2VE6A

Crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN D-B ALPHA CHAIN
publication title Discovery of Cd8+ T Cell Epitopes in Chlamydia Trachomatis Infection Through Use of Caged Class I Mhc Tetramers.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ve6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ve6A01
4MXQA 5B38A 2I9LB 4P2QE 4UI2A 1KGCD 1QO3A 1GPOL 3QCVH 3KYOB 4NUGL 4R4NC 4Q7DA 2OL3H 3VXME 5MHSE 3B9DA 1JTOA 1RUPH 3V0WH 5BOZG 2IAND 2CIKA 5E9DB 4Y5YB 2JJTC 4UNVA 3GSRB 3I75B 3CVHH 4X4ME 3TBYA 4XCFH 1HE7A 4LPXA 1JGDA 4A2LA 1N64L 5KVGL 1T03H 1N0XH 3QI9A 5B8CA 4Y88A 3B4NA 3GSNL 4B5EA 4UTBH 1LE5A 3DHJA 3LDBB 4HDIB 1RZKC 3MRFA 4BFBD 4P3DB 1RAMA 3B8SA 1IGML 5BS0A 4OZHF 2Z4QA 4ODTL 1UWGH 3FHQA 3G6AA 3TP4A 3ZZ1A 5C08D 3BPNC 3PWUA 1FL5B 4HEPG 2YD4A 5DD5L 3JTSA 4JDZA 5C6WH 1J5OH 4XWGL 4FFEX 4Z8FH 4FFZH 3CX5J 1J8HD 2OTWA 5DUBA 4KWUA 2BOCA 1NL0L 3G04B 1BQSA 3QQ4A 1VDGA 1KCSL 4JFOA 4BSWA 1EEQA 2AK4E 5F9DC 4U1GC 3WD5H 1CDCA 3GHBL 4PLNC 2R9HD 1VPOH 2OJZL 1JZ4A 2JJTA 4J8RA 4AQOA 3E0GA 3G6JF 4LHJB 5C0BE 5DJDB 3Q3GA 3FOMA 3MA9L 2ARJB 1JYWA 3BH9A 3ZKQD 1NGPH 4HIEB 5E8NB 3V5KA 1T83C 4PGBA 1XF4B 1RIHH 1ZT7B 4F7TA 3RWIB 3VGGA 4QRUA 3BYYA 3EOTH 4JRYA 1UZ8B 1JWSA 1YUHA 1FO0L 1ZANH 1T89A 4GS7C 5D8JH 1AY1H 5IEKA 4JRXB 4L4TA 4YBHA 1OP9A 4C55A 5EZOH 2FNBA 5FYJH 4MD5A 4K7PX 4Z7VF 5C8JA 3MZGB 5HYEA 1HSBA 1XH3B 3IFPB 1P9MC 4OCXL 1TVBA 3CXDH 43C9B 2R0LL 3TCXA 2IBGA 3V5HA 1INDL 3H3PH 4NQTA 3DGCR 3T0XA 2C3VA 4JZJB 5JNYA 4ZUSA 3RVWD 5AZEL 1BPVA 5HHOE 3GNMH 3FB8B 3P4LA 4U6YA 3NFNB 4ZOBA 3MX0A 1AXTH 2JIXA 4D9RD 2R1WA 2R2BB 4G43A 2F58L 2E27H 1MIMH 5DEGB 1V05A 2HKHH 3MRLB 2R23B 4KKLC 1T83A 1WF5A 4K3DH 4EXPX 3EO1B 3DX9B 2WQRA 1H8SA 4XGZB 4YHLL 1BECA 5D6CB 4ENEC 2BNUA 4NN6B 2WLYA 5C2BL 1FPTL 2B0SH 1L4IA 5I73B 4IDJL 3TPKA 3IJYB 3ARFC 4XMKH 1DVFB 2AGJL 1CLZH 3MOAL 2FIRT 1FFNA 5T3ZH 4AIZA 1P9MA 1F90L 2R2EB 5JMOC 2HG5A 4F15C 2PYFA 4GG8B 5E94B 1R24A 4GMSL 3AAZB 5H37H 5LCVH 1SEBB 2OMNA 1AQKH 1X5HA 1AXSB 5ANME 2FR4B 1A9EB 4TPRH 4A2MA 4YHNA 1RVFL 1ZTXL 3CFKA 4Q9RL 3H7BB 3KLSA 3M07A 3S88H 2QADB 5HHMB 2A9NL 4R3SA 1QRNB 2V5YA 1LEGB 3KJ6H 1VFOA 1BVKB 2DIJA 4AG4H 2D4DA 5JXAH 5E9DE 1JGLH 4P9HL 3WNMA 2IALA 5ESQA 2ICEA 5C09B 5CJQH 15C8H 1YEKH 5E7FA 3ZTJG 5F7EH 2V9QA 5JHLL 3NCYP 4GXUM 5KVEH 2EIBA 1R5VB 1U8HB 3ARFA 1PLGH 3EHBC 4BFIB 2MKLC 4UIMA 5FM4A 5D2NC 1UVQB 2FECL 1FGNL 2FJFB 3QZWA 3L5WA 2HA1A 3C2SA 4D0DB 3DX7A 4JKWA 1EMTH 3OB8A 4JFXB 5I8CA 5E2WL 3SDDD 5CLTA 1A6UL 3O11A 5IHUL 3WNPA 1RY7B 4I2XE 2GAZB 4LKXA 3PGDB 1YEHL 5DJXA 5IW6A 2IANB 3S37H 5CFHA 1WBXB 2F5AL 2VR9A 3F7VB 1QG3A 4QY8B 4XBGA 3V0VB 4DOHB 3LQZA 2B20A 1HILA 3OTTA 4N0YH 2FECI 4J3TA 3O6FC 1B2WH 4YDIL 1B0GA 5IVZA 3IAPA 2MQ3A 1H15B 2BY0A 3P30L 3UYRH 3WCYA 5FUZL 3FN3A 4QWWC 1DP0A 5E2JA 3F7PC 3BKYH 4U1LA 4WTZA 3WUZA 4IOIA 4HF5L 2X1WL 4GXVL 1TZGL 1CE6B 1U6AL 2EIZA 3RQ3A 4JB9H 4B0MM 5BV7H 1DLHA 3P77A 5F9JB 5C08B 4MCZB 5D2NA 1RUKH 2YK1H 1JN6A 1P5UA 1WFOA 3HTLX 3QULA 1J8HB 5E08L 3VD4A 5DMJB 1R3KB 4L3ED 3J7HA 4TVPH 3M1BB 1PG7W 4K55A 1K4CB 3WFCH 5I1DB 5KS9F 2FIKA 2FO1A 2F54D 3OB0H 1MEXL 3HE6C 3QJHB 3QEQA 1MCPL 5C0ND 1PQZA 3TIEA 1YPZE 2P46B 4POUB 2VB5A 3NIGE 1ZGLP 1M4KA 2KH2B 4OD1H 4R4FH 1OAQH 3T0WA 3ERYA 4QRTB 3DSFH 3GSWA 4L8SB 3WDIA 2JKXA 2JELH 4JRYD 1G6RB 3O6FA 1KBGL 3MV8A 3TYGH 5BCAA 4JHAL 1U58B 2CUHA 4RAUA 4H20H 4LCIH 2D7OA 1TTUA 4FQIL 1D6EA 2QR0B 4IHOA 3T1FB 5HDOA 4H88L 1NSNH 1S5HB 2EC9U 1CDJA 2VDMH 4OGXH 4M5ZH 2PW1A 5FOBB 4MWFB 1AGFB 4PRHD 3I02B 1XGYL 4NC2B 4KZEH 4QNPF 4GRLA 1FG2A 3FQRA 4EUPG 4LCUB 1XGUB 4IJ3B 3VE0A 4PBWD 3TFKD 3G08A 5T5FL 5ESAA 1OGAE 3L6FB 5DZOA 1BREA 4F58H 2X4NA 2XZQH 1I1AC 1GAFL 2DS4A 3HE6A 3I85A 1MAML 3PWJB 2HRPH 3DTXB 4HFUH 1JPTH 1BD2E 3CU7A 4HWZB 1FVDA 3E6FB 3QISA 3X14A 2YEZB 4Q97A 1LEKB 4TUKL 2W0KA 3N50A 1B6UA 2EECA 3EDKA 1BFTA 1MCFA 4LLYB 3RGHA 2OCFD 4LHUA 1CD1B 4XX1G 3ZYZA 1DQML 1YMHB 5J13B 1A1NA 1R5IA 4DZ8B 1HHIA 3QQ9D 2XN9E 4HUKB 1TTFA 4WTWA 5IMLA 1BOGA 1MCNA 4HJGA 2KUTA 3O3UN 3V6BR 5KN5A 1EGJL 1TZHA 4DW2H 4UOW1 3U2SB 2R0WL 1B0RB 1DDHB 4E41D 5HHXL 4BZ1H 2VXQH 4G6AC 3NOIA 3S5LA 3S9DB 4HJJH 1L7TH 2YS4A 3AB0B 3M8OH 3S3PA 5C09E 2ZOKA 1JPGB 1WLHA 4TTDD 3U48A 1AIFA 5J0BA 3NCEB 1OWRM 1A02N 2NCMA 5L2KA 1CDYA 2NNAA 1NLBH 4OZHB 1I1AA 2ADGA 5DF0A 1HZHL 4U0RC 3UJIH 1C5BH 5HYJE 3CSYB 4WNQB 4ZXBC 1LP9F 1QLFB 1BQHA 3VFVA 2K1MA 5KW9L 4YHOH 1KGCE 2EIEA 1RUML 5DJCB 5FO8B 3HI5L 2EZ0C 5JW5B 5F7MC 5JW4M 3U7YL 3JUYA 4JFPA 3DUUA 2ZUQB 4RMRA 5ILTH 3GBML 1KOAA 4UMGA 1JGUL 2P43B 1JBJA 3DV4B 5K9JH 4NBXB 4AEEA 2ADIB 3G6JB 1AGDB 1YY9D 3I9GH 5ERWA 4DOHE 3GMPA 4YK4C 2FHCA 3IU4H 1N5AB 1ORQB 4Y7MA 4X6EB 5CZKA 2XI9A 4XNUH 1T4KA 4UT6L 1U93B 1YJDL 2J5LB 3V6ZB 4MVBD 1IC7L 4ZQKA 1OPGH 4NFBA 4C56E 3MRIA 1XAUA 3JWNC 3TGXA 3FO2B 3MJ6A 3ULUF 4NQVA 4MDJA 3H42L 1ZHKB 2P5ED 3LS5H 3O6ML 4D0CB 1XGPA 1ZEAL 3SDDB 3B9AA 1G7QB 2EH8L 1T0MA 3X3FH 5BVPH 3Q6GH 2VDNL 1LILA 2PETA 4PRAA 4Z7VB 3IFOB 4NCC2 2XZAL 4ZXBA 1JGEA 4ZUVA 4F7MB 5IJVB 4KKBD 3GHEH 1VEMA 4JKMA 3L5XH 1OP3H 2AJXH 1KB9J 4Z7WF 1AKJD 