4L8CA

Crystal structure of the h2db in complex with the np-n3d peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 275
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8cA01
4RFOH 1G6RA 1SJHB 2CRMA 2HKHL 4HUXB 1JGVL 1TVBB 4M5YH 4TNVK 3S97C 1I9IL 3WCYA 3FHQA 4RDQF 4MA1C 3QEHB 3WS6A 4O2FA 4FMKA 1IFHL 3CSYA 3F7VB 2XWBB 4PRAB 2B4CL 4X98A 4OQ1A 3MACH 2YHGA 2NTFA 3ZE2E 3T0AA 4NO3A 1PQZA 5K33A 3T0VA 3W2DL 2Z92B 4LLWA 3RWDA 2DKSA 3RPIA 4U1LB 1FZJA 3VG9B 4BSJA 1V8HA 4PG2A 1E27A 5D6DC 5CP3H 1KG0A 4JRYE 1G1CA 1ZTXH 3Q6FA 1FG2A 3C87A 4P4KD 4Y16A 3QEQD 2F74B 4I3GA 3IGAB 1VACA 5E2UL 1J0HA 5CGYD 1CL7I 3DROA 4U6YA 5D7SL 2XKSA 4Y19B 4QOKD 1I9JH 3H0TA 2OL3L 3T2NH 3IDGB 3B2VL 3JV0A 4CVUA 2BXZA 3K2MC 1FFOB 5DHYA 1MCBA 5ALCH 1B6UA 3VFOA 1L6XA 4HWNA 4JQVA 1HI6B 1G7MA 4APQC 4GG8A 3F58H 5T33H 3QRFM 2OI9A 3VGDA 1AXTH 4XHJD 3V9FA 2XYCA 2WINB 5HDQH 3RGVA 4IIQC 4HIEB 1DANU 2FYYA 1ZHKB 1LK3H 4HX1B 1J87A 1RZFH 1TJHH 3QG7L 5F6HJ 2JJVA 3MOAH 4DN4L 4L8CA 4G6KH 4YIQB 1EUTA 3QIWC 2QHRL 3UJIL 5D2LE 1RFDH 5EO1B 3FFCB 4R90L 4XPGH 1WWWX 3WFCL 4U31A 4M7JH 4M8QB 1J0YA 1T0NA 3TPUA 5M7QA 1AGFA 4RMWA 1M7DA 5J06A 1TITA 3LN4A 4LPXA 1PX4A 1D6VL 3S96B 2EDOA 4WO4B 3T0ED 3LEVL 2NPLX 4OCNC 2QR0B 4IOIA 4EI5A 4HS8L 1IGJA 4MA3B 4LRIA 2Y07L 3GUTA 3WKNA 1T1WB 1HNGA 4QRSB 3WL9B 1QO3A 1UJ3C 4FTVA 3ARGD 3CMOL 4GSDH 3L3GB 4KRMB 4KJYB 5CMAA 3ZTJG 1OPGL 4BK5A 3P30H 1TTUA 3CDGA 3HR5A 4OD2A 1S7QB 5MEPB 3S4SG 3VXUB 3BP7A 5DO2C 1MI5B 3OKMB 3TZVC 1KTDA 4Y4HB 5CBEB 1C08B 1YEDA 1EGJL 3NIDE 1E4XI 3JTSB 2VR5A 3S98A 2FATL 3QDMA 4GAJL 1T22B 3H3KA 1A7NH 3OJ2C 2V2TA 2VTFA 3HC0B 1DBJH 3RHWK 4HHAB 2HJKA 3P4NA 4D0CB 4N1EA 3ULUE 4OZGA 5BCAA 2ZCLH 3EJZC 3MJGX 5JW4M 4RA3A 3TVMA 5FECA 5D7LE 4J3OC 3MNVA 4JREC 2EZ0D 5MERA 5MHSD 3G04B 2EDKA 1WBYB 2Z31D 1T83C 4HWBL 4LIQE 1CD9B 3T8XA 1N4XL 4ZOAA 1MHPH 5EO0A 1EX0A 3MX0A 4LLDB 4ZG1A 4WTZA 4MNHB 3O6ML 5EOCH 1RZJC 2R56H 3J7HA 5F88B 1JZ5A 3C8KA 2EYTA 4MJ4A 1EHXA 4P2OD 1HIMH 5EB9A 1BFSA 3RRQA 1MREL 2EYSA 4O9HL 1QKZL 2C5DC 3RDTA 2DQJL 4PJ9D 3E8UL 4PJ8B 2J4WH 5DTFA 2VH5H 5J13C 1NH6A 3AY4C 4MDJB 4J6RL 5D9SA 3UBXA 8FABA 4XNZB 1AI1L 4W4OA 3MV7D 1T1ZA 1MWAL 2FEDD 3SKOB 3WLWC 4PTTB 3BPCB 1KCGC 4GQ9L 3DUUA 1TNNA 1K8DA 3HNSL 4HH9A 4BSVB 2QQNL 4NO2B 4NJ9H 5ICZB 4I3RH 5HYSB 3PJSB 2Y6SC 4ZS6C 4PS4H 2AKRA 1L7IH 5GGTA 2ITDB 3JV5A 3BKYL 4M7KH 3WHE1 4KXZI 3MRRA 5T1MB 2W0KA 3CCHB 3GMLA 1RUML 4DK6A 3MRIA 3TH3T 2B0SH 4S1DC 2A6IA 4U1IA 1AY1H 3BDBA 1KJ2A 3LEYL 4JRYA 1MQKH 4FN0A 1J12A 1IGFL 2X6MA 5SWSD 2NY5C 1KN2H 1WEJL 5D2NE 3WFBL 4UNVA 3EYQD 1H3XA 3KGRA 3NCYS 4LEXL 1JZ3A 4ZFOA 3O3DB 3KPSD 2DYPD 3S35H 3OXSB 4QRPE 5IESH 5FGCB 1JNLL 2PKDA 4HIIB 3E1F1 5ADOL 4HGWA 5IVXF 5KSBB 4L3EB 4NN5C 4P3CL 1UC6A 5IFAH 5FDWB 5F7WC 4URTB 4DGYL 1T21B 2VDKH 5A3IC 4PV8A 3HPJA 3OKDA 2GITB 3U4EB 4UT7L 4XI5D 1MVUA 4JR9H 3RVVD 5KTEL 4WI4A 3MLPA 4NRXB 4JO2H 2NX5E 3A67L 3IF1B 3BGMA 2UYLB 4PLJC 5IMMA 4OZ4B 5CIPA 3QULA 2CPCA 4KDWA 4R8WL 5JHDA 1O7SA 2P5EE 4PJAB 1FL3B 3PP4H 4NNYA 1E6JH 5I75C 3WMSA 1VGKB 2F5AH 1DFBH 1KIRA 1QYGL 3IDYC 3ZTNL 5B22A 4X0KA 1TCMA 2CLVA 5BS0E 5D2LA 2Q76B 1FE8H 2AERT 3L7EA 1X6NA 4KZDL 2J8UE 3HS0A 4BFGA 2BNUB 1CXFA 4FXKB 4JAMB 4QHMA 5DZLA 1CI5A 5HYJE 4KRPC 5HJ3B 4CADB 4POZD 5FKPA 5ITFB 4CN6A 5EA0L 5C8JA 2WP3O 1G7HB 1XR9A 2PXYD 4R7NA 1BM3L 5ICXA 3U7YH 3BZFB 1MELA 5I18H 5CEXA 3HB3D 5HDBF 4J4PC 3S4SA 4YZFF 3ZKMD 3GEWB 4A2MA 4KUCD 4NO5B 4F7TB 4PY7B 5E2WH 5IGXL 5J89A 1IL1A 4JFEB 2E7HA 4LLYA 1BEYH 4HC1A 1NPUA 1I8IA 1V7MH 5CEZD 1BWMA 4KKAC 2I9TB 4LGPB 4KAQL 2KQMA 2JE8A 1KB5A 4ZPVB 1KF9B 2ED7A 3LDBB 1OSZB 1A4KA 1AKJB 4RGNC 4C4KT 2ERJB 2CUMA 5GGVY 1RZGA 3LKSA 3FKUS 4OUUB 3RKPA 3FFDB 3QG6A 4G8GD 5MEND 1J9CT 2E7LA 3NTCL 1IKNC 3HPLA 1IBGH 4JQXA 3SDCC 4QT5A 3ARVA 1N8ZB 4BQ6A 3CZFA 4ISVA 5I1IH 4LF3A 5T5NG 2GAZB 2VQ1B 4UV7L 2QADB 5D7LA 4IRSB 5EO9B 2DM7A 1XGUB 3ULVL 4ZPTA 4HIJA 2A73B 5EBWA 4PJHB 5CUSL 2XIDA 3NPZB 5GHWH 5C07E 1FZMB 1J10A 1XCQA 4P5TA 3C08H 4X6CB 2MTPA 1G9NC 2VISB 3EZJB 2AQ1A 1SEBA 1Z3GH 5F9WB 1DQLL 4ZXBA 2GSIB 5I9QC 4NO0A 3QIUB 3MRQA 3H9SB 4WEUD 1IAMA 2VLLA 1X4ZA 4PFEA 1AGBA 4YBQD 2CMRH 2HG5A 5FB8B 1S7XB 3LN5B 3QT2A 3ULSA 5C0JA 3VWKB 1MCIA 3EO0B 1S7TB 3SDDC 4NM4H 2B1AH 2FX9H 5I1EH 4DQOH 3PWLB 2HKFH 3CU1A 4X7FC 3UPRA 1E4WH 2YRLA 4TSCL 1IKFH 3O2DL 2EDJA 3UYOD 1U58B 4CRPA 3OPZL 1JTTA 2FO4A 4GRMB 4ELMA 1H5BC 3PG2A 4WFHD 1XGPB 4LBEB 2ZUQC 1YEKL 4LSTH 3FQXA 5E2VL 3CFBA 5AD0A 1W72L 3B8SA 3RVTC 4CW1B 4P9HC 1P7QD 1UWGL 2AV7A 2XA8L 5ACLA 4OF7A 1BQUA 5D2NA 1WWCA 4UB0H 1SEQL 5IHZA 2D2OA 1MOEA 5ISZD 4I0PD 3HE6A 4P4KC 1FYTD 1IEBA 4QRPA 2DBLL 2F53B 2YKLL 2UVEA 3QCVH 5IEHA 1IMHC 3QDJD 1G9EA 2YWZA 4NQVB 3THML 4U3CA 1MCCA 4QCIB 1ETZA 2F58H 2QKIB 4ELKA 1JNNH 3AU1A 5KS9B 1INDL 1KN4H 2HWZL 3MV9E 1UWEH 3LV3B 4C56D 5L2KE 5M94B 1ACYH 3ILPA 4I0CC 1KJ3H 1S7SA 4GXUM 2DJ4A 4I9WE 1F3DJ 2VC2H 4MA8H 2F19L 4QGYA 4B7LA 5CSGA 1FJ1B 2NX5A 3UTSB 3VXOB 4OD1L 1JZ6A 1WBZB 3MJ9L 2G5RA 2OMNA 5DF0A 2P5EA 5DVNA 5CHNB 5DJCA 1QFWI 1KCLA 1MJ8L 1GAFH 1LE5B 1QLEL 4GMSH 4NZRL 5TPWL 