2PO6A

Crystal structure of cd1d-lipid-antigen complexed with beta-2-microglobulin, nkt15 alpha-chain and nkt15 beta-chain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d
publication title CD1d-lipid-antigen recognition by the semi-invariant NKT T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein/immune system
total genus 62
structure length 275
sequence length 275
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2po6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2po6A01
3JSSA 3BW9A 43C9B 4N5ED 5INCA 5JPMA 1U8OA 4JM4H 4JR9L 1C5DB 2YPKB 3KNBB 4X4YB 4EDWH 2ZNXA 4KMTL 2HJLA 5FOJA 5L2KB 1Z0NA 5LWYH 3EO0B 1X5KA 4G5ZH 2RIKA 4UTBH 5DWUH 1A2YA 5DRZB 4OZIF 3MCLH 2HA1A 4GUPA 4PJGB 1RZ8B 4HPYH 4ODWB 1FZMA 3M17B 3I6GA 3I50H 5EA0H 2W0KA 1YQVL 1G1YA 4GH7B 3OKEB 5DHYB 2AEQL 4ZSOB 1INQB 2VDQH 3K8MA 4X4MA 5GGSY 3WNNA 3GBNL 4I3GA 3E6HA 1AGBA 4L8SA 1G6RH 1NEZA 4X7FC 1U91B 2LU7A 2VDKH 1RV6X 4U1GB 2N7BA 3QUMA 2Y6SD 4YO0B 3TT1H 4NO0B 4Y4FD 1LO0L 4QRUB 3ARGC 4HBCH 3CVIL 2B7DT 5CSBA 3HI1A 3DTXB 3HMXA 1KJ3L 3QEQB 1CFVH 4JAMB 2WANA 1JGDA 1BF2A 2VLKE 3JUYA 4FZ8L 4MGXA 2VDOL 3LB6D 2E9BA 5EU5A 1JPST 2PYFA 3NIGF 4U0RC 4HC1L 4YDIL 4UTAH 4WDIB 1P4IH 1IKFH 3OZ9H 3WNLA 3U9PH 4HS3A 5A40E 4M03A 1FZJB 5DI8A 3E3QE 1ORSB 3RY4A 4K3DL 4J6RH 3SDCA 3SDAC 4P23C 1RZFH 4G3YH 4JM2D 4XGZB 2R1WB 4ETQA 1G7IA 3UPRB 4LHJB 2CQVA 1MCWW 4Q9CA 4CUCA 3UEZA 4MVBA 4X5XA 1S7QB 3VFNB 2J88L 2O5YL 1FBIL 4YWGH 2VIRA 2OTPA 3MLPA 2O61B 2VLKD 3UP1A 1LEKA 3A6CH 1HXMB 4ODHH 1UXSB 4XVSL 1MAML 4RISL 2IALB 3U83A 2A0LD 4OF0A 2P8MB 5GSVA 5EO9A 4R0LA 3NTCL 3T0EE 3VA2C 3QO1B 3ECBB 1YY8A 1MPAH 4MVBD 2RR3A 3S34L 4OQTL 2C3GA 3ARBB 4ZO6A 4RQQA 5I8EB 1F13A 3JWOL 4B7IA 1E4WL 4LLQB 3SGKC 4D0DA 5FYJU 5D1ZA 1EVTC 2FECL 1H5BC 3NACH 1KPVA 4ZUVB 1K6QL 3OF6D 4MB5A 3SO3B 4ERSL 1KOAA 4UZGA 3FCTA 1W8OA 3NABL 2YXFA 4U33A 4WHYH 3P30L 5DD6B 4HT1H 3K81A 4GAYB 4NQXA 4HKBA 3NCJL 5HHOA 4FQJH 2FL5A 3T0ED 5DHVB 4MQ7A 1HOCB 1IEBA 3MV11 5I17A 1I1FB 1WBXA 3VGAB 4K9EH 2MQ0A 1YNLL 5LGJB 2HTLD 1A6AA 1NBQA 1GC1C 4XNYH 3SKNA 4G6FD 4J4PD 5E0QA 2ERJB 2WBJA 4S11A 1KYOJ 4XXCC 1BOGA 3RWIB 5C6TL 4PFEA 5FKAA 1AJ7L 4JDTH 1NCAL 4TULH 1CDCA 5I19L 3SEPA 1I1CA 5EZOH 5T33L 2VXUL 2HFFB 4L9LB 3IDJA 2DTML 5ICZB 1VCAA 1ZHNB 4RAVA 4X80H 4ZAKD 2ESVE 2BC4B 4JFQB 1NFKA 4YE4L 1UKQA 5E2TL 1IQDA 5J3HC 3LQMA 5D71H 3C9NB 2H32A 3H9SB 4WTZA 1KC5L 1FG2A 3O6FB 4OV5B 2AKRA 2JJTA 5DRNA 1AHWC 3QUXD 5CGTA 2OR9H 4ZPVA 1CICA 1QPXA 2W65B 3FRPA 3D3VE 3TF7C 1DJSA 4BZ1H 1LK2A 4QTIH 1FQ9C 5GGRY 3THMH 1U8IB 3VI3F 4P2RB 1NFDE 1CGYA 4X7EC 4WI5A 3HI6H 1JWSB 4XMLH 4PRAA 3DV6B 4GRWB 1WV7T 4XWOC 1OCWL 2ESVD 3KJ4B 3OV6A 5DJXB 2DS4A 1A3LH 3ULSB 3UCRA 4DK3A 1XR9B 2C9AA 1UM4H 3UJIH 3W39A 1WBZB 4LCUA 4C4KT 5EUKA 5D8JH 4C54A 4OLZH 1ZT4B 4XNQA 1T7ZA 1VFBB 4YPJA 5JXEC 1BAFL 1OPGL 4JKLA 1PX4A 1M7IB 5T1MA 1I75A 3PWLB 3D3VD 3S35H 1BFVL 4JB9H 5J13B 3EDJA 3ULUC 4Q58C 3KYOB 3ORJA 5CJ8A 3MFFA 3TZVD 3MSPA 5CD3A 3MRGB 3QCUH 1BWMA 4WY7H 2P8PA 1UM6L 3R1GL 3BFOA 1T7WA 4FZEH 5B22A 3Q5OA 4JN1H 2V2TA 1PQZA 4OI9A 3MBEB 4JZJB 4PP8C 3ME0A 4MDIB 2VDML 5GGTH 3D9AH 5HPOA 4PJFE 1HKLH 5CJOH 5I1GL 4HK3N 3TIEB 2XRAL 4L29B 1WIPA 5I6XC 2G60H 2VC2H 1I85A 5JZ7D 1YEEL 4Y8DC 1KIUA 5EBMB 2CIIB 3LCYA 1DEDA 5GISH 2X4UB 2X1XR 3DROA 4L1DA 5FK9A 5E2WH 5I2IA 4QTHB 4KTEL 3UPCA 2V5RA 4LLMB 1MFCH 1T7YA 4LGSB 1T22A 1HHJB 3FONA 3TV3H 5CUSH 5MP6L 4RAUB 4D94A 3KDMB 1JE6A 1U58A 4L1HA 3VFGH 4PJIF 5TDOA 1I3GL 5F3HA 4PJ7E 1NLBL 4MJIA 1PJ9A 4I5BA 2IFGA 3STBA 2IGFL 4XPBH 4CN4A 5F6HI 1JFMA 1EEZB 4YHML 3TCXA 1UGNA 4PG9A 1CDYA 2HJKA 1J1XH 4FQ1L 4WTWA 2D7PA 3ZE0E 1OQXA 1DANU 2W9EL 1UWGL 1CF8L 4BFIA 3H7LA 4DZBA 3MLXL 3GKWL 4NRXB 5IESL 2AK1H 3RDTC 5FDYA 2VLLA 4PLJC 1YYML 4DVBA 2DDQL 4M7LL 4HUUB 3CZJA 4MAYC 1TJGH 4TUOA 3UYPA 1HSBA 3QUYA 5DRWA 3WFCH 2BHZA 5CJXA 1DBKH 1NDMA 1X4YA 3HRPA 4XTRC 3OHXA 2VWEE 4S2SA 3QP3A 4DCQB 3A6OA 1JPGB 1ZGLM 4PJXB 1T0PB 5F8QC 4OZIE 2C3HA 4Y5VC 4R90H 1T20A 4HUXB 1RHHB 2QKIB 1DFBH 1WZKA 4EN3D 1EHNA 4K2UL 3UYRL 3V6OE 3D39E 5DFVD 4I3SH 5I1JL 4ONFL 2W60A 3K2UL 3CDGA 4GBXB 1JPTL 5J4MA 4NN7C 2ENSA 1VESA 4QCIA 3U4AA 4JKWA 1T7XA 5HHVL 2NY5C 5TGBA 4HUWB 4CMHB 2GITB 4I0PC 4OLEA 1UB6B 4JRXB 1D9KA 2ICCA 1MCCA 3LS4H 1UCBL 4MCYA 1VENA 3QWQB 3S5LB 3TFKC 2XQYK 1RZKH 2B2XH 5ERWB 2WV3A 1RUQH 5DQ9A 3LKPA 2WK2A 1TJHH 3M1BA 3ARFD 3D39D 1IZJA 1MREL 1I1AB 1U2HA 2PCPA 3C2AH 3FFCB 1KB5H 3GSVB 3IDUA 1T83A 3MRDB 3DIFA 3LKOB 1W72H 5DUBB 4XBEL 1FNAA 2YPLB 1X3DA 5ENWA 3BUYA 4LU5H 5DK0B 1NC2D 1E6JL 4QHNB 4Z8FH 5B21A 4K3HA 3U0WH 5F88A 5IMKB 4U1IA 1S9XB 4BSVB 5HYSA 2BRRH 1CDHA 2OM5A 3CSBA 4R26H 4NZRL 1PLGL 4ZG1A 2AJ3B 5C08E 5FUZH 3LDBC 4X6FB 3WS6A 4QHLA 5C09E 1N26A 3CX2A 1I1YB 4QHMB 4ZFZB 5BVPH 3FOLA 4K3JH 5ANMB 3GMNA 3I6LE 1BREA 3ARTA 1MFEL 3T3ME 1AD9A 3GIVB 1Z6JT 1HHKA 5ETUA 2NYYC 3HZYB 4U6HA 1UVQA 1W0YT 5K59F 4D9LH 4FQXA 4PR5A 1VADA 5EOQL 2BCKB 32C2B 5LBSH 4OF5A 3TYGH 4Z7UB 2V2XA 3G5ZA 4NHUE 2AJVH 4OZGF 5MEQA 1J8HA 5C08D 5A16A 1UKSA 3HG1B 3ARED 1PG7W 1AD0B 2C1OA 1FV1B 5C09D 4NHUA 2VH5L 3RL2B 1KCSL 3KPSA 3WV0A 