2PO6A

Crystal structure of cd1d-lipid-antigen complexed with beta-2-microglobulin, nkt15 alpha-chain and nkt15 beta-chain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d
publication title CD1d-lipid-antigen recognition by the semi-invariant NKT T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein/immune system
total genus 62
structure length 275
sequence length 275
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2po6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2po6A01
3GSOB 4RFOL 4KVCL 4KK6D 3TVMD 4YDJA 2AI0L 5DMGD 4J3SA 1QPPA 5L88L 5LAXA 3RVWD 3O3BA 4IOSD 1M6OB 1RZ8B 5MEQA 4WFGD 3X14B 5IB4A 5I2IB 1NCCL 5E2UH 1CXLA 4R97B 5BS0D 1UZ6E 5SX4I 3CC5B 4X80L 4OLZL 5KJRL 3EYVB 5BMFL 3SE9L 5TDOA 1J1XL 4ELKA 2H32A 2AQ3A 1I1AC 3S96B 4FFVD 3S5LA 1GOGA 2ZCHH 2V17L 4HQQL 2YHGA 1BVLB 1I3UA 5EZOL 4KY1L 4N1EA 4P48A 3VFVA 3TBYB 3CUPA 3C08H 3FN9A 3LN5B 4M7ZB 2AK4B 2DMKA 1NFDF 5HPMA 1DTUA 1NAML 3GMPB 1LO3H 4OAWB 5E5MA 3KAAA 1KELH 2KBGA 5T5FH 2ZOLA 1CYGA 4O5LL 4BK5A 3INUH 4U1SA 3P4NA 5C0IB 4JAMB 3P0YL 4Y16A 1EAPB 1DLFL 1DQTA 3GKWH 3BKMH 1DBJH 5AEAA 1Y6KR 3KPRA 3ZKND 3P4MA 1MOEA 3MV7B 4XWOD 2AJYH 2GJJA 4OQTA 4YK4C 1JZ7A 3U36B 5I76B 3NIFE 2R2HA 3GSWB 1YEGH 1IJ9A 5F70A 2DIAA 3OAUH 1LDPH 4NNPH 3MNWB 5DFVC 3TYFA 4QRRE 2OTWB 1IAKA 4CU7A 4XNZC 4PD4K 3SDAC 1G7LB 4MNQD 4PBWD 5E24E 3D9AH 4ETQB 4EDXB 5BV7C 3MLYH 4GRWH 5F3HA 3RX7A 1PQZB 2MQCA 2ZNXA 3MRIA 4MDIA 2JB6A 2R9HD 5KSBE 3U7YH 2BJML 2CXGA 3VRIA 3GSXB 5TQ2H 3NFNB 1MI5D 4XVUD 2JF1A 2Q8AH 5DD3L 5C8JB 5E8OB 3BEVA 3JV4B 3QUXC 1U8QB 4NN6B 4YHPA 4Y5VB 4WY7L 3PV6A 1XZ0A 2D3VA 8FABB 2HN7B 1JWUA 1TIUA 2X09A 1CLZL 5KSUA 1JGVH 3LKSB 1ES0A 4MJIB 1YY8B 1KB5A 2FL5B 5FO8B 3FFCE 4DK6A 1FAIL 5JQHC 5EZIL 5FECB 3V4PL 2EDTA 4NQDA 2ARJQ 1TITA 2GAZB 2XN9D 1KIQB 5F1NB 2NY1C 4S1QH 4EN3C 1N8ZA 4Z5RA 3O6KH 3DNKA 1QRNB 1NGQL 2C3XA 4Z95H 3N1QC 1V7NH 4JFEA 2AKRA 5AZEL 3WFCL 1S7XA 3O4OB 2BVOB 5CS7A 1X5FA 1C7TA 1A5FH 2R8SH 1RZKH 4GKZB 3GBNL 3UYRL 3VG9C 2EDBA 4LGPB 1FL5B 3KXFE 3IKCA 4V1DA 2NTFA 1LHZA 1VFBB 3D2UA 4NDMA 3QHFH 3T2QA 5BVJB 2AEQL 5KOVC 3QULA 4XVTL 3O9WB 4PJAA 1A9BA 5DD1H 4YO0A 3O2DH 4POYA 3TPUE 1F3DJ 4OCYL 4NRZA 3GSNH 5IEKA 2IAMD 4HK3N 3FQWB 2APWA 2BY3A 3UJJL 3WFHB 3MACL 5JORA 4AY0A 4BJLA 2KH2B 1DQDL 1JZ6A 2RBLA 4L8BB 5DJ6A 4BSWB 1I1FA 3PWPE 3QUZA 3VFOB 2I9TA 4Q9BA 1TETL 4KI5C 2XRAH 2PO6A 5J7CC 4Z7UE 4D0BA 2XTLA 2DYPD 3LS5H 3WUZA 3MYJB 2HYMA 4I3SH 4N90D 1KPUB 4OF3A 1UZ8B 2JK5B 3QCTH 1A6AA 3S34L 3U1SL 1OM3H 1IZJA 1E27A 3BP6B 1BJMA 2N7AA 4PLNC 2J8OA 4NKMB 5DD0L 4DZBA 2KQNA 1EFXB 1MAJA 1W0VB 4GAGL 4JZNB 3BVNB 5HHOB 4Y5XC 3KHOA 4BSJA 1BVKB 1JGEA 4LOUD 3QNXA 4ZMAT 5T1LD 4OI8A 1JZ8A 4ZDHA 1GC1H 3V6OA 2P7TA 4G7YH 3QPXL 5F3BB 2FEDC 4Z8FL 2ICWA 1MJ8H 3TF7C 4NHUB 5HGAB 1NEZA 2VLRD 4G7VL 3FMGL 5E1AB 5TF1H 1G6RH 2XKNA 4N8VA 1F6FB 5BOZG 2XKUA 3LKPB 4J4PA 4DGYL 1U8KB 5GRYA 3LMJL 4U6XA 1Q9LA 4KTDH 3P11H 3SBWA 4KZDH 4C4KT 4XRCB 4G8FB 4AZ8A 2V7NB 4ZTOH 5I1DB 1JF6A 3OKEA 4L3AA 3LVEA 1I3VA 5E8NA 1AHWB 1FYTD 5DI8A 5F7KC 2G75B 2PCPB 3TT1L 3EFFB 2ADGB 1ZANL 2EYSB 3PHOA 1LO2L 3BGMB 3OR6A 3MUGB 3BZEA 2P45B 3AUVA 3QDME 1J1OH 2DQCH 1KGCE 2BSTB 4P2RB 4YNYB 4NQTA 3B9KC 3FCTA 3MGAA 5C0RH 3MJ9L 5F7UA 2VDOH 3KPQA 5JXAH 5C0AD 4JFQB 1BZQK 4AG4H 1KFAH 4Y2DD 4DKFH 3ZSTA 3MRHA 4NQUA 1CLYL 2NXZD 4QF1B 1HYSC 4ZXBA 2ITCA 4AIZA 2I5YH 3DI2B 4BSVA 1BJ1H 2DL9A 5GRVK 4RMTA 1FC1A 4N0YL 2CRYA 1XF4B 4WO4A 1AGEB 2MWCA 4MAUL 2VZ1A 4Z7WE 5JMOC 1ZVSB 1RULL 4OLXH 1WZMA 2HT4C 1UEYA 1TCMA 2HJKB 1I7RB 2ICWJ 4OCRL 4UB0H 4ZAKB 1R5VA 3KG5A 1NKRA 5CWSB 1SEBA 1NC2A 2H45A 3Q3GB 4JHWH 3MRDB 3K1DA 1HINL 2PW1A 1B4JL 1M71A 4WDIB 4WNQA 4OM0H 3EGSA 3P77A 4APQC 1FZOB 5LGHH 5GPRA 3VXRA 3E2HA 3LV3B 2CQVA 4ODHL 1FZJB 3GI8H 1J10A 1YZZA 5I1CL 4X7FC 2FX8H 5GRZA 2ZUQB 1MCFA 1NANH 3G5VB 3SY0B 2VDPL 2CK0H 4FFZH 2IGFL 2F8XC 2PXYC 5MP6L 1OB1A 1S9YA 2NY3B 2A6JA 5EC1A 3ILPB 1JGLL 4M7LH 1WFUA 3WSQL 3RPIB 3HMWH 4R7DA 1KSRA 4G8GD 4QKXB 3MO1A 2V9QA 4I0PB 5GGSA 4G5ZH 3A6CH 3B6SA 5C0BB 2R1WB 2ADFH 3MGOB 5IG7A 2DDQL 3IU4L 3MRJA 4GXUN 1MHCB 1W72L 4GAYB 3BIKB 3C5JA 2VO5A 3WXWL 4YBLB 2B4CC 2PUQT 1FL3B 1A47A 4F7CA 2FHBA 5D1XB 3C60B 4CUCA 2XXMB 4PRBB 1FYHB 5ESAA 3PQYE 5C0FB 5FKAA 4J8RB 3OB0K 4TSBL 4HULB 1A1MA 4S1RH 3HUJB 1AGDB 1QSEE 1QVOA 1TVDA 3LCYA 5JTWA 1A14H 2ZUUA 3BT2H 1KEMH 1VSCA 3N85L 4HUWB 5GS0D 3C6LD 3V0VA 5TE7L 2VXTL 3QIWC 1E6JH 2DMBA 3C5ZC 1KIUA 1OF2A 5TDPA 4JY6B 3O45A 1Z9OA 3UTTD 1R3JA 4L9DA 4LASH 1ADQL 5E6IB 4CMHC 4M6ML 5I71C 2FX9H 4DZ8A 3CCHB 4OKVA 5C6WH 4Z7NE 4KJYB 5GGUB 1OTTD 1TJHH 1T7XA 1DLHB 4UINH 2XI9A 1FNEA 1UJ3B 2GFBA 4HHAA 5FIEA 1GCFA 1CD1A 3BPLC 4QY8A 1HQRB 3WNLA 4F9LA 2AAVA 3HR5A 2BDNH 1U8OB 4N1HB 2X41A 1SJEB 5D1QD 3KS0H 3QI9A 4P2YA 3BMWA 3KYNB 1F97A 3MCLH 5F44A 2X4UB 1RZFL 5EOCJ 5I66A 3TIDA 2VXQH 5DS8A 5EO1A 4EBQL 4LLUA 4XP1H 4XVJL 2RFXA 5KVGH 1NBQA 3JWOL 3FRPG 5EOQH 3ULUC 5F7EH 3W2DH 1QFWH 4JM2A 3HHRB 43CAB 1JGDA 5ISZE 3KYKL 1UKQA 5KN5B 5MENE 4YDVB 4JB9L 2DM3A 1HKLH 5K33A 1MCCA 5HI3C 3LEYL 4JFDA 2K7QA 4PRDB 5CSBA 3MREB 4MHHI 1H15A 4LKCA 3CPLA 1QQDA 