4A 3U83A 2VLJB 1YEFH 2K1MA 4X5WA 1TENA 4P57B 4X9BA 5F3HA 2AKRA 3QUZB 1PZ5A 2I9TA 1U8LA 2Y07H 4WDIB 5EU4B 4GW5A 4FQXA 1T0MA 1OHQA 5DVKA 2ADIB 2A6JB 2VAAA 5FM4A 4UQ3A 5JOFA 1EZVY 2ILLA 3MYJA 5MENB 3NCJL 2NXZD 1XCQB 4M48H 3F5WB 4ZTPH 5D2NC 4LU5L 2J8UE 5AWNH 2NXYD 4OIIH 2UVEA 4JJ5B 1MI5A 3NA9L 4FA8A 2Y1VA 2Q87A 1HHGA 1JPFA 1U8PA 3G5XA 1RPQA 3DROA 3SDYH 1U3JA 3C09B 4NP4H 4NQCB 4M4PA 3SDXE 4KI5E 2FLRT 2BXYA 4ZS7L 2NY3B 2Y06L 1LO3H 5FUCC 1UZ6E 2X2YA 2E9JA 5GISH 4K3DH 3UEZA 3HPLA 5FGCE 4U1NB 5SWQA 4PJAB 4DW2H 2Q6WB 5CZXC 2XACC 5D7JD 5FOBA 4F58H 2Y7QB 2ZP0T 5CEYA 5I76A 4Y5VB 3CAFA 1JWSB 4V3EB 2L7JA 8FABB 4I18C 3K2UH 4WJ5B 5GSRB 3WJLA 3UTQA 4HMEA 4IRJD 4PJEE 1Q9OA 3P9LA 3RPKA 1EA9C 2J2ZA 3RVUD 4AMKL 2XWTB 4YHOH 2YMXH 2CXGA 1WCQA 3EO0B 1I1AA 1Z0MA 3JWNC 2XNAA 1T1ZB 4HK0B 3EIFA 3V0AC 3VXPB 5IW3A 5I1CL 3UC0L 3DYMA 1Q0XH 5D7IF 4H26A 4ZYKB 4JKKA 4PRDB 1F90L 3GEWB 4QRTA 5HHXL 4XVTL 3VXTA 4R4ND 1OPGH 3FT2B 1F5WA 4F37K 5E2UH 3KPSA 4D9RD 1T66C 3KJ4C 4LCWD 1HHIA 4PRBA 2OTUA 2RIKA 5J9PB 2BSED 3HC4L 1D5BB 3DARA 3WS6A 2R2EB 4LCIH 4UV7L 3OKLA 5JDSA 4L3AA 4M7KL 4KTEH 5E08H 5DUML 4B5EA 4UB0L 1E6OL 3CFBA 4JFXA 3IAPA 1T6VN 3M17A 3EAKA 5HYSG 2GKIA 4RBPK 4U1SB 1J0JA 2MQ3A 4LDLB 3RAJH 4G6JH 5F6HI 1EHAA 2WBWB 5T3XE 1VCAA 3QCUH 1YYMH 4JGJA 4RMWA 2YN3A 4J2XA 4Y1AB 2KUTA 3GBNH 4NDMB 4R26H 1FLRL 4HT1H 4KROB 4TULH 3ZL4H 5C08A 3HZMA 4XX1G 4AQOA 1T5XA 3O6KH 2JJTC 4TPRH 4V2CB 3WIIL 3HE6B 2GIYA 4GW4B 1H8NA 4Q2ZA 1N59A 3UTSA 3OQ3B 1JGEA 1CGUA 1KGCD 4QXUH 1UWXH 4LMQI 5JW4R 1BGXH 4NT6A 4FFEX 2YUVA 5FGRA 5JOEA 3RNQB 3W0WA 4GS7C 4PJDB 4QLRA 1A7OH 4LKCB 5DRWA 4JHZA 1BQHA 1RZ8B 3O41B 1HE7A 5FA3A 5IROA 3PP3K 1N4XH 3RWEA 2BVQA 3HC3H 1RUAL 3DVNB 4FTVA 5IB3A 3P0YL 3QDJE 5DMIH 4JFHE 3WIHH 1U8HB 2AJXH 4OV6F 3QEGL 1FNHA 2BOCA 3WIFB 1PJ9A 1JHLH 5DD5L 4FP8L 2AEPL 1TITA 3MRJA 4J12A 4J3SA 2BNUB 1OGAA 2BRRH 3GSRA 5D1ZB 5E8OA 3PGDA 4DK6A 4F15C 2AJVH 4TVPH 2V2WA 1H3GA 4JDTH 3KYKH 4F37F 3U4BH 2VDPL 4LSSL 4XNMB 3W9DB 1J9CT 3RY5A 3MOQA 2AK4D 1ZS8A 5IKCB 1W72B 2VISB 1FG2A 3D85A 4XI5D 5HYJA 4CADB 4GKSA 4GAYA 2DI7A 5KZCB 4NSKB 4X7SH 1WWAX 2D7OA 1NLBH 5C7XH 1FE8L 3V8CA 3JVGA 1L0QA 1OAXL 3LKQA 3OF6A 4Y2OA 2V5SA 3GJFH 3IXAA 2A6DB 5GGVL 2ADJA 5I8OL 1QLRB 2DIJA 4P9HL 3ROOA 1SYSA 1IAIL 1BHGA 1V7NH 2XA8L 3L5IA 3CZFA 4JO2H 4QHMA 4XRCA 2EDOA 3SDXB 3RWJA 3QR2A 3KYNA 3T65B 2CJUH 3NCBB 4DKEH 1HINH 4BQ9A 5FGCB 3RJDA 3FB5B 4KDTA 2NNAA 3TIDA 2DQHH 5ANME 1YZZA 4P5TC 3R8QA 1FAIH 1PG7W 4CJ1A 3BGFC 4WW2C 3WKML 5KANI 4OIBA 5K9OB 1YNTB 4HIIB 2NX5D 3CIQA 3S4SB 1BQLL 3MRKA 1PLGH 5ESAA 4PJEB 5D5ME 4GG6E 1P5UA 1N0XH 2OZ4A 3ULSA 1A1NA 1UYWL 5C0GB 4LLVA 4EDWL 5J1TC 3OX8B 3CSYA 1LK3H 2OXHA 1KCLA 3MX0A 2DD8L 1MWAB 2WY3A 4MJ5B 3HNSH 1UACL 1B2WL 2R0WL 4M62H 3TH4T 4PGCA 1OP5H 5JO5B 1P4IL 1NJ9A 2EC8A 3MBXH 4U3CA 5FYJU 4PJ7A 1GGBL 1J05B 4ZAKC 2FX8H 3LKRA 3MNVB 4OZHE 5CZXD 2G9HB 3U7YL 1WCBA 2ED9A 1CDJA 3ARSA 5FEBA 5GGUA 3RDTB 1D5XA 5F9OH 5HDOA 2Q76A 5C71A 1U8OB 1M7XA 4ZFZA 1FFNB 1ZLVH 2H6PA 2HJFA 4NNYA 1MRFL 4KGLA 4PJXA 1NGYB 4DGIH 2VITA 4YDKL 1HQ4A 3P11L 4NQSA 3TO4D 4MAYC 3EDEA 1FZOA 4Z77A 3RNKA 4XBGB 1ODAA 3GMQA 3MUY1 2D7TL 4YHYB 4LDEB 4S1QH 2EH7H 4R2GB 4K23H 3CFIC 5F7YC 3PDOA 4QCIA 3G6JE 1Q9WA 3SDCC 4Y0GA 2LTQB 4MDJB 1IMHC 2MJWA 1DSFL 2NZIA 3QUYC 4I3RL 3MGAA 3F7VB 5J3HC 5K9JL 1Y18A 2KDGA 4JFFA 3MLWH 1T66D 2AABL 4XP1L 4I4WB 5HHPA 3OB8A 4GMSH 3FT4B 3KLAB 2V7HB 3QBTB 3VE0A 5DK2A 2LQRA 3SDDC 1M6OB 5J11B 3U4EB 2JKXA 2R56L 4U6HB 3LSOB 1WQVT 2X10A 3KNBA 4TUKL 4B53A 3Q1SH 2P7TB 3RL2A 5B8CC 2DBLH 4FMFA 4U7MA 1S9WB 3V4PH 4Z7QE 4PPTA 1AO7A 2XRAL 4OD1L 5D71L 4QTHB 4N8VB 4M1DH 2A83A 1VACB 3QDJB 3TBTA 2YC1B 5F3BA 3BVNB 3DURA 1P2CB 4XPFH 4O5LH 