2VE6A

Crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cd8+ T Cell Epitopes in Chlamydia Trachomatis Infection Through Use of Caged Class I Mhc Tetramers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN D-B ALPHA CHAIN
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ve6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ve6A01
3L95B 2ATPA 1T6VN 3GSNH 2R39A 2FD6L 1MJ7H 4NQXB 3DLQR 3BQUB 2BK8A 1EVUA 1KEML 5F1KC 3V6OA 2J5LB 2Z8RA 1WGOA 5GJSL 3HG1B 3F5WA 4E41D 3HR6A 3QHTC 4XI5D 4Q9CA 2ZPKH 1M6OB 3CMOH 4FFEX 1CXFA 3GGWB 4HS8H 2FX9L 2FZ3A 2OI9B 3RAJL 1IARB 1F42A 2E7LC 4GSDH 2Y23A 2V7NA 4R96B 2NY5H 1OTSD 3PGFL 4NQDA 2WY3A 1GYAA 5INCA 3CJJA 4G42B 1NDGA 1A2YB 1FRGH 1K8IB 3GSWA 1NCDH 3DRQB 2VLLB 2CLVA 4KDWA 4XHJD 3V4UL 4D0CB 3IJSA 3CX5J 4M7ZC 2ZCLL 1LK2B 3C09C 3WSQH 1RULL 2K1MA 3I9GH 5F1NB 3P9LB 2VDRL 3HC0A 4K55A 2YZ1A 5CUSL 1ZVSB 2NZIA 1JWSB 1V05A 5IT2H 1YEFL 4RGOH 3UTOA 4R8WL 5FB8B 4WI4A 1ZXQA 5IB4A 1UM5L 1IAII 5I1IL 4U6YA 1UWEH 1SY6A 5JW4R 3DRTB 4JDVB 3DX8B 1BD2D 2YPLD 5B8CA 4I9WE 4MHHI 4P49A 4WIQA 2ESVD 3BZ4A 4OJFH 1XH3A 1RZ8A 4U1MA 2CRMA 3CDGB 1YY9D 4XAWL 4I0PC 5F7WC 2IAND 1CGXA 1DE4A 3HE6A 4PJHA 3BUYB 1D6VH 3VGAB 3X3FH 2ZOKB 4MXQD 5HHMA 1XR9B 4HKXA 1UEMA 1FV1A 4QKXB 3ARFD 3QDHA 5J8OA 2C7UB 3GMNA 4Y16B 4EZMA 2ZPKL 4DVBB 2EO9A 2X4UB 4I48B 3QDJA 1OARL 4RFEA 1B0GA 2VLRD 1EO8H 2DQUL 4RMTA 5EO9A 5E08L 1LP9E 4ZODA 1I3VA 1S9WA 1GHFL 1PLGH 5EU3B 1GVIA 3H0TB 4PGBB 2KDGA 4YDJA 1BZ9A 1NANH 4QY8B 5C0FA 1CFVH 4Y4HB 2VDOH 3UXFA 2H26B 1BOGA 1SBSH 4YAQB 5DD3L 5IGXL 1UWGH 5GGVY 3WUWA 3NCMA 3SDCA 1NUNB 3D0LA 3L6FA 5HVHC 4XMLH 3O45A 4NKIH 5C0AB 3FQXA 4JG1L 2YD8A 5CWSB 2XWTB 5FDWB 2FO4A 1K3ZA 2E9WA 2EEBA 4X4YB 4YPGA 2FHBA 3QIBB 2P8PA 1EJ6A 4EDXB 3BFOA 1VFUA 4LGRB 4I3RL 1OD9A 1OAYH 4Z7NE 1FFNA 1ZS8B 4UUJA 3SKMB 2DLEA 1DBKH 2G2RB 1UACH 1PG7H 5ID1B 2IALA 4YJZL 2NX5E 3CCHA 1HKLL 1J1XH 2E6QA 3OAUH 3QFDA 1S9XA 3HZVA 5IJKC 5FUZH 3Q2CA 5IMMA 4DGIH 4N1CA 5C0AE 4AQOA 4K7PL 5JZ7D 3EJZC 1BECA 2FATL 3CLFL 4GRWF 3D1MC 4EN3A 3ARBC 3BDYH 3TVMA 3I6LD 5DQ9A 1ZT4B 1WITA 4M6AA 5JORA 3ALXA 2VL5B 4JM2C 3QIWD 1RZFL 4XPHL 2GTZA 3MRBA 3HE7C 3P0GB 4KROB 4NYLA 5IMOA 3TH3T 3BKYL 2EDTA 2DQCL 3RHWK 3QXAA 4QHUB 1P4LB 1UCBL 3PP3K 2ADGB 1CGYA 1INDH 2IAMB 4LASH 3RHWF 4HWBH 2VXTL 2AEQL 3FQUB 1KN2L 3OR6B 5DD5H 3VXSB 4HEME 5ESVA 1BREA 2VRAA 1LO4H 3REVB 1JTOA 3MV8B 5FB8A 3OAZK 1DJSA 5EO1A 1J5OL 1QBAA 2VUOA 3OR7B 3T2OA 3LH2H 1QFOA 4ZS7L 3KYNB 4OKVB 5KG9A 3GHBL 3VFGH 3KPLB 2IMMA 1IM9D 1YEGL 4XVUD 2Q8AH 2I60H 1I9EA 3BPNB 2YD5A 5BZWB 2DI8A 1G9NC 3VWKA 2IBZX 4LCYB 4OFYA 4JQIL 4HFWA 4P2CG 4PJFB 1KIUA 5A3IC 4N90D 2XXCB 4NO3B 5HDQH 4MXVF 4NQEB 1FZMB 1TZHA 5K9OB 4WI7A 3S37X 4LARH 4ERSL 2XQBH 2ZUYA 4H88L 1TTFA 1LP9A 3MQIA 2HH0H 3VXQB 2HJLB 1GGTA 1DANU 5HHMB 3A0OA 4X6BA 3TPKA 5J6GB 1J05B 5L0QC 1AHWA 1CDUA 5E2TL 2D7PA 1MJ7L 1C16B 4OB5H 2PYEA 4DCQA 1IGFH 4KZDL 1KB5H 4OGYL 5E2TH 3VXUA 4YQXH 2APBA 5F7KC 1XR8A 2NY6D 1MEXH 1IKNC 4YHKL 3HI1B 3JTTA 4FQXD 4QOKE 1B3JA 2FHFA 4B7LA 3NCJH 3H9SE 3NCYS 1F90L 1JHTB 4MQXD 4LQFH 2R1XB 4XNZB 3WIHH 5CS7A 3E0GA 4BQBA 4XNMB 4D9LH 4M5ZL 2D0GA 3LN4A 2MJWA 1QEWB 1U8HB 4EVNA 1XGRA 3CVIL 4ISVA 5DYOB 3VRLE 3EFDL 2P5EB 4RWYH 3SOBL 1FO0H 4KY1H 4YEFA 3SHSA 5A16B 3HG1A 3F5WB 4M7LL 1ADQL 5JUEH 4X7SH 1N5AB 3O4LB 4M6MH 2E5EA 2OMBA 4HZLA 2DQHL 3DX9B 4GRMB 3Q1SH 3QSKB 5DD5L 3TIEA 4C56E 5MEOB 4FRWA 4R4BB 5TGBB 5GRJL 5FOJA 1INDL 2SEBB 3VXPA 1EMTL 2VLKA 3TYGL 4O58L 1U8LA 5C0ND 2PR4H 4AL8L 4PJAE 5DHYA 2WP3O 1QFWI 2F8OA 1GH7A 3ALWA 3QHZH 4IM8A 1ZOXA 3QJHA 2YA0A 2EYSA 1PY4A 2EYTA 1YPZB 1HHHB 5J1TC 1HOCA 4NRYA 5GS2H 4IRSB 4C58B 3PWNA 4PV8B 1N6UA 4J3WA 4CVZA 1QBML 5AWNH 3D39D 2XZQL 1ZLUK 1E4XL 4FNLH 5BV7L 3TT3H 3ARPA 3ARUA 1HH9A 3I6KB 5ALBL 2CLRA 1QSFA 2A1WL 4O9HH 3S4SG 2V2XB 5GGRA 4GRWE 1DANT 5E2UL 3TO4A 4X9BA 5IBLC 2BHYA 4S0TD 5IB1A 4DAGH 3ULVL 2FD6H 2QQKH 4QLRA 4JVPA 2YPLA 2NCMA 3PWPE 4XBGA 1ZTXH 3O11A 1F45A 5IVXF 3UTQB 5AYQA 5EIIB 1F11A 2AXGA 4LVNB 2LFGA 3QCTL 2ZUXA 2E27H 5FYJE 1CDIA 1ETZB 3HMWL 3G6DH 2CRZA 3KYMB 5EO0B 1C5CH 1U8QA 1QVOB 5K9QI 3C5ZB 4XVTH 3KS0J 4HBCH 5SWZE 4E5XB 5C0CD 1A5FH 2JJVA 3W39B 2WV3A 1JGLH 1U8PA 3BKCL 5LAXA 1T2QH 5DT1H 1SYSA 5GS1C 4PGDA 4UILL 3MLWL 3SOBH 3NH7L 5GGVL 1I7UA 1LO0H 5L88H 3N1MC 4R9HA 5T5FL 1H8OA 5GGQH 3MYJB 4X6BB 5DEGA 3MLXH 2AABL 2ZCKL 5D8JL 2IH1A 3MV11 2H26A 2PTTB 1A6UL 2F9BT 2EE9A 4F8TA 4Y4KA 1SY6H 4Y89A 2VDKH 4FQHB 3AFLA 1JNJA 4WENB 4CVUA 5SX4I 4KDTA 1T0NB 5F7LB 4NSKB 1MNUL 5HHOE 4TNWF 4UNVA 1PFCA 4YHOL 3FQXB 4X9IA 4ELKB 2ZP0T 5E8PA 5CEZD 2CO6B 1KXQE 1Q72L 5AG8A 5C2BH 2ZG2A 1T80A 3NABH 3U46B 3EYQD 3B2UC 5E9DA 3ZL4H 4G6MH 3MRFB 4D0CA 1J0JA 1BJ8A 4NN5B 1AI1L 2AJSL 1VACA 3VGBA 4M48H 5AEAA 3EO0B 5C0AD 3T1FA 3MYZA 1TETH 4XHQA 3OXRB 2E27L 3VFTB 4KTDL 5IV2B 1PZ5A 4PB0L 5MEOA 1EEYA 1BAFL 2G5RA 4G9DB 3MRBB 4PJGF 2FECI 4S1SH 4ZQKB 3UBXB 4U6YB 2NX5D 3MRKB 1T3FB 3VGEA 5L9DH 3HRZB 5IROA 3V6FB 2RGSA 3RWEA 5AZEL 3O2WH 1LNUB 1JNHB 3CSYA 3FQTA 2XTLA 5C9KA 1FIEA 3FFCE 1U8JA 1YPZA 5HPOA 4K7PY 5FK9A 3TO4C 3LZFH 4OLWL 