1FZOA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
273
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title The crystal structures of K(bm1) and K(bm8) reveal that subtle changes in the peptide environment impact thermostability and alloreactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fzoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fzoA01
1PDKA 5LCVL 4N0UA 5GIRB 1ZGLM 2AS5M 2O5YL 5GGTH 3KLAB 1AHWA 3K1KC 3LN5B 4OZFB 4UU9B 4UILH 2X4UA 1T7WA 1M05A 4MD4A 3TP4A 2HKFL 2NY3D 4JFFA 3MGOA 5GPRA 2NY4D 3MROB 5IQ9A 2VLJB 5CSBA 3IGAB 4QRRA 1JPTL 3SQBA 1HIMH 2R0ZL 2EDNA 1W72B 4TULL 4ISVA 4HG4J 1VFBB 5IMKA 3GMNB 1RMFH 2IFFL 4N1CA 3U7WL 3KS0H 1E0OB 5C0CA 2EDOA 1MWAH 3W2DH 5KSAA 5D5MF 1FORL 1L8JA 3HAEG 5FGBA 3R8BB 5F8QC 4O58H 3O45B 2X42A 4LLMA 1WBYB 3NN8B 4JG0L 1F4XH 3LEVH 4GW5B 1X5FA 4ALAL 3OWEA 1QRNE 4CRPA 4MA7L 2R0LH 3UDWA 4OCYH 3BIAX 4OGAC 3VWKC 1UA6L 3C8HA 4MJ5B 4Q6IB 4IEFB 3S34L 4KGJA 1IGML 2A38A 3KNBA 1RULL 4WO4D 5H2BB 3TO2B 3CUPA 3DRQA 4JRXB 4MAYC 3I6LD 4QGTA 5DJ8B 5DRNA 4F9LA 3O8XD 4NO3B 3AMKA 2OJZL 4QXGH 1KB5A 1KBGL 2YPVL 4G8FA 1M7XA 3G9AB 4LCIL 4S1QL 1K8IB 4JHAH 2X09A 3PL6D 2YN5A 3QXWA 3IFLL 1KIRA 1EO5A 1I9RH 2XN9A 5IOPB 2X70A 3GGWA 1T1WB 1OVZA 2X9WA 5TQ0L 3C5ZA 4V1DA 3RPIB 4JY4B 5TH2A 4M4RA 4IOIB 3U0TA 4NNXA 1M4KA 2WIMA 4HWBA 1MAJA 4ZXBA 3WJJC 1FFNA 3TFKD 2BNRB 3U1SL 5GISH 3D2UA 5I8EA 5CEZH 4CL7A 1HILB 1QFPA 4PJIF 4RFOH 4N8PA 1HQ4A 4QTHA 1MJ7L 3BRDA 5HHPA 4HZAA 4ZFOA 3V5KB 5B38G 4YDIH 3VRLF 3DECA 3QXVA 3KYOA 2D2OA 2YSSA 4KJQC 3KPLB 3NCMA 4MDIA 1JFQL 4YDJA 1ACYL 1OM3L 4F7PB 5D5MA 3DJ9A 4FG6D 3T3PF 1K4DA 4LSVL 2ADFL 2APBA 3IU4L 3QPXL 1KNOA 4M43H 4BUHA 3KG5A 3IU3A 3SHSA 3LH2L 1KTLB 2XTJC 3P4LA 3MYZA 4OGXH 2ERJC 4HUUA 3EJZD 2P5EA 4BZ2L 2VLME 5DUPH 1JNNH 3TN0C 2HWZL 5GSVA 4PG2C 3JV5A 1GPOH 5IFAL 5KS9E 4JFFD 1S5HA 1XCQA 3RAJH 1LGVA 1ZEAL 4MD5B 4NN6B 3ARGB 4FTVD 4Z76B 4PS4L 3EO0A 1I8KB 3CH1B 1Z6JT 3SO3B 3VGAC 2JJSA 1QFWL 3OXSB 1E6OH 4L4JA 4HUVB 4NZUH 1SJHA 3X13A 4QGYA 2XZAL 3RUGB 3P9MB 4ZFFB 4HH9B 1MFDL 1I7UA 3KS0J 3F7YA 2A0LC 3O11A 1IC7L 2D7OA 3L7FA 3D1MC 1C1EH 2GHWB 5C0CD 2GCYA 4XP6L 1HSAA 3NA4A 4PLJC 4HJGB 5KSAD 2AJVL 4OF0A 5ICXB 4NDMA 1AKJA 1DQDL 3ZYZA 1T89A 1S9XB 4KK8D 2ITDA 1BBJB 4HW6A 1GZPA 5GRVL 3HRZA 3BSZL 5E5RB 3U2SA 5CGMA 3PNWB 5E6IA 1MHHB 3WUWB 4PJIA 4RFNB 3SDCA 4R4BA 4KROD 4PRIB 4YFLF 5I8KL 5ID0A 3MJ7A 2K1MA 3MRJB 1BLNA 4YGVB 5KVGL 1UYWL 1PLGH 1DDHB 6FABH 4ODHH 4WY7H 3SGJA 1JGVL 2VAJA 1J8HE 4WHCA 4FS0A 1WVZA 2XN9D 1V7NH 4HH8A 3V6BR 2GJJA 4WTXA 4V1DD 2HYMA 2VC2L 3VXPA 3W0WE 1OQXA 3QEQB 4R7DB 3KJ6H 5CMAA 4LEXH 5EFIB 4K3EH 1TQCB 4NKDB 4WU7B 3IKKA 4ZXBD 1A4KB 3TYFA 4RISH 5DK0B 4BJLA 4JRWA 4JO1H 1T4KA 3D2UD 4Y1AE 5FYLD 3B9VA 1A7RL 3UAJD 2VITA 5DHVB 4PGEB 5HDBF 1BHGA 4TNVK 1NUNB 5FA3B 4YQXL 1XGRB 1A6VH 2E9JA 4P57B 1FG9C 4PGDA 2R1WA 1PY4A 1MF2H 1T22B 4U4BA 2QADC 1UACL 5CD3A 3MRBB 1XGYL 5SV3A 3O3UN 3TCLA 1UWGL 1MLBA 4YHKH 4PJCE 4KKCD 4YHOH 2P45B 4LQFL 3D48R 3DX6B 2F58L 5E1AA 3RA7H 5IT2H 4Y89A 3HZKB 2YD9A 2J8OA 2P5ED 1FP5A 2WQRA 4XNYH 3HC4L 3GO1L 4PJAF 4JFQA 3PWLA 2EKSA 4N8CL 5I16B 1C5CH 1XF1A 1YPZE 1QVOB 1I1FB 1X5GA 2OI9B 5J89A 4Y16C 3VMNA 3GIVA 3QNYA 4FQHB 1TPXB 3OKLA 4R4ND 2FR4A 5C71A 5DWUL 2IBZY 4P9HH 2WBWB 4F2MA 1JGUL 5DD0L 1IGFH 2A2QT 2PXYC 4L8SA 1F3JA 3H6JA 4IDJH 1NGQL 1RUPH 2Z8SA 1S7XB 3ZO0A 4YPJA 1KJMA 5I19H 1OP5K 4KQ4H 5F7HA 2BNUB 1IE5A 3G6DL 5AEAA 4U1IB 1TVBA 4EEEA 5AAWA 4OSUL 3S37H 4IMKA 3V4PH 1ZA6A 3FQNA 5JO5B 2UY6A 3OG4B 5EBGA 5KG9A 4KQ3L 4KHXH 3TBVA 3SDCD 1PBYA 4XMLL 1MIMH 4PJGA 3CSYA 3WIIH 2XWBA 1A6UL 5EZLA 4DGYH 4ELMB 1OTUC 4XGZB 5CIPA 1OARL 4GRLC 4MVBC 2NY6D 3HLAA 3RKDD 4JY6A 4KK9C 2ESVA 1X7QB 1CICA 2P42B 1YEJH 3FB8B 1GGYA 1IJ9A 5CJ5A 5ITFA 1HCVA 4NJAH 4PJ8C 2FNBA 4HCRA 5GGVY 4U1MA 1NCAL 3QZWG 1LO0L 4JO4H 4P3CL 2IMMA 4JREC 1FYTE 3RY4A 5EU4A 5C9JB 2W07A 4HIXL 1FNLA 4OCRL 4XNMA 1FN4B 2DB8A 1IARB 4OQ1A 4QXUL 2BRRL 4PJAA 5D7IE 5I71C 4MJ6A 3VFNB 3F7RA 1RZFH 3QIBC 3G5XA 1B3JA 1BIIA 3B9KC 2F5BL 4QRUA 2VZ1A 3I2CH 3KYNB 4K94C 1S7TB 3IDMB 3O6FB 3WD5H 4Z0BH 5GGRB 3TF7C 1IGIH 2APFA 4XC1L 4EOWL 2VZOA 4OGYL 5MEOB 4JGJA 1JWUA 2FEEL 2VL5A 5HY9A 4X98A 3WJLC 5IB3A 1AGEB 3G5VB 1R5WA 4R3SA 3WL9A 4KTEH 5ALCL 5JW4Q 3VFUB 5BS0A 5DGRA 3N06B 1EXUA 4MNGA 3JTSB 3OSKA 3U30C 3LKSB 3I84A 3DVFA 3QP3A 5IHBA 3L3GA 3H9ZA 1KJ2H 3GFUA 5FOJA 3WNLA 2VN4A 1I3GL 2BVUA 5EUKB 4BZYA 4EQ2A 5L9DL 1AR1C 2VKWA 1DUZB 4PJFB 1J0YA 3MR9B 2O5ZH 4XNUL 3RDTD 1CLYL 5IV2B 2PNDA 2AI0L 5K59F 1J8KA 3TPUA 3CVHL 4ZFZB 3GUTB 3E8UH 1YYLH 5IJVA 3BGAA 4LVOB 3LRHA 4UTAL 4HHAB 5D6DC 2F54E 4PUBH 1AJ7L 1INQA 4B53A 1BZ9B 2F53B 2BVPB 3OB8A 4MAYA 4JY5L 5EORL 4H1LH 3GB7B 1UJTA 4YHIA 5KW9L 4ZO9A 4D9QD 5KVFH 1JV5A 2OP4H 3O2VH 3VXRB 3UTOA 5IB4A 4IIQC 5IK3B 3C08H 4MB3A 5EUOE 1KXQE 2FLBT 3WNKA 2F9BT 2C4FT 3GRWA 5E9DB 5KBNC 4X9GA 2ESVD 2Y07L 3NIDF 5KJRH 4JAMA 1CICD 3L6FA 2VUYA 3L3JA 4PP1D 4Z7WE 3FCTB 5A1AA 1OWWA 3WJJA 2OJEA 1AD0A 4KKLD 2DLTA 2NTFA 1CN4A 4XPGL 4JKLA 2B1AH 2C1OB 4GAYA 3B5TA 4K9EL 3SDXE 2Q76A 1D5ZA 2DQUH 4NNYA 3NA9H 4U3HA 