1U58A 3CVHA 3QI9B 4X9HA 4TNWF 1MJJA 5TQ2L 3DTXB 2I26N 4XPTH 1EX0A 3O3AA 3VW3L 3QIUD 1WJ3A 1CR9L 4F33B 4LSPL 3BXNB 2VKXA 1TCRB 2GT9A 3IDJB 1HHJA 5JR1H 1RZIA 2FO1A 4HPYH 4PFEA 3GMNB 3NFPB 5D72H 2J5LB 4L4VD 4G7YH 1E4KC 2Y4SA 4JFDE 5E99H 4NWUL 5EUOE 4OZIA 1CGYA 4PJ9B 2ZSVA 2GSGB 1DQML 1J88A 4LPYA 4R7NA 2XTJD 5D2NA 3WUWA 3MNZB 3B5TA 4KKAC 2J88H 2OXGA 4UIKL 1RHFA 5ICZA 4QGTA 4JO4L 2IQ9H 1FQ9C 1FYTE 1BVLA 3HZKB 1CT8B 5H35A 5DUPH 5EZIL 3MRNB 4CAGA 4DN4L 1OD9A 5F88B 5IBTH 1SJXA 2ARJQ 2ERJB 3C60C 2NY0B 3O0RL 5DHVB 2Q86A 5HGHA 1X5AA 3HR5B 3GO1L 1KN4L 1JHKH 4PJAF 4Q9RH 4JZJC 1VSCA 1HCVA 3CXHK 4I48A 4TRPL 3NIFF 3UO1H 2UZIL 1R24B 3SGEI 1OSPL 5EN2A 1Q0YL 2IALB 3GSWB 4HJ0C 3RI5F 4J8RB 5CSZB 1CFQA 4FFYH 5D1XB 4W68A 1O5DT 2X4PA 5IMLA 5D5MB 4GG6B 5LGHL 1S7UB 5EBLA 4EI5B 3B9AA 1DQJB 1NLDL 2M2DA 3CJJA 5E95B 4P4KC 3MRHA 1JF1A 2OR9H 4N0UA 4PJBF 1INQB 4EN3A 2OTPA 4XP6H 5BZDA 1IVLA 2EXWD 4FZ8L 3EDFA 3BW9B 3BQUC 3AREC 3KYMA 1JZ2A 3ZHLA 2GTWA 4OZFA 3BPCA 4OJFL 2P1YA 1BOGA 1J1OH 3L3IB 3MYZA 3OKEB 3HTLX 2X4OB 4P5TD 3TBYB 1S78C 4MA1B 4M93B 4F9PA 4HHAA 2DQIH 1UADC 3AY4C 1C16A 1IKFH 5CJQL 5ACMA 5DT1H 3VFVA 2HVJB 4JO1L 5B39G 3GK8H 1JPGA 1J0ZA 3NTCH 3V0VA 1PEZA 3VXQA 4G8GD 5EUKB 3REVA 5FYKD 4BUHA 2JCCF 3L7EA 2OL3H 4UT6L 1MRDL 3PWUA 1S7VA 2Z93B 4H0HB 4DQOH 5BS0E 1OM3L 1GOFA 2NYYC 2BY3A 1MCCA 4XPHH 2DMBA 1FN4B 4YDVA 4EQ3A 4APQA 4HS3A 2HT2C 1A9EB 2X4QB 3GMPA 4NKOA 4V1DA 4ZAKD 4RFNB 5FAAA 3RTQC 2AJYH 5EU5B 2IAMD 5F96L 3LEVH 5IMMB 4UDTB 3RX7A 1KPUB 1J8HB 5DRXB 4LVHB 1KLUA 1TZIB 4NO5B 15C8H 1EMTH 1P7KA 1QTYT 2NY6C 3EJJX 2Z92B 3S37X 3CXDH 2DMCA 3REWB 3TZVA 5I71B 1U8QA 4HWEH 1UC6A 4K3JL 1CWVA 5E2TL 2YRLA 1ACZA 2C3WA 5HHVH 2RHEA 4CVXB 3QG6A 1I4FA 1U3HB 5HDLA 4UZGA 3VDCA 5F44A 2JIXB 5HHME 4ZQKB 1BQSA 3HMXL 5EBGA 2VLRA 1UB6B 2IGFH 3PUCA 3QQNA 4S11A 3SDCD 2CO7B 4ENEC 2WQ8A 3SKMB 2Q8BH 3UTZA 3QUYD 3BHBB 4L8SA 4ORZC 4PY8I 3C8DA 4F8TA 4GRLC 1MQKL 1QFWM 4OB5L 4RGNC 2P43B 5CHNA 1EO8L 5DYOA 5F7MC 1CD1A 2VLLB 4WNQB 5DI8A 3L6FB 4WUUE 3JV4B 5DD1L 5C1MB 5FYLD 4MAUH 1IAIM 2AEQH 5EUOB 1FZJB 1SJVA 5LKNA 2H41A 3B8SA 4R8WH 3GSOA 3KLHC 3BO8B 3QUXB 4NBZB 1RK0B 1KTDA 2EXYD 5AYQA 3WL9A 1ZT1B 5FM5M 2J8UF 2E9BA 5FV2A 4HEME 4HH9A 1VGKB 4ETQB 3DVFA 3ZSSA 4WENB 2JELL 1FYTB 1OAUL 4X7FC 1B4JL 1K4CB 4MCYA 3AS0A 5BW7C 2H8PA 5HI3C 1KPRA 3P30L 4NO2B 2Z31B 1F6FB 3ZE0E 4ZG1A 3TEUA 4YXKL 3VFNB 1EEUA 1WLHA 1ZGLB 4OCXL 2OM5A 3PNWB 2FJFA 2EDJA 3MJ9L 1JWUA 3EOBB 3QHZH 5LAXB 3T0BA 5J8OA 1F11B 1CDUA 5GRZA 4NZJA 5F1KC 4P2YA 1IAKB 3TYFB 1XF2A 4XMKL 5EULV 4AIOA 1A2YA 1BJ8A 5JHDA 4M9PA 2V2XB 4HKXA 2BHUA 1GIGL 1MREL 4MDIA 4CN1A 2AGJH 5DSCB 2GYSA 3QEQE 4NO3A 3GKWH 3PWNB 5IK3A 4AJ0A 3MLTA 3QDHA 4K3GA 2NY2B 3JV0A 1MHHB 5DQDH 3VFSB 2IADA 2E7MA 1RU9L 4ODUA 4P5MA 2BSTB 2F53A 1NMBL 5INCA 3C5ZB 3QT2A 3WFDH 4JKMA 3ARUA 5HY9A 4IMLB 4LHJB 1JYXA 4AZ8A 1UWEH 1KCRL 3QPQD 1AD9A 1XIWD 1YJDH 1G6RB 3QCTH 4XC3H 3MV9E 1F45A 4FRWA 3VH8B 3QNZB 1A4KA 1YMHB 3BH9B 4U0RC 4HJ0D 1TZGL 4FQ1H 3LN5B 3WLWD 3KR3L 3DETC 4Z7VE 1MJUL 1YUHB 2CH8A 2YKLL 3VXSB 4KPHL 4P2RA 2PR4L 3STLB 3QUKA 4MAYA 4J4PA 2WWKT 2BFVL 1ZVSA 4P4KD 2P45B 3BT2L 3TA3B 2XV6B 3ZDXF 4FQPA 4PJHE 3C09C 4I5BA 3BQUD 4R90L 1UEMA 1JV5A 3CFEB 2HT4D 4IJ3C 4OLUH 3ULUE 5C0AE 1M71A 4MXWL 4NRYA 4HDIA 1XGTB 3O2WL 4J6RH 4KH2A 1VEOA 4YO0A 3PGFH 3T4YA 1QSVA 3L3OA 4RMTA 5CJOL 5GPRA 2AV7A 3GIVA 3OKNA 1RUPL 2QBWA 3O11A 4IRZL 3GUTB 4LLQA 3E2HC 4JFPB 2VDML 3QB7C 1QKZH 2CR6A 1U93A 4WU5B 3SDDA 4K8RD 1KC5H 3OPZH 1NQBA 3GJEA 5B8CA 3TJEH 4MSWB 4ZFOA 5E8DH 4Z8FH 3V4UH 4HKJB 5KSAB 4IDLA 3PHQB 1VKXB 2R2BA 3FAXA 3U9UA 5HHOE 2R69H 1GAFH 1VFOA 4WHTA 3FQTB 3IFLH 3UJTH 5AG8A 3S35X 3VD9A 1QO3B 4G6KH 3SKOB 4QYOB 4C56A 4G9FD 