1UM4H 4PP2A 5EOCJ 3JV6B 3K2MC 4MAYB 1NL0L 4UNTA 5E95B 1FG2A 5BV7H 3MC0A 3M8OL 4WU7A 5ICYB 3OGCB 3V5DA 4AMKL 1F2QA 1J1PL 4NJAL 3H9SB 3CFJA 3BGFB 3U79A 3I2CL 2QQNH 3L3KA 3QEUA 1NCBL 4XCNB 3TYFB 1TNNA 4HIJA 3U9UA 1WISA 1OP5H 3A67L 1FVCB 4HKJA 3MREA 3FO0L 1VESA 4Z6AT 1I1FB 3FFDB 5AYUH 1YY8B 3KXFE 2OMNA 3UPRB 2B4CH 3Q3GA 4MDJB 3G5XA 4OV6F 5FUZL 3F7RA 1OY3B 1S78C 2AJYL 5LBSH 2E9IA 5TPWH 1XCTB 3MJ8A 4XMPL 3SGEH 2ITCA 2ITDB 4NM4H 4HIIA 1MI5B 4JRXE 4QTHB 2DM3A 4H26B 4PJ7B 4YHLH 5H37G 5D6DA 2VC2H 3TH2T 5EU3A 3QXUA 4OZ4A 4FFYL 3VWJD 1SQ2N 5E8EA 4L8SA 2D7QA 4Q2ZA 4IEFB 3BPCA 3UJTH 3OWEA 3OBAA 1HHGB 4Q6IA 5CJ8A 4XP5H 4YC2C 5D7IB 2OZ4H 1GL4B 3ARDC 4S1DC 5ENWB 3T4AB 5FUCE 3PWPB 2RB8A 4LSQL 4Z8FL 3LIZH 3EKCA 5C08D 3IRZA 4NO0B 3DXAE 3NA9H 4NFBA 1KPVA 5HHNA 1FYHB 4UT6L 3F7PC 3FN3A 2I25N 5C07B 3SJVA 4IOIA 4BSWA 4P23D 1OP3K 1PD6A 3U7WH 1KCKA 1MJ8L 2YWZA 5B39A 3CFCH 5B38B 5EN2B 2AP2A 1WZKA 1A6ZB 1OF2B 4OV5B 2W0LA 3OPZH 5FYKH 3EDFA 1CFNA 3ZKXB 4PRBA 4X6EB 2P46B 5T1KB 4R4BA 4QOKA 1A47A 3SJVD 5F7FA 5GGTH 2CLZA 2R15A 4XBPB 2GKIA 2BY1A 2OK0L 1X5IA 5KN5A 4XCEA 4BSJA 4L3CA 2DBLL 2JJTC 3QJHB 4D0DB 1R5WB 4WWKA 3ZZ1A 2Q1EA 3PQYD 4ZSOE 2FYYA 1IEAB 3KG5A 3V5KA 2B1AH 4J3TA 3WFHB 4GG8A 3VXMA 5KVDL 3MLWH 4KRMB 3EYSH 4RMWA 4XVJH 1N64H 5EZIL 2EDHA 4YZFF 3BDXA 1CICC 5DT1L 2UY6A 1TLKA 4FFVC 4Y5YA 2HT4D 1JI2A 2X4TB 3EOTL 1FBIH 1YNTA 4U1SA 4MNGE 3UTSB 5C8JB 4M93B 4UNUA 4L8BB 2YUWA 4K07A 3QDJB 3M45A 2P8LB 4R4NC 4PGEA 4X4ME 1F11B 4HJJL 3CC5A 3SGDH 2FECL 1MCKA 2OL3H 4LNRA 1YQVH 4DKEL 3R8BB 4ZXBA 4EIGB 3LN5A 5LGHL 3WHE1 2DQFB 4ODHH 3F8UB 1YY9C 5T3XL 4IOFC 4NGHL 3O41B 3RZCB 4YDJB 3DSNA 1HINL 3BH8A 5KVGH 3CFJB 4U6HB 2C3VB 3HAEH 4YIQA 1H9VA 1U6AL 3L3DA 4H1LH 3Q5OA 3CFKB 5D2LE 1BF8A 1I1FA 5EBMB 1MH5B 5FYJD 3WYRA 4L4TD 2OX5A 3R06B 3GMQB 2UUDK 15C8H 1BF2A 3TIDA 3P9WB 3MRNA 3PHSA 4JVWA 3MJ7A 1OTUD 2NX5A 5DRXB 4JN1L 2PTVA 2X4RB 1MCCA 4P3DA 5KVFH 1QRNE 4WHYH 5CSBA 1ND0B 3AREC 5CJBA 4G8IA 4ZS6D 2WIIB 5EUKA 2NXYB 3EOBB 5B3JF 3S36L 3ROLB 4WW1A 4YHML 2FJGB 4Q2ZB 3LQAL 2NY2B 3QG6B 4MB3A 1AXTH 3VXSE 1TCRB 1MAML 4U1JB 2OR9L 4DOHB 4I1NB 4BQ9A 4S0SD 4ZOBA 3FB7A 4Y2OA 1MY5A 4KU1A 4BH8A 3AAZB 4EOWL 5JQHC 3MLSH 5DQ9B 5GZOC 3MZGB 5DHVB 2WBJD 5JUEL 3CFIC 4LMQI 2X89A 1ORSB 4KK5C 1WC7A 2ZUQB 3OMZA 1BEYL 2R1YB 5D7IE 4FTVB 5HHXL 3QA3B 1VENA 3D18B 5EA0H 3FAXA 4EN3D 2UZIL 3E6FA 1MFBH 4JO1H 4PJ5D 6FABL 2PCPB 5FXCH 5B39B 1UCBH 3O6KH 4X6CB 5IB3B 5F96H 4LCCA 5D9SB 5MI0B 5HJ3A 2F8VA 3V8OA 1TPXC 3L1OH 5HYIA 3REVA 5JMOC 4WEMB 4LSUL 5TDOA 4OT1L 4E9LA 4IS6B 4KI5D 1GGBL 2Z92A 4YDVA 4G9DA 1FL5B 3HUJE 4PRID 4XB8A 4MD4B 1G9ML 1MWAB 4Y5XC 4LPWA 3UPCA 5GGSB 1YQVL 3HC4H 3R1GH 3DMMA 4RGMC 4MAUL 4OLXL 5B3NA 5IEHB 1JF1B 4WW2C 2HRPH 5H2BA 1KTRL 3IU3A 4DK6A 3F12B 5IQ9B 4B0MM 2P1YA 4NO3A 2B1HL 3SE8L 2VN4A 5D2LA 4JZOA 4WU7B 2AK4E 1F00I 1LO2L 3QT2A 1OD7A 4F7CB 3S98A 4YO0B 5DJ8B 2B2XL 5FGSA 1I1AC 3ZE2F 1N64L 4HIEB 5E7BA 4K8RL 2Q87A 4U1HA 3QXDB 3C5ZA 4Q58C 1QO3B 3B9KB 2G5BA 4N0UA 4OI9A 4PJEB 4F7PB 2GJZB 3G04B 4JFZH 1CD8A 5ACZB 3TJEL 1Q8MA 5E5UB 1YPZE 1JUFB 4R4FH 1QEWA 1Q0YH 2ADJA 3STZB 2O93L 2HFGL 4XP6L 2ATKA 2W60B 5HYSB 3C2AH 3RVVD 4G6KL 1IJ9A 1NCAL 4LRIA 2UWEE 3GIVB 3IAPA 2FLRT 3IRPX 5IUSA 2BVEA 1RUML 4Y4KB 1RD6A 3GSVB 5C6TH 3NZ8B 1CK0H 2H6PB 1G9MH 4GRMA 5HDQL 4ODUA 5EBMA 2BHUA 3DGCR 1CBVH 1HN1A 5DO2D 1EBPA 4PREB 1OQXA 4HIXH 3W11C 3ZHKA 5HHNB 5JDSB 3RWHA 3WNLA 3MV9E 5D96B 4XNQA 1DQLH 2DL9A 2OQJA 5B38A 5FGCB 4N9GB 3G6JE 3F7VB 1KLGA 4D9RE 2GCYA 3QI9B 4UOJA 2B2XH 3VD3A 2Q76A 1D9KC 5SWSD 4OM1H 5B8CC 4N0CA 4G7VL 1I4FB 1CVSC 1EXUA 2E7LE 3C5JB 2FGZA 2VDQH 3HPLB 4KMLB 4C4KT 5I75C 4N0YH 1BVKA 1VACB 1AQKL 3WIFA 1M6OA 3U7AA 3CX2A 3FO2A 1DBML 4AT6B 1MCRA 4UTAH 1Y6NR 1B9ZA 3X12B 5FCUL 4YFEA 3LKRB 4HWEH 4LAJH 1QR4A 4QHLB 5TPWL 3CXHJ 4CMHB 2QBWA 3MRKA 3WD5H 5GRZA 3TZVB 3WKML 3D3VB 4FQJL 5HDBF 1LNUA 3H42L 1BWMA 1PLGL 5DK3A 1TITA 1UM6H 5FHAH 4NQEE 2BX5A 5JZ7C 2KKQA 2C3HA 4OT1H 3CZFA 2BJMH 3V7AG 1Z9MA 1K2DA 3S88L 3ZSTA 4WFEE 3A6BL 3RJDA 2PN5A 2VLJE 2CR6A 2VITB 1T22B 5JR1H 1JPFB 4LGSB 3ULVE 1J0IA 4OZIA 3ZDZF 3ZKSD 4KK6D 1X5AA 1QLEL 4JDVA 2Y5TA 4E5XA 2PW1A 4QYOB 3NH7H 4WI9A 1PSKL 2Z31B 5KTEL 4J12A 5I8OH 2D3VA 1PKQB 3T3PE 3GSNL 4WO4A 1RUPL 4IIQC 1T2QL 3QEGL 1DE4B 1KULA 3HE6B 4PJHB 5E70A 1E6OL 4JZOB 3RL1A 3GMPA 4HUXA 5FYKD 3ULVC 1LEGA 3O41A 3RZCA 1N5YH 2OZ4A 1BQHB 3QUXD 4OTXL 1G7MB 3MUY1 1NFKA 2BSRB 1F3JB 1FPTH 2C4XA 1V7ML 2IH1B 4WTZA 4BJLA 5BOZG 3MRPA 2M26A 5D7LB 4ZFFB 1OLLA 2DMKA 1JMZA 2R0WL 1TJHL 1V7MH 3RX5A 2FSEB 4K3JH 3ULSA 4KJPC 1DSFL 2QSTA 2FDBP 4QRRB 3WS3B 1G7JB 3N1PC 1F4WL 3IJYB 5HHPA 4JR9L 2VLJB 3IDIA 2W07A 2D03H 3ZDXE 2QSVA 2QHRL 4OAWA 4KKNA 4KK8D 4JLRA 5I1JL 4JFEA 2QADC 4NC1E 1S9YB 1IC5H 5IJKA 4PGZA 1OM3L 1A6WL 4HT1L 3W5MA 4GW5B 2IFFL 3VJ6B 3L95A 3OKYA 5ITBH 3O6FC 1N7ML 3WHXA 1JWMA 3P2TA 4KJWD 3BIKA 2Y06L 1UJTA 1AO7B 3RGVD 1A6ZA 2AV7A 3NCBB 1JK8B 1AE6L 4JO3H 5EB9A 2X70A 2EC9U 1MSPA 1CLYL 4OSUL 1RHHA 3MCKB 4AH2B 3A6CL 1RFDL 1T89A 1U3JA 4M43L 4MJIA 2FR4A 4LKXB 3LS5H 2YEZB 3ZDYE 4KHTL 4YHYB 1L8JA 3B6SA 