1RJYA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjyA01
1U93A 5EN2B 5KVDL 4JLRA 3S6CA 1N6QH 1U8JB 1RK1A 3REVA 1MCWM 2X4OB 1YZZA 1YY8A 4YHPA 4Z77A 1S3KL 2OMBA 5I0DA 4JRYD 4TNWK 3VD4A 1JL8A 2CIKB 4RMWA 1XGYL 3BHBB 4MD0A 4JVPA 1BOYA 1I85C 3BKYH 2BSTB 5FGBA 2C3WA 4YHZH 2ADFH 5HDBE 1MWAH 1D9KD 4DKDC 3PWJA 4PJIF 4WU5B 3U46B 1DTUA 3UTPE 3V0WH 3DJ9A 3QWRD 3MRIA 1TQCC 4XRCA 1KG0A 3B5TA 4G6MH 5HHMA 4JFEA 3CUPB 3L1OH 3LKNA 3MJ7B 3LS5L 4XVSL 4M3JA 2E6PA 4M1CD 4JZNA 3L3JA 1EX0A 2CXGA 4HUWA 4OT1H 3FFCD 3MJ9L 1OAUH 3KPPA 2XNAA 1U8HB 4MA3A 1IEBB 4XCEB 4ODWA 3KR3L 4XB7A 5IKCA 3T4AA 5IB4A 2BVQA 3H3KA 3D85D 1WSST 1VENA 4D9LL 3HRZB 3GSNH 4OI9A 4DKEH 4LSSH 1JGLH 4PG2C 5MEPB 4I0CC 5F7LB 2Q6WA 5EO9B 4RIRA 1MH5A 4H25A 5DHVH 3B9VA 2IEPA 2OZ4A 3UTQB 3HS0A 1AGCA 4LNVA 3C6SB 4ISVA 3L3IA 3UROR 1CK0H 1O7SA 4QXUH 2QQNH 4O2CB 1K6QL 1CXKA 4YXLH 1E4KC 3SDDB 4BSVB 4OCRL 2WW8A 5FA4A 3FZUC 1S5HA 2ICWI 5KSBB 1AY1L 3S35X 1A6AB 4LKXA 5M94B 3BGFC 5CP3H 1A22B 5DJ6B 5F1SA 1KN4L 3EYUH 1P1ZA 2V5MA 3LEYL 5T1LD 4GSDH 1N5AB 2RFXA 1B4RA 1W0YT 1XGTB 3CD4A 2XTJB 2AEPH 3RVXD 3DI3B 4Y2OA 3SBWA 3MRBA 4XXDB 2AQ2A 5IB1B 3NCJL 5IG7B 3V95A 3GBML 3OGCA 3BE1H 5DRZA 3U9PL 1B6DA 1FE8L 2OQJA 4QF1A 2AABH 3QRGH 4F7TB 2IH3B 5DJ8B 5DEZA 5T1KB 2VDLH 2VDQH 1F4WH 2IC2A 1IM9D 5TF1H 4PGEB 5DJ2A 4YDVA 1B0RA 1CLYL 1EBPA 1Z9LA 1Q1JL 2YD4A 5LQBL 3SE4C 3E8UH 3FO2B 1KB5H 5CHNB 5I1EH 1DBJL 4NQCD 2XTJE 1DDHB 3F65A 2CKBL 3V6OA 3AUVA 2FEDD 5KVFL 2Q87A 4LCIL 3TEUA 4LCCB 3L3HB 2CLZB 4MJ5A 4Q2ZB 4JPVH 1JYXA 4LSPH 3NN8B 1W0WA 1KNOA 4X8XA 2Y4SA 1HI6A 4V3DB 3GMMB 1M6OA 4XMKL 5HXMA 2HTLC 5CKGA 2YXFA 4JY5L 1UB5A 3HC0A 2HT2C 3DRQA 5MHSD 3C08H 5KJRL 1V7MH 3MNWB 2C1PA 4EKXA 4LHUA 4C55A 1I1YA 4YFLF 3TZVD 1RUQL 3V52L 2R0KL 5DC4B 1RURL 1BJ1H 4OV5A 3LV3A 1GIGH 1NGXA 3BWAB 1Q0XL 4NYLA 1XGPB 4XCCH 5EZLA 5DR5H 5E6IC 4JCMA 4YHOH 5KVEL 3QZWA 1MAMH 3U6RB 2A9MH 