4HXAH 2NYYD 5GHWL 3RA7L 4KJWD 2W9EL 2VLME 1MCLA 4G8IA 5H94A 2F8VA 5E8NA 3X12A 5A16A 4GQPH 1WISA 1U8IA 3U9PL 3RTQD 1HXMA 1XCTB 3OKKA 5KVGL 3CFDA 5BRZD 3O2DH 2HFGL 1FO0L 2KZWA 3CFJA 4W70A 5BOZG 4ODXA 4UMGA 5BMFL 3WO4C 1NBVH 1IBGL 1GZPB 5A2JH 5BQ7B 5IB2B 4QHUB 2NY6D 2J7LA 3GSNL 2HTLC 2C4XA 3AM8A 3ARBC 3EZ8A 4HC1L 4DTGH 3EYQC 5FHBL 2WQRA 1RVFH 1VENA 2VC2L 4OFVA 4IMKC 3SGKC 4FQJH 1BZ9A 3GZKA 2ITDA 1NAKH 5D96B 3BZEB 2DM4A 3ESUF 1IKNA 4F8QA 4JLRB 5AZ2L 1ORQA 3O6MH 3EDJA 4XP5H 4C83A 4NYLB 4XNUH 1Z9MA 5FCUL 5KW9H 3QJHA 2WV3A 1FV1B 1QYGH 2CMRL 1QBML 1KBGL 4QRPE 4YJZL 3LMJL 2EDLA 3QULB 3TPUB 3F7YB 4DGYL 2IANA 3KDMB 4RISH 4KMTH 4GRLD 3CDGA 3A6CL 1KEGH 2ITCB 4I2XA 1OT1A 3C60A 4YNYB 3BJLA 2Z91A 4XBEL 1OL0A 1KPVA 3EYVA 4DZ8B 3KXFE 3GJFB 1Z3GH 5DEGA 4MB3A 3S36X 4HULB 3MRCA 4JM2B 3V6ZA 4ZUVA 1B90A 3VGGA 2X4TB 5GZND 5DJCB 4NNXA 4JM4L 4CN4A 5CD3B 4JPKL 5IVXA 4XPBL 2LU3A 4PRID 5GRUL 3VXUD 3BMVA 5CMAA 5I19L 1S7WA 4CMHB 2DQGL 1ZHNB 5FYKL 3MOBL 3SGJC 3NCJH 4N1HB 4XX1E 3AREA 5F9WC 1CQYA 4HXBL 5EIIA 1KCVL 4LU5H 4WI5A 5T1DL 4ZUTA 5GQBA 3NA9H 3W39B 3K4AA 4B41A 4OZHF 2CGRL 3RKDC 1D5ZA 1JF5A 5D8JL 4ZDHB 1UENA 3MRPB 3FHAA 1E28B 1P4LA 5TDPA 4GT7A 3ZYOA 3QDGA 1V3KA 2DLHA 2W0FB 3AY4A 3MMEB 3PHOA 1QR1B 4ZS7H 1WBXA 4JY5L 2UUDK 2Y06H 4LGRB 3D25B 4KXZH 5F7HA 1CICC 3NFNA 4HUWB 3N50A 1UCTA 4Z7VB 3VD4A 3MFFB 1WC7B 3D48R 2QR0B 5JPNB 4MD4A 4OKVA 1BBJA 1F3DJ 1KB5L 4S1DD 4X6DA 5CKGA 4YHML 5E6IB 4ZUUA 3OZ9L 2AJZA 4PJHB 1DJSA 4HG4J 1NCAH 4J3UA 2OI9A 4P23B 1F58L 4AMKH 3G6JF 4Z5RB 5DURD 3RL1A 5B4MC 1MHCB 5C0AB 1U92A 4MS8C 3PWJA 5FYJD 3GMLA 1U3ZA 4GBXC 4NKDB 4H1LG 2XN9E 2EIEA 3L5JA 4LNRB 1FP5A 2XI9A 3IJYA 4UV4L 4UOW0 3QRGL 3C9NB 5DVOA 5I1CH 3PWLB 3UC0H 2DM2A 5HHNA 3DETD 1T83C 1F90H 1X5XA 5FYLL 5HHXH 4XVTH 4H25B 1CDYA 4Z7QF 3E3QE 4BFGA 4QRRA 2VN7A 2SEBB 2P5ED 4YHPA 3ZE2E 3L3GA 5HHOB 3T1WA 5EPMA 2H26A 3UPRA 1K9TA 1RUKL 2NPLX 3HNTL 3HC4H 5IP4A 5IEHB 4L4TA 2CD0A 3D39D 4I77H 1B0RA 3BYTA 2C4FT 2Y72A 4M7KH 1MVUB 2JJVA 5DUMH 1KG0B 4UQ2A 4UB0H 4PRAB 1E6OH 1LO5B 4P3DB 4XVSL 1SMAA 3V0WL 5DGQA 4PJIB 4EVNB 4YHKL 3QXUA 3UTPE 1MLBB 4KUZL 2WWMC 1KJVB 2C1OB 1E4WL 5JORA 1QPXA 1X6NA 4WHCA 1FLRH 3GMRB 1X5JA 4JJHA 5C0BA 5DDHB 1WIPA 4OT1L 3S5LG 5CIPB 1YNLL 4NHUE 3LS4L 1IZJA 1S7RB 2AXGA 4PRPB 5FDWA 3CC5A 3WIIH 5FKPB 4KTYA 1FVDA 4MA7L 32C2B 2ZUWA 1SJEA 3O45A 3T1FA 1L0XA 5LJYH 3SCMB 1QHOA 2LTQC 1KB9K 2VXQL 4LCYB 4AQ1B 5IMOB 5LWYH 2ZUSA 4U1KA 1RUAH 3MJ7A 4JE4B 4P2QD 4PJCA 5A40E 3P0YH 2G5RA 4KK9C 1UVQB 4NOBA 2HTLD 3SE4C 5SWZB 1I3UA 3QEGH 3PQYA 1DQQA 5DD5H 3QFJA 4FP8H 4Z7UE 3ARDC 3KHQA 4H5SA 2MMXA 3KXFB 3TGXA 3RBGA 1EPFA 9CGTA 5HPMB 2BC4A 1RZJL 1F42A 3N0PB 2IH3B 5GGVY 2W59A 2VDPH 4LSSH 2DLIA 4JVPA 5IM7B 1PY4A 3D5OF 3H7BA 3ZSTA 4MX7B 2DL2A 2RB8A 4RFOL 2FGWL 1XGYL 5TPWL 4ONFH 5D7KD 5HYEA 4QHLA 1KENL 4L8DB 3GM8A 5E9DB 4QWWC 1ZK9A 5INDB 2YZ1A 4MNQD 1FE8H 3FT3B 4ZD3H 3OJMB 2G60L 4F57L 1QFWH 1QFPA 4P57A 5C2BL 3QUZA 3OKMB 1WBZB 2P5WE 4HWZB 4WDIA 5EU4A 5GGVH 1JNLL 5I8OH 2ADIA 4LEXL 3P4OB 2A6JA 4P9HH 2J1KA 2XZAL 1QLFB 4Z18A 1X3DA 1IAIH 2XA8H 1WFOA 2GEEA 4U6YB 1BD2B 4PJ5E 3GFUA 5ALBL 2VL5B 4S0UC 1C5BL 1XCQA 3F5WA 4K8RL 3D18B 4A6YB 5IMKB 1OAZL 3AXLB 1L6ZA 3S35L 5E0QA 1YY8B 5J1AB 4HJGB 3VFGH 2NY5C 1H0DA 3WKMH 1NC2D 4NQCA 1T20B 1BQLH 4OFYA 2AV1B 3ZYIA 3CH8A 3FB6B 2HVKB 3ARYA 5E8EB 4U1NA 1UYWH 3RU8L 2QSQA 3W81A 4EDWH 2Q6WA 2WIIB 3RKDD 2Y7QA 1U8JB 1BFOB 5I15H 4PJ8B 4ZO9A 2DD8H 4G6ML 1JWSA 1QRNE 5F1NB 2XN9B 4H8WL 8FABA 3VWJC 4FQHB 1HHKB 1UACH 1NCTA 4WJ5A 5GSRA 2R0WH 1P4IH 3VXOB 3O9WB 5FGBA 1GGBH 5JA8B 3BUTA 4IHOB 2DWDB 2WK2A 5EC1B 3U7YH 3MUJA 3RGVD 4XP4L 5K9QG 4KK8C 4HMDA 4F7TB 3S3JA 3SN6N 3EO0A 4JN1H 5JQHC 5EU6B 1Q94A 5FOJA 