5FHBH 3P11H 4PG2C 1U3HD 1FIGH 4EI6A 5BJTB 4UUJB 3SKMA 1HEZA 2GITA 4JY5H 5C70A 3HC0B 5T3ZE 4P99A 1J87A 1NMAH 4MQTB 5D4QA 1E4KA 3VXMB 3G9AB 4H1LA 2VDQL 3LKNB 2YN5A 4WWKD 4R7DB 1SEBB 5CMAB 2DJ4A 5TQ0L 4BK5A 4P5KB 2WUCH 3O8XC 4XCCL 1F4XH 4ZNEE 2H8PB 2ZSVA 2ZKHL 1MIML 1W0WA 3UJTL 3WE6A 1R3JA 3FT3B 4WUKH 3Q6FB 3B8YA 3PGFH 4JPIA 3W5NA 1VGKA 1F4XL 5BMFL 1GIGL 5M95B 2EE2A 1KJ3L 2QADD 4L8DA 3Q3GB 4BELD 2VQ1B 5EPMB 5ADPL 5BW7A 3OZ9L 4LKCB 4KRLB 5IVZB 3MOBH 4G9FD 5I76A 2R0LH 2A0LC 2WQRA 3S7GA 3MNWA 4N1HB 3DO7A 4P2YA 4NZJA 4WCYL 2HMID 1XAUA 3JZ7A 4XPGH 4WO4C 5EZOH 1J0ZA 4ZUWA 4DGVL 1FG9C 3TBTA 4PP1C 4HUUB 4PJCA 4QRPB 2Q6WA 3RFZC 4U2YA 4OZIB 4M5YL 3MRQB 1KCRL 5GZOD 2BNRB 2X4QB 1IGCL 1XIWC 3BPCB 3G6AB 1QFWH 4LVOB 2YD4A 1E28A 3QIUC 4JGJA 4RGNE 1QFWL 4UOW0 3WUWG 3MODL 4KQ4L 3F7YB 4XTRD 5KANI 4N0UE 4KKBD 4HBQA 3PWPA 2IEPA 3M8OH 1MAJA 4FXLA 4R26H 2DS4A 2XA8H 3ARED 4RFNB 5C7XH 3ULUD 2AJZA 3SQOH 3UYRH 5MERA 1PQZB 4LLMB 2DTML 3KYOB 5A43C 4DEPB 4M6ML 5DHXB 5DD1L 3N85H 5ILTH 3VCLB 1RUQL 4G6AD 4C4KO 5JOPE 4PBXA 1X5FA 4DKFH 4QXWA 1ZEAL 5EOCL 2Z35B 4NOFA 1QFUH 2R29H 4UV7H 4PJDE 4AM0B 4OGAC 2YPVH 2XN9D 3MBXH 3O3EA 4HEPG 4KV5E 1NAMB 3OSKA 1M05B 4YHMH 2X40A 5FDWA 2KBGA 5JDSA 3O2VL 1I3GL 2R1XA 4FZEH 1RZ7L 4YBLB 4JFEB 5D2NB 2P8PB 4TNVF 1S9YA 3HMWH 1HSBB 2VH5H 4LQFL 4Z7VF 1T1WB 1U93A 1H5BA 4WNQB 1Q9LA 3T77B 2G2RA 1MF2L 3IFLH 5E2VL 3RIAF 4XB7A 5DWUH 3C60C 3DRQA 4JQVC 4P4KC 4JO4H 3KAAA 3OAYK 3VGGA 2XWJA 5IOPA 2MQ3A 3WNNA 1HKFA 1N6VA 4LCCB 1B4JH 5E4IA 1F2XK 1NGXA 4NKOB 5GJTL 3ARSA 3UDWA 4FQQB 3BUTA 3VGFA 3JWOL 1QYGH 5HJ3B 5F71A 1D5BA 3TWCH 3UZVB 3WIFB 3DX9A 5F9DC 5BRZE 4W6XB 1PG7L 2GI7A 4LBEB 4CRPA 5D70L 1KJ2A 4MYWB 3OX8B 4B7IA 1D5ZB 5F72S 5DUPL 5KJRH 1LDPL 3U6RA 3DBXA 5C0JA 1MFBL 5JA9A 4ETQB 1U91B 1KTLA 4DUWA 2NZ9D 4LLWA 5F7EH 4KV5F 1HILA 1DBJH 3D3VA 1ZSDB 4WU5A 3G5VA 5SV3A 4PJDF 1RZKL 3DMMB 1A4KB 5BCAA 3C8KA 5DZNA 3FRPG 3QDMD 3QAZB 4RRPA 4P0DA 1NKRA 1YEEL 1UH2A 3C6SB 2UV3A 3MACL 3VXSA 3U1SH 3P4OA 1HOCB 1DFBL 4EQ2A 1JGVL 4RIRB 2GJ6E 1OTSC 3LKNA 3QUKB 2W9EH 4X83A 2PR4L 1FPTL 2Q3AA 2Y9RT 4NIKB 5C09D 2Z8SA 5EOTA 2AXHA 3MFFB 3BH9B 5IHZB 3OJMB 2QKIA 3U4AA 5D7KE 4PV9B 5CILH 4QXUH 4KJPD 4ONGH 4ODTH 3RTQC 5TH2A 3V2AR 1NBVL 3MRMA 4PJ9B 3LKSA 4DAGL 4I13B 3QG7L 3GUTA 3HNSH 3TIDB 1P4BH 4M02A 4X5LA 3BISA 3ULVD 3P0VL 3T4YB 3U1SL 3DUSA 1CLYH 4OSUH 5KSUB 1I1YB 3CSBA 3BPLC 4GKSB 3IDMB 3LQZB 4QXGH 4ZO6A 5A2IH 4YLQT 2BJML 2CDFB 4JM4L 1NMCB 2AAVA 2W1NA 4I4WA 4NFCA 3QG6A 3ZKND 2Z91B 3Q6GL 1FNLA 1YUHB 4CVXB 3QUZC 2B0SL 1YMHA 4FZ8H 3GSVA 1B90A 1SHMA 3JWOH 4P2OC 1T4KB 5JW3L 5HXMA 3O45B 1WC7B 5A1AA 3RUGA 3B43A 1AFVH 3D85B 4JO4L 4UIKH 2PXYD 4JG1H 1OHQA 3WFZA 2E6PA 5D1XB 1P2CB 1XF4A 4KRPD 3OZ9H 3FT4B 4LEXL 1TJHH 4AEIH 3PWUB 4Z76A 2VLKD 3GB7B 5GPRA 3U7YH 4S1QL 1J8HD 1KLGB 1KC5L 2GY7B 1IAIM 5BMFH 3HRPA 2FNBA 3QDJD 2APTA 5INDA 5TF0A 2JIXB 4GQ9H 4Y4FA 5IEKB 4G80A 4V1DB 3KWWB 1L7TL 4LMQE 4MNQD 4G5ZL 1GHFH 5BXFB 1MCBA 3V6OE 1UZ8A 3V52L 2BVQB 4N0YL 5C09B 1PGRB 2V17L 4WY7L 3EW3B 5C3LD 1NCCL 2DQUH 3BW9B 5B22A 3L7FB 1GGYA 2F5BH 1IEHA 3E6HB 3RX8A 1LILA 4R0LB 3QRGL 1CLOL 4XH2B 2B1HH 4HUWB 1A6TB 4IDJL 1FZOA 3MLVH 5F1IB 2L7UA 3BD3A 4J8RB 3T1FB 5LGJA 3QH3A 1NFDB 5DFVC 1A8JH 1VDGA 3DXAA 2F58L 5E2WL 2BMKB 3OJVC 1RJLA 4JQIH 5J7CC 3B9KA 3KHQA 1J11A 4ZTPH 5JW4N 3C6LB 2NY1C 3C8KB 4LRNH 1UWXH 1J1XL 1XCQB 1CE1L 1QHOA 5E99L 4LSPH 2PKDA 3QCUH 5E03A 1MFNA 4HS6A 1DBBL 1HHJA 1IAIL 1OCWH 2IG2L 1JNNH 1EGJL 1WLHA 3I84A 3HAEG 1RJYB 1TVBA 4P5TD 3SBWC 3LN9A 5KSAD 2GJ6D 3SEPA 1NLBL 4PJXA 1RK1A 4ODXA 5FV1L 1MAKA 4RX4D 1FYTA 1RUAL 4JRXA 4NKIL 5T33L 2EIDA 5D7LA 4KVCL 1I1CA 1XGTB 1FGVH 1FZKA 2X9XA 5F9WC 5IG7B 2PXYB 4RA3A 2VSDA 4PJHE 3D85D 3WS3A 3VWJB 4QRRA 4LLYA 4MDJA 4AENB 1JFQH 1JN6A 5ANME 3K81A 4TUKL 5CD5C 4LRNL 3TFKD 2VLJA 3HLAB 1I7UB 3JUYA 3MUZ1 1MIEH 2DMCA 4GG6B 2DQGL 3I3EA 4LHJB 4JY5L 5D7KD 5IW3A 1C8PA 2AI0H 4X0KB 4HG4K 4RMVA 2OQJB 3UJIH 4YQXL 4JGUA 5FUOH 3VJ6A 3VE0B 3RGVC 5DYOA 4MLSA 1ACYL 1HWHB 4WDIA 2NY4D 4PY7B 3TBSB 5EC1B 4NUJA 3RVTD 3K0WA 1CLOH 5I2IB 2AV7B 4I3RH 1ZHKB 2GT9A 2CGRH 5E8PB 1A7RL 5BS0D 5EU6A 1JGUH 1QZ1A 3NPSC 1WSST 1JGEB 4ZFOB 1BEYH 4LVEA 3PDOB 1ADQA 1NGPH 3BPOB 3I75B 5FA3A 2DQDL 5GIRB 2DLHA 1H5BB 3RI5K 1H0DB 3H8NA 4HMDA 3KPSE 4I2XA 4J6RH 1Z6JT 4G3YL 4YDIL 4MA8H 5IFHL 3RI5F 4XBEL 4AEHL 5IHLB 3RUGF 2XKNB 3IDJA 4PTTB 2CMRH 4ODSL 1IZKA 3RWDA 4EN3C 1IC7H 5IOPB 4ZPVA 4GG6E 1HEZB 4BM7A 4CADB 4NP4H 4WGVB 3MV9A 3MLYL 1A4JA 4HWEL 1MRFH 5HI3D 1K2DB 1TIUA 4D3CL 5I1GH 2XPGB 4FMFA 3VFTA 2FWOA 1KPRA 1NEUA 2FX8H 5D93B 5GS0L 1KJ2B 3OJDB 4OLZH 3DURA 1DDHA 3MPCA 4HXBH 3UZEA 3RY5A 3I50H 2B20A 3FO1A 3QDMB 4PJHF 1WEJL 3EJYC 5DD3H 1TMCB 2A6IB 3GK8H 4PY8J 5DVNA 4WWKB 1DN0B 4L9LC 4JJ5A 1U8JB 3TF7C 2KUTA 4XVJL 3I02A 3V5KB 3WFHA 5I73B 5HHOA 4GG8B 1JPST 3JV6A 3JWDC 4MAYA 5DC4B 5H35A 1FYTE 1OTUC 1KCVL 4K9EC 4AIZB 3RWCB 1D5MA 4KK9D 2G60L 3JV5A 3BAEH 2QSCL 2IADA 3MLVL 4LDOB 1UACL 1CFTB 2HKFL 1SM3L 5CLWA 3QUZD 3X17A 5IBTL 3LDBB 2UZIH 5GGQL 1SM3H 1S7WA 4U0QB 1U8NB 4NN7C 4PGEB 3GK8L 1X5KA 3SGKA 5I71B 