1XGRA 4KZEL 2OI9B 3G04B 4X7SH 4QNPE 4G80B 4L3EA 1BZ7B 3QXVA 1ZS8A 4OZ4B 2OJZH 2APXA 5D2LB 1HCFX 5MERA 2H26B 2CDFB 4S0SD 3L5XH 1KLUB 1S7SA 2CUMA 2COQA 1M7IB 2HG5B 6CGTA 4PJFF 3U79A 4DK3A 4UTBH 3UXFA 4FTVE 4WW2A 2XV6B 4Z7OF 5SWZD 2EXYD 4GW5A 4PRHB 3QZWA 5D7IF 1JFQL 1MUJB 1YUHB 2XTJD 3E3QA 4YQXH 4TUJB 1TZGL 4XBGA 4WI7A 4F15B 1EO7A 2XQBH 4HS3B 4KXZI 3H9SE 1JF5A 3P2TA 4MAYD 1BQUA 4PG2A 3MLTB 1GZPB 3O2VL 4OGZA 1PG7X 2HT3D 4PJDF 1AR1D 2ICWI 3RWFB 3VXSE 1J87A 3QEHB 2ESVE 2XWBB 2CXKA 3O2DA 4ZYKB 4EDWH 3GSNA 2WBJD 3GUTA 4ONOA 5BJTB 1K3IA 5TQ0L 3ZKXB 1C16B 4IRJD 5I73B 3CVHH 1JF1B 4LNRB 4M5YH 3M8OL 4R8WH 2FD6L 5GJTL 1J05B 3RUGF 3QA3B 2EIZA 2FIKA 1FVEA 2F15A 4LHUA 1IQDA 2CKBB 5C08E 5FYLL 1IEBB 3GJEA 5E5UB 4GJTB 2W9EL 3RA7L 5ADPL 4IS6A 1NAKL 4PV8B 4WUUD 5EBMB 3MZGB 1WIOA 2E8YA 1AH1A 4WHYG 3LKQA 3VXUA 3L95A 1L6ZA 5LBSL 5CJOH 3MJ7B 2H2PD 1KTKE 4OD2A 4X4ME 5D5MF 1OLZA 4C56E 1U36A 5TGBB 5ICYB 4NJAH 3MA7B 4QOKA 3T2PA 1KCSH 3NPSB 5ICZB 2VMFA 2BNRB 4X9BA 3RKPA 5HVHB 3HNVH 4LSQL 3JTTB 1UA6H 4WCYH 5J1SC 2IH3A 1T89A 1C5CH 4RBPK 4HW6A 5C2BH 2ID5A 4U6TA 3DMMC 1YY9C 1J8HA 4IIQA 5HDBF 4P4KB 2XNAA 3MRQB 4PJIF 3V4VH 4HC1A 1W72B 3RL1A 4RGOL 3DVNA 4UQ2A 1XGUA 4MXQD 4K3JL 4PJCE 1J86A 1B6UA 4N0UB 4KK8D 1G6RA 5IJVA 5CIPH 1DEDA 1FHGA 1G9NH 4ZUTB 1RUAL 3FT2B 4G6FB 3RVVC 1FJ1A 3VFPA 2DJSA 3GSOA 3HI6H 2A38A 4E9LA 5D71L 4BFEA 2ORBH 3M1BB 1NCDL 4B53A 1RZ8A 5DF0A 1JHLH 2JJSA 2Z8VC 1LDSA 3GKZA 5DEZA 3UO1H 3ZT7A 2J2ZA 5HYFA 4PJGF 4TSCH 4MB5A 4M7KL 4K3EL 5IB5B 3MBED 1CLOL 3CC5A 2WANA 3NFPB 1T2QH 3MBXH 2L4OA 2XFXB 3DTXB 4YHLH 5HHMB 2VRAA 3C87A 5F7HA 5HGDA 1V7MH 1HHIB 1A3RH 1QD0A 2AXFA 3WBDA 3EOBA 1D5IL 1GVIA 4OUOA 4L4VD 1IEAB 1S9VB 1BVLA 4J12A 1U8MB 1HH9B 2AJSH 4PS4L 4XP6H 3PHSA 1QFPA 3TBYA 1EMTH 1BD2A 1H3GA 3LDBB 5C09E 1MCRA 3NZ8B 4OB5L 3LN5A 2FO1A 2AK4A 2YPVH 4IOIA 2H8PA 5DRZB 1ZLUH 5HJ3B 2UWEF 4M6OH 4FS0A 4XPTL 5ID1B 3D3VA 3QIUB 5FGRA 2WUCH 1ZHLB 1EZVY 4NSKA 1U3HB 1CD0A 1CF8L 4OJFH 1C5BH 3OAZK 4M1GH 3OKKB 2IPKA 3QIBA 4XNUH 3RWGB 3MV7A 4NGHL 5B21A 3GSWA 1ZHKA 4FMFA 2EEAA 2ED7A 3DX7A 1G1YA 3MNWA 1S7RB 1A6VH 1RURH 3MRFA 3EDEA 3VRLF 5C0CB 4E41A 2VL5B 5BV7L 1UQSB 4LVHC 1AP2B 3SE4A 4LPVA 3D85A 4IRSC 4ETQA 1UWEL 1CR9L 2FBJH 4EDXA 3FTGB 3VCLB 2Y36H 1MCEA 4W4OA 4F7EA 1DVFA 5KW9H 4B0MM 1TJIH 2BCKA 5CSZA 1S8DB 2A9ML 1YDPB 2BOCB 3BE1L 1X4XA 3IS1X 1VFAA 5C8JA 3QEQE 4AENB 4Y5YB 4DOHB 3DX9A 1A6WH 4R2GB 4IDLA 4ZUUB 4IBLT 4TULL 3VGHA 3ARDC 4BK4A 2D03H 2EDDA 4QHNB 5T3ZD 3J7HA 4YGAB 3V52H 3WE6A 1AGBB 4XAWH 3HE7A 1RUQL 4LK4A 2CDEA 1OCWL 3RZCB 2FL5A 3VG0H 5FO8A 3JWDH 5D7SH 2K1MA 1SBSL 5C6PB 1SYVB 2CH8A 3FOMA 1DBKL 1I8IB 1N0XH 3NAAL 2GAZA 1HQ4B 3WJLA 4KI5F 1BJ1J 1ITCA 4CNIB 1UACL 3VFWB 5C0NC 5FCUL 3QUMH 5F7DB 4HGKC 1MIEH 3I6LE 4XXDB 5D2NB 4TRPL 4XMPL 2BVOA 4XWGH 4Y4KB 4GQ9L 2FX7H 3DSFH 7CGTA 5DGRA 4ZFZB 1LK3L 4XNXH 4HK0A 3SCMA 1UT9A 1ZT7B 4YXKL 3P9MA 4GKOA 4Z7VF 3VFUA 3QDAA 3BXNB 3CSYB 3O9WA 1X5AA 4ISVB 4XH2B 3W0WD 5KTEL 1R5WB 2MCPH 4U3XA 3FQWA 1JPFA 4HCRH 4ZUSB 4ZODA 2YD5A 2A73A 3MUJA 1FZKB 4ZFFA 4DEPC 4L8BA 4DN4L 4YHYB 5JOEA 4OFIA 2OQJB 3OKLB 3VFOA 3PL6D 4GW1B 5E08H 1IE5A 2R1XB 2EDOA 4Q9RH 3GO1L 3TO4D 1T5WA 5GGRB 2YOCA 3RNQB 1U95B 4XCEB 1HIMH 4ZNCD 3F7QA 5DMYA 1UZ8A 3MYZA 3QAZB 1RFDH 4GKSB 4PRIE 1U8NB 5DHVB 3L3KA 3VMPA 4RGNB 4X5XB 1TMCB 3PJSB 5FUZL 4XNQB 1FLTX 1W0VA 3GHEL 4JZNA 3BVNA 3DUSA 5HHOA 3H9HA 4BQ9A 4EI5A 1BVKA 4OGYH 4U1GC 5L2KB 3O81A 1D9KA 4NC1C 1CFTA 2LVEA 3BPOC 4Y19E 5HPOA 4LCIL 3TVMA 4FQXB 4OCWH 3VFRA 5ICXB 3VXNA 1LP9E 3AMLA 4NHUA 4R3SB 1CFVL 2VDRH 4XPBL 2AXGA 4GBXD 3PNWA 5ANMB 1AO7E 1WQVT 4JRYD 3ULVE 2YA0A 4L1HA 4J2XA 2B0SH 3H9ZA 4DKEL 1IKFH 2QR0B 2R0ZH 5FM8A 1JTOA 3L5WA 4H88H 4XRCA 5B38G 4G8FA 3EYUL 1A0QL 3V4UL 2XYCA 2XICA 4QXTB 1OAQL 3AS0A 3PWUB 2MQ0A 3G5XB 3EJZC 3VWJD 4NFCA 2Y07L 5IV2A 4K94H 1WAAF 3LKNA 2Z91A 4X8JB 2G75A 3TN0C 4YAQB 3CVHA 2EE9A 3EFFA 2IH1A 2VR4A 1JTTA 5FM5M 4M1DL 3CFCL 3DRTB 3MUGA 5JIKA 3UJTH 1P7HL 5GS0H 3U4AA 1R3KB 4P2RA 3QQ9D 4YNYA 5IB1A 4U49A 1KOAA 4OLUH 3GRWH 1OP3H 3ARPA 2YR3A 4AMKL 4OCSH 3SDAB 1S78D 5ILTH 3SOBH 3IRPX 2ZG2A 2VXSL 1RVFL 3JTSA 3RGVD 5TDNA 3PHQB 4F80A 4G6KL 2R0KL 1EDQA 4MJ5B 4A6YB 2Y7QB 5KSVB 3GMOA 1I85C 5JXED 2H3NA 5C07B 5GGVH 3UAJC 2OP4H 5HI5C 2QQQA 3D25B 2OZ4H 1ZVSA 1DUYB 4ZUWA 5F6IB 3WCYA 4P5MB 2AK1L 4ZAKA 5HHXL 4RRPG 4MZ3A 4FNLH 1ZHNA 4JFOB 1DJSA 3MRDA 1A1NA 4P59L 1T6VN 1RQ5A 3VGEA 4X7TB 4PJ8B 3S3PA 5CIPA 4YPGA 5GZOD 3V7MA 1RMFL 4JPIA 3QRFM 5F7WC 3ABZA 1IC5H 3DHJA 3NN8A 4YBHA 4P5TB 5E6ZA 2NR6D 3U9PL 1J18A 5I1EL 1QFUH 3G5VA 2OR9H 4TQEH 4CJ1A 4UV7L 4X9GA 1XIWA 4KVNH 4OZFB 3BP4A 2MOVA 25C8H 1KXTB 3ILPA 2XN9A 3HI1A 5E6YA 5A16B 3CFKB 5E2VL 4H1LG 5EU6D 5IR1B 2B1HL 1F58L 3IDGB 4AEIH 2PTUA 1LWRA 1GSMA 3O3EA 3HG1D 5SWSE 3BI9X 5FKPB 1AGFB 5I1AA 1NANI 1UADC 2F54E 2IADB 3H3KA 3AREC 2J5LB 5CP7A 1HSBB 2X4SA 4N9OB 2WINB 4CVZB 3QWQB 4OV5B 1YYMH 3PDOB 3RWIA 1NLDL 4PRBA 1H0DB 2VZVA 1T1WB 3FB7A 1CICB 4ZUVB 4OLWL 1M7DA 4X6BA 3THML 2UY7A 1OTUC 1MCQA 5DQDL 2BP3A 4Y8DC 4PP8C 1KLGA 1EV2E 2W9DH 5DZOA 4XBEL 3WFZA 3ULUF 1T21B 3C5SB 2HTLC 2E27H 4XNMB 