3C60B 5D1XD 2MCG1 1IVLA 3L3OB 3MV7D 1P4LB 5AAWA 3DRTA 5JIKA 4WTZA 4P4KB 1CXLA 1DQTA 5BQ7B 4Q9RH 2R2BA 3RDTB 4C83B 1MELA 2B20A 1YEJH 1P69B 4XPBL 3TH4T 4UDUB 1ZLUK 3QCVL 1HKFA 1C5DA 1KULA 1Q9OB 1ZE3C 4Z95H 1MWAA 2FECI 2PW2B 4KJWC 3L5WB 3O2WL 2Y1VA 3WO3B 1FZJB 5GIRB 2VLJD 1AKJB 4MX7B 2UWEA 5F1IB 1LK2A 5IIEB 2D03H 4KKNA 5L2KA 1U95B 2DQCH 2X1WL 1I8MB 3VFSB 1JNHB 2NYYC 3VXRA 1S7QB 4MA7L 4G6FB 1JGEB 2G60L 2VXUL 4UMGA 2NXYD 1DQQB 5A2LH 1FNHA 5H94A 1P7QD 3QPQC 5IHUH 3WD5L 4LCWD 4EIGB 3UJIH 3B2UD 3FHQA 2DAVA 4OCXL 3EDJA 3U30C 3GSNA 3DVNB 4Z7QF 1KOAA 1T3FB 2CO6B 1CFNB 4NZRH 1FYTA 4WHDA 1P9MA 5DHVA 1CBVH 3BUYB 3TH3T 4NO5B 1EV2E 3WLBB 5JIHA 3SDCA 3FKUS 3SO5A 4MQSB 3IFOA 1QFWL 1DFBH 2APXA 4JAMB 1RZ7H 4OIBA 4OLUL 3TYFB 4L8CB 1P4IL 1RQ5A 4N0CC 2IG2L 5FK9A 3B2VH 3Q5TA 3ZKMD 2CR3A 4JY6B 2H1PH 2KUTA 4OIIH 2ITCB 2DD8L 2QR0A 3OG4B 1JYNA 1KGCD 3NA9H 5CZXC 4MNHA 3KPMA 5HGHA 5CP3A 4XNUL 4HKBB 3OX8A 3QQ3B 1MHPL 4N90E 3HPJA 5DS8A 4ZAKC 3VDAA 1CR9L 1T83A 2VAAA 4JDTH 1KIRB 3OSKA 4F7CB 3L3KA 3MRDB 4KZEL 1YA5A 2AJUL 4TULL 1UWXH 3ARGA 2W9DH 3RFZC 2X4SB 3WEXB 4S1RL 4Y5YC 5CCKH 3LB6C 4LVNC 2R0LL 4RZCB 4LGRB 3C9NA 5CP7B 1ZA6B 1R24B 2HJFA 4RBPK 2FR4A 2F53B 5D71L 1A1OA 2IPTL 1NEZG 5FHBL 1S7VA 1GZQB 1UWGH 3QQ9C 1PZUB 3F5WA 3EBAA 3HCVB 3IAQA 1ZS8B 1REIA 1F6AB 2I07A 2RBLA 3O8XD 4L4JA 4EI5D 4GG8B 4BZ2L 5TDPB 3BIBX 4FQLL 3WV0A 1AXTL 1XIWD 5J1SC 3INUL 1FIGL 5EORH 3NPSB 4XP1H 1KJ2H 5BS0B 1KB5A 5EZJB 2E7LC 3REWA 4NHCH 4KTEL 1JZ2A 2D7OA 1CVSC 4PB9H 5HVHC 4NUJB 2OYPA 1T6WA 3O2VH 4XPFH 4A2MA 2ICWB 4HKZA 1QR4A 4PJDF 3QIBA 2QLVB 1DBAL 2OI9C 3TNNB 4LCYA 1NCCL 2VXSH 4U7KA 4WI3A 2F53E 1QBMH 2BC4B 1YEIH 2AI0L 2GTZB 1V3MA 4X9GA 4FQXA 4MA1B 4Z0XA 4M6AA 5T33H 3HFMH 3QDMD 3MCLH 5IROC 1RJLB 2FHFA 1J10A 1IGTB 1TZIB 2MCPL 3QUMH 1Q72L 3U36B 5BS0E 2OR9H 3TVMD 3KG5A 5HYJE 5CKAA 5KVGH 1M7IA 1NKOA 4HBCH 4FFZH 1CGWA 2OR7A 4NQEB 3NIFF 