1X6NA 4Y19D 3MRNA 4JVPA 5EBMA 1T21A 4MXVF 3L95B 4YHKL 4L5FL 5GS3A 5C9JB 1G7LA 3D39A 3OZ9H 5IBTH 4JG1H 4Z77B 2ICWA 3EW3B 1IQWH 4X9HA 2HH0H 5HYIA 5GSVB 3NACL 1ROWA 2B39A 1KCVH 2X89A 3B6SB 4WCYH 2GY5A 3I2CH 1S7WA 5GJSL 2VAAA 5FAAA 4L4VD 2EEDA 1EHNA 1T3FB 1UM6L 4KJYA 2HJKA 4M3JA 3L3KB 3QQ4B 4MQ7B 5TQ2H 1CFNB 2L4OA 3LH2H 3MRBA 2ERJB 2HVKB 1Q9LB 4OM0H 4GSDH 5I17A 4L3EB 5T3XD 1MPAH 4PG9B 2YKLL 4TSBH 2DM2A 3WJLC 3ULVC 4LARL 4OZFB 1WFNA 2FX7H 1UZ6E 2F54B 4HSQA 3O2WH 3O3EB 1QFUH 3O6KL 4H26B 3VW3H 3OBAA 1JVKA 5EC2A 1SBSL 1YDPB 3MV8D 2P1YA 3D69A 5ALBL 3W0WA 4RQQA 4Y89A 1JPFB 5D1XC 4JRYB 1FRGH 2D0GA 5I8KH 2FYYB 5C0IB 1MF2L 3RP1A 4JANA 3C60D 1UM5H 5HPOA 4X98B 5J8OA 2G60L 1JNHA 1P1ZB 3W9DA 3GKWH 4QHMA 1HCVA 1NCAL 3UTQB 2BVQB 5FDWB 5GS2D 5DUPL 3AS2A 3RL1B 2BOBB 5IK3A 3WE6B 4H5SB 4ZUTA 4PRHB 3LRSB 3JSSA 3MJ8B 4XC1H 1X5ZA 4B53A 1BIIB 1N4XL 2R56H 3QDJA 4PJ5A 4XBEH 2EDLA 3VGBA 5DGRA 3VFGH 4MNGB 5F7UA 3WJLA 2OZ4L 3HCVB 2Q8BL 3U36A 4NZTL 2CGRH 3MYJB 3VWKC 4OB5H 4NT6B 1E27B 3K8MA 3BKMH 3K3QA 5C0CA 1NC2D 3FTGB 3PDDA 1H3XA 4RMTA 4W4OC 2A6IB 3BGAA 4PGCA 4F9LC 3ULUD 4JY6A 4JQIL 2CIIB 2IPUK 1NGZA 3U0PB 3HKFA 3KPRA 4YDKL 5D1XA 1X7QB 4MA1B 3WFBL 3LSOA 4UU9B 1A2YA 1S7UA 5KG9A 2FX9L 1QQDB 1ZOXA 1NC4A 4I5BA 2Y06H 5J3HD 3O0RH 3LKQA 3LRHA 5FECA 4JQVC 1U91A 3S35H 5FO7A 2B4CL 4G6JH 1FFNB 2O5YH 3NCBB 1JRHI 5IF0A 4E41B 2HG5B 3KPQB 2EDKA 5FB8B 3WBDA 3QNZB 1H8OA 3JUZA 3MACL 4X83A 2FX8H 3WUWG 2VLKE 4YHML 3QSKB 4QHLA 4X6DA 1RJYA 3FO0L 3HPLB 5CSZA 2ATPA 5ICXB 2VRAA 3VWKA 1R5WA 1IAKA 4DN4L 4QRSB 5J57B 5DD6B 1HXMA 3BIBX 3C8HA 4JKPL 4KPHL 4X0KA 3DGGA 4W4OA 5L8JB 4FXKB 3MR9B 2ZG2A 4LPYA 4F9LA 4S2SB 1DQJA 1UB6A 4JFHE 3I50L 3QXAA 3VXTA 3G5VB 2DQEH 4Y4KD 3RWHB 3NAAH 5KS9B 1WEJH 4LKCA 4G9FE 2NR6D 5AYUH 1W8OA 4Z7VE 3R1GL 3NVQA 4BK4A 2K3TA 4KGLA 4JQVA 4DWHA 4PB9L 2EIDA 5DZLA 4JO2L 3S7GA 1CYGA 2E8YA 3LIZL 3QZWB 5CJBA 3MRQB 4ZTPL 1OF2A 4AT6B 5ETUA 3HLAA 3CH1A 4HS6A 2HT4C 4KRPD 4MD4A 2NY1D 5A2FA 3IKCB 1JF6A 3F7YA 5DHVA 3VG9C 5FF6A 5KSAA 5DD0L 2FEDC 3QXDB 2H9GA 2IF7A 4JZOA 3MLXH 5JQ6H 5DJ2B 2GJZB 3C8DA 5DJZA 4BH8B 4AEFA 4KK6D 2VDPH 5HTSA 2PF6A 1S7TA 4HIHA 1F58L 2P5EB 4XCYA 1YEGL 2J8UF 3BDYL 5I30H 5GRVL 4D9QE 1GH7A 3WIHL 4ETQA 1YN7A 2O5XH 2IBZY 1F13A 5L7XL 4PJGF 1E0OB 4LCWA 2DM4A 3TNNB 1AO7E 4UTAL 1BM3H 1J86A 4Z95H 1XCTB 2APFA 4MQXD 4CVZA 1AKJB 3IDNA 2W60B 4Y19B 3PUCA 4XP5L 3DI3B 5TPWH 5C0EA 4M1CD 2AK1L 1ORSA 5I71B 2H6PA 3WFHA 2ZP0T 4GBXD 4GUPB 1JIBA 3ZDYE 1E4KC 4U1HA 4Z7UA 4IRSD 1OARH 5SWSA 1ES0A 5DS8B 3EYUH 3BRGC 2AV7B 3FQTB 1JL8A 2VJXA 3THMH 1C08B 2ITCA 4NQDD 3P2TA 4L4VB 5FGCB 4X7CC 1X5AA 3H6JA 4U05A 4EVNB 2V5SA 5CHNA 5BRZD 1O5DT 5J11C 3RX7A 3OGCB 1MY5A 4LAJH 4KI5E 4HPOL 3MFFB 3RNQB 4ELME 2VTFA 2AI0H 5K9OA 1KB5B 4XPAL 4CL7A 1KSRA 3MV8B 4QTIH 4HMEA 3AGVA 4JY4A 1MCQA 1K8DB 1MFCL 4MMXC 2R1YA 1BJ8A 4K94L 4GRWB 1BBDH 4QXUL 1Q94B 2WIIA 1GSMA 4C57C 4OV6F 2BVYA 4PJEF 3GSQA 3ULVH 1TJHH 3C60B 1JNNL 2E6PA 1LP9B 2PXYC 2NMSA 2X4SA 5I9QB 4HH8A 1E4KA 1Z0MA 5I1KL 5FYLH 1DLFL 4JFYB 1LMKA 4OTXH 3IDGA 2XQBL 1JF5A 2E9JA 1MVFA 3L9RA 1RZJC 2PO6C 4XCCL 2GFBB 1PAMA 5D4QA 2H3NA 4XNYL 1MFEH 2C1PA 1ZT4B 4E41E 35C8H 1WISA 3IVKB 5C70A 3CDYA 1DQQA 1SYSB 1R6VA 3KPRD 5ADPH 1NC2B 3QEUA 1T5WB 5TE7H 1MFBH 1T0NA 5FYKL 4FMFA 4R4BB 5A2JH 3QHFL 4S10A 5MENA 2NYYC 5MEQB 1RURL 4HQQL 2P5WD 4X80L 1HHHA 4RFEA 1T1YB 1T6VN 1QFWL 2LU4A 5IW1B 4DN3L 2PXYA 4PJ7A 2EE2A 3RIFF 1HYSD 3IGAA 1A14H 2Y7QB 1PDKA 4LSSH 4K2UL 5C1MB 3MV11 2AEPL 1JNLL 2WP3O 4YPGA 3EBAA 1U36A 5F7YC 1FNGA 2X70A 4Q74A 1ACZA 3O2DA 1KJ2B 1G9EA 4CVWA 2PO6A 1PKQB 4UT7H 4F3FB 4L3CB 2ESVE 3NPSB 5CWSA 2YD7A 3N85H 2DQFB 5JPMA 4PP1C 5IB1A 4MJ6A 2J6EA 1QFWI 3CFEB 2OQJA 3J8F7 3BOVA 3IXAA 4JN1L 3ZMRA 3UPCA 4N0FA 4OD3H 2IFFH 4L29A 5IB3A 1DE4B 1UACH 1W8NA 3K0WA 2P5EE 4PV9A 3SDCD 4MJ2A 4Y4KB 4JFDE 4K71C 3BGFC 4OF8A 4ONGL 3ECBB 5EZJB 3VFUB 3LRGA 2DQGL 5EDXA 1ZT1B 4WW2C 1V7NH 4ODUA 3BXNA 5JPNA 2EXYD 1T4KB 4WI7A 3EKCA 4QCIB 3DI2B 5DJYB 2D3VA 2ZOLB 1S8DB 5KSAD 5DRWA 4JFZH 4XH2A 3GMNA 4Y19E 1CGSL 2IGFL 4XI5D 3PQYE 4KRPB 2NY1B 1A6ZB 2ZCKH 4YXHH 4KTDH 3ZKMD 3RIAF 4ORZC 2MQCA 1I3VA 3VDAA 3UAJD 3VFPA 4X8JB 2GT9B 1AHWB 4RWHA 2LAAA 1KCKA 3DYMA 5B22A 2YD9A 4LGRB 1SVCP 3IFLH 4FQJL 5LGJB 3BGMB 1CE1H 1G6RL 4L4VE 1UADC 5FGCE 2A1WH 5A1AA 1UJTA 5GS1B 2XTJD 4HXBH 1DQLL 2A73B 4PY7A 5I66A 4YHIA 3QDMD 2ICWB 3QNXB 4JKKA 1S9XA 2WBWB 5H2BA 1NCCH 1SMOA 4WJ5B 1QLRB 1PX4A 4WW2A 3MLYH 4G80B 3TVMD 4JRWA 1J9CT 4QRQB 1Z3GL 4GBXB 3SE9L 2VDQH 4C83B 5L8KB 1S7SB 5I1IH 2J8HA 1SM3L 5EIIB 4XMLH 1T7YA 4IRSB 3SKJH 3HAEB 4JM2A 5E0QA 4LEXH 5EO0A 2PW2A 1IM9D 5C7XL 4NQDB 2O93L 1XCQB 5E8OB 3ZT6A 1PEZA 4N0CC 3W9EA 2VXTH 5JZ7D 1IEBA 3KR3L 3G6DL 4NOFA 5KSBF 5BRZB 1OT1A 5E8PB 3HNVL 1JTPA 1A6PA 1ZSDA 4M4PA 2FJHA 4N5UA 1JGVL 1YQVL 3VFMA 1GIGL 1H3TA 1KLFA 3D85D 3MLUH 3UTTD 3BP5B 1EXUA 3DRQB 5EBWB 1U3HD 4NM4L 1MCJA 4M62L 3FZUC 3O3BB 1H3WM 2WUCH 1RZFH 4QTHB 4YDVB 1E4XL 4OV5B 1RFDL 3GBLA 3LEYH 4OUUA 4HUUB 1P84K 4FTVA 1GJIA 4O5LH 4YXKL 4PJCA 4WDIA 4PY8J 4XX1E 1AGEB 1SJHB 1Q0XH 5F9OL 4O9HL 4ZUTB 3MRJB 