4OD3L 1DQMH 5F9OH 3O3DA 3AREB 1ZLUH 1F42A 3TBYB 3SN6N 1CXEA 4XCEA 2HJLB 3DV4B 4JO2L 4LU5L 2XIDA 3ZMRA 1LILA 5FEBA 1KFAL 2EIZB 3DI2B 3UTTB 4PRBB 1CFSA 4LVNC 1QEWA 1IFHL 4D8PA 5GS2H 3VMPA 5HVHC 4M6ML 1N26A 3HR6A 1ZA3B 3HS0A 2DD8H 4X7TA 4GG8B 1KTRL 4ZFGH 4HJ0C 3RGHA 1DBAL 1WGOA 1B4JL 4KKBC 1CZ8H 4O2EB 3S5LA 1U3HC 2AXHA 4LLVB 1N7ML 5EU5A 1ZANL 1OAZL 3EO1B 4XAKE 5KOMC 2VLKE 4PG2A 2EH7H 5C0BD 1QSFA 1RZIA 4JVWA 2EDDA 5F9WB 5F89A 1UENA 3QUKB 4TUJB 3HE6C 1Z9SA 4HS6B 4DKEL 3WIHL 3VFMA 2W59A 3SOBH 1IZJA 2F5AL 3NMEA 3ARPA 3GSVB 3CFDA 4QHMB 4XNXH 1ZLSL 3QDMB 2ZSWB 4OF5A 4P9ML 4RGOL 4KXZH 5IBUG 3RX8A 4CVXA 1LWRA 1E27A 4JQXC 3IDIB 2VR9A 1IAIL 4N9OB 4MWFA 5DHXB 5JUEL 1QQDB 3KPSD 2HLAA 3QJFA 1KXVC 2A83A 4JGUA 3PF2A 3S4SG 1N59A 1T1XA 2OL3A 4LOUC 3AXLB 5ICYB 1T04A 4P46C 3BYTA 4U1NB 3TO4C 5FYJL 3VH8G 4OGAD 3DXAD 3V0VB 4NC1C 3VWKD 1BREA 5HPMB 1RJCA 4XPFL 1DUYB 1A0QH 1X3DA 4YXHL 1PZUB 1RZKH 1KJ3H 3QCTH 4MAYD 4P5MB 5SWSE 4CMMA 5DURD 2OZ4H 1S7WB 2NXYB 5F7WC 1PGRB 5ECJE 2GJZB 4NFDA 4U6HB 4A6YH 1FZJA 1P9MC 4FFYL 2DICA 4X6CF 3FB5A 5EOTA 5SV4A 1ERNA 3S35H 4JFHE 5KSVB 2D7MA 3X3FL 1CR9L 1EHAA 5FUZH 4G9FE 4U1JB 5KS9F 5C0DA 5K9OA 3K46A 2X7LB 3FZUD 3DUSA 1CD1B 3MRKA 3GSUB 3FKUS 1S5IL 1IVLA 3F12A 5IESH 1LK3L 5C6TH 4YHML 5C07B 5DJXA 3RIFK 3UTZB 1SY6A 1GGIL 3WV0A 3PWUB 4PBXA 3MV7A 4KJQD 5GGVH 1MJJA 5HGAA 4M6NH 5TE6H 4GKZA 1ZVSA 1FCGA 1F58H 4G7YH 1E4XI 4P4RB 3VD4A 5CZXC 2AGJH 2HVJA 3CJJA 2E3VA 2XTJD 3BPLC 3LV3A 2UZYB 3KPPA 2FB4H 4LEOB 3TN0D 4GG6E 3MJ8A 3OKNB 1I75A 5HHMD 3ZYJA 5I1LB 4LK4A 5JOPE 4DZ8A 4HWNA 4AEHH 1OSZB 3MLRH 4Y16A 1G6RA 3KLHC 3UBXA 3EDDA 3KXFB 3U0PB 4O02H 1QO3A 4WTWA 3FN3A 2VO5A 5IG7A 4HJJL 5D7LD 2PXYA 4JFYA 4QRQA 4Y2DC 4OIIH 3RHWK 4PLJD 2UZIH 2Z4QA 1B0WA 3HI5L 3FFDB 3EYVA 5KS9A 4J8RA 3CFEB 4TTGA 1GGBH 2OTPA 4KVCH 4DN3H 1LQSR 1MRFH 2DQCH 1BVLB 4HKBA 2WIIB 4BM7A 3LDBC 5AWNL 4NT6B 4HK0B 3L3OB 3VFRB 3MV8E 1KYOK 1EEUA 3LQMA 3ZTJG 4U6YB 5JW4R 1IZKA 1GZQB 2ZZUT 1V3LA 1L0XA 1KG0B 4M6AA 4GRLA 4PJCF 1OP3K 2QEJA 1TQBC 3DX7B 4HK3N 4MVBA 3N9GH 1J0ZA 4G9DA 5HDLA 3UTSB 3DVGB 1J1OH 3QUXD 4PJ8A 5F88A 4NZRL 1MELA 5BZDB 5MENE 3BH8B 2D3VA 3BYYA 1J0JA 25C8H 5LGJA 2IPTH 1UH3A 4JZNA 2A9NH 3PDOB 2ZCLH 1YPZF 3BXNB 4M61A 2VDML 1GCFA 3ARYA 3P4MB 4HFWB 4M62L 3LEYH 4RMSA 4LSQL 4D3CL 1NCNA 4S1RL 3T8XB 4HXBL 1QPXA 1Y18A 3NCYP 1JPST 1G7IB 1EX0A 3B9KA 4JB9H 3NZHH 2YXMA 4TYUA 1J8HA 2QSCL 3Q5TA 1R0AL 1FAIH 3MRNA 2DWDB 3NCJH 4M4PA 3TF7A 1R3HA 2XXMB 1A1NB 3W0WA 1ZWIB 1Q9WA 3MV7D 4W6YB 2FHFA 1I7ZB 2QADD 5IUSA 5J12B 3WJLA 4JFOB 1XR8B 4BH8A 2E8YA 1HH9B 2XACC 4JQIL 1QACA 4UQ2A 3IVKB 3HMXA 3IB4A 3SCMC 4Y1AA 1D5XA 1WWBX 2D31B 1F97A 4XTRC 2YC1B 5DD1L 3NFPB 3MOQA 5FYKU 1F4AA 5HHNB 5LGKA 1DFBH 3IDXL 3RL2A 4LRNH 4OD2B 3OJDA 3VXQB 5DUBA 1NMCB 4Y16D 2X1QA 3MO1B 3P0YH 4HIHA 1T20A 4JFDE 3FRPA 1QLFA 4PJCA 1PG7W 4I9WE 5JXAH 1BGXL 4N1HB 3BH9B 2PXYD 5I75C 3BP7B 5LAXB 2L0DA 2QQLL 1WV7T 2R2HA 2BHUA 4XPTL 3CFCL 3U82B 1P2CA 1BAFL 2BMKB 4LFHG 1JWMB 5KSUB 5FKAB 1CFQA 4ZUTA 1YPZA 1JNLL 4TQEL 5D6DA 2AEPL 5I8OL 2LAGB 4ZQKA 2E6PA 4L4TB 5CWSB 2IH3A 2Q8BL 3LSOB 1SHMA 2YPKA 4LKCA 1BD2B 1F90L 2RFXB 4ORGB 3ABZA 5F7EL 3VXTB 4Q58C 2FJFB 3BP5B 5D7JC 1MRDL 3RKPA 4IIQA 1CDIA 1OTUD 2CXGA 2QQKL 4K7PX 5EU6E 2D03H 5HGHA 3MLXL 4MVBD 5F6HJ 4KK9D 1C12B 5GRUL 4L3EB 1II4E 5EZJB 1KGCD 2XG4A 4X6DF 4PJ8D 3LS5H 1J88A 4DKDC 1CI5A 4P2RB 4UNUA 2GT9B 1KTDA 1UT9A 2ZUQB 4ELKA 4I3GA 4MQSB 4PJXE 4TUOA 2N1KA 1J1XL 4WEBH 3LHPL 3AAZB 3S36L 5JNYB 4ZAKB 5HHQB 4QOKE 3CZFA 2EIBA 1IL1B 1J87A 5TQ2L 5DSCB 3QIBD 1A7PH 4X5WB 4MNHA 1AC0A 4KV5E 3B9KD 3MNVA 5IB2A 1CGXA 4IRSB 1I8IB 1IC5L 4X99B 5ID1A 5LXGL 1WZKA 3BIKB 3IDJA 5HDOA 3RNKB 3QJHA 1ZLWK 3W0WD 5GS0H 3I85A 1FYTA 5HYJB 4K9EC 4M9PA 4TNWF 1WTGT 3QUZB 5HYEA 5DF0A 5D7IA 5MERB 4Y1AD 2H8PB 2VDRL 1NJ9B 4BSVA 1LEGB 3SE8H 2RAMA 3WXVL 1W0WA 5L2JA 5ERWB 4FQCL 5T33L 1YQVL 1QYGH 1HDMB 2N56A 2EXWC 1ZAGA 3EJJX 5AYQA 3IDNB 1QBMH 3QG7H 1P4LA 3QRGH 1WSST 3F62A 1I9EA 3OKEA 2MOVA 2JCCE 2FBJH 1KPVB 3MFFB 2V9QA 2I27N 3IFOA 4JQXA 1AR1D 1GJIA 4RMWA 1CXIA 4Z7WF 1ZK9A 5D93B 1MEXH 3WS3A 1MFCL 3RBSA 3RWDB 1NCDH 2V2TB 1JN6B 1QFOA 2IG2H 4H88H 1UKQA 5BJTB 1M6OB 2BXZA 1WZ1H 5DJ0B 2PYEB 2A6IB 4YBHA 3PQYE 4HUWB 4P46A 3RL1A 3TO4A 2AEQL 4ORZC 1U8KA 4H20L 1FZMB 3L9RA 3GJEA 2C5DC 1B0RA 3ME0A 4KRPC 3OKKB 1I1AC 3D3VE 1VERA 2LE9A 4TRPH 3AVEA 1MJ8L 2DLFH 1VEPA 2ZWLT 3LD8C 3LIZH 1RPQA 3IS0X 1P9MA 1U8HB 3Q1SH 2XNAB 1XF5A 5F1SA 5JW3H 4CADB 2H32A 1UB6B 1MIEH 2V7NA 4RWYL 5M94B 5L6YH 1KJ2B 1CK0L 3QUMH 1FO0B 3CMGA 4PLNC 2F54A 2X1WL 1ND0A 1BFTA 2BVOB 4P3WA 3I50H 4PY8J 3ARFB 4PYGA 4XH2A 5T5FH 3CCHA 5AYUH 3BUYB 1XIWB 3Q3GB 2FLRT 4LLDA 5B39G 2CIKA 1MCWW 2BY1A 3MBXH 5EO1A 4NKMA 4ZPTA 3F7VB 1RY7B 2H2SC 2IPKB 2I9LA 2WBJD 2CMRL 4GW4B 2Z31B 4KJPC 4TSAH 3R0MA 4CU7A 5EUOA 5FUCC 4D0BB 5B8CC 1INDH 4NRZA 5TF0A 4I48B 2HFEA 5K9JL 4Z7WA 1DQQB 2OQJB 2UWEF 1FZOB 4FA8A 1T7ZA 2FJGB 2KQNA 5JXEC 3HAEH 2E7CA 2P1YA 3HUJB 4HJ0D 5DJYA 1FIGL 4HC1L 1GOHA 2V17H 3WFHA 5GRWA 1C5BL 4KKBD 4M7LH 3SDXA 1FYTD 4NKOA 4UV4L 1U3HD 1Y0LA 4JG1L 3HE7C 1U2HA 5T3XL 