2DQHH 5BS0A 4LCIH 1I1FA 1JRHI 5HYJA 4M6NH 3M17A 1ORSA 1SVZA 4OD3H 5EU3B 1HXYB 2O61B 4WI9A 3MLUL 1WLHA 3L95B 2BSED 2X89D 5IMKB 5DUBA 4PJXE 1CVSC 1FRGL 3PQYD 5GS1C 1KJMA 5L8JB 2IH1A 2C3WA 3LQZB 2AXJA 1EDQA 5I76A 1P4LB 1XF3A 2O5XH 3ERYA 1B90A 1CR9L 1F2QA 1HQ4A 2X4UB 4M6MH 3VGHA 2BNRD 3GIVB 4X9HA 4D9QE 1CS6A 4KUZH 4PRPA 4LPYA 4Y5XC 4JY5H 5CJQL 5I17B 4D0DA 3IAGC 5D1XD 4X4XB 3VI4F 5CINL 4OZHB 2M1KA 1BOGA 5DJZB 4O4YL 1JHLH 2GY7B 1U8OA 3L6FB 4FQCH 2A83A 4JM2C 4G8FB 5F6HI 3KPQA 5DQ9A 3QJHB 2E27H 2W38A 5JR1L 4Y4FB 4S1QH 5IFHH 2ZOLB 1IM3A 4F58H 1CLZL 4AEFA 4MJ6B 3ROOB 4GW5A 4GKSA 3VG9C 2NXZD 3NACL 4UT6L 3DVFA 5ILTH 4HZLA 3GSRB 3MRLB 1CU4L 2VWEC 4WI3A 3V5HB 2X1QA 3BKCL 3FQTA 4OQTA 2BDNL 2W92A 2R29L 3RTQD 5DMYA 1G9MH 1CFVL 4HG4J 4JM2F 2NY7H 4FABL 5ESQB 4FMFA 2VL4A 2QSVA 4PLKD 3FO9A 1KLUA 2G9HB 1Z9OA 3H7BB 4M1GL 1N6UA 2IPKA 3O6KL 1T1YA 3S34H 4LSQL 1EUUA 1ZLVH 2VIRA 5ANME 4LCCC 5H35A 5C07A 3DMMD 3VFNA 4EDXA 1BZQK 3WD5L 4DN3H 5FYKD 1UXSA 5HGAA 4I18A 1C7SA 1ZGLM 5JOFB 4LU5H 5ETUB 4L5FH 1FGVH 1ADQL 1H3UA 1Q9LB 4XZUB 5C09E 4N8VA 3RKDD 4F9LA 1A7OH 3BP6B 4PRIB 4XC1L 1A6ZB 4Y8DC 1B2WL 3CFCL 5GRZA 1T89C 4K7FA 3V6ZB 5C0CB 4PJ9C 4GRWE 3OR7B 1YQVH 2DQTH 1NGXB 1A5FL 1YUHA 2HTKD 4FHBD 4TULL 3D48R 2WQRA 3W0WD 4FFZL 2YN3A 3VRJA 1QFHA 3ZKQD 5F7YC 3QWQB 4PB0H 4L4TB 3KYKH 1HOCA 5L7XL 5TDOA 1EH9A 1KCVH 4NQED 4RDQG 5I1HH 2W9EH 1U3HD 3OHXA 4G7VH 4ZQKA 4HCRA 1TXKA 4JKPL 5GS0C 3OXRA 1IGMH 3VFTB 1PAMA 3BIAX 3DIFB 3FB8B 2DS4A 1H15B 4AL8H 3WYRA 3TBYA 1CQYA 5GS2D 3SKJH 3P40A 4O58L 4KQ4L 1P9MA 5KSAB 2X40A 4NDMA 3EYQC 3KS0H 5GIRB 2R2BA 4CNIA 4PJCF 1A0QH 5T1LA 2A77H 3D5OF 2VSCA 4QWWD 1U6AH 4GG6A 2PW2B 3MCLH 4XP4L 5CSZB 3MV9A 5HPOA 1LEIB 3WBDA 4Y4HC 1JZ7A 3O2WL 1CL7H 5GRUH 1JPGA 4LSUH 3UROR 4RSVA 1NCUA 2DWEB 2IBGA 3PL6A 3QCTH 4GKNB 3K1KC 2IQAA 4QRTB 1IT9L 3S6CA 5IHBA 2CGRH 4HIHB 4XAKD 4DZ8A 3MLRL 3ORJA 2ICWJ 2BSTB 2RFXB 1VEPA 4KROC 4XI5C 3GJFB 5D7IB 3U2SA 3V52H 3F5WB 1A9EB 5I71B 1YMMB 3OG4B 1C5DA 4DKFL 5DS8B 4GAGL 1LILA 4WUUB 5HHNA 2WUBL 2V5YA 1TDQA 1N5AB 2PNDA 4XWOD 4QHUA 3JWOC 4PJ7B 3CZJA 3PHOA 4OZFA 2ORBL 2F54E 5BZWB 3F6LA 3KPLB 4LGSB 4MAUL 1R24A 1Q9KA 3F7PC 4K71C 4AEHL 5BO1L 4A6YB 3R0MA 1YC8A 3X11A 2IG2H 3JSSA 1ZT4B 2VUOA 3L3JB 5BVPH 2R2EA 1Z9LA 4Y4KD 3DHJA 4HLZH 5EPMB 3CVHB 4XNYL 3L9RA 4PJXA 3C9NB 3RVXC 4OFDA 4S1RH 1CGSL 4HULB 3RAJH 2FD6H 3MQIA 4PJ8C 5E95B 2XQBL 2M26A 3ARUA 2GJ6B 2AJSL 4HW6A 4L9DA 4XNZC 4RISL 3VXNA 4YC2C 1NKOA 3GNMH 1A4JA 3P73B 5ESVB 1TTGA 5D8JL 5DD6B 5LGHL 3C60A 1N2RA 2EKSB 5F70A 1ES0A 4NQDD 2R4SH 3U36B 1FORL 1NMBL 2AJYH 1J8HE 4Z7WB 1E4JA 4LHUD 5HHVH 3B6SB 3DX6B 4HH8A 4ODUA 2AGJH 4BJLA 1J18A 3P9WB 1A14H 4HBQA 2WWKO 4YHOH 1JWSA 4PP8C 4NZDA 4DW2H 3RWHA 5TE7H 1JJUA 2H45A 1DL7L 1L8JA 2IAMA 3JTCA 1K2DB 3FJTA 3NZ8A 1ZLSH 2WANA 1QPXA 4HSQA 5I1CL 5JPMB 3I75A 4JFFD 4K94L 4YHZL 1E4XH 1PZ5B 4KUCF 3P9MA 3EDFA 4HJJL 5IJVB 4OJFL 2ZSVA 3EOYG 5E2TL 1GGIL 4ONGH 5JW5A 4JQIH 4FXGB 5LG1A 3NFNB 4WFEE 2EEAA 1FNHA 1F90H 3OX8A 1AJ7L 2DWDA 5KAQF 5ANMA 1G0YR 1S9VA 2FJFB 2XXCB 4PJ5B 1NCCH 3KJ4C 3GZKA 2ADJA 4N1HB 1YEJL 3DXAE 2XZQL 3KYNB 5I1JL 3OKNB 3C8HA 5C09A 2KZWA 4PB9L 3LSOA 2OX5A 4LGRB 5CEZL 4E41D 2BVPB 3S3SA 3UTZA 4DKEL 4TUJB 4OCLC 4YAQB 3P9LB 3RWFA 1ZA6B 5BW7C 4IM8A 1MCFA 4MHHG 4F7PB 1QA9A 5I1KH 1KEGH 2ZOKA 3VH8B 1NFDB 1WV7T 5IKCB 5T1KA 3EOAA 2VQTA 3LS5H 4F33B 4X7TA 3GSUB 4LCWD 1UACH 1XEDA 4ZFFB 5J6GB 5K9KA 1NDMA 5DZNA 1MCEA 5C71A 2FGWL 3VXRD 2W60A 1S7RB 4HJGB 5DR5H 1VGEL 4X7SL 2AVGA 4TUKL 1CF8L 4MCYB 4NQCB 1R3JB 4G8IA 1K4CA 3BHBA 5B39G 1NGYB 1QRNB 4GLRH 3TESA 4Y2DA 3TO2B 4J3VA 5IG7A 1BQLL 1I7TB 1R3LB 4UILH 5IQ9B 4H0IA 3G5VB 5GJSH 3UJTH 5DMIL 1W0WA 1YY8A 5C6WH 2L7JA 4NNXB 2DICA 5E08H 4ZFZB 1L7TL 4GXVH 3GHEH 5IVXE 4LVHB 4MNQE 2W9DH 3MLZH 2FEEL 5FOBA 1ZLVK 4YEFA 3IETA 1NCBL 4HPYH 1P4IH 3HI5H 2APBA 3EO1B 3U9PH 3WXVL 1GOHA 2P5WB 4KI5D 4G6MH 2A6DA 1I1AD 1O0VA 2JB5L 2YOCA 5D6DA 5C08D 2VZSA 3O45B 3L3OA 4YE4H 4K3HA 3BDYL 2ERJC 3U4BL 1S8DA 4XCNA 2DL2A 3QI9D 4NNPL 4FQXD 3B8YA 3VGFA 1G84A 3MYJB 4Y89A 4ODHL 2BHUA 5GGSA 2YRPA 3HC3L 2Z9TA 2VXTH 4JM4H 3LCYA 2MKLC 3WLBB 2QADC 3BT2H 5F8RC 3IDNB 4XBEL 5LQBL 1NJ9A 2BC4B 4APQA 1IC7L 1WJ3A 4MNGB 2LAAA 4YHKH 2XWJA 4BK4A 3PE9A 3DV6A 3SJVD 3IJSB 4KRLB 4BZ2L 2WBJB 4Y1AD 3GSVB 3TN0B 4U6VL 4IIQA 4AEIH 5I74C 1MHCB 3DRQB 3MV8D 5ADPH 3UBXI 3SDAB 3HAEB 1TETH 4JDTH 4L3CB 5HHME 5HDBE 5JHLL 4YZFE 2G2RA 5J1SC 5F7EH 1F4WH 4IMKC 3OKKB 2NW2A 2Z8SA 5F9WC 3KPNA 3FMGL 2AXFA 1K8IA 3QIWA 1LO4L 3K8LA 4P2RA 3QIUC 3TYGH 4Z7NE 2NCMA 3F12A 1F13A 3GKWL 5C0AE 3SOBH 5B3JF 4I1NB 5EUKB 4A6YH 2EE2A 3MJ7A 2I5YH 4PRHD 1UYWL 3MTRA 3WIHA 3DSNA 3KPMB 4JZOA 4JLRA 1CVRA 2YN5A 4DVRH 4PJHF 4F37K 5F3HA 1NSNH 4Y5VB 4ETYA 4WU7B 5F8QC 4JFYB 3VXSB 2DQCL 5K9QG 1MSPA 3MLTB 1J8HA 3ZE0E 3QXDB 4XCEA 2FH6A 5EIQA 3LKQA 2YPKB 1GGCL 1C5CH 2CDFA 3TA3C 1UJ3A 1PKOA 5AEAA 1PKQE 1UH3A 3X3FL 5DT1H 1MEXL 5IQ7H 1PX3A 5F1SA 5KJRL 1DUZA 3I2CH 5JNYB 2DQGH 4BFIB 3EYSH 3MRHB 4ZUTB 2NXZC 4PRNA 5EC1B 5DFVC 1S7UB 1I1YB 5CP7A 3TZVA 5EOTA 1K6QH 3V8CA 2EDTA 4QHNB 