3OB0K 2H26B 4R8WH 2XYCA 3TBSB 1XCTA 1PKQA 4GRLD 4KVNL 1TVHB 4I2XA 4LLQA 3V9FA 2GT9A 5ITBH 5D96B 3JV0A 1Q94A 4L29B 4RSVA 5I71C 1RUKL 3IXTB 3NIDE 5BXFA 1U8MA 2ZOKA 3TA3C 5EBLB 1NBVL 4UT9L 3SCMA 5HJ3A 4PTUB 1TPXC 2FGZA 5FF6B 2OJEA 3QG7H 1AP2B 1GGUA 4EXKA 5E2WH 1TNMA 4IDJL 2XFXB 2GY5A 4NQEE 3TJHC 4LNRB 1QSFD 4LOUC 5B4MC 5DVLA 4UB0L 1JPFA 3LMJH 3OR7B 2BERA 1AXSB 4YBQD 3BKCL 4Y1AA 1TZGH 1HHHB 2BJMH 1ZTXL 5EFIB 3G6JB 4QXGH 1I7UA 1DUZB 1AIFA 3MTRA 1MCOL 5JLZB 3RL2B 4H0HB 4LRNL 1OGTA 4XBGA 1VACB 3CFBB 3LRHA 2NTFA 1KCRH 4MNQB 1NDGB 2ID5A 3SGDI 1T0NB 2NY6D 4N9OB 4BK4A 4X99B 5ECJE 4UBDC 3F7YB 3KPQB 1K4DA 4MDIA 2HRPH 3FQRB 3BH9B 2VXVH 4XMPH 3VFNB 4LLAA 5FDWA 5DUMH 1N7ML 2IGFH 1U41A 5IFAL 3MRHA 1D6VL 5EO0B 4L9LA 2WM0A 4QNPF 1IBGH 1DR9A 4NWUH 1WZKA 4R4FL 4XNMA 1NGPH 4KVCL 1BWMA 4RMVA 1RZKC 1CGSH 4PV8B 3H3PL 2JCCA 2JIXD 5HYFA 5E2UH 3DXAA 5C0ND 3NTCL 3G6JE 3O4OC 1CDCA 2R1WA 4NJAL 2A77H 2J6EL 3SY0A 1X5HA 3VRJA 3OXRA 4PB0H 3A6BL 3P77B 1E0OB 3PXHA 3T04D 3FQTA 1OSPL 3IFNL 2V7HA 1MFEH 1IJ9A 4YLQT 1DBMH 4JHWL 3PWVA 1NLDH 4MNQE 4TRPL 2CRYA 1FNAA 5T1DH 2AK4A 4N0FA 1YNKH 4M8QB 3B9KB 4MD4B 3BX7C 5IT2L 4P2RB 4MAYD 3FO9B 2X9YA 5BMFL 5BVJA 1KCKA 1QLRB 2XZAH 3Q6GH 4Z78A 3OJ2C 4IOFC 2E9JA 5JIPA 3UX9B 1CFSA 1E28A 2FATH 4MJID 3TH2T 4IS6B 1AO7D 2HAZA 3LN9A 2BNQD 1OCWL 2IADA 4M6MH 5CUSH 1MCFA 3OKKB 3RVWD 5DJCB 2J12B 5ADOL 4K2UH 4IRZH 4QWWD 2P42B 1KJ2A 3H8NA 4NWTL 4PBVC 3CDGB 5I6XC 2QQKH 3J8F7 5DZLA 4XWGL 5GJSH 2QADB 3O3AA 1CIUA 1WBYA 5ILTL 5IP4A 3PV6B 4ZFGH 3AU1B 4XT1C 5C92A 1X4ZA 4PJ8B 4M5ZL 2DQFA 3FT4A 5CFHA 3ARFD 4N68A 3I2CL 4NC2B 4AM0B 2Q3ZA 3TO4A 4P2RE 2VZ1A 2CSPA 3SGJA 4RMRA 3VWKB 5HYSG 5FIEA 4PJGF 2VZVA 2WUBL 3RWJB 3SPVA 1MREL 1RJYA 4JFXB 1SJEB 4W6XB 4YZFE 5J13B 3HUJA 1UM6H 2BSRB 1FN4B 5E8EA 3F12B 4JZOB 3FL7A 2G9HB 3LHPH 2AV7A 3QUMA 1UKSA 1S9KC 1IC4H 5IOPA 4WW2C 4PDCE 2DIBA 4OLXL 3I50L 1KSRA 