1AQDA 1LP9E 5C0FA 1FLRL 2BNQB 4OLEA 3TZVA 1DE4A 2OSLB 5L88H 3EOTH 3FTGA 3CU7A 3QDGE 4PG9B 4HQQH 3AU1A 3HE6D 5I1GH 4TUKH 4KJYB 3IKCB 4ONGL 2X4PB 1IGCH 2UVFA 1Z3GH 2R56L 3GBNL 1DSFL 5JORA 2FJHA 3BEVB 3E6HB 1XT5A 1RIHH 4RFEB 5JLZB 5K9KA 3I6GA 4Y2DA 3RGVC 1U8JA 2IGFL 2CDFA 3KPQB 5H35B 2DDQL 3UC0H 2VLKA 1CFTB 4CUCA 2E8ZA 2DLHA 3GSWB 5DMYA 4GMTH 4X6FA 5E8PA 3O0RH 4LIQL 1N0XL 3MLYL 3VRJA 3GMPA 4ZUWB 3PGDB 4AEEA 4OLZL 4NQED 1MCWM 5HGDA 4P46D 3KHQA 3TO4D 4OI7A 3B9EA 3V6OE 4PRNA 4YIQA 1LO2L 5GJSH 4R8WL 2MNUA 3BP4B 3WFDH 2XRAL 2R2CA 4O51B 5HDQL 1LE9B 3H9HB 5JR1L 3W9EA 2DTML 5JHLH 1VCAA 3LCYA 3PUCA 4ZOEA 1IKNC 5E8OA 3S97C 1IGJA 1T5WB 4I5BA 3UTQB 4MMZC 3QIWB 1KOAA 1C08B 1YJDC 1HQRA 2OR9H 1U95B 5IGXL 5JTWA 2GITB 3K81A 4GG6F 1AQKL 2F54D 5E5MB 4UINH 1T0NB 5C09B 3GHBH 3FT4B 4RZCA 2J5LB 5D71L 1F6LL 1YUHA 5SWSA 4HS3A 4U31A 3NACL 4AEFA 3BP6B 4MB5A 2YA1A 3V4UH 3B6SB 4Z0XA 3HRPA 3KPRB 5ADPL 1MFBL 2YR3A 5L0QC 4AG4H 1WBXB 3MACL 2DM3A 1UC6A 2X4TA 4AEIL 1Q0XH 5IVXE 3AS1A 3SGEH 2XPGB 2ENYA 3MLUH 3HNTL 1CBVL 4N5EC 3K2UL 5A2IH 3DRTB 1X5AA 4G8EB 3DHJA 5AZ2L 3WIFB 4E5XA 3SCMA 3H3BC 2MCPH 5CZXD 5IEKA 5IB1B 5ANME 5CJ8A 1YN7A 5F3HB 5I1JH 3FL7A 3CMOH 3P77A 4Y4KB 5FXCH 1LO4L 2AXGA 4EDXB 3U36B 3B83A 1IM3B 1E4XL 4QYOA 5EN2B 2K7PA 3KLHD 4ODXB 2NXZB 5C70A 4LSUH 4AM0A 5B38A 1OAXH 4HLZG 2D7QA 5HD8C 5E99L 1LEKB 1ZHLA 4KRNA 4YHYC 2CJUH 2GJ6B 4Y2DD 3SEPA 2VXVL 4UT9L 1FG2B 4XAKD 3EYSL 5KVDL 1MH5B 4N8VB 3CPLB 3WFCL 1QR1B 4GG6A 5EC2A 4KY1L 3MXVL 4XHJC 2WLZA 3KPTA 1KEML 5GRYA 3NTCL 5EO0B 5IMMB 5FB8B 4UB0L 4MNQB 2W9EH 5E2WH 1BQHA 4Y4HB 1DVFB 4X7SL 1H3GA 4EJ1C 5IR1B 2CKBL 1OLLA 4NHUB 2HH0L 2PW2B 5T5NF 3C2AL 1Q1JL 3BIBX 1ZGLP 1UKSA 5D7JA 3L5WA 3G6JB 3MNZB 3SE4A 1A6TB 4XNZC 1S7VA 4P59H 3CVHA 4CBPA 1P69B 2EH8H 3N85H 3G5ZA 1A5FH 1YEFH 5I8CA 1GGCH 3A6BH 1CG9B 2XOTA 2F8OA 4OKVA 3V6OC 1YZZA 3VFPA 3MV8A 3MGAA 2CH8A 2B2XL 2GSIA 4D0DA 3MUGB 1AP2B 4KK5C 1AGCB 1ONQB 3CGTA 3U4BH 4Q9QH 1N6VA 3DI3B 5SWZB 1Q9KB 1A2YB 3VXME 3L3HB 3BHBB 4JFHD 5HJ3A 2NW3A 1NDGB 1KELL 1YC7A 5I74C 5MENA 4OM0L 1GC1H 3HC0B 4Y8DC 1INEH 4OIAA 5C0AB 1AFVH 1U8IB 5L2KB 5F96H 4GKSB 1VGEL 1WFUA 5T3XE 1S9WA 2PKDA 1J1PL 3SCMD 4ZOBA 5F9DC 4FXLA 3T0AA 4HIEB 5I18L 1GL4B 4XTRD 1KIQA 2GAZB 4YFEA 3G5YA 2NX5E 5T1MA 1RURL 4N5UA 5HGBA 4JM2C 4N0CA 3I9GH 1F3DH 2CLVB 3HNSL 1T6VN 1YC8A 43CAB 3FOLB 3BEWA 4OFDA 2W0KA 4YDKL 1K5NB 1KC5H 2C3VB 4JQVA 3BW9A 5F6IC 1OAKH 4G8GE 4RGNE 1FVDB 1MCSA 3E6FA 4XX1G 3IXAA 1ZHKB 4P5KA 4KTDH 2Q7YA 3DHMA 1IRAY 4LIQE 2Y9RT 3ZDXE 2Z35A 3TVMA 3MJ9H 4PJXF 3WIHA 5I0DA 4LCWE 3QO0A 4HWUA 3SY0A 5GRJL 5JOPD 1K6QH 3H8NA 3PHQA 3KYMA 4GUPA 2R4SH 8FABA 4KV5F 4LCYB 4F7CA 3MLZH 3V4VL 5IHZB 1I1AA 4NP4L 3OKMB 4JFDA 3O2DH 2FECI 1NAMB 4O9HL 4OLUH 1U8QA 3U9PH 4XXCA 2PETA 3ULUL 3VGBA 3SE3C 3GJFA 5D7JD 3C2SA 4OZHB 3BN3B 3E2HC 2AEWA 4JHWL 3FQXA 1XFPA 2RB8A 3GSNL 4D0CA 5I2IB 4NRYA 3VXUE 4ONHB 1MNUH 4NO2A 4DW2H 3RRQA 4UIKL 3TBSA 1KULA 4YHZH 3VFOB 4X8JA 4WUKH 4M93C 3GSRA 1MHCB 4Z7NF 1AC6A 2WP3T 3IAQA 3KDMB 1DTUA 5KZCB 4KKNA 3THMH 5FDWB 4C4KT 4FNLL 5ISZB 4OZGB 5D6CB 3MV8D 5DJAB 5BZWA 3TIDA 3UYRH 2RBLA 4AIZB 2VLJD 3SJVB 4GAGL 3FQRA 4NQSA 2O61B 1YNLL 3NPZB 5EU6A 3DYOA 4XP4L 4FQXB 5FCUL 2GKIA 5B8CA 3SKMA 5C0RL 5JW4M 2IQ9L 2L7JA 5CJQL 3W39A 2YD8A 1ZHNA 4IOSD 1C5DA 4LCCB 5JXEA 1U6AH 3O41B 5MEND 4LLWA 1HHKB 3X11B 3STZB 2JB5H 1T1YB 4NHCH 4GSDL 5SWQB 2FD6H 2FDBP 3HE7A 4PJXA 1TJHL 3QZWA 4F15B 5J11C 4YUEL 4QOKA 1G7JB 1YEEL 4QHKJ 1O7VA 1VACB 1T83C 3RJDA 4X83A 5EZOL 2DQFB 3WDJA 1F3DJ 5BQ7A 1SM3H 3V7AG 4XWGL 2EXWD 1EMTL 1U8OA 1A7OL 1LHZA 1R3IL 5HI5C 2NXYC 3FO9A 2CKNA 1DQJB 3KVQA 3SE9H 1I9JL 3DGCR 1YN6A 3RGVA 3VG9C 1SYSB 2A6DA 1VGKA 1ITBB 2BX5A 3JWDL 3VXSB 1AD9A 5ICZB 3DIFB 3S9DB 4PLKC 3KYKL 4IRZH 4DKAA 3BZEA 5IVZA 2CQVA 3TT1H 3RWEB 4QHUB 3H9SE 1N5YL 4MCZB 4G6KH 4GXVH 1P7QA 1NGWA 3FFCE 3L1OH 3VA6A 3OF6A 4KRPD 1S9VB 1I1AD 3QI9C 3U46A 4N9GA 4I9WD 3CXDH 2Y4SA 5BXFB 1SEQH 2ARWA 4JDZA 1IGTB 4EVNA 4IMLB 1IKNA 3VE0B 1J0HA 2NY4B 2OK0H 3KPMB 1D5IH 3TWCH 4JANA 1A7QH 1LP9F 2YPLB 5CJBA 5DI8A 3PQYA 1A3LH 3ZL4L 4K07A 1D9KC 4DTGH 3X12A 1HYSC 2J3SA 3RWJB 1YEGH 3EUUA 2IMNA 4XBGB 3ARWA 1HH6B 3D3VA 5IHUL 4WHDA 3NCCB 4HMEA 5TDNB 4Q0XH 2ZUVA 3ZKXC 2CSPA 3PE9A 4WW1B 1PYWB 5EOCH 2H2SD 1U58B 5DMKA 5CZVH 3OKOA 1IQDA 4KJPD 4XPBH 3TYGL 4DN4H 1CDHA 4QLRA 3LS4L 4QO1A 1AO7E 4F57H 4I4WA 3FN9A 5EU6D 3TT3L 1WBZA 1TZIA 3FO2B 2I9TB 2NY1C 1MJUL 1G7LB 5LWYL 4N5EA 3WSQL 2D4DA 4HZLA 5JXED 3BOVA 9CGTA 2F19L 3PGFH 3QG6B 5E2TL 5KN5B 1FNGA 1JGDB 2XA3A 4KJWC 1MUJB 2AV7B 1EEYA 1WICA 2VOTA 3MA9H 5J57B 4Z7UE 5F21B 4XVUC 3PL6B 5DD6A 3HZMB 3LAFA 1YEIL 4AT6B 1FL6B 3VXOA 3D69B 1C8PA 3ARVA 3U6RB 5C2BL 1OPGH 4PRID 3MZTA 4WFEE 4WWID 4GAJL 5FDYA 1H8NA 1N5AB 4PJFF 3MLWH 4JN2B 4IDLA 2QV2A 1U8LB 1WWWX 1C16B 3RGVD 1JGLL 1LP9A 1E4KC 3N1GC 3ALXA 4XMPH 2D0GA 3QQ3B 2Y7QA 3BAEH 1J18A 3MA7B 3QDGA 3QEQD 1HNGA 3WNMA 1HINH 2AQ1A 1I7RB 1GAFH 2ARJA 4N0UB 1O0VA 2H41A 1P7QD 1FFPA 1AHWB 2V9RA 1BWMA 2MQ3A 5BV7L 2JLLA 2IBBA 3EIFA 3MGTA 1VADA 1ULVA 4ODVH 3TGXA 3MLSL 1RU9L 5DVLA 3WUZA 2MSPA 4B0MM 