2W0LA 4AQ1B 1DBBH 2QV2A 4LCUA 1CGYA 1FNLA 2XA3A 3UEZA 4OTXH 4KQ3H 5SWQB 4NO2A 2DYPA 2VKWA 5L0QC 3IDNB 4J6RH 3B43A 3R8QA 1INDL 1VB9A 4FQIL 4H25A 4BUGA 5KAQF 3DROB 1E4KC 4KJYA 4P3DB 3K74B 4Y1AB 5BZWB 2R2BA 4J1UB 4OV6F 5FXCH 5I0DA 3QPQD 5T1MB 5MEOB 4JN1H 4LF3B 2IQ9L 5E8DH 1PBYA 1PKQB 1HQRA 2D7TL 1T1XB 5HVGB 1ORQA 1KCLA 3RVTD 2CK2A 4JO3H 2VLKE 1YNTB 5GHWH 4P46D 3FQTA 1FP5A 3UYOD 3L9RA 5IM7B 2MSPA 1D5ZA 1TDQA 1OQOA 2EEDA 1HZHH 2YMXH 2BVYA 3I3DA 3ULUL 1SJXA 1FNHA 5IVXF 2X9WA 1MNUH 2Q87A 1HSAB 5KN5A 1D5MA 1F4WL 4EVNA 1N3NB 1OPGL 3MREA 4FQCH 5IHLB 3J8F7 1IM3B 4NPYB 4I3RH 3VD7A 4DQOL 2V5RA 3F7YB 3ARBC 4HJJH 3FQUB 4UT7L 1RZJC 3G04A 4NZRL 4MD5A 1P84K 3HNTL 2AJXH 4X6DA 2A74B 3U4EB 4CN6A 1HH6B 4KDVA 3U30B 1AGCB 2CDFA 1EERB 4FQJH 2EDNA 2NY0B 4MJ2A 3V2AR 3QUMA 3LKRB 3M45A 2GJZA 4PJ5D 5F1IA 2O93L 4JN2B 1N64H 5DT1L 4MX7A 1MUJA 1KG0A 4X4XA 4YHKL 3T2NH 4TUJA 4KMTH 3R1GL 1KGCD 1C12B 4NWTL 3HE6B 4KKAD 4S0TD 5CBEB 2ARJB 1A7PH 1YPZE 2WSKA 4L8DB 1I3RA 4OF5A 5IHBA 1RIUH 4S0UC 3DUUA 1QACA 3RX5A 1I8MA 4NN7C 3BPCA 5C0AA 4XCFL 3RWFA 3LAFA 2XWTB 3DRQB 5DTFB 4ORZC 4DUWA 4IRZL 3WO4B 1A6ZB 4HIJA 4MSWA 5EBGA 4PJ9C 1C7SA 4H8WC 4YBQC 4JKPH 3MV11 4NM8L 1J05A 3NA4A 1E4XH 5KSAD 3KYAA 2K3TA 3HMXH 3U0WL 3HS0B 3T1FA 3AAZA 1WF5A 1RZ7L 5IFHH 2YPLD 3W11C 1ED3A 2GT9A 1IEBA 5KSBB 4MQSB 4XP4L 4APQB 3WFDL 4PV8A 4HUKB 5EBMA 1YEKH 2AV1A 4Y7MA 5D7JD 3CZFA 2D7OA 4LDEB 3PWLB 3QDJE 1IT9H 3HKFA 3R0NA 3RL2B 3QJHB 3T65B 3TIEB 1BOGB 3H8NA 3HB3D 4P23D 3L3GB 1U8IB 4WWKB 4JFHD 4YHOH 4OUUB 5ICYA 2BFVH 3L5HA 3MA7A 5B22A 4V2BA 5IMKB 5BCAA 2F58L 1WISA 4WGVB 3FZUC 2BNRA 3L5IA 4FABH 1T22A 3UTOA 2GUOB 3QRGL 4HUXB 4HLZG 1FFOB 3HC3L 1H8SA 5CJQL 1L4IA 1PDKA 2OTPA 3AFLA 4RMSA 4P4KA 5IHUH 5C7XL 4NKDB 4G8GA 2DQTL 1BFTA 4G3YH 1WIUA 1H3WM 4LEXH 3O3AB 2Y5TB 4N0UA 1YMHB 3SEPA 2DRUA 3AVEA 2DBLH 4DTGL 3C09C 3GBML 5JDSB 3BGAA 3FT2A 4JDVB 3M17A 5T3ZH 3KXFB 3DURA 4QRUB 2AJZB 4UZGA 5EU3A 3MFFA 2R29L 3LIZL 4I0PD 4KGJA 2R4RL 3HRZA 2DJUA 4QRPD 3FO0H 2YK1H 3ZTJG 4JFEE 4S1DC 3M1BA 4ZD3L 2EH7L 3TGXA 3X3GL 5I8EB 3RTQD 2VXUH 5JUEH 1OW0C 5IB5A 2DI7A 1N2RA 3VD5A 5L9DH 1FVCB 4CRPA 1MWAL 4UNUA 4CMHB 3D69B 3C6LA 4LVOB 1JRHL 1I4FB 1S7UB 2ADJA 5TH2B 2P24B 4Z77B 4HXBH 5HGBB 4PYGA 4Z7UB 4PJAE 1ZOXA 3SDCB 3MV01 4UQ3B 5CD3A 1U8MA 3SKMB 3UTTA 1HH9A 3OAYK 5D70L 4R4FH 4FMKA 5ID0A 1JNLL 2YD6A 4M93C 1U42A 4HS8L 4UDTB 1B0GA 4F33B 4JKLA 3GZKA 3RY6A 1VADB 1I7UB 4ODSL 4CDHA 4XC1L 4KKCD 3QIUA 4TUKH 2F8VA 3UJIL 3KPSB 1YMMD 1FBIH 3V6BR 3ZMRA 2GK2A 1GHFH 4XPGL 5E6ID 3REWB 2E7LE 5E03A 4M00A 3OKKA 3CU1A 3S98A 3F7VB 3JV6B 4ZOBA 5AWNH 1X5IA 5IB3A 4NQED 3KYMB 1D3CA 4HFUH 4ELME 4NJ9H 3CH1B 4HG4K 3IJYA 1UXSA 2YXMA 1IM9D 4TPRH 2YD8A 4LLMB 1H5BB 1RHHB 2VL5A 4I77L 1K4CB 4Y4FB 3OB0H 5I1KL 4KK9D 4XXCA 1L0QA 3X3FL 1IEHA 5DUML 3FTGA 1LK2A 2EYRA 2PTTB 3V6OE 3OZ9H 2DQDH 3O2WL 4HUVA 1PLGH 1QLEH 4IDJH 1DFBH 1QLRB 4M61A 4JPWL 4UOW1 1E4WL 2BOCA 4PJBF 3V5DB 5I1GH 3RAJH 4QXGH 2AGJH 3BZFA 1JHTA 1INQB 2N4IA 5F9JB 5IVXB 4HIEB 4KPHH 3WMSA 2FB4H 3QDMB 4LKXA 1JYWA 3QP3A 4NRXB 1HHKB 5D72H 5AUMB 5JQ6L 1WEJH 1P4BH 3CX5K 3B9AA 4MAYA 3EHBC 4P57B 4RISH 1FN4A 1SYVA 1N6VA 1MJUL 4UT6H 4D9LH 4I18C 1JPSH 1OAKH 4UI2A 4CNIA 3D39D 4LRIA 5I8CB 2NYYC 2UV3A 3H3PL 3MV9D 1NDMB 5F7DA 3QFDA 4MD4B 3KLHD 4XXDA 5DURD 5D2NA 1CFSB 3N06B 5DA0B 1OAYH 1AI1H 4LCCA 3X17A 4UIMB 1SBBA 4L8SA 3SDXA 4E0RA 4Z7WB 3NCBB 1W8OA 1FGNH 5J1AB 4DVBA 2HTKC 4XMKH 4Y16C 1WCBA 4J7RA 3WD5L 1AIFA 1EGJH 1U41A 4K2UL 3UZQA 4DKDC 5GISH 4AEEA 1A7BA 1IL1B 2G2RB 4DGIL 1TPXB 4PJ7E 3CSYA 3CMGA 4K07A 1KJ3H 4Z18A 3QO0B 2DKSA 3BHBA 4M6NH 5I19H 4LSUL 1ZLVK 2NZ9D 4WHYH 1NCWH 4ZUSA 5I17B 1AY1L 5J13C 4JG0H 4G9DB 2AERT 2YZ1A 1NFIB 2FNBA 5IT2L 1MHHB 2QADB 3LB6C 2Z93B 3U2SA 4PBVC 4OLVH 4RWYL 1P2CA 1QNZL 5GGRA 4K7PY 4HWNA 1HE7A 3QCUH 2O5XH 5KVEL 1FFRA 4BFIA 4YC2C 1Q1JH 3NCJL 1MAMH 3QUKB 3IVKA 4GKSA 5EUOF 4WFHD 1MPAL 1PYWB 1UENA 4PUBH 5DHVA 1A8JH 1MIML 4NN5B 4X5XA 4UTAL 3PJSA 2XKSA 1KB9K 1TJGL 3Q48A 1EHLH 5L2KA 5FUCC 1FZMA 4PR5A 3RDTD 5J3HC 3DV4A 3EDDA 3QBTB 4OCMC 3K2UL 3PQYB 3SJVD 4EXPX 2NPLX 1GL4B 1XR9B 5C0DB 1I7ZA 3SDDD 4Z0BH 1MWAB 5GJSL 2LU4A 5JR1L 2H2SC 3GHBL 4HZLB 4OLYL 1I7TB 1FH5H 3HPJA 4WGWB 3MBEA 5DJXA 4JREB 4P5KA 3BO8B 5CILH 2Y23A 1ZV5A 4MQ7B 4PJHA 1OAUL 1GOFA 3WS3A 4EXKA 3NZHH 3QG7H 1HNGA 3VXOB 5C71A 1MVUB 5D1ZB 3EO1A 2QR0A 2X44D 3B2VL 4WI5A 1GAFH 4BZ1H 4JY4B 1EZVX 1TENA 3BN3B 3IDMA 2CLVB 1DP0A 3EFDL 1FPTL 3G5XA 2OCFD 3GGWB 1CL7H 5A2JH 3HI5H 4X8JA 5HHMD 3Q5YA 3G5ZB 1JHKH 3BESR 3TZVD 1DBAL 3DBXB 3MR9A 1QEWB 3VFMB 4NHCH 3RWDA 3ARGC 3DRTA 3HMXA 5FOBA 3QQNA 1MJ7H 4PJXF 1CT8A 4XPHL 1R3KA 3PWNB 5CD5D 5AAMA 3QUZC 4X6CF 4MS8D 4PLJC 3NH7H 5M7QA 4S2SA 2WQ8A 3LQAH 1GPOL 4KQ4L 2DQJH 5A2KH 4NO3B 1FRGH 5JPMB 5CJXC 5HYJE 3KGRA 4YZFE 2J6EL 3WXVL 4D3CH 5MENB 2DKMA 4A6YA 4R7NB 5KSVA 4FZEH 3TA3D 2XPGB 3IDXH 3OJVC 1XF5B 4J23A 4L8CB 3L3JB 1RK0A 4Y4HB 1T04B 4NOFA 4XZUB 1ZSDB 3BQUD 3Q1SH 1RUPH 1JPST 2FWOB 2F74B 2EE3A 2WWKO 4P5MA 3LOWA 4H0GA 4GH7B 3ZE2E 4JQIH 3L7FB 1CXIA 5DHYB 4ZFOB 4BQBA 4F3FA 4JFOA 3BZ4B 4DUXA 2YPKB 4X98B 5C0CD 4JFDE 