5I74B 1JGVL 1T1ZA 3QNXB 4UNTA 3IU3B 3VXPA 5TQ0L 1MRFH 2MKLC 3PABB 5IW6B 4YAQB 2R9HC 1MPAL 4ZYKA 5B4MD 5EA0L 5EWIL 4MS8D 3SJVD 4YDKH 3P11H 4GBXD 5C0CB 4M1GL 2B4CL 2BNQA 2C1PA 5F8QC 3FT2A 3U7AA 3VGHA 2D7TH 2X7LB 3N06B 1F8TL 5E1HB 3ARBA 4M93C 4DCQB 3E6FB 2XIDA 1D5BA 4K7PY 1MIEL 2R2EA 1I8IB 4H20L 3IJSB 1DSFH 1T2JA 2OP4L 4NN6B 2P49B 4HAFA 5K9JH 4MB5A 3BE1L 3MV7E 4K2UL 4XP1H 5A2KH 3HI6L 3T8XB 4OGXL 2PYEE 3U36B 2MHAA 3V9FA 4Y1AA 2C9AA 5I6XB 2R56H 4NDMA 4TUKH 3PWPE 4UAOB 2XPGB 5D93C 2XRAH 3Q5YA 4R97B 3X14B 1QLEL 4OD1H 4Q6IB 4BSJA 3BRFA 3B2UC 5D71H 1MCHA 1S9XB 3S7GA 5FUZL 3HE6A 4GW4A 1H8OA 1EAJA 2EDBA 2AEIT 3ZE0F 2VXVH 3NN8B 1T03L 4X83A 3T3MF 3HI5L 2DQTL 2PXYD 5TQ2H 3RNQA 1KCUL 4PJDA 3VW3H 1RZ8A 2VZOA 3O41A 2ZCKL 1CR9H 3HG1D 4LSPH 4WWKC 2YEZB 5EO9B 5DEFB 2VQUA 4R3SB 4X6BB 2DYPD 3MRMB 5GJTL 3QZWG 4GLRH 3P4NA 1M7IA 4EZMA 4NOFA 2IPKB 3HLAA 3AB0C 5D1ZA 3T3PE 2BNUA 1EJ6A 4NWUH 5E56A 3O8XB 1XGQB 3B4NA 1F4WL 1DQMH 5EU3B 1HSBB 4KK9D 5ISZA 4XNMA 3W9DA 1P7QB 3MJ8B 3DGGB 3WDHA 1AE6H 4UIKH 3ARZA 4FFWD 1W72A 4D9QD 4ZNCD 2VISA 2APFA 2Q3ZA 4RX4D 3GGWB 3D0LA 2W9DH 3ARDD 4JO4H 1XR9B 3DMMC 4CADA 1J8KA 1GL4B 3ZKNC 5DRNA 2MWCA 5TJWK 1NANH 4NSKA 5DJ2B 5EZIH 2R1YB 4DN4H 4FQLL 5JIKA 4GOSA 5T3ZD 4PJ5B 1J10A 5AEAA 3O0RH 3T4AB 1JFQL 1CICA 1AO7D 3GO1H 1KN4H 4Z7OE 2DBJA 2A6DA 3WEXA 2ZCLL 3ME0A 3O6LH 4LPWA 1QLRA 3I9GL 3WMSA 4BFBD 1M7DB 4TRPH 2FJGA 4QWWD 1I75A 2UZIH 3MRIB 3BWAB 1OSPH 2VXUL 3SHSA 2HYMA 1Q0YH 3OAZH 2BVUA 2R0ZH 3JV5A 4HUVB 4XC1L 5IWLA 1CLCA 3MR9B 3T65A 2CIIB 5LGHH 3BKYL 1AI1L 3FB5A 1C5DB 1AC0A 4HUMB 4OFDA 4G8FB 3W5NA 4L9DA 4X6CE 1FRGL 4XCCL 1JPTL 4RWYL 1QRNB 2XWBB 1C1EL 4FZ8H 5I17B 2V6HA 2VE6B 5K9OA 3S4SA 4HIIA 4PJGE 4PJEA 1UWGL 5C6WH 5C0GA 4U6XB 2PF6A 1F4XL 1ORSB 4LAQL 5DRZB 2EDYA 4NRZA 1EV2E 1KT2B 4HIEB 1R3KB 1QRKA 2GSIB 3BFOA 1MWAA 3TWCL 5AD0B 1NUGA 5CJQH 1FVEB 4MD5B 1BZ7B 5JO5A 4JO1H 2B2XL 2YS4A 5GIRB 1KACB 3ELAT 5KBNC 4ZS6C 1XGPB 2D0HA 5T1KB 4PDCE 5IB4B 3CD4A 3MNVA 2G9HA 5IW1B 1KJMA 4JFEB 5L2KE 4C4KT 4LCCB 3MROB 4UT6H 4I0CC 3RDTA 1MRDH 3VWJD 2J8HA 1OM3H 1U8OA 4KK6C 3BI9X 1FFNA 4Y5YB 4O2CB 2F54A 4MA3B 5DJAB 1NGYA 4P46B 5CSGA 4KK8D 5F96H 5D2LE 4S2SB 1WT5C 4ZOEA 3DX7B 4XBGA 1IM9B 4WI2A 1MOEA 3LV3B 4IRSC 5LQBL 2I9LA 4K3JH 4MDJA 2X1OA 3NBNA 1ZANL 5E2TH 3PWPB 1DBJL 1WICA 2DN7A 3V8OA 4N5UA 2RQ8A 2IG2L 2ESVE 5CWSB 3F7VA 3D2UB 3CX5J 4HWNA 4JGUA 3ECBB 4NQXB 4HLZG 3SE4A 1UH3A 4OLXL 3FT4A 3HMXH 2V7HA 3KLAA 3EJYD 4PJFE 4N0RA 4YXLL 1M6OA 3IFNL 1DANU 3U4EA 1FPTL 3P4MA 4U6HA 2DB8A 2YN5A 3MV8D 1S9WA 3HE7C 3BKCL 4KVCL 5ACLA 1MQKH 2JB6B 3C6LD 4CGTA 3FQNB 4OB5H 1RJYB 4QTHA 1EO8H 3TT3L 4N8VA 1VACA 5TGBB 5CS7A 2QV2A 1RD6A 2YC1A 2BNRD 3BVNA 3EO9L 1P2CA 1YMME 2CLVB 5DD1H 3ZMRA 1X5GA 4HAGA 4BK5A 5KS9B 3QI9A 4PRHD 2VZ3A 4JVWA 3VFWB 3G9AB 3BIAX 3B2UD 3DI3B 1G1CA 4APQD 1MF2L 4F33A 1NCCL 3RIAK 1TCRA 4WO4B 3EGSB 3IDJA 3SKJL 1N7MH 1TZHB 2R4SL 3EOTH 2RJMA 2J4WL 4PS4H 4KXZI 2JELH 4LSQL 4NBXB 2ATKB 1B4JH 3KPRE 4PJ9A 4X7DC 3I50L 2GSGA 1C12B 2NW3A 2FATL 4YXKH 3B9EA 4OGYL 4OCXH 5I73B 3MNZA 1DVFC 1LE5A 1GH7A 3MJ9H 1X5FA 4X98B 3WSQL 2FNBA 4LLUB 2HMIC 2VLRD 3HZKA 1NUDA 2WBJB 2UZYB 1MI5E 5DJYA 4P48A 3MRNA 1HSAB 3ARGB 5JXAL 5F88A 4OZGF 4K71C 4XMKH 3UPCA 5J6GA 4Z76B 5DHVA 4XWOC 3T0EC 4DVRL 1NFDB 2Y9RT 3G04B 3HR5A 3BPLC 1GIGH 1MREH 1DQDH 3IVKB 3DMMD 1BPVA 4MQTB 1NAMA 3WFZA 4BQ6A 1GSMA 1OAYL 3K74B 2VWEC 3FRUB 4JM2C 1R24A 3BUYB 1RU9H 2VDRH 2IALA 4RIRB 3BPNB 1HI6B 3FN9A 1NMBH 5CSZA 1WAAF 3TVMD 5D5MA 1S7UA 3S6CA 4EI5A 1KCRH 3QCVL 1DQJA 1FFPB 4E5XA 5DVNA 2ID5A 1NCDL 4CMHC 3UCRA 3VFMB 3ZE2F 1INQA 1UH4A 2V5TA 1Z9OA 2OTWB 1TZGH 5BOPA 1TFHA 3D69B 3KR3H 1WZKA 3NGBB 5TDNB 1MJUH 2YKLH 4KPHH 3BN9C 4R96A 2PR4H 