4TTDC 3OJ2C 2X4UB 1RZ8A 1M05B 3FQUA 2EZ0C 4J23A 4K55A 4MD4B 3SDYL 1RFDL 4NUGL 4JFFB 3MGOB 4X8XA 2LTQC 1I4FA 5IQ9B 4QRRB 4ZO8A 4RGMB 2BDNH 1YEHH 1QKZH 2W0PA 4ISVB 1L9MA 3V6OA 5IMKB 4KRLB 2N7BA 2AJXH 2DWEA 5C0CB 2OYPA 3VH8A 4H26A 5KSAB 3NCEB 5F1OB 5EOCJ 1MFCH 2CD0A 4LLMB 4LPXA 1P1ZA 2X4OA 1XF4A 4ZODA 2PUQT 2UVEA 3TV3H 3L3KA 4WI6A 1XGQA 3IYLW 5ITBH 3BDXA 4FQPA 3QCUL 4YLQT 4N5ED 3GI8H 5B21A 1RZGA 2BSTA 3O3EA 4LLYA 3KNBB 4KROB 5F44A 1JPGA 1NLDH 2HMIC 2NY5L 3DRQB 5DRNB 5GZND 2IAMC 3BKCH 5H37G 1RZ7H 2VXUL 1KB5B 5LGHH 4G8FB 2WSKA 1A6ZA 1B2WH 4FZ8H 3BZFA 4NQUA 4HDIA 3NH7H 4JM2A 4K2UL 2Z0BA 4MXQC 1ZVYA 5IVXA 1KIRB 2XN9B 5D7KE 2I5YH 3GGWB 2X70B 2AJSL 4EDWL 2KDGA 3C5ZB 4V1DB 1JYWA 5TH2B 3U0TB 4NNXB 3F7PC 4KZDL 4ZXBB 1KN4H 1FFNB 1YY9C 2AK4E 5HD8D 3D2UB 4XP9H 1CDUA 5I8EB 5ANMA 5AG8A 3PP4L 2XICA 5J3HC 3PHSA 3QO1A 1HQ4B 1OTSC 3HMWL 4QTHB 4AH2A 3SGKC 5FO9A 3W11C 2FX8H 1DANU 5HHPB 4XHJD 4ZFOB 1T7YA 4JPVL 2DYPA 3KYOB 2YSSB 4HGMA 4MAUL 3C87A 4OB5H 4M03A 5EC1A 4MDIB 4O5LL 1TNMA 3INUL 4YDJB 4J3OC 3BKMH 3GDBA 3GSXA 2BSSA 5D5MB 4U2YA 4ZAKC 1K4DB 3ES6A 4EI5A 2Q87A 5E8NA 3SE3A 3ZYOA 5I1IL 1KNOB 3IU3B 2XXCB 2VWEE 4K3DH 4UT6H 3WHXA 3E2HA 1JYXA 3CDGB 4I77L 4HUUB 5JZ7C 2P5EB 2VXSH 3C5SA 4H8WH 4U7SA 5GSVB 5HSFA 3G9VA 1TMCA 1S5HB 1XCQB 2P8PA 1AGDA 3JV4A 3EO0B 4HT1L 3UEZA 2NLJA 2APTA 4MSWA 1RJYB 3K4DA 4XVSH 3QAZB 2Y1VA 2CK2A 2R0WH 3V52L 4OQTL 3X13B 4F8TA 1T2XA 5HI3C 1A4JA 1I7UB 3F7YB 2I60H 4OFKA 3O11B 2HTKC 1IT9L 3T77A 1SMOA 1ZS8A 3TH3T 3L7FB 2GCYB 5DD3H 4A2MA 2FZ3A 1HSAB 4NDMB 4RBPH 4O4YH 1AKJB 1UZ6F 3QQNA 5DS8A 1QFHA 4YE4L 3BZ4A 2B4CL 2ITDB 4JRYE 1GZPB 3HRZB 3ZDXF 1WEJH 3U2SB 5E6IB 4KVNL 2XZQL 1EHLH 4PJIB 3FAWA 1FE8L 3WNPA 3SDCB 4DK6A 4R4BB 4L1HA 1PAMA 5F7NC 2X6MA 4YEEA 3RPKA 1GRWA 3LOWA 5ID0B 4WW2C 5HDQH 3MJ7B 3TJHC 5FHBH 2R23A 1UEMA 1BLNB 2NY6B 1RIVL 3GZKA 5EWIL 3VXMA 1NSNL 3X3GL 4BK5A 4WIQA 4HUXA 1OQOA 3SDAC 2CIIA 3VXPB 4KAQH 2OR8A 3OMZA 4HC1A 5CMAB 3MSPA 3TIEA 5IM7A 1EA9C 3EFDH 3TYFB 2XA8L 4JHZA 3HR5A 1WLHA 1T4KB 2Q86A 2YRPA 2VAAA 2GEEA 3WFZA 4J12A 2WWMC 2NX5A 2VITB 2ITCA 1SJVA 4DWHA 1HXYA 4XX1E 3I3BA 4WFFD 1XIWC 4NN7C 2APVA 2AJYL 1NL0L 1EHNA 4O2CA 2DYPD 4PGDB 2R1WB 3NPSC 2Y5TA 4YX2H 3GEWB 2C1PA 4NOFA 5CD3B 3QI9A 3WFEH 3LMJL 4EIGB 4G8GA 5J06A 3TCLB 1MLBB 1U0QA 4OM1H 2KUTA 5EZIH 5EBMA 1H3VA 2XWJA 3QHFL 3M07A 1UVQA 5E1AB 4FFZH 3RU8L 5EO9A 2DQHL 4LCWA 4U0QB 4JRXE 4WCYL 2YK1H 5GZOC 1AI1H 2FECL 2C26A 1D9KA 1S7UA 4F9PC 4JFQB 3PWLB 2EKSB 4NQXA 4PJ9C 5D70H 1KN2H 1CS6A 3GIVB 3QNYB 4PGZA 3OKLB 5D7SL 2FR4B 3O6LH 1VENA 4XVJH 4F2MB 2KQMA 4L8SB 1F3JB 2VWEC 3VXUA 5KVMC 4PGBA 1L7TL 2BHZA 3O3AA 4EBQL 1KJMB 2BNRE 2VDLL 4U6VH 4ZD3L 1TVBB 4PJ7E 1ZA6B 3FQNB 2P47B 1FL5A 1Z0NA 3QR2A 4GRWF 4LMQE 5F97E 3ZHLA 5KG9B 3GMOA 4K8RL 4M1GH 3TBVB 3MUHL 3ESUF 3H3PH 4PJGB 3CSYB 1KTKE 2XWBB 5EZLB 4G59A 3IDGA 4IHOA 4H0IA 5CIPB 4LSPL 4FQ2H 4FFEX 1E4WH 3GMRA 3HLAB 1Q72H 5D9SA 3K2MC 4JY6B 2ESVB 4R6UA 1MFEL 3OZ9H 1CICB 1I1YA 2ZOKA 2AP2A 5ITFB 1U8MA 2C3XA 3OPZH 4L5FH 3V2AR 4JM4L 4U1MB 5HI5D 2NXYD 5FM4A 5A16A 1N2RA 1V7ML 3C6SA 3HZYA 5EU4B 2EDHA 3V7AE 2EDEA 3T65A 1E4KA 4XNMB 1QLEH 1N64H 4PJAB 3MRDA 3Q2CA 1QA9A 1V05A 4MJ6B 1ZV5A 2R29H 1BJMA 3G5XB 1BIIB 4QRUB 2JJWA 4OLXH 5CJOL 3L3DA 3HPJA 4LP4A 4YK4C 4FABH 4DAGL 4N0FA 1P4BL 1JWUB 1KCVH 3A67H 1U8NA 2VL5B 5HY9B 3QI9D 4X98B 1HKLH 4G8GD 4RNRA 5C92A 5IB3B 5L7XH 1ZVHA 4UIMA 3HI6H 2BJMH 5BW7C 1R5WB 4R3SB 2EDRA 2GUOA 5BS0B 2BHYA 2EO1A 3ZDZE 3RWFA 5IKCA 1EXUB 4MNGB 2DLEA 3H9SA 4Z7UF 1QNZL 1ZOXA 3M8OL 3L3GB 4LLQA 1D9KD 4G6ML 2CKBA 3FFCA 4QHNA 1HYSD 1TCRA 3VGDA 1MPAL 4ZO7A 3OAYK 2EDFA 3BJLA 4R7NA 4JZOA 1UM6H 3EO9L 4NUJA 4H0GA 5I66A 5IIEA 2LV4A 5L8LB 4KUZL 3JXAA 3GK8L 1JTTA 3TPUB 1H3UA 4ETYA 3VXUD 1NCBL 3CH8A 5E8DH 4D9LL 5IJVB 4M02A 2NY1D 3O4LA 1JUFA 3GKZA 2ZJSL 2AJUH 2YN3A 4WWKA 2HG5A 3LRGA 4XCYA 4YXLH 1INQB 4BH7A 3LQAH 1MREL 2IAMA 2G60L 2WMPA 4MAYB 1R5VA 4YHIB 5DURB 2BVQA 5JMRA 2V5YA 1BFOA 1F11A 1JV5B 4KJWD 5CUSL 3QQ4A 3OAZH 1BQLL 5IB4B 1AO7A 3S8WA 5DEGA 5EIQA 1DVFC 5GRXG 5TE7H 1NMBH 4NZJA 1FC2D 1G9NL 1SQ2N 3KGRA 4JO3H 1KV3A 4FQIL 4JAMB 4KPHH 3L6FB 3L3JB 4KDVA 3V0WH 2OJEB 1AD0B 4Q7DA 2NY5C 1LQVA 3GMMA 2NTFB 4GAYB 3CFBA 2Q76B 1D5ZB 4PTTA 5ADOH 2CDGA 3CSGA 3O3DB 4FRWA 5HPOA 4PB0H 4Z7UA 3SGKA 2LQRA 4OTXH 4XCEB 4LHQB 3P30L 4WW2F 2H26A 2EYTA 3AGVA 1GIGL 1F3RB 3BE1H 1CFSB 1XGUA 1QEWB 4D8PB 3TBTA 3W82A 3HS0B 3JTTA 4X7TB 3K1DA 3X14A 1CD0A 4I3SH 3ZKNC 3VD7A 1PFCA 1WCQA 1X5HA 2VABA 3S5LB 3DTXA 4MJIE 5EU5B 2XTJB 1YYMH 4FZEH 2ERJB 4TTDD 3S36X 1H3WM 5GGTL 2CDEA 2M26A 4U0RC 2EZ0D 4WI4A 5D4QA 3A0OA 4XBEH 1QSFB 1RZIB 5J13C 1B6UA 1KSRA 1IEAB 4OLYH 4N0YH 5F89B 5KAQG 1S8DA 4UILL 3H9SD 1IILE 3VFMB 1LE5A 3GI9H 3HHRB 3VGAB 4DGIH 2E7HA 4TOYH 1JF6A 3CFDB 1ZT4A 3FFCD 4LPCA 2CO6B 3ZE0E 4G42A 5M7QA 3DO3A 5CINH 2IBGA 5BMFH 4CVXB 3UJTH 1E27B 1HIML 5CZKA 3MRHA 3GSNA 4MWFB 2FX9H 3BDYH 3K4AA 5DJ6A 4G6AC 2HLAB 1JZ4A 3MRRA 3QJFB 1RMFL 2A83B 2QQNH 3ZSTA 3PWVA 4LSRH 5E08H 1N59B 3OBAA 1T1XB 4LRIC 1MWAL 3W2DL 2OL3B 5A3IC 3AM8C 4TNVF 4AYFA 1T04B 4YXKH 4G6FB 4O58L 