3MJ9H 4WV1A 1IE5A 3TCLB 3I6LD 5ESVA 1KELH 1LHZA 2R8SL 2GFBB 1QRNA 1P1ZB 3P4NB 4FQCH 1OF2A 3DVGA 3WBDA 4U6XA 1LWRA 1P4LA 4WI8A 4WO4B 1QFWI 2IPTL 3ALPA 4MD5A 5TE4H 1IAOA 1MCNA 4OLWH 3GI9L 4D9RE 4U05A 2IQAB 3QSKB 2OMNA 1DQLH 3X14A 4ONHA 1VEOA 1ULVA 5CGYD 1KCKA 3EYUL 4IS6B 1MF2H 3BPNC 4ZFOL 3KPSD 2UVEA 3HC3H 4GMSL 2X9YA 2H9GA 3ALXA 4KVCH 1S7TB 5C1MB 5JOPE 1U8NB 3G04A 2ZOKA 3K46A 4ENED 4F8QA 4ZOCA 4I18A 4WWKD 3LEYH 4PB9H 2ICEB 1I4FB 4GW4A 2QR0B 5IMOA 1IM9A 2EZ0C 2HWZH 2DM7A 5TQ0L 4D9RD 5MEOA 1A0QH 5ID0A 1KJ2A 1P7QA 3RZCA 12E8H 4PRPE 3VI3E 3LH2L 2AK4B 2Z92A 3NN8A 4LIQL 5T1KB 1WLHA 3C60C 2CK2A 4E42B 1NMCB 4Q6IB 4UINH 3P0YH 5JOPD 5BJTB 4P3WA 2NZ9D 2OCFD 4KRPC 1QFUL 4PJ8C 2GTZB 3BP7B 5B39A 3Q3GA 3U36A 2M8XA 1ZANL 1SYSA 1G9ML 4ZUSB 3PNWA 3P9LA 1S7XB 3VXRB 4PRPD 2P49B 3G5VB 3U30B 2HJFB 4U0RB 1A5FH 1OAKH 2AW2A 3ALWA 5E8DH 1U41A 5GZNC 5CZXC 1K4CA 3GMLB 2FBJL 4AIXA 3DNKA 3GHBL 5CEXA 5GRVL 3SKUD 4MZ2A 4OIAA 4HFUH 5DMGC 1AI1H 1ZT1B 1I8IA 4ZFGL 5GS2H 4MNHB 5J1TC 2HVKB 1JTTA 2EDTA 1T04A 3S36X 2GI7A 4F37F 2ED7A 2EE9A 2M1KA 2VDPH 4OLXH 4XPTL 4QXUL 5IB1A 3VFOA 2QSVA 4N0UB 5C92A 4XAWH 4F57L 2X4SB 1OD7A 3V8OA 1DQML 2OI9C 4NSKA 3VG0L 3QR2A 1S7RB 4X7TA 3U4BH 3GGWA 1H9VA 3CU7A 5AUMA 5EU7E 3IDXL 1TVHA 3MFGB 3S96A 1R5IB 4PJIE 1EUTA 3GSNH 3TN0C 1NCDH 2WUCH 5GGRB 5FGBA 4X6EB 1KIPB 4P5TB 5D7SL 4MD4A 4PJIA 5IVZA 5TE6L 3W9EA 2B0SL 1UYWL 1G9NC 5IJVB 3UPAA 5E99L 4PJBB 5F1KC 1UQSA 5F9JB 4NFDA 3LQAC 1QYGH 3O9WC 4JFPA 4LVOC 4BZ2L 5MEPB 4YDLC 3BHBB 3L3OB 3UDWC 1BX2B 1TTUA 4XP6H 1HH9A 1UEYA 3FT4A 2ZZUT 1Y6NR 4QXTB 1HZHL 2JB6B 4YXLH 3S7GA 3U0PB 1OW0A 2CK0H 1OTSD 3MO1A 3WJJC 3CFKB 4N0FA 4LCIH 2JK5A 1CD8A 4OBRA 2XT1B 3DX9B 2Q6WB 5D9SA 5D1QD 3BXNB 2PW2A 1YYLL 3QRFM 4PJGF 3CAFA 3QDJA 3K4DA 5T3XE 2DLFH 1IAMA 5BRZE 5I16A 1XGYL 4KJPC 4CDHA 4IRZL 3MLVL 3OB8A 1EFXD 3CCHA 2Z91B 1WCBA 4YBQC 1D5ZB 1DBMH 1W8NA 4N0CC 3WXVL 5FA3A 3L3IB 3DLQR 1CQYA 1U95A 4NKIH 3Q6GH 3ZKNC 5DQDL 2IFFH 1F90H 4F7TA 4OCLC 3MRKB 1MFBL 1NLDH 1QEWA 3MRRA 5IQ9A 2JJSC 3RBGA 3L3DA 4PJ9D 5EOTB 5I0ZA 5C0EA 1BEYL 2QADB 4QF1A 2VR4A 2RAMA 5CIPB 1GGCL 5T3XD 2EEAA 4PRIA 4M61B 1P7KA 5BRZD 2YD6A 3BN3B 2YZ1A 2E7MA 4XHJC 1ZMYA 3D6GA 5EU3A 1NFIB 4XC1H 4EUPB 5IR1B 4PGCB 3PDDA 4IM8A 3ET9F 3ARDB 2NTFB 2X4QA 3O8XA 4KKAD 3SE9H 4HKJA 2R4RH 3PIQB 3VXTB 3VD7A 3IJYA 3VXOA 1KLUB 2FYYB 3KWWB 5DD5H 4RGNB 5HGHB 3LKQB 3TJEH 2PO6B 1WC7B 4JQXC 5CMAA 4F33B 4P5KA 4XH2B 4PRID 2FGWL 1IKNA 1N6VA 5HTSA 1KJVA 5E5RB 2HG5A 3NA9L 3QXDB 4RWHA 4O2EA 2R0KL 3GJEA 5GS0C 4LVEA 4NQCA 1RJCA 2VZOA 3SDXB 4ZDHA 2ADJB 3C8DA 1S9WA 2A74A 4R4BB 2EICA 3OWEA 4DOHB 4NPYB 4QRQA 3SKOA 3AY4A 5F1OB 4JKPH 5DK2B 4LEOB 5DJ6B 1HH6B 1TTGA 3DX7A 2FIKA 1ZAGA 4XB8A 4G59A 5I1KH 4ZO8A 3RWGA 3VJ6A 4IIQC 3LMJL 4PIRF 3TVMA 2GTWA 4RX4A 2VQ1B 1KXVC 2DQGL 5I6XB 3TO4A 4OCYH 4HLZH 1NBYB 3BIKA 3L5XL 2AEWA 1T2QH 1P6FA 4I3RL 5K9QG 2YS4A 3QUKB 4Z7VE 5IMLA 4BUGA 4O9HH 4YXHH 4YHNB 4OZGE 1T1YB 2BMKB 4HV8A 1IGCH 5I18L 1NCUA 4P3CL 1CR9H 5ADOL 1KIQA 1S9YB 3CSGA 3VRJB 3LKRA 1OQOA 5GIRB 1OAXH 3H0TA 1IC5H 4W4OC 1JGLL 2R1XA 2VSCA 1H0DA 1WVZA 4XC3L 3RVWD 4NJAH 1IAII 2VDRL 4QRTB 4R7NA 2RCSL 3PDGA 2DB8A 1SYVA 4Y5XC 1XCTB 1YY9C 1KFAH 4N68A 4P9HC 2QSQA 4LSUL 2NXYB 4KAQH 3W0WE 3BI9X 4UU9B 2FSEA 1G6RB 3D18A 4LP4A 4TYUA 4WCYL 4MAYB 1OL0A 1SJHB 5CBEB 1WTLA 4L4TB 3RGVA 1HEZB 2XZCH 4KUCF 5KJRH 1CWVA 3U82B 4ZUTB 3UZVB 4YHLL 4CDGC 1L0QA 1JPFB 4IHOB 4HZLB 3CFEB 1VPOL 4XPHH 1OD9A 3O6MH 5GGVY 1JYXA 1Z5LB 3MRJB 4HUMB 5DURB 4HQQH 5H94A 5HVGB 4Y5VB 1J1PL 3PGDB 4GRWF 4X6DB 4Y89A 3V5HA 1Q0XL 2BZDA 3BKJH 1MIEL 5C0IA 4XBGA 1HYRC 4AMKH 2L7UA 4HKZB 3O2DH 4ZS7L 2CLRA 3W0WD 4HC1A 1N8ZB 1Y0LB 3HR6A 4XMPH 4YXKH 4HIXL 4X9BA 4N8CH 3MOAL 4QT5B 4M7ZB 1B9ZA 4MD0B 1LP9A 1PYWB 5C0RH 1QR4A 4I0PB 2IH1B 2XZAH 1JNJA 4CMMB 4FQPA 2H2PD 4Y1AB 4RDQG 2XKSA 1K8DB 4OUUA 4ZNCD 3MYZA 3RP1A 3VXQA 1YC8A 5ID1B 2LFGA 4M3KB 5I0DA 2ZPKL 1U93A 4YAQB 1FNSL 3C08H 1BFTA 1RFDL 1ZLSH 4RWYH 2QJDA 2DYPB 1QUNA 4YGVB 3TWCH 4DKEH 5C0AA 4EJ1C 1TXKA 2I9TB 4YFLF 5AD0B 4KJQD 2AJYH 4IRSB 3RIAF 1FSKC 3EJYD 5GS1A 1Y18B 4CW1B 4S0UC 1ZA6B 2XPGA 3QQ9C 4JQIH 3CK0H 3PUCA 1T6WA 2NTSP 4OQTA 1AGCB 3PE9A 1ONQB 4JO3H 1R24A 2NX5E 3KXFE 4A6YH 1ORQB 2EDKA 4RSVA 1WITA 2Y5TB 5B3JF 3CUPA 3HZVA 3FB8A 3EJJX 5F7MC 4MNQE 1EHAA 4Y5YA 5H37H 1V7NH 5A1AA 3PJSA 1INDH 3DETC 1I9JL 1QPPA 1XGPB 2GKIA 3HE7D 5BV7H 2IAMC 1CBVH 1KTDB 4GW1B 4MNQA 2NXZC 5D93C 4YR6A 3HRZB 1K8IA 1A6VL 1WT5C 4Y4HB 2BY0A 5I8CB 1EGJL 2HLAB 2VLJB 4X6CB 5E8EB 2R2HA 5IFAH 1CL7I 2DQJH 2Y23A 3QUMH 5IROA 5LGHH 5B38B 5GHWH 4X4ZA 5IG7A 2J5LC 3LY6A 3EYSH 2GW5A 4NO5A 4D8PA 1BZ9B 3U6RB 5HSFA 3KXFD 4HF5H 3HMXH 4RRPA 1W0VA 5I75B 4LSPH 2G5BB 2RBLA 2ARJB 4TOYH 4MNQD 1LE9A 4JGMA 4GAFB 4NDMB 1FO0B 1FL3A 1DLFH 3GSUB 1CVRA 5I76A 4WFHE 1NGXA 3TJHC 5FEBA 4KDTC 5D2LA 3PWUA 1CLYH 3FKUS 3ZDYE 4EDWL 5L2KE 4AEFA 4L4VA 2XWJB 43C9A 5CEYA 5LWYL 1CFBA 5EU4B 4G5ZL 4PJXF 1C5DA 3KNBA 2YPKA 4P59H 1J9CT 5DWUL 4CRPA 1BJ1J 5L88H 5HY9B 3EO0A 5IBTH 3SCMD 4B53A 4XXDB 3IKKA 2EKSA 4Q74A 3VD5A 4HPYL 5DRZA 3W5MA 3IDNB 2FJFB 2PYEB 5EA0L 4S1QH 5IW1B 4ZSOE 2BNUB 