1N5YH 1BGXL 4FTVB 1WWBX 4HXAH 1BIHA 4X7TA 4KVCH 3GMNB 5B4MC 1WZ1L 5A2IH 4PLOB 1ZA6A 2DL2A 4ESKA 5IESL 4J4PC 3VI4F 3H9SB 3T0EE 5HGGS 3NCYP 1NCCH 4MB4A 3OQ3B 1NCAL 4GW4B 3SBWC 1LNUB 1MJJB 3NCEB 1AR2A 3A0OA 2YS4A 3VXSB 4K71B 2ESVB 2OK0L 3WDJA 5A16A 3CFKA 2CLZB 3E3QE 4NCC1 5DGQA 4HQQH 3IDGA 3MJGX 5D6CA 2GIYA 1NCBH 4KY1H 4YHNA 1TQBB 5ITBL 5DMKA 3R4DA 5DMIH 4HAFA 5FO7A 5C08B 4CJ0A 43C9A 5HXMA 1BP3B 1BBDH 1HSBA 4GG6F 3UMTA 1KIRA 4V2CB 2CSPA 3VXMD 4RAUB 1MFBL 4P2OB 3EOAA 3MLRL 4FQ2L 4Q6IA 2X4PB 1M05A 2ED9A 1OSPH 3MPCA 1CICA 2Y4SA 3F65A 3HC0B 4JFPA 4U1KA 3P0YH 3SGKC 1MCHA 2DLFL 1T7YA 3A6BL 1JVKA 1U91B 4UDUB 2JKXA 4C56B 1NPUA 4RX4D 1G9EA 3OXRA 1KULA 3H7BB 1IGIH 1F4YH 1DSFL 4OGAD 1WITA 4G9FD 1KENL 3O4LD 5JHDD 2V7HB 2G9HB 1EVTC 3CLFH 3MOAH 4GKNA 2GJ6D 3O8XC 2E8ZA 5FYJD 5ALBL 3CDGA 2BHUA 2PTVA 3IDNA 4GXVH 3TO4A 4F9PA 5T1KD 5CZVL 2D4DA 2NLJA 2MTPA 4QHLB 4PJCB 3DROA 2FRGP 4Y1AA 4QOKE 2AP2A 2L7JA 3IFOB 1WZKA 3FRPA 3VXPB 5DD6A 1G7MA 1QOKA 4LF3A 2GSGB 5FA3B 1T1XA 4FA8A 5CEXB 5CZXC 1CZ8L 4YHIB 3U7AA 4PGCB 4P49A 5H37G 5EORH 1UG9A 5D9SB 5AD0A 5C6TH 1ITBB 2B7DT 3I2CL 1OARL 5HHPA 2XZZA 2K9UA 1CWVA 3DGGA 3GSQA 4JO2L 1N5AB 3QNYB 3ELAT 1LEIB 2MQ3A 4XT1C 4GBXA 5BRZD 3CXHJ 1HSAA 3NTCH 5IGXL 4JRYA 1N3NA 4FRWA 1MREH 3EDFA 4PLKC 4LLYB 2VSCA 1RZJL 3CFEA 1KCVL 1KC5H 3QUYB 5EUOB 1YNKL 3FQUA 3ULVL 3BH8B 4HS6A 2J8HA 4ZFGL 1H3UA 3IETA 1S5IH 4RAVA 1JCKA 2A74A 2VL4A 3DV6A 1HH6A 4L29B 1YJDC 1I1AD 5LWYL 4U1IA 4M3KB 1AGCA 1JI2A 3T0WA 3OJDB 3UYRH 1UB6A 2X89D 4Q0XL 5C09B 1HWHB 4LSVL 3LKRA 4FQ1L 2BC4B 3U82B 4JN2A 4PG9A 4POZC 4HKJB 1RU9H 1C12A 2I07B 3DHMA 3GIZL 4FP8L 3W5MA 3P0VL 5F7NC 4JFZH 5CBEA 1BD2E 4L8DA 1EGJA 4HFWA 4DAGL 1DQDH 4WHTA 3MRRB 5T5NG 3JUYA 4NZTL 1N4XL 5GGSY 2W92A 2XWTA 3GMQB 3D3VE 1UCBL 3WIHH 4JO1L 3UTQB 3RGVA 4H8WL 4QRRA 4HWUA 4FQLL 2IAND 1SM3L 2NY6C 5JXEA 5L7XL 1A7NH 4NQXB 4WUKL 3HS0A 4F9LC 4PY8I 2X40A 4M8QB 3U1SH 1WV7T 3BAEL 5IVZB 3S4SG 2HJFB 5KSBA 1O0VA 4M1CC 4LAQH 4P2QE 3LD8B 4NP4H 3VMNA 3OPZH 1NGPH 5FGBA 1EXUB 2I25N 2A1WL 2BY2A 4LHQB 5BW7C 4OZGE 4X6CB 1ZTXH 4ONGL 4QRSB 5C0GB 4LVEA 5KZCB 4E41E 4HX1A 2AABH 3DO7B 2BHYA 3PWLA 3BWAB 5LCVL 1DQML 1QTYT 3CSGA 3F5WB 3T65A 5I1JH 3TIEA 3NA9L 4JM2C 5SX5K 3ARXA 3BMVA 1E4XI 5E2TH 3GSRB 4LSPL 4KTEL 4CVXA 3QEGL 3QUXD 4G7VH 2X5PA 1B0WA 1RJYB 3FFCA 4RFNC 1Q9WB 4HUXA 2V2TA 3KPMB 4O58H 4LLDB 1AXIB 1N6QL 3ZYZA 2CLRB 5KAQG 1WBZB 1D5XA 2ZPKL 4K3GA 2MJWA 2SEBA 3LMJH 4Y2OA 3FN0L 5EU6A 3LEVH 2NY1D 3CDFA 2V5MA 4EN3D 2VISA 5JW4R 2XIDA 4XCNB 2EH8L 4H1LH 2FO4B 1BHGA 4FOMA 2C3GA 3FO1A 3BKCH 1URLA 4C4KO 1J5OL 3IRZA 3AS2A 3X11B 4QRUA 3U7WL 3MRCA 1ERNA 4KWUA 3TT1H 2LU7A 1BBJB 3BDYL 4M48H 3VJ6B 2NMSA 1ZANH 2IG2L 3RIAF 4PG2C 2CO7B 1VEMA 1JYVA 2EEBA 2X4QB 4OZHE 4WU7A 3TPUA 4U1MB 5DC4B 5I18L 2BZDA 3IFNH 1UVQB 1ZMYA 3UTPE 5E8EB 1F3JA 1CFQB 4JFFB 5TFSL 3MSPA 1MRCH 4ZQKB 5HYQA 4KAQH 3PWPA 4K23H 4OM1H 3R0MA 4TOYL 1S7UA 5FM5O 5HGBA 1VHPA 3SDCA 3TT3H 4G6MH 1FO0L 1J0IA 3SKMA 1FL6B 4WFED 2R15A 5J6GB 3ZO0A 1CLCA 4KI5D 3ZL4L 1U92A 3T8XB 3QG6B 1L7TL 4BH8B 4LSRH 1RULH 4PRIB 4QCIA 1U8PA 1Y0LB 4LCYB 1I7UA 1DEEB 3NCMA 1QSVA 2P49B 3IS0X 5EG6C 1QR4A 2FLRT 3M07A 1HINH 1FGVL 4XC3L 2BSSA 4RSVA 4S11A 1K8IA 1U8LB 3REWA 1KPVA 4Y19B 5FV1L 2VSDA 5ACZA 5F9OH 3JV6A 5DA4A 1GJIA 1VPOH 4HZAA 5I1CH 2NW3B 3GB7B 2VXVL 3E8UH 4IIQC 4M43L 3ZDYE 2XA8L 3ARBB 3SE3A 3R06B 3VD9A 4QTIL 3TBTA 1AO7B 2ITDB 5FHAL 5KVDL 2BSED 2QHRL 4MDJB 4BM7A 4QRQB 2FEDD 1GIGL 4PJEE 4LLMA 4U6VL 1H5BA 1RHHA 1K4CA 5F1OB 1TVBB 3ZZ1A 3IDYC 1SMOA 3WN5C 3LQZB 3L7EB 2MKLC 1AXTL 4W70A 3T1WA 4HJ0C 3MZTA 1RIVL 3TFKC 2DQUL 4WFGE 2NY4B 4GMSH 2N1KA 2M1KA 2KKQA 3O41B 4XI5C 4P9HH 5F89B 3V5DA 5BS0E 5L6YL 1CE6A 5FB8B 2JJSC 2M26A 5DJ0B 4PJ5A 2NY7L 4WRLA 3DJ9A 1WICA 1BLNA 4LP5A 1QR1B 1T66C 4R97C 1OT2A 2ZCLL 1P7QB 2L7UA 4LGSB 2CR6A 1HHKA 1MFCH 5F88B 4YXHL 1IGML 3CVIH 1V8HA 1UM5L 4CAGA 5KS9F 1Z5LB 1FFPB 4PJ9B 3MX0A 3LEXB 5IK3B 5TE7H 2VXTH 4XMLL 3BGFC 3B9KD 4NM4H 1DN0B 4K7PL 1YYLH 4L9LA 4DW2L 4WTWA 3IJSA 4M7ZC 1LE9B 5FF6B 1REIA 3OGOE 1G7JB 1HYSD 3RVUC 4M6MH 4UIMA 2O5YL 5K9OA 1UXWB 5KSAA 1EEYA 1MRDL 4Z7WA 3QJFB 1J12A 3SGJC 4YHML 3FQNB 4FFYL 2FBOJ 3K4ZA 3VRJA 5FHBL 4V3DB 2DD8L 3BPNB 3VW3H 4K8RC 1G7IB 3E0GA 4OQTL 2XY1A 2NZIA 3ROLA 1SJHB 3LQMA 4HBCL 2HT4D 4LPCA 5D7JA 3TV3L 3AXLB 4MNQE 2MMXA 5DSCB 5JNYB 3SKJL 5K93A 5EOTA 2EDQA 1RZFH 4KDTA 5CEZD 1NC4D 4P23A 3HN3A 2Z31B 4G9DA 4APQD 3JWOH 4IEFB 4BA8A 5AYQA 1UM6L 4RNRA 4BUHA 1NFIA 1VFOA 4U1HB 2VDML 1MI5E 4JB9H 5GRWA 2XY2A 4NWUH 4J3TA 4HLZH 4UIKH 1VKXB 2PXYD 4H20H 4JDZB 1T5XB 4HDIB 3QUKA 1Q0XH 3H0TB 4Z7QF 1VGEH 1H9VA 1V3LA 1MCSA 5SWSB 5DJZA 3U4BL 1RJLB 3LHPL 2F54B 2VC2L 4UILL 3KR3L 2GTZB 4NOBA 4OLEA 1KB5L 4PTTA 2XN9E 3TO2B 2ZJSH 3G08A 2F5AL 5BQ7B 4X6FB 1BF2A 4Q74A 3PQYA 4PB9H 1TZGH 1MELA 3QXWA 4PGDB 3U0TB 2BY1A 5B38A 1XR9A 3WJLC 5AG9A 5C0DA 5IW1B 1QSEA 1YEJL 1BWWA 3D5OF 1RUKL 3CH8A 2OS7A 3H7LA 3O2VH 5IQ7L 2DICA 3O4OC 1FO0B 4MQ7A 1JPGB 3TEUA 3IU3A 5HY9B 1MVUA 4KHXH 5K59E 3FJTA 4M93B 1DQLL 4B7LA 5FUOH 3QIWD 2BSRA 3C5ZD 3GK8L 1W0WA 3STZA 2M2DA 4ODWA 5DR5H 3O9WC 3WIHA 4QHMA 