2Y36H 4KUCF 3O4LD 1D5MA 1F4XL 3LEVL 5EU3A 3EJYC 5F7YC 2J4WH 5DJDA 1RUMH 4JR9H 2IAMD 4CMMB 4WW2A 1NCCL 2R0LL 4OCYL 3TJHA 2E5EA 1KB9K 2ZSVA 4RAUA 5HHOE 5MEQA 2P8LA 2B0SH 5FYJU 3HFMH 1FZJB 3C6LC 4DVRH 3P4NA 5EOTB 4MXQD 3L5JA 4Q2ZA 4QXGL 3SDAA 4HKZA 1JHTA 3HB3C 1NPUA 2VDKH 3VXNA 5C0DB 5K9OB 4JHAL 4S0SD 1I9RL 3DUSB 1YY9D 5JA8B 3MRKB 2A74A 1JHLH 5SX5H 5I76A 2Y06H 5J3HD 4S10A 3F12B 5L8KB 4I2XE 1OTSD 2FBOJ 3W11D 1MLCA 4JEGB 2A73A 5GISL 5DJXB 1U91A 2FX7H 1G7QA 5CEZL 3VD9A 3RBGA 4F7MA 4RFOL 3BPNB 3MV7B 3OAUH 5F7UA 1MJJB 4Z5RA 2QADB 2VTFA 1AXSA 3P0VH 4TSBH 3WNNA 5HGAB 3T0EE 1JZ3A 4GKZB 1A6WH 1ZVSB 2AK4A 4OFPA 4ZAKD 2HRPH 1DANT 4YDIL 5INCA 2SEBA 3VA2C 3VGGA 1J9CT 2HVJB 3EDKA 3G04A 3LV3B 5JZ7D 4LCCC 3KPPB 3SBWA 3MJ8B 2EE9A 5IFHH 4ZUVA 4F9PA 4M43L 5DR5H 1Z9MA 4DZ8B 4F8QA 1HEZA 4Y16B 4ZTOH 4OGXL 1G6RB 4C58B 4OZFH 1KLUA 3QUZD 4OCWH 3U4EA 5DUPL 3UBXB 5DD5H 1GPOL 5HI3D 1QO3B 4QRPE 5I1KH 5IG7B 3RAJL 2HTKD 2PXYB 4LHUG 4F7TA 4JFYB 4QRQB 1E6OL 4NZUL 2Z4QB 1W72H 3EYVB 32C2A 4M3KB 4ESKA 5KS9B 4J8RB 1C1EL 4NFBA 3G6AA 4RMTA 4K3JH 5CBAA 3NGBC 4HKBB 1OL0A 3PV6A 5MHSE 4UNTA 4H1LG 2VDQH 1PG7H 4MXWH 3NCFB 3EFFA 3EYUH 4H5SA 4FN0A 3SGDI 5F6HI 4GRLB 3TJHD 3LPFA 1T80A 4PRPE 4JRYA 4MDJA 4G9DB 5E1HB 3HA0A 4PJ8B 4UNVA 5CLWA 1B90A 4FQJH 5F88B 1FDLH 3QULA 1CYGA 5LGJB 1FVEA 3O6MH 4JREB 4JZNB 1PLGL 6FABL 4ODHL 4I18A 4K8RC 4Q97A 4M61B 1OTTD 1V7NL 4X4YA 5I71B 4RQQA 1T7VA 3KJ6L 2ICCA 3DPBA 4LEXL 1Y18B 3CK0H 4K3EL 2WWMD 1Q9LA 2WZPD 3BPOC 3B9KB 4AY0A 4UTBH 5GGRY 4RISL 1J8HB 1XIWD 4YBQC 4JO1L 5D7KD 3MRNB 7FABH 1FIEA 4W6WB 3GKWH 1R3HB 3W0WB 2NY0C 1Q9WB 1I8LC 1YMME 2CUHA 4L8BA 4PV8A 4BH8B 2J6EH 1IAOA 2I07A 4PJ7F 4JCLA 2XQYK 5D1XC 1A6VL 4UQ2B 3M17A 5BW7A 1XAUA 4Y1AB 1D5XB 1Q0YH 4FQ1H 1MF2L 3TLRA 3GJFH 5CGYC 4F58H 3G08A 3U30B 3AS2A 4YHKL 1CIUA 3HTLX 4YHOL 1ADQH 4KUCD 5GZOD 4PJ9D 3RL2B 3RA7L 5IT2L 1DL7H 3OJDB 4OLVH 5DUBB 5IEHA 3IJYA 3Q48A 4X4XA 4HIHB 5IROC 1VFUA 1T20B 1EFXA 1Z5LA 4HF5H 4XNYL 5D8JH 5JIKA 4PJCB 4DOHE 3FO0H 1C5CL 5MP6H 2X4QA 3QNXA 2IH1A 5MEPA 1W8OA 2R2HB 2MTPA 3WNOA 1P2CB 4P9HL 1IGFL 1UH2A 1CFQB 4XP5H 1YPZB 3MYJA 4ZUTB 4AJ0A 1KPRA 3QRFM 4IDJL 4JZJA 1LDSA 1RAMA 4ZQKB 1RUPL 5F7DA 3VFGH 1UJ3A 2IH3B 1Q94A 2YPKB 4LKCB 5C07E 5I19L 4KQ4L 4P23C 1EFQA 3S37L 1X6LA 3MRMA 1G0DA 4NPYA 4YDLC 3V4PL 4IIQB 4H25A 2KL6A 1EHXA 2DQGH 3JZ7A 4K7FA 2X4NB 2XKNA 5HGHB 1AHWC 5KSBE 4KHXL 4HAGA 1JF1A 1O5DT 4MX7A 4JRYD 4KHTH 1MIML 4ZOCA 3WIIL 4NNPH 5D2NE 4D2NA 4PJ7A 3RWCA 1KJVA 4DGYL 3DARA 3ZDZF 1TFHA 4BQ9A 3ROOA 3QEGH 1WIOA 4LNRA 5IMLA 1KTDB 4ELKB 4M7LT 4QRTA 1YEJL 4NJAL 4TUOB 5T1LA 1HK6A 4JO4L 1CIDA 3KPNA 5TFSH 3CZFB 4RMUA 5CEZE 3HCVA 1CFVH 4MNHB 3OKDA 3MNVB 4LVNB 3WO4B 4BZ1H 5IB2B 5HVHB 5ID1B 5JDJA 3IDJB 3QJHB 3GNMH 1RZFL 1A3QA 2VLRE 2GK0A 1DQLH 5IBTH 4EZMA 1FYTB 3DGGA 4X9BA 2FO1A 2EC8A 5DHVH 1MAMH 3I2CL 1UADC 5AZEH 3WD5L 2JJTA 3Q6FA 4MQ7A 5D7IB 4Z0BL 1IGIL 5CD5C 1VEMA 3C8KA 4BSVB 3IT8D 1XCTA 1KCSH 1W0WB 5L2JB 3AUVA 1YJDH 3ARTA 4HFUH 2PTVA 4UZGA 2ED7A 1TETH 4F9LC 5BVPH 1P4LB 3FOMA 3DSFH 1R3KA 3OKEB 3UJIH 2DL2A 5HYIA 5HXMA 1G7MA 4GMSH 4M1DL 4OZGF 3IFOB 1JPFA 2ZNXA 3QHZH 1ZSDA 3WS3B 4P5TC 1KJ2L 3NOIA 3F8UB 2FL5A 1WFOA 3VFSA 2XZCH 3LKRA 2O5ZL 3AM8A 4ODTH 1BVKA 4P46B 3RL1B 1T0PB 3RIFF 3TO4B 1U8KB 4OQTA 4NCC2 3L9RB 3GJEB 1B0RB 3ULSA 15C8H 2M8XA 4YHNA 3E8UL 1YYLL 1NC2A 4DFHA 3DURA 5TJWK 4PUBL 1MFNA 3C6LA 1EJOH 1XF5B 4RRPG 2H32B 3OQ3B 1DVFD 2V7NB 1G1YA 4GRMA 3STLA 1CFBA 5KVFL 2OP4L 3O2VL 2NR6D 2F54B 1ND0B 4XH2B 1CLOH 3CCHB 3C08L 4F33A 3CLFH 4L4VE 4LLDB 2CIKB 5FGCE 5HGGS 1OAQH 5EO1B 1P6FA 4NKMB 4YWGH 5KJRL 4LCUA 3ZE0F 4ZPTB 4PGJA 5T1LD 2I9LB 1NLBH 3CXHK 3BN9C 1SJEA 3RHWF 2EEAA 5EUOB 3AMLA 2JTDA 4B5EA 2B1AL 2DQUL 3NA9L 4NRZB 5F9OL 1DQML 2HFEB 1DN0A 4HBQA 1WCBA 2DBLH 5D2NC 4Z7WB 3N1PC 4XWOC 2UZXB 1T03H 5DJYB 3ZKND 5E03A 2IADA 3WFHB 1IQWH 3SDXB 4NKOB 1QPPA 1Y0LB 2EO9A 3BPLB 1IKFH 1AQDB 2DMKA 5C0FB 2DD8L 4ZFGL 5DUMH 3TZVB 1DE4B 4UDUA 3FTGB 2V5RA 1CZ8L 3QNZA 2PR4H 3QIUA 5C0AD 3AU1B 3KLDA 5L2KD 3MBEA 5KANG 5H37H 3NZ8A 2EH7L 1X4XA 4FXKA 5JORB 2FJHB 3BGMA 3KHOA 3MFGB 3REWA 4Q6YA 4BELD 3QYCA 4MJIA 4Z78A 5K9KB 3I6GB 4Y2DB 4Q9RH 3SOBL 1U8JB 1UWXH 2CDFB 2WUCH 2QR0A 1CDCA 2VLKB 4P2OC 4XNXL 4G6AD 5MI0C 3JUYA 2IJ0C 4ZUUA 4MYWB 4X6FB 1Z0MA 2M1KA 3VRJB 3KWWA 5CKAA 3GMPB 2J88H 5A3ID 1GOFA 1T6WA 3LDBB 5HGDB 4IJ3C 3RWIA 5FV1L 4AQOA 4PRNB 4YIQB 2O93L 1V3KA 1ZT1A 3E0GA 4POZC 2EYSB 4HGKC 1IC4H 4Z7QE 5E70A 4PRAA 2IANE 5BVJA 2UUDH 4Z8FH 1NC2D 3GHEH 3W9EB 5I15H 5C3TA 1TQBB 3TNNB 1A0QL 4CAGA 5E8OB 4XCCH 1IGJB 1RZKL 4I5BB 1KJ3L 4M7JH 1GGUA 3C6LD 3QCTL 1CFNA 2GTWA 1NKRA 1HQRB 1FN4A 1JMXA 2OZ4L 1JTOA 1RZJC 5EPMA 4HSQA 3HB3D 4GQ9H 4A6YL 1QFUL 3S96A 3S35L 4KMLB 3NFSH 4RZCB 2DM7A 1AGBA 5SWSB 1YUHB 4HS3B 2HT4C 2YBRA 4KKAC 1PX3A 2AXFA 3MUY1 4Y5YC 5FUZL 3IS1X 4Z0XB 5HHOA 4NQCE 3QCVH 3BPCA 4O2FA 2R1XA 3SGEI 1SJXA 1GVIA 3CX5J 2X4TB 3RY5A 4D94A 1U9KA 3UROR 1BX2A 3NVQA 4XCFH 4RCAA 3LVEA 4PJ5E 5IESL 1I8LA 2HVKA 2Z93A 4AIXA 2EYRA 4N0RA 3SJVD 3EW3B 5C6TL 2JIXA 4MA3A 5CKGA 2DF3A 5D1XA 3U0WH 4PD4K 4GBXA 1U3ZA 4E5XB 