2FYYB 2V2TB 3R1GL 2BFVH 2ZUXA 2EC9U 3L3IA 1AP2B 3OKEA 1G9NL 2E6PA 3UJJH 2X4OA 2VQ1A 3TBYA 1JHTA 1I9RL 1LP9F 3K8MA 5F7FA 3MCLL 4QNPE 2HVJA 2DQEL 4MXWH 4EKXA 2B1AH 2CLRB 1ACYL 3O2WH 4IOFC 2H45A 2H32B 5CJOH 3AFLA 1B9ZA 1RUPH 5GRJH 4IRZH 4DZBB 2GJ6B 3FOLB 4PRNB 5F1IB 2VDMH 1S7SB 3WNOA 3B8YA 2Z93A 3WE6B 2EYSB 1QFOA 2EDFA 5IJKC 3C08L 1BX2B 4P59L 2EIBA 4OCLC 1FN4A 4P23C 2WLZA 2F74A 2X4QA 2V17L 1U42A 4NCC2 3VRIB 3L3KB 4AL8L 2F8OA 5IV2B 4DKDC 5EU5A 2F53D 1UB5B 5IMMA 4UDTA 5HI5D 4LLMB 1KPUA 2ESVB 3H9SD 4LRIC 1J8HA 2X9YA 5DRXA 1IJ9A 1TZIA 2DQDL 2YPVL 4NO5A 4AEHH 4JRXE 4KK6D 5GHWH 3RA7H 2Z92A 2W9EH 1OW0C 1T0PB 1IAMA 3REWA 1YQ2A 4PJFB 5KVEH 3U9PH 4Z7UF 3JZ7A 5KVGH 4M9OA 4EUPG 2HFGH 1EIBA 1FO0H 3O3DB 1SY6A 5I0ZA 4HKBB 1YN7B 1GJIA 1I7TA 5BMFH 4OCSL 5EO0A 1LK2B 1IBGH 4CVXA 1YEKL 4WWKA 3TN0B 3W0WE 3OHXA 1U3HA 3GMOA 2EDWA 3GSNH 4ZQKA 4P2RD 4L3ED 1QFWI 4HC1H 1UB6A 1JZ5A 5FHBH 1A6TA 1NCNA 2AXJA 2X9XA 4POUB 2P24B 1YMMB 4OKDA 1GGIL 1OGTB 3BP7A 5CP7B 2AEWA 3MV01 2I25N 2JTDA 3BHBA 4YGAB 4HIHB 1FL6B 1QSEB 4HUNB 5AZ2H 1ZA6B 1OGAE 5BV7B 1IAII 3CVHL 2VUOA 1AQDB 4O51B 4WFED 3WN5C 2VLLA 1KELL 4WNQA 5KVMC 2CMRH 1OOAA 1QBMH 1KBGH 3L6FA 3DVIA 1KULA 3IRPX 3CH1B 1CLZL 1I9IL 3LMJH 5F89A 2W0KA 4DGYH 1PZ5B 3HE7D 4NQVB 4FQXB 1T0MB 5EUOA 1FZJA 3KPRB 3B83A 1ZWIB 2VAAB 3FO0H 4UQ3B 5JOFB 4XBEH 3FMGL 3BO8A 3OXRA 3QUXA 4Y4HD 1RK0A 2VZTA 5B3JE 1OWWA 3QG7L 1CGXA 1I7ZB 1ZT1A 5D1QB 5CZKA 1JNJA 5ICXB 1VGKA 4ETQA 3DIFB 1MJ8H 3P73B 1FYTA 3FO2B 3GM0A 4LSUL 1K4CA 4PG2C 1U3YA 4L8BA 1MI5B 2FB4L 4JM4H 1MHPL 4LSDA 4JPKH 4NO2A 1BWMA 3VFNA 3DROB 1ZGLA 3PNWA 4GAJL 5GRUH 3HMWL 4WEMB 2JJSC 4XPGL 3EOBA 3UAJC 5I19H 2DQGH 5D7LD 5LAXA 1J11A 3VGBA 3GKZA 3MOBH 5FYKH 3JTSB 5HVHC 2YHGA 5KAQG 4AG4L 5SWQB 2A1WL 4MNGA 3TYFA 1IAKA 4RFEB 3K1DA 3MLZL 3T0DA 5FOBB 1KCVH 2ZKHL 4YLQT 5CEYB 2QADD 4KGJA 5I76B 4KQ3L 5T1DH 4NO0A 1TQBC 5I16A 4XTRC 3VFPA 2V2XA 4DEPB 1AFVH 2CGRH 1QSZA 2NY4B 4Y5XB 3UROR 1DEDA 2HMID 5I1IL 5DSCA 4CU7A 4JAMB 3ARWA 3ROLB 3C8KB 1XR8B 5CGTA 4N68A 1WTLA 1AR2A 1TVDA 4JY5H 1MHHA 3VFSA 3RY4A 1P6FA 2BSTA 1I1AB 3D3VB 4LIQH 3S88H 3C5ZA 1NEZA 4IMLA 4JRYD 5I1LB 3K8KA 4UINL 1CXFA 1G6RA 5I1JL 4PJ7E 4WV1B 1MY5A 1KB5H 1MVFA 3VH8A 4OF5A 3QNZA 3OZ9H 1YMHA 1X4ZA 3MO1B 3ZTNH 3BH9A 1CZ8L 1UKTA 3VXTB 5HD8C 1F58H 3MODL 3L1OH 3LN5A 3WD5L 2VOTA 1YUHA 3RQ3A 3VXSA 2R23B 3NH7L 3STLA 4OCWL 1WT5A 4PJXE 3TA3A 3BP4B 3WNLA 4UV4H 2W92A 3CFBB 4JFXB 4IRSA 3MQIA 2OLDA 1T5WB 4JCMA 2ZUUA 1MLCA 3BN9D 5FYLH 3HS0B 1XGTA 1F6AB 1Y6KR 4M03A 5EO1A 3BMWA 4PP2A 1D3CA 2RFXB 3VXNB 2AVGA 3GUTA 3S98A 4N0FB 3U1SL 4JFPA 1MCQA 1RUKH 3HNTH 4WU5A 5F6IB 4JRXB 5KSVB 2EE3A 3RJQB 5C09D 4JFFE 2Y6SC 1D5MA 3QDGD 4W6WB 3HRPA 3TPKA 3O9WC 4H0IA 4MSWA 1GHFL 4XVSH 4HKJA 2R0KH 2ZNWA 5KN5A 3V0WH 3PHQA 1VKXA 4W4NA 4YK4C 4NT6B 3QWRD 4YHKH 2YD6A 3ILQC 3MPCA 4KUZH 3W0WB 5B3NA 3SKOA 1A02N 1E4WH 1OD7A 4BA8A 5DRWB 1OY3B 4XBPB 3ET9F 3MRGB 3INUH 2V7NB 3LH2H 3V5HA 5HPOA 4TYUA 3MRRA 1XCTA 4OT1H 3VI4E 1YNLH 2NXYB 5CFHA 5IGXL 3LS4H 3H2WA 3VFTB 1GZPA 1MCKA 3LQZB 5IB2A 1NANI 3G6DL 3GSRB 4QHUA 5ITBL 5ENWA 4MA7H 1D5IL 4DN3L 1PKOA 2WP3O 3FOMB 2RCSL 2V2WB 2NCMA 3K80A 3UTTD 5DHYB 4C55A 2M8XA 4R4FH 4U1JB 2FDBP 2VDNH 3WIHA 2VXQH 3HUJA 1CS6A 2VLKD 3PIQB 4NN6C 2E7LC 3BZEA 1FG2B 4JLRA 4P2OC 2V5MA 3EO1A 2X09A 4DJMA 4NYLA 4OZIE 4Y16D 4ODWB 2N1KA 4K55A 5D2NE 4IRJB 1RZJH 3TPUA 3F7YA 1WZ1L 2WMPA 3KDMA 2H9GA 1E4XI 4LHUG 1MCPL 4V3DB 2A0LD 5CEXA 2YD2A 3T0EA 4RFOH 4CMMB 2FGWH 1XGYH 5TPWH 1FZMB 3LEXB 2FHFA 5HGDB 5DC4B 4DZ8A 3FRPA 5CINL 1KENH 3GJFA 2ZUQC 2BVPB 4IM8A 4JM2A 4X6CF 2G60H 4F57H 1D9KD 5SWSD 2X4TA 5C2BH 3MUGA 1IC5L 5CD3A 3IGAA 3VA6A 2X4RB 5ACZB 1CQKA 4PJGF 1JNLH 4LEXH 4MJ6B 4X80L 2FO4B 