3ULUE 1PSKL 3IU3A 5E7BA 2XPGB 1R3JA 4TULH 2HT3D 1NCNA 1S7VA 4JREB 3M17B 1SJXA 5HYQB 3SJVD 1E4XI 2ADFL 2B1AL 4N0CA 2EDJA 4JCMA 4NNYA 3X12B 4U1MB 5CINH 4XWOC 1C1EH 5HPMB 4Z7WE 1I1CA 3DX8B 1MUJA 3EDEA 2VZUA 1F4XL 2IADB 5D7SL 3UEZA 5DFVD 3L1OH 1OLLA 5JXEC 5DFWH 2B8OT 3N9GH 3KPRB 5E95B 5GGTA 1FJ1B 5IHZB 1PKQE 2PTTA 3EYFA 2NW2A 4ZAKC 1I9RL 2NY0D 2Y5TB 3F12A 3IDYC 4LLVB 3O2DH 3I6GA 2VZ1A 5HY9A 4HK0A 1RZJH 3MNWA 3PG2A 5FECB 3W5MA 4QRPD 4OBSA 4AYFA 2P5WB 3OAYK 4R97B 4KAQL 4Q9BA 5GZOC 1HNGA 1U8NB 1VESA 1F11B 2GSGB 4M93C 3NFSL 4DUWA 4LIQE 5L6YH 3V4VH 4YR6B 2J6EH 4OCRL 1D5XA 4PJGB 4DTGH 5JOPD 2DMBA 1I8MA 4JO3H 4QHKJ 5DR5H 1JWMB 3L3HA 5D7JD 4HXAH 3RDTD 1IT9H 4HIJB 1WWCA 1YYMH 5DA4A 4HKXA 4UAOB 2P8MA 3ABZA 3K4ZA 5EWIH 1L8JA 1RHFA 1AR1C 4NRYA 1WIUA 4LAQL 1E6OL 4O2FB 3OL2A 4TSAL 3HI1A 1X4XA 1DBJH 1VFBB 3R8BB 2QQKL 1SY6L 1FZMA 4EDWL 5I1GH 5A2LH 5J06A 5K9KB 2ZUWA 3EJYC 1DQJB 3WFEL 4WV1C 1KT2A 4PJIF 5JXEA 3IT8D 1CXIA 1FFOB 4AM0B 1GYAA 5SX4H 1GHFL 3OAZK 3RKDD 3MV7A 4ZAKA 7CGTA 4KU1A 4FQQA 5EU7C 1MHPH 4CVXB 3SDCB 4MA3B 5ECJE 4J7RA 3UCRA 4NIKB 1KIRB 4CU8A 4OZFG 3MA7A 4LLMB 4X4XB 3CPLB 4QGYA 1MCIA 2X4PB 5IMOA 3CFBB 3KYNA 4AH2B 3TT3H 2C7UA 4MNQD 3MCLH 4N0UB 3VJ6B 4BKLB 1PZ5A 3U30B 3OKOB 1OCWH 2BXYA 3FQNB 5KSAB 5F6IC 1T1WB 2Z35A 5C6TL 5DTFA 4PJEB 4XCYB 1VGKB 1DANT 2BMKB 5JMRA 4ZSOB 3GMOA 4BQ6A 5DVLA 3W11C 1YN7B 3ZT7A 1CGXA 3ROLB 2IEPA 1JI2A 3KLAA 2XY2A 3HC0A 4R0LC 5EU6E 2AKRB 5CD3A 3A6BL 1NAMA 1M6OA 2FWOA 4WV1A 4NQDE 3UMTA 2P7TB 2WWKO 2QEJA 4PJXA 2YD8A 3RVXC 5GS0C 1I7TB 4P23C 5DRZB 2XKNB 2V2XA 1BJ1J 4FQXD 2XTJB 2CJUH 1OT2A 5DSCA 2V17H 4JKLA 4ZS6D 4LVOB 3N1GC 3QDMB 4O58H 1JHTB 2BHYA 3X13A 1EAPA 4LBEB 4MD0B 5LGHH 2JTDA 4FQ2H 5DJ8B 4JM2D 4QXTA 3TVMB 3AY4A 2DD8H 3BPCB 2Z8VC 5KJRL 4NC1C 3VRLF 3P11L 1IM9B 2W65B 1J1PL 1P4BH 5IM7B 3IJHB 4HZLB 3B2UC 1VGEL 5A2IH 2HLAA 3MCKA 1TITA 2W1NA 3AUVA 1FE8L 1QBLH 3JZ7A 3HZVA 1YEDA 3U9PL 2BSRB 5DK0A 4OSUL 1EO5A 1YEJH 1RIVH 4PD4K 1B9ZA 2J4WH 3D85B 5ISZA 1T66C 1MAKA 4JEGB 3UTTB 4ZPVA 1T2QH 1FVCA 1NEZA 4NRZA 1U3HB 4P57A 4P23A 1WZ1H 2UYLA 4JFQA 5F3BA 3S97C 1YZZA 2YD2A 2DQIH 2YD3A 5IMMB 2OTUB 3QYCA 4NJ9L 2F5BL 4I18C 2ICWJ 4MS8D 1KTRL 2ED8A 5T5NF 3C5JB 1XGRA 3SKOB 1M05B 1OTUC 4XAKD 5FUOL 5EFIB 5DO2D 3B5TA 2J8UE 4PJDF 4MHHG 4BK5A 1P7QA 4GOSA 4RNRA 1A6AA 2OX5A 5IIEB 3KXFE 5GGTH 1PG7L 4I0PC 4P4KD 1A6TA 5A2KH 1I7UA 3OKKB 3KYMB 2XTLA 5T1MA 1DQDH 1UC6A 3SJVB 4ZMAT 4LRNH 1YEEL 5D7LD 5F88B 3FRUA 3PV6B 4HWEH 5A16B 1HHJB 2DQTH 1JZ8A 3C09C 1IAOA 3IYLW 4C54A 5L88H 4GKSA 1L9MA 2Y23A 3MNZB 3UTZA 3QZWG 3ARDC 4LPWA 2DLFH 1MI5D 4GG6F 1R3LB 3RVUC 1BGXH 3IDMA 4F7PB 2NY0B 5CBAA 3OKMA 5HD8D 1FBIH 2D31B 1IGIH 1NGYB 1BOYA 4I18A 1I1YA 2IWGA 4NKDB 4QRPB 4WUUA 3NIFF 3PP4L 1MHEA 1D5MA 2BHUA 3ARTA 1WBYB 5LVEA 4DEPB 4S1DD 4MHHI 4OLVL 4KK8C 1ZVHA 3KPSD 2CLVB 3RWCB 4NUJA 2AXJA 2GTWB 5D7JB 3CVHB 3RDTB 3BT2L 3TBTA 1AE6L 5IB5A 5D7KD 3AMLA 4I0PA 1A6VH 5T1KA 4LGSB 2V7NA 4ODSH 4G8GA 1KIPB 2FSEB 1QVOB 3JXAA 4MYWB 4N0UE 4HLZG 2J88L 4LSUH 4WTZG 5IB1B 1QSED 1ZV5A 4X6BB 4O4YL 3MLRH 4XVSH 4J1UA 1MJJA 4RGMC 2DLIA 4Y4HD 3TO2B 5GIRB 4PR5A 4X6CF 3BHBA 3ARDA 4H8WC 4XP9H 4XPGH 4M1GL 1Q9WB 3RWJB 1MRDH 5LAXA 5HI5D 1U92A 4XMPH 3F8UB 4AL8H 5IMKA 4N5EC 3KJ4C 3PWNB 5D96C 5EPMA 2NX5E 2JE8A 2VLJD 2O61B 1BIHA 2BSTB 2FBJL 3JV0A 5FCUL 4OLWH 5DMKB 2IH1B 2CK0L 4TVPD 3FCTB 4L8BA 5BVJA 5EUOE 1U95B 2YXMA 4XPTH 1V3JA 4R7DA 5CEZH 1T20A 1A8JH 5F3HA 4MNQB 2I60L 3MROA 2G5BB 1F8TH 1QOKA 1TDQA 4OI7A 2MCPL 4P5KB 1XF5A 2XTJE 3S36X 4R7NB 3KWWB 3MV9D 2EXWD 1WCBB 1YEFL 2WM0A 4PY8I 1OVZA 5T3XL 1NCDH 2DMKA 2EYSA 5JQHC 2EDDA 1LDPH 4YBLC 4PRIA 5JOFB 1RIUH 3GO1H 2NTFA 3OKYA 2YA2A 3QDGA 3SE8H 4RGNE 2IC2A 5DK3A 4LPVA 5TGBA 3U0WH 4UQ3A 2X4OA 5DMIL 4Y5VB 1BX2A 1N2RA 5FUCC 1KB5L 3LVEA 3HUJB 3TJEL 2M1KA 1WC7A 4NKOB 1F45A 4PJHA 4WEMB 3FAWA 1XZ0B 3D48R 3RTQD 4JN2A 5HJ3A 1H5BC 1FZOB 4UIKH 4PREB 1TJIH 2KPNA 3T4AA 2DL2A 1JF1B 4NKMA 4FQXB 4OFYA 2BNQA 2LVEA 4M5YL 3BQUD 2FATL 4Z7QE 4I48A 4K8RC 1ZHBB 3LEXB 4GAYA 3NTCL 5J12C 4YHZH 1KLUA 4JM2B 1QYGH 5JR1L 4OI8A 1LDSA 2J7LA 2DIBA 4LHUG 1NMBL 3OHXA 3P9LB 3MUGA 4KTEH 5SWZA 3B2VH 3U0TB 1YNKH 3JWOL 2W0FA 4HCRA 4QHKI 2Z92A 4J4PD 4HUXB 5BMFL 3TNMB 3FB5B 3NA9H 4LF3A 3OKDA 2Q8AH 1A3RH 2NTSP 3NIDF 2HFGH 3ILQD 2A83A 5EORL 4UB0L 3BW9B 2YRLA 3VXRD 3X3GH 5JHDA 1WITA 3S5LG 2VO5A 4NHCL 5JORB 1QBML 1LGVA 3OSKA 1H5BA 1KEML 3W2DH 3HG1D 2AJYH 4JGJA 3C5ZC 2BRRH 2EE6A 2N56A 3AFLA 2UWEE 3BP4A 5JLZA 1F6AB 3QO0A 3VXOB 2CRYA 3DUHA 1F00I 2Y6SC 1YMMD 3SO3B 3C5SB 1LNUB 3BEVB 3LN5A 2WBJC 4PJIB 3DX6A 2DWDB 5E24E 2F53D 4QO1A 1I9JH 1KPUB 3QPXH 4OQTH 5IFJB 4WO4D 4XXDB 5E4EC 2V6HA 1CDIA 4MB3A 3PWLB 3ZTNH 2DIAA 5I1LB 4P4KB 4H1LA 1OAZH 3P4OA 1G7IA 4HFWB 3TBVB 4M1DH 2K7PA 4FXGA 3VGAB 5JOPE 5IVNA 4PRNB 5D7LB 3TO4D 3C9NA 5IVXA 2BP3A 2Q3ZA 2EYRA 3EYQC 5I6XB 5LXGH 3O3AA 2DI7A 1QEWA 5ACZA 4MDIA 2UY7A 2XWTA 4RMUA 3L3OA 4Y2DD 3HMWL 1PFCA 4F8QA 1A4JA 1ZKAA 1MI5B 2ZCHH 5F7FA 3TZVC 2A6KA 4YAQA 1UEMA 3WIFB 2BK8A 4DZBA 4DGYH 3VXUD 1IFHH 5DHXB 2WBJA 2X4QB 2YN3A 3K2UH 5E2VL 4O51A 5IP4A 