1X6LA 2W9EH 4OIAA 2GYSA 4X6EB 3EO0B 5J56B 1MQ8A 1IGCH 3UBXG 3DBXA 3VFMA 1U3JA 3UTZB 5LBSH 5HD8C 1QBLL 1YMMA 2E6PA 5FFLA 2VLKB 3GJFB 2IBZX 1CFBA 1BECA 4P9MH 1KTDA 5CEYB 2FGZA 1MCWM 5FYJH 5E9DD 1CL7I 2XZQH 1DE4A 5EIVA 1FE8L 4NO3A 3CFJB 2VAAB 4RRPA 3QYCA 4DN3L 5ISZA 1NGZB 3KPSD 5DQ9B 5DXWA 3HZKA 3WIIH 1PGRB 2IPUK 3WYRA 3ULUD 4YDJB 1ZSDA 3TCLA 5KVFL 4RGOH 4K3JH 3K4AA 5LAXB 2A6KA 4D0CA 4NZDA 1CD9B 1MCDA 3ARTA 3OHXA 1D9KC 4KH2A 1IAIH 2VLRE 1YEIL 3GSUA 4LCWD 3SE8L 4ZFOA 4U1JB 1BEYL 2AJ3B 2VABA 2CRMA 1CBVH 4WTZG 4FTVA 5TDOB 2DLHA 1MQKH 3AM8A 4ELKB 3ZE1E 3BH9A 2NY2B 3FT3A 3GMNA 1OVZA 4H1LA 3OAYH 2BRRL 4HUUB 2UVFA 3S35L 4X6DE 2LTQB 3WHE0 3AGVA 3VFVB 2VIRA 2EC9T 3H9SA 1FNFA 3BEWA 3CUPB 3I75A 1UEMA 3I85A 4GW4A 2VDLL 1NUFA 2YD9A 1FYTE 4L5FH 5ESVB 1PVHA 3S36H 5E5MB 3D39A 5C2UB 1CXHA 3MV9A 4R26H 5F9DC 3I9GH 4U1SB 1AHWC 3P4NB 3PXHA 4U7SA 4F58H 4PB0H 3RGHA 5FDYA 1FIGL 4C83A 4DCQA 5B3NA 3KPRB 3JUZA 3UC0L 3VD4A 1K3ZA 2IPUG 3MXWH 4ODTH 5C0AE 4HSQA 5D6DC 2J88H 4E42A 1C08B 1MFEH 2X4PA 3TYFB 4GMTH 1B2WL 1Q72H 4WTXA 3KJ6H 1IARB 1IAKB 5E70A 3QDJB 1PAMA 4RZCB 4HJGB 2B8OT 4K7PX 1OT1A 4X4MA 5F3HB 4UDUA 1YEDB 3MRIB 5I74C 4NRYA 4MDIB 2JB6B 5J6HB 5IFJA 1QUNA 3VRIB 3KPTA 3MA9L 2CKNA 3NABL 3Q6FB 1G84A 1HILA 1WFOA 4YC2B 5EIIB 5GRUL 2I26N 1OHQA 5DQJA 5FYKL 1A1OA 4QT5A 1WJ3A 3VFSA 2P5WD 2JCCE 1UWEH 4ZAKC 1EO8L 4NZUL 3PV6B 4GLRH 3FB6A 2CJUL 5KSUB 3DMMD 1YY9D 4O51A 4YX2L 2BNQD 4F2MB 3VI3E 1ES0B 1JTPA 2BK8A 1FV1A 1KB5B 3F12A 3VXPA 1SVCP 4N0FA 2C1PA 1QLFA 2GSGA 4ZNEA 5T3XL 1K4DA 1G9NC 4NQDB 2XT1B 3QEUA 3MCKB 4Z5RB 2ZUQC 2D0FA 3CLEH 3OKDA 5D7LD 1K6QH 3ROOA 4TULH 4G8GE 3RVVD 3RDTA 4J3OC 1XIWC 2IPTH 3SJVA 4JFEB 4JHZA 1SHMA 1S7XB 2NY3C 3C8HA 5F8RC 1RUQH 5C0EB 4XPFH 2QSQA 2R69H 4JQXA 1N5AA 5EOCL 5E2UL 1SBSH 3IXTA 3IKCB 1OGTB 2NTFB 5DEFB 4GO6B 2D7NA 2R4SL 3C2SA 3D2UB 2Z8RA 2HFFA 3QUYA 4LPTA 3QULB 4ODBD 2H1PH 4YBLC 2ZCHL 1IKNA 4PJAB 3W9DA 1ZLVH 4TRPH 1YJDL 4JE4B 4L29A 1XMWA 4NRZB 5IEKB 4GQ9H 2ZCKH 4N5EC 3HR6A 4X7CC 4FN0A 3C9NA 3ORJA 2C4FU 4GRWF 3C08L 5JORB 3P4OA 2BC4A 1KUMA 1MCLA 2ZUYA 4NQVB 2QQKL 2A0LC 1I1FB 1JK8B 1LO3L 3L3DA 3PP3K 3QUZB 1EHAA 4LVNB 5F1SA 4ALAH 2I9TB 1PZ5A 2PO6B 3TZVA 5T5FL 4D0BB 3BRDA 4HKJA 1ZLSH 1ZKAA 3MLZH 2I9LB 3UTTE 3INUL 5ITFA 1JN6B 4RIRA 1MEXH 3MLUL 4J3VA 3GKWL 3BKML 3SGDH 1DBJL 4I4WA 4DN4H 4PGJA 2AJYL 1YEHH 1CK0H 1VEPA 1YEGL 3GMQA 3OAUL 4ELMB 4DZBB 1G9MH 4NNPL 3T0AA 3UTQA 3OSKA 4A2MA 9CGTA 5LQBL 1JZ2A 4LSTL 3T3MF 4HKBA 1JGEB 2JB5L 3TA3A 1UJ3C 2AQ1A 3D9AL 3ZT5A 3MLYL 4PP1C 3BQUA 2P7TB 1Z6JT 2LQRA 4MWFB 4U1NA 5IVZA 3ZHKA 2KPNA 3QWOA 2HJFA 1I3GH 3UTSD 3D0LA 4IRSD 3EO9H 4OCNC 1NEZB 5IUSA 5LGJA 1RV6X 1EXUA 5DJAA 1YN6B 4LSSH 5ENWA 2XKNB 4N8VB 2Q8AL 4QRSA 5D4QA 1V3JA 3QEQA 4OI9A 4WHDA 4CW1B 4P3CH 2PETA 1Z3GH 2D0HA 1TTFA 2GSIA 4LCIH 2HH0L 4U6XB 1F6AA 4KJWC 3V5HA 1JGVL 1IGTA 1C1EH 4TUOA 5IW3A 3VGFA 4LEOA 3ARDD 3N1PC 5CLTA 1U8JA 3BUYA 3OKEB 3KLDA 2AEPH 5CFHA 3D48R 1GOHA 1NBZB 1WBZA 4NO0B 4S1QL 2JIXA 3JVGA 3FQRA 2DWEB 2VE6A 5SWZE 2EKSA 4CVUA 1G7PB 2ARWA 4R4NC 3PHOB 3OR6B 1EEUA 2XTJE 3BZEB 2DQIH 5CAYB 2G5BB 4JVWA 1A0QH 1WBXA 3V4UH 5C0ND 4XCNA 1GRWA 4P99A 2R8SL 1RZKL 3FCTB 2NX5E 4JHAL 5DK3A 3OX8A 4OD3H 3S35X 1OY3B 5FEBA 4F15C 4AQOA 3MRHB 2XWJA 5IBUG 5I30H 5BZDB 4ZXBB 5K9JL 2ITCB 3VXMA 5TE6H 1RD6A 3QFJE 4AIZB 2HFTA 3SQOH 4PJ7B 5DD1L 3FOLA 1CE1L 3O2DL 4PJFA 4N1CA 3GSNL 4U1MA 4WO4B 3SDXE 1II4E 3KLSA 5E8EA 1CFQA 3ZKXC 4RX4A 3FQXA 1YN7A 4ZQKA 3K2MC 4GT7A 1LGVA 2VXSH 4WUUE 1SEBB 1NC2B 4G9FA 2UVEA 4DVRH 3O4LA 5JHDA 1DBMH 2R0KH 2Z8WC 1Q0YH 2M8XA 3ARFB 3ZDZF 2VLLA 2PW1B 3LS5L 4WNQB 1ND0A 3P77B 4I3SL 1R3HA 4R4BB 1SY6H 3MLWH 3E2HB 1ZK9A 4FXKA 15C8L 5T1KA 1NMBH 4N9GB 4X7DC 4OFYD 3QCTL 4BH8A 1TVHA 1OM3L 3DYPA 3PE9A 4N0RA 2AK1H 1Y0LA 1I1YA 1DEEA 4K3DL 1IC4H 5CEZH 5HHVH 3AS1A 2BVUA 3RUGA 5DK0A 1OB1B 1S9YB 2A6JB 4O02H 4B7IA 1QHPA 1JZ3A 3PDDA 5HVHC 1F2QA 3B6SB 3H2WA 1GC1L 2FLBT 4G7YL 5TPWH 1P6FA 3DOSA 3GB7A 2NW3A 5IG7B 3MRJB 1LP9A 1ZHBB 4HC1L 5AYUH 4P4KC 1LO0L 3C5JB 2YSSA 5AAWA 2X1PA 1AO7A 2ITDA 4ZPVA 5TF1L 2W0FB 3STLA 1G6RL 1JUFB 4MDJA 5BRZA 4QRQA 1ZGLP 3WLWD 4F7CB 5D5MA 3RIAK 1JWSB 1B4RA 2HLFC 3U83A 1JZ4A 5ESAB 7FABH 1HOCB 3WL9A 2B1HH 5FKAB 1T4KA 4KTDL 3P11L 3I6KB 4KZDL 3EYFB 1A1MB 4OZIE 3MXVL 1QVOB 5LKNA 1QO3A 4ZTOL 1I1AA 4NNYA 2B4CH 1MFAL 4HAGA 5E94B 5F89A 2X89A 4PJIA 3G6JE 4QXWA 3V0VB 1EBAA 4K94C 4PJHE 1OTSC 3F58H 3EJZD 1OF2B 1H3PH 2VZUA 4MNGE 5EU7E 4OLWH 3THMH 1R3JB 3LZFH 2VZSA 4M4PA 4L4VE 3TN0D 2I60L 1J1OL 3MRNA 2DQCL 5F88A 2NQCA 1MCNA 4OKVB 3TBVA 5C0RL 3L6FA 4XBEH 1Z5LA 4QYOB 3LEXA 1FNEB 1S7TA 1TZHA 2GFBB 1KFAL 5D8JH 5IK3A 1A4KA 5FA4A 1YQVH 1KLFA 1UKSA 3HR5B 4PJGA 2I5YL 4GRWB 5FF6A 1OTTC 1FNSL 3RY6C 2IANA 3QI9B 3WJJA 4JR9L 1QPXA 1U6AH 5ESQA 1INDH 2VITA 3QIUC 4LQFH 5I66B 3TIDB 3FQNA 5DS8B 4LLUB 4ZTPH 3L3OA 4Y89A 1U3HC 4OLXL 2RFXB 2P5ED 4KV5F 4K8RL 4JM2B 2IQ9H 5HI5D 2D7TH 1QSFD 1G7IA 2W0KA 4HWEL 4U3CA 4JFDB 1SJHA 4N5UA 2B2XH 5DYOA 4JRXD 2XQYK 1QQDB 3GFUA 4OM0L 2P8LA 2F53D 4UUJA 5JNYA 5LGHL 3D18A 2ZOKA 4MCZA 4Q6YA 4KRPB 1DZBA 1BX2A 2UWEA 1ZS8B 3GI8L 1VA9A 