5LAXB 4UTBH 4QCIA 4P23A 1OSZB 1JE6A 4ZXBB 1RURH 4Y16C 3CFCL 1H8NA 2DQFA 2AJVL 1RJYA 1TVBB 4DJMA 2OYPA 5HY9A 1Z5LB 2YPKA 4XWOC 3E1F1 1GOGA 2AEPH 3VFWB 1KNOB 3BP7B 1LD9A 1JCKA 1V3LA 3OB0K 5AG9A 4L8SB 4HJJH 2VLME 2GSGA 2XXMB 2VLRA 2LVCA 3WV0A 2HFFA 1UKTA 3NZHH 1U8KA 1YZZA 2Q7NA 4V1DE 4EI5B 5HHQB 1Q0XH 4M9OA 1GC1C 3K8LA 3U30B 4LLYB 3R06A 4MVBC 3HUJA 3U9PH 3R0NA 1NAMA 4I0KA 2A74B 3BIAX 2VSCA 1KJ2H 3CVIH 3OV6A 2FH8A 2VUYA 3IVKB 1OB1A 4OIBA 3PGCB 4RA0C 4O51B 5HVHB 4OZHE 1NCWL 3KPPB 1NBQA 5TDPB 1MQ8A 1YJDC 5ALBH 1LK2A 5INDB 5AUMA 2A6KA 4J23A 4U31A 4LCUB 4PY7A 1FVDA 4XNUH 3GKWH 5CP7A 4KRNA 2IWGA 2UWEA 3RVVC 5ESQB 1JWUA 4L1DA 4FQQA 2BOCA 4HGWB 5CKAA 4LAQL 4YGAB 3MLPA 1JGEA 4G9FB 4FQIL 2GY5A 3PDOA 1Z9SA 5KS9B 3QZWB 4U1NB 3WFDH 3DRTA 2LTQC 1GC1H 4JZJC 4LLQA 1ZGLP 2VLKE 5F9JA 5CSZA 1M7XA 2X89D 5CGYD 2Q8BL 4HFUL 3B9EA 4BKLB 3L3HB 4FOMA 4L8DB 1CXIA 5I1LB 4DGYL 1MHEA 4LSRL 4C56A 1DL7H 2DMBA 4FQCL 1N0LA 3GI8L 2EDYA 1FNEB 4Z0XA 5B3JE 1R5VA 2EXYC 1OAUL 3AVEA 4JDTH 4U6XA 1HCVA 2OR8A 2XICA 3UAJC 4F7EA 3D3VD 2W65B 4QF1B 3MTRA 1RZIB 2XPGA 5DQDH 3SDXF 1EZVY 5ICXB 3D2UD 5FYJL 5HI4D 3CDYA 1Z3GL 5E8NA 2ICEA 1P7KB 1YN7A 5IESH 3MRGA 1U3HB 4GAGL 2V5TA 2VZOA 5DVLA 1CXKA 2XA8L 5DD0H 3VFRA 2DDQL 1XCQA 1NFIB 5D2LF 4PUBH 3OF6D 5HI5D 1T7XA 5BVPL 3MBEC 2FIKB 4DN3L 2YD1A 2P5ED 4OF7A 1F6AB 4PJ9A 5F89B 2ORBL 3X14A 4YNYB 1T20B 1YJDL 3VFUB 2VC2L 2XA3A 1IAIH 4Y5XA 1ZHBA 3BPNC 4YR6A 1BD2E 3QFJB 1IKNA 1XR9A 4H8WH 3OKDB 4WW2A 2GJ6A 3QJFB 4MD5B 4NZTL 5JOFA 1A1OA 3LQMA 2X4OA 4X4MA 1MFAH 2H1PL 3CFBA 4I0CC 3QPXH 1U6AH 3MGTA 1A64A 2OM5A 4GMSH 4ZO7A 1T0MA 3HPJA 1EDQA 5ICZA 1MIEL 1OW0A 3O3DB 1YUHA 3KPMA 1EAPA 3MCG1 1WIUA 1HKLH 1QFWM 3T0EC 5D7IA 8FABB 1E0OB 3SE3A 3CXDL 2VLJD 3VH8A 2WSKA 3DXAD 1KFAH 2KQNA 4NQSA 4OCSH 1U93B 5CCKL 5IMLA 4YHPA 2Q3ZA 5JW5B 3MR9B 3RUGB 4P59H 3QRGH 2BVTA 1ONQA 1ND0A 5DJ0B 4NQED 1DQQA 3C08L 2R4RL 3W81A 2XWJB 4M1GH 4NUJB 4WFGD 3KPRB 3F58L 4Z76B 4U1JA 3GB7A 4N0CD 1DEEA 3MNVB 4R6UA 1A7BA 5L9DL 5IMMB 5IK3A 2B5IC 3B9KD 5H94A 4KRPC 5JHDD 1XFPA 4Q97A 1T03L 2KPNA 2A9NH 4V1DA 4LPYA 3RL2B 1CFVL 2R1YA 3T08A 3V0AC 1KENH 2EC8A 4RMRA 1HILB 1GRWA 2DQJL 2PO6C 1AD9B 4ENED 3SCMC 3GSQB 4PJDA 2ZSWB 4JCLA 2IAMD 4Y7MA 4WEBL 5FM4A 2BNUA 3P4OB 2GCYB 4JO3L 4UT9H 2J8OA 1AJ7H 1TZGL 4Z7WA 3SPVA 1TQCB 3BKJL 3P40A 3C5JA 1S8DB 1DDHB 3JUZA 4N90E 1WWBX 3BGAA 2D9CA 1TJIL 5IHZA 2V2TB 3EO9L 1NC4B 2EKSA 5DJ2A 4U1SB 4NNPL 1D9KA 3KJ4B 3TBYB 2NYYC 3LKSB 1YEIH 1DQDL 4OZGA 1KCVH 2ADGA 4DTGL 1AIFB 1WBXA 6CGTA 1JZ5A 3CC5B 2J6EA 4DN4H 4KUZH 1QSZA 4XMLL 1EVTC 1A7OH 5C0CE 4HK3N 4UBDC 1Q0XL 4K3JL 2YA1A 1RAMA 3HZMA 2APVA 3QFJE 3MRHA 1CQYA 1EFQA 1NH6A 1RK1B 4ODXB 4NKDA 1ZLWK 3QUMA 5D6DC 4LVNC 3QWOA 3HI1A 2ED8A 5FF6B 1RURL 4UQ3B 3CFKA 5IKCB 3ESUF 2D4FA 4NWTH 3VWJA 1HE7A 5I8OL 3UROR 3ERYA 2CIKB 4L3EA 3TM6A 1S5IH 2HVJB 2R0KH 1K4DA 1HQ4B 3LN4B 3TBVB 1GGCH 2YPKB 3CNKA 4OCRL 5BS0B 1KCUH 1I8MB 5DMGD 1RK0B 1Y0LB 3BMVA 1ZMYA 3C9NA 1VGEH 3BE1H 5A2JH 1D5IL 2B4CL 3ARDA 3QHFL 2O5ZH 4XC1H 4QRQB 3GI9H 1CZ8L 5EUKB 2G60H 1ZLSL 2C3XA 5E2VH 3VI3F 5KS9E 5GGUA 4WDIB 1U42A 1PYWB 4OGXH 2X4NA 5D70H 1ZVHA 3RVUC 4HHAB 3O0RL 1BBDH 1OGTA 1H15A 2NTFA 3QG7H 5E5RB 3S36X 3OGOE 3VH8B 4DKAA 4Z7UB 2LABA 1MQKL 3JWDL 1IQWL 5I16A 2XZQH 4R97C 2Z9TA 2D0HA 1AJ7L 1TZGH 4H0IA 2HFTA 4IRJB 1M4KA 3O8XA 2J3SA 2YHGA 4C54A 2EYSB 4XVTL 5DJ6B 1NDMB 5CGMA 4HH9B 3S35L 2P5EA 2CQVA 1JZ7A 3F58H 3N9GH 4P2RB 3O6ML 1DR9A 4XXCA 3X11B 3FZUD 3HPLA 4PJCF 3QUXA 1F6LL 2R4RH 2YBRA 2RFXA 1AR2A 2EC9T 5CAYB 2X09A 5I8CB 2H41A 2NY0D 1MVFA 4HK0B 1HXYA 3ZDXF 5IESL 1RUKH 3QQ9C 2W9LA 5ADOH 1RZKH 1BFSA 4KWUA 5D7LE 3NCEB 1RVFH 4OUOA 4BKLA 2XZAH 4QWWD 4Y5YC 1FGNL 3D9AH 4X6DE 2XWBB 4LDLB 4C59B 5IEHA 1FNEA 5DC9B 4KVNH 5E2UH 4YHKH 3DARA 1OAUH 2ADFL 1P7QD 4J2XA 1QLFB 4JZJA 2DD8L 3MXVL 4GKNB 1QYGL 5F7NC 4D9QE 3PQYB 1QNZL 4GAJL 4LSVL 4Z7WB 3SPVB 3RU8L 2X4PA 4JFOA 3ELAT 3A6BH 4OLEA 3LS4L 5AYUL 2NLJA 3SO5A 2LAAA 3MLUH 3RTQD 4GXVH 4H5SA 2Y1VA 4G7YL 4MSWB 2OL3B 3TF7A 4RQQA 1Q0YL 4L5FL 5T1KD 1NFIA 4GXVL 3V6ZB 3L5XH 1C1EH 4MAYC 1FNFA 4KHXH 1P84K 4FQJH 4AENA 3BQUD 1PBYA 1CU4H 1QBLH 4NJ9L 4PJGA 3IDGB 5T5NF 3ZDZE 3ULUH 5MEPB 4YDLB 3ULVF 3UTQA 1OGAB 4NQVA 1YEGH 2Q8AL 4XCCH 2QV2A 1NCWH 3P73B 2V7HB 1FZJA 4P23B 3UJJH 5J0BA 5E24E 2YXFA 2WLZA 1B2WH 4DUXA 2GFBA 1BVZA 3RGHA 5AZ2H 5C08B 3FRUB 4HZAA 3HC3L 3K74B 5HDBE 3FN0L 1P9MC 1SMAA 3QNZA 4PRAA 3G6AA 4HXAH 5L2KE 5C0IB 3DYOA 5T1LB 1T1XB 2UYLA 3OKKB 1RZKC 1X6NA 3OB0H 3NZ8A 1KFAL 3VDBA 1UWGL 1YECL 3FL7A 4HFUH 1E6JH 3NTCH 1EHLH 4MAUH 4OLXH 3RDTB 4DKDC 3BIBX 2GYSA 2HVJA 5DRZA 4XZUB 2AJZB 5BZDA 5FGCE 3WNOA 5SWQB 4OLVL 4OKDA 5ISZB 3CFEB 4ODWA 2G75A 1CK0L 1XMWA 4XNUL 3NABL 4O51A 1KJMB 1TJGL 5IK3B 5H94B 3S6CA 5E4EC 1TVDA 1MREH 4NRZB 1A0QH 4AM0A 1REIA 1I4FA 4ORGB 1OAYL 1QA9B 1XF2A 4MJIB 4WHCA 2BOCB 4HGWA 4XPBL 2NMSA 3SDCD 5DUBB 4XPTH 4PG9A 5E94A 3QYCA 4OUUA 5F8RC 3S88H 3VW3H 1T1WA 5DQJA 1EJOL 4ZDHA 3VFSB 3QO0A 3K8MA 3IJSB 2OSLB 3ZKXC 4KKAC 2P5WA 3BKML 1MPAH 5JHDE 4XP9L 2UWEF 1N0XL 4NCC2 4PJBB 4ELMB 4ZFOL 2ZUSA 4HC1L 4R7DA 3HI5H 