4ZOEA 4PJGA 1X6LA 2VDQL 5ECJE 3V52H 4ODWA 5E94B 4YHYC 3M17A 1GGUA 4IRJB 3HAEH 1G6RL 4ZSOA 3QZWB 1N7MH 1INQA 1HDMA 2X9XA 4DW2L 4HSQA 5IF0B 4WFHD 3TT1L 4DQOL 1U91A 5ITFB 3SE3C 5L2KD 1LMKA 5JDJA 4Z9KB 3P9MB 4YO0A 5LXGH 1QFWM 4QRUA 1CFVL 4PY7A 1MCDA 1RIVH 3T2NH 3DSNA 5C0FB 2HT4D 5ACZB 3DTXA 4TN9A 3QEQA 2VLRB 4YJZL 4JAMA 3CLEL 3DUUB 2Z8VC 4OGXH 4LFHG 2ZCHH 4LEXH 4WHYG 4YPGA 3OZ9L 3CSPA 3HPLB 4GJTB 5HHNB 3U9PL 4DGIH 4J3VA 5E8NB 1OARL 4WUKH 3S3PA 1WWWX 3QFJB 3JTSB 4J6RL 4OIIL 1B3JA 3GBMH 1I7UA 4CJ1A 1IJ9A 1FZJA 1RZFL 3ZDXE 4F3FB 4PPTA 2P48B 2NY5L 2C26A 4NO0D 1ORSA 2YKLL 5DUMH 2V2WB 3H7BB 4GS7B 2EH8L 4KGJA 2YZ8A 2R1WA 4XGZA 2HLFC 3UPRA 3OX8B 5SX4H 4KZDH 3TPUB 4QHKI 4YWGL 4PJ5B 4TUKH 3H42L 1S7QA 2OQJB 3VFNA 4OLUH 4DAGL 4ODHL 2IG2H 1Q9OA 4CJ0A 3NCYP 1YJDH 3MGTA 5DGQA 3T4YB 1IEAB 5IT2H 3RX7A 2F74B 3E1F1 1UZ6F 1BFSA 1HXMA 2XA8H 1W2KT 4ODTL 1UXSA 3UXFA 4OLVH 3REWB 1T89C 2XN9B 2IALA 3K80A 4GRLD 1GZQA 2I27N 5I73B 3U2SA 4UAOC 2D7TH 2A9NH 1XH3A 2D0HA 3QO1A 2NW3B 4OD2B 1DUZB 1NSNL 1YNKH 1HKFA 4GMTL 1GYAA 1Q8MA 3EFDH 4UV4H 4J3XA 3EZJB 3PG2A 5I8EA 4Z7WB 5I8OL 5IVXB 3KLHD 4Z7UF 3NACL 5F6IC 2B5IC 5KVEH 3GI8H 4LLQA 1XIWC 2QQKH 4X4XB 1L7TH 2XQYG 3C6LC 4MQTB 3QDAA 4ZUVA 4I4WA 3OAYH 1KENH 4M00A 3WFDH 4H1LH 3MTRA 2OI9B 4HT1L 5D7JC 4HDIB 3CXDH 3RY6C 4U0QB 3CSYB 5AYUL 3DARA 4WI3A 5DD6A 4O2CB 3HUJB 4GAYA 4JVWA 4G6KH 4PLOB 1K85A 2NNAB 1KLFA 3ARBD 2ZSVB 5DHVA 2VYRE 2O5XH 4XNYL 1HOCA 1V3KA 1I1FA 3QIBB 5LGJA 2EC8A 3RFZC 4JDTL 1XF3A 1A3RH 5EZOL 5ISZB 4RFNB 1HQRB 3QG7L 2QHRL 3RWIA 2NY4C 1MHCB 1FE8L 4X80L 1HSAA 3MLWL 3MOQA 5BOPA 2HFFA 5HHMA 4L9LA 3PXHA 5ICZA 3VXMB 2F8OA 3H9SE 2L0DA 4KQ4H 5FUCC 3UX9B 5D71L 4DGVL 2BC4A 3P77B 1RZGB 1CFTB 4JFQA 3MUGB 5FA4A 1YPZB 3I9GH 2X89D 3MLYL 3M8OH 5DXWA 3C9NA 2R0LH 5FGCB 5D70H 2ATPB 2BSSB 4PBXA 2ITDB 1MJJB 5EBLB 1PKQB 4BZ1L 5D1XB 3HC4H 1R5WB 2W65A 4P57B 4P2RE 2Y36L 1X5LA 2VXSH 3THML 5JW5B 1DCLA 4KH2A 5F9DC 4YHKL 3PL6B 1XCQB 3HI6L 3PXJA 3JTCA 4TNWF 2FR4B 4G6AC 5L7XL 1MWAB 4P2RA 4K7PH 1D6EB 4QKXB 1A3LL 5BCAA 2KH2B 3DBXA 1WK0A 3T65B 1TZHB 3H9SD 2IANA 3VWKC 3O6FD 2XFXA 3DV6A 3W2DL 3UJIL 1W72B 1Q72L 5F6HJ 2FO4B 3LPFA 4JFFE 5CBAB 2EDRA 5DJXA 3MV9B 3O6KH 3KS0H 1XR9A 3NAAH 5DT1H 4N0RA 4KUCD 3KPTA 5DJDB 3S35L 1VFBA 3RZWA 3V7AE 1IGMH 3X12A 4EI5B 1M7IA 4OD1H 4P2RD 1D6VH 5IEKB 3QCUL 4WY7L 4NNXA 1FHGA 1Q1JH 3KYOA 4JN1L 3BZ4B 3TBTB 5BZDB 5IKCB 5GGTL 3D9AL 3GDBA 4EDXB 1TCRA 4HGKC 3RKPA 1JHTB 4LF3B 2ICWI 2OZ4A 3MBEA 4XNZB 5HHQB 5C71A 4JZJA 4MDIA 5CJOL 4JFFD 5ACMA 3V7MA 43CAB 2MQCA 1RUMH 2G60L 3QQ3B 1PX3A 2FNBA 4AK1A 5GISL 3ZKMC 3TIEA 1EEQA 4N0YH 4L29A 3B2UC 5E2WL 1TZGH 4H88L 2IQ9H 1TMCB 2YD4A 5B3JE 4X8JB 2FLBT 2CIIA 4YUEH 2X4UA 1BVKB 4QLRA 4CADB 3INUH 2ZOLB 5JIPA 4QTHA 1WWAX 5CUSL 2IPKA 4FXGB 3MBED 3VFGL 3CH1A 1HHJA 3K4AA 5E8OB 5F72S 2NY0D 4RAUA 5BO1H 4GFTB 4XVTH 2OK0H 1MRCH 4LOUD 5E70A 1IRAY 4XPBL 2JELL 4P5MB 3OSKA 1VACB 3MCG1 4PJBF 4JFZH 3TGXA 1EEZA 1OAQL 2P7TB 2PTUA 1NCCH 3IS1X 1PGRB 3G9VA 2E8YA 2C7UB 3VWJC 5HVHB 1H3WM 3OAYK 1JV5B 2AK1L 4TRPH 1S3KH 3SQOH 3CFDB 4JZOB 4KRMB 5BZWA 2Z31A 5H35A 1BQLH 3WFCL 4KV5F 4ZFOA 2XI9A 1AXTL 1DBKL 2YUVA 4AEHH 3VRLF 1HNGA 4HUUA 4MSWA 1HNFA 4XCEB 3RVTD 2AVGA 3HB3C 3O3EB 4G8IB 4EOWH 2X70A 3LD8B 3OPZH 1IGIH 3E6FB 1A02N 3CNKA 4LQ1A 2J1KA 1G9NL 4DCQA 2F58H 1JPGA 1BMGA 2QSTA 3LQAL 4K7FA 4PJXA 2APFA 8CGTA 4LPXA 2FATH 4HUXA 4BYHA 5B3NA 5K9KB 1RHHA 2QKIA 3MZGB 3L7EB 4L3CB 3S4SG 1B0RB 5FCSH 4E41E 5TQ2L 1YA5A 3WHXB 2GK0A 4GBXA 3V4PL 4F2MA 1KCUL 3D2UB 4BFBD 4XX1G 5E2UH 4OAWB 2W1NA 4HUWA 2YK1L 4LMQE 4APQA 3LS4L 2YPVH 4WGWB 5HYIA 1UB6A 4JRXA 2YA1A 5GS3A 2AJSH 5IOPB 1ZLWK 1LGVA 4QXGL 1XZ0A 1IAIM 4AIOA 1DP0A 1RUQL 1R6VA 4ZXBC 2DM4A 3LRHA 2GAZA 3MOBL 4J3WA 4FQIH 5E4EC 5IMMB 1MWAL 3C2AL 2J8UB 4GBXD 5ERWA 5AZEH 3DMMB 4P2OB 2UYLA 3WMSA 2V7HA 1I1AA 3S37X 2DLIA 1W72L 4E41D 1CLZH 3DGCR 3FFCA 1ACZA 1BOYA 3GSVA 4KKBD 1PZ5B 3MRDA 4HH9B 1I9RH 2XY1A 4YHOH 3LKOA 5F96L 5DUBA 2YPLA 3PWPA 2X05A 3U0WL 2D2OA 3N1MC 1PKOA 2CRZA 2MPAH 1N6UA 6FABL 3ULUF 4QHNA 4TUJA 4DK6A 1MRFH 3BJLA 1B6DA 3SDXF 4R26L 5IMKA 3OJ2C 1KT2B 1S9XA 4BSVA 1FRGL 1JGVH 5FUZL 1N6QH 3H3PH 3LIZL 3EO9L 5BVPL 2YSSB 5IQ7H 3PF2A 1UZ6E 4K3JL 4I1NB 3V6FB 4X0KB 2AJ3A 3T1FB 5CWSA 4PJEB 4FFWD 4LRIA 3IJSA 3QH3B 1I1YA 4QHMA 4ZFZA 1ED3A 5ANMA 3ARVA 1T21B 1V7ML 3GIVA 4WIQA 5IFJB 3HZYA 3MRNA 5B4MC 3JWDH 2BJMH 4ODXB 4Z7UE 5EPMB 5HI4C 3TYGL 3GMPB 2GSGB 1WAAE 3EYFB 1FYTB 5FO8B 2BSRA 2PXYB 4MXWH 1K4DB 2BCKA 3RU8L 3SGJC 4BFEA 1JRHH 4YK4B 4Z7UA 2XTJE 1LK3H 3RNQA 4NHCL 4XB7A 2IAMB 5GGVL 3HG1A 1HILB 4QY8A 1FV1A 3QHTC 1PFCA 1HCVA 3TCLA 1T80A 2EH7L 2HN7B 4RBPK 5DLMH 3ZTJH 1B0GB 4ODUB 4PYHA 2GFBA 5L0QC 1P1ZA 3P4NA 5TE4L 5C07B 1C08B 1IVLA 2APWA 5CZVL 2R56L 4WO4A 4AM0B 3AM8C 2J5LB 3IRPX 4GXVH 2IQAA 2V9RA 1YMHB 4EXKA 4JRYE 4KVCL 1X5IA 4PGJA 2XTJD 4XP1L 1BBDL 4KJYA 1ETZB 4R4FH 2LVEA 3RKDD 3T8XA 3LEYL 4PB9L 1S7TA 3DVNB 3D85B 1U8NA 5IEHB 5AZ2H 3L6FB 1D5XB 4MA8L 1NGYB 1MI5B 1MHHB 2E8ZA 4C59B 1EIBA 2ICEA 1I4FA 3LKNB 2E7LA 1A0QL 2QR0A 4X6DF 2W9DH 2Q8AH 12E8L 4NGHH 1PSKL 3ZT5A 3LPWA 5E8PB 3QPQC 