3EW3B 4MGXA 2FX8L 4XHQA 3EAKA 4ZO6A 3T0EB 1IMHC 4OI7A 3QUXA 3BW9B 2CK0L 3DVGA 4FFZL 1ACZA 1F4WH 4WW2B 4KROB 1T1ZB 3HMWL 5INCB 5H2BB 3ZE0E 5IWLC 1VKXA 4M03A 1G7HB 1EHXA 5C9JA 4G5ZL 2W91A 1T5XA 4XBGB 3TBWA 4HDIA 5DZNA 1WC7A 1QBMH 5T3ZE 2ADFL 3MNZA 4Y5YC 5FCSH 4EN3A 4WEBH 4O9HH 2YD2A 4QWWC 4R2GC 3QT2A 4U2YA 1F42A 3RQ3A 4KC3B 3RJDA 2E7HA 1MRFL 4MA1C 1ACYL 5E00A 3GSNB 3SPVA 3GUTB 3ARED 4UT9H 1GZQB 1PFCA 2R39A 4S1RL 5GQBA 1A14L 2VQUA 1FVEB 3BT2L 4LHUB 1B6DA 3NCFB 4WEUD 1KEML 3WUWG 3GJEB 5D2NC 1OTUD 2C26A 5C0JA 3UDWC 4IOFC 1E6JL 5JZ7C 3ZDXF 1JMZA 3UBXB 1ZA3B 5HY9A 3T4AA 3VGDA 2HTLD 3LKQB 3D87B 5SX5H 2ATKA 3L95B 3TYGH 4LASL 4BYHA 3W0WE 4ZSOE 2Q8BH 4OD2B 4G42A 4NYLA 1F3RB 2VWEE 3BKYH 1BFVH 4JFFD 3HFMH 3PGDB 4QOKB 2EXWD 4HH9A 2HA1A 4U6HB 1RZGB 1A6TA 3GI9L 4GRLA 2IH3B 4IIQB 3ISWA 3OKYA 2X4RA 1KJ2H 4YHYC 1N59A 2VLKA 3GJFA 2XNAB 4RAHA 4UQ2B 4XP9H 3MCLL 2ZWLT 1S3KH 5CKAA 1NMAH 2Q3ZA 1G6RB 2VXQL 5IJVB 4AYFA 4XPAH 4XP1L 4Z7VA 1RAMA 5KVGL 1MCBA 5EOQL 3GM8A 3NIGF 5F7EL 3QRGH 4M4RA 3W2DL 3SKUD 3CMOH 3QAZC 3KPOA 3HC3H 3IDIA 5J8OA 2Z0BA 3VFPB 1IAMA 2CGRH 4RGNC 3TF7A 3OXSA 5C7XH 2DQTH 4X7SL 2OR8A 4LGRB 2OJZL 1RK1A 3EIFA 3ARBD 3OV6A 4U6YA 3GBMH 1A3QA 2HJLB 2Y25A 4U1JA 4JZOB 2B1AL 4FQXC 2AJ3A 4AEHL 2FZ3B 3STBA 4JRYE 4UTBL 2R29H 4WI9A 5HGDB 2AXFB 3EOBB 4HUUA 3AU1A 5JIHA 5LVEA 2XQBL 3BGFB 4YGVA 2BY0A 1BD2B 4I48A 4JJ5A 1YPZA 4XGZA 2VAJA 3MNVA 1IAII 1S7VA 5GGRY 4IOIB 3JWNC 2H8PB 4UMGA 5ESVA 3FT4B 1Q94A 4RCAA 1T83C 2MPAH 3D3VB 4EDWL 5J57B 1U93A 4WU5A 4NSKB 4XNYH 1J7VR 3CVHL 4RFEB 4G43B 4M5YL 4E5XB 4R8WL 3FONA 2QQLH 3C2AH 5TF0A 1JNLH 1Z0NA 1EJ6A 2IPKB 3QIBB 4XHJC 5CBAB 4Z78B 4YBQD 3RP1A 3JXAA 2VZ3A 4P2QB 3QNZB 3MCG1 1ZHKB 4XC1H 3P73B 1C08A 3DX7B 5E2WH 3W11D 1SY6A 3MRFB 4L4TD 3FO2A 1ZXQA 1J1PH 3O6FB 4KMLB 1BREA 1OLLA 4E41B 1KJMA 3QDJA 5CJOL 4RZCA 3D85B 3W9EB 4HJGA 4O2CB 1UYWL 1WAAA 2JELH 1KN2H 1YEDA 2VB5A 1CDBA 3VFGL 5IMOB 1NC4A 4NJAL 5J6HA 4F7EB 3ZYIA 4JCMA 1DVFB 2BCKB 3Q6FA 2MFNA 5CSZB 2FR4A 3HNVL 1JV5A 3FKUS 3U46B 4KRNA 5EIIA 5IBLC 3RWHA 1UA6L 4RA3A 4WCYL 1C5CL 1VFAB 1R5IA 4MVBC 5F6IC 4EUPG 3FZUD 2OL3H 1FDLH 3DX9B 1XH3B 5I1KH 5K9KB 3V4VL 4JGUA 3H42H 4GAJL 5DVNA 4EI6A 5KANG 3O2WH 4GAFB 5E1HB 3WE6B 3WS6A 1TNMA 4S10A 4F2MA 2W60B 3HE7B 2CDEB 4FG6C 4PJ8C 4JPWH 3BX7C 2J8UE 2OSLB 1G9NL 2AV7A 3HUJF 3FOMB 1D7FA 3A67L 3WHE1 4N68A 2IBGA 4P5TC 3MCKA 1EPFA 1EJOL 1CVRA 3DXAD 1FSKC 2ORBL 5EU6E 3RIFF 2Y5EA 2CO6B 1EVUA 4OZHB 3JZ7A 1JHLL 3UO1L 5C0EA 3VWKB 3VA2C 1QBBA 4TSCL 3IYLW 2DOCA 3HG1E 1T0NB 5DEGA 1AC0A 4S1DD 4NT6B 1OGTA 5IW6B 2AXJA 4HK0B 5DEFA 3SCMB 3MBXL 3NOIA 5IHZA 4OFVA 4YHLL 1YEFL 3P9MB 1P7KB 3VFUB 1A3RL 5A1AA 5EU5A 4NZJA 4LIQE 2AJUH 1U3YA 2J5LC 4JRWA 2AJSL 1QYGL 2ZSWA 3QIWA 3I84A 3NIDE 3C5ZA 1EMTL 1JPFB 3CU7A 4R9HA 1EIBA 4Q6IC 5IEHB 4F8QA 3SQBA 1N6UA 3QDGD 1CICC 2A73B 4C54A 4WV1A 4ZFFB 2YPVL 4NQVA 5JOFA 4MQXC 4AK1A 1JK8A 1XGPA 1W8NA 2HT2D 3HA0A 4M6OL 2LU3A 4LMQI 4RWHA 2WUCL 5BVPH 1CDGA 1VESA 2I9LA 2WIIB 1T5WB 4MXVE 5IMLB 2JJUA 1JN6A 2E7LA 5LXGH 4OJFL 1C5BL 4M1GL 1X5JA 5J11B 4XNUL 4OF0A 3S4SA 2HMIC 3T3PF 3L3KB 4PRPD 5E9DA 2NXYB 2O61A 2H41A 3TO4C 4F9PC 1CGXA 3CXDH 4ELMA 3S37H 5D2LF 1A6VL 2PR4L 3DUSB 3H9HB 4EI5B 1BWMA 1D9KB 2IFFH 1QNZH 1CFTB 4KHTH 3TVMB 2FBJL 1BM3H 3VFRB 4MWFA 2X05A 3VXNB 4NC0B 2E9JA 4M9PA 5KW9L 2AXGB 1A21A 3PNWB 4O4YH 3SN6N 1YN6A 2JJWA 4ZO8A 5BS0B 3QR2A 3AC0A 4CW1A 4JJHA 3GMMA 3RZWA 4N8CH 4NNXB 1A6PA 5IKCA 2D03L 3L5WB 1PG7L 3V52L 4JG1H 2E6QA 1JNNH 4XAWL 4MMZC 4OF7A 5I16B 3VG0L 5JR1H 5D7SL 2DQHL 5IV2B 1N0XL 1RHFA 5BO1H 5DK2A 2EIDA 1CU4L 2Z91B 35C8H 3LKNB 1NBZA 4NO0A 1JFMA 4PJ5E 3U30C 3CVHB 2DWEA 4AIOA 2IH1B 3EHBD 1G7PA 2NY0C 2V5TA 1LQVA 4YDKH 3B2VH 3B8YA 1MIEL 3LRSA 2H9GA 2G5BA 1EAJA 1CDHA 1WGOA 2NYYD 1MLCA 1SJVA 3EFDH 5IB1B 4AT6B 5IIEB 3DSFL 2FJFB 1IGJA 3S6CA 3QXAB 5EZJA 3HE6C 1A6UH 3P3YA 4U4BA 5BZDA 3JTSB 5TDNB 2DQFA 4TTGA 4OGXL 5I74B 4TTDD 3DLQR 4PJ7A 3HNSH 5F7MC 4Y16D 3GMOB 1AQDA 2H3NB 2MCPL 4S1SH 4MNQB 3WO4C 5E99L 5GGQH 5I1HL 3BP7A 5DZLA 4ZUWB 4OT1H 2YPLE 5C70A 1BMGA 2X6MA 4KGLA 3BP5A 4KKBC 5JXEC 2CKBL 1KJ2A 1BJ8A 1ZHNB 2J6EH 2Q20A 1MI5B 1R3LA 1A1NB 2VDNH 5L8LB 5E08L 3ARFA 4N0CA 4XTRC 5E4EB 1NFDE 2P5WA 2W1NA 4R4BA 5CIPB 5FGBC 2FHCA 4YPGB 1SEQH 4JPIB 3LB6D 4N9GA 1BIIA 3NN8B 1RFDL 4JFHE 3DMMA 4PGEA 2BNQA 2X4OA 3TP4A 4LU5H 3KPPA 3LRGA 5GZOC 1XIWB 1G6VK 4WWKC 3BP4B 5F6HI 4OGYL 2XN9B 2L0DA 3HI1B 5JW4M 5I15H 1WZ1H 5FAAA 1JGUH 5D7LA 4I8DA 2VJXA 4QXUH 5GS1B 1JNHA 4OCWL 5CKGA 5IESH 3BN9C 1WVZA 3O3EB 1ZHBA 1MAKA 3UX9B 5J3HD 4YFEA 2VDRL 5I1AB 1NCAH 2PYED 4NQDD 5CSGA 2W0FA 4NO5A 1JUFA 1NDGB 5CP7B 2X4SB 4RA0C 1MCIA 2X9XA 1LO5A 1HHGB 1JWSA 2B0SL 2H2SD 3LKOB 5CUSH 3RWIB 1AXSA 3FB7B 2BRQA 1HOCA 4LLWA 4QRPE 2R0ZL 4PIRF 4M5ZH 3I6KA 1M7DB 4X6BB 3IDUA 3EYFA 4H88L 4HWZA 1DQQB 2IAMB 5B3JF 1KLGB 1JPTH 3AB0B 1NBYA 4V1DD 1I8LC 5E94A 3D2UD 4K94L 3VH8G 3DECA 5M94B 1U9KA 1DANU 1CIDA 1CXKA 4LCUB 3UPRA 1FFQA 3UJTL 2BOBA 5GS0L 4NO2B 2DYPB 2Z4QA 3RPKA 2ATPA 2DLFH 4HPYL 4G6JH 4LVOC 1UWGH 4H25B 3ARGD 4KKLC 1CQKA 4OLUL 1X4YA 2R2BB 3SDCC 1EHNA 3ULSB 2A2QT 5HDQH 4OCSL 