3FL7A 2MCPH 4JFOB 1CE6B 4RGNE 1GGBH 2HLAB 5AZEL 5HYIA 3RTQC 1XR8A 3BE1L 5ACZA 2NW3B 3NABH 2OTUB 4JDVB 3UJJL 2DQUL 4NKDB 3T08A 3UYRL 5F7DB 4P9ML 1IAOA 4JGUA 3DMMC 43CAA 3L3DB 1JHTB 1BLNB 2OR9L 4MJID 1GJIA 2ESVE 2CUIA 1XCTB 4K3JH 5DJ2B 4XCYB 3R4DA 4NUGL 4RRPG 1T83A 3QQ9D 1CGVA 5LGJB 2VZTA 3MOBL 1X5AA 3SEPA 3RKDC 4HD9A 2R0LH 3P4MB 1X4YA 3CVIL 5F93C 1DLFH 3CDYA 4S0SD 35C8H 3H9YA 1FZOA 32C2A 4WEBL 1SBSH 1QPPA 4K07A 3VXMB 4MSWA 3I6LD 1F6FB 1QQDA 2CRIA 7CGTA 5E7BA 5IB4A 3A0OA 3RZCC 5K59F 3PIQB 2WLYA 3TIEB 3SY0B 4FQ2L 3C5JB 4XCFH 2I07A 3GSOB 1LK2B 2PYFB 3AY4A 4Q6YA 5I15H 4S1SL 1J1XL 5D1QB 2EDNA 1S5IH 1YNLH 3VXTB 4M7LL 4UI2A 5D1ZB 4QTIL 4HIXH 2OTWB 4IDLA 3VA6A 3UO1H 3QO0A 3SDXF 5JUEL 1WUNT 2VAAA 1FC1A 2ZSWB 5IVXA 4R4ND 1KLGA 4MNQA 1A6TA 3O6LH 4JFZH 2XTJB 5LAXA 1OSPH 2BVUA 3TWCH 1S9YB 4S2SA 3OB8A 1CE1H 2MPAH 5ECJE 4X6BB 5C0EA 3B5HA 1HHGA 2HT4D 1DQDL 4P2QB 3IKCB 4W6WB 1RV6X 4NUJB 4U1JB 5FO9A 3SQOL 2NY1B 4K9EL 1TJGH 2Y5TB 2Y7QA 5L8LB 3VD4A 3WFHB 2X9XA 3KLAA 3MLYH 5CJ8A 1B0RA 3B2UD 3IFLL 3QH3B 1WC7B 3C09B 4PBWD 2PYEA 1FLTX 4MD4B 5JTWA 4N9GA 3NCJH 3WIFA 3V5KB 5T3XD 3ZKSD 4JHAH 2P8MB 4CDHA 3C2SA 3QDHA 5CCKH 1ZT1A 2BRRL 5JXAL 1A64A 2XKNA 4IRJB 3I50L 5HHMA 1KPUA 1VFBA 4XMLL 1ZVYA 3R1GH 3A6BL 5JO5A 3P3YA 3T77A 1PSKH 4HWZA 2ZPKH 3EDEA 3MRJB 4Y2OA 4X98B 4XTRD 4NN6C 3SKNA 3VU2A 3LS4L 3N50A 2QQKH 4X80L 1PQZB 1T5XA 2ICWI 3NMEA 4LLWB 3RWDB 3AUVA 1FZJB 1P7KB 3BPLC 1N0XH 2FX7H 1ZANH 4KMTL 3HAEH 1UZ8B 4LRNL 4J3XA 4BA8A 3Q6FB 1TZHA 4E5XA 4XB8A 4NP4H 2YMXH 5DC4B 4PD4K 4L8BA 3CDCA 4UINL 3TBSA 5I66A 4J4PA 1INQB 1QBML 3D9AL 2B2XL 3ARTA 1A3QA 2DM3A 1TPXB 1T4KA 2E6PA 1PKQA 2YZ8A 2P7TA 1G7MB 2VE6B 4DZBA 3VD7A 1FSKB 1JGUL 2A6JA 4KHXL 2OI9B 2BVOA 5J3HD 4DVBA 3BYYA 3AFLA 3GMQA 3GSXA 5DMKB 3RGVB 4P49A 3S5LG 4LSSH 1RUPL 4EBQL 1FCGA 1CLYL 1OAQH 1OTTC 3FFCD 2PO6B 1G7IA 3N1FC 2J6EH 4Q0XL 3U4AA 4WO4D 4I5BA 3SDCA 1EV2E 1OTUD 1EFXB 5IB1A 4H1LG 3RUGF 1JK8A 3QIBB 1EEQA 2BZDA 5C9KA 2X4RB 4HS6A 2ESVA 1OHQA 4EXPX 5BZDA 1K85A 1CDBA 1IAIL 3MV11 1T0NB 4OLYL 5HHQA 1M7DB 3D85D 2H9GA 3C6LD 3OB0H 5T1DH 2IC2A 3VWJB 3KLHD 1H3PL 2R69L 2APWA 3R06A 2A1WH 2A9MH 4PJBF 1UCBH 2EH7H 1J5OH 3QHZL 4I0KA 1GL4B 5CSBA 1NBZB 4JVUA 1U8QA 5JDJA 1JFMA 4Q58C 1MI5D 1SY6H 1CD8A 4M62H 5IWLC 1UB6A 3N0PB 1QO3B 3WNMA 4FTVB 3FN0H 4DAGL 3MSPA 2VDLL 4MD0B 5HI4C 4C54A 3CDGB 1DANT 3HR5B 4OD2B 3TCXA 3O3UN 3CFDA 5F7HA 4JJ5B 3AS3A 3CH1A 3HUJE 4Q74A 1H3WM 1AHWC 2AV1A 1RZKH 4LLQB 1EXUA 5D7IF 2ENYA 3HZVB 1DVFC 2QEJA 4NKIH 1OAXL 2HTLD 4WDIA 3SDDA 5KN5A 1XGYL 2VLRE 3QDMB 1JF1A 1U8JB 2V2TB 4M43H 4ZO7A 3EFFB 4PJCE 5F97E 4YXLL 1L0YA 4PJ7F 1T0PB 4N90E 1B88A 2EECA 1H5BA 1AGDA 4J1UA 5FECB 3TVMB 5I19H 4WCYH 1BFOA 3MNVB 1MCWW 1T66C 3N9GL 1EO8H 3TIDA 1WCBA 4MLIA 2BHYA 5FAAA 4XBPA 5IB5A 4LMQE 4OLUH 4QHLA 3ZKXB 1F2XK 4LDOB 1BZ9B 4P4KA 3ZKND 1F4YH 3C8KB 1WIPA 5C0ND 5AUMA 3PHSA 5F1NA 1CLOH 5J7CC 3QCUL 2CJUL 2DQIH 3KPSE 3QI9C 2IADA 2EYSB 5D7KD 3OKYA 2IWGA 1FAKT 3U1SH 2APFA 3JXAA 5HHOA 2C7UB 5HVWA 5DTFB 3B83A 3QNZA 5FCUL 4PJIF 4L4JA 5FM5O 5FYJH 1EHLL 5L6YL 5C0DA 3TP4A 3UBXB 3VRLF 4N5EC 2DAVA 3LKRB 1I85C 3V6FA 5I6XB 1KPVA 4JGMA 4UOJA 1IGIH 4HF5L 2FSEA 3FQRA 4EJ1C 1VSCA 4HAGA 2HN7A 2IFGA 3DUUB 1K8DB 4HH9B 2Z4QA 2Y36H 5INCA 3VDBA 4DGIH 2KL6A 3BEVA 3V0WL 2AKRB 2IPTL 4U1MB 4IHOA 1GOFA 3R0NA 3MRRB 3FQNB 3ABZA 4UTBH 4GS7C 3BQUC 2WUCH 3BESR 3MRIB 1JPSL 2HFGL 2DMKA 3PDDA 4M3JA 4RFOL 4U1IB 1KJ2B 1G6RH 5DZOA 4L3ED 2HT3D 4JRYB 5EU4A 4M5YL 2PUQT 4WVRA 3TC9A 1J1OH 1R5VB 4ZAKD 2H32A 5I73B 5JXED 5GS1A 4O2EA 3WFDH 4I2XE 4ODXA 4ZFOB 2OTPA 3MACL 1D9KD 1X5FA 5E56A 4JKKA 1BF8A 5HGDA 1CLCA 4KJPC 5E70A 1I3UA 4O5LH 1MY7A 4HGWB 5IBLD 3RWGB 3QHTC 4Y5XA 3UPAA 2AK4D 3QJFB 4MXQC 2XWTB 5A16A 1LEGA 1ZTXL 3HPJB 1D5XB 4PJEF 4JM2A 3GBMH 1IZJA 3VXQA 1MVUB 1DBBH 1ODAA 4HUXA 1TVBA 1I9JL 4MD5B 2GEEA 3CUPA 3O9WD 3T2NL 1C12B 5GGQH 5BRZD 1RJYB 4ZDHA 4PRAA 5CIPB 5ALCL 1OAUH 3LQAH 1M71B 4RMTA 2VO5A 3F58L 4U1LA 5T33L 3ARFD 3MV01 1AXTL 3HKFA 4X0KB 1QVOB 4G8GE 2IBZX 5KAQG 1WZKA 2ARWA 3SO3C 5MENE 2Q86B 1MCKA 5D2LB 5HDQL 3L7EB 3DVNB 4KV5F 1T2QH 3HS0B 1A3RH 1U3JA 3IGAA 4FQHB 2IMNA 3Q48A 4M61A 1LK3L 4Y19A 1RZFL 1TJHL 2XOTA 5FKPB 2D9CA 3CLEH 5C8JB 3MOAL 15C8H 3Q1SH 1FFOA 1FO0A 2CIIB 1INEH 4G6KL 4LCCA 2YPLE 4KRNA 4JO4H 1RFDL 1HI6A 2OR7A 5CEXB 4XC3H 3S4SB 1NUNB 5BMFH 1KCSL 5D7JD 5F9AC 3ROLA 4XPGL 3V0AC 4M7JL 1KT2B 1RUAH 2EO1A 3AS2A 3DJ9A 1AKJD 2YC1A 3TN0C 5EBMB 4JFXA 1IC1A 1I8IB 3MZTA 3OV6A 1T89A 3SDAC 3N1GC 1HYSC 4PJ9A 4LPUA 3KNBA 2I60H 3MUGB 1KB5B 5HI3D 4WNQA 1U2HA 4PGBB 1A4KB 3REVB 2COQA 3EYUH 4YIQA 3QQ4B 5IROC 3T3PF 4IRSD 3LKSB 1RZGB 4S0TD 2VLRA 4GSDL 2YS4A 1JI2A 5BV7H 4G42B 3WO3B 3D18A 3P30L 4CKVX 4J3WA 4PJCA 1AIFB 3QHFH 4Z7QF 3B4NA 1KB9K 1KV3A 2C3XA 2QJDA 3CZFB 1KIPB 4MZ3A 5GGRB 1YN7B 5D7LB 4JCMA 4WFHE 1VFAA 1QR4A 4ZPTB 4YLQT 3JWDH 2ITCA 3QFJD 3HE7D 3OB0K 3QBTB 1T1WA 1KXVC 1A7NL 1Q72H 1DBJL 1NC2D 3HCVB 3WL9A 2HT4C 3QWOA 4HMCA 1A7QH 3L3GA 4M4PA 4P5TB 5FXCH 1TVDA 3S36X 2ZCLL 4H8WC 4JN1L 2VDPH 3O8XD 1DN2A 3JUYA 1EEZA 3VWKD 3ALPA 