1KGCE 1I8IB 4P5KA 1D5BB 2H3NA 5IWLA 3FCTA 1YPZF 4Q0XL 5J9PB 2NY5C 1A5FL 5DMGC 1B0WA 4MJ2A 4GJTB 4HWBL 1S7XB 1INQB 1OT1A 3GMRB 4CDGC 1JRHH 3S5LB 2C3GA 4HKJB 1WT5C 5E6YA 4M6NL 1T5XA 3QO1A 3JBG7 3DMMD 2Q8BH 4L4VB 4I77L 4UU9B 2AJUL 4PRPD 1R5IA 5C2UB 1U9KA 1G6RH 1FLTX 1MCSA 1NC2B 1SJXA 1T7VA 3H9HB 3HB3D 3I6GB 1FL6A 3O9WA 1N5YL 1F6AA 2H45A 4MNGB 3W9EB 1G1YA 3FQNA 1GZQA 1T66D 4GKNA 5KW9H 3QUZA 1MJJA 4HKXB 4HUXB 1IVLA 3U36A 1VA9A 1DEDA 1LEGB 2FB4H 1J0KA 4JFDA 2VB5A 3N1GC 3ZKMD 5B4MC 3NCJL 4NDMA 3QFJA 4F58H 4BK4A 1KSRA 2MCPL 1IGTA 4MXVE 2B39A 3GNML 2X4UA 4I48A 1WWWX 1A6AA 3IXAA 1DBKL 5ELIA 1G6RA 4HT1H 4OF6A 2MKLC 2Z4QA 1I7RA 5IKCA 2GK0B 3BSZL 3FFDA 1HNGA 1R3LB 4K7FB 1T0MB 4S10A 2IQ9L 4ZUTA 5BRZA 5FCUH 3GUTB 5C0NC 3FO9B 2AJUH 5SX5H 4PRDA 5JNYA 4Z0BH 1S9WB 2D7MA 3BHBA 2I24N 5FO9B 5BS0A 4HIIB 3RY6C 4RAVB 4LFHD 2EXYD 2NW2A 2OTWA 1UM6L 2X10A 3RTQA 1QP1A 3EOYG 4U05A 2CUIA 1FFOA 4R2GB 1N26A 4ZPTB 3VDAA 4F3FB 3WD5L 3MLYH 4Y88A 4RDQF 2N7AA 3EYVA 4MCYA 1AGCA 2XQYG 2ZOLB 1FVDB 2Z91A 4OJFL 5CP7B 3BQUA 1U8OB 4ORZC 3L3IA 3NGBC 2W0KA 3L3OA 1Y18A 5C1MB 2X70B 2E3VA 4PRBB 3FT2A 3CPLA 4ZOEA 1KIRB 2ENYA 3MACH 4X7SL 4U49A 1LDSA 3BEWB 5BQ7A 1OTTC 3AREB 2G9HB 1S7SB 3QUYD 3TJHC 1VKXA 1HCFX 4LLQB 5SWSE 1YC7A 4GSDL 4BSVA 1N2RB 3MUGA 3SDAB 2NY2C 3LEXB 3BZFB 5DJ6A 4NT6B 4NZUL 1BOYA 1EGJH 4G6JL 5IBUB 5CP3H 2ERJB 2A77L 1MRCL 5LCVH 5T3ZL 1R0AH 5DRNA 4EI6B 1NDGB 4WI5A 4DW2H 1K8IA 2H2SD 1S7QB 3RKDD 4MA1B 4I18A 2O5XH 4ZFZA 2Q20A 1J0YA 3BVNB 2ZUQC 3PXHA 2R23A 2PYEE 3IFOA 4XP6H 3H7BB 5HYJB 4MVBD 4CU6A 2PO6A 1MEXL 2D4DA 3V7AE 4JFFD 3CFDA 4YE4L 3DGGB 4L5FH 5DHVH 2EZ0C 3LSOA 3TPUA 5GS0C 3MLZL 1TPXB 3KXFB 3L5JA 5TE4H 3DIFB 2NZ9C 2BERA 4A6YA 3C6SA 1FAIH 2FGWL 1KIQB 2DI9A 1YECH 2NTSP 1TVHA 3WIIL 4IRSD 4F15C 5F89A 2I07B 4OM0L 2AQ1A 4KMTL 2A77H 5LCVL 1E4WH 1IZJA 4KAQL 5GSRB 5I76B 2I9LB 1RUAH 4LHUB 1A6TA 1X5XA 2X4PB 2J6EL 3OB8A 4XWGL 1RMFH 1QFUL 1FNSL 4ZFGH 4RGMB 4JVUA 4WW2B 1C5BH 5I1AA 2GK2A 2X4TA 4YK4B 3T2PA 5KG9B 1G84A 4X9FA 1X4ZA 3K1DA 2XT1B 5BS0E 4CMMA 2CMRL 2HRPL 3RWFA 4N5UA 1JIBA 3OQ3B 4R26L 1HIML 2YSSA 4X99A 2EH8L 2Q86B 4FP8H 3I6GA 4JHWL 2X9WA 3MLTB 1LO2H 5JMRA 2HTKD 5EO9B 5IMLB 1MELA 4YHPB 1GXEA 5J6GA 3B9KC 2X4RA 4Y19A 5F7MC 1IGCH 4EUPA 2MPAL 2VE6B 4OF5A 5D5ME 5FA4A 1RK0A 4POZD 4DZBB 2MOVA 4JFDE 4AYFA 5BVJB 5B4MD 2NQCA 2MPAH 4D8PB 4M43H 1RPQA 2DIBA 2X42A 4CVXA 1N3NB 2HN7A 3BSZH 3L3DB 1OT2A 1P4IL 5D7SL 5JXAL 4NZRL 1ZT1B 4MJIE 5GXBB 4FQXB 2ADFH 2NY6B 5TF1L 3T0BA 3DECA 3H7LA 1XGQA 1WTGT 4NQTA 1LMKA 2P5WD 3P77B 5DHVA 4NNXA 3D9AL 5JNYB 2XFXA 1ZLWH 4A2LA 3U4BH 3AGVA 3MRLB 4BH7B 2ZNXA 3GSUA 1WCBB 3K7UA 1B0RA 4Y4KC 4KQ3H 4RAVA 3O3BA 1T89C 4XP5L 4JRYD 1IAKB 1XIWD 2VLLA 4IRJA 4M4RA 1AKJD 4M62L 4OIIH 3WFCH 5BOPA 5IB3A 1AY1L 3RNQB 5E8DL 1SYVB 3WEXA 1JZ8A 2FBJL 3ZTJH 3IF1A 5CZVH 5EC1A 4S1RL 4JFEE 1S8DA 5CJOL 3ILQC 3ARZA 3X11A 1AKJB 5DEZA 3QUXB 3PV6A 4ONHA 3RKDC 1A14L 3FB5A 2P45B 4G6ML 1QLRB 1P69B 1ZV5A 3KGRA 4OCWL 2SEBA 4J4PD 4LCWA 3RVTC 4GW4A 5BO1H 1JV5A 1QSVA 1MFEH 3ZTJG 5B8CB 3L5WB 5DTFA 2MHAB 4DZ8B 2BC4A 4KC3B 2P5WB 3D6GA 2R69L 1JF1A 5I66A 5I75B 3OXSA 4TQEH 5J11C 4AEIL 5IQ9A 3LRGA 4QRSB 5ALCL 4E0RA 4M7KL 4OQTL 1RFDH 4ZPVB 3LOWA 1DP0A 4M1DH 1NLDL 3HZKA 5F1IA 2YA2A 2Z8VC 1PX4A 1YEEH 1CG9B 3D39B 3THML 2I9TB 2VDKL 2O5XL 4CMHC 1KTDA 5FAAA 2OK0H 5JLZA 3DURB 5HVFB 3L5IA 1G9MC 1FV1B 1GGIL 5JW3H 4LSVH 6FABH 5J13C 1BMGA 3S5LA 1BJ1H 1U95A 4BFIB 1CLZH 3VFVB 4TSBL 2NR6C 1EEUA 4JFQB 1QO3A 1OP9A 2AJXH 1FNAA 4OD2B 2EO1A 4YHZH 5ACZA 2CIKA 4L3EB 2UY7A 3B8SA 2XG5A 1HDMA 3VXNB 5JW4Q 1D7FA 4J3VA 5GSRA 3QIUA 3U36B 4NQEA 1UH4A 2V2WB 3O4LD 4PD4J 5J1AB 1NAMH 1UENA 1UYWL 3FB8B 4F33B 4P2QA 1NBZB 4E41A 3MRCA 4H20H 1T21A 1AI1H 4B50A 3I3DA 4PGCA 4PBVC 3VI4F 1CXEA 4JRWA 5SWZA 3O2DA 2WLYA 4U1HB 1TENA 1OLZA 2DQTL 5KVMC 2WWKT 1EPFA 3MV7E 3MROA 4NC0B 4PJGE 5DMKB 3DETD 3BHBB 1DQDH 5F7EL 3K46A 1F58L 4DFHA 4NHCL 4MMXC 5I18H 3EJYD 5KSBE 1JNNL 4Z5RA 1JHTA 3G9VA 3EHBD 3RWHB 3UJJL 3BP4B 4JFFB 5I19L 1WBYA 1DCLA 1FFOB 4ZPTA 4F3FA 5CIPB 1KBGH 4L1HA 2Z8WC 4BQ6A 4Y4KD 1IQDB 2OI9C 3S9DB 4ODVL 4P2RA 2IC2A 1C08B 3IFNL 2VLRB 1MJ8H 5I2IA 5E2WH 5D5MF 3LEYH 1W2KT 3ET9F 3PF2A 1GSMA 4UT6H 3C60A 5DUMH 1EO5A 4ODUB 1A7RH 3IFLL 3UBXG 3P0VH 4S0UC 5FHAL 4HZLB 3T0AA 3EZ8A 3IDNA 3SDAD 1JHKL 4Y8DC 4I77H 4P4KA 4PJ8C 1MHPL 3S4SA 5EU4B 1G9EA 4O58H 4NKMB 3GSUB 1UXSA 3FONB 3NFPB 1IFHH 1OAZL 4NZTH 3ARDD 3RZWA 4P4RA 1EO7A 3VD4A 2IBBA 1EV2E 1CI5A 4FP8L 4Z77B 4RFOL 4XAKD 2R8SH 1I9IH 3BI9X 4NRYB 3EYFB 2UWEB 3HA0A 1FO0L 3MBEA 2BSED 5E1AA 1EEYB 3BGMB 2O5YL 1A1MA 3C5SB 4JPKL 3S3JA 1H3PH 5FOBB 43C9A 4OFIA 1TETL 4GLRI 3H6JA 2MSPA 4LPUA 5BZWA 4HDIB 1U36A 3HG1E 3QNYA 4X6FA 4DZ8A 5DLML 1CF8L 4KROD 1ZTXL 2HTLC 4KI5E 1DQTA 3M1BB 3QIWB 4RGNC 3MV7B 5DQDL 3G5YB 1NMAL 3RVUD 2I9LA 4KMTH 1LEKA 1IL1A 3K4ZA 2HAZA 1LQVA 3RWCA 1FL6B 3O9WB 3S8WA 4QEGA 3H9SA 1OVZA 4OB5L 1L6ZA 4FFZL 1KTDB 1FVEB 5E6IC 1Q72H 2Z93A 1QBLL 1GPOH 2H9GA 1AGEA 2HT3C 2MTPA 1JPGB 1C16A 5KSAC 3DV4B 4TOYL 3MODH 4KQ4H 5IVXE 1NCAH 2D9QB 3AXLB 3MRGB 4PRAB 5CEYA 3ULSB 4QYOA 1N4XH 