4QYOA 3QUZD 3JBG7 4PLJD 5ILTL 3SOBL 5CGTA 5HYJA 5BXFA 1INEL 1ORQB 2ZKHH 1YMME 2C3VA 3FQTB 3L9RB 1MCWW 2ILLA 1D5ZB 4MA3A 2OP4L 4HF5H 3WNNA 1TFHA 4R90H 3P30L 3T77A 4NQEE 5DUBA 2FJHA 3UTSA 4IRSA 3SKNB 2OL3A 4FNLL 5MHSD 1D5MB 1CZ8H 4EVNB 3IF1A 2KL6A 3V8CA 2NY5H 4FZ8L 3RU8L 4HWBH 4MD5B 2LAAA 4WW1A 5LJYH 3BJ91 1IC5L 4X6DB 1FORH 3MV8D 4KJQD 5B4MD 1H3VA 3ARYA 1CGWA 1H5BC 4OSUH 3T0EA 4Y4FC 2HFGL 4F7MB 3BW9A 2OR9L 4MA7H 2EZ0C 1I1RA 3PP3H 4TQEL 3QUMB 5IGXH 2GEEA 2GJZB 4J4PD 3FN3A 5ALCH 5F1IB 4W6YB 25C8L 2R2EB 1FYTB 3ZTNH 1T1ZA 4JM4H 3PGFH 4MX7B 5INCA 5H2BA 1G7HA 5EU4A 1KG0B 4X4XB 2ZP0T 3ET9F 1NSNL 1MF2H 4PP2A 1WBYB 4AEIL 5FM4A 1RIHL 5LWYH 2C5DC 3TBSB 4X9FA 1WZLA 2NX5D 4X0KB 1CTOA 4Q0XH 3IAPA 1I3RB 4URTB 4RMQA 1ULVA 3I02A 3FHAA 5C3TA 3DUUB 3DUHA 1I8MB 3BPCB 5C0AB 1BFOA 1YYML 4Y2DB 4R0LA 3D39E 3QFJD 2NXZB 3MV9E 1PSKH 2NNAB 4HUNB 4HIJB 5HHQB 4MSWB 3G5YA 4G59A 1N7MH 1KJVA 3BKJL 1GZQA 4FP8H 4PJBA 3P0VH 1ZGLA 4PPTA 3T1FB 3HPLB 2D0GA 3AAZB 1EUTA 4JCLA 4M7LT 3W81A 2Q7YA 4K7FA 3MRLB 1ED3B 2BNUB 2GT9B 4OBRA 2HVKA 4AJ0A 1PX4A 1U58A 1DBBL 2JJVA 1UCBH 4YDLC 4JO1H 4JQVA 3UBXA 1ZA3A 2AV1B 2H6PB 4H8WH 3CZFB 4OTXL 2Z8SA 1O7SA 1GGBH 3NFSL 5E2JA 4ODVH 4KUZH 2JCCB 4J6RL 1KYOJ 4WUKH 1AKJD 1TPXC 3O8XD 4Z0XA 4OFYA 3PGDA 2DMCA 2VDQH 5JPNA 4G8IA 3B2UC 1CS6A 3K8LA 4U6HA 1RZGA 1T22B 2A1WH 4JN1L 5E8DL 4KDTC 1T80A 2ZUVA 3O0RH 5LCVH 4U7MA 4JO3L 3VXRD 3NA9H 5GHWL 3DO3A 4G8GB 5CZXD 4ZS6C 5T3XD 2FSEA 4NFDA 2QADC 4LSPH 4NUJB 2YMXL 4G6AC 5F8QC 2QSVA 4WFHE 2CDGA 1KN4H 4ZOEA 3SGEH 4ZNEE 3O11B 1BFSA 2Y6SC 3M17B 1I1CA 3DURB 3TH4T 4WTZA 4NQCD 5EU3B 2ZUTA 2ZPKH 3MFFB 3RKDD 5JW5B 1MH5A 4I3RL 4NN5C 3WNKA 3LH2L 1OGAD 3HRZB 4HJJL 1CGVA 3FN0H 5L8JB 3REVA 3SJVE 2AJXL 2P44B 4K9EH 4PLKD 4XCCH 3ECBA 1G0YR 4Q7DA 1A7QH 4HUMB 4FQJL 2HJLA 2FGWL 2YUXA 4JZOA 2FZ3A 1N2RB 1PKOA 3QWRD 1F90H 4F57L 3BRGC 2VN7A 3MJ8A 1N64L 3C6LB 5GGTH 4MXWH 2ADJB 4JVPA 3T2NL 4JREC 4KMTL 5CD3B 1NL0L 2WMPA 3UTTB 3GMLA 3TN0A 3L1OH 1A4JA 4POZD 5ID0B 4CGTA 1A7PL 4FXLA 4AM0A 1DR9A 5D1ZC 1TZIA 5DO2C 1B0GB 1T0MB 1RIUL 3X13A 5HHME 4G8EA 3FT4A 4CMMA 4U2ZA 3V0WH 3DX6A 2V5SA 1Y18A 3CIQA 3CFBA 4JKPL 4RFEA 5D1QB 4G43A 4NKOA 4E5XA 2R0WL 1ZAGA 3ZL4H 1E4XL 3HMXL 4HMEA 5CBAA 4Z78A 1T7WA 4PRNA 5IFHL 5IB3B 3DPBA 1J9CT 2NY6D 4KUCF 3RJQB 4P2QA 3QNZA 3P73A 1A9EB 2OR7A 5DFTA 1UGNA 2C9AA 3ESVF 1YEKL 3PWJB 3O6MH 1QSFA 3IJYB 4OZGA 1UXSB 2PKDA 4XC3H 3O6FA 4M1CD 4F7TA 4EUPB 5ADOL 5I1IH 1IT9L 3W9EA 4JRXA 4O2CA 3RY5A 1X9QA 3B5GA 3QHZH 2P48B 5JHLH 1NGYA 1LK2B 1OAZL 2EYRB 4A6YL 4PV9A 3HLAA 4HMDA 4YHOL 3IAGC 5IMOA 2BFVL 2IBBA 2ZSVA 4HUVB 2W9LA 4Y4HC 4M61B 2BVTA 4MNHB 4PJXA 4LQ1A 2YD3A 4QTIH 5FHAH 2EDYA 3U46A 4I9WD 4KK9C 4FABL 2QHRH 5KVDH 2VH5L 1KT2A 4YFLI 4RMWA 2WP3T 5C0CE 5HYSG 3BZFB 4U6VH 1JHTB 2J12B 2Q86A 5EFIA 1XH3A 1A7RL 5K9KA 1U8HA 5IHUL 1I8KA 1RJCA 1JNJA 4L3ED 1CGTA 4G3YL 2XTJB 4LEXL 4LKXB 5DLML 3IJHA 2O5ZH 2EO1A 2W60A 3NMEA 4MA1B 1WFNA 1T3FA 2OSLA 4MAYB 5EWIH 1FN4B 2ZG1A 3MLPA 5L6YH 3Q5OA 3N1FC 4DGVL 1P4LB 4WVRA 3QFDB 2WBJB 1IC7H 3AREA 2EDFA 2YK1L 3KPLA 1SVZA 2H32H 4OZHA 4IRJB 3B3IA 4LCCB 3VWKA 4K71C 4L8SB 3WFBH 3SDXB 4E0RB 1IGMH 5JUEL 1T0NA 4PY7B 4NT6A 4HPOL 4LPXA 5TE4L 3S88L 1TXKA 5L9DL 1F45A 4DVBB 5IW6A 1QP1A 4HIHA 1WCBB 4KI1A 1TQBC 3RI5F 1AIFB 4LPYA 4WUUB 3VXME 1P7KA 1B0RB 4HXBL 4PJFE 3BHBB 5EUKA 4R4FL 4CKVX 4P2OC 4Z7OE 5IEHA 5JW3H 1MRDH 3O6LH 2ZUWA 3ES6A 1AC6A 2BXYA 1QA9A 4FFYH 5D7IE 5FHBH 4G9FE 3O4LE 2OJEA 4QTHA 3KWWA 5JHDE 3VXUD 5FO9B 3U2SB 4H0HB 3EYOA 4HBCH 4TUKL 4YUEH 1CCZA 4NBZB 1FBIL 2GJ6E 3KLAA 2WIIA 1GHFL 1P2CB 2YRPA 5FYJE 2QSCL 5IMLA 1UZ6F 2FEEI 3TJHD 4PJDE 4BFIB 1YC8A 1F3DH 3IVKB 5AWNL 4JGJA 4AH2A 4CADA 2EDLA 2BVQA 4HFUL 3CJJA 4Q9QH 4NJ9L 3RUGE 1R0AL 1J8HD 2DS4A 1G7QB 4HWBA 5EC2A 1MCPH 4PJEA 4TPRL 1FZMB 4X99B 1BQHG 4PR5B 1NGXA 5J1TC 4ETYA 3DV4B 5I8OH 3UBXI 1LD9B 1SYSA 1T7VA 3LPFA 3OZ9L 2VLJD 2DQDL 4OZIB 1S9WA 3QCVH 1I7ZB 1PLGL 1QLEL 3EJYC 3OL2A 3V6ZA 1D6EB 2UZYB 4IDJL 3U4BH 2WNGA 2EDEA 1DFBL 4MCYB 2GCYA 2VC2H 2W65A 2Y06L 3HPJB 3MBEB 5DJXB 3KR3H 5BRZE 1FNGB 4P5KB 5BS0A 3U0PA 4HJ0D 3TFKD 5D5ME 3RAJL 4P9HC 4QXGL 2AGJL 3O3UN 6FABH 1YNLH 4PJHB 3WS3B 4JQXC 4XI5D 4NNXA 3EO1B 4MNGB 3NIFF 2A6DA 4KPHL 4CDGC 2DLEA 2FB4L 1ZT1B 4L4VB 5DWUH 4GRMA 5D72L 3IDMB 1K8DA 5L2JA 1WEJL 5A2LH 3OKOA 4MMXC 2HKFL 3QUYC 4NKIL 1T66D 5I16A 5HDBE 1A3LH 1UM4H 1IKNC 1AE6L 4PJIE 4UT6L 1CXFA 1ETZA 4D9LL 5CJ5A 1JPSL 5FK9A 3VGAC 4OQ1A 1OAKL 5D96B 4I13B 4GSDH 1XF1A 3GEWB 3KS0J 5KSBF 1MFDH 3CFDA 3MR9B 3RWDB 5IMMA 4XAKD 5FOBB 5JDJA 1CT8B 3MOQA 3GK8H 4D0DA 1KPRB 1OAYL 4AT6A 5IIEA 2FJFA 4S2SB 1CI5A 2AK4D 1IBGL 3LSOB 1FGNL 3QXAA 1I9IH 3RVUD 5IB2A 5EO0B 1LO4H 5GISL 5K9QG 1T7ZA 4PJGE 1HDMA 3TH2T 4RMVA 4U3HA 2N7BA 3HC4H 1JP5A 3MOBH 1Z0MA 2IANE 1KJ3L 1RK0B 4HIIA 4M6NL 4K8RD 1DN2A 1WTGT 4MNQA 4ORGA 4NUGH 3MV7D 3QQ3A 3QXTA 1A2YB 1XCTA 4P3WA 5GZNC 5I6XB 2E7CA 5H94B 4DN3H 4F3FB 1MI5A 3F7PC 2J4WH 5F7LB 1BQLH 3ZLQC 5DRXB 4M7JH 2JLLA 3P9LB 4OLVL 3LD8C 3KNBA 4YIQA 1NBVH 3QCUL 2O5XL 3B9EA 5DJYB 4EUPH 1Q1JL 1EX0A 4KXZH 2UWEE 1MAML 1ZA6B 2RQ8A 4PUBL 2GITA 3V79C 2Y9RT 