4W6WB 4ZPTB 4UT6H 2YN3A 4LAQH 3MACL 4OLYH 1F8TH 2AK4A 5FF6B 4JRYD 4LK4A 1HHIB 2A1WH 3P0YL 5K9QI 4E42A 3BP6B 3SGEH 5EZJB 1FNLA 3IJHB 3QNZB 4HMCA 3QIUC 4Q6IA 1AE6H 5BJTA 3DOSA 1JWMB 3UTQB 3UROR 2BNQB 3S35X 2GTZA 2BFVH 3BP7A 3VXRE 4UT9H 5EC2A 4O58L 3ILPB 2BSTA 3T0XA 4HJGB 2DIJA 2CIKB 1CXLA 5EIVA 4F7CA 3OB0K 5T1KD 5E8DL 1K3IA 2V17L 1UB5B 4OCXH 4UB0L 4KJWC 2HJFA 1V05A 1M1SA 5HXMA 2HH0H 4PV8A 4ZTPH 5IP4A 4MB4A 3CFBB 5D6DC 2ZP0T 1MLBB 3MMEB 3B9EA 1U8HB 4K7PY 4HFUL 3ARGD 3GMLA 4RAHA 4XZUB 2X7LB 4NCDA 4N0UE 4JVPA 2VDPL 4OLXL 3NBNA 1JZ3A 1I3RB 1MRDL 1ZT1A 2G9HA 3BGFC 4MNHA 1ITCA 1T1WB 2HVKA 3IDYC 5TDNB 3VXRD 1FC2D 3OAUH 1ITBB 2YA2A 4N0UA 5E5MB 3U4BL 2X4SA 3TESA 1OGTA 4CBPA 1AH1A 4ODVH 5DMKA 3TA3C 3HPJB 2MFNA 2DBLL 1CZ8H 2DKMA 4HW6A 5F3BB 5T3XH 3BH8B 25C8L 2WUCL 4X6CF 4P23D 2VXVH 1R5IA 4UAOB 4Y2DC 1NBVH 2G5RA 3VGHA 5GGRA 1I8KB 3F7PC 4PJBE 5GRUL 1KIPA 4P5TA 1MJ7L 2XQBH 4P0DA 5F6IB 3MRIB 2MCG1 5IJVA 5I66B 3ELAT 4PJBA 5CHNB 4KDVA 1XIWB 4LGPB 2OSLB 4XP6L 4QRPB 2QQQA 3C6LB 1FGNH 5MEPA 3BHBA 4U1SB 2EYTB 2R69H 5T1LB 5JQ6H 2YEZA 1BX2A 3ZZ1A 4QXTA 1UH2A 4Y16B 4LSRL 1MCPH 2JB6A 2WW8A 3EDDA 3JTTB 4KV5E 4NQVB 3U0PA 2DKUA 2BDNH 2VO5A 3T1WA 4NKOB 3CFKA 5GPRA 4ZOAA 3UO1L 4KHXH 3DX9A 2P8LB 1A7BA 4KKLC 3BXNA 4PRHB 2DLFL 2AXGB 5D7IB 5J6HB 5FO7B 5ABDE 1Q38A 3LAFA 3PP4H 1A1MA 3I2CL 2QQNH 2NPLX 2Z91A 5F7EH 1D5ZA 4NKIL 2DN7A 1AQKH 3Q6GL 1FVDA 2IFFL 1F90L 4OFKA 1V5JA 1WCQA 5CLTA 4JFEB 5CGMA 4WVRA 3KPMA 4OF8A 3RHWF 1REIA 1M7DA 3B5HA 2BVTA 3ZKSD 5E03A 3MRKA 4HKXB 4TSBL 4WUUB 4OI8A 4U49A 4NKQB 5D4QA 4HLZG 5EOTA 2H26B 5JUEL 5CIPA 3EKCA 5SWSB 4AJ0A 5AAMA 1X5ZA 3OJDB 1WSST 5B8CC 5ESAB 5HGBB 1KSRA 1IC1A 2W9LA 4M61A 4K71C 4FNLL 4K94H 2DQHL 3FB5B 3H9ZA 4ZS6D 4E9LA 5IIEA 2EECA 1NFIA 4JY6B 4EUPA 5IR1A 4PGCA 1Z2KA 3I75B 3SE9L 3QBTB 3R0NA 3TBVB 2R4RL 3ARDA 4IDJH 4YDVB 1HK6A 2NTFA 5J3HD 4GRMB 5DO2C 5KZCD 1CTNA 2EEBA 3D0VA 3V4VH 4ZO9A 4JY4B 4JCMA 4L5FH 3PIQA 3VXTA 4MS8C 5GGQH 1OM3H 2J6EH 3I85A 5JHLH 5F7LB 5HGHA 1MH5B 2PO6A 4MA3B 1WC7A 1WQVT 4S0TD 3PWVA 4A6YB 4XH2A 3V2AR 3ULUE 3BDXA 3BD3A 3SDXE 2D4DA 4KMTH 3RQ3A 3QXDA 1CXIA 5MI0B 1RZKC 3MZTA 3WDIA 2ADJA 4R4BA 4XWOD 2Z8WC 4M5YH 4NPYA 4NQSB 1KLGB 2QL1A 3QPXH 4N1CA 3WJLA 4ZTOH 1Q94A 1L6ZA 5DK2A 4LEOA 5DJ6A 1HH6A 4Z7WF 2AEQH 3DO7B 5IVXF 2YBRB 2HVJB 1KXQE 3BOVA 1M7XA 3GBNH 4XBPB 5JXED 5BXFB 4KU1A 2NW2B 3C5ZC 4OCYL 5FYLE 2VQ1A 4ORZC 4JM2B 3ULUD 5C0BA 4HAFA 4JFYA 5E00B 4O9HL 5JW4M 4MA1C 4YX2H 5F7HA 4EZMA 4XNUL 1KJ3H 3HUJF 2OR7A 1IGCL 4KK8C 4FZ8H 5JOFA 2VLKB 1DL7L 2VDOH 4Y2OA 3U79A 4RMTA 4Q9QL 3PWNB 4YDIH 4GLRH 1NKRA 1OAXL 3VRJA 1EDQA 1I8LC 1MFDL 4Z7OF 3L5HA 1WIOA 4K3DH 4PLKC 5GIRA 1Q9WB 2Q8BH 4RGOL 1UCTA 4WU7B 4J12A 4G80B 3QCTH 3IFPB 3EHBC 5FYLD 1N59B 3VGGA 1HXYA 1JGUH 5F9AC 4KI5C 4QRTA 1KFAL 1L0YA 2Y4SA 5T3ZE 4XVUC 2P5EE 9CGTA 2J88H 3SPVB 1FBIH 3HAEB 1OY3B 1KTLB 1Z3GL 1YPZF 4NOBA 1XCTA 4YNYB 1GPOH 4UU9A 2XZCL 1G6RA 4KKCD 1T4KA 3S88L 4XVSH 4MAYA 1SJHA 3UZQA 1OAZL 1TPXC 5CBEA 2J8HA 4L4TA 2Q86B 1HEZA 4XPHL 3O6ML 3NTCH 4ZUTA 5K93A 2FX8L 1ND0B 4HQQL 3GIZH 3CFEA 1N3NB 1Z5LA 4OQTH 4U1HA 1SY6L 5H37G 3BKJL 3SGDH 4LLUA 4LPTA 3RDTD 3KYMB 5T3ZD 4PLJD 4LLVB 4FMKA 4X6DA 1BVLB 4GG6E 2P5ED 4J3TA 3UTSE 4MAYD 4O02L 1FCGA 3SO5A 4HWEL 1CDIA 4HKZA 5I1LB 4ERSH 1FP5A 2RGSA 4BK4A 1N8ZA 1Y0LA 1YNTB 1JZ4A 2A6DB 1NEZG 4NCC2 4WGVB 4XTRD 4ZAKB 3E0GA 3P30H 4QT5A 1DTUA 2XZAL 1MCIA 1QG3A 4MD0A 4Y1AE 1PYWA 5I1HH 1UA6L 5JPNA 3RVVC 2IH1A 3DXAE 5DURD 1RHFA 1Z9LA 3QEUB 2V9TA 3P2TA 4OCWH 3QUXB 4G8EB 5BS0E 1A6TB 3C08L 4LCWB 4MQXC 4V1DE 2RQ8A 4RWYL 5ID1A 3LN5B 4MLSA 4ODSL 5C6TH 5HDOA 3TWCL 1BVZA 1RK1B 5I19H 2AJYL 3UTSD 2D3VA 2VXUH 1FLRL 2DYPA 3OXSB 4NM8L 2A2QT 2ZG2A 4YGVA 3RVUC 2DTMH 3AROA 2E3VA 3EFFB 1J0KA 3R4DA 2I9TA 5AD0A 4I0PD 4IRSA 4JQIL 3BDBA 1JN6B 1IT9H 1Y18A 1JZ6A 2ESVB 4CW1A 1P84J 4JO3L 5D5ME 1MCEA 3BGAA 4MWFA 4Y1AD 4A6YL 2ZUYA 1JTOA 4LSVL 2JLLA 3DXAD 1AGCA 1ONQA 3ROOB 3TFKD 4K3EL 1MIML 4P2QB 1ORQA 2Y5TA 1T0MB 1INDL 2E7HA 4LASH 5BS0D 1I3UA 2WLYA 5E9DE 5KSAA 3U4EA 2BNRA 3FQUB 3EYQD 4V1DD 2DYPD 3D3VB 4ETYA 5E5UB 1XGPA 3S6CA 2FX9H 2JTDA 2P24B 3TZVB 1KTDA 4XCNB 1NC4A 4JE4B 2VLJE 5IM7B 3HRZA 3QUZC 2DQJL 1OHQA 4S1RH 1OCWH 1T5WB 3BZFB 4Y4HA 2CGRH 5GHWL 1F4WL 2ED9A 4IOSD 5I8CA 1KN2L 3EO1B 4O51A 4X6CA 3EYSL 3DYOA 4KK5C 1BIIB 5B38A 3TYFA 1F45A 4TOYL 3U6RA 3BSZH 1CFNB 1BZ9A 1OP9A 4ZUWB 4M9PA 2GY5A 1BAFH 1DLFL 3E2HC 5CSZB 2G5BA 2ARJA 5E9DD 1BFVH 1WFUA 4NDMA 2R2EB 3GSUA 1V3MA 3B9KC 1P2CB 4OFVA 2J12B 1UM6H 2VLJD 5FKPB 2NYYD 4QHKJ 1LO5B 1QO3B 3DYPA 5L88L 3AFLA 3VXUB 5EU4A 2BVPB 2EIZB 3I02A 3BPLC 4JVUA 3W11C 3QDME 2PYEE 4PJFB 4KROC 3VCLB 2AXJA 5I1GH 4RA0C 4XXDA 2XRAH 1O5DT 3V52L 2FLRT 1RUKH 1AKJA 1ZOXA 3IDNA 2FJFA 2O26U 1YEEH 2PYEA 1GAFH 5IW1A 4PJHB 3S36H 3EDKA 4P49A 5E94A 3CX5J 2I24N 4KTEH 5KSBB 4IRJA 4LP5A 1H15B 4YDKH 3PHQB 3QZWA 4DKAA 2EYSB 4G9FA 4MXQA 3NOIA 2EDQA 3BD4A 3SE4C 4WTZG 5IF0A 3U7WL 5CKAA 1RZJH 5MP6H 1BQHB 2VITA 2CR6A 3FAXA 3OR6B 3VW3L 4HHAB 15C8L 1RIVL 3F58H 3T2NL 3P9MA 1F4AA 2NY2C 3QAZC 1OGAE 4PJ7B 1E28B 3QDMD 3FRPG 3TP4A 2PYED 4OGXL 1KUMA 4LEXL 5C0FA 