2XZAH 3T04D 1ZHNA 5ESAB 5KTEL 1FCCA 5C3LD 5ALBH 5CZVL 4NFBA 1C5BH 2IJ0C 4XT1C 1YNKH 4N0UE 4K8RH 2A9NL 3MUHL 3TT1L 1OAZH 4Q97A 2CKBB 1UH2A 1W0VB 1SYVB 1YEIH 3S35H 3W39A 1LD9B 1A6VL 4ZDHA 1CFSA 3MRPA 3I6LE 1E28A 3PQYD 4QKXB 4X0KA 1R5IB 4AENA 1RZKC 4KJPD 1REIA 1ETZA 2W0FA 4Y4FD 4C57C 1U41A 3MMEA 3LKRB 1QR1A 3BDXA 1ZE3C 1BREA 3D25A 4RMUA 1ZLUK 1DBBL 5FFLA 4XTRD 1C8PA 3RU8H 4HUWA 5DJZB 1Z9SA 1RK1A 4Z7VA 5E4EB 3MFFA 2DKMA 4UBDC 1WC7A 5GGRA 5D2LF 2HJFB 1ZSDB 2QR0A 5JPNA 4G6MH 4H8WH 3IFPA 3NPSB 4I13B 5IJKA 4XHQA 5E6IA 5JMOC 1YJDC 1K4DA 5FO9B 4PJHA 2X4SA 1S3KH 4P23A 2X9WA 4NQDA 4Z5RA 2VLJD 3VXMD 3NVQA 1MHCA 5C0AA 4XP4H 4QCIB 2ORBL 4LLYB 4V1DE 4YBLB 4XVUC 1JGVH 4LNRA 4GXUM 4YIQB 5TQ0H 3C9NA 2D3VA 4OGZA 4PJFF 4RAUA 3V4VL 5MEND 3PWLA 3KPNB 1Y18B 4TSAL 4JFFB 1MPAH 5EA0H 5HHPB 1H5BC 2AK4B 4H25A 4M1GH 5DK2B 2B4CH 1JYNA 3FTGA 2PNDA 4FHBD 4L4VE 4I3SL 4RWHA 4UT9L 3KHOA 4ZFOL 1CL7L 1S8DB 4Y4KC 5ETUB 1P4BL 5IEHA 3DV4B 1MIEH 3CVIL 4M5ZL 2R29L 4H20H 1X5KA 5DK3A 1MVUA 2CPCA 1KG0A 1T4KA 2OP4H 1MCNA 1LO5A 4P3DA 3EYFA 2Q8AL 3OKYA 3PL6C 3BE1H 4PJIA 3F6IA 4K2UH 1U58B 3MBEC 3HI6H 1MLBA 4OGXH 1MJJB 3BD4A 1KIQB 5GZOC 2Y6SD 2L4OA 5LXGL 3F7QA 2ZUVA 3GMRA 4O58L 4Q7DA 1HHJB 4W4OC 5DDHA 4DOHB 2JB5H 1QLEH 5CIPA 5I9QC 4PRPA 5I66A 1KCGC 5FUZH 1T03H 3S4SG 4Z7WA 4OZIB 3PGCB 3I3EA 1Y6MR 2ZSVB 3HI5H 1C5CL 2DQTH 4LHUD 1BVZA 2VB5A 1KCUH 1T22B 1KJ3L 4NJ9L 2NX5B 5D2NB 3QPXL 2ZCKH 3Q3GB 4LCYA 2QJDA 3HNVL 1NGXA 1LO0H 1BVLB 5DVLA 1UVQA 4OCMC 5GJTH 5SWZA 3NZHH 2JJSA 3FQXA 3SO5A 4BKLB 3RVWD 4JRWA 5GRXG 3KXFA 2ZSWA 5GGSB 5HPMA 1N64L 1H3WM 3QIWD 1F4WH 1I9EA 1MELA 5F21B 1KN2L 2NW2B 2IH3A 2WUCL 4OGAD 4P2OD 3LRGA 3AS2A 3GBLA 5IQ9A 5KANG 1TPXC 5A2IH 4O2EB 4MX7A 4I18B 1XMWA 3T0VA 2IPTH 4U2YA 3C2AL 4UUJB 2IBBA 1WUNT 3I85A 4N90D 4U7SA 4L1HA 2VABB 4L8DA 3SKUD 2MPAL 3DX8B 5E9DA 3SEPA 3FT3A 4FQLH 5EBLB 4LVOC 1KYOJ 3KPQA 4YHNB 4NCDA 2R0LH 1JFQH 3OKMA 3BJ91 1JF1B 1WBZA 2BDNL 3PHSA 4HWZA 1IAOA 2ZCLH 2GK0B 1FNEB 3B9VA 3I9GH 4K94L 4JDVB 2PO6C 1QLFA 3O2VL 2F5AH 4XZUB 4AM0B 4U6YA 3EJZC 1BD2A 1U91B 2VXUH 5F7WC 5L88L 3FN3A 4MNHB 1S7XB 4RRPA 1CXLA 4QNPF 2OR7A 4A6YA 3KJ4B 3AXLA 3E1F1 1YN6B 1AI1H 2YA1A 4JQVC 3X17A 1YY8A 4XCCH 1FRGH 5J1AA 4HJGA 1JPTH 4RWYH 3V0VB 1C1EH 5D1ZD 3RVTD 4TSCL 3REVB 3ARGC 1T1YA 1P7HL 4ZSOB 2AV1A 1FFRA 3FB6A 1UWGH 5IFAL 4NBYB 5E8EA 4LP5A 3G5VB 4PTUB 3IXTA 4OCYL 3RWDB 3P77B 4P3CL 3Q5TA 1F4XH 1KJ2L 2WIIA 4AEIL 1BFOA 1CVRA 3UYRL 3ARXA 1IEAB 4V1DB 5F1NA 4FQHA 1HHKA 4OD3L 2X70A 1NFKA 3QISA 1CIUA 2E9IA 5KZCD 5GSVB 2B2XH 2YD5A 3VXOA 4JDZB 3O9WA 1KLUB 3U82B 4IHOA 2DWDA 1MAML 3NOIA 4M7LT 5EC1A 5E24E 4UBDD 2BOBB 4F7TA 3LIZL 1I85C 4L4VB 3RWHA 5EU6A 3BRGC 1H15B 5I1DB 3QNXA 5ALCH 1WK0A 3H9YA 4JY4B 4YX2L 3WHE0 3QG6B 5IW6A 3PABA 1I4FB 5CGMA 4C56E 3AMLA 4YAQA 3TJHA 3LQAL 2XTJB 1XFPA 3BZ4A 4CVZB 4C58B 3DXAD 3MRDB 4JGMA 5C0CA 4KI5D 1EFXD 3ZE1E 1MAKA 4XVUD 1TVHA 4F15B 2UY6A 4FG6D 2X7LA 5IB1B 4DCQA 3E6FA 4BELD 5LQBH 5DZNA 1MCDA 4YQXL 1CU4L 1I8IA 3NACL 1ZANH 1DBJH 3MNWA 3SGDH 1CD1B 5I1KL 4NPYB 4XHJC 1AXTL 2G2RB 2IG2H 1ADQL 1LO2L 4P2CG 1CF8L 4OLXH 4MJ4A 3U36A 1L9MA 3S3PA 4YXLH 3DYPA 3IFNH 5B3JF 1FPTH 5DQ9B 3O6FC 3DLQR 1A7BA 3ILPB 5JIPA 3LN9A 2XPGA 1EHNA 3BKCH 4KVCH 3PL6D 3X14A 4Q6IA 1N6UA 1AHWC 2HLFC 1P84K 3GNML 2IANE 4IS6B 2IC2A 3X3FH 3S3SA 3I3DA 3EO9H 3NN8A 4I2XE 4XGZB 3OSKA 2H8PB 4QOKD 1T7ZA 3K8LA 5C0JB 2FBOJ 2HT3D 4HFUL 5H37G 3WFEL 4Z7NE 3IETA 2H2PC 1MF2H 1RJCA 1JWUB 1NDMB 1NCCH 2YEZA 5EO9A 5DEFA 5SX4H 3SKJH 1SEQL 4R3SA 3A6BH 4P5TB 2YPLE 2OJEA 4X6BA 2R4SH 1HHHA 3MRMA 2CRMA 4WW2B 4OBSA 2DMKA 3HR6A 4H1LH 2J4WH 1N2RB 4ZOCA 2IPKA 5E2JA 4YEEA 4LSQH 3X11B 3BKJL 5T3XD 5I0DA 3O8XA 1XGQA 1A6WL 3I50H 5EU3A 1HSBA 