4RMSA 4JO4L 4ZYKB 3L3DA 3WS3B 2NZIA 2AXGB 3FQWA 5KSBE 4Y16C 3KPSB 2NY6D 2XXMB 4YIQA 2RHEA 3MRPA 3EHBD 1J0KA 4GQPH 2B2XH 4I3GA 4L8CB 1WFUA 4ODWB 1OTSC 1MJ7H 4MNQE 2VAJA 2H1PH 2YD1A 1QSEB 1CDUA 4FFVD 5ICYA 5E99H 2AV1A 3E3QC 3MRMB 1D5ZA 3GMQA 4Y4HB 2FLRT 4LK4A 4ZO9A 5FOJA 2ENSA 2YA1A 4X9GA 1M71A 4JQXC 1M7IA 4NO2A 5BV7B 3MTRA 1WTGT 3TZVA 4LDOB 2MPAL 2VLJB 3UP1A 3EZ8A 2YOCA 3WSQL 5E5MB 4X6FA 1N3NB 4J3OC 3T0EC 3D0VB 3FQUA 2Q3AA 2C3GA 3NCFB 4NRXA 4WW1B 3C08L 4PRID 2Z35B 5FYJE 1QSFA 4Y16A 3QDGD 3TWCL 3MV9B 4H8WH 1BLNA 3E6HA 1MVUB 2ICWI 1ZLSL 1CGUA 4JPIA 3RWEB 4HS3B 5DJ6A 5MERA 4G7YL 12E8H 1FFRA 1WFTA 5I18L 3V8CA 3U9UA 2DB8A 1KYOK 4CUCA 2DTMH 4ZDHA 5AYQA 1YQ2A 3WXWH 2VWEC 4P2CG 5HGAA 4PJDB 3E3QA 4NJAL 4RSVA 3RTQB 3W5NA 5I15H 1G1YA 1HINL 5TJWK 4JQXA 4AY0A 4Z5RA 4G8EB 1I85C 3D5OF 4LFHG 5F97E 1EAPB 1TMCB 3P73A 1BZ7B 4GW4A 5DK2A 2G75B 1U8PB 2ID5A 5AWNL 4JAMA 2F74A 3I6LD 4HCRH 4WFHD 4KROC 3QUXD 3HRPA 2NW3B 3BQUB 4J12A 3A0OA 3T0EA 1RK0A 2V9TA 1FQ9C 1NFDF 1Y0LB 3ZDZF 1N6QH 4GG6B 4YGVB 1JTTA 1CFTB 5EN2B 3QQ3A 1D5BB 3GJFK 3CLEH 2D7PA 4XRCB 5E6ZA 5T3ZE 4JZNA 4JR9L 3QUZD 4XTRD 3H7LA 1UB5A 4GLRI 4OCYL 1T04B 2WANA 4QKXB 3QEHA 4HHAA 1A1OB 2V7HA 3OWEA 5KAQG 3CFCL 4G9DA 5DQDL 3GUTB 5IFAL 1H3PL 4K8RH 3IFNL 2VDRL 4KMTH 1G7MB 5KTEL 3VXRB 1FO0A 1ONQA 1E28A 4KJQD 1S9KC 1MLBB 1AH1A 3KNBA 3D2UA 1HSAA 3FFCD 1RZGA 4HMDA 3PABA 3FB6B 4XXCC 1R3IL 2N7BA 3RHWK 3ISWA 3HG1B 3RAJL 1I85A 3EUUA 4Q9CA 3WDJA 5D7LE 5DJAA 5EU4A 1HI6A 3S4SB 1YMMB 4F33A 4PTUA 5FYJU 1DUZA 4X6CB 2VLLA 3VWJD 3L3GB 3G5ZB 3STBA 3VFRB 2F53B 2DQDH 4OLZH 4TOYL 4CNIB 5HDQL 4KQ4H 4XCEA 3CFJB 2P8PA 4WO4B 3SHSA 1S7QA 5F7LB 3ULVF 3O9WC 5GISL 3QPQD 2DWEB 1KELL 2DQCL 2I26N 4IMLA 1EJ6A 4IEFB 3D6GA 1JHLL 1IL1B 1KN2H 3QJFB 2GJ6A 1MHHA 1F5WA 2D03H 4O00A 4W6WB 3V52H 3TO4B 4WRLA 1JFQL 4P9HC 3CZFA 4XNMA 4Z76A 1EO8H 4F37K 3L7FA 5BS0E 2R4SH 4ZODA 3EGSA 2VC2L 1C16A 1DBMH 4R26H 4QHNA 3OKMB 1I7ZB 1UCBL 4M7JL 3SDYL 1NMCC 1X5FA 3LKNA 2DJ4A 4NDMB 4Y2DB 3LEVH 5BXFA 5ACMA 1HEZA 1QSEE 2G9HB 3QCUH 1IGYA 1D5MB 2Y1VA 3V5DB 5GRJH 3F62A 4WU5B 1T7ZA 2JB6A 3WLBB 4PTTA 3T2OA 1PX3A 3VRLE 3VXUB 1AD9B 3QIUA 2CKBA 1U0QA 3T77A 1MFNA 2NXYD 5ICZA 5C0JB 5GRUL 4I13B 3QUMH 1I3GH 1FG9C 1UWEH 4X6DF 2H2SC 2NY6B 4YFEA 3HR6A 4ZFOB 4M8VA 3O9WA 3UC0H 1CD9B 3UPAA 5TQ0H 3L7EB 4TVPE 3UBXB 3BE1L 1P4IH 2RCSL 4X7TB 2W9DL 1I1FB 2Z91A 5F1OB 4EXKA 3PJSB 4U3XA 5D7IA 1MWAA 5HHPB 2GIYA 4HWBA 4F7EB 1VA9A 3LKPA 3ZKNC 5GZNC 3QUKA 3K8LA 5AD0A 2EC9T 4ETYA 1LO3L 3H3BC 3PWVA 4TRPL 5CJXC 4OAWB 4OFDA 2PTVA 4AENB 2X4TB 2FL5A 4XT1C 1IAMA 4PJDE 2HP4A 1N64H 4WFFE 1J8KA 5KVGH 3GDBA 2OR9H 4NHUA 2V9RA 4CVUA 4P2RA 4GH7B 4N8CL 1XF5B 3GSNH 4Y1AD 4YX2L 4YQXL 3DBXB 4N8VB 2FO4A 4PRIB 1A9BA 2A38A 4UUJA 3QDGB 3QO1A 5DUML 1DN0A 4NBYB 5TGBB 4BQCA 4M7KL 1X5YA 4ODTH 5DEFB 4U0QB 2E7BA 2I27N 5DD5H 5ID0B 4KMLB 4XWGH 3QWRD 4P5MB 1IC4H 5EO9B 5GGRA 3LD8B 3NH7L 1PY4A 4GG6E 3QWQB 2DQUL 1NL0H 3D9AL 2GITB 1BF8A 1KCSH 1H3UA 1U3ZA 4FZEH 5FYLD 3GHBH 3NIFE 4OLXH 1BAFL 3O41A 4E9LA 1IAIH 3JV4A 1SBBA 2OJZH 5CJXA 4PRPA 4X7EC 1QPXA 3DO3A 4YC2B 4G7VH 2OJEB 4KJPD 3MA9H 4GAYB 1K4DB 3QFJA 5T1LD 3GMLB 3QUXB 1NAKL 4WWKC 4ISVB 3D3VD 4X5XB 4FQHA 3WN5C 4D3CL 4JHWL 3UTSA 5T33H 1U8OA 4JPKL 2R8SL 3MGOA 3SKMA 1G9MC 2SEBA 5SV4A 1NCBL 4X4YB 5F71A 1SJEA 2Z8WC 5C3LD 2Q20A 2DBJA 2VDOL 1J1XL 3QUZB 5BZDA 3MLSH 2VLRA 4P46C 1JCKA 4NQEA 1A3QA 1TETL 2I5YL 4X6CE 1XF3A 3PHQA 4RISL 5D6DC 5TE6L 1FZJB 3VXNA 5FO9B 3C87A 3D25A 3UO1L 1G9NL 5C07A 4OKVB 4OCXH 1GC1L 2R0LH 4UZGA 1W72B 3BPLC 3BMWA 4X7FC 3UXFA 5J89A 4K7FA 3L3IB 3QIWD 1DBBL 5AZEH 5E5RB 4OFVA 4XC3H 4M48H 3FFCB 3FT2A 4KKCC 2NZ9C 3MRRA 3H8NA 4PLJD 1OM3H 1ED3B 1I8KA 3D0LA 1RUPL 4LASL 4P5TC 3VXQA 1CK0H 5F9AC 3OV6A 3PGCA 1MCOH 4KXZI 1P2CA 4NZDA 4WWKA 4JDTL 1OOAA 3CVHL 4OZGF 3VWJB 2RGSA 5MP6L 2KZWA 2C3WA 4BH7A 2D7MA 3WN5A 4YHLH 4JPVL 4PJBF 2EYTA 5DRNB 5C2BH 1T03L 1FPTH 2V5RA 4IDJH 4EUPA 4HKZB 4Y5XB 2HJLB 2AGJH 3QRFM 2WWMD 4UTBL 3EYOA 4P46A 4C58B 3MOAH 5D6DA 3DMMD 2BJML 1F90H 1HHGA 4HK3N 2G5RA 3BESR 4GMSH 3AXLA 4ZOAA 4W6YB 5GGSB 5A3ID 1ADQA 1ZWIB 1N6VA 1J5OL 1OD9A 3FT4B 4Z8FL 4FFZL 5D2NE 1KC5H 1RVFH 1WZLA 1ZTXH 5EOTA 4Q9RH 1T1XA 5CEXB 2OI9C 3P4MA 3DVNB 1L0XA 3EYSL 2ED9A 1YJDC 1HOCB 3I3DA 4XCNA 3DO7B 4HC1H 2XNAB 3G5XB 2A9NH 5DXWA 1KJMA 3GB7B 3T4YB 4P5TA 5EA0L 1MIEL 3QEQE 2IQAA 5IB2A 3F5WA 4UDUB 2NXYB 4P9HH 2BZDA 3PIQA 1RMFL 3B5HA 4GW5B 5JHLH 1NGQL 2LABA 1YEIH 1MFDL 3NIDE 2YC1B 3B9KD 3AROA 2OXGA 4OGAD 4Z6AT 4Q6IB 1UH2A 4FQLL 1T6WA 4P2QA 1V3LA 1X4ZA 4UQ2A 5F1NA 2HJFB 2NY2C 1FGNH 1ZANL 3HPJA 2E7LC 1Q0YH 5D8JL 1NFDB 3U6RB 4LVHB 3ZTJH 4Z0XA 1EEUA 3HI6L 1TNMA 3VXMA 3LKSA 2PYEA 5E2WH 1LE9A 3L5HA 4R6UA 1A6UH 3JV6B 3RY6C 5IHUH 4XVUC 3AU1B 1XF2B 1YEHH 4E42A 3AMKA 2QQQA 5IKCB 4X4MA 5B4MD 2OI9A 4EI6A 1OAUL 1NUNB 4JFEA 1MJUL 5INDB 2R1XB 5C0FA 4NQXA 4G42B 4XBPB 2NY4C 2VITB 4YDIH 1LEIB 1G84A 2VYRE 4P9ML 4N90E 2ZSWA 1FL6A 3MREA 1Z9OA 5IT2L 4Y1AB 4HKJA 4PGEA 1MJ8L 1RZIB 5HHQB 5DJ6B 3V6OC 1MIML 4KHTL 5FUZH 3REWA 1XFPA 3LKRB 1OSPH 1C8PA 2DQHH 4HF5H 5FK9B 3V4PH 1VERA 5I76A 