1BEYH 1FSKB 1IQWH 5T33H 2VZOA 2P8PA 4UV4H 3OG6B 5JIIA 3DETC 5GRJH 2ICCA 4BZ2H 1XGYH 2BRRH 4J3WA 5JO5A 1WWAX 3OTTA 3DXAA 5GS1A 2QQNL 5D6CB 4MJID 4YHNB 3VRLE 3I50H 4Z7UF 4JANA 5DMKB 5EB9A 3ZKSD 4LMQE 5FO7B 5GGTA 2VDLH 1FH5L 43C9B 5C92A 1NDGA 1FLRH 4QGYA 1OAXL 5CILL 1KIRB 3DX8B 1HHGA 3EOAB 3LKOA 3PABA 4Q6IB 3NZHL 1M05B 1QRND 3GMRA 3QG7L 1N26A 1IFHH 4KK5C 5C1MB 2RHEA 5M95B 1G0DA 4JFPB 1VGKB 1GAFL 4U1KB 4GS7B 3W0WB 4BZ1L 4ZSOB 1FIGH 1I9RH 4HIXH 1DQQA 3SO3B 2IAMA 3LRHA 1B90A 3OXRB 1CL7L 4PYHA 3VXQA 1X4ZA 3HI5L 3P40A 3Q5TA 1JHKL 4TVPD 1YECH 2DM7A 1B2WH 3O9WD 3PL6B 4GKNB 4JPVL 2HWZH 4NHCL 4H0IA 3BD4A 3CDGB 3FB8A 3FB5B 1NLBL 5IBTH 3GNMH 4WFEE 4HLJA 3TO4B 3V6FA 2NLJB 4KI5E 3NH7L 3O3DA 5HD8D 5IJKA 1FG2A 3ULSA 3EDJA 2DQJL 3NABH 1CDUA 4PRPA 1G7MB 5DD6B 1FRGL 1MHPL 5GRUH 1XCQA 5CINH 5MI0B 4D3CL 2GK0A 4ZOCA 4LFHD 5T1LA 5AD0B 5IROC 2C1OA 4FFEX 1RUPL 4YJZL 4J3UA 1BQSA 4ENEC 4Z7VE 5HHPB 3R8BB 2YWYA 2B5IB 3DGGB 1QG3A 3GSQB 3LN4A 3SKNA 4JQIL 1EFXD 2VLRA 4EJ1C 4GBXB 5HHOD 1KCRH 4JLRA 4JRYB 1N5YL 2DB8A 3ETBF 3K1KC 2NW2A 3CFEB 4AL8H 3WHXA 3S9DB 1DDHB 1RY7B 2UYLA 3MODL 2R2CA 3D1MC 4HS6B 2FYYA 3IETB 3ULVC 4RAVB 5E0QA 1T0PB 3DV6B 1TCRB 2W38A 2ZG3A 3CK0H 3VFTA 4U1IB 1L7IH 1Q9KB 1T20A 4NFBA 5EOCH 1PEWA 1AQKH 3MUY1 4F7MA 1UB6B 1KCUH 1QFWI 1IZKA 3VWJB 4L1DA 1UC6A 2R4SH 3CAFA 2R2EA 1FYTA 2JE8A 4Z7WF 2Z35A 3ILQD 2Q76B 4KJPC 5A40E 2NY4C 5CCKH 4PG9B 1I9JH 3I6GA 1GGYA 5I8KH 3EYQC 1YJDH 1E6OL 1WBYA 4I18A 1NCBL 3MMEB 5ETUB 2Z9TA 1XEDA 3TBSA 4X0KA 1YEEH 4YE4H 5MEPA 5DMIL 5DUPH 2CPCA 4HFWB 3AY4A 3WUWA 4WHTB 3NVQA 1BBDL 2QQKH 5FDWB 4M02A 1EUUA 1XF2A 4Y2DA 1HCVA 4IHOA 2HFEA 3RGVB 1OSZB 4QRRB 1OSPL 2NNAA 4OD1H 4HCRA 5HHQA 1R3IH 1X6NA 4HT1H 4P2RD 1FFNA 3WIFA 3MLUH 3D0VA 3HPLA 3KVQA 5DVMA 3MRLA 2BNUA 4LPWA 1IC1A 3WJJC 1IGIL 1F4YL 4HH8A 5J12B 2H6PA 3CLFL 5LQBH 2E6JA 3MOAL 4LSTH 4HX1B 2JJTA 4PGBA 2JB5H 3VDCA 2DTSA 5KS9A 1WAAE 2JCCA 4GXVL 3BPNC 2C3HA 1J0YA 4MYWB 2DQGL 2VDKH 3UCRA 5CEZE 4CVXB 3ESUF 4Q58C 4ZAKD 3WNPA 5HVFB 4WIQA 3FFCB 2J8UB 2CUHA 2V2TB 4AEFA 5E5RB 1M1SA 4QLRA 3BD3A 5GXBB 2Z31C 1D5XB 4JY5H 5ECJE 3VDBA 2HH0H 2SEBB 5EORL 3UPAA 5E4IA 5ELIA 5C6TL 4FXGB 3HZVA 1F4HA 5EU6B 5DDHB 4NUJA 2VISB 3MLVH 4CBPA 3VDAA 5HDOA 3FO1B 5LG1A 3HG1B 4IJ3B 1T1YA 1XIWD 4MZ2A 2VKXA 3O11A 5FYKU 3DGCR 2PYEA 2NY3D 3NTCL 1B3JA 2V2WA 3MRCB 1D6VH 1MREL 3TNMA 4DKAA 4Z7NF 5JW5A 1KC5L 1K9TA 1DCLA 5C0BD 4GUPA 3NPZB 3QDHA 5IFAH 5DC0A 1S5IL 3IAQA 1HHHA 4WU7B 3TPUB 2AEWA 1KBGH 2VYRE 4JHAH 5ERWB 3SGEI 1F3JB 4CN1A 5CZKA 5F72S 1QFWM 5I75B 5DJDB 1QHOA 5D1XD 3C60D 5HYQB 4N5ED 3PWPB 5HHNA 5K9JH 1K5NB 3MGTA 1RU9L 4WI8A 2A0LD 1CE1H 3GRWA 3JTCA 3T0DA 4JFZL 1U92B 1WCQA 5B8CB 3ARGA 4JEGB 1T0MA 4QCIB 2P8MB 1U8PB 4RGMC 4QNPF 1KIPB 4FFWC 4QGTA 2EDKA 3WIHL 2P43B 1ZEAL 4ERSL 2BSSB 1G9MC 3WKNA 3HZYA 1K8IB 2OZ4A 4MA8L 3I3BA 5D1QA 3DI3B 1KPVB 5J9PA 15C8H 4P46B 5CJXA 5ACZB 1A7NL 2YRLA 4GRLC 2AEIT 4LNVA 5E9DE 1XFPA 4K3DH 4LAQL 4NP4L 3OPZL 1NGPL 1RUMH 1A9EA 4PP1D 1F00I 3TBTB 4D9RD 4ZS7H 3PWJA 3TNNB 1ZTXL 3KPSE 5F7YC 1X5GA 4EUPA 5HYSB 2CIIA 1IGYA 2AABL 2IBZY 3ULUE 1A64A 5I1JL 5DRWB 3N9GH 5E2TL 1Z9MA 2FATL 4BKLA 4HC1H 1YC7A 3MV8A 4P4RA 3VE0B 1IRAY 2XZCH 1F11B 1LO0H 1A7OH 4HGWA 2PW2A 4KJWD 4MNHA 3EZ8A 2DN7A 2IF7A 4LCWE 3CNKA 1CE6B 1QRKA 2UZIH 4XBPA 4JFYB 2A83A 4O58L 2WWMC 4PJ5B 4ZFOL 4Y88A 1PW3A 5SWZA 3EOTH 1BLNB 4EZMA 4XP5H 3AMKA 4LDOB 2ICEA 3LEVL 3MXVH 4JZJA 2NY2C 1NAMB 4R4ND 1MFAH 3DIFA 3BKCL 2GW5A 2NX5A 4EIZC 5C9KA 3TWCH 2LTQC 1E4JA 1P4LA 3QH3A 4RQQA 4PRHD 4TNVF 2QJDA 4M48L 1MHEA 4JKWA 1ZWIB 3QFJA 4L9LB 3KYOB 2WBJA 3IJSB 5IVXE 1FCCA 3QB7C 5DVKA 3GIVB 2I60H 1EEZB 5CLWA 4IRJA 2FJGB 2D31A 4DFHA 3EYSL 4YDLB 1FC2D 2C7UB 5K9OB 3IFNL 5F96L 5KSAB 1EEYB 12E8H 1JL8A 1NMCB 4PY7A 3ARZA 3GM0A 2YPLB 3VRJB 3BRFA 1MRCL 3SGKA 4PJCF 3IGAA 4KAQL 4XB8A 4CVWA 2YEZA 4WUUA 1MLBA 4OF8A 3CSPA 4K23L 4OM1L 4MB3A 1B0RA 1PD6A 1BAFH 3PGCA 3ROLB 1YQ2A 1FNSH 5DJ2A 4G6ML 5D7JB 3TT3L 4JR9H 1DUZB 3GSVB 2WBKA 1NFDB 5DD5L 5EOTB 3IFPB 4LL9A 1GGIH 1AKJA 2DTMH 4P23B 3O8XA 4LSRL 2HRPL 1E28A 2A77H 4K8RH 1FVDA 4RNRB 2I27N 3E6FB 1GGCH 2DM2A 4Z76B 1HXYA 4HWEH 5FO9A 3CXHK 1P4IH 3T4YA 1KCKA 1BQHB 4D9QD 2IQAB 3EZJB 1IGFH 2P5WE 1ZT4B 4FQQA 1JJUA 5HTSA 2VUOA 5F9OL 4MXQA 3RWEA 1UJTA 1VPOL 3E8UL 2BNRD 2BNQE 5DJZB 2V2XA 1S9XB 4P2CG 5AZ2L 4PREA 3PP4L 4NKQB 1G7QA 4PTTB 4PD4J 3WS6C 1AFVH 1EBPA 4P4KD 4TNWF 3G08B 4X99A 4NQCA 3BSZH 3AS3A 4X4YA 3VGGA 4EOWH 5D7LE 3NACL 1LD9A 1OGAA 2HKHH 2F19H 4BELD 4YR6B 4QRPB 3V5KA 2DLIA 5B38B 4OZIA 5A3IC 1QSEB 2HLFD 4BQ8A 4GMSL 1D6EA 1HXMB 4G6FD 3RTQB 4MCYA 1XGQB 3FRUB 1EO5A 1GH7A 1DL7H 4P9HL 1CGSH 1FNGA 3Q6GH 3ARRA 4OZFG 5EPMB 3ALWA 3RI5K 3G6JA 1NUNB 3QWRA 1MRFH 2F5BH 2G60H 4XVSH 1ACYH 3IU3B 5CHNB 4MNGA 1ZT1A 4L4VA 3BDXA 1OTSD 2BSRB 1MFCL 4F8TA 1W0WB 3STZB 4LLQA 3IXAA 3Q0HA 5GSRA 4LIQH 4ODWB 3CVIL 2RCSH 4QHMB 2CMRL 4GG8B 1X44A 2A9NH 4RBPH 4EQ3A 3BYTA 2VZTA 3UROR 4NM4L 4ONFL 1L0XA 1YYLL 4WV1C 1YMMB 2ERJC 3K8MA 3WFEL 3KJ4B 1KPRA 4LVNC 4TVPH 2XACC 4QRTA 3UP1A 1S7QA 4R96A 1KTDB 2V9RA 2PO6C 3LSOA 4LLAA 1DE4B 1HI6A 3FHQA 4NQEB 4OIIH 5EO0A