3SCMB 2ADGA 5IEKB 5GGVL 1YN7B 1SVZA 1IGYA 4I2XA 5I9QC 3MRLA 3P77B 4M6NL 5TE6L 1PD6A 1BZQK 1F58L 2GFBA 4G7YL 3BQUC 5T3ZD 3VDBA 4IM8A 2AXGB 2AGJL 1U8PA 4XAWH 4QYOB 2ZPKH 4KI1A 5IROA 1EZVX 2FB4L 3T0EA 4AM0B 5B38B 3RZCC 2BP3A 3MRFA 1N8ZA 2H9GA 4AEHL 1ZHLB 1A64A 4QTIH 5DC9B 3WN5C 3MLRL 4UV7H 1B6DA 1X5LA 4U1GC 1UKTA 4NO0A 4TVPH 4O02L 5L8JB 5EC2B 4NSKA 4GG6B 5EULV 4LASH 4I0PC 4M5YL 1TTFA 4S0TD 4OIIL 5FIEA 4HKXA 4JFZH 2YUVA 4FQLH 2UZIL 2EICA 1BQHB 2VH5H 1D6EA 4YHPA 5CBEA 4NN5C 4P23A 2NZIA 4QRPA 4X80H 5C0GA 3T0XA 3QWOA 1GGBL 4KVCL 5D7JB 1CQYA 4DN3L 3L5WB 1MRFL 2X4SA 2DQCL 1NC4A 3BMWA 3WDIA 3ULVC 3V5DA 1S7VB 3CVHB 4KI5E 1OF2A 3L95A 3G5ZB 1CDBA 2NY2C 3LKNA 5I8CB 3OB0H 2YKLH 4LDLB 1AY1H 1P4IH 3H9YA 5ALBH 4CN6A 3T0VA 4QEGA 4OGZA 2ZUSA 4W4NA 5ESAA 3N9GL 2V5SA 1TIUA 4OKVB 1X5JA 1QSVA 3VFPB 3MV8B 4K8RD 1J1OL 2COQA 4WFHE 1QHPA 2GSIB 2W38A 4G6JH 4D0DB 4N68A 2AV1A 3KYAA 5CP3A 3VW3H 2YPLD 1JI2A 1HSBA 1JJUA 25C8L 2IPTL 3R1GH 2A9NL 3I3DA 3PJSA 4PRPA 3RTQC 2ZCLL 1PZ5A 5CLTA 2W9DH 3A6CH 4LLVA 3RWGA 3JV6A 3LEYL 1FZKA 2NW3B 4YBQD 5HJ3B 2R39A 2LFGA 2QHRH 5MENB 3NCYS 2NY0D 4CNIA 5DEZA 1LD9A 2W1NA 2XI9A 4PB9H 2CXKA 4JB9L 3NZHL 5JDSA 1R24A 2JIXD 3UYPA 1FAIL 3H42H 4FMFA 5D1XD 3NCJL 1S9WB 2JB6A 5TE4H 2ZOLA 2FATH 4QHKI 3WLBA 1NCCH 3ZT5A 3PIQA 1KIQB 2M2DA 4H0HB 3G5YB 1G7PA 5CGYD 3D25A 2B20A 2ZUXA 5T1MB 3OX8A 2XV6B 4MZ2A 5HGBB 1FNFA 5DGQA 2PYFA 1H3XA 2B5IB 1BWWA 4UUJA 4YFLI 5A2JH 3BEWB 4L9LC 4R4FH 1CCZA 5FECB 1YMMA 3PXJA 1M71A 3BW9B 1DLFH 4JFPA 1KLGA 4YAQA 2BCKA 4P5TA 3E6FB 5GGTA 5C08E 5F1KC 3IXAB 1DFBL 5EDXA 4LRNL 1NANH 4LQ1A 1R3LA 4P5KB 2Q7YB 2DRUA 4U1SA 3P0YL 3NABH 3UJJL 1OHQA 4WU5A 5TF1L 2Z35B 3TVMB 5FYKD 4LVHB 4RX4D 5JXAL 3QO0B 4XT1C 1T2QH 1BEYH 3SY0B 1FGVH 4PGCA 3EOYG 2OTUA 3PHQB 3KYMB 4GUPB 4KRPB 8FABB 3D39E 1BZ7A 4F7CB 1I1AB 4LARH 4DZBA 4JFDB 1NGZA 4ODUA 1U8QB 4QWWC 4X9HA 4P23D 1A1OA 1CU4H 3LD8B 3GJFB 2LVCA 4UT7H 4UMGA 1NC4D 5I1EH 3FQXB 4M48H 2JK5A 4D0CB 4NRYB 1MWAA 2VDPH 2HFGH 4NO2B 4OCXH 4RWHA 3TBSB 2R1YA 3D9AH 4X8JB 4X0KA 2ZNWA 3FT3A 3GSRB 3WO3B 1FL3A 4K71C 1WQVT 2D03L 5MHSD 4HEPG 4HUKB 5F3BB 3BT2H 5BZWB 3TIDB 2AK1H 2H1PH 1YEDA 3LS5L 3FQRB 4QRRD 4S2SA 4NQSB 2CUIA 3AROA 3MUJA 3BMVA 1G9MC 5EU6B 5B8CB 4PRPD 3SKMB 5KSBA 3CFIC 4WTZG 5D2NA 4WEBL 4J3UA 4PJBE 3W39B 1ZHNB 3BDBA 1C5DB 2P8MA 3V8CA 2V6HA 4LLWB 1PEWA 4U6XA 4V3DB 1A7PL 1QUNA 2OBGA 2W65A 3HE7B 4KTYA 4PJXB 3QZWB 3JBG7 3IFNH 3T4AA 3PWPE 5CD5D 4TPRH 4QOKB 5DDHA 5GS0L 1RJZA 1BVZA 1F8TH 2PTUA 5K93A 5BQ7B 2DQDH 1L0YA 1BF8A 4GRWH 1U8OB 2DQTH 3GSOA 2VLRA 2ARJQ 2K7QA 3SE8L 3FO9B 3L5XH 5ESVA 2PN5A 3WXWH 1YMMD 1QYGL 1YN6B 3RGVB 1BJ8A 1FC1A 2A6DB 4Y5XC 1F2XK 1VGKB 3RWHA 5EA0H 5I1AA 3QG7L 1QBML 4P2OA 4P5TD 3QRGL 1DP0A 1AD9B 2QSVA 2FBJL 3C5ZD 5FUOH 2ICEA 3VRIB 3B9AA 4J3VA 3BZEB 5IVZB 5CILH 3B8SA 1ORSA 2GIYA 1MEXL 2FHCA 2QQQA 1NCDL 1P7QB 4KZEH 3REVA 5E2VH 1QZ1A 3WFBH 1NGWB 2IG2L 4H88L 1DBBH 5FM8A 2ORBH 5T1DH 3D85A 1WZ1L 4ODWA 4QT5A 4C59B 4PJGF 3U46B 4N9GB 3HG1E 4JDZB 2WINA 4EVNB 1JCKA 3MMEA 1YNKH 2WP3O 3BPNC 1YNTA 3C9NA 4JANB 4TRPL 1QBLH 1PQZA 3LKQA 2DLFL 2DIJA 4C4KO 5I6XC 4KGLA 5DI8B 3PQYB 4Y4FC 4CVWA 3HC3H 3X12B 3LIZL 4RMQA 4HS8H 3Q1SL 2DIAA 2VRAA 3VCLA 5JW3L 1OGTA 1MIEL 3D3VB 3MQIA 4GLRH 2OMBA 5L6YL 3CVIH 1LDPH 4C56E 4WVRA 4Y5YA 1B0GA 1JK8A 3QUML 3BFOA 2NMSA 3I50L 4E0RA 5L0QB 5T5FL 1DQTA 2P46B 2V5MA 5DMKB 5AYUL 1RZKC 1REIA 2LABA 3OKOB 1IQDB 4GJTB 4XMKH 4I4WB 3ULVF 3MBXL 5E6YA 4RA3A 3H0TA 2FWOA 1WBZB 1TZIB 4JVUA 1XH3A 1TZGH 1E4JA 4YC2C 3K3QA 4CVZA 1A9EA 4TSAL 4HZLB 3T2NH 4L4VA 2DI7A 4WI9A 1INDL 2XFXB 5C2UB 1AKJD 5FO7A 1FNGB 4BSJA 5ILTH 1F13A 1EEYB 1J12A 3CFJA 4Z7QF 3BQUA 5DD6B 5E6ID 2V17L 3LB6C 4M7LL 3PV7A 3VDAA 5CEZD 2HLFC 1T1ZA 3VXOB 3IDUA 3OXRA 2HN7A 3O9WC 1AXTH 3RZCA 5L88L 1L6XA 3ARBC 4HBCH 3EOTL 3QFJE 2VLRD 1JWMA 2BOCA 1D5BA 4HQQL 3WN5A 4M7ZB 5I1GL 4TUKL 4YHYB 5ETUB 4ODSH 3NAAH 1FJ1A 1IGCL 1LP9B 1NFIA 1Z3GL 3BJ91 5B22A 4WUUE 1TDQA 5JIIA 4P2OD 2Y7QB 3DX8A 4I0PA 1RIHL 3QDGB 1F00I 1VDGA 4X6EA 1PEZA 2VE6A 2ARJB 1BOYA 3BD5A 4JJHA 3RP1A 4MS8C 3UC0L 2NY7H 1RUKH 2YD7A 3KR3H 4GMTL 1FFPB 1MRCH 1QRKA 3O0RL 4Z7OE 1EO7A 3MGTB 1VADB 4POZD 3D85D 4XNZB 3HZVA 3DROA 4LSTH 3JVGC 3B43A 2X10A 1C7SA 4AQ1B 1RZ8B 3FQUB 1Q38A 1AIFA 5GJSL 4CMHC 1K4CA 3WFDL 1SYVA 5IBLC 1I4FB 1CL7I 3FO1A 4WI3A 3Q6GH 4JHBA 5JHLL 4NWUH 1HHGA 4B50A 1A6AA 1W0VA 4M7KH 4R96A 4C54A 1EAPA 2OR9L 2DWEB 4HXAH 4M1DH 1JVKA 2IANA 4XXDA 2HT4D 3VH8B 4H26B 1G9EA 2VISA 5FGRA 3RTQA 1EGJH 4UINL 1FO0H 3GHBL 1P1ZB 2X4OB 5EBLA 1XF4B 1NGYA 5I74B 3V4UL 3VI4F 3L3KB 4NZTH 1XGQB 2FIRT 3OKYA 2BSRA 2YD5A 3TCXA 1MI5E 5D1ZA 4AG4L 1JPSH 1RZGB 2BSTB 3O3EB 4LLYB 2P44B 1JNJA 1JPGB 3X17A 2DL9A 1Q0XL 4L4VD 2IEPA 4EXPX 1HOCA 3MLUL 4EXKA 1OSPH 1PKQE 3QH3A 4NQCA 1A6ZB 1YA5A 3BZFB 2AEIT 4HDIB 2LU3A 2G2RB 4JM2B 3C5JA 1V3JA 3BQUD 5IVXB 1VKXA 1S7RA 2MCPL 2ENSA 4JKMA 4L9LA 4PJ5A 5I1JL 2JE8A 3CMOL 4HEME 3UBXI 1ZT7A 5F6IB 2VKXA 3RZCD 1CE1H 4HUWA 1NMAH 5IMOA 4V2CB 5ANMB 5C0JA 3QO1B 4LSUL 4AH2B 2R69H 3MREA 1OAXL 3SPVA 1RI8A 5FO9B 2D7TH 1HWHB 2FCBA 2XQYG 5HYFA 4CN1A 4I0PD 