1FC2D 2AW2A 3BOVA 1RZ8A 1MHPL 4Y4HA 1WWAX 5F7FA 3WFEL 3MRQB 1AXSB 2VLLB 1F3RB 5BQ7B 3B2UC 3IFNH 3C5ZB 2R56L 5EOCL 3IT8D 3JTSA 1JWUA 3PDGA 4C56E 1YJDH 3WJLC 1CGYA 3BI9X 2X4NA 3ULSB 4E42A 2VDMH 4HHAA 1HIML 4X4YB 1Q0YH 3E0GA 5FYLE 4JO1H 1U8HA 3UPRB 2J4WL 1OP5H 2VH5L 5B3JE 4GBXD 3G04A 4GUPB 1WBYA 3FT3B 5IMLA 2FO4B 3HI6H 3BJ91 4GKOA 3TT1H 2J5LB 1CFSB 3G6DH 2D7OA 3CFBB 3K7UA 3QZWG 5IOPB 5LBSH 3GRWA 1URLA 2AV7B 4CUCA 4I3RL 2XY1A 5E1HB 2BK8A 4PS4L 4I2XA 1L7IL 4ESKA 3LRGA 4IS6A 5HVHB 5GGTH 3HE6B 1FCCA 4OKDA 4M7KL 5IF0A 4KQ3H 4PJ8A 1IEBB 2RCSL 2DLIA 4QRPB 5IEHB 3TBTA 3PQYE 5I8CA 3V6BR 1X7QA 5GGUA 2ZUUA 4LOUD 5SWZD 3OKLA 4MDJA 1G7PB 4RAHA 2AEIT 2B0SL 3UTSD 4W81A 1ETZB 1HYRC 3AU1B 1AY1L 4OFYA 2VZUA 5FYKU 1KJ2H 1MQKL 5EOCJ 2BNRE 3SKOA 2BY3A 2W65A 4PTTA 1KN2L 3BPCA 1S7SB 2PETA 4L8SC 5F3BB 3KHQA 4KI1A 2GCYA 2GSGA 3S35L 5EU7C 3PGDA 4NO2A 1G0DA 1EFQA 2NX5B 3PJSA 3RNQA 5HYSA 5IESL 1T03H 1W0VB 2ITDA 5F71A 5IFAL 2ICCA 3LRHA 4LQ1A 4R4FH 4WHYG 5DJYA 2P5EB 3GMMB 2VDKL 3EFDL 5TGBA 4MVBD 2HFFA 2YPVH 3TO4D 4NOBA 2VXUL 5DRWB 3UAJD 3QXAA 4JR9L 4TTDD 5DQJB 5BS0B 2CRYA 3I84A 3NA4A 4JO2L 1EJOH 1Z9MA 1UADC 2CSPA 3MROB 2J8UB 4N8CH 1WBXB 1IILE 1QSED 3KYAA 4G9FE 2I25N 5E8NB 5CIPH 5HYQA 1ORSB 3PP4L 4L8DB 1E6JL 4LCYA 4HIIA 2F5AL 1DFBL 4GRLD 2EYRA 3RIFK 3B9KD 5DUBB 1YEGH 4YUEH 5FDWA 2YPLA 2IH1B 5KG9B 1CG9B 3HMWH 2F8XC 5I76B 5K59E 1FE8L 1XF3B 3BRDA 2GITA 4DWHA 3STLA 4K8RH 4Y4FD 5FYKE 4XNUH 4PDCE 4D0DB 4NRXA 1OQOA 1NLBH 3IF1A 3ARYA 5D4QA 5GISH 4IRJC 2CO7B 3KPQB 3VGAC 1EZVX 3MCG1 5DQ9B 4P46B 3ZTJH 5BW7A 3U7YL 1FL3A 2CLZA 3SDXE 3P4LA 3BJLA 1V5JA 1IM3B 1SM3H 2BNQE 2Q76A 3GBLA 5E24E 1BBJA 2Y06H 3SE4C 1HWGB 1BEYL 2GQHA 3MA7A 2JTDA 1IAIM 4HC1H 1V7ML 4GW5B 1T6VN 4GKSB 1P5UA 4JAMA 5JQ6H 3FZUC 3UZEA 3KDMB 1FV1B 5HJ3A 1GRWA 5ITFA 1DQJA 4LARH 1C16B 3MXWH 2YA1A 1UM5H 1DQTA 2MHAA 3HR6A 4YHYB 3GSWA 1VKXB 4NQEE 5FO7A 4I48B 3BZFA 2WNGA 4P3DA 1FIEA 1IVLA 3FO9B 4HFWB 3A6CL 4LPCA 2IPKB 4XPBH 1T1YB 4NO5A 4YHIA 4PRID 4PY7A 1R3HA 4ZO6A 1P7QA 2VXSH 1IBGL 5H35B 5C07B 3Q0HA 2HJLB 3BGFB 2D7PA 5DJ6A 1UXSB 3T4AA 5HGAB 5KSVB 1FSKC 4R2GD 4QGTA 2I9TA 3ZKNC 1LDPH 4LIQH 5C0BD 1S78D 2CQVA 3LIZH 1XFPA 3NCEB 4KPHH 4RZCB 3RIAK 5GHWL 4ORZC 3EO9H 2PO6C 3C08L 4NFBA 4K55A 2C3VB 5DRXB 2JK5A 4LSPH 4NKMA 3MUY1 1LO3H 4NWTH 3DLQR 1LP9F 4XAKE 1Z3GL 2VZ1A 1AQDA 1OW0C 3QIBC 1DZBA 2VDOH 4RX4D 2MJWA 3E2HC 4P57B 1XGUA 1HOCB 2JB6A 3D2UB 1F42A 1MFAH 5TDOB 3VWJC 2CMRL 2GI7A 3PHQA 2A73A 3UXFA 5D72H 4J3SA 4PJHA 3OHXB 4PRDB 4ZQKB 3OXRB 1FZMA 2ZKHH 4NM4L 5CILH 2BJMH 5DFWH 2B1AL 2FX9L 5I1EL 4DQOL 3TV3H 5E4EC 1O7VA 2HKFL 2PTTA 4L3AA 3TBYB 4OM0H 5DJDA 1E4WL 1J86A 3VDAA 1IKFL 4OCSH 4U1GB 1U2CA 2HT3C 5AG8A 4NQUA 3QEGL 5D71H 1TIUA 3GGWA 1KFAH 4BYHA 4NDMB 3FRUA 3QIUA 4DEPC 1RHHB 4UQ3B 3PQYA 4LSTL 1KBGH 5FGRA 4KKLC 3BMVA 2GY5A 1D9KC 5J57B 1I3GH 3FB5A 1OAKH 3LN5A 2BNRA 3QQ3A 3MV9B 4JB9H 4LK4A 4LFHD 1SMOA 2FL5A 4D3CH 5L2KB 4XPHH 1S7TA 5MEOB 1JPGB 1P4BH 1X3DA 4UB0L 1BAFH 1WCQA 4QRQA 4WUUD 3WDJA 3PL6B 2IQAB 1X5XA 1GC1H 1WZ1H 5CJBA 2CDEA 4DZ8B 3QCVL 3T3MF 4DKAA 4MJ5A 2OSLA 2CKNA 3NFPA 4ENED 4WWKC 3U2SB 1FN4A 3AMLA 4V1DB 1MIMH 2F58L 3TA3A 3MJ8A 1JNNL 1XGPA 4LBEA 1MIEH 1KN4L 3RUGE 2A38A 1C5DB 3QXUA 1A8JH 1UWEL 2AABH 5HHNB 1ACYL 1JBJA 1KJ3L 1OP5K 1V7NH 4QHUB 2NQCA 2NXYD 2VC2L 1OGAE 5DMGD 4MA8L 4YGVA 2MCG1 3TJEH 4CW1A 2EDXA 4KGJA 3ARFC 4N0UE 3V6OC 1YECH 2G75B 2BY1A 2NR6D 4NCDA 3U0PA 4MXVF 4PJBE 3WFZA 2ZG3A 2ZCHH 3ARRA 4G9FA 3X11B 4MDIA 1ZMYA 4MXWH 2GJ6D 2F53A 4N0CD 3RTQA 5CZXD 3L7FB 3MRPB 3FQUA 3L9RB 2EIZA 4QCIA 1GAFL 1R6VA 4GMSL 2DQHL 3CGTA 3BPOC 3KPRE 4LCIL 5DD5H 3DMMA 3LZFH 2V7HA 2XN9D 3PXJA 3VXNB 4M6NL 4X99B 4OD3L 5I6XC 3RVUC 2JELH 3VXOA 3BD5A 3C60B 1N2RB 1U93B 2GT9B 1ES0B 4NHCH 1WBZA 3BH8A 4Q2ZA 4UMGA 5L88H 3BMWA 1R5IA 3SDXA 4NWUH 2O5XL 5JZ7D 3HC4H 3MLVH 4M6ML 3QUZB 2R1XA 1MPAH 5DHXB 3EDJA 4ODUB 4PJ7E 4KUZL 2BNQA 4JY5L 1CD0A 1JWSB 3MXVH 1NCDH 4LKXA 1IRAY 3RWHB 4PUBH 3RZCA 1CIDA 2IAMB 1JHLL 1R3KA 1N3NA 4FQCL 3RWIA 4GW4B 3MLSH 1AGEB 3KYMB 5K9JH 1HZHH 1VERA 2R1WA 5I16A 5EU6D 2E27L 2BSSA 4S1QL 1SJVA 3P9MB 4NQEA 4OIAA 5IFHL 3BUYA 1E0OB 2ZSVB 4F58L 3MRGB 1P4LA 4D9LH 5IUSA 3L5WA 1WFNA 2X4UA 3AREC 2EEBA 5AWNH 4JVWA 5ANMB 2UUDH 3HE7C 5ILTL 1S9VB 4X6EA 4PGDB 4NQXB 5DJZA 4NIKB 3L6FA 5DQDL 1JNHA 4OQTH 4G8FA 4JEGB 3INUH 4PJIE 1G9ML 4NJAH 3EHBC 2NY7L 3BVNB 3Q5OA 3VRLE 4UBDC 5C09B 4UOW1 2CKBA 4HFUH 2A0LD 4PJDF 2X4TA 1F02I 3ZLQC 3S34L 4LHJB 3QXVA 1EPFA 5C08E 4GRWB 4MJ6A 1QA9B 2Z8VC 2ZOKB 3MRCA 4DN3L 3FONA 5T1KB 3EOAB 3U7AA 4LU5L 4NQCD 3L5JA 4X7TB 1FFRA 4L5FL 2YBRB 3GSRA 1EHAA 3L3KB 4L1DA 3FN9A 1D7FA 2WQ8A 3CAFA 1A7OL 5K9KB 1NDMB 3EYFA 3O4OB 1JPTH 3TJHD 2JCCE 5DUPH 2W60B 5ESQA 5TF1H 2O26U 2LV4A 2G9HA 2N7AA 4GBXC 3H7BA 1YQVL 3BZDA 4N8PA 2DQTL 4G8IB 3BHBB 4NQTA 3SGEI 3SJVE 4CU8A 3WEXA 1RU9H 2E6QA 4ODTH 4RA0C 4Y2DB 4PTUB 3I02B 2QLVB 3GDBA 3QB7C 1HQRA 5HBBA 2C26A 1MCDA 3S7GA 4MMZC 2LU3A 3MV8E 4PB0L 4G7YL 1YY8B 5ETUA 4HUVA 2X5PA 3KYKL 1KCVL 1NUFA 5I1HL 4TSAH 3IETB 3VW3H 3BP6A 2W9EL 1A6ZA 4G7VL 5J9PB 1KSRA 