3BN9C 5ACZA 4R96B 4H1LG 2VLRA 3ARRA 5F70A 4WUKL 4G9DA 3DUUA 5FV2A 5MHSE 2FDBP 3HPLA 3GBML 5HHNA 1UWGH 3X3GL 1CF8H 5E8NA 3OXRB 4EN3B 3IAPA 4DFIA 3QFJA 3B4NA 3JTSA 5GGTA 3EGSA 5HYFA 3OKDB 4F3FA 3DX8A 4MNGA 4HJ0C 3ISWA 4M7LH 4M8QA 3TPUE 3QG6B 5C6PB 2V2WA 3H7BA 4NZUL 1DVFC 1XGUB 3HR5B 5IBUG 2EZ0D 5DHVH 2K9UA 1WZ1H 3AMKA 1AO7B 3OX8A 4OLUL 1OGAD 1YJDL 4PJ5A 1YMMB 4LRNL 3WFZA 3IDIB 2OQJA 1UC6A 4PJEF 4HK0B 2XA3A 2XN9E 3T4YA 3C09B 2AAVA 2F74A 4OZ4B 5MHSD 4QOKE 2D7TL 4MCZB 3REWA 1QSZA 4K2UH 4TTDC 4AIZB 4POYA 2XN9A 5INDB 3BJ91 2X42A 2V5TA 3A6BL 4ONFH 1TQBC 3V5DB 3K2UH 2HP4A 3QXTA 4KRPD 4PJ8D 4UT7H 2EDNA 3N9GH 2NW3A 4OD2A 5GRYA 5J11C 5DJAA 5GRJL 5HHVH 3S3JA 2Q3ZA 5KVEL 3GI8L 4Z7WA 1L7TL 5IVXA 3BGFB 3MRCA 3TBYB 3ZKXB 5KAQG 3ZT7A 1WEJH 1FZKA 3KR3L 2EO9A 3VXPA 2CRMA 3CXDL 3TA3B 2XN9D 5JHDB 2EDLA 2J4WL 1M6OB 4HDIA 4G6KL 5KSVB 1BBJB 3SN6N 1JNNH 3AVEA 4B41A 4QOKD 4RZCB 5GZND 2DQCH 5CZXD 1MJ8L 3HUJA 3KPRE 2B1HH 1MREH 2APTA 2QEJA 3STZB 5DMGD 5EZIH 4J2XA 4FFZH 1Q0YH 2ZSVA 3WXWL 1A3RL 2YUZA 1FFRA 1K9TA 2DTSA 3QIBA 4PP2B 5I1DA 4XBEH 4AQOA 1INEH 3IAQA 2OYPA 5ISZE 4CVZB 4OZHA 3LN4B 5DMIH 4KTYA 1E6JH 3FZUC 3VXME 1WFOA 1QVOB 1MHCA 3TBSA 1XT5A 2ICWJ 5E6IC 5EULV 4H8WH 1X4XA 1YPZE 4RMUA 3WUWB 2ICES 4OIBA 3VXMA 1PLGH 3V6BR 3I9GL 3M8OL 5FGCE 3TN0D 2EEDA 2GK2A 1RZGA 2R0LL 1CFTA 3O3BB 3MUGA 5D70L 3KPRD 4HXAL 5F7KC 1PKQE 3KHOA 1NCWL 2ZG3A 3D25B 4F8TA 3HC4L 3UTPE 1ZVSB 2ITDA 1MJJA 2UV3A 5ISZD 1MCHA 1X5HA 3WNOA 4Z78B 5D1XA 1R5WA 5BW7A 5JW5A 1QR1B 3MYJB 3G08B 4K7PL 3VXMD 4U2YA 3PL6A 4NQTA 2SEBB 4U3HA 3FTGB 3MV9E 4JJ5A 3QNXA 3T65A 3O6KL 4FQ2L 2O93L 1W72A 2FO4A 4JO1L 3WN5B 5CBAA 4GO6B 4M1DH 3MV9A 3EOTH 3UJTH 2VH5H 2IADB 1IGML 2VL5B 1WISA 4P9MH 1MHPL 5DJDA 5J0BA 1D6VL 1YEDB 1ZKAA 4KJPD 4WWKB 3UTPD 2Z8RA 4XP9H 1C12B 4F7PB 3ZL4L 3F7QA 2RJMA 3KLSA 4EI5A 4W6YB 2IPTH 4YBQD 3KPOA 2YR3A 1VA9A 4N0CD 1MUJB 5IEKA 1DZBA 4XMKH 3QI9C 3VGDA 2X10A 3BZ4A 2EDFA 3S4SA 3F8UB 3ZKND 3TBTA 5BZDA 2R0ZH 3OKYA 3MV9D 4EDXA 3HC0B 4X8XA 1JHTA 1N2RB 5DMJB 1RUML 2NR6C 3MLTB 1SMAA 3D0LB 4CAGA 4GMSH 43CAA 2DOCA 5FUOH 1RJZB 1TZGL 1C16B 2IQ9L 1UH3A 3MV8B 3QQ3A 4W6XB 5HYSG 1TMCA 4XHJD 5C0CA 1EV2E 3E8UL 4X8JA 2WWKT 1BVKA 5DEGB 2AEPL 4CADA 1BJ8A 2ZOLA 3ARZA 3DECA 2CXGA 2OK0L 3WIFB 1NAMH 1MRCL 2X9WA 3BH9B 3GHEL 2HT3C 1GL4B 3LH2H 3MJ9A 4LPWA 2GT9B 4JFZL 5AYQA 3MA7B 3RUGB 4N9GA 3TBWA 3O3DB 4P5MA 4J1UB 2MQ3A 2X2YA 3LRGA 5IB3B 1VACA 5F1NA 2D03L 4YHZH 3V0VB 3C5ZB 4DKFH 3NFSL 2LTQC 5HBBA 2P7TA 4WEBH 4TRPL 1WFTA 4N1EA 5GS0D 1NCNA 1CLOH 1QFUH 5DJ0A 1DN2A 5AEAA 2C7UA 4PJCB 3SE8H 3MV7A 4FXKA 1JV5A 4FMFA 1BQLL 1G9MH 3CFDA 4B0MM 4JZOA 5BV7C 4PTUB 5IFHH 1JGEB 5HHPB 1EPFA 5GRWA 1ZLVH 4EOWL 2VISB 1TVBB 1IGIL 5D7IF 3MRQB 4IOFC 1IC7L 4L8SC 5EO1B 2ZJSH 1OT2A 4HIEB 5F7DB 4G8IA 3DI3B 3E6FA 5I74C 3O6LL 2F53B 4LCYB 1AIFB 1WZMA 1BZ7B 2GEEA 1E4KA 1R3KB 4R2GB 4DN4H 5CILH 4ZFGH 5I1IL 1CIDA 1NEUA 1NGWA 5DJ2B 1CGUA 2CLZB 4XPTH 5K9KA 4MJ6B 4QXUH 4F57H 3L7EA 5C0ND 2D31B 1B0RA 1DQMH 2V5MA 3HLAB 1KB9K 4U1NB 4CU8A 5CD5D 5E2UL 4HXBL 3ZO0A 1VGKB 5FGSA 3IDXH 5TPWH 5EOCJ 4OAWA 1TQCC 3ULVC 3SDCC 3ESVF 4N8VB 1GGIH 5IOPA 5D1QB 3RIAK 3OKLB 4FFYL 5FYKE 4FQIL 4S1DC 5TE6H 3W9DB 4OJFH 3F5WB 4MVBC 3WEXB 1YY9D 4OZFB 5JTWA 3BPOC 5IMMA 2BVQB 2BXZA 3F7VB 3FQNB 2ZCLL 1CLZL 2J8UA 3DMMA 4P2OA 4BZ2H 1EFXB 2GJ6B 3D2UD 3W82A 2Z93B 5E6YA 3ZTJG 4FABH 4I77H 1N0XL 1HZHH 3VD4A 3ZT6A 2MPAL 5C3LD 1A7OH 4X6BB 3L3JB 1L4IA 5B39G 1JGVL 1HHGB 1N6QL 3H3PL 1VGEL 1DQJB 2H2SC 5FYKD 1KT2A 3SDDA 2FGZA 3KLAB 5IQ7L 4P2OD 1F4XH 4PRBB 1F3DJ 5D1ZC 2D0FA 2R2CA 3HN3A 3K1DA 4IRZH 3V6FA 1ROWA 4X0KA 3T1FA 4PJEA 3WXVH 4BFGA 3ZYIA 2IBZX 1TETH 3RAJL 1UJ3C 3PV6A 1T21A 3VFUB 4JM2F 3JWDL 4BH8A 2BJML 5DQDH 5IFJA 3BZDA 4RMWA 3KPNB 1U8MB 5EWIL 3VFWB 2N1KA 2Z8SA 1MFBH 4ODXA 4XNMB 5EPMA 4D0CB 4GAGL 3IKCB 3GMPA 3NGBC 2GSGA 2EO1A 3QJFB 1FYTA 2WBJC 5FO8A 2PXYA 2PKDA 3Q6FB 4HPOH 3O81A 2NY1C 4FFVC 1QD0A 1I9IL 4WHTB 3PGFH 1UEMA 2IAMA 3RIFF 4HFWB 2X44D 4R7DB 4I2XE 1HILA 3NCFB 3I84A 5JR1H 4NKDB 4HG4K 3S97C 4HWBL 5C07E 3QQ9D 4P4KB 3T09A 2HN7A 2V6HA 4C57C 1B0GA 2H1PL 2JJTC 1C08A 3REVB 3CZFB 1FYTD 4MLIA 2W0FA 2QTEA 1JIBA 1CICC 3Q48A 3FHAA 3DETD 3N1QC 1YMHA 3NZHL 5E08L 2IAMD 2ZKHH 5BQ7B 5FECA 3V79C 3L9RB 2XWTB 1ZHLA 2AV7B 2CDFB 2FEDC 2B4CC 2CUIA 3B9VA 4FTVB 5AZ2L 3GBLA 1IZKA 4N1HB 1DN0A 3WCYA 1MCBA 3P40A 3TJHA 2LAGB 3D85A 3DVNA 5C07D 3L6FA 1D5XA 2PUQT 1NGYA 1MI5A 2W9DL 4KY1H 3RTQA 1H3PL 1MHHA 1ZWIB 5KSUA 4NGHL 5EU6A 3BPLB 3LKNA 5GRVK 5LAXB 3DGGB 4KROB 3LMJH 5CLWA 2CXKA 2AXFA 2DQGH 4OLYL 4ZPTA 2A1WL 2R1YB 4BQ8A 5A3IC 3L5XH 4Y8AA 4Z5RB 4I3RH 1QSFA 3O41A 4YDJB 3MJ6A 3TJHD 5FF6A 4ZODA 3Q2CA 1LILA 1AE6L 4Z7VB 1A21A 3BP6A 4NRZB 5EZJA 4AL8H 3H9HB 3IJHA 5BVJB 3QNZA 3BX7C 3LVEA 5E2VL 1ZHKB 5EC1A 3UTQA 3QAZB 2BNQA 2DJSA 2YA0A 3FO2B 1I85C 1JGLH 3ILPA 4OCXL 3MLUH 1VFOA 3SY0B 1A14L 1FIEA 2CIKA 5SX5H 4XC3H 3VXSB 1G0DA 2HH0L 1SMOA 2RCSH 2A73B 3RX5A 4TSAL 3CC5A 1JBJA 1KCVL 4DZ8B 2P5WB 1S8DB 2BVEA 5F44A 3CFBA 3MMEA 1MLBA 4H0HB 4P46B 1U8HA 1GOGA 4LSSL 4WCYH 5IK3B 4E5XB 5DF0A 4XZUA 4Q0XH 3OAUL 2VUOA 1IGJB 1I3RA 