5HI4C 5T1MA 1AIFB 1FNFA 4OGYH 1RULL 1P7QA 4DWHA 3MJ8A 3DGGA 3MLTB 3X3GL 3FFDB 3VWKC 5JA9A 1M1SA 3GGWA 3WSQH 1XR9A 3B9KC 4ODUB 4P5MB 5DJ2A 4PJ7F 2XKUA 4ZAKB 3WFHB 1V3MA 2R1YA 3HB3C 5JXAH 5BXFA 3T4AA 1N3NB 1T2QL 4DVRH 2IEPA 4IIQC 4PREB 2CDEB 1A4KB 4XXCC 2PW1B 2BY0A 1M7DA 3QDJD 5E5MB 1OAYH 1NC4D 4JFHD 3SE3A 1J12A 4PJXF 4QGYA 3DX6B 3MRIA 4HUKB 3BWAA 4P9HC 1LQSR 6FABL 2NY1C 1AKJD 4MQSB 1OCWL 4KC3B 4HUVA 3WXWH 4X6DE 3MR9A 2CIIA 1PGRB 1CE1H 1G0XA 5EOQL 3QCVH 5FV1L 4I5BB 4HF5L 2X40A 3SDCB 1JV5B 4G8FA 1LHZA 4GAGH 1RURL 4RDQG 3KPOB 4FQQB 3V6OC 1F2XK 4HDIB 3QUYB 4JR9L 2XWBA 3WJJA 2UZXB 2N56A 3L3OB 3O11B 2MQ0A 4LLQB 4S1RL 2DI9A 2JJUA 3HHRB 1H5BA 3SDDB 5IHUH 3R1GH 4LSTL 4U6XA 4XAWL 1ORSA 1G9NH 2RR3A 4OLZL 1RIHL 5DRZA 3QFDB 3GJEB 4PIRF 2O61B 1MCBA 1R3KA 2GSIA 1A6AA 4QRRE 3SKNA 4Y4KA 1DUYB 5CP3A 1FVEA 1S9YA 4MD5A 3H0TB 4GXVL 5LGKA 2DQEH 5E5RB 4WHTB 1KLGB 2BRQA 3KPLB 2A73B 2CDFB 5GIRA 2YXMA 4HIJB 1XGPA 4C56B 1ACYH 5IB4A 1DR9A 5ABDE 1LDPH 4L4TE 3VI4F 4JFEA 5L9DH 2IFFL 3MBEA 3QIBC 4G8IB 4LCCA 3MROA 2E9WA 4GXUN 4WV1C 2DLFL 1I8LA 1MCWM 3C08H 4P59H 4Y5YA 4O2CA 4RGNE 1NGZA 3FO9B 5DJAA 4I9WE 2V17H 4ONGL 3SDAC 2FECI 4P46A 4AL8H 3BSZL 4PGZA 2E7CA 4BZ1L 5D1XD 4ISVA 5D7SL 4S2SA 3AUVA 5C0BE 3O2DA 2DQDH 4OI7A 2YPVH 1BZ9B 4OFIA 3DX7A 4N5EA 1IM9A 4OZIF 4AIXA 4CUCA 2ZPKL 3LV3A 2MFNA 3TM6A 1TNNA 5E2WL 1EJOL 3PWPA 3WFCL 2CDGA 4OCSH 4QRSA 5C07A 2X4NB 1YEKH 5CWSA 5C86A 3D2UA 1I8MB 3ECBA 2CIKA 2W65B 2CUHA 4NQXA 5ESVB 2XKSA 3CZJA 3IDXL 4ZUSB 4JANB 4PJCE 1IQWL 2W0LA 5F6IC 5TF1L 1OF2B 3C60B 2DLGA 4J3WA 4MZ3A 1JGLL 4XHJD 3NIGE 2E27L 4YBQC 4Y2DC 2KL6A 3FQUB 3QFJE 4QHNA 4JZJB 3VH8G 3N1QC 3FQNA 1DUZB 1RJYA 1XIWB 4NC1E 3QNYB 5C0EB 4PLOB 5TGBA 2YPLB 2OX5A 2CLVA 1QBAA 1EK3A 1QHPA 3O6FD 1CLZH 4NZUL 3VMOA 1I9IH 2XQYK 5KS9A 2Z8VC 2NXZC 1QBLL 2EYRB 1TJGL 3IF1B 3VFWA 1SMOA 1YEHL 3N9GL 2UYLA 1QP1A 5JZ7C 3Q6GL 4OI8A 1PAMA 3FMGH 4P4KB 3EGSA 5IFHL 1FNSL 2QL1A 4N9OB 1TZHA 3QG7H 5GGSY 1LEGA 1I3GL 4KTDL 4ONOA 3BQUB 1YQVL 3AREB 2PO6A 4LPTA 1IGTB 4N0CD 5EIIB 2ZOKB 2XTLA 1S5HB 4YHLL 4LSUH 2H2PD 1DBML 2EYTB 5KSBE 2HJLB 1W72L 2FB4H 1C12A 1MHPH 1YDPB 3UXFA 1CFNA 3U46B 2XZCL 1D5ZB 2A9ML 5C0RL 5D7JC 1P4LB 4GAJH 4QF1B 3HMWH 2ICWI 4LVEA 4XPGH 4EXPX 2A6KB 2JIXD 5B22A 1TQCC 4X6FB 4LLUA 1BJMA 3MUZ1 5JLZA 1MCOL 3NFNB 1UKQA 2NZ9C 3BIKB 4AG4H 4DVBB 2A1WH 5HI4D 1KTRL 3N1GC 2DLEA 3MLZH 1HSAA 3ARGA 2ZKHH 4KQ3H 4Z76A 5EU7C 2PUQT 3VWKD 1NFDA 4NQCE 3QO1A 3G04A 4G9FB 3IVKA 4X6DB 2R2HB 3ULVL 5I1IH 1FIGL 3QXTA 2XZQL 3VI3E 3RTQB 3FO1B 3RL1B 3FRUA 4XXDB 1FNAA 4RIRA 5SV3A 1HI6A 1I7UA 2CRIA 4JFDD 3MCKB 2NY6B 2UV3A 5TE6L 2ICWB 4X4XB 2G75B 4URTB 4UINH 3W82A 5I1JH 1I85A 4CBPA 1WWWX 3VFMA 4UU9A 4EJ1C 1CIDA 1GOHA 5FYKU 1FIEA 2GUOB 1CZ8H 4KUCF 2OTWA 3MODH 1ZVYA 2BVEA 2IWGA 4PB9L 4WFGE 4WHDA 5GS1C 5GGQL 3WD5H 3D69A 1WFUA 2H26B 4LK4A 4MJIA 5TDNA 3NH7H 4X4MA 1MWAL 2FYYA 2Z31D 4OCWH 2V2TA 3QDMD 1AP2A 3WFBL 3SQOL 1PQZB 4UQ2B 2DOCA 2BNQE 3UZEA 4GRLB 1PX4A 4RGNB 4HGKC 2APWA 3L5WB 2CLRA 1WWCA 7FABL 2H32A 4R4BA 4DZBA 4ZO8A 5ECJE 2GJ6A 3U1SH 3FOLA 5L8KB 4PRNA 5CJBA 5F1IA 5MEQA 1S7SA 3F8UB 2EYSA 3BIBX 1BX2A 3BGMB 4WI6A 1IGFH 4JG0L 1GHFH 3VMNA 3J7HA 3L3KA 4X99A 4Y1AE 4PRIB 5J4MA 5IV2A 1AHWA 1H3PL 5D7KE 5T3XL 3D6GA 1JTPA 1R3IL 3VXUB 4LLMA 3RFZC 2ESVA 2PTUA 4QT5A 1KSRA 2M1KA 4HK3N 4U1KB 3ES6A 4MVBD 4LKXA 3LDBB 4PJCB 5JPMB 2X6MA 4G3YH 4OLWL 3SDAD 3V52L 3O3DA 5IGXH 1YN7A 2LVCA 1LK2A 3QQ9D 3QFJB 3BP6B 3TN0A 1TJHH 4PJDE 3G6DH 4XI5C 3QXDA 3O3EB 5ITBH 1D5IH 4DN3H 1J1XL 1VB9A 2EDHA 2VDQL 2KBGA 3DJ9A 3SOBL 2WIMA 4M61B 4PB0H 3N85L 5C6PB 1T3FB 1OGTA 3IFOB 4N9GB 5CP7A 1JVKA 1NGWB 4HUUA 1JRHL 5BS0D 1FL6A 1CDHA 1QSEA 1A6UL 1ZA6A 5ESQB 1U8KA 3OAYK 4X5XB 