3V6ZA 4PJEE 2B39A 4HCRH 1IGML 7FABH 3H42H 4QTHA 4MA7H 4AL8L 2A6DB 3W5MA 3ZT6A 1NCWH 4GT7A 4FP8H 2WBWB 5FGSA 3SKJL 4MS8C 1EVTC 4NM8H 1SVCP 4RFNC 1XT5A 4XCNB 3V7MA 4KJWC 4GJTB 1GGUA 4L4TA 4OCWH 5GJTH 2WBJD 5GGSB 3OAUH 4X9GA 1QG3A 1A0QL 4QYOA 3ULUC 2A77L 5EFIA 5E5UB 1U6AL 3RUGA 3MCLL 4AZ8A 3W11D 1CL7L 4XCCH 5GRUL 3B9DA 3VFTA 4APQB 4KV5E 4LSUL 2V5RA 3DIFA 2XWJB 1OGAA 3DV6B 4MVBC 3BH9A 1EAPB 4N0YH 3QCTL 2IFFH 1U8PB 1RI8A 1YEHH 2F54B 4GW1B 4N0UA 2X44D 1QACA 2Z8WC 4PJBA 2QSQA 4TTDC 1MFEH 1ZHLA 1OLLA 4JE4B 3QUYB 3V52L 1ZGLB 3NIDF 5KANI 5BOPA 2LAGB 5I0DA 3TBWB 2G2RB 5GIRA 5E6ID 3QUKA 4KK5D 3MBXH 2RB8A 5GZOD 2NW2B 1RIUH 4WV1B 2DIBA 1M1SA 2AXFB 4HKZA 1K8IB 3B9EA 3KPRA 1PDKA 5CSZA 3ULUF 3AS0A 3B9KC 4OZFH 5E4IA 3VFGH 2HLFD 1RURH 5JOPD 5TDPA 5B8CC 2XG5A 3C5ZC 4YDKH 4GKNA 2IG2L 3MJ7B 3F62A 3VXPA 5BVPL 2BSTA 4JZOB 1K4DA 4FG6D 4JLRB 3GJFA 5D7IA 1U9KA 5F3HB 2HMIC 3T3PE 2XV6B 4S1RL 4QXGH 3KS0J 4XVUD 3RAJL 1YMMA 2FD6L 3IAQA 1QBLH 4POUB 4C57C 3C6SB 3CMGA 5DK2B 1J8HB 1NC4D 1MVFA 3OSKA 4TVSa 4XCEB 1T3FB 1A6UH 4MNGE 4PJ7A 4Z7QE 1LNUA 2CDFB 5IWLA 5BZWA 3GNML 4Z7VE 3KPLA 2J5LC 1CGXA 5HVGB 3OJMB 3KAAA 2R4SL 4JN2A 4JCLA 3HZKB 3IXTA 5EPMA 3OAYH 3CVHA 1A3LH 1AHWA 5HHVL 5CP7B 4Z8FH 3F8UB 5EOTB 5HHPB 2I24N 1DVFA 2AGJL 3IAPA 3UTPD 1DBMH 1A14L 4MB3A 1W8OA 4YHOL 1XIWB 4DW2L 5SWQA 5TE7L 4OFVA 5ACZB 3GMNB 5KVEH 1GIGH 1MWAB 4RAVA 2W91A 1ZLSL 3NZHH 5C86A 2M2DA 1IAOB 4GKZA 4U6XB 1R0AH 1J7VR 1E4XL 2R1YB 4K2UH 4LLMA 2EKSA 43CAB 3DXAB 5ACMA 4TPRH 4PJIA 3FOMA 2NY4D 1AGCA 1RJLA 3VXSE 2XQYG 1KCRH 3ZDXF 3VXMD 4ONGL 1YYLH 4JQIL 5B3NA 3B6SA 5DHVA 2DTML 1F90L 3O3BB 3MFFA 3DBXA 5C08A 5TE6H 4H0HB 1NCCL 3SCMB 32C2B 4YFLF 3AROA 4B0MM 4UT9L 5D1QD 1TQCC 2BOBA 4Q9CA 4MSWB 3QI9A 4YFEA 5FCSH 5B39B 3W9DA 3ILQD 1QQDB 5IB4B 5D1ZD 4ZODA 2BP3A 1IGYB 2DMCA 5KVFH 1IM9D 5CD5C 3ISWA 1KEGL 5I1KL 2Y72A 3NFNA 2H2PD 4N5EA 4PP1D 5A2LH 2XTJD 3MRFB 1I85A 3LS5L 1Y18A 1JVKA 1FBIH 2ADFH 2FJFA 4JZNA 1UACL 4PJ5A 1FDLH 2RQ8A 5T3XE 3QO0B 1BECA 2VAAB 5GPRA 2DLGA 5IVXB 4P2QD 5IVNA 5DR5L 1KLGB 3F7QA 4MNQB 1A6TB 2UUDK 1Y0LA 5FYJD 1SQ2N 1ROWA 2J8UF 4PJEA 4P46C 3BAEH 3WO4B 3P9LA 5C0EB 1ZA6A 3BQUA 4UILL 3DX8A 3PNWB 3BP5A 4P59H 4J12A 1F6LL 1HHGB 2EC8A 5GJSL 3UJTL 1BIHA 5IKCA 4ETQB 1HNFA 2D31B 4F33A 5EORL 3IDIB 5E08L 4GXVL 2W9DL 3MLZL 3OGCB 4ZFFA 4UTAH 5FO9B 5JOEA 2AQ3A 4L1HA 4NFDA 3TNNA 3MMEA 1DUYA 4H26A 4JRXD 3RI5F 3ZE1E 4HPYL 1P4IL 3HI5L 3U9PL 4XH2A 4DN4H 1JYWA 1SYVA 1WF5A 4G6ML 4NN5B 4MCYA 4UAOC 4ZNEA 2ZP0T 4TQEH 1NGYA 1QRNA 3RDTD 4MXQA 1A6WH 1WISA 4YE4L 3TO2A 5F21B 1I7TA 2XACC 1LO0H 4LPVA 2EXWD 3G5VA 1LVEA 1CN4A 5EU7E 5INDB 4AYFA 4K3DH 2NXYC 2G60H 4EN3B 1NCTA 5T5NF 3MA9H 3BGFC 3PWVB 2XKNB 2NR6C 2VXTL 4JM4L 4HUMB 1MF2H 5DDHB 5HHMB 3QR2A 1KPUB 1YQ2A 1VFBB 5EBLA 3G6JB 1JFQH 2MNUA 4R26L 5JO5B 2VLMD 3T77B 2DL9A 3CNKA 3IDYB 3QPQD 4N0CC 4YHKL 1HHHA 4WWID 2X41A 4Y16D 1ONQA 3CK0H 5DJXA 1MJ7H 1DE4B 4LLUA 4OFKA 5C0AB 2GTWA 1T5XB 4AEIL 5I1DB 5ADPL 4DFIA 1KC5H 5HHXH 1TETL 4JDTL 4H5SA 2ZWLT 5GRXG 3DUHA 3MYJA 3BXNB 3RGHA 4OBRA 5F7EL 1F4WL 1WAAF 1A2YB 2E7CA 5GQBA 1N59B 4E5XB 4MZ2A 1R3IH 2ILLA 3TYGL 1ZVSA 3IDNA 1S3KH 3TBSB 3UTTE 2BCKA 5I66B 4MNGA 2Q7YA 1LMKA 3CFJB 3SOBL 5CBAA 4A6YL 5JZ7C 4FFWC 1HHIA 3IJSA 3RGVD 2I5YL 4V2BA 3S37X 1CDGA 3V2AR 3GSVA 4WFGD 3TN0A 4R9HA 4Z5RB 1PKQB 4PD4J 3WIHH 4G9DA 2P7TB 4P23B 2BVEA 4MQXD 4HKJB 5M95B 4DVRL 1MHCA 1NSNL 1KACB 4N9OB 3U6RA 2BOCA 1CXIA 3WNKA 3SDAA 3CSGA 1CBVH 2BVOB 2EDHA 1WQVT 2HJFB 4DVBB 2HRLA 1U3YA 3GMQB 5KSUB 2IGFH 3GSXB 1N4XH 1CQKA 1CFBA 3OKKA 3JWNC 1C5CL 4RGNB 2XICA 5IROA 1UB5A 5JA9A 5B38G 1G7IB 5DT1L 5K93A 5IQ7L 2OZ4A 3HNTH 3I2CL 3WKMH 3SDCB 2DQGL 4U33A 3EYSL 1QSVA 4PJFF 5IHLB 3NPSC 2IMMA 3MBEC 2NY2D 5IB1B 4EI5D 4N1CA 4J8RA 5EU5A 4HS6B 1K6QL 2ESVB 3VJ6A 2MCPL 2LABA 3VXSA 2MKWA 1GGBL 1YC7A 5HHQB 2H9GB 2NY3C 3QXDA 2V5TA 4CU7A 3C8DA 2OQJB 3LEXA 3NABL 3R06B 1PG7X 1LP9E 1W72B 3ME0A 4ZTPH 2YEZA 1D5IH 3O4LE 2EDLA 3P4OB 1YDPB 2C1OB 2R9HD 3BO8A 4K3JL 5HDOA 1CD1A 3MRHA 3IFPA 1MLBA 1WITA 1HHKB 1JZ2A 1AO7E 3NCYP 4QHNA 3SHSA 4JFOA 1CE6A 3QDMD 2NZ9C 1GZQA 2HLAA 2R0LL 1HHJB 3CFDB 1RZJH 5IM7B 2NW3A 1DLFL 2OTUA 3CH1B 2X4PA 35C8L 3WJLA 3NIGF 1YY9D 4S11A 1SBSL 4TNWF 2AV1B 3OAYK 5F7DA 1EXUB 5FDYA 2V2WA 3H7LA 4WDIB 4QRUA 3FTGA 5EUOF 3TVMD 1AE6H 1CICD 1FVDB 1KGCE 4U1KA 3L3DA 1JHTA 4XCFL 5ADOH 4TVPE 5C7XH 3ULVD 3L3HA 5I15L 1H5BB 1AGDB 4BZYA 1FZKB 1S5IL 2ZUQB 4LAQH 1YNLL 4KFZC 4NZTH 4MMXC 5CKGA 2NZIA 4HIXL 4LVOB 4Z7UF 3UO1L 5KTEH 1EEYB 3TIDB 1WCBB 3EJYC 3QUZC 3A67H 4XBPB 1MH5A 1X44A 3O6LL 4HQQH 4JFZL 2J88H 1OSPL 1IEAA 4P4KB 3TIEA 3O3EB 4NBZB 5AUMB 1REIA 3GSOA 1LK2A 3TWCL 4EIGB 5F1NB 2KKQA 1CE1L 2MPAL 2IADB 4POYA 2XZZA 2YD7A 5IIEA 4MXVE 3VXTA 4HK0A 3IS1X 2OTWA 2NY5H 3PGCA 4L8SA 1OD7A 5CZKA 3W11C 2AK4E 1WFTA 1A1NA 1TJGL 3V6FB 3KWWA 2ZSWA 2WWKT 2N1KA 4WGWB 3SGJC 5IFJB 1BQHG 2FSEB 4WTXA 4E0RA 2HN7B 4QXTA 3MLYL 2Z93B 1EO7A 3ZYIA 1OTSD 1OOAA 5IR1A 1H8OA 2I27N 5BRZE 4AM0A 2Z4QB 4AEEA 5DJ8A 1HKFA 5INCB 4R96A 2EDYA 4X6BA 4GQPH 4JRYD 3BEVB 3D69A 2B4CC 3QQNA 1OAZH 