1FFPA 2C3WA 2YSSB 3FOLB 3QIBD 3HG1D 4FTVD 3GI9L 1I9JH 4WO4B 3QNXB 3MJGX 4MXQA 4NJAH 1II4E 3RDTA 4JANB 1MOEA 2AK4B 3RPIA 3WS6C 2DM2A 5C0EB 5EU7C 4EUPB 1SVZA 3L9RA 1MFCL 3EYOA 1N8ZA 4K23H 5C9JB 5D7JD 5DFTA 5L2JB 4OGZA 5HSFA 5DD6A 4J3XA 1CXLA 3S34H 5F21B 3LKOB 3TJHD 2VZ3A 5F6IC 5EUOA 1OTTD 4UBDD 4TVSa 4W68A 4RFNC 3EYVB 4MCYB 1K4CA 2CIIA 3EFDH 1G0XA 4O5LH 2XTJE 4ALAL 4JFXA 3LQAH 1OAZH 4FFWD 1QHPA 3WJJC 3UMTA 3HNVH 4LPVA 2YRLA 3U7YL 1W72A 4XCFL 4C57C 5GIRA 3PIQA 1RZFH 4LEXH 5DHYB 3BP4A 4JFFA 4WTWA 1NCBH 4P46C 3ARBB 1OAQL 2WQ8A 4ZUUA 3DX6B 1IM3A 1HHHA 2Y25A 2VDMH 4JM2B 2BSTA 4MA7L 2AXFA 2V5YA 5MP6H 3MRFA 4PB9L 5D2NC 4KROC 5FHBL 5ESQA 1CFNB 1KB9K 4ZFZB 5KAQG 4CJ0A 3RZCD 5C6PB 3EZJB 1BBDL 1FSKB 1N59A 5ISZD 4YXHL 2IAMC 3TN0D 2XTJC 1IILE 3U0PA 1ZA3B 3SDDB 3OXRA 3EJZD 5GQBA 4D9RD 1T0PB 5JR1L 1HINH 2ZUWA 4WFFE 5KSBB 2ESVB 3JV4A 3STBA 3GSRA 1YDPA 5INCB 5DK0B 1BD2B 1R5IB 3ZTNH 1S7TB 4F9PA 5E7FA 4E0RB 3V6FA 3RWEB 1NC2A 3H9HA 4WUKL 4D2NA 3LKPA 5DJYB 5ACMA 2OJZH 5T1LD 1TVHB 4F7EB 2EDOA 3FQTB 3IDUA 5DMYA 3W0WD 2ADIB 2H32A 1JBJA 3QDGB 3HNSL 1R24B 4KKBC 4PP2B 5FYJH 3BDBA 3KYMA 1CFSA 4FMKA 4MXWH 4O5LL 5DVOA 4HUUA 4LLAA 2DKSA 2X1QA 5FOBA 2BNRA 2X4QA 4JQXA 2GSIB 4YHZL 1OGAD 5L0QB 5TQ2H 3E8UL 4HC1H 4LKCA 3M1BA 3QIWA 4LNRB 3IGAB 3ZYZA 1MRFL 4D3CH 5HVGB 3G5XB 1G7LB 1A7QL 2Q86A 4M3JA 2Z0BA 3MLTA 5DUML 2R1WA 4GBXA 1T83C 2OTWB 3RTQB 2R56L 3U2SA 4GRLD 5JO5A 2N4IA 4OFKA 2CXGA 4PJIE 4NUGH 5DGRA 2J8HA 4EXPX 3FMGL 3QDJE 3MGTB 3BN9D 4NN6B 1T1YB 25C8L 4NKDB 4JY6B 4LOUD 4MQ7B 4HC1A 3ARVA 3D48R 3H2WA 3FKUS 4GT7A 3O9WD 4LLVB 1TQBB 2XZCH 3CDCA 4BFGA 1ZGLA 5K9JL 4JHBA 35C8L 2EE3A 3RVWC 3BPLB 4RFEB 2ID5A 1PY9A 1FL3A 2C5DC 3WDJA 3KPTA 2CUHA 4NNXB 3ZSSA 2VDML 5DJ0A 4MCZA 4DUVA 4OZHB 4HF5H 2Y07H 1B0RB 4ZD3L 3QQ3B 4TRPH 4RRPG 4WI3A 1S7QA 5FM5O 5DD6B 1EFXD 4WW1B 3GSXB 4Z7NF 3GFUA 4HAFA 4WV1C 4ZYKA 5EDXA 3TBWA 5HGAA 4K3EH 4U1LA 3RQ3A 1EHNA 3QB7C 1BIIB 3H7BA 1BFOB 4OV5A 1AKJA 1CR9L 4D94A 1DVFC 4E42B 2J12B 3TC9A 2AJVH 4XCYB 2XRAL 4O2CA 2VXVL 4NBYB 1D5ZA 5EU4A 2B1AL 2MFNA 3RIAK 2A73B 4IRSC 4YDIH 5CWSA 3QDAA 4Q9QL 3RWJB 1XGUA 2X6MA 4X4ZA 2K7QA 3GSWB 3CSPA 3DIFA 4PRHE 5L6YH 4JKKA 3L5WA 3EOAA 1CBVL 3P4MB 1BIHA 4TULL 3L3HA 4I5BB 4PJ5E 4HS3B 2HJKA 4XHJC 4Z0XB 1CICD 3BN9C 3FQWB 3HZVB 1S9XB 3H9SD 3MO1B 3QUKA 3L5XL 3UX9B 2OTUA 1N59B 3UTPE 4WEBH 1LP9F 2VWEC 4MAYD 4XRCB 2ICEB 3REWA 1ZANL 3QHZL 3DX8A 4JFPA 3TYFA 4XI5C 3VFMB 3TBYA 1IGMH 4TQEL 4HUKB 4L8CB 2EDBA 3T0XA 1SMOA 1A9EB 4Y4FD 2FL5A 4ODVH 4X6DF 1X6LA 2CKBB 2FEDC 1R3KB 3TCLB 2X05A 1E4JA 4HUNB 5J3HD 3NFNA 1O0VA 4N0FB 4DW2L 1KXVC 1T20A 5IVXA 3E3QA 5CZKA 1KYOJ 2PW2B 1VEOA 5DJDA 4RIRA 1V7NH 3MSPA 5CJOH 3LN5B 2VO5A 1ZHBB 2H9GB 3OKOB 2FX8L 4G7VH 3FB8A 4U1KA 4PJCE 4F33A 5GS0H 1NSNL 4CNIB 1J1OL 3U9PL 4WY7H 2BHZA 5F8QC 1RHFA 2EEDA 4MD0B 1YMMB 2VXVH 3WN5C 1PG7X 2WINB 4FQXA 4KK6C 1I7ZB 3VWKB 4XP9H 2ZZUT 1MAMH 5E99H 1XGQB 3K4AA 1IT9L 3IDGA 3P77A 5E5MA 3N9GL 3PHOA 2OXGA 3IGAA 1FQ9C 3PABA 3SDCC 4ZFGL 4YH6A 2FX9H 1NC4D 1Y0LA 3MJ7B 2H1PH 5F9WB 2F5AL 2V5SA 1RUPH 3VI3E 1A3RL 2YKLH 1RUMH 1MCDA 1OQOA 3LKOA 3FTGB 4HW6A 2PYEB 1IBGH 4NQDD 5LXGH 1DLHB 1MRCH 2Y6SD 4HHAA 5T3ZH 5I1KH 2I5YL 1OGTB 1BBJA 1UM4L 4QHNA 3S37H 1IKFL 1XGPB 3BDYL 4NNYB 4YE4H 4K9EH 4PDCE 5CBAB 4LEOB 1CD0A 2PYFB 3QR2A 3T65B 3TCXA 1Z9LA 4NN5C 4DGIL 1KG0B 1JV5B 4Z7OF 4JM4H 4YUEL 1K6QH 4JKPH 3ARBA 4ZUUB 3NN8A 3TVMC 5CEXB 4OBRA 1U8HA 5L88L 2OR7A 5I19H 3EDDA 2VDNH 2FYYB 3D18A 5J6HB 5D1ZD 4QRSA 1Z3GH 3U0WL 1NGYA 5JXEA 1CDGA 5ID0B 3BEVA 2GJJA 3BO8B 3BPOC 3QXWA 1MFEL 4WUUE 1J1OH 32C2A 4NC2B 4MQXC 1HHIA 1QKZL 1CGSL 2D03L 1J8KA 4HJGA 1BIIA 5TQ2L 2L7JA 4OFVA 1QA9A 4L9LA 4KAQH 1U3YA 5E1AB 5C07E 1IGYB 1DBBH 3AUVA 2A0LD 5KSBA 3DXAB 4Y1AE 1UJ3B 1NGQL 3S96B 1FAIL 2QR0A 1G7IB 1Q94A 2RQ8A 4CVWA 1MHCA 5EBGA 1P5UA 1E4KC 3QNYB 1LO3L 1UYWH 4FZ8L 2EDNA 1W8OA 4WRLA 4B53A 2MCPH 3MLRL 1Q9WB 2NY5L 2H3NB 2LAGB 4MWFA 3OR7A 4Z18A 4NUGL 4P2QE 4RX4A 3VW3L 2DQDH 1WWCA 4WWKC 3GMOB 1SJEB 2BFVL 1UQSA 5LGJB 3QFJD 3QH3B 4O9HL 2X9YA 1DUZA 5I73C 4K3DH 5HHVL 1P4IH 3MLXL 2ARJA 4YIQB 5EWIL 5DJXA 1KCUL 4HIEA 1AHWC 4PFEA 4Y1AD 1R3HB 2YK1H 4BYHA 4I0PD 4XX1E 1F97A 2JB6B 1X5GA 3OPZL 5CD5D 4N0UB 3KDMA 2W38A 1RIVL 5F93C 5I74C 1A3RH 1FZJB 2ZUUA 1U2HA 3W9EA 3L5HA 1XIWA 4ODTL 4OQTH 4YXKH 3ARFA 2PW2A 1WFTA 4G5ZH 5DJDB 1RUKL 2NY0C 1K4DB 2CO7B 3OG4B 4W4NA 2DKUA 4OZIE 4RSVA 1UB6B 1OAKH 2R9HC 3PL6B 1FNGA 3JVGC 3EYSL 5I71C 1VFBB 3CU1A 4XVSH 4QY8A 3AM8A 4O4YH 3DROA 4C55A 5IW1A 2X1XR 3G08A 3O6FD 1DTUA 4OBSA 5EUOB 3LPWA 5F3BB 3FFCB 4UTBL 1FE8L 4NQCA 2X44D 1RMFL 1H15B 5GHWH 2C26A 4Y19D 2XWTA 3QDGE 4I3GA 5GRXG 3QQ4A 4FTVA 3PJSA 4YDKL 4PLNC 5FKPA 4ISVB 4EI5C 5EORL 1FC2D 3E6FB 1ZT7A 4Z7QF 2HT2C 3T04D 5DZOA 1A7PL 1S3KH 1TJIH 1HZHL 1MHHA 5I1DB 1NDMA 2AXFB 1HSAB 3FB6B 3L3IB 1RHHB 2GT9B 3SCMA 1BHGA 4AH2A 1KPUB 3LKQB 3CVHB 2A73A 4BZYA 4DK3A 3S97C 4XPBH 3AC0A 4N8CH 3ARGC 4ELKA 5I1KL 2PYFA 2UZXB 4HK0A 1VKXB 4EDWL 1T1ZA 1G6RL 4JQVA 2YEZA 5FUCC 3EDKA 3GJEB 1OWWA 3Q5YA 1VADB 4ELMF 4X80H 3BWAB 1QSEB 3QWQB 2RCSL 2Y36H 4ZS6C 5H2BB 