3I6LE 4LSVH 3ME0A 5DRXB 3WKML 3WO3B 3ILPA 4Z0BH 3KPOA 3Q2CA 3SY0A 5L9DL 2E7LA 1FDLH 3DETD 5CZVH 4DKEL 1EEYA 2E8ZA 5I8EA 5E08H 3OKEB 1BBJB 1UFUA 5MEPB 1FV1A 1NBVL 1CLZL 3RY6A 2A6DA 1JV5B 5TDPA 2OSLA 3BD4A 1MEXH 2AQ1A 2GTZA 1MCPH 3VRIB 3ES6B 4WW2F 2CD0A 5C0BA 3CMOL 4KJWD 3ZKXB 4TPRL 3NN8B 4OZ4B 3MUJA 2X05A 5T1LB 3ESVF 1KBGH 4EIGB 4JHAH 5DQJB 3O8XC 3D3VB 1EV2E 3FFCE 4FQIH 4OCSL 5F7WC 3S88L 3TYFA 5IBUB 3V6OA 3QFDA 3KJ6L 5D71L 3OG4B 1SHMA 3VFOA 5I0ZA 5JXAL 1DN2A 2WY3A 3R06A 1LVEA 1JGLL 3WLWD 3GIVB 15C8L 1XGYH 1YEKL 4S1SL 3FO9A 3STLA 1IC5L 1FH5L 5FHAL 4GRMA 4GKNA 2VKWA 4LSRH 5DMGC 3TN0D 3QEGL 1TTGA 5T5FH 1FAIH 4WGVB 1U8MB 5HHOA 1HDMB 1RJZB 5FGSA 4G8FA 1GAFH 5HVHC 3HE7D 3QIWB 4NWUL 2BY1A 2J1KA 1OQXA 2B4CC 2LTQC 1EMTL 2D7TH 4AEIL 3U4AA 3HRZB 5DWUH 4V1DA 2VH5L 4TUKH 1I3RB 1XR9B 1FZKA 3OR6A 5E00A 5H94A 1DQMH 4Y5YC 3O8XA 5T1DL 5EU3B 4X7DC 2OZ4A 5CGYC 1SEQH 1UWXH 3D18A 2HT2C 4NZUL 2UZXB 1KTKE 4N0YL 4NO5B 5ENWA 4JHBA 1AC6A 1EGJH 1GOGA 3HR5B 4YPJA 5CILH 4QHUB 1T7XA 5HHXH 4HUVA 3LDBC 3WFZA 3LKOA 3A6CL 1AGBB 1GGTA 2HFEA 3DMMB 4YWGH 4EDXA 1GGIH 4JB9L 4XNZB 5BV7L 2AXFB 4Y8AA 5KOVC 3MC0A 1RUKL 2YK1L 4AJ0A 5EIVA 3DSNA 2R4RL 3DUSB 4JO1H 3F7QA 2I9LA 3ARGD 1JZ7A 4NOBA 3HZYB 3MRHB 4P3CL 4URTB 3ARED 3KYOA 1GOFA 5IB4B 1SYVB 1FFPB 3F6LA 3BP6B 5KW9H 3E2HB 1T0PB 5T5NG 3T77B 3O6LL 1ERNA 2JCCF 1LO0L 3U7YH 3BN9C 3GSVB 5E9DA 4Y5YA 4PRBA 3MJ9L 4OD1L 4DUXA 2YSSB 1HCFX 3GSRA 3I75A 3GBMH 4P99A 4X9IA 3IF1B 3ZE0F 3CSPA 2W0LA 4JDVB 3EOBB 3RWGB 1CIDA 2VZTA 5A43C 1E6JH 5CD5C 4IOFD 1FN4B 4N9GB 4P2QD 1TCMA 3ALPA 3FAXA 1DQTA 3B9KB 2Y72A 5KBNC 1I7RB 5C0DB 4H20L 3AS3A 5MHSD 4UT6H 3O4LD 3VFTB 1RJLB 4HDIA 4LIQH 1BFVH 1IC7H 1NSNL 4P3DA 1RZ8B 1X5GA 5B3NA 2VDML 5E1AB 1A7RL 4XVTL 4WHDA 3H42H 3O6MH 1ZEAH 2IPUG 4RCAA 4KZEL 2EH8H 1FL5A 1M7DB 1A7NL 4HBQA 3DXAD 1D3CA 1IAIM 3QQNA 4K07A 3QDJE 2BSSB 4PJ5E 4DQOH 2XICA 3G04A 4JZJC 3T0BA 1A3LL 1A1MB 3ULVE 3WIIL 4L9LB 2OK0L 4HS8H 4NWTH 4DGIL 4YHKH 1JHKH 3LOWA 5FYLE 5C9KA 1A9BB 1NEZG 4L5FH 4LQFH 5C0CE 5C0AE 2VR4A 4K7PL 3B3IB 4U1SB 2E9BA 4JFFD 5DJDA 1YN6B 3TBSB 3UJJL 2ARJA 3WIHA 4FFWC 4K9EL 1WJ3A 4HIEA 5E8NA 1I8IB 1CN4A 1RZ7H 1XF4A 1YY8A 1ZT7A 4KV5F 2P44B 1QBAA 5GJSH 4YNYA 6FABL 3RWIA 1EZVX 5CP3A 2AK4D 1UZ8A 1MCEA 4OZGB 3L3JB 3DURB 4NN6C 4HUWB 5C0GB 4JRXA 5I73C 2HN7A 4PJBB 2BY3A 1X4YA 2ED7A 1DVFC 2ARJQ 2YKLH 4YBQC 4LARH 2GK0B 2W92A 3DPBA 4HJJL 3BKJH 3M8OL 1D7FA 1OAKL 1XH3A 3O6KH 3IFPA 5ITFB 5IR1B 3P0VH 3VXSD 43C9A 2YD6A 4I77L 3DV6B 1SBSH 4PRDB 2AABL 2A2QT 1FSKB 2HFTA 4X6DE 3NCCB 4JZJA 5ALBH 2H32H 3A67L 4TUJB 4LLAA 5D2LF 5HYSB 5F1IB 3FB8A 3UJIL 4G6ML 2NPLX 3NFNA 5IJKC 1MF2H 1U41A 1CL7L 2R2BA 2QADC 4PJ8A 1W0YT 5FIEA 1QR1B 5DLML 4G59A 1BFOB 5BZDB 4OGYH 2G60H 2VZSA 5DEGA 5CP7B 3MRLA 4LRIC 2R23A 3VXNB 1QACA 3HNTL 2MSPA 5B39B 3SKNB 1B4JL 3EO1A 3DX9A 2DDQH 4XGZA 5D6CA 5K9JL 4PGZA 2PCPB 3BVNB 1N4XH 5KVDL 4IRJD 3IJYA 3IU4L 3MNVB 2IG2L 2ZUSA 1DVFA 3TN0B 1ZVYA 4XNUL 1CTOA 2OZ4H 2Y5EA 5ID1B 1CL7I 4PBXA 4NZTH 3C6LA 3EYVA 3HE7B 3WL9B 2R2EA 1JRHH 1KENL 2OR8A 4GG8A 5E94A 4KDWA 5HVGB 3LS5L 3AAZA 1SEBA 5HDLA 5IQ9B 3VH8B 4XP1L 1AXSA 2Z9TA 2FR4A 1A9EA 4YDKH 2VR5A 2NY3D 4UV7L 3PNWB 2UY6A 3H7BA 3WFBH 2GI7A 3MXVL 4QLRA 2DKUA 4YO0B 3GHEL 2APWA 5IJKA 2DAVA 3RUGB 3RFZC 3L5XL 3WNKA 4GAGL 2C9AA 2AJXL 5HHMA 1CTNA 1EH9A 2EDYA 1QRNA 1J0ZA 4EQ2A 1S9VB 1LEGA 3WO4B 5GJTL 3OQ3B 3MJGX 4ZD3L 1BVKA 1QKZH 2QSCH 2YRZA 2RB8A 4LRIA 4OJFL 4D8PB 1KG0B 1UWXK 4JG1L 5ESVB 5C09A 4I4WB 4EN3D 1IQWL 3BAEL 3ETBF 1PEWA 4HV8B 1KXVC 3VG0L 1KCVL 4MLIA 1R5VA 4WCYL 1U8HA 3MACH 1CFQB 3AC0A 1A6WL 3BYTA 4YHMH 3ZDXF 3VDBA 4BFIA 1C5DB 3FO0H 4Z7UE 4TUOB 3BZEB 3P3YA 3CAFA 1UVQA 4N8VG 2FJFA 1E4WH 1FFQA 5TQ2L 3ARGB 4DN4H 4D0DA 5HGHB 3LH2L 1J18A 2VUOA 4CJ0A 4JFXA 3AREB 1LO5B 1W2KT 3FB7B 4F7CB 2FX7L 2GAZA 3I50H 3PGDA 5DQ9B 5IOPB 2WV3A 5GPRA 3VA2C 2R9HC 3BN3B 2IANA 3OXRB 4LLDB 1WBXA 5D1ZD 3ELAT 3VI4F 2BRQA 1S5IL 3F7VA 4EKXA 3R1GH 2DF3A 4QY8A 1TZIB 3V0VA 4TVSa 1QFHA 4L8SC 4PB9H 1N6UA 1FCCA 2VQ1B 1FCGA 4P2QB 2H26B 2HFFB 4JO2H 5AG9A 3LIZH 1AI1L 4ZTPH 4WU7B 4MB5A 3SDAD 2FGWL 4WI3A 5J6GB 2B7DT 3O4LB 5FKAB 1U2CA 1FVEB 5DD0H 1H8NA 3MUHL 1L0QA 3Q5OA 2HYMA 1D5IL 4Z78B 1CE6A 1TVDA 1F58H 1YEGH 5F9JA 3BDYH 5C08A 4MCZA 4IS6B 4L8DB 3DXAB 2R56L 5JUEL 1FYTD 1KJVB 1J8HA 3WIHH 4OZGE 4IJ3C 1R3KA 3VFGL 2FZ3B 5C0FB 4P4RB 5L7XH 5IV2B 3M1BA 5J1SC 4UTAH 4NN7B 1K4CA 5I1DA 5CP3H 1HN1A 4DCQB 1XT5A 2XFXB 3BWAB 3FKUS 2X4RB 3QJHA 3RVWC 3UDWC 4XP5H 4HX1B 3BJ91 2RJMA 5CMAB 2WQ8A 1OHQA 2D9CA 2VSCA 4H0IA 3ZKSD 3KPMB 4QRTA 4Y4FD 4L8SA 4JFFB 1CGYA 3PV7A 1G6RA 5J13C 5HHVL 1U58A 4JGMA 3EO9H 4RIRB 3FONB 1W72L 2QR0A 4G6KL 3H9SD 3HB3D 3T1FA 2AK4B 3S34L 1UKSA 1S5HA 1BZQK 2A6DB 4J6RH 5HBBA 1KPRB 2O5YL 1CT8B 2E7MA 5GGUB 5FOBA 4MWFA 1AGFA 4UILL 2F19H 3I02A 2EEBA 3F65A 5CS7A 5IEHA 4LMQI 3AB0C 4H1LG 4HPOH 4LCUA 1XGUA 2FX8L 3VXSB 4AEHH 2BHZA 3WMSA 4XPAH 2QHRL 4XHJD 2GK2A 5KVFL 3LN4B 3L6FA 3MXWL 5F72S 2IBBA 1Q1JL 4M00A 3CFDB 5DVNA 4DGVL 1MFCH 3UDWA 3RA7L 3PWJA 4K94H 3DTXA 4PJ8D 4O2CB 4NCDA 2JF1A 2KL6A 4QXUH 4KK5D 4HWZA 