1CTOA 5C1MB 3NH7H 4IHOB 5CEYB 5T3ZE 1TZIB 5E6IC 4KK5C 3NCJL 1PY4A 2JIXA 2CK2A 1ITCA 4XPTH 3V6OE 3LN9A 5KZCD 3ZL4H 4JHAL 3FB6A 2B1HH 4M00A 4NUJA 5CCKL 4U7SA 1T6WA 4KHTH 1FFQA 2OLDA 4ZUSB 3R1GL 2WBKA 2E9BA 1PSKL 2VERN 3AAZA 2ZPKL 4CMMA 3EOBB 4KKBD 1P6FA 4ODXB 3T0EB 1JRHL 3O4OC 3RY5A 3UTTA 3O3AB 5IBUG 2QQKL 2H2SC 3QH3A 4NRYA 4XVUC 2X7LA 5DRZA 1WC7A 2FRGP 5EWIH 5HGDB 3NBNA 3KG5A 4XMKH 4X4ME 2WK2A 1N0XL 2FX7L 1ZANL 3S5LB 3V5KA 3QUMH 2ICES 5A16B 5JHDD 1LEGB 4U7KA 3ARGB 4IRJA 4NP4L 2YMXL 3VXQB 4GRWF 2FB4H 5BXFA 2HH0H 3U46A 3CUPB 4PJGF 4OT1H 3ARXA 2O5YH 1EMTH 5L2JB 1TVHA 3MRJA 4H1LB 4ZDHB 2X05A 5CFHA 5F72S 1DBKH 4K8RD 1SHMA 4LSRH 3SE4A 1BWWA 4RAUB 5CGTA 1MCHA 4OCYH 4JANA 4M4RA 1JPFA 1P7KA 2FLBT 1NFIA 3ECBB 5D70H 3DI3B 2E8YA 1UZ8A 5EH1A 3K74B 4R4BB 4PJDE 5DUMH 2FLRT 2HFTA 1KYOK 3TH4T 4M61B 4OLVH 1OAQL 1M7IA 3QWRA 3MGTA 3DO7A 4CGTA 1INQA 5I30H 1BREA 1FP5A 4XNQA 2Z31B 1LP9A 1FO0B 2C4XA 3R8BB 3O6FC 2Y4SA 4LCCB 1ITBB 3QFJE 3FO2A 4EEEA 1YNTA 3BWAA 3V4UH 2VE6A 4G6AC 3O4LA 1VADB 5DWUH 4TSCH 4J3TA 3ROLB 1CFTA 4Q6IA 2PR4H 1U36A 5JIHA 2VITA 2YC1B 5DMKA 5T1DL 2IEPA 4JFXB 4IDJH 2BHZA 2BVQA 4GH7B 2A1WL 2A9ML 1AO7A 1TJIH 1UCBL 3QUYC 2EH7L 1J5OL 1DEDA 4PJ9B 4HS3A 5HI5C 3DGGA 2PO6A 3KNBB 3ZYJA 1DEEA 3HUJB 1CTNA 2EXYD 4OTXH 4WNQB 4WV1C 4OF5A 1G9NH 4ZSOE 3IDJB 4OKVA 3TT3H 1SY6L 4M62L 5D5MF 4AQOA 3ARWA 1EFXA 3U30C 1QHPA 3HA0A 5D7LD 3FN0L 3MV7B 3NFSH 2VLRB 1OW0A 3QIBA 2X4RA 3D18B 3E2HA 1J0JA 4XP1H 2UZXB 4PJCB 4P2CG 1RAMA 2QSCH 1VPOL 2WWMD 3SGEH 5I1AA 3GI8H 3VWJA 4AH2A 5JQHC 1RZKL 3PP3H 4ODVH 4NKIL 1VFAB 2APXA 3G9VA 1NBZA 4YXKH 1BFVH 4M03A 2ITCB 3VGBA 1KB9J 2YUZA 4ZXBD 2HVKB 4OF0A 2FIKA 4M43L 1RMFH 4NO0D 3AGVA 3QWOB 2AK1H 2NNAB 4MD0A 5SWSB 4QLRA 3NVQA 5IHUH 1KJVB 5I19L 4WCYL 3S3PA 1UJTA 4AK1A 3V95A 2D7MA 4EDWH 3KPSB 1D9KA 1H3GA 1QLEH 1EEZB 4JJ5A 2FIRT 1EO8L 1C5BH 1BQHA 2DB8A 5SWZE 4P9HH 1T20A 5J1AB 4HUWB 1RZ8B 2EKJA 4LLQA 4NSKB 3HZVA 4OLUL 3SDYH 3JTTA 1XIWC 2AK4A 1JWUB 1U8JA 1F4YL 2X4NB 1CLOL 3EFFA 4KROB 5FA4A 4E42B 4LNRA 3GBNH 4WWKA 3K81A 3P0GB 3U1SL 5FA3A 5IJKC 4RMSA 4BFEA 2R0ZH 2VMFA 3PDOA 1U8HB 3J8F7 5FYJL 1ZHNA 4HLZG 5IMLB 5F44A 1B4JL 1VB9A 5ID0A 3ARFA 3V6OA 4Z76A 3QPQC 4HXBH 2HP4A 4K71B 1IGIL 1A7BA 3D0VB 1BZ9A 2HVJB 4PIRF 3SCMC 1IZKA 2J3SA 5F9JB 5CJXC 1QSEE 4M1DH 4ERSH 4KU1A 3FOLA 2Y36L 3RL2A 4DGIL 3ZDZF 3T0DA 2DRUA 4I2XB 4IS6B 2C7UA 3IDUA 5IF0B 2VKXA 2PXYB 3CX2A 3TBTB 5I8CB 4YEEA 4UTBL 1X7QB 3HG1D 5GGUB 3GSQA 3OKLB 3WXWH 2WUCL 4X4MA 4UUJA 1TQBC 3C2AH 1T5WA 4YC2B 3LKRA 1G6RL 2R2HA 5DK3A 4EUPG 4OFPA 2JJTC 2P5ED 2W65B 1J1OL 3BN9C 3OF6A 2H32H 2DLFH 5TQ2H 1Z5LB 3WFDL 4NQSA 4LASH 1RULH 2GCYB 3GHBH 2GSGB 4HKBA 4GLRI 2D9QB 3HFMH 3PGDB 4YO0B 5BS0D 3RNQB 2NLJA 2EIBA 4O5LL 3S88H 5D93B 4U1MA 3LPGA 5DJYB 4HJ0C 1H3VA 3FQNA 5TGBB 2HFFB 2X1PA 5HYJD 2OS7A 3WO4C 1DCLA 5B4MC 3GBML 5A40E 3QXAB 4G8GB 3P0VH 3ZDXE 1DBBL 1CXLA 2P8PA 4P4RA 5MENB 1YMHA 2FNBA 4PJDA 1OGTA 1NBQA 2V9TA 1R5VA 3N1MC 5GGQL 3SGKC 3V79C 2FJHA 4M7LT 1KTRL 1QP1A 4X8JB 5HYQB 4JGJA 4PRPD 1OAUL 3AREA 4U3HA 3LQAL 2KPNA 5L8KB 4LCYB 4D9RD 4Y8AA 2EYRB 3U48A 3NA9H 5JMOC 3RP1A 3RWGA 3K2UH 4BFBD 4BH7A 1A9BA 2YPLB 3HE7A 4FQ1H 4G5ZH 1LEKA 3QJFA 2XWTA 3I6KA 3KJ4B 4ZO8A 1D5XA 3STLB 3I9GH 1T2QL 1A3RL 4NC1E 3D3VE 4PG9A 3REWA 5DURB 2EDBA 5HPMB 1BIIA 4MD5A 2A9NH 3HNVH 1C12A 4YJZL 1I9RH 4NHUE 3QXWA 3CLEL 4OFIA 4EN3C 15C8L 1J0IA 1RJYA 3Q1SL 4LEOA 1T7VA 1PGRB 1INEL 5C0BE 1FO0H 4Y0GA 4JO4L 2CLZB 1L0XA 1OL0A 3L1OH 1M71A 3VI3F 4XC3L 5BMFL 1YA5A 4ZSOA 2GFBA 1QVOA 5IW6B 43C9B 2E3VA 1RUAL 2Q86A 4NN7C 1BBJB 1N64H 3MUHL 3DVNA 3MA7B 4RBPH 3IU4H 2QQLH 1CICC 4FQHA 2Z35B 1FVEB 4FFVD 3T04D 4Z77A 3AM8C 2X70B 1BHGA 4HUUA 1OARH 1BX2B 2I60L 1DQJB 3DVGA 4GBXA 3Q5YA 4I4WB 2MHAB 3RL1A 2CIIA 3GSWB 3ULVC 2B20A 3EYUL 5FO7B 2IPUG 4P3DB 4F9PA 5BV7L 1KEMH 1MJUH 2VLJE 1UVQB 3G6JF 2YXMA 3I3EA 2CUHA 3T2OA 4YHIB 1KT2A 1R3HB 1P7QB 3QHFL 4OI8A 4RFEB 4JG1H 1FNFA 5EBMA 4P23C 4Z7NF 2D4FA 4JFDD 5DJ6B 3RX7A 1FNSH 3T4AB 3WNPA 4KK9D 1DSFH 4M9PA 1U91A 3G5YB 1FYTB 5GS0H 4CAGA 5HD8D 3JWDL 4MCZA 3PWPE 3MUGA 5HYFA 4PGBA 3HLAA 3REVA 4ZFGH 4MS8A 3MRBB 3QQ4A 1FNGA 1VESA 3ULVF 1A7QL 3ARSA 4C56B 4G42A 3ZE0F 4BUHA 4DOHE 1KENH 5A43C 2JK5B 2VDPL 1NGWB 4KK8D 5C2BH 4NKMB 1AIFA 2AJUH 4XWGH 2IALA 1ZLWH 3TM6A 1NGPH 3BDXA 2GIYA 1KIPA 1AQDB 5GGRA 3RZWA 3QZWB 1YN7A 5MP6H 1IQDA 4LFHG 3ALXA 2JB6B 1OTSC 1AR1D 2BSRA 3IFNL 4MVBA 5GZND 3RY4A 3PHQB 1YJDL 4KJQD 3WN5B 1UT9A 3KVQA 5IVZB 3HCVA 1WAAE 1SJEB 4MAYD 3CXHK 2VDML 1C8PA 1B6DA 1PFCA 2RGSA 4M5ZH 5EOQH 5I74B 3PP3K 4IJ3B 2IF7A 1Q0YL 4JO1L 2PTTB 5HGBB 1QSEA 5DJDB 5T1LD 3GM0A 3MV9D 4F57H 1U95A 2XRAH 2XNAB 4EUPA 1M6OA 3JWOH 1CXKA 3GGWB 3HI6L 5TFSH 4I9WD 3FRUB 3B9KA 2HT2D 3LH2H 3PQYB 2Q8AH 3PL6D 1AXSA 3OGOE 4UNTA 5B8CA 3G6DL 5BQ7A 3C5ZA 1YPZF 3D1MC 1S7VB 5LBSL 1HXMA 3FB5B 3GRWH 2BNRB 2RHEA 3QQ3B 4WI2A 2XN9E 2FL5B 4X4YA 4U1HA 5IVOA 3MLXH 2LQRA 1NKRA 4QRQB 4XXDA 4KKCC 1MFDH 4EOWH 1QR1A 5GGTL 4WU5A 2VAJA 4WIQA 3DV4A 4U3XA 4KQ3L 1QLFB 2CDEB 4ZO9A 5JA8B 4HAFA 4MJ5B 4XX1E 2OSLB 4GUPA 3NFPB 