2DYPB 3VFTA 1K2DA 2CJUL 5EC1B 2RCSH 3GSXB 1U2CA 2BSSB 3ES6B 4EI5B 3P4OA 5E8NB 1FRGH 1CQKA 1NUFA 5CCKH 2KZ1B 3E2HB 2W9EL 5DTFA 3WHXB 5E2WL 3WO4C 3ULVD 3ARDC 4U2ZA 1A14H 3C5SB 3DUUA 4LHUA 1OP5H 2NY2D 1TMCB 2ATPA 3MJ6A 3D0VA 2VDNH 4M93B 2P8PB 1AGDB 2CR3A 1ZXQA 1MQKH 3JV4B 3FHQA 4OF3A 4P59L 4JVPA 1B88A 5DQJA 2NLJB 2EH8L 3N85L 4MSWB 3GMLA 1F02I 2IQAA 5FA4A 1A5FL 1YEFL 1A4JB 1GGCL 1T5XA 4WFGD 3T77B 3A6BL 5BS0D 1ZS8B 2J2ZA 1FZOA 1XMWA 2IAND 1R3JA 2FZ3B 2V2WA 3BKJL 2WBKA 4H1LA 3UXFA 1KEGH 5DS8B 2H6PA 3BZ4B 1JWSA 2NTSP 5KVEH 3U4BL 4Q9QL 4ZOAA 1MCRA 3OGOE 3FN0H 5GS1A 1DBKH 1LEIA 1LO5A 1QFWM 2WUBH 5J11B 3S5LG 4HPOH 1GC1L 4X7CC 4XI5C 5A40E 1INEL 2R23B 3VJ6A 1AFVL 5FKPA 5GJTH 5F96L 4A2LA 1OT2A 4QKXB 3PABA 1S78C 3TNMA 2EE2A 4HUXB 1MVUA 2CIIB 4PJ5D 3F6IA 5TGBA 1RSFA 1RVFH 5IM7B 3TIEB 3VG9B 4Y5XA 1QFUH 3I9GL 3O2WH 4FTVE 2IPUK 1L4IA 1QRNA 1A6PA 3HR5B 3GM0A 5BO1H 3DYMA 1BF2A 3IF1A 2Q86B 4U1KA 3RI5K 5GGUA 4MXVE 1DBJH 5GS0C 1KC5L 1MCLA 3GMQA 4EUPA 2NX5B 3MRGA 4PJHE 2ITCB 1OAKL 1HXYB 4HPYH 3MRCA 4PJDE 1ED3A 4O2CB 4KTDL 1UXWA 5IVOA 5HHVH 2Y5TB 2C1PB 3MJ9L 2B1HH 1WC7A 1T7XA 3QI9B 4G8GB 4RGNB 2RIKA 5C08A 5EBMB 2PO6C 1K6QL 1JHKH 2XWJB 3TC9A 1UVQB 2R4SL 5F70A 3MLZL 3LKOA 4B41A 3O2DL 1EBAA 5EO9B 4OLUL 3U9PL 4LCWB 5E4IA 1K8DA 4Y4FA 4LHUD 4X5LA 1KUMA 5FO8A 1BM3H 1D9KB 1S7UB 1WFNA 3JUZA 4NQXB 5DJZA 5HYSA 1JGEA 1RUQH 4OLWH 3D39A 4ZSOE 4MQTB 1MNUL 4HWEH 1E6JH 3HPLA 5EIVA 3MXWH 4DW2L 3TZVC 1QSFD 3ZKXB 4YHZL 4WUKL 4NZDA 1WUNT 1RK1A 4HCRL 3VXUB 4PGBB 3BI9X 2ED8A 3O3AB 3THML 2OZ4A 5JHDE 3R0NA 3VGEA 4OUUA 3UYRL 2NY1B 1JE6A 4G3YH 2A0LD 4A6YA 4M5YH 2Q6WA 1FGNH 1JP5A 5DFWH 4RIRA 2LAAA 1UZ8A 2Q8AH 1FL5B 2DI8A 1BFSA 4OCLC 1XR9B 4M6OH 3B5HA 5GRZA 3GMOB 4BFIA 4IRJC 2YMXH 3AY4A 4L1DA 4WFHD 1U6AL 3IDGB 4IHOB 4W6XB 3JV0A 2JB5L 3CC5A 4NHCL 2CR6A 2YRZA 4G6FD 1NH6A 4U3CA 3GMRB 2FD6L 1FV1A 5D9SB 1HHIA 3NCBB 4PJBA 1I1YB 2ZOKB 2O5XH 3O9WA 1U8MB 2KBGA 4YHLH 5INDA 2AJ3A 4LF3A 1MH5A 3ARBA 1FNSH 5A16B 3S88H 3RVTC 5JW5A 1N2RB 5DRWA 3SGDH 5EIIA 3C6SB 3HZYB 1S7SA 1SM3L 5GS2D 3T65B 2MQCA 4CJ1A 3PWPA 1QRND 2DAVA 2OCFD 3MRDB 2A77H 2R0KH 4JPWH 4XC3H 1QA9B 2VLLA 2P5WE 3SE9L 3W5MA 2R2BA 4Y0GA 2CRYA 5J1SC 2EE3A 5TDPA 3EOAA 4MS8A 2C7UA 1QFWI 4ONFH 5FGSA 1UWXK 2BOBA 3MLPA 2J12B 3MV9E 3L3DB 3HPJB 1Z2KA 3EJZC 4IRZL 4ETQA 1EPFA 2Y6SC 4N0FB 2HFFA 3TT1L 1RIUH 1U8NB 4G6KL 3JVGA 4GXVL 4RNRB 3WCYA 1PSKH 1X4ZA 5C08D 4U49A 4UIMB 4URTB 1DEEA 1VEOA 1DJSA 3L1OL 4R97C 4Z95H 1GHFH 3LZFH 3KPOA 2LTQB 1QP1A 2GUOB 3RWFB 5IKCB 3H9SB 1TJIH 2YEZA 4GRWB 2A6JA 3CXDL 1NAMH 1SEQL 4Y4FD 2MMXA 2R9HC 4LLQB 3VRLE 2CKBB 3FFCB 4QHNB 2OK0L 1TCRB 3TWCL 1D5IL 4X6BA 1JZ8A 3CD4A 3U4AA 1RHHA 1A7QL 4PY7A 5EU7E 4M1CC 4R7NB 4JZOB 2I26N 1A3LL 3O4OC 3V5HA 2R8SH 4NUJB 4DTGL 3HG1A 1BPVA 4JFXA 5I66B 5IIEB 1YEGL 3BO8A 1IBGH 3VGHA 1H5BC 3S3SA 4P3DA 4JN1H 2V2XA 1HE7A 2XT1B 3UJJH 2VQUA 4Q0XL 5TF1H 4P4KC 4PP2A 5EOCL 3O4LB 1JUFB 4BUGA 2W91A 5CZVL 2VSCA 4XPBL 4DN4L 4F57L 2HG5B 1QLRA 4XCYB 4HG4K 1CGSH 4BH7B 2IAMB 2VLMD 1R5VB 2I24N 4C56A 4OV5A 2BVQB 3IDYC 1BFOB 5D7IF 1F11B 5FYJE 4LVEA 3TA3C 4Z7OF 3QQ4B 4LGRB 1AO7B 4QXTA 3PGFL 5DEGB 5DLMH 5T3ZH 3LB6D 1Z9OA 2HLFD 2NW2A 3QUYC 3P2TA 4CKVX 4ZPVA 3DYPA 3MA9L 3O9WD 5D96C 4MLIA 1T0MA 3SE4C 3T2QA 2PCPA 3ARBD 3GMMB 4GRLD 4Y5VC 3S37X 3CFBB 4PTTB 3CIQA 4U1HA 1OPGL 2CDGB 4S1SH 4Z7UB 3OKMA 3PWPD 3MLWL 2H26B 2EYTB 5T1KA 3B2VH 3GSQA 2ZCHH 4FFWC 1XGUB 4MS8D 4XMPL 1KPUA 1CD9B 3TBTB 3BAEL 3JTTB 3QFJA 1NEZA 3X14B 2WNGA 1HINL 3RVXC 1SEBA 3V7MA 1GAFL 2VABB 3DTXB 3I6KA 2C3WA 3SKJH 3T09A 4WUUA 1J8HD 3ARDA 4GKNA 2CDEB 4ZUSA 1RK0A 3VG0H 4L8CA 4DKFH 4ODVL 5C0IA 5IBLD 1S8DB 1LE5B 2VZVA 2VR5A 1N3NA 1B9ZA 5E0QA 2JJVA 3QA3A 4DUVA 1ZT4B 4MA8H 1YMHA 4G42B 1YECH 1DLHA 1WIPA 2ZUTA 3D18A 5C8JA 3MRHB 2JF1A 3GSNB 4N0CC 2BDNL 3AS0A 2A9MH 1YEHL 1QKZL 5DJ6B 3HG1D 1OP3H 2B5IC 5EUOF 3QFDA 5AD0A 3MRRB 3HNVL 4G5ZH 2VSDA 2AJXL 2AQ2A 3C09C 3PWVB 3PGCA 4JQVC 1OCWH 4BSWA 2AKRA 4B7IA 5D72H 1NFDE 1WT5C 4OT1H 2HTLC 1KCUH 1D5MB 2ICWA 3RKDC 1U3JA 4HAFA 5EU3B 3SDXF 2NPLX 3IRPX 5DJDB 5EU7C 1TJGH 3TV3L 2FSEA 3TVMC 4LVHC 4WW2B 4J6RH 4C56D 5ITBL 3JWOH 4NOBA 2ZSVB 4RAUB 5MEQB 3GI8L 2P8LB 2FHBA 1L7IH 5DZNA 1DEDA 2HAZA 5IHLB 5HYQA 1IAIM 1NLDL 3P4NB 2DQIH 2YWZA 5E8EA 5I1CH 4UAOB 5I1DA 3BKCL 2VQ1A 4OZ4A 2OXHA 4MCYA 1RZ7L 4Q2ZB 3SDAB 5LGHL 3BKYH 4HKZB 4XXCC 1ZTXH 1JHTB 5C0BE 3I02A 1B2WL 2FEEI 4FZ8L 1MI5A 3NH7L 3VXNB 5GSRA 2ATKA 2I5YL 1HNFA 2AVGA 1A3RH 2CLZA 4IBLT 2A74B 1GC1C 1RQ5A 5I76B 1PKQA 4R90H 4QRSA 3QXDA 1H9VA 1KN4L 2RJMA 1UQSA 1MLCB 4NN7B 5FYKH 2A73B 2VIRA 1U91B 4WJ5A 1G7QB 4XP9L 5AUMA 4BQ6A 3KPSE 1FPTH 5T1KD 5DXWA 4F7MB 2Q3AA 3NPSB 5TDOA 3EZ8A 3PDGA 4NGHH 1AXSB 4JPKH 2FX8L 2AK4B 1KT2A 2PO6A 3VFWA 5FOBA 5DC0A 5INCB 2SEBB 3DXAE 4OB5L 4XB8A 5CP7A 3G04B 5CSGA 3BKML 3ARDD 3QDJE 2VDOH 4ZUVB 4PJ9B 4WDIA 2OM5A 1KIPA 1NGPH 4JPIA 4K3DL 2AXJA 4UT6L 5JQ6H 1N4XH 1HEZB 2VXSL 1NQBA 2Z8RA 1KLUB 4H8WL 3U4EB 1XGPA 3R06A 5I1HH 1KYOJ 1FFOA 5IF0A 4F7TB 1CXFA 4PRDA 3OJMB 2VNCA 4QF1A 4LPTA 4HKJA 3MOBH 2HJKA 5C7XH 5IW1A 3ERYA 5CAYB 4X7DC 4WO4A 4XVSL 