3MXVH 4ELMA 4TN9A 5SX4H 5DRNB 2J8UE 4OF8A 1Z9OA 1BQHG 4FQLL 3MRJB 3GSNA 3BO8A 5DMJB 2LTQB 4YHIA 4FA8A 1SVCP 2ZOKA 1BJMA 3VDCA 1KUMA 3OR6A 3PWLB 3MV8D 4O2EA 3SDXE 4HJGB 3VXOA 3VXRB 3GRWH 3MRDB 1IT9H 3I6KA 3IXTB 4YBHA 2XRAH 1RIHL 5I15L 1E6JL 1PZ5B 3GMRA 3C08H 4ODSH 1GIGH 1R3JB 4S1SL 1EEZB 3LRHA 1ZWIA 2JELL 4IOSD 1A9EA 4HV8A 3KYNA 3MUHL 4IRZL 2VZTA 3V6ZA 1R3KA 3QUMH 3JXAA 5TJWK 1EHXA 4F7PA 4N5EA 5CKGA 4OZGE 3PDGA 3RIFF 2I07A 3SY0A 4PJGB 1FJ1B 4JANA 2N1KA 3DO7B 5H35B 1DVFD 4O02L 4M03A 1OGAA 4JY4B 3WFBH 3STZA 1OGAE 4NDMB 4RMQA 2A6DA 5EC2A 4OFYD 5I1AB 5HYQA 1WIOA 1IQWH 1BZ9B 1LD9B 4GOSA 3E2HC 2Q6WB 3MRQA 3L7EB 1WV7T 4WFHE 3H3BC 4Z7WE 2F74B 4YAQA 3P9MB 1X5JA 5IVOA 4APQB 3WLBA 3M17B 3FO0H 1T1YA 5D6CA 1YNKL 5TE7H 2QHLA 2EYRB 2QQQA 2NXZB 4HX1A 4BZ1L 4MMZC 5C0IA 3UO1H 1INEH 3UC0L 2JB6A 1XR8B 4F58L 5C0BD 3F7YA 1XGYL 1BM3H 1NC2D 1YJDH 5E8OA 5C0AA 4QXGL 5KAQF 4L4VD 3K2UL 5KW9L 3HNVL 4OAWB 3WN5A 4GRWB 1UWXK 1VGEL 3PXJA 3DVGA 5I0ZA 3KYOA 3IVKA 3WFEH 4BZ2L 4F57L 5KSVA 4JGMA 1WFOA 5EA0L 43CAA 4N9GA 5IF0A 5EOCH 5E9DD 4UT7H 3CLEL 4HCRH 4D8PA 4GUPA 1VHPA 3CGTA 3WHXB 1I9IL 1X4YA 4JG0H 1IMHC 3GZKA 2IBZY 4GRLC 3SKNB 1BBJB 5DA4A 1XGPA 1KCSL 1HI6A 4WEUD 5HDOA 4YFDB 3BZEA 4YBQC 3U0PB 1FIGL 1ZA3A 1NJ9A 3KLAB 5LJYH 5MI0C 1CIUA 5SWSA 3QZWA 4U1NA 4I9WD 4PG9B 2R0WH 4UDTA 4KK5D 5F9JB 3VXPB 4HSQA 4QT5A 5J89A 3VG9C 1IAKA 2B5IB 5HYEA 1ZT7B 1CT8A 3EOAB 1NAML 2D2OA 1X4XA 3L3JA 1IC4H 1HHIB 3DTXA 3QDGA 3MXWH 1NGWB 3EO0A 4AMKH 3HE7A 1RZIA 2DQEL 2PO6B 3ARRA 3B83A 3SCMB 3CFDB 4TSAL 3FB5B 5I1EL 3G6JB 4G9FA 4QOKB 2B0SH 5C0JB 1QRNA 2A1WH 2DYPB 3GMMA 2HTKC 3DVNA 2PW1B 5F7DA 4Q9QH 5GGRB 5I18L 2GEEA 3RDTD 1HYRC 4NPYB 4IMKA 5FGBA 4YFLF 4HKBB 2YPLB 2CKBA 1U8MA 2VQ1A 4X7TA 4Y5VB 5EPMA 4Z78B 1WZLA 3BJ91 4FQPA 2VZ1A 4XPFH 1JPTL 3U4EA 1LP9B 4HWNA 1GZQB 3V95A 1LO0L 3KJ4C 4LVHC 1LK3H 1P4BL 5EOTB 4S1QH 4N5EC 5ICXA 1RIHH 4AL8H 5I15H 3GJFK 2HVKB 1BFVL 1RZ7H 4JFDB 3QEUB 1KENL 3GO1H 4PRPA 2EIZA 3MRPB 4U1KB 3U48A 3OKEB 4GG6F 4BUGA 1UVQB 3RA7H 5MENB 4JY6A 4KH2A 1CGVA 4KKLD 5JPMA 2YWYA 4PR5B 1BX2B 3TLRA 3WUZA 4WI2A 5FECA 3OTTA 1DQJA 1I7TA 3UYOD 1I7ZA 2MQ0A 3IYLW 2AJ3B 3LCYA 3DV6B 1O7VA 3MV8E 3VA2C 3F7QA 5K33A 4NNPH 1HQRA 1PAMA 2GAZA 2ITDA 4M6OL 4YHLL 2B7DT 4RNRA 4PJEE 3P0YL 2P24A 3BKMH 5FO9A 3SQOL 3DUUA 4XPFL 5GSVB 3KR3H 4DZBA 2HWZH 4E41B 1E4XH 4FNLL 1PQZA 2NNAB 4KUZL 3OKNB 5DJCA 2R2EB 1A1OB 5DEGB 4I4WB 1XF5B 5A16A 3CMOL 4XPTL 2WMPA 2CKBH 1JK8A 2ARWA 1BFOA 2DTSA 3O3DA 1C5DA 3H9YA 4K2UH 1Q1JH 3OKMB 2YD2A 5CHNA 3O3EB 4TUOB 5F88A 1U58A 3MRNB 2VDPH 5D2NE 4GRLA 1MRDL 3BKJH 3T3MF 4PBWD 3QUYC 1ONQB 2VXSH 3GSQA 4WNQA 2ZSWA 3BX7C 5IB5B 3I50L 4G8IB 3EO1A 4OLYH 3SE9L 1S5HA 2VAJA 3ROLA 5E6ID 5ID0A 1TZIB 1K3IA 3QUML 5I17A 1JGVH 1KPUA 1LGVA 1MFDH 2R23B 4P2RD 2HFEA 1JPTH 3FFCD 4KVCH 1FFQA 4Q6YA 3FB7B 4KTDH 4F80A 1YYLH 3C60D 5GISH 4PYGA 4XRCA 2F53A 5IV2A 1M71B 2R29L 2AJSH 3KPRE 3DPBA 5AAWA 1KEGL 3MX0A 1MCOL 4YFLI 4S1DD 4RFOH 3VXTB 3ULVH 3B3IB 3L3JB 1L9NA 5HGHA 5IIEA 4N0FA 4IBLT 3TA3D 4O2FA 1KLFA 4RAUB 4OM0H 4DGYH 3SO3C 1S9VB 4EEEA 1F3DH 4Y5YB 1XZ0A 4ZUWB 1JYNA 2YZ8A 3J7HA 2DLIA 1JP5A 1B6UA 1UC6A 4HV8B 4C83B 2BY0A 5IB4B 3HE6C 3WLWD 2XY2A 1CGUA 4K71B 2BMKA 1YEJL 4TTDC 4OD2A 3C6LA 3QPXL 5FM8A 3TFKA 2FX7L 1D5IH 1UZ6E 2V6HA 1FJ1A 2Y5EA 1AP2B 1J7VR 4HKBA 2OTPA 1U8MB 1YEDB 4JY4A 1SYSB 4P9HC 1Z0NA 3PABB 3QIUD 1VEPA 2J1KA 1WEJH 3KVQA 4UV7L 4LLUA 3ARGD 4OCWH 2ITCB 1KCSH 4UILH 3TBVA 3B9AA 3TNNB 1AR1C 1OM3H 1J88A 2XQBL 4HMEA 4L29A 4YGVB 4KMQA 1O5DT 5AZEH 3ARYA 5HI3C 3V52H 2BVPA 3VXRE 4HCRL 1B6DA 2FJFA 5BW7C 4P5TA 3WXWH 1UB6A 5FO7A 1IAOA 3PHQA 3HR5A 1NLBH 3KPQB 1QSFE 1OPGL 4RDQG 1CYGA 1I8LA 5E8EB 1FO0A 3N06B 4GAYA 5C0DB 2JELH 4KKAD 4X6DA 5HGGS 4O4YL 2GJZA 4M5ZH 5F3BA 3ZYIA 3FFCA 4ONFL 4ACPA 2F8XC 1AXIB 4HLJA 3DX7A 3DETC 4NQCB 4RNRB 3KPNA 1KT2A 3UDWC 3JVGA 4HKZA 1WAAF 3MRLA 5KSVB 5GSVA 5DJZB 1KN2H 1N6QH 2W60A 2GHWB 5GRVK 4PJAA 5C9JA 2IGFL 3T0EA 3P11L 1F4YH 3JWDH 3PP4H 4FQ1H 1XF5A 4Q9BA 2OCFD 5FYLD 3RNQA 5EN2A 3ME0A 2VLMD 4YHYC 4U3CA 3RWIB 1ITBB 5LGKA 3AAZA 1C7SA 3GGWA 4G6JH 5IBTH 5FYKE 3X3GL 3I75A 4I3SH 1HXYB 2F5BL 5ESAB 4G80B 4OCMC 1BVLB 4MZ2A 5DJAB 3LEYL 4NQDB 1J12A 4I18C 2QSCH 1KTLB 2RJMA 5BXFA 4M00A 3TJEH 4PJBF 3PIQB 3NFSL 1VSCA 3QZWG 4PUBL 2Y06H 3IDJB 4WU5B 3UAJD 4M1DL 3CSYB 1CL7L 4ZMAT 3PGDB 1FFNB 1ZS8A 4QRRE 2LE9A 5ITBL 3NZHL 5T3XH 1D6VL 1FGVL 4TUJA 2JCCA 3LH2L 5JPNB 4K94H 5L7XH 2D7OA 3MRJA 2R8SL 2FWOB 1NBVH 1F58H 4WFGE 1IGIL 3B9DA 1TFHA 4MWFB 3OGCA 2UZYB 1HHKA 3G6JA 2HFEB 4G8EB 5IBUG 4O2EB 5HGDB 2VR5A 4KPHL 1FE8H 3Q1SL 4MD4A 1HXMB 3I6LE 4AT6A 4L3EE 4YHNA 4NPYA 1F5WA 1FVCA 4V3DB 4FQ2H 3LRSB 2YMXL 1AY1H 1S7TA 1A3LL 2Y72A 5F70A 1I3RB 4AG4H 5DRWB 3MA9L 4H0GA 1EFXA 3QCTH 1RULH 2ICWB 3I9GL 3BOVA 3FQUA 2O26U 4Y2DC 3T2NL 4NRXA 3QIUB 4JN2B 3V0VB 3WIHL 1ZKAA 4HS6B 4H26A 4PJ7A 2V2WA 3T3ME 1X7QA 3IDMA 3S3SA 2D7NA 3DV4A 1CFTA 5EO1B 2LVEA 5MENA 1UGNA 1OAXL 5KZCB 3FRUA 3GBNL 4RQQB 5LQBL 4HJ0C 2Y7QB 3PUCA 4F37K 5C86A 4CN4A 3KPLA 4XVUC 2CDGA 4EXKA 1FYTB 5D1ZC 3S37L 4G59A 3O3AB 3ZKQD 1P1ZB 1MCLA 