2CSPA 3BRDA 4B5EA 1HE7A 4ODVL 1T1WA 1VPOH 4M1CC 1CZ8L 1QFHA 4K55A 1F4HA 4OUOA 1MVFA 3HPJA 1RUPL 3L5JA 3BH8A 1MIEH 1NBVL 1T89A 3B3IA 5FM4A 5KVDH 5IHBA 3DUSA 3IDGA 5DVLA 2HLFD 3QUYC 1EA9C 4HIXH 5CJXC 1I8KA 1YN6B 3MOAH 3FB6A 4UQ2B 4QRPE 3P73A 4G42B 1FGNL 3IGAB 2YWZA 3MRIA 3DSFL 4YBHA 1N5AA 5JW3H 4LLDB 3GSRB 5CHNA 1URLA 5CIPH 5JQ6L 3HZMB 4QRPA 1NANI 1J10A 3C6LA 1AGEB 3C8HA 3CDYA 5F89B 3QFDB 1MCPL 4FG6C 3IU4L 4U1SA 2EYTA 3F7YB 5T1LA 2BDNL 3WDJA 2MJWA 1V3JA 2Q76B 2EXWC 4ELMB 2YMXH 4Y16A 1IAKB 3JTTA 3NCCB 2ZPKH 4KHXL 3HE7B 1FNSH 4PRHE 4WI6A 1F58L 3DUHA 1KG0B 4PJFF 5D7IE 4NKOA 3MX0A 1ZT7A 2R2BB 1ZVHA 2VN7A 4I48B 1A9EB 3UYOD 2P8LA 1YEJH 3MUY1 1XIWD 5D7IA 4QRPD 5J6HA 3C6LD 4PJHF 1QQDB 1D9KC 1H3GA 1NMAL 2QQNL 4LKCB 1HI6B 1IGYB 3ROLB 1JVKA 1SY6A 5T1LD 5C86A 5KSBF 1VKXB 5FUCE 4X9FA 2KZ1B 2NX5B 2DLGA 4CN6A 3KXFB 4Y16D 2VTFA 4OM1H 3ULUH 4Q2ZB 2X4TB 2KKQA 1ADQH 1KN4H 2XXMB 5DD0H 4CNIB 4NQDB 2IMMA 4WUUE 4JFEA 4PRHD 3RNKA 1T83C 4PJ7F 2HRPL 1IBGL 2F54A 2YRLA 1QSEE 4RNRB 4EQ3A 5BOZG 5J6GA 5SWSE 4HKXA 4JLRB 5ADPH 5DYOA 4N5EA 5F9WC 4NBZB 1EGJH 2H26A 2NY4D 4K94L 5SWSA 4F7MA 3OJDA 1CDGA 5ESAA 5HGBA 3SCMB 4M1GH 1V3LA 4IDJL 3FB5A 4V2CB 4C4KO 5EIIB 4PGBB 1U8KB 5FYLH 4JY6A 4C58B 3BESR 2GYSA 1JZ8A 3TBVA 4L5FL 4YDVA 4GRMA 4O2FA 5GGQL 2J6EL 3WS6C 5JHLL 5ICXB 3EYVB 1A1OB 3QHFL 4WUUD 3T3PE 4UNVA 3GSWA 1QSED 1MH5A 1DR9A 5SWSD 4XPFL 1ZGLB 5HYJB 4A6YA 5FAAA 3UBXB 5I71C 2PTTB 2P1YA 1B90A 3QCVL 4Y4FA 4G6AD 4CVXB 5EBWB 4FQXC 5IBLC 3ETBF 4M5YL 3WE6B 3QPXL 3SJVE 5C3TA 3VWKD 3L5WB 3RA7L 4ZTOL 5LCVH 3CGTA 4RGMC 1VB9A 1T3FA 3Q1SH 4NQSA 2YD1A 1KLGA 4NIKB 1EEUA 2A83B 4NC0B 1IILE 4RFOH 3DO7A 2YBRA 3H6JA 2LAAA 4WV1C 2HVJA 1FL5B 4DW2H 4XBPA 2FCBA 1AGFA 2QLVB 3O45B 4DQOH 2VABB 3BP5B 2NW2A 3BP4B 3ZYOA 1D5IL 4PG2A 4TPRL 4YX2L 4QWWC 1U8PB 4JM2A 1OSZB 4N9OB 4OCMC 1MQKH 1DQQB 1VEPA 1EAJA 5E00A 3P0VH 4X83A 1F6FB 1HHHB 3U0TB 3SJVD 3CLEH 2Q87A 4PLNC 3FB7B 2VLKA 4RCAA 1FN4B 2H6PB 2P44B 5A43C 5DFTA 1EX0A 1OARH 5ESQB 1JHKL 3S37H 5I9QC 4GRLB 4OIIH 4QYOB 2Q8BL 4GXUM 3ZKMD 4R4NC 3QCTL 2JB5H 2NY5H 5JPMB 1U8OB 2YKLH 1JGUL 3E3QA 2EH8H 1A9BB 4WU7A 2ED8A 2HJLB 3IFPA 1N59A 5E7BA 3GUTB 3GO1H 4RRPG 3ZTNL 1A3QA 1DUYB 2B39A 1GPOL 3H42H 2VL4A 3SPVA 2EDOA 3RZCC 3HAEA 4GUPB 4DAGH 1KTLA 4IMKA 2V7NB 4YNYA 3OF6A 2WUBH 4LCCB 1WJ3A 4XRCB 4WI7A 4ODTH 1FAIL 3LKSB 3RI5F 4D3CL 2DF3A 3T3MF 3K7UA 3OJVC 3MRHB 1QLEL 3KGRA 3GIZL 4HMDA 4Z77A 3IRZA 3MNZB 1F2XK 1ND0A 2APVA 3T0EA 1NSNH 3VWJD 4GMTH 4MMXC 4N90E 3KPPB 4BUHA 4MJ5B 1N3NA 1D5MB 2DQIL 5I8OH 3EIFA 4J4PA 4S10A 3KYMA 1E4XL 4LLVA 3WIHL 1BVLA 1M05B 1RULL 5I1LA 1YN7A 4HUVB 3O2VL 5D72L 3F65A 3HB3D 1YNTA 1WF5A 5I1HL 2A38A 4HS3B 2AI0H 4ZAKA 5AYUH 5DI8B 3MJ7A 4EI6B 4L8BA 4XPAL 1TQCB 4OCWL 4Q9RL 2EXYD 3SDCB 4LCWE 3EYOB 5JOEA 1VDGA 2HTKC 3WS3B 2HT2D 3QUXA 4G8EA 4N90D 3QDGE 1CU4L 4X5XB 4I0KA 3ARUA 3MRMA 1A6TA 3BPOB 4JFOA 2VIRB 3LN5A 3QG7H 2QHRH 4KUZH 1A7RH 1GGBH 2CRYA 3CMGA 1RK1A 1FE8H 4HGWB 2P4AB 3MLWH 1IT9L 3WNMA 2OX5A 1FO0H 1H8NA 4OBSA 4U7SA 3EFFA 1U8QB 3BKMH 1AFVH 4PJDE 4DGVH 3MJ8A 5GSVB 1JN6A 2ESVA 2MNUA 4P2QE 2A6JB 2I9LB 5FGBC 3MLYH 1N64L 3SKMB 4LASL 2HFGH 4WNQA 4ZXBD 4LCWD 4IBLT 1JCKA 1T0MA 4H1LA 3SBWA 3QDGD 1FFPB 4C83B 5D1ZB 2Y36H 2CMRL 2FX9L 3FQUA 2X1OA 1S7VB 3D3VA 2I60L 4YHKH 3RUGF 1I8MA 3O4OC 1D5BA 1JNLL 3FMGH 4S1RL 5L7XH 1PY9A 2P24A 3TZVA 1NFDA 2CGRL 3IFLH 1OW0C 4DUXA 4NQXB 2VERN 1UJ3B 5HHOB 3Q5YA 3W2DH 4ACPA 2FL5B 1Q72H 3BZFA 3BVNB 4UBDC 1DQTA 4JFFB 2J2ZA 4OFIA 4PJCF 1CYGA 2E5EA 3BSZL 4P2QD 3O2WH 5HI3C 4NFCA 1BIIA 4AH2B 4DFHA 3GSOB 1A6AB 3G6JE 5ALCL 1SJVA 3NGBB 3SKNB 1FLTX 4ZUWA 3QJHA 5IB2A 1D3CA 2R9HD 4Q9BA 5FGRA 1A7NH 1LO2L 4GT7A 5CSZA 2R0WH 1GGTA 3RVXC 4UDTB 4KVNL 2EIBA 3BEWA 3M45A 3QQ4A 2NMSA 4CVUA 2R2EA 2OL3B 3VXUE 3HA0A 5J1AA 1P2CA 4CN1A 2UY6A 1AXSB 1LNUB 5FKPA 4MHHG 2NY0B 1B2WL 1LO5A 1QO3A 2YD9A 5B4MD 3BKCL 2H32B 4M9OA 1FG2B 4X7CC 5HI4D 1JF5A 3VXUA 2BVPA 2EIZA 4KI5F 4RMSA 3HTLX 3FT3B 4PJFA 1RUKL 4NNPH 1MLCB 4PJHE 1GAFL 3KJ6L 3VGEA 1K5NB 1CICB 3S36L 5IHZB 1CGSH 3VCLA 4JG1L 4H88H 5KSBE 4YDKL 4JREC 4K23H 2XG5A 3WO4C 4PDCE 1CVSC 5SV3A 4GKNB 1MJUH 2WZPD 1RZJL 1BM3L 3CLFL 1U3YA 3RPIB 2AGJH 3PHQA 2RB8A 5ILTH 1WFNA 1DBJL 1NCTA 5H8DA 3F58L 3O8XC 3VXUD 4M5ZH 4HUKB 3STLA 1BQHA 3LZFL 5TDPB 3NFPB 4G6JL 1ZLUH 1X5JA 3TC9A 4HHAA 1JMXA 2JELH 3W39B 3QXWA 4FXLA 3QQNA 3KPLB 2H8PB 4PJ7A 2ZUUA 1E28A 1I7ZB 1IKNC 4Z76B 1QA9B 4E0RB 1OAQH 4R96A 1U3HB 4YGAB 1R3LB 1QBAA 1GHFL 4ZD3L 4JPIA 3PWJB 5CD3B 4EN3A 1AR1C 2FB4L 2QHLA 2P8PB 1UZ8B 3CU1A 3AY4C 2V2TB 1PD6A 1AO7E 1AXTH 1WZ1L 4LLAA 1XGUA 1UH4A 3VXNA 1YMME 3HR5A 5J12C 5DJYA 3U9UA 3JVGA 1P53A 1AO7A 1FH5L 3QPQD 4FOMA 3TVMC 2AV1A 4KHTH 3AS0A 3GRWL 4HGMA 1KTKE 3TO4C 1SBSH 1YMMA 4FN0A 2VXTL 3IDIA 1G9NH 4N5UA 1NAMB 4HK0A 1AR2A 3DROB 5C0DB 3LQAH 2O5ZH 2FO1A 4M8VA 4UQ3B 4OZIA 4OZ4A 3C8KA 4MCZA 1T22B 3FN0H 3QIUD 5FXCH 4UT7L 3N9GL 3IU3B 1MCWM 3V6OA 3ARFA 3D39A 5TQ2H 1T1XB 3V5DA 4E41B 1U58B 5HDLA 5TDOB 3V4PH 3IXTA 1KCUH 1AO7D 4WI9A 3BWAB 4NQEE 2VJXA 3L3GB 2EC9U 1WEJL 1UWXH 4KTDH 1YMMD 5IJKA 3ZMRA 2YK1H 4ELKB 4PG9B 5JHDE 1SJXA 3TBYA 