3FT3A 4EVNA 5ID1B 1KXQE 1FN4B 3TA3B 3MJ8B 2N56A 4PJFE 1KJ2L 3HMXA 3JV6B 1CFSA 1QFWM 1KTKE 5IOPA 4LVOC 2ED8A 2W9LA 3QUXD 4YGVB 3QDGE 4DGVH 4XX1G 1RPQA 4ZFOL 2FWOB 3QAZC 2NXZB 1KIQA 8CGTA 3U0PB 5E8PA 5L9DH 1T03L 4OGYH 1CGTA 4JKLA 4OZIE 2JF1A 5EU6E 4G9FB 4MDIB 2AXGA 4R4FL 1PZUB 3RTQB 2YPVL 2FH8A 2DQFB 5GGSY 1G7PA 5CGYC 3FQUB 1FL5A 4G43B 2EIZB 4WUKH 2VLKD 5KVGH 1GXEA 3C60D 3G5XB 3GSNA 4OM1H 4KK6D 3T0XA 1EJOL 5F6IC 4MYWB 3DMMB 2EDRA 4N8CL 5F3BA 2V7HB 1XZ0A 3D3VA 1JGLH 4FQIH 3V5DA 2EICA 3NIGE 4XHJC 1W0VA 4Z95H 1G7QA 5C0BA 1YEGL 1YEIH 3BH8B 4NBYB 4V1DE 4YUEL 2IAMD 4Q2ZB 5EUOE 2V2XA 3HMWL 3GMMA 1R5IB 3SDXB 2YSSA 4P48A 1B0WA 2R1XB 5DRWA 4K8RL 2ZG2A 2BNQB 5DQJA 4XNUL 3UMTA 3MGOB 4LKXB 3MZGB 1NLBL 2K1MA 1SMAA 1I7ZB 2DQDH 3W9EA 3RZCB 3MROA 2J8UA 1WBXA 1R3KB 1N3NB 2L0DA 2P1YA 5DRNA 5GISL 1QZ1A 3RWIB 5E8NA 4Z7UE 1K3IA 1I3VA 2R1WB 4F7MA 5I16B 4L8DA 4NPYB 2BSSB 2ADIB 4XP6H 4NQEB 4FRWA 4F2MA 5KG9A 1CG9A 1SM3L 1U3HB 3BUYB 4NCC2 4XVTL 3T0EC 4TRPL 3L5WB 2Y06L 3IRZA 2VLJA 4HC1L 1L6ZA 3WHXA 5C09D 5E8OA 5JQ6L 4JFHD 4X6EB 4LARL 2WY3A 3BKMH 4JFQA 3MXWL 1UM5L 5AAMA 1JNHB 3ARGC 2YD4A 5GSVB 4U4BA 4P46A 4WEMB 1NFKA 3DTXB 5T1KD 1JPST 2CR6A 3PWPA 1Q9OA 2DI8A 1XF2A 2CKBB 2PW1B 1OAYH 4ODBD 2IANE 2X4TB 4XPBL 5JW3H 3RBSA 2VXSL 1I7UA 4JPWH 3MRCB 1T2JA 4AIZA 3FB7B 3FONB 4FNLH 3KDMA 3K0WA 1FV1A 3NAAH 1X5HA 1AQKH 1C16A 4LIQL 4Y2DD 3FHAA 1ORQB 3LIZL 2ZZUT 4LSDA 1VKXA 3EYFB 3G5ZB 4KPHL 4P5KB 1NEZG 4RBPK 4I48A 1V3MA 4JO3H 1LD9A 2K9UA 3SE9H 1T1XA 3EO9L 4HFWA 2EZ0C 1R5WA 2ZNWA 4LSPL 2Z31C 4RGOH 1WAAA 4YBLC 3BIBX 1LO3L 4NWTL 3WEXB 4KTEH 2PCPA 2Y9RT 3IRPX 2HJLA 3TLRA 1HEZA 4KDVA 1HQRB 1FVCA 2VDOL 5FYLH 3MREB 4XVSH 5KSVA 3HAEG 4BQCA 4HUVB 5IW1A 1A7PH 4WI6A 4N0CA 3S8WA 1MFAL 4H88H 4Y4KB 4P2OC 2H8PA 3SPVA 5D72L 2ZUWA 4NN6B 5DVLA 4RZCA 5I1GH 4Q9QH 2ZKHL 5CILL 1MAKA 2BJML 1N5YH 4QTHB 1ZS8B 3TV3L 3BPLB 4G6JH 5JOPE 2C3VA 3EDDA 5DRXA 4PJGE 4OM0L 2XN9A 2XPGB 4OCSL 1AFVH 1OY3B 1M05B 3DURB 5E9DE 5D71L 4APQD 5HXMA 1KFAL 2FEDC 4P57A 4UDUB 1KBGL 4NQDB 1ZHBA 3RNKA 3D2UA 3OR6B 1ZLWK 1I3GL 4QYOB 3DVIA 4PJFA 3OMZA 5EFIB 1OAKL 3RUGB 4JB9L 4PRDA 3TF7C 4D3CL 4XPHL 4TTGA 4WHYH 1P4BL 4YHMH 1WIOA 3VFWB 1BAFL 1OGAB 2X42A 1CDCA 3QFDA 1KTLA 3BH9B 3QDGA 5GS3A 4KMQA 1NAMA 3HUJF 1GC1L 1WZ1L 4N0UB 2E5EA 4GAFB 5IT2H 3QIWD 4PJBB 4P2RD 1RIHH 5A1AA 2P4AB 4MB5A 4FQPA 5EU6A 4YFDB 4JFFB 1ZHLB 3VD5A 1MIML 1IGTB 1MIEL 1RHHA 4UQ3A 2AABL 4YWGH 4P3WA 3UTPE 5C3LD 1AH1A 3NCCB 3QUKB 1V7NL 5H37H 3TJEL 4HKZB 3KPRB 1N6QL 3ZYOA 2C4FT 4Y7MA 1YECL 5L2KA 3MBEA 2R0KH 5TDPB 1QEWB 5MEOA 4FQ2H 3OG6B 1J8HD 1UZ6F 2V17H 2E8ZA 2ZCHL 3RWJB 4NZUL 4MXWL 5FYJU 2YD1A 4YHLH 3VXPB 12E8L 3E3QC 1K4DB 3LD8C 3RVVC 4GFTB 4XNMA 5D5ME 4V1DA 2ADGA 5EUOA 1ZOXA 4ONFH 2OBGA 1BVZA 4PGEB 1G0XA 1CYGA 4EZMA 5DD5L 4M8VA 4G6FB 2YR3A 3LZFL 5DO2D 1F4HA 4YHPB 1LNUB 4MJ2A 1L0QA 3TZVD 5FYKH 3P2TA 2G75A 4JFPB 2JELL 1WZMA 4YDIH 5IMOA 4NHCL 1BBDH 3RWCA 4Z7UA 2AXHA 5L88L 4JN2B 1BVLA 1UCTA 4K94C 4NWUL 1BF2A 1EVUA 3HC4L 1RUKH 3IXTB 3E6HA 3MLVL 3L7FA 3MRPA 1AHWB 3LPWA 1MPAL 2Q6WB 4POZC 1YEFH 4MB4A 1YYMH 1DVFB 3EJZD 1V3LA 3GIZH 3TBVA 1FYHB 1NCDL 3MXVL 2VN7A 2PXYC 5SWQB 3KLDA 4PUBL 4DCQA 2IQ9H 2EDQA 1QFOA 4TN9A 4RAVB 2MMXA 3HB3C 4JPKH 3MLSL 5KBNC 5K9JL 3ZKMC 4X99A 4GKZB 5FKAB 5FUZH 1M4KA 4QO1A 4LLMB 1U93A 2GT9A 1E4KC 3FOMB 4PJIB 4ODSH 3NOIA 1AGCB 1RJLB 1IJ9A 2IANA 3QUZA 4LLVA 5DHVB 2D7QA 5AWNL 5D93C 2YK1H 1I1AB 3MLWL 4LDEB 3MFFB 2PN5A 3DBXB 5C08B 1NEZA 3Q3GB 1FQ9C 4OQTL 2F8VA 4MX7B 3INUL 4GW4A 5JPNA 2BOBB 1AGEA 3KYMA 4NJAL 1RIVL 2AJZA 3QI9B 2DLTA 3W9DB 4FQXB 2VDQH 4M1CD 4JRXE 1BD2E 3WLWD 1SYSB 1I4FA 3QNYB 4XAWH 3CLFH 4HFUL 2CKBH 2P8LA 3ZSSA 4OGAD 3MR9A 2JCCB 2YD3A 3MRGA 3STZB 3ARQA 3EAKA 4I8DA 5EBGA 1EBPA 4ZS6D 1KOAA 4LVNC 1FNEB 3SJVB 3ZDZE 3SGJA 3QPXH 1Y18B 1MRFH 3ARBD 3JV4A 4JZNB 5LCVH 5FUOH 4PGDA 4NQXA 4MAYC 5J12B 1ZAGA 5AYUH 4F7EA 2PTUA 3MV8B 3MRNB 1JPTL 5DUPL 3FQWA 4IRZH 1NEUA 3BVNA 1RUQH 5TF1L 3MRMA 5BJTA 1Y0LB 1DDHA 5E6IA 2VLME 4PJEB 4CJ0A 4LL9A 1RU9L 4GS7B 4ODTL 3BQUB 3DX8B 3PABB 3BP5B 1PBYA 5FV2A 2P48B 4YBQC 3CU7A 1MLCB 2YBRA 4KVNH 1D5ZB 4HZAA 2NY0D 4F80A 3L3KA 4FQQB 5E9DA 5FK9B 3IFOA 4TSAL 1BZ7A 3VW3L 2OL3A 3TNNB 1DUYB 2PYED 3MMEB 4H26B 2DBJA 5F7LB 1UM6H 4HCRL 4XH2B 7FABL 3H42L 1SYVB 5DSCB 4MA7L 3WDIA 4PLJD 1MRCH 1NCWL 2AJ3A 3PV6B 4FP8L 1DR9A 4O00A 5IK3A 3K8MA 4OSUH 4PTUA 3I02A 1G7JB 1N26A 3AVEA 3P77A 4I3SH 3QUXC 4OCWL 4TYUA 3U0TA 4O02H 3OAUL 4JRWA 2CR3A 1QSFE 3IDXH 4S0UC 3DYOA 5J9PA 5EBLB 4JY4A 1P2CB 4I0PC 4XCCL 3WIIH 4KRPD 1HDMB 3UZQA 4M7ZB 1HHHB 3TPUE 4N0YL 2IFFL 1YEHL 1ONQB 3SO3B 4NOFA 5DJXB 2ZUSA 4LLUB 5J11B 2GTWB 4Q9RH 1MFEL 2XA3A 4J4PD 2VUYA 4H5SB 3GI9H 1CGUA 3VI3E 1ZEAH 1NCNA 3MBXL 1JTPA 5D5MA 4W68A 1RIUL 4P0DA 3O6FA 3UDWC 2YD6A 1N0LA 1ZVSB 4KKAD 3VFGL 2BCKB 1CZ8H 1X5YA 5EULV 2Q7YB 5CBAB 4YDKL 4X6DF 1EAPA 4A2LA 1HHIB 2VOTA 1U8PA 2AJVH 4GW1A 2F54A 4UU9A 5AZ2H 4DFHA 4Z7VB 3BSZH 3WN5C 1QBBA 4G9DB 3F7YA 3GJFH 5E6YA 5E7FA 2R23A 3QUYA 2BOCB 4IJ3C 3U6RB 1ZGLA 1T04B 1Q0XH 3KXFE 4QXGL 1FPTH 2MSPA 1QBLL 4ZTOH 