25C8H 4PD4J 5GRXG 3E6FA 1C7TA 2NY5L 1JE6A 2YEZA 5CUSL 1LEKA 3VFOB 1CLOH 3HNSH 5ELIA 2HWZL 4LLYA 1IGFL 5I1KH 1CD1A 4ZO6A 3C2AL 1YMHA 4Q0XL 1DLFH 3HZMA 2CDGB 4DZ8A 2ZUQC 2JCCB 5M95B 5AYUL 1Z0NA 1OGAD 5IBLD 5HSFA 1A7OL 5FKPB 3T08A 1XF1A 1IE5A 3U2SA 4IRJB 1BF2A 1B0RA 1BD2D 1DDHA 3C6LD 4Y2OA 5B3JF 2AJZB 1V3MA 5FXCH 1WQVT 4XNYH 3LZFH 5BO1L 2J5LC 3MLXL 4WEBL 3V4UH 4R90L 5I8OL 1CQYA 1JPGA 2WP3T 2VDPL 4A6YB 3SCMD 2XN9D 3SDDC 2XYCA 1KF9B 4HPYL 4C4KO 4OZHA 1F3DJ 5FYKH 2F9BT 3S96B 1NCWH 3QHFH 4OCMC 3GEWB 2O5XL 2NY3B 4WI9A 3BZDA 4HQQH 3CSYA 4WNQA 4DAGH 1QLFA 1UZ6F 1ZLUH 3O2VL 4KDVA 1QFWH 4DN3H 5DJCA 1S7XA 1EX0A 5FO8A 2AS5M 5JW5A 5EULV 4K2UH 3SBWC 5TPWL 1BFSA 2W0PA 1QP1A 2AJUL 1HKLL 1S7RB 3QA3B 1YC7A 2CO6B 3S37X 4EN3B 3DV4A 5ANMB 1BJMA 3O3DB 3ZHLA 3G6JA 1AGDA 3RI5K 1WZMA 5HYJD 1N5AA 1ORQA 4QYOB 4BSJA 4X6EA 3MZTA 1II4E 1XGQB 4QXGH 1U93A 3V6ZA 3K1DA 1PYWB 2CR3A 5J1AB 3O4LE 3FO2A 2ERJC 1ZHKA 2A0LD 4N0RA 4D0CA 3SDDA 4NN5B 1G7QA 4O02L 4PRBB 2OR7A 5E70A 2AI0L 5C0NC 4Z7VA 3IFOA 3DXAE 4ONGH 5F89B 5D1ZB 4F7MA 5HVWA 5IJVA 1SY6A 2PR4L 3NMEA 1CI5A 2FCBA 3QHZL 4C56D 1F2XK 1N8ZB 5IG7B 3SBWA 1NJ9B 3L95A 1T89C 4LLUB 5D2LB 3OJMB 5BW7C 4FTVE 5C9JA 4LSQH 3SDAB 2IGFH 4Z77A 4I2XB 4PJCE 2HMID 5GSVA 3CXHK 3B6SA 3PWPD 3GJFB 5D9SB 4JFFE 3BPOB 4R0LB 1FIEA 1T3FA 4X99B 3VMNA 1OP5H 3MV01 4FQJH 1FYTB 3L3KA 4MQ7A 1CFNA 1G6RH 4HJ0D 2HVKA 1Q9LA 1AO7A 4L3EA 3TFKC 4PG9A 4OZFA 1MCWW 4AMKL 1DUYB 1DQLH 1BZ9B 1C12B 2F54A 35C8L 4R2GD 3O3EA 3T09A 4ZUWB 4U6VL 5IROA 4H26A 1VADB 1B3JA 5TE7L 1YDPA 3H0TB 4U1JB 5IQ7L 3VXSE 3MLZL 4P0DA 3TJHD 1IBGL 4EI5D 1YY8B 4Y4FB 1HXYB 4YNYB 1Z3GH 1JPFA 3SE9H 4MA1C 1TIUA 1SM3H 1I9EA 5BW7A 2FYYA 3QQ9C 5C0IA 2HN7B 1PBYA 2VOTA 4F57L 2EO9A 2ATKB 3H9SB 5GRYA 4ODXB 4X98A 2N4IA 3ARBD 1P1ZA 1G6VK 2WINB 1YPZB 2P45B 3KR3H 3UTQA 2BVQA 3BSZL 2XKUA 4NQUA 5FDWA 3BD3A 3RL1A 2BOBA 3WE6A 4H5SA 3HNVH 4PRHA 3TBWB 1K2DB 3LRSA 4RMWA 3MJ8A 3CSBA 5IESL 2JCCE 4R9HA 3LY6A 1JGVH 1L6ZA 1YQVH 4QT5B 5K93A 1GIGH 1BIIA 3LCYA 4PLKD 4RAVB 4WHYG 1VKXB 3ZE0E 3OF6D 3MLTB 1KPVB 2M2DA 4NM4H 3TFKA 1MCLA 3FJTA 4M62H 2C1OB 4MNGA 2YXFA 1E4XH 3HCVA 1RFDH 3MYJA 4JLRB 4NT6A 1E27A 3D87B 4PJ8B 1UQSB 4PLOB 2W91A 3FTGA 4YXKH 1MRFH 2A6IA 4NNXB 4O9HH 2CIIA 2APTA 4M7LH 3U0PA 5HGDB 1JK8B 3MV7E 3JWDL 1X7QA 2ICES 1PSKH 3MRCB 5DT1L 4UU9A 3JTTB 3SPVA 3QR2A 4M7ZB 1QQDA 3RIFK 4Q9QH 1OGAB 1XGTB 1V7NL 2I9TB 2BXZA 4FOMA 4RFNB 1K6QH 2AEQL 1FL3B 3V7AE 1YY9C 2ADFH 2B1AH 3QAZB 1JPSL 1PKOA 3MBXL 1YECL 1BD2B 2DI9A 3C6LB 3EYVB 3ARUA 1NLDL 4E41A 3ZDYF 1MCHA 2CKBL 3KPQA 3JV5A 1KNOB 1F4XH 5D7SH 4ZFGL 5FB8A 4KTDL 3QNZA 4MVBC 3KYAA 3GBNL 4HIIA 3SCMB 2XN9B 1A22B 1LO2L 1I9RH 43CAA 3HPLA 5CEZE 5ICXA 3MQIA 3DHMA 4QRSA 2OM5A 5DD6A 1V5JA 1WIOA 4KV5E 1QA9B 3TCLB 4KAQH 3I3EA 4FXKA 4KI5F 2FH8A 3MR9A 4KKBC 3NFSH 4S2SA 4ELMF 1OGTB 4W4NA 1KCGC 1U42A 3G5VA 1WAAF 4OCRH 1MWAL 3RWHA 1U8LB 3CDGB 3P4NB 5KS9A 1MNUL 2VLKD 4HWBL 4D0BB 2XG4A 2EDEA 3OR7B 4TTGA 1ZLUK 1IM3B 1NCCL 3ULSB 4M3KB 5F9WB 3WEXB 4RZCB 5I71C 4LAQH 1E6OH 3QCTL 2VDQL 5I1IL 2P48B 2R0KL 4XMLL 3PP3K 3MRQA 5HYJB 4LEXL 4AT6A 2QQKH 1SY6H 1ZA6B 2Q7YB 4JFHD 5D2LE 3RIAK 3IKCA 4EDWH 4EEEA 4OLYH 3QXDA 4MVBA 4R8WL 2HTLD 5DJ2A 1FP5A 4DK3A 2GJZA 4BH8A 4G9FD 3IDUA 3U46B 2P5EA 4JHZA 1GHFH 5J6HB 4DFIA 4WUKL 2A6JB 1IQDB 2VDLL 4PJAF 1FYTE 3TLRA 3V6FB 3OX8B 1OTTC 2ADJB 5K59F 3TNNA 4V3EB 3CC5B 1RI8A 1XCTA 5AAWA 3I6KB 1AKJA 2X41A 3FO1B 4C56B 2W60A 2WWKT 4Y19A 1CIUA 2AJSL 4U1NB 1NBQA 3QH3B 1G0DA 1Q0XL 3C60C 4OZFH 5C6TH 1UENA 1DJSA 5HYSG 1A7QL 4X9BA 5D1QD 4D9QD 1NBYB 4GUPA 5I9QC 4GRLC 3PWPB 2Z0BA 3BZFB 5DS8A 2AV7A 3FQTA 1W0VB 4CU7A 1AO7D 3GK8L 3MOQA 1C08A 4L4VA 3AVEA 3PL6D 5ACLA 3H9SE 4UDTB 4EVNA 5HGBB 1RZKH 1KYOJ 1C1EL 3OGCA 1A21A 4S0SD 5FCSH 3JWOC 3MFFA 1RK1B 4R2GB 3RNQA 2W9EL 2X10A 4G5ZL 3EJZD 1KB5A 3RZCA 3ULUC 5J12B 5I74B 3MO1B 5TDOB 4EI5B 3TPUB 1K8DA 4D9LH 4U6XB 4OT1L 3ZDXE 1FC2D 1Q94A 4HMCA 1KCRL 2MOVA 3MLWH 5EOQL 3P11H 3C60A 2Q87A 3V4VL 5J3HC 1LP9A 1J1PH 4KI5D 4DTGL 1MHCB 3ARBB 4J3SA 1VGEH 5IEHB 3FFDB 1JZ5A 2E6QA 4JFYA 5KANG 1NCTA 1U8JB 2NXZD 4F8TA 3QG7L 4S1RL 4OSUH 2AP2A 1ZLVH 5ALCH 4NQSB 4JY5L 3JVGC 4Q2ZB 7FABH 1KJ3L 2GFBA 3VI4E 1I8LC 1XR8B 4DKAA 3SGEI 4YHYB 3NPSC 3S35X 1G9ML 2Y36H 5I2IB 5I1GL 5CIPB 1ZT4A 2HLFD 1NBZB 4CMMB 4NJ9H 1A7BA 3IVKA 2VMFA 2XZCL 2F5BH 1SYSA 1NC2A 1T5WA 3R4DA 5DYOA 2EE9A 5TH2B 4NQCD 3ARPA 5KSVB 3HZMB 2X4UB 1QPPA 1ZS8B 5H35B 4R4BA 4Y4KC 5E1HB 2C4XA 1ADQL 3IDXL 5MEQA 4I3RH 5GHWL 1KEGH 1T1YA 2APVA 4WFGE 2NR6C 1EBAA 4UINL 1PG7H 2W59A 5IW1A 1J05B 1F4YL 3OXSB 5KANI 2Y7QA 5ABDE 1YEEH 5EBLB 3EOAB 4WHTB 3FT3A 4PG2C 4GQ9H 4KRPC 3QUMB 2NY1C 2KZ1B 4UV4L 1A4KB 1DSFH 1KJ2A 4BFEA 3JVGA 1PKQA 1I8LA 4KK6C 4F3FA 3Q1SL 2VZVA 3UZVB 4L3CA 2ZCLL 1WWAX 2DQFA 4DKFL 5I1HL 1GGCH 1AHWC 4I9WE 5DFTA 3FN0L 4PBVC 4BYHA 4MJID 2R15A 3CFEA 2A77L 4PJHE 3U4BH 4K3JH 2V5TA 1EVUA 1S7XB 4ONHB 5AZ2H 3PP4H 4F9PC 1QUNA 1AD0B 1JI1A 3KS0J 3MODH 5GS1C 1DE4A 4MQXC 4Y4KA 4EBQL 2VLKB 5D70H 2BNQE 2MQ0A 2ESVD 2Q7NA 4EQ3A 4M1CC 1AE6H 3ECBA 5EZJA 3VFUA 2UVFA 1T7WA 1ZT1A 4OUOA 4GBXC 4QCIA 