1AQDA 4O51A 4JQXC 3VGAC 3MRQA 3HC0B 3WDIA 3MSPA 2BMKA 1OTTD 3CH1A 5ISZE 3B9KA 3MRBA 1TIUA 3ARFC 3ESVF 3DUHA 4D3CL 1TJIL 5L7XL 4YBQD 4Y2DD 4LMQE 5HBBA 5J0BA 4NQVA 5DURB 1MCPH 3KPRA 1ZWIA 5KSBB 5KSAD 1INEL 1OP3K 5JUEL 3VXRD 1I7ZA 4XXCA 2GAZB 3B3IA 5D1QA 5DUBB 4OSUL 4U0RB 3AROA 5ICXA 3JBG7 3DIFA 5HHMD 3P73A 4PLKD 1URLA 3FO2A 1AC6A 5JZ7D 3DGCR 1WFTA 5A2LH 1T80A 1J0YA 1DL7L 1IC5H 3ZDYE 1HOCB 2P5EB 4EOWL 3R0MA 3ULVE 3TESA 1H0DB 1MCEA 1MIML 1LO4L 1JYWA 4HCRL 4WTZA 4IJ3B 5KTEH 3MC0A 3B43A 3JTSA 5DD6B 4HPOL 4WUUD 4RFEA 2A9NH 3U30B 1X5IA 3Q6FB 3TT1H 4AT6B 3E2HB 4WEBL 1S5IL 1IFHL 3C6SB 1A6VH 1RUQL 4WI9A 4HLZH 4Y5XA 3F12B 3TCXA 3FFCD 4JAMA 3ROLA 3C8KA 2NZ9D 1XR8A 1ONQB 2DTML 1JZ4A 2OMBA 2CLZB 5IB5B 3S9DB 3R8BB 3IAQA 1K3IA 3TO4C 1DBBH 3D3VA 1L4IA 1KXTB 1Q94B 1TTFA 3VDAA 3QEUA 5I1LA 3QIBA 3LKPB 1F3JB 5HHQB 3SGDI 4WV1A 2EE9A 4GO6B 4LEOA 1ND0B 1PG7L 3MO1A 3WO4B 2GJZB 2BNQB 1HXYB 4P2QB 2C1PB 4PGJA 2P8MB 3ZKSD 5MHSE 4OV5B 1ZOXA 2F54E 3ARBB 2QQKL 1V3LA 4UTBL 2R23A 2ORBH 4NKMA 4OCRH 4KFZC 1HK6A 2QKIB 2CSPA 3BP4A 4ACPA 2D0GA 2X1PA 5TE4L 3RVXD 3V4VH 4XNYH 4TSAH 1IRAY 3LY6A 3QEQD 1T5WA 3OB0K 2FD6L 5AYUL 1EGJL 4YZFE 3LHPL 2MHAB 3HS0A 1F6AA 3WLBB 2XFXB 1FDLL 2RFXA 4I3SH 3G5ZB 3GB7B 3VXNA 3B2VL 4N0FA 4UT9H 3G6AA 1WZMA 3OTTA 1CL7H 3EHBD 1P4BH 3UZVB 3CVIH 4JRXA 4M5ZH 4UT7L 5KSVA 3QIUC 5SX4I 3MGOB 1FH5H 3U2SB 3FONB 3MV9D 1JTTA 2FEDC 2WSKA 4MLSA 4ZXBD 4JB9L 2Q8AH 3U48A 3ZDZF 3VRLE 5BJTB 4Z7NF 4F7CB 3ALXA 3QJFB 3CXHJ 1X5YA 4FQIL 1TXKA 4I0PC 4XBPA 5F1SA 5LXGH 3MRGA 4O58H 2V7NA 5IVXF 2B5IC 5E6ID 4POYA 2XTJC 3VG0L 4RGOL 4OCNC 5T1LD 5A1AA 3P4NB 1M7IB 3VFTA 4OZ4B 3HLAB 3LQZA 3ULUD 3MACL 4G43A 3FOMA 1C5CH 4IOSD 1NC2B 1C7SA 1I7RB 5DHYA 5F6HJ 2YA2A 5F9WB 2VO5A 4NJ9H 4U1JA 5ISZB 5IF0A 4G5ZL 3QPXH 5F7UA 5IHZB 4H1LB 4KHTL 3GHEL 3PIQA 3HNVH 4BYHA 3D0LB 4MXQC 3TFKC 5JW4Q 2VQTA 5DRNB 1IILE 4ODWA 5CEZE 1MHEA 3WS3B 3L3HA 5HHOD 4OD2B 3CK0L 4IRJA 1DN2A 1XF3B 2AJ3B 1N64H 1CICB 2X5PA 1KN2H 4DUXA 5CGYC 2WUCH 3BDYL 1FZKA 2VLMD 3WEXB 4F9LA 5ERWA 2HAZA 2EKSB 35C8L 4F2MB 3NZ8B 1RZGB 2F58L 2FJGB 4LASL 4CMMA 4JG1L 3T09A 1YEJL 3C2AH 4X6DF 5I1GL 1FZMA 1JFMA 3LEXA 4PP1D 5HGDA 1KTLB 3ARFD 2YA0A 2EXWC 4ZFGL 5J6HB 2VDOL 2JLLA 2BVPA 2MPAH 4JFYB 1PBYA 4U1MB 2HWZL 3ARRA 3RY6A 3SJVB 4GBXB 1N0LA 4M48L 3OJDA 2BDNH 1HEZB 1BJ1H 2X4RA 5ACZA 4OIIL 25C8L 3O4OC 4HUXB 1MFCL 3KS0J 4LCWA 4MJ6A 3N1MC 4K94H 1GCFA 2FO4A 4GRWE 4RMQA 3O2VH 2GW5A 1I3VA 5L88H 1F6LL 4QRPD 3SCMD 1VESA 3VGDA 1D6EB 5IBLC 1LO3L 4EUPH 5JXED 4K3DL 4NRZB 2CKBA 1W0VA 4MQ7B 1SYVA 1LD9A 4WHYG 5I1EL 5DMGC 2VH5L 1R5IA 3K2UL 4TSCH 5MEPA 1KJMB 3KXFD 2IAMC 5KAQF 2QSTA 1UJ3C 3SBWC 5IFAH 1YA5A 1G6RL 1EUUA 4OCYH 1UKSA 4P3CH 1KJ2H 5DJZA 2VIRB 3S96A 4YHOL 3QQ3B 2F54B 1WBYB 2A77L 4AEIH 3UYRH 1ZSDA 1F00I 2YWZA 4P0DA 4OD3H 3K4ZA 1A4JA 3EZJB 5FO9A 2YD8A 3HG1B 3TBVA 2YRPA 3IDYC 4YFLI 1A7QL 3PP3H 2DYPB 1MAMH 3OV6A 2COQA 1I9JL 5DFWH 5DFVD 3LIZH 5D6DC 4LLYA 3VFOA 2H2SD 5I1HL 2I9LB 4M8QA 2JE8A 2ATPA 3ZKMD 3G5YB 3HRZB 4YX2H 5KVFL 4YIQA 3FB7B 1IM3B 1J8HE 3MV11 3KPNA 2EEBA 1FFOB 3LQAH 4Q9BA 2GI7A 4LPCA 4KTEL 4E42B 5E08L 1TMCB 3NIGF 4HGWB 1D6VL 2AK4A 4XCEB 3ARDB 3DHMA 3RZCC 3P4MB 3DO3A 3QCUL 4PGEB 1DN0B 1S8DA 5ETUA 3DV4A 4K7PL 4R26L 1CU4H 5B21A 3NACH 1P9MA 3HMXA 3OR6B 5K9QI 3QUMH 4FQ2L 3ZL4L 2HFEB 2ARWA 5I1KH 1AXTH 1LEIA 3GSXB 1A5FL 2EXYC 1ADQH 1LO2H 1ES0B 2ZG3A 5IFJB 4QXWA 1TVBA 1KIQA 4JQXA 3V6BR 3WXVL 2ADFL 3K0WA 2I27N 4PJ8D 2NR6D 2XN9D 2FEDD 4R6UA 1JZ6A 4XVJL 4U1IB 4BZYA 4JHWL 2DQUL 3GNMH 3AAZA 2DAVA 1AGFB 5DMIL 5GS2H 1GPOL 4I0PD 5EBMB 4ZNEA 5JTWA 3PGCA 1JHLL 1KCSL 5GS0D 1RI8A 2NW3B 3TBSB 1T22A 4HFUH 4L4JA 2NX5A 1MCSA 3MLXL 4WIQA 2EZ0C 3WFEH 4DAGL 3Q3GA 4FXKA 5DEZA