1YUHB 1NC2A 3KYNB 3ZKQD 3ARXA 4KJWD 4KQ3H 5DC0A 4NN5C 4LDOB 4QXGH 1JNNL 3BO8A 5JHDA 2DQCL 1FL6B 3MOBH 1JRHI 2B1HL 1BBJA 1MWAH 4DEPC 2VLLB 3OMZA 5EZIL 4RZCA 4FFZL 1Q0YL 1RJYB 1QBLH 3STZA 3JV4B 4H0IA 4TUOB 1INEL 3QUYB 2FEEI 3LV3B 4WW2B 5DRWB 1QP1A 5DMIL 4LHUB 3RGVC 5AG8A 4OD3H 1NDMB 5IVNA 5F96H 4PP2A 4NQED 4LVNB 3LN4A 1ZXQA 4OCSH 4LPUA 3GMRA 2DQTH 6FABH 4DJMA 4H8WL 3TA3D 5JHDD 2BOBB 1NGQH 4OKDA 4IJ3B 1QVOA 4K3GA 2OMBA 3VG9C 1FRGH 2I5YL 4MDJB 3WUWA 5JMOC 3LIZH 3EO9H 4Y2DD 2OL3L 4BA8A 1J05B 5IB4B 3O3BA 5DFWH 1QOKA 4JQVA 5C08A 3SKJH 1F42A 3AREA 1MNUH 2IEPA 5C09A 3BQUB 1P5UA 3WKNA 1BPVA 2VDNL 5EN2B 4NO2A 3D25A 5TGBB 1FGVH 2LABA 1KGCE 1V7MH 1ZVSA 3WSQH 5DDHA 4S1SL 3P0GB 3HE6B 3NH7L 1UT9A 1Z0MA 3BGMB 1CG9B 2AQ2A 1QR1A 5IHUH 2MSPA 3MYJA 3OG4B 5L2JB 4UOW0 4Z7VF 4JKMA 2SEBA 3RU8H 5GS0H 5D2NB 1YEIH 1A7QL 4M1DL 2NY3B 2E6QA 3EOTL 3UJTL 2XTJB 4NHCH 5GGVH 3WN5A 4P9ML 1ZLUK 2ID5A 5GS1C 4XP9L 2VL5A 5L6YH 2EH7H 3DV4B 3BUYB 1G7JB 5F9WB 4M93C 3QYCA 1KGCD 1YEDA 4WWKA 4PB0L 1A6WH 3QISA 1C12A 2CDEB 3K0WA 4XMKL 3JWOC 3LPGA 5CZVH 2R56H 1CS6A 4JY5H 4U1LB 1MUJA 3GMQB 2R0ZL 3X3FH 4Y5YC 3AGVA 4UUJB 4ESKA 1L7IL 4M6OH 4LVHC 5DZOA 4QHLB 4JRYB 3HC0A 1N2RA 5FUOL 4FQHB 4XP1H 1BBDH 3MV8E 4LSQH 4QHUA 3D0LA 2CDGB 4C55A 1RJZA 3WL9B 1H8SA 1ZEAH 4LSDA 4GAJH 3MR9B 4K8RL 4MA8H 3CFIC 4OTXL 4HS6A 5IROC 4BELD 5K9JL 4U6HB 3VFMB 2EDXA 5A2JH 4OQ1A 1NAML 5DEGA 1JF1B 4HIIA 1PSKH 3IFNH 5DO2D 1JMZA 4LNRB 3TO2B 4RGMB 3WIFA 4M6MH 3RUGE 1J8HB 3MACH 5FYJE 3BH9A 4P9HH 4MS8D 4Q6YA 4PRPA 2W92A 4YHZL 2GT9A 4HWBA 3MA7A 2IJ0C 2BY1A 3MV8D 4DKFL 4WV1B 3O3DA 4J1UA 4WEBL 2DWEB 5IB3A 4PJCE 3D5OF 1CLOL 2ORBH 4GW5A 1OF2B 3V0VA 3C5ZA 3SE8L 3ARGB 1H3TA 5E2JA 4CU7A 1P4LB 1HQ4A 4POZC 1YEGH 4ELMF 5IFHL 2KPNA 1QKZH 4O58H 3BRFA 1UG9A 4G7VH 4HH8A 4PTUA 3CVHB 1JGEA 4ZNEE 3VH8B 2V17H 3I6KB 4UDUB 2EYRA 5HHPA 4UB0H 2ZJSL 5FYJD 2VZTA 4BQCA 4XX1E 3MNVB 2VISA 3CDCA 2F53E 3C5ZD 1I1RA 3SDAB 3G04B 4P23B 4HIEA 3JV5A 4KI1A 2J3SA 4KI5E 4DN4L 5CILL 1CFQB 2F53A 4LCYA 2Z0BA 1BZ7A 1R3KA 2X4NA 1IM9B 2WM0A 1MRDH 4KK8D 5ID0B 5DJ2A 2CLZA 4NZJA 4MJ6A 3WDHA 3MCKB 4M7JL 5DR5H 2D31A 4NO3B 3HLAA 4U1NA 2DBLH 5TPWL 1VGKA 4OT1H 25C8H 2X4PA 4PLKD 3PGCB 1GGIL 2WAHA 2F53D 3NIFF 4DTGL 1FNEB 3QNYB 4TTGA 3EHBD 3WFEH 2Y1VA 1DBAH 4FS0A 4R2GD 4NYLA 4OJFL 4N8VA 3FO0H 4G8FA 2A9ML 4KI5D 5D1QA 5GRUH 4XVUD 1MJ7H 1UACH 3Q3GB 3W9DA 3F5WA 3WEXA 3N1GC 3KLDA 1H5BB 2GJ6E 4WTXA 4OZFA 4PY8I 2VUYA 2BVQA 4MXVE 3F7VA 3FQNA 3G6AB 1U2CA 4FABL 4I77L 4YZFE 1U0QA 1EFXA 4U4BA 2IH3A 3RX8A 5DTFB 3VFRB 2Z93A 2ADFL 1MCKA 3NCBB 3DO3A 3KYKL 3ZDYF 4LSRH 4WFFE 1A7OL 4PS4L 3HCVA 1K4CB 3UO1H 2DM3A 2Y7QB 4MAUH 2KQNA 5CEXB 3L3JA 4XP4H 3WFHB 1F00I 4UNTA 1F4XL 3VI4F 1DQJA 4PJ9A 3TNMA 3KLAA 3VFOB 4PRBA 1RIUH 3NCMA 2GJ6D 1BQUA 5BRZA 3SO3C 1TETL 4NSKB 3I2CH 4UOW1 1QBML 4X7TB 3GGWB 5FO9B 5AUMB 5FCUH 1TVHB 5KZCB 3RVVD 4WFFD 3VFUA 1FFQA 1CE6B 1S9KC 1AHWB 4WFGE 4HCRH 4GOSA 4MD4B 4TSBH 3VFWA 4MQXD 1E27B 4GKSA 4HPOL 4D0CA 4DWHA 4ZFFB 3QJFA 2ERJC 5JORB 5JUEH 3PGFL 1MCOL 2WIIB 3Q6FA 4JFPB 1KBGH 3OKNB 5JR1L 4FNLH 4WHTA 2DQHH 4UMGA 4L9LC 2BP3A 1U3JA 4HFWA 4R7DA 4AY0A 5JXAL 5IVOA 4PRDB 1I9EA 1C8PA 3T04D 2ZSWB 3ZDXF 1HYSC 4NKDA 4KXZI 2H41A 5JIHA 3RWFB 4PJAE 1OB1A 1MSPA 2CD0A 1MHEA 2D7MA 2FZ3B 4P4KA 4WEMB 1FNHA 3J8F7 4GLRI 5D9SB 5KVGL 3REVA 4WFGD 3P11H 3CZFA 3FRUB 2RFXA 4HMEA 5F1IB 4PGZA 1KJMB 2ZKHL 5DVNA 4AZ8A 2GIYA 5FHAL 1M4KA 5I16B 2ARJQ 2ZUWA 4FTVE 3FO9B 4JDZB 5BQ7A 3CVHL 2VAAB 3L9RA 1K2DA 2XWTA 2AV7A 2CDFA 1U6AL 3D48R 3QUZD 3N1PC 2GUOA 4P4KD 2EDDA 3ZSSA 4KY1L 3KJ4C 4U6YA 4KK5D 3AS2A 5CJ5A 2FH8A 5HJ3A 4KDWA 2MKWA 3RWDB 4JGJA 1FZOB 2ADGB 2Z35A 3DGGA 4UI2A 4D0BB 4QF1B 3L3HB 4HWZB 5JO5B 4M6NL 4OFPA 5J13C 4FTVD 3B9KD 5F8RC 4WI4A 1GJIA 4XNUH 4AL8L 1BLNB 1CT8B 2FECI 4Z7VA 1VFMA 5ITBL 2J6EA 4NRZA 3O8XB 1DL7H 4OZGA 3H9HA 3VFSA 3L1OH 5BVJA 4JZJC 5DA0B 3B9AA 3W11D 2YD7A 5HYQB 2N7AA 2R15A 4Q9QH 3VXOB 1RVFL 4KROD 4FP8H 5CJBA 4WW1B 2FWOA 1BGXH 3MLUL 2XZQL 1MFDH 3VXSE 2HFTA 3FAWA 4RGOH 3FO2A 1MAKA 2HG5B 3OGCB 3SY0A 5GRZA 3QULA 4O2EB 4EUPG 2P5WE 3VXSA 3EJZC 3GJEB 1RD6A 3RDTB 1SBBA 2A73A 2A74B 1KCRH 2EDJA 4YQXH 3K74B 2P5EB 4BK5A 4OKVB 1Z3GH 3SKOB 2C3XA 1Q9LB 1XF4B 4DZ8A 1QLFB 2PW1B 4P4RB 3W0WA 2V9QA 2NY2D 4P46A 1CFSB 1OP5H 4Q0XL 3S88H 3DX7B 5IK3A 3VE0B 1KCGC 1OAZH 5J12B 2NY7H 1GC1L 1XMWA 3RWGB 4P2CG 2GTWB 5EOCH 1IGJA 2FX8H 4WWID 4KK6C 1R3HA 1G7MB 1AC0A 3VXSD 4CL7A 4NKMB 1JTPA 3BIKB 1SY6H 2KQMA 2B1AH 2ZUTA 2P5WD 5KVDL 1JPSH 2Z31C 5HGAB 2GHWB 4HJ0D 3AB0C 4P46D 5GGUB 3VFVB 4GG6B 3UJJL 4MQSB 4NN7B 1DVFD 4O02H 4HV8B 3UTSB 4HWEH 2VZVA 4X98B 2BK8A 1JWUB 2VSDA 1QBBA 1QFWL 1KIQB 5IGXL 3LEVL 1P6AB 5JW3L 3LKRB 4UQ2A 4JJHA 1EERB 1T0NB 3H0TB 3IGAA 1UA6H 1XF2B 2R1XB 1EO8L 5FHBL 3MLSL 3DXAB 3GSRA 3HZMA 4ELME 4R7NB 1AGEA 5C0GB 4NN5B 1F11B 1CD1B 2YMXL 3MC0A 5F89A 3QFDA 4TTDD 5BS0B 4F9PA 3F7YA 4TNVF 3Q5TA 4TSCH 4V1DB 4ODSH 1A6UH 1YEFL 1IAKA 3OKOB 2OXGA 3HE7A 1KPUA 5JLZB 5T5NF 4GBXC 2EC9T 1IM3B 1FLRH 4NM8H 3BKYL 3K8LA 1KG0A 3LHPL 4PD4K 1YEJL 1YQ2A 2R2BA 4I48A 2CRIA 4CU6A 1A9EA 4CMHC 4Q7DA 4APQC 2AABL 4NWTH 