5DJYA 2ZOLA 1S8DA 2BCKB 4IRSC 4O4YH 3GSNB 2XA8L 4IBLT 4PG2A 1OB1B 2IH3B 1KV3A 1A6ZA 1P4BL 3MRKB 2R2HB 4JFDD 5EUKB 5SWZE 4X7SH 5FGRA 2X6MA 4M1GH 4G9FB 1W0WB 4X8JA 3OMZA 3PWPE 2GT9A 5FUCE 3WYRA 1AHWA 5LGJA 2XWBB 4UT9L 4BUHA 5D72L 1NGWB 2FBJH 5FCUH 3BGMA 1FIGH 1T2QL 1NKOA 4F9PA 5DGQA 5GS1A 3PQYD 1HH6B 1UXSB 3OAUL 1R0AH 4RBPH 2A73A 2I60H 1AR2A 2MCPH 5B3JE 2H2PD 3QNXA 1YEFH 3GGWB 4TQEL 4S1QL 2FEEL 4WJ5A 3UZEA 1QLRA 1IGCL 2CLRB 5GSRB 4G80A 5D1QB 4QRQA 4LPTA 4GBXA 4C83A 3CMGA 1S7SA 1HQRA 5JDJA 5EIIA 4IRSA 3TPUE 1ITBB 3HAEA 3TJEH 2WAHA 1IEAB 1P7KB 2V2WB 1LK2B 1MELA 4JREC 1AO7B 4NQDA 4PUBL 1CD8A 3K46A 1XCQA 3QDAA 5E8OA 1K5NB 4LEOA 4LRNL 3PL6B 5DD3L 3MFGB 3ZT5A 1JFMA 3IRPX 4GRWH 3UJTH 4HWEL 5BRZA 1AQDB 5E8PA 1Z9LA 2FB4L 1MCSA 2FEEI 3WHXB 4W6XB 3RZCD 2C4FU 1QLEL 5HGGS 1K3ZA 5D93B 3OB0K 4POZC 5E2UL 3VD7A 3BP5A 3DRQA 1CG9B 5EBWA 2FATH 5GS2H 5F7KC 3O3BA 4QTHA 4YDVA 1MRCH 1BGXL 4WVRA 3MPCA 1RUQL 3TT1H 4OV5A 1FBIL 4QOKD 4WI8A 3VD9A 4OCNC 3B9EA 4HUUA 4OFPA 5JR1H 1N5YH 3SGJC 3VU2A 4C59B 3BH8B 3LPGA 4R97C 3RL2B 3INUL 1AGEA 1SJHA 1CFVL 5CBEB 3BDBA 5FV1L 4KZDL 3JWOH 3M45A 3QG6B 1HYSC 3MRJA 3SO5A 4ELMB 5BMFH 5GGQH 4A6YL 2XPGA 1IKFL 2BNRD 3RPIB 2NXZB 4UAOC 4JJ5B 5EORH 4UB0H 1A6VL 3F7RA 2FD6H 3G5YB 3M17A 4Z7NE 1AFVL 5EU5B 4NHCH 5F6HJ 5HYQA 1QBMH 2OYPA 3X12A 4U1MA 1TXKA 5CGMA 1WV7T 5HPMA 4GAFB 3UPRA 1HHKB 3DX8A 2IADA 1CXEA 1UXWB 3VRJB 3LB6D 1L0YA 5K33A 2FRGP 2IPKB 2WUBH 1FJ1A 4G6FD 4AL8L 4NQCB 5IHZA 1LWRA 32C2B 3SPVB 2Y5TA 2IPTH 1MH5B 2B1HL 4LLVA 3SDCC 4X8XA 4B41A 1R3HB 2YBRB 3SGJA 1GZPB 4HH9A 2P5WA 4KH2A 5LQBH 1U8NA 2GSGA 1F11A 2UZYB 6CGTA 3QP3A 4PJAB 4HZAA 4YR6A 1F8TL 2QBWA 4LOUD 2EXYC 1N26A 4PJGA 4X9FA 3U30C 5IFHL 1GXEA 4XP4L 3PDGA 1JWMA 5KSAC 4ODBD 3KGRA 1BJ1H 3N06B 5M94B 1QSFE 4HIJA 5JIKA 3ZYOA 3LAFA 2VXSL 3GO1L 4HIIB 4XI5C 1UG9A 2E7HA 3K7UA 2BVEA 1MCBA 4O2FA 3ZKMC 1F2QA 4K3EH 43CAB 3EFFB 1VFBA 3P9MB 3HMWH 2MWCA 3UAJC 4CW1B 1JZ2A 1N59B 1AGCB 5J1TC 3MMEB 5D5MF 1S9YB 4MJIB 5K9KA 3E3QE 2IAMD 1TENA 3NGBB 2E9IA 4UIKL 4FN0A 3G9AB 1ZLWH 1TJIL 1FFOA 4AM0A 2DJUA 5E2VH 2AQ3A 2XTJC 4JO4H 4CN6A 4CVXA 3SDCA 4MA3A 4LVOC 3PHOB 4PJFF 1KIRA 2J2ZA 2DL9A 2UZIL 4OKDA 1OAYL 4LLMA 4X4XA 2ESVB 3CPLA 3MGTB 2X4PA 3CFBA 4AH2A 1CS6A 4N0UA 2GW5A 3VJ6A 3T0EE 4YHZL 1H3GA 4MX7B 4BKLA 3RI5F 3BX7C 3TVMC 4MSWB 3OKOA 2I07B 1URLA 1PW3A 3FQNA 5CEYB 4OLUH 4YLQT 2P42B 2DYPD 1T1WA 1OSZB 3B2VL 4XVUD 3TH2T 1F3JB 4NBZB 4PJEA 4PV8B 4PGDB 1VGKA 2BMKA 4JFDB 3WHE0 3L5JA 3NA9L 5KSUB 4GT7A 5JZ7C 3BP7B 4ZSOA 2HFGL 3HC4H 3ROLA 1LHZA 3GIZL 2AKRA 5EZIL 4YFLI 3V8OA 2MPAH 4BZ2L 1TQCB 2P7TA 2AJVL 3WSQH 3MCG1 5AUMB 1EFXD 1U3HC 1I7TA 5DRZA 2XKNA 1EFQA 2OTPA 2YPLD 2BRRL 3PQYB 4PS4H 1DANU 1OP3K 3QDMA 3TWCH 2R29L 4HUMB 4U33A 3OJDA 1JHTA 2WBKA 1U8IB 4LBEA 4MD0A 3EZJB 4FA8A 4G7YH 1KTDB 4XPBL 2L0DA 5I18H 1I9JL 5DJ8A 3QPXL 5EU6D 4OQTL 5ADOL 1CR9L 4M43L 3S3JA 3TVMA 2ZPKL 3BPCA 4H25B 5DDHA 5EOCJ 1MREL 3ZTNL 1VEOA 2HT3C 3HZKB 5HI3D 1IM9A 4P2YA 2W65A 4NJAH 4NCC1 5IM7A 3IJHA 5FDYA 2A74B 4HZLA 4M1DL 2XIDA 1S9WB 5FHBH 3REVB 5E2TH 4RAHA 1TPXB 1HINH 3O4OB 1S78D 3CJJA 4GLRH 1K9TA 2GJ6E 2YPKB 1WAAE 2BSRA 3AM8C 2X9XA 1Z9MA 3RZCB 1ZA3B 5DFVC 3MLVL 1A47A 3D85A 1G9NC 2IQ9L 5F96L 3UTTA 1NFIB 1IGJB 3MSPA 1GC1C 1U3HA 5JDSB 2XQYK 4PJ9D 2NY0C 3C6SB 5IMMA 4QOKB 2OTUA 5ITBH 2E3VA 1CBVH 3HS0B 1JYVA 4DEPC 4P59H 2QV2A 2EDTA 2VNCA 3E1F1 4IRZL 4OCYH 3SQOL 3O45B 3C5JA 4NQCE 3SKOA 1M05A 4GW1B 5EUOF 3DNKA 5EFIA 2Q76A 3KPLB 3CGTA 4NGHH 5BJTB 1DFBL 5DJ0B 5D7JC 2P8LB 3CFCH 3RDTC 3KPPB 3GSOB 5DQDH 5IFAH 5IIEA 1INQB 3IFNH 1BMGA 2VDRH 1IC1A 1GZQB 3OKKA 5KTEH 3KYMA 4M6MH 3CCHB 3GMRB 3SJVA 2ARWA 4PJAE 3P9WB 5K59E 5F88A 1R3IH 1H0DB 4YDLB 3PV6A 4KVCL 1HHJA 4NO0D 4RDQG 5A16A 3BO8B 5L0QB 5TF0A 3RAJH 2C26A 3AM8A 2D0HA 4KY1H 5D7IE 5DYOB 3MNZA 3TA3D 1GGUA 3BRFA 2YR3A 4AIXA 1LO4H 3KXFD 4OZIF 1R3LA 4G6FB 5DI8B 3B9VA 3RKDC 4TOYH 4F7PA 5HDQH 2DM3A 1JP5A 2D31A 3EO0B 1NGYA 1ZGLB 4OF3A 4MJIE 4NKDA 4QRPA 4OCWL 4LVNB 1OW0C 2OL3A 2WIMA 4NHUE 2O26U 1T5XB 4Z7WB 1F42A 1NGXB 3QB7C 2COQA 1WBYA 2ZKHL 4P2RE 4TNWF 4MAYD 2PNDA 1JHLH 4LSPL 3FT3B 4Z7QF 2CLVA 2GEEA 3RWCA 1SQ2N 1KTLB 2GTWA 4GMTL 5D7JA 3CVHA 3RDTA 12E8L 1JFQH 4ODHL 1MFAH 4M8QB 2Q6WB 3T8XB 2VC2H 1KIPA 2FSEA 1QVOA 2OP4L 2DTML 1UCBH 4M7JH 4Y5VC 3SDYH 3EJJX 4X6BA 3S8WA 2GCYB 3QDHA 2X7LB 1B0WA 4RWYL 3WJJA 5HDBF 2CK2A 3S36L 3TO2A 5JW3L 1Z5LB 4K23L 5GIRA 5E6ID 3LV3A 4APQD 5I15L 1MOEA 2IAMB 1MCCA 5DHVH 5CJOL 4ZTOL 1Q9WA 4I3SL 3RWJA 4PDCE 5JW4Q 4KQ3L 4FQXC 1K85A 2CDEB 5GRUH 4KKAC 3PWNA 2O61A 4ZS6C 2BSTA 2CXKA 3CLFL 2IH1A 5DMKA 3FCTA 4LSTL 3QFJE 1VFAB 3IETB 1OW0A 1U95A 2UWEF 4ODVL 5MEOB 3IDJB 3BE1H 3PHSA 4MNQA 4JM2C 3CUPB 1IMHC 3RGVD 2G5BA 3RJQB 2RCSH 2E5EA 4P5KA 3UTSE 4R7NA 2W9DH 3KWWA 3U4EB 1WCBA 3EOYG 3RVVD 4HBCL 3U79A 4ZNEA 3I3BA 1XIWD 3NFPB 2DYPB 5JOFA 1ZMYA 2NX5D 4JJHA 2IBZX 2VLRE 4NQEE 5HI4D 4E5XB 1V3KA 3MBED 4NKQB 4XVJH 4Y5VA 3ZE1F 1LO3H 2QLVB 2YN5A 4TRPH 3HUJA 2P47B 4EIZC 4IIQB 4K7PY 2RFXB 2M8XA 4KMTL 4NKOA 3NCJH 5TE4H 1XZ0A 5F6HI 4XNXH 2YUWA 4IMKC 4ZS7L 1G7PB 4XB7A 1FZOA 