1Q9KA 1ZE3C 5T3ZD 2A6JA 5D6CB 2BVYA 4Q6IB 3P0YH 3MA7A 4U7KA 3BXNA 3O2DL 1AQDA 2JF1A 2JJWA 3THMH 1MLBB 1JUFA 1JN6B 1G7LA 3P4LA 5I1CL 3EYOB 1DSFH 1N8ZB 3AB0B 3PJSB 3T09A 2HJLA 1DLFH 1O7SA 5C0FB 1L7TH 5DRXA 3LAFA 4ZAKD 4YGVA 5IGXH 3KYKL 4Y4HA 5T3XD 1GAFH 3DSFL 3RA7L 4YBLC 2EDQA 4LHUG 5I1DA 1T2JA 2VDOL 3O6LH 4WJ5B 3S36H 4ZUVA 4XT1C 1CE6A 5IP4A 3NTCL 2DLFH 5T1LA 1NGZB 3SE3C 4F9LA 3OKMA 4XC3L 1AQKH 4XBEH 1KCLA 3C60B 5F88B 5D1QA 2E7HA 3KWWA 3IDIB 3PV7A 1F13A 1W0YT 5EU6B 2CKNA 1T1ZB 5EUOF 3KLAA 4LCCC 4P2QD 4EDXA 5C0BA 1KT2B 3GIZL 4CN6A 1R5WA 4M62H 1VPOH 4KZEH 2NPLX 1KLUA 2MWCA 2P43B 4PRIE 1A2YA 2XKNA 1AD0B 3E6HA 3CXDH 5EFIB 5I0DA 4QNPF 3TGXA 4GFTB 3QUYA 2DWEB 1FZOB 3DMMC 3DTXB 3MCLL 3MRDA 3SDAC 1INEL 3UC0H 1JWSA 5J9PA 4U1GC 1RJZA 3UTTA 3BJLA 4IS6A 4GMSL 1GZPA 1EEZA 4HLZG 2VABA 1KB5L 5TGBA 5E94B 3D87B 1LO3H 2FR4B 2VZSA 3GEWB 4P57A 4WV1A 1B88A 4TPRL 3LKPB 5DJYA 4XNYL 3P30H 2EXWD 5F7DB 2EICA 1JZ2A 4U1IA 4WVRA 2WBWB 2R0ZL 1A14H 4U0RC 4OI8A 4QRRD 2CUMA 3IU3B 1YMME 4NCDA 5HHOB 4DN3H 4H1LB 3HAEB 1PG7W 2EH8H 4NQCE 3B5HA 4LP5A 2R2CA 5K93A 1SEBA 5CMAA 1MIMH 4TTDD 1OCWL 2W9EL 4JPWL 1IC7L 3P9MA 3VFNB 4APQA 3GHBH 3VFGL 3J8F7 1G6RB 3AXLA 5CEYB 2Z4QB 4D9QD 4ZXBD 2IPKA 5A3ID 3O8XD 3QO1B 4XGZA 5J12C 3HNTH 3ZDYF 3SGJA 3QXDA 3C87A 4WUUD 4JFDD 3FOLA 1GOFA 3HLAA 5IVZA 1LEIA 4P2OD 5F7UA 3DV6A 4XP1L 2JCCE 3QUZB 3V5HA 1J05A 4KHTH 8CGTA 2BSRA 4BZ1H 4NBZB 4YXHH 2EECA 5ERWA 3VE0A 3MZTA 5EO0A 1Z5LA 3VFWA 4QTIL 3RX7A 1OARH 3EOBA 3F65A 3QEHB 4TVPH 3GIVA 1AGCB 3O6FA 1VEMA 2DYPD 5HHPB 2XZCL 3DUHA 4TULH 4UIMB 3IDYB 1NCUA 4NM8H 3QEQB 2VOTA 1U8PB 3FT2B 5FV2A 1NJ9B 3ARWA 5HTSA 3FO9A 3BXNB 4CJ1A 3O2WL 4RBPH 3M07A 3MLRH 1RVFL 2O61B 2DWDA 4KTYA 5MHSE 2XNAB 4KJWC 4X4YA 5I9QB 3O6KL 2OLDA 5HYSG 4FQXC 1F4HA 2NY6C 3IKCA 4RZCA 5CJQL 4XNQB 5T3XE 4Q9RH 2PTTA 3FTGA 4F2MB 5CFHA 1ZEAH 1EEQA 3BESR 3BVNA 4Y1AA 3L3OB 1J8HA 4HIHA 1TZIA 1UCTA 2YD9A 3DWTA 5DD1H 5ILTL 5ESAA 4RWHA 5AAMA 2I27N 5IFJA 1NAKH 5CILL 1F8TL 1S7RB 3T65A 5I1GL 3AMLA 3NCYP 2HKHL 3FO2B 1N2RA 3MUGB 2RCSH 2AJYH 2Y36L 4KJQD 5LBSL 5D7JB 2ESVA 1I85A 5E9DB 2EYTB 4P2RE 2AK1H 1BQSA 1LK3L 5KVDH 3MNZB 5I1LA 5IB2A 5A2FA 4GS7B 4QHUA 4IHOB 3BT2L 3FQWA 3B3IA 2C1OA 4NO2B 1HHKB 2NY4B 4Z0BL 4GH7B 4KJQC 4FS0A 4U6VH 4XNXH 2YK1L 1MCWM 5D8JH 2H8PA 3VFMA 4U6TA 4PP8C 4NZUH 4IIQA 5J11B 2EKSB 1FCCA 5GRWA 3KHOA 3IFPA 3VRIB 1JPFA 4AZ8A 3U6RB 2WZPD 5ETUA 1U91A 3GBML 3IT8D 5CBEA 4QRUA 3W2DL 1JPSL 3OAZH 4XPAL 1DQJB 1I7TB 2V17H 4HPYL 4RISL 1MCOH 3WDHA 1AIFA 3QCVH 4POZC 4Z9KB 1K85A 4X99B 1ZHNB 3SKJH 1KJ3H 5ADOL 4E41E 4QRTA 1CR9H 3B5TA 1FZMA 5GS3A 4YNYA 1OAQH 2PXYC 3MV7D 4DKEH 1RJCA 1UKSA 4QRPE 4ZNEA 3VGHA 3GMPB 3H0TA 4PGBA 3LIZL 5HYSA 3MGOB 5DJCB 1HK6A 2E9BA 2GJ6B 3QJFA 4MD5A 3ALPA 5HHME 3G6JF 4P5TB 1NMBH 1D3CA 3QWOB 5BV7B 1T7ZA 4QHKI 1E28B 4K8RC 2VWEE 4XGZB 1NSNH 1MLBA 3UZQA 1JJUA 3C6LD 2GQHA 2A74A 4KUCD 4JHAL 3W0WA 2P8MB 4OZIF 4LLMA 2EDXA 4UQ2A 4BH7A 3IDXH 1I8MA 3MYJA 5A2KH 3IB4A 4PRIB 2XN9E 4MNHA 2AKRA 1DFBH 4NM4L 3ORJA 2F54A 3MR9A 4MA8L 4MGXA 3BZDA 3H3PL 3LQZA 4LSTL 5DJZA 1I8LC 4UZGA 1QSED 2IALB 4M61B 1XGRB 3QI9A 1H5BC 3MXWL 1JWMB 2LV4A 3NACL 4GXUM 4PY8I 4NSKA 4KKCC 4TTGA 5DWUL 3UEZA 1EXUB 3HMXA 5D1QB 1XGYH 4YBQD 1BQUA 3TN0A 4OFPA 1JWUB 4PLJC 1YMHB 1QFPA 3RWIA 1K8DB 4EN3B 1A7QH 1HHGA 4JRXD 4M7KH 2QQLL 1A0QL 3EFFA 1IBGL 2VL5A 5LXGL 4PRHB 1KV3A 2XFXB 5I16B 4XCYA 5J57B 4GW4B 4CUCA 5I8EB 2Q7YA 1WQVT 3D85A 2J5LC 4N8VB 2XYCA 2MMXA 3PP4L 5D93C 1I3UA 2LU7A 4UMGA 4EBQH 3IKCB 1N6QL 4PLJD 4YPJA 2BNQD 4PJDB 1FFRA 2E7CA 2LU4A 3MOBL 3NA4A 3ZE2E 4PJ8B 4WFFD 1AO7E 5IFAH 2BNUB 1WJ3A 3LV3A 1KEGH 2NXYD 3TNMB 1BFVH 2WBKA 1J8HB 4HIHB 4L9LB 1JYVA 5CD3B 3MV8A 3BRFA 3TP4A 2WP3T 1GZPB 2P4AB 5JLZB 5F3HB 1MPAL 2VITA 4M8VA 4ZQKA 3UBXA 3MJ9H 2F54E 4M7ZB 1X5ZA 2ARJQ 1U95B 3TVMD 3C09B 2DBLH 1H3XA 1G7QB 3FT3A 2Z31A 5IWLC 5GS2D 4NC1C 1CD9B 2RIKA 3HI6H 5DR5L 4D0DA 4XXDA 5DZLA 4L4TB 3OXSB 4JREB 1BQLL 5E6IA 3N50A 3PP3H 1YEDA 3O11B 4HF5L 1FLRL 4R3SA 3PQYA 3HUJF 3LDBC 4TOYH 5I30H 3NFNB 4L3ED 4M7LT 5IVXB 4TSAH 2I9TA 4ENEC 4W6YB 4Z7OE 5KBNC 4X80L 1J18A 2BVPB 3IXTA 5K9JH 1LE5A 2QKIB 3TO2A 3QIWC 4HIJB 3VMOA 3U82B 4I0PB 2YUXA 1EUTA 1YNTB 4ZXBC 3RVWD 4GBXC 2J7LA 2FSEA 2XTJD 3NA9L 3VGAC 3O9WC 2VR9A 3V4VL 3GSOB 4GAYB 5C0DA 4MD0A 2VYRE 2OP4L 1I8KB 4X6DB 5D7IF 3KDMB 1P1ZA 4PJIA 5MEPA 1S78D 3NIFF 4KK8C 4XP4H 5FGRA 3IFNH 4BA8A 3BE1L 3P73A 4ZAKC 2Y4SA 2ZKHH 1T66C 1OPGH 3GJFH 2R4SL 5DDHB 5FO8B 5F7YC 2FEEI 3G5ZA 5HYQB 5CIPA 3ZE1E 2X1PA 3NBNA 1F02I 1UADC 3MLSL 3MJ6A 1CF8H 4HUVA 2AGJH 5E8DH 5C3TA 3IAQA 5IW6A 3TPUE 2V5MA 2NY7H 1YYLL 3MROB 2V9QA 3O4LE 2EIBA 5ENWA 3T4AA 4QHNB 1BZQK 1QD0A 1MCWW 2O61A 5EH1A 3WO4C 4Y4HC 3DI3B 3LD8B 4OCXH 5DRZB 4IMLA 2HMIC 4Y4FC 3O6MH 4WHDA 3SJVB 5F6IB 1UEYA 4PRIA 3GBLA 3IJHB 3NN8B 4YWGL 1RQ5A 1JMXA 1E6OH 1DBAH 1F3RB 2ATPB 2JK5A 3QRFM 4EUPG 1QSEE 5JPNA 5IQ7L 3W82A 1CFQA 2BXZA 2ENSA 1ES0B 3D69B 3NCCB 3VU2A 3EYFA 3HZYA 3ZO0A 2QQLH 4P46B 3EJJX 4PG2A 5C07D 4YEEA 3Q6GH 4O02H 4LBEA 2X1OA 1BQLH 1CD1B 3GJEA 1GGIH 4JPIB 1U0QA 2XY1A 3BP5B 3PE9A 3BW9<