1QQDA 1T66C 5D5MB 4LKCA 4LSVH 1HI6A 4OM1L 1IGYA 3SOBH 3ULUL 3HMWL 3ROLA 1C1EH 1VKXA 1ADQL 4K3EH 1MIMH 4NQDE 1G9MC 1KN4L 2NX5A 5DD0L 4OFYD 3KXFA 4AYFA 4YEEA 3VG9B 3WIHA 2X4TA 1EXUA 7FABH 3LDBB 5IV2B 5E9DB 4X9IA 4CNIA 1P4BL 3A0OA 5I8KH 1I1AC 1LQSR 4MJ2A 4AT6A 2BVUA 2XOTA 5ADPL 1IC4H 1VEMA 3NIFE 1LP9B 4NBXB 1EO5A 4JLRA 1G0YR 2GJJA 3U46B 1GXEA 2ATKB 3FZUD 5J7CC 3WFBH 3ES6B 1F4WH 4M1GL 1KN2H 3D69B 4Z0BL 2NX5D 4XCYB 1KPRA 1N4XL 5FYLL 4C56B 4LLWB 4X99A 4OUUB 1FYHB 35C8L 3SCMA 3ILQC 5EIIA 4PGBA 4NQDD 1U8KA 1X5XA 3ARPA 4Z7QF 1BF8A 4NP4H 3G5XB 5CP7B 2WSKA 4F7EB 4LRIC 3EYVA 4PV9A 1A1OA 4MX7B 5E1AB 4OM0L 5HYJE 2E9IA 2R4SL 3JV0A 2EDWA 4YHIB 4JFDE 4X4YA 1FC1A 2XPGB 5KAQF 5L2KA 1ZGLA 2ZWLT 4MHHI 1MEXL 3UBXA 4ZYKB 2PTTA 3VI4E 4GQ9L 3QDMB 4CVXA 4KPHH 5EBWA 5LCVL 3FB8B 3Q1SL 5FFLA 4F58L 1RZ8A 2J7LA 1LD9B 3L5WA 5T3ZL 3BPNB 1J87A 1CGTA 4RFOL 3OKEA 5DHYA 2A6IB 2A83A 3H3BC 5LVEA 1OP5K 4EQ2A 1RZIB 5HYJD 2NY6C 1R3IH 1FL5A 5ALBL 3U7WH 3O45A 4NO0A 2X1PA 3T0VA 3BP5A 1MQKL 4JFDD 4AG4H 3VW3H 2R2HB 5MERB 1N5YL 3BP4A 15C8H 3P0VL 1U8PA 1OSZA 4WO4C 5IG7B 1DQQA 3QI9D 3LSOB 2WP3T 1OGAB 5C2UB 1QNZL 5A2IH 1HHHA 1VFAB 3QEHB 3U0TA 4I0CC 1L8JA 4L8DB 1LE9B 2NR6D 3FOMB 3C60B 3FB7A 4WDIA 4WW2F 3S37L 1NMBH 3KAAA 1FN4A 2H6PA 3X3GH 2JB5L 5FB8B 3J7HA 1RK0B 4TVPE 4U1JB 5D2LB 4GRLA 3PWUB 4QYOA 3MLZL 1OAUH 4L4VB 5CEYB 5KVMC 2K7PA 4KRPB 4PJ8B 1OTTC 4MA7H 3GO1L 4NZUH 5B38G 5J56B 1A9BA 5DEZA 4RMQA 2E7LC 4LARH 3X13B 3GUTA 2E6PA 1KTRL 2EKSB 1DUYA 4LRNH 2O61A 2ZUVA 2WUBL 2OBGA 2HT3D 4X4ME 2A77L 4IMLB 5SV4A 2V7NA 1CTOA 3CDFA 1JZ5A 4LCCA 2P8MA 4XRCA 3LKSA 1HDMB 1BFOB 1NMCC 3HS0B 5HHXH 2HMID 4QOKB 3BISA 3ECBA 3MRHA 4TVPD 3A6BH 4Q6IC 1ZA3B 1GRWA 3MNZA 3ARBA 4HULB 1ACYH 2MWCA 1C5CH 2PTVA 5GRJH 3KPPA 5MENB 4PY7B 1WAAF 2HRLA 4MJ5A 1D5MA 3QWOB 5BMFL 4YFLI 1R5VB 2PETA 3BZEB 4Y7MA 3MA9H 1NAKH 3U7YL 5JDSB 3KR3H 3DHMA 1M05A 4YPGB 1TZIB 4M4PA 5D6CB 2AI0L 2UWEB 2CKBH 3RWEB 3U30C 3QZWG 1CQKA 3V6ZB 2J4WH 4IOFD 4HUVA 4KGLA 4HD9A 3ULVE 2R29L 3KHQA 1PVHA 1I7UB 3TN0B 1NBZB 4JG0H 3OL2A 1CK0H 2WWMC 1MJ8H 4EI6A 2VE6B 2Q1EA 1FPTL 2MMXA 3KPRB 2X89A 1YZZA 2XY2A 3EYOA 3DYMA 2LQRA 3HNVL 3WXWH 3FQXB 4UIKH 4HWNA 3WS3A 3GRWA 4KUZL 1A7RL 1GGBL 2C3VB 4NBYB 3O9WB 3PABB 4LVOB 4WFEE 4YDLB 2AXHA 1FFOB 2VDLH 5KVFH 3IXAB 5L9DL 1Q9OB 3MGTB 1FO0L 1F3JB 1ZHNA 3BKML 1AFVL 3QIWC 4HGWA 3P9WB 2XG4A 1KIRB 3ULVD 1U8QA 3SDCD 1GZQB 3H9SA 3GB7B 2BOCB 3O6FA 3U2SB 4OV5A 1XH3B 3RIFK 2HFGL 2A6JA 2I9LA 4S1DD 4HXAH 4P5TC 3IF1B 3SKMA 1NCWH 1FVCB 1U36A 4X5WB 5J57B 1S78D 2Y25A 1NKOA 1FFPA 1KEGL 4C83A 4D9QE 4Z6AT 4LDLB 2G2RB 2NLJB 3B83A 3FMGL 4WFED 3AAZB 1U8IA 4JO4H 4I4WB 1S7VA 3PHOB 2YN5A 1JYNA 3IFLL 4KZEH 1JWSA 3BPCB 4PP1C 5HHOE 5JIKA 2CUMA 4R97C 1XGQB 1NGZB 4G7YL 5LKNA 3O3AB 3ULSA 1UJ3A 3O2WL 4FQ2H 2EKJA 1WBZA 4JO1H 3BVNA 4JFFA 4PGDB 1IAIL 2H2SD 1ZT4A 5JW4Q 1A7NL 4AH2A 4CVWA 3GSOA 5D1ZD 1MHPH 4H5SB 3N0PB 2R0WL 3PWLA 1XF3B 1WBYB 4G6ML 3ZL4H 1CD9B 4D9QD 1WIUA 4HEME 4LMQI 4UDTA 1HSAB 3MRGA 3PQYB 4LKXB 5HHMB 5HHOD 4ZS6C 5JW4N 2OL3A 1AXSA 4JHBA 1LNUA 5FA4B 4NNPL 1CGSL 3GMMB 2HKFH 5EIQA 2WBJD 3FT3A 1MLCA 3JZ7A 1F6LL 2QADC 3MUHL 1JP5A 1K5NA 5IHZA 5EBMA 1MVUB 2NY1D 4K23L 1NL0H 4FFVD 3BEVB 1MJUL 3UTTB 3E8UH 4LLMA 2AGJL 5ILTL 2VQUA 4JPVL 2AEPH 4GKNA 4M5ZL 2D9QB 3ARDC 3RPIA 3KDMA 3DBXB 1CDBA 2HAZA 5HPMB 2IANB 3SDYL 2XFXB 3GHEH 1S5HB 5CINL 3CFJB 3IDMB 1CXEA 5TDPA 3NFPA 3AUVA 4IIQB 4RGNC 4ALAH 1CICD 2PO6C 2DICA 1QLRB 3KPLA 4QRRB 2H8PA 2D03H 1I7ZA 2VZSA 4Z76A 1QA9A 3NFSH 4E0RA 2W0PA 3X12B 2COQA 4XI5C 1U3HA 4JEGB 1OP3H 2FEDD 1R3LA 4NNXB 4NRXA 4Z7QE 3PWJA 4WI2A 5HDBE 3CXHK 1UZ8A 3DWTA 3WJLC 1TCRB 3FQRB 5TF1L 2YUWA 4HLJA 4XCCL 3VA6A 4KHTL 2F5BL 2DI8A 1G6VK 1X5AA 1IC7H 1SBSL 1U3HD 5A3ID 3O6LH 2O5ZL 4JDVB 1CDJA 4X9GA 2AERT 1NAMA 5C0DA 3FN0L 1HCFX 3VFTB 1LQVA 5I30H 1HINH 4Y5XB 5I1IH 2IPKB 1JL8A 3AS1A 3B5GA 4UQ3A 1Y6MR 5HD8C 1DLHB 5IHLB 3B2VH 3CH1B 5DS8B 3IU3A 4HS8H 5J9PB 4MJIE 1CL7L 1T1XA 3UC0H 2QQLH 2X1WL 5FM5M 4KTDL 4E41A 4HXBH 5DK3A 4K8RD 3DURB 4R6UA 1G7HB 4KKCC 2GITA 3BWAA 3L3GA 2MOVA 3B5TA 4XAKE 4ELKA 4KQ3L 4F9LA 1J0HA 1YUHA 4FHBD 3S5LA 3DX6B 3KYNA 3UTOA 4FFYH 4G43B 2JCCB 5F1SA 2R23B 2VB5A 1FL6A 2IBBA 2XTLA 4JZNB 5BZWB 2Z31B 1U92B 1QBLL 2ZCLH 3AB0B 5H35B 2NXYC 3GSQB 3DHJA 2YHGA 4ZFOB 2A6KB 4OD3L 1RJYA 4MJID 2BRQA 3JV4A 2XYCA 4MSWB 1N0XH 1OSPH 3LV3A 4WW2A 4OCSL 4LHUA 5DK0A 1XGRB 2DQTL 1NGPL 2X70B 5GJSL 3MODL 4M1CD 1NGQL 4XAKD 1EHLH 4XPGH 3QDHA 4XNXL 1CXKA 3K3QA 2BOBA 1VGEH 4K7FB 1P9MA 1LO4L 3AXLB 5AWNH 4H20H 4MDJA 4X6FA 3SKJL 1MNUL 1BWWA 1J05A 3QUYD 3T2QA 5IB4A 2GK0B 3G9AB 4LHUD 4F2MB 1FGVL 1FSKB 2BERA 2WNGA 3WSQL 4M7ZC 3LOWA 3BQUA 1KV3A 1NQBA 3RAJH 5EN2A 3VRIB 4APQB 5DC9B 5IHUL 2VAJA 3F12B 3NCEB 3HE6A 3MQIA 1FFNB 3BGMA 1L9NA 4FG6D 1CG9A 5D2NE 1KNOB 5EWIH 3VD3A 3O4LB 5GS0L 1XZ0B 32C2A 5L2JA 4GAGH 1YEIL 2EXWD 2DQDH 2GAZB 1I3VA 1WAAA 5CKGA 1EZVX 2ICWB 5D2NA 3O11B 2AJXL 5DUPH 3NIGE 2UYLB 2NXZB 1AD0A 2DLHA 1I9IH 5D93B 2V7HB 5JW4R 3EYQC 3BQUD 1XF1A 3RL2A 1QTYT 2Q7YB 5L6YL 3FFDB 3H2WA 2C5DC 4IRSC 1CI5A 1NPUA 4I2XB 4HWBH 5T5FH 1A6WL 2GSIB 3HE6D 1D9KD