1NDGB 3MCKB 1B4RA 4QXUH 3TBWA 3G6JE 1OWRM 4M6OH 1A6UL 3LAFA 4WV1A 1EGJA 1EBAA 5JW4Q 2ESVD 5EC2A 3MUJA 4YNYA 1UB5B 2I26N 5GRVK 3ELAT 1ERNA 1I1RA 4QY8B 4K3GA 1NMAH 5LWYH 1F8TH 3H3BC 4DJMA 1H8NA 1A3LL 3CVHH 4J8RB 5EU5B 4Z8FL 5D1XC 5C0RH 3VJ6B 3ARDD 3ULVE 1MJJA 4HWBA 1DBML 5EIVA 3OKEA 1J1PL 3C6SA 5I2IB 5DK2A 2FCBA 1T3FA 1S5HA 5KVEL 3LEXB 1GIGL 3OBAA 3BWUC 4ONHA 3NZHL 4NYLB 4AG4H 2B5IB 4C83A 1R0AL 3N85H 4WTZG 2C9AA 4K2UL 2YEZB 2LU7A 4TPRL 3BO8B 2VXQH 3ET9F 3TYFA 1CD1B 3HZKA 4JRXA 2HYMA 3OJDA 3IFPB 1KCRL 1BD2A 5E99H 5GGVL 1YYLL 1MLBB 4KTDH 4XHQA 3SDDD 4LPTA 4M48H 3GM8A 5HHPA 5DHVH 4H20H 1XF5B 4UV4H 1TMCA 4Z0XA 1GZQB 1XIWA 2AQ2A 5TE6L 3VGGA 4U0QB 3GMNA 2X4PB 1MWAA 4YQXH 4Z0BH 4PLKC 3UBXG 2D7TH 2V2WB 3EYVA 3FTGB 4QRUB 4U6XA 3RPKA 4TUOA 5IJKA 3CFKB 2R1YA 4U1KB 5E0QA 5TQ0H 4NT6B 3DXAA 2ZNXA 3RVTD 5SX4I 3V0VB 5KVFL 1YPZE 2QBWA 4QRRE 1BJ8A 3D39E 3K4ZA 3L3HB 1MAJA 2H1PH 3LKPB 3O3BA 4X9IA 4GAYB 3LB6D 1FBIL 2ADFL 4UDTB 1FDLL 4W6YB 2IH3A 1YN6A 3SCMA 5CJXA 1OP3H 5HHOD 1MH5B 1OT2A 5B39A 5BOZG 1KCKA 4K9EC 1IEAB 2HTKC 3DX7B 3QRGH 2GJZB 2NY6D 4OCRH 4L4VD 1IGYA 4JKWA 3BAEL 3VD3A 3OL2A 2C1PB 1CDIA 3UC0H 4P59L 4BKLB 1OM3H 3B3IA 3MRFA 2DD8H 3IS0X 5IIEB 2JJSC 2JJTA 4HK0B 1U3HC 5DEFA 3PGCB 4L8SB 3X3GH 4UTAL 4OLXH 5JHDE 4TNVF 3GMPA 4M93B 1A1NB 1F58H 4D8PA 3KWWB 4OIIH 1MCOH 4KZEH 2AEQH 2UY6A 4E0RB 4QXTB 1QSFA 3EOTH 1C1EH 1JN6A 4TQEL 5IR1B 3WSQH 1A6WL 4AM0B 4UQ2B 5DJ8B 4R96B 1KCSH 1LO0L 3PNWA 1CDUA 3D69B 1J88A 2A74A 3HI1A 5J6HB 4ETQA 1UA6H 3CFIC 4BELD 2D31A 2JIXB 4K3DL 1HH6A 3IDIA 3B9AA 3FB6B 2G60L 4QWWC 5C6TH 3SGKA 2K3TA 4IMLB 3OGCA 3MA9L 3HRPA 1JL8A 1MF2L 2GHWB 4F8TA 3QEQE 3LRSA 3NGBC 1JZ8A 1JFQL 4Z6AT 2B8OT 3D85B 3C6LB 2UVFA 3AAZB 4QOKE 4CMMB 5BVJA 1RK1B 3BP4B 4JM2D 3CK0L 3WV0A 3UTTB 2WMPA 1MJ7L 4NRYB 2GKIA 2X7LB 2X2YA 5DRZB 1F4AA 4X83A 2DF3A 1ZVHA 3OWEA 1KC5L 5HHXL 5INDA 4XWOC 5F89A 5DI8A 5DLML 3LKOB 1BGXH 4G3YH 5ESAA 4EN3A 3PWVA 4CJ1A 5B38B 1RZ7H 3KXFA 3VGAB 5DDHA 1R3IL 5C0GB 5BXFB 3U46B 3GKZA 3SE3C 3G6JA 1S3KL 4AENA 5DJAA 4L9LC 2YZ1A 2E7LE 3S36H 1TVHB 4Y4KC 1Q9WA 1F6AB 4AT6A 3IJYB 5I8EA 5DEZA 3WIHL 1F11A 1HK6A 1DE4A 4JN1H 5C0AA 1ZLUH 4OLZH 4Y19D 5I1DA 5KOVC 3V8OA 1J0KA 1S9XA 2H6PA 1CICA 4JANB 1JPFB 5D6CA 1NFIB 1CBVL 3QSKB 1IC4H 3AM8A 4F7CB 5FUCC 3BXNA 3L3IA 3BISA 2IGFL 1A2YA 3WFEH 1N59A 5JIIA 2XG4A 3CIQA 3I3DA 1J0ZA 3T0EE 3CC5A 1M7IB 3MGTB 3KPTA 3DO7B 3GMRA 3VFVA 3CFJA 4X9BA 4X5WB 4XNQB 4JZJC 1KYOJ 1LP9B 4CVWA 3HNTL 1QSZA 2OZ4H 3WKML 5MEQA 5FV1L 1FHGA 4Z5RA 5A2JH 3FO2B 1YNTB 3BWAB 3GO1H 4YFLI 4P23A 4HKJA 3KPPA 3O4LB 3F6IA 3WUWG 1CFTB 4Q6IB 1BMGA 2R0WH 2HJFA 2VITB 5KSUA 1IEHA 4PBVC 5LGKA 2BVQB 4R97B 1AO7B 4M1CC 2VLRD 1FL6B 3W5NA 3GJFK 3T1FB 2J12B 4PRBA 1CFQA 4HS3B 3DGGB 4OGAC 4ZTPL 3HRZB 1AP2B 1DEEB 4N90D 3RHWF 4LNVA 3BZEB 4RRPA 1D5IL 4H8WH 6FABH 3RA7H 3IDMB 2CXGA 4K7PH 4OKVB 5GSRA 4OGXH 4OB5H 2FDBP 4Y5YB 4ELME 5GS0D 1VHPA 2RCSH 3ARBC 1NMCC 3O2DA 1WT5C 3E2HB 1WICA 1YPZA 4TOYH 1NBVH 4QRRA 4OF6A 3X13B 3D39A 5I1AB 3STBA 3VA2C 1RZJL 2OQJA 5SX5H 4AH2B 4BZ1H 3RU8H 2DQEH 2P24A 1WWBX 5MHSE 5DD0H 1KXTB 1QRKA 4PLOB 1W72A 4U0RC 1AE6L 4FFEX 5E4EB 5T3XH 2ZJSH 4HUKB 3P4OA 3VXUD 1YDPA 2C1OA 2FIKB 5FF6A 4C59B 2CK0H 3MUZ1 4Y4HD 4W70A 5C7XL 2BXYA 4EKXA 3LHPH 3O81A 2FJGB 4RMUA 1HHKA 2NY0C 4ZAKB 3EFDH 1KPRA 2EIDA 4LAQL 5H2BB 3V4VH 4DEPB 1QD0A 4NZTL 2IBBA 4FQLH 4HGKC 2VXUH 5IW3A 4HWEH 4ZUUB 1HHJA 4UIMA 1D9KB 1U8MA 1NBYA 4KROD 1UM4H 3Q6GH 5IM7A 3HG1E 1BQHB 1U8LB 1T20B 2KZ1B 5CJ5A 3H2WA 5JIPA 1I8MA 3JTTB 2DDQH 2XT1B 4HQQL 1FVDA 2AK4B 3MV7E 1V05A 2J88L 4XP9H 3DWTA 1NQBA 1T7XA 5FA4B 4LNRB 3MJ9A 4LLAA 4WWKB 3CX5K 3O9WB 1FZKA 5FA3B 3G6AA 3PDOB 1V3KA 4F3FA 5BRZB 5I8KH 1IC5H 1UZ6E 2NY5L 2VXVH 1RK0B 1ZHNB 1U42A 1EEYA 2FO1A 3RVXD 5ID0B 4KI5C 3ARFB 4Z76B 2ZG1A 3JVGC 1I1AC 4O51A 3IVKB 4PJ8D 2DM4A 5ITBH 5IBUB 2GK2A 3FO0H 4ZUWB 2Q3ZA 5FHBH 3O3EA 5SWSE 3QEQA 2AP2A 3FOLB 4NGHH 4OFYD 1JV5A 3RL2B 1OP3K 5LKNA 3OKOA 4FQXC 4QOKA 1OAZL 4PRPE 3NH7L 1JHKH 3BPOB 4D9RE 2ATPA 4XPTL 2O5ZH 3ZL4L 5E5MA 2B1HL 3T0WA 3ZT7A 2VDNH 3GSQB 1K5NB 2W59A 2FR4A 3VDCA 1RZIA 4UUJB 4KHTL 1LO2H 1T5WB 1L9NA 4BUGA 2R2HB 5D7JB 3SGDH 3E3QE 4JKMA 4KI5F 5IFJA 3I3BA 2OJZH 3LPFA 3SO5A 5J12C 4NQSB 2Z93A 3PGFH 4AMKH 4HKBB 2YUVA 3A6CH 3PWUA 5EWIL 2CXKA 2NLJB 2H41A 4XMKL 1DLHB 5CEYA 1TZIA 2D7NA 4RNRB 4DTGH 3QUML 2Q8BH 1A22B 5IV2A 1DP0A 2JCCF 1BOYA 4LQFH 1XGQA 1BQSA 5JMRA 3OQ3B 3T1WA 2EH8H 2FB4L 4L29B 3VCLA 3WUZA 2HH0L 2P8PB 4P4RB 1YMHB 1NL0H 2YPLD 4HT1H 4PJDB 1OGTB 4ZUSA 1JF6A 2R4RH 4OT1L 1DQQB 2O5YL 2X9YA 5CS7A 3MFGB 5EN2A 1EMTL 2FJHB 3EOBA 1QFUH 3T0EA 3WUWA 1DBKL 2YUWA 1F3JB 1Y6NR 3O3AA 4LSRL 3ARDC 1I7RA 3QNXA 3AREB 5DURD 2XFXB 4OCYL 3PWJA 1QFPA 3QEUB 3QFJB 1A9BB 5D70L 3HE7B 1PEZA 3S5LA 4BH7B 1LEKB 2DJUA 1TCRA 3I6KB 1NC2B 1HCVA 5DUML 5E94A 3ARGA 5JLZA 1ADQA 1HCFX 4PG9B 2XZCH 4JFDE 5F7UA 4YK4B 3REWB 4OLVL 3HN3A 3NCMA 1BIIB 3O8XB 5ERWB 5CEZE 1CIUA 3ZDYF 5I30L 2P44B 4R3SA 5L2JA 4H1LA 4LEOB 4N8VG 4G59A 4QF1A 3EIFA 3V4UL 1U8KA 4ONOA 4RAUA 4ACPA 1VFOA 4RMRA 5DWUL 4ZSOB 1A6VH 1JC