4PREA 4N8CH 1EFXB 1JF1A 3EAKA 1K8IB 2YPLB 2XZZA 4FQXA 1HQ4B 1Y18A 4RGND 4YQXH 1KULA 4M02A 2VZOA 2MNUA 5L2JB 4WGWB 2VE6B 3UYPA 4M7KH 4LPUA 1HQRB 4OF6A 1V7ML 4MS8C 1BQLH 1ZHBA 1ZK9A 3LEXA 3SQBA 2H32B 5EU6B 2QQLL 5GGVY 4FMKA 1Y6KR 3NH7H 4QOKE 3P9LA 1B88A 4LEOB 5BQ7B 2DQUH 5HHNB 4P4KC 2D4FA 3U0TA 4G8IB 1KN2L 4HUXA 4P3WA 2QKIB 3TNMA 4DVRH 1ULVA 3FB5A 3GSXB 2D03L 3VGAC 4CMHB 4OBRA 1AJ7L 3BW9A 1HKFA 2R4SL 5I6XC 2BNRE 4M9OA 2BVPB 3A6OA 3QUYD 4IMKA 5JORA 3MGAA 1NAKH 4P2OD 5F7DA 3LEVL 3OKLB 1G7HA 2ZUYA 4MCYB 2WK2A 3H2WA 5CCKL 4Q6YA 3QCUL 4PJ9B 4D3CH 4JHWH 1WK0A 5HD8C 2R8SH 4PGJA 1F6AA 3VXOA 2J3SA 3VFWB 3V79C 5D5MB 3K2MC 1EEZB 4V2BA 3KLHD 3K80A 3C5SA 1LNUA 2XV6B 4U1KB 3BEVA 3BZ4B 4XNQB 4PJIA 1J1XH 5C92A 4MS8A 2DWDA 4FQ1L 5FYKD 2VL4A 5EG6C 3B43A 1TETH 1KPUA 2R0ZH 3QUML 4S1DC 5F1SA 5IFJA 4RISH 5TE6H 4XXDA 1LD9B 2EDOA 3BIAX 4KXZH 4E0RB 1G9NH 1FGVH 2J8OA 4PP2B 1CICD 4KI1A 5FGBC 5TQ0L 2X5PA 1GC1H 2H45A 1Q9OB 3PWLA 4PJFB 4WHCA 2JLLA 1I75A 5I1LA 4P4KA 3GI9H 5CSGA 1J12A 1DBBH 1J7VR 4HFWA 3UPRB 3TBVA 1CFSB 2LTQB 1JMXA 4PRNA 5D7LA 2WMPA 5I1AB 4NO0B 3ROOB 4HLJA 2PYEE 4Y4HC 3V7MA 4NZRL 1KN4H 4LASH 3TA3B 2NLJB 2DQJL 2JB5L 3SDXF 2J8UB 2VLME 4YEEA 4JDTH 5HI5C 5BV7C 5MP6H 4HH9B 1MI5A 3KXFB 2X44D 4BUGA 2BY2A 5EC1B 4JPVH 2Z31D 3WIFA 4JFEE 1Q9KB 2AQ2A 3KPNB 5EOCL 2OR9L 5DC9B 5INCB 2BC4B 1OD7A 4F2MB 3PDOB 2AJ3B 3WUWB 2X4QA 3CH8A 4MAYB 4ORGB 4ZYKA 3WS3A 2AXGA 4I8DA 4M9PA 1UJ3B 1FNLA 1D9KD 2BJMH 3KPSA 2EXWC 4KK9D 4N1CA 4GKZB 1QFOA 4NFDA 3NBNA 5FGBA 3LQAL 1A7PL 1KFAL 4HAFA 1ND0B 1S3KH 2GUOB 4L8CA 3BUTA 1G7JB 2D2OA 3ARSA 4L9DA 4ODWA 4LNVA 4IM8A 1IC4L 3H9HB 3QIBD 3DRTB 2XWJA 4U1IB 2E7LE 4QRRD 1QSEA 2GSIB 3RWFB 2P24B 3EYSH 3MRMA 1JYNA 4Y4HA 5CGTA 4FZEL 4MZ3A 4OLXL 2HAZA 3RTQC 2FJGB 1IAIL 5E6IB 2O5ZH 4APQB 5EA0H 1P4LB 2ENYA 1MIEH 2ZZUT 4XP6L 4EZMA 4G7VL 1RMFH 2BVTA 1NGQH 2VLJA 1MFDH 1UA6L 1HH9B 3BQUC 4FQPA 3AY4C 2W07A 5E5MA 1N3NA 3D0VA 3RVTC 4FQLH 4U6HB 1P53A 2YZ8A 4WW1A 2X9YA 5T33L 1REIA 3RGVB 2YPLE 4OM1L 3MV9A 3HI6H 3V6OE 2WLZA 4CKVX 3MJ9A 1IAII 1MVUA 3RWEA 3ZYJA 4HS3A 3KLDA 3MLSL 1XIWB 4LLWB 1QR4A 2NX5B 1I4FB 5DZNA 3NZ8B 4YE4H 4J4PC 1Q72H 4K9EC 4UOJA 2Z93B 2NY7H 3K1KC 3HMXL 3MBEB 4FP8L 4BM7A 5EUOB 2YPVL 4ZOEA 3DVGB 3R8QA 1OAUH 3ILQC 3W39B 1JWUB 1RHHB 4PJDA 1NUGA 1MJUH 4JM4L 4YUEL 5FYJD 3V95A 3VXPB 3RTQA 4XC3L 4KHXH 4M48L 3RBSA 4LDLB 4P9MH 4EOWL 1X9QA 4G8EA 5IT2H 3OJDB 1OM3L 1MJ8H 1EUTA 1TMCA 1BZ7A 1A5FL 1U8PA 2G75A 4KHTH 1YC8A 4RGNB 3T2NH 3T65A 1EERB 4V1DE 1UM4H 1CK0L 4X5WB 3VFSB 2NW3A 3BQUA 1MCOL 5CKAA 3BDXA 4R96B 1I1RA 2CLZB 4MNHB 3WKMH 5TDNB 2EKJA 3KAAA 3MRDB 1RJCA 5DDHB 1Y0LA 3P0GB 2CO7B 3T1WA 2FHFA 3IS0X 5L9DH 4OZIB 4GG6A 4WO4C 1CF8L 3WDHA 4YGVA 1CFTA 4DKEH 5EN2A 1D5BA 2I24N 4XRCA 2DKMA 4NYLA 4AIOA 3T3ME 5D5ME 1NBVH 1BEYH 3SN6N 1T04A 4OIBA 4RX4D 4J4PA 1J0JA 1A1OA 2ITDB 5FA3B 3NPZB 3TO4C 4TSCL 3GUTA 3CMOH 4WY7H 3VCLB 1G7MA 4PJFE 3VXRA 4CADB 4RRPA 1DL7L 4NFCA 1CXHA 1KC5L 2ICCA 3QUYB 4HIXH 4ERSL 1MLBA 5T3ZD 1NDGB 2CDFB 3FB6A 2CXGA 4WI6A 3VDCA 4Y2DC 1CLYH 2YWYA 4P2OB 3HG1A 5GGSY 1Y6MR 4OCSH 4WI5A 3RNKB 4CU6A 2ZSVB 3CK0L 4HC1L 1B6DA 1MQKL 4HWUA 2QQNL 3S4SA 5D71H 1G0XA 3WKNA 1YMMA 4W81A 1QTYT 3BMVA 4X6CA 3L3GA 3G5ZA 1FLTX 3VFRA 2Q76B 4LNRB 4U3CA 2F53A 4S1SH 5DHYB 4HGWB 3X11B 4CNIA 3BUYB 5I19H 1YEIL 1IC5H 3DROB 1FH5H 3CFJA 4WO4A 4HKBB 5FA4B 5FHAH 3VFNB 1K3IA 2NY6C 3STZB 3V2AR 3R0NA 4MXQD 1CICB 3QNYB 5GXBB 5I16B 2DWEA 1AC0A 3BI9X 3QEGH 2E7CA 1A0QL 2UWEB 1Q0YL 2ZUTA 1IL1A 1QNZL 1RD6A 1TVHB 4NWUH 4QGTA 1DR9A 3RY4A 3QJFA 4FG6D 2M26A 1YNTB 3TO4A 3IJSB 4FFVC 4AEIH 4DVBB 1ETZB 3LS4L 2VH5H 4M61B 1U8KB 2R39A 4YHPB 1QHPA 2EDFA 1WGOA 1EJOL 1I7ZA 4NDMA 1X5LA 4Y2DA 1L7IL 5T1DH 3QI9D 4JVWA 4FNLH 2EKSB 1F4HA 2G9HA 1U2HA 4NZUH 3V5DA 3NA4A 1ZXQA 2OL3B 1T22B 2Z31B 4WU5A 1BP3B 3TM6A 3WLBA 1WWBX 3MOBL 2X2YA 3VXUA 1AD9A 3KYKH 3RWDB 4V2CB 4ZUUA 1T1ZB 5C0JA 5F8QC 5BS0D 4L4JA 5I1CL 5J9PB 2EDHA 1CVSC 1EAJA 2EDRA 3A6CH 4MGXA 1OSPL 1J88A 1JPST 4FZ8L 4ZG1A 2DQHL 1D9KB 4ZFOA 4LLQB 3V4PL 2VISA 4NNPH 4ZFFB 3ALWA 1CWVA 4LSVL 4BA8A 3L7EA 1KXTB 5DD1L 4Z0BL 4R4ND 3UBXA 4QF1B 1ZHNB 5CZXC 1FDLL 2R4RH 4X7TA 5CZVL 2ZUUA 3QIBB 1I1FA 5JIHA 3LD8C 1KCUL 3ORJA 1CGTA 4P3CH 4QRRB 3OKNB 3LV3B 1DEEA 3PJSA 4JRXE 3DYPA 4U2YA 5BZWB 5HHPA 2XT1B 2VL5B 3VGFA 1F4WL 4F7EA 5CLWA 3O6LH 2AAVA 5KSBB 1LO0H 1KLGB 1NDMA 3MJ9H 5TFSL 4OAWA 3GMMB 1M7XA 4MA8L 4ELKB 2Y4SA 4OD2B 4YC2C 4AENA 1IGTB 3HFML 1LK3L 2X4TA 1OAXL 4YDJB 3QUXC 1AP2B 5LGKA 3TV3L 4L4TD 2FLBT 1NAMH 3BEWB 4NO3B 1JNJA 3DBXA 4N8VA 2I25N 1A7RH 4NSKB 4XVTH 3C8KB 3ZLQC 3RPKA 3QUZC 4UNTA 4XTRC 5DEFA 3TIDB 4MAUL 2BVOB 3F58L 3IDIB 1A7NH 2KQNA 4ALAH 5DEZA 5ID0A 1BHGA 4WFFD 4DJMA 4P5MA 2V2TB 1GRWA 1I3UA 5EO9A 4LSRL 3ZL4L 4OZIE 1FAIL 3CXHJ 4ONFL 3GJEB 4LVEA 1KIQB 2GITA 2JIXD 5JO5B 1A3LH 3WIIH 2OK0H 1ACYH 4JPWH 4KJQC 2BFVL 4JE4B 4DGIH 3WFDL 2D7TL 1Y18B 4BSVB 1OY3B 2Q86B 4YJZL 2B5IB 3NZHL 1MLCB 5DWUL 4OI9A 1F3RB 2VABB 4K7PH 1DBKL 2OJEA 3QWOB 4LCCB 4O2EB 3UJJH 1FLRL 1K4DA 2F8VA 3WNNA 3GMLA 4MJ5B 3QUXA 4K9EH 4CN4A 1EA9C 2DLHA 4ISVA 1BVLB 1D6VH