4BFGA 1H0DA 2R0WL 1IAMA 1F2QA 2VXTH 3O8XA 32C2B 1AGFA 2I60L 2Z92A 2BRQA 2GQHA 4DGVH 3ORJA 1OGAE 3P40A 4MXVF 3G6AB 5DD3L 4PJHF 1Y6NR 4WV1C 5CBAB 3PL6A 2IFGA 3PV6B 4O4YL 3ARUA 1GSMA 3BISA 2ZCKH 3QUMA 4IRJA 5HI4C 3SQOH 2IC2A 3EFFB 5DMIH 4NQVA 3ALPA 1WEJL 3W5NA 4H5SB 4LOUD 4ZG1A 3ISWA 4XI5D 1EHLL 1H3PH 1UWEH 4JRYB 5K59E 4AL8H 4YR6A 4NWTH 5DT1H 4MDJB 1C16A 1NBVH 4ZTPH 4XBPA 2X44D 4M8QA 4FXGA 1ZLWH 3DMMC 5FHBL 3QULB 3CDCA 1FVEB 1KB5H 5HHME 1MI5D 2BXYA 4I18B 4ZS7H 2VYRE 3HAEA 2F8VA 4X4YB 2G9HA 4GS7C 3V6FA 4KAQL 3QXAA 4RQQB 4PREA 2YA0A 5GS0D 2W9LA 1I8MA 5D7LE 1Q9LB 1S7QA 3NIFE 3EFDL 2IBZX 2UYLA 2ZKHH 3ZHDA 4HWBH 2XWTA 4WGWB 4YK4B 3FRUA 5E00A 1U93A 3NIDE 5FYLH 3J7HA 1YDPA 4XNQA 3P9LA 5DO2C 5CEXA 1IAII 1V3MA 4K7PY 3S35X 2VXQH 4L8BB 2QJDA 4FTVA 4PV8B 1KENH 1IAOB 2I07B 3EBAA 5I30H 2BY3A 4RAVA 3M17B 2PO6D 1TCMA 1PJ9A 1X4YA 1N0LA 1UXSA 4G9FA 2GK2A 4YX2L 4HULB 4PJHA 3WFEL 3G08B 2CPCA 4OM1L 1OAUH 2HT2C 4PJDA 5EZIL 3NFNB 1TVHA 3BUTA 3MODL 4C57C 3TJEH 4FFZL 2ADJA 5DEFA 1UCBH 5BV7B 3ZT6A 5IEHB 1X5ZA 4G7VH 1EO8H 3IJYB 1FLTX 4X4XB 1R6VA 4JCMA 1EFXB 1Z5LB 2YK1L 1AI1L 2MKLC 3TZVD 2X4QB 1V5JA 5D70L 3QNXB 2IH1B 3TESA 1H5BA 1KN2L 4NQDE 5MEPB 1BBDH 4OBSA 3O6LL 2BFVH 4Y19E 3MZGB 5F71A 3W81A 5ESQA 4XVJL 4P4KA 4HV8A 3EOBA 3JWNC 2K3TA 3MYJB 4M7ZC 1KPRB 4JZJB 4V2BA 1F4YH 2OTWA 4ZSOA 5F7DB 1U41A 1NKOA 1UJ3B 4I13B 1JYNA 3LN4A 3MOAH 1Q94B 2VLKD 4U6VL 4IRJD 3FONA 3TA3A 3QDHA 3MV7E 3MRMB 4Y88A 4NPYB 3GIZH 4H25B 1F6AA 2LU4A 4LGSB 3FZUC 3QXUA 3QT2A 4K7FB 5JHDA 1QTYT 2XKNB 1KCRH 1JF1B 4MX7B 4M1GL 3QUYA 3UO1H 1LNUA 4Y7MA 1BOGA 3H3PL 1JI1A 5DJ2A 4PJ7B 1A7NH 1KJVB 3RWCB 4OKDA 2CGRH 3V9FA 4FQ2L 3ROOB 2BY0A 1E4WL 4Y5VA 1Q72L 4WTZA 4LNRB 5IMLB 3RVTD 1HKFA 3ILQC 3OZ9L 4QRTB 2B7DT 3UZVB 3JTCA 1TTGA 2FYYA 2VZ3A 4L5FL 3OPZL 2D0HA 5T1LB 2O26U 4ZNEE 4EN3C 4ZDHA 5DZLA 2YA2A 3BKJH 3IETA 3KPNB 4Z9KB 3HCVB 1SVCP 3FHAA 5ACZA 4X6CE 3OKDB 3U7YH 2JELH 3CDGA 1QLEL 1N64L 2AABH 5SWSD 4E41E 5DVNA 4R0LC 2GK0B 1BQHG 2R29L 4P2QE 2Y6SD 4JE4B 5J9PA 3DGGB 3EDEA 4MD0A 1UGNA 4E9LA 4OLXL 1AE6H 5TPWH 1WK0A 5CSZA 4FABL 3Q6FB 4MQ7B 4U0RB 1RJYA 4OFVA 3C8KB 5J13B 2P5WA 2WANA 1X5XA 4RMRA 3LQZA 4G9FD 1KCVL 1XCTB 3A67L 5GS3A 4XZUA 1HHHA 1HKLL 5L7XL 1CT8A 5CEYA 3MRPA 1MFAH 3FQTA 3MV9A 3HI6L 5SX4I 2BJML 1RZJH 2R9HD 4OZFG 4X7FC 3FOMB 5GGSA 1R3KB 1HWGB 1G7MB 4LAJH 2DQEH 1KGCE 2WWKT 1JPFB 4M1CD 2YUZA 1ZSDB 5M95B 5DMGC 2DQJH 1FBIH 3QWQB 3GBMH 1G0XA 4HWZA 2FL5B 4P2CG 3FMGH 4KMQA 3VFSB 3LKRB 1VPOH 1UM6L 4X9FA 1BVKB 4M5ZH 3MLVH 4P4KD 3D6GA 3DV6A 1WT5A 4KDTA 2DM2A 4R2GC 4NBYB 3ULSB 4QNPE 5DK2A 1FYHB 4YHNB 5E8DL 3OGCA 3OR6A 3QUXC 4OZIE 4JFEE 5J8OA 1NC2B 1MCFA 2AJUL 3DURB 3TA3D 4DJMA 3C6LB 4QHLA 4YXLL 4FQQA 4AIOA 3LQAL 4MA1C 3EGSA 3SKUD 5EBWA 2FIKA 4GRMB 3STLB 5JHDD 4OUOA 3ZSSA 4UQ3A 3ECBA 4EI5C 4ACPA 3QUYD 5T5NG 3LKPA 1CE6A 3IJHA 4F33B 3F58H 1NMBL 2BVEA 2E7MA 3QDAA 5TE7L 4K23H 5CIPH 4JO3L 4KPHL 4LCUB 5DYOA 4MGXA 1I3RA 2L7UA 3V0WL 3MRIA 1QBAA 1SJEB 4LPYA 4HCRH 1JRHH 5ADOL 1DN0B 1EK3A 1F4WH 2JCCF 1S3KH 1WCBB 4FFWD 1NGXA 2BC4A 4PB0L 5DRXA 1EEQA 4OTXL 5DFTA 5CJXC 4YNYA 2N4IA 2IADB 3RVXD 1OB1A 2DI9A 1NFDF 3A6OA 3BE1L 1QSEE 3V6ZA 5DHYA 3RY6C 3B4NA 4L3CA 5E6ZA 3ULVH 1ZLUK 1RHFA 1DBMH 4I3SL 4UDUB 2P5WD 1FCCA 3RDTA 1D6VH 3QNZB 3QIUB 4PFEA 1MCJA 1YYML 3MBEB 4FZEL 3W9DA 1LO3H 3P11H 2P48B 3MJ9A 4XPHH 3MV9D 1K3ZA 4BQBA 3NZ8B 4XBEL 4JKPH 1ORQB 4K7PH 4FXKB 3BGMB 4G43A 4LSSH 4OIBA 4OLYL 4N0YL 4XRCA 3REWB 2MPAH 4OJFH 4Z78B 4MJIB 3GI9L 4HIIA 4DGIL 5ACMA 4TOYL 2EKJA 4N0CD 3S98A 5J6GA 3O2DA 2QR0B 4XVTH 4ZUUB 3PHOA 5J1AA 5CINL 2XG5A 3OHXA 5BMFL 3UJTL 3KWWB 4WV1A 2FX9L 3BDYL 3NGBB 5HVFB 4JDTH 5E2UH 2OX5A 1I85C 3FQWA 1GOGA 5IQ7H 4H8WC 3RWIB 3FAXA 2HTLD 4HUMB 2QQNL 1HHJA 4XP1H 1ZT1B 2E6JA 4LSRL 3JSSA 4ERSH 5E08L 1G7HA 1EDQA 3TVMD 3RVWC 4PRAB 4LAQH 5BVJB 1M7DA 4YXKL 4J3TA 4OD1H 2Y36L 2FGWH 3OR7A 2JCCA 3DVIA 2J4WL 1RUML 1CFNB 3WUWG 2GTWB 4JR9L 1CLZH 4JFDD 4RGNC 3DVNA 4CU6A 3DMMA 1NFDA 2B0SL 5EPMB 3ZZ1A 3HFML 1S9YA 4DVRL 3S96B 2WW8A 5J4MA 1WISA 1AGBB 1OT1A 2ADIA 3O3BA 2YBRB 1FFQA 4HGWA 1NCWH 2AXFB 5C0EA 5HHOB 2VDKL 3GRWH 5DRZA 5FYJD 3BPCB 1ZGLA 3BPOB 3VMOA 4O2FB 2R1XB 3ZKQD 4Z7VE 1JHLL 4JJ5A 2GYSA 3IXTA 2Y06L 5C0BA 3UTPE 2NY0B 1BX2B 4OAWA 2AQ3A 2HVKB 2Z93B 4X6DE 2EYRB 3U9UA 3C60C 2JIXB 4MA3B 4TVSa 2FX7L 5D1XB 4GBXB 4AZ8A 1S9KC 4NQEE 3IFPA 2HJFA 2ADGB 2J8UE 4NC1E 3OAUL 4XHQA 5IW6A 2DTSA 3P0VL 4TSBL 1J86A 1IGYB 4I2XB 1EAJA 1GGTA 4WI2A 1CF8H 3MRLB 1MCNA 3ZTNH 1A6WL 4PDCE 2HRPL 2GFBB 1HZHH 3MCKA 3R4DA 2IPUG 1UM4H 2XQBH 3KPSA 3UCRA 2EDXA 1U8PB 3HE7D 1SBSH 3T0EB 4YH6A 5FM5O 5IFHL 4QOKD 3MRFB 5DR5L 5D2LE 1N8ZB 4EIZC 2H9GB 2QHLA 3DXAA 4FP8H 3VWKA 1NBZA 4PP8C 4J4PC 4ZTOL 1PW3A 4NO0B 1OP9A 4OCWL 5DD5L 3QDJA 5DVKA 4KMTH 4BKLA 1G9MH 3H7BA 4NSKB 5I1KL 1UM5H 3DBXA 2IALA 1OAYH 4HKXB 1ES0A 1YEKH 3M1BA 2DKUA 3NIFF 4PRHE 5D1QC 5F1IA 3WKMH 1W72L 1PVHA 3SDDC 1D6EB 4YHPB 5CBEB 2DOCA 4XPAH 4P23B 4QRPB 5C0GB 1FAKT 5HI4D 4AMKH 3QWOB 3K74B 4K3JL 5EOQH 2X4SB 4YDLB 1NC4B 2A1WH 3F5WA 3U79A 3V5DB 4EI6A 2OL3H 3U83A 1OF2B 4JM2F 4NRXA 3L95B 2VDQL