4S1SL 5KW9H 1ES0A 2XA8H 2E7HA 1WC7B 4MJ2A 3ZDXE 4AIOA 2W0FB 1UZ6F 3U4BH 4YDLC 2YD2A 5FYKU 1R3KA 3WKNA 4N1HB 4RWHA 1T7ZA 2X42A 4LAQL 1JF1B 3MOBH 1EMTH 5D7IF 4MDJA 1CQYA 3KYOA 5T3ZH 1U8PB 2CD0A 1QPPA 4H20H 3C2SA 4MSWB 1TJIL 2R29H 5F8RC 5TFSH 5ETUB 3ZKQD 4X8JB 3QEQD 3B8YA 2DI8A 1P7KA 3VD7A 4PG9A 5EUKA 5D7KE 1ZA3B 4GW1A 2FB4L 1T66C 4PJAF 3TGXA 3I9GL 5DDHA 2DLTA 5DYOA 4MXQA 4PREB 4U0RC 3CFKA 1EPFA 1CU4L 5EU6E 3T2OA 4BZYA 3PWLB 5HVGB 5MENB 2ARJA 2VQ1B 4KGJA 2XQYG 3WJJA 3QEGL 4NC1C 1UM4L 4P3CH 3OJVC 4Y4FA 3ULUC 1FSKC 1XR9A 1RZ8B 5HPMB 5L2JB 3QQ4A 4E0RA 1I1AD 3H3BC 1J0YA 2BSED 4HUUA 1AC6A 4PJFB 4XVUD 2CO7B 4ZUWB 5I16A 1W8OA 2WSKA 5CINH 3OBAA 3OZ9H 3VD3A 5SWSD 2W9EH 3QO1A 1B2WL 4YC2C 4U1GB 2W07A 1FYHB 4M61B 3T1FB 4FXKA 1Y18B 3SKNB 4HH9B 2C5DC 4JLRB 1NCWH 1U3HC 3I02A 1RK1B 1PZ5A 4PJDA 5FUOL 3REVB 3S8WA 1C5CH 3QEHA 1DL7H 1YY8B 2FX7H 3CK0L 4YHPB 4Z77B 1IFHH 5JDJA 5MENE 4RDQF 1IQWH 3Q3GA 3EGSA 4I3GA 2Y5EA 2IFFL 4MD0B 4YUEH 1AGEB 2J88H 4HUNB 2KQNA 4KQ3H 1SEQH 5ADPH 4ZO7A 1KTRL 3PWJB 3ZSTA 1T4KA 5D7SL 1LMKA 1IGMH 3BUTA 2GHWB 2R1YA 3ZE1F 1Z9MA 3MRIB 4YGVA 5HHMB 3ZT5A 4JFEB 4PJ5A 3KS0J 5F1NA 3VXUD 3IKCB 2NY4B 2R2CA 4JZNB 1NCBL 2BX5A 1QQDB 3UZQA 4HUWB 3JWOC 3KPPB 2XNAB 4MA3B 3BP5A 4ODWB 4BFGA 3T4AB 1HXMA 3G5XA 3CIQA 2BVQB 4JKLA 4KKBC 5IB4B 3VWJC 1TVDA 4N8VG 4LGSB 4P57A 2X7LA 1KIPB 5D70H 7FABL 3D18A 2VDKH 3O81A 4H25B 4LPXA 4NRXA 3T8XA 2GY7B 3HS0B 1AGCB 3HAEG 3WS3B 3MRPA 4ISVB 1A6VL 1VKXB 4Y4KD 5C0BA 2CXKA 2DJUA 1BQHA 4WI7A 5HHME 3RTQA 4JFEE 1U92A 5C70A 2BNRB 1GGIH 4OCSL 2VB5A 4WEMB 5FA4B 2X05A 4RMUA 4BFIB 5I18L 2RCSL 1S5HB 1RIHH 5I8EA 3K0WA 3N06B 1AFVL 5TQ0L 2J8HA 2JELH 2RFXB 4Z5RA 3QDJB 3SHSA 1MFDL 4NN6B 4YXHH 3CPLA 1EHLL 4CVXA 5CJOH 1CE1H 1I9JH 2SEBA 3NGBC 4NDMA 2HN7A 3FN0L 3MRBB 3D2UA 3SKOB 2EDWA 2NXZD 1J1XL 1U3ZA 1L7TH 3OGCB 1U2HA 1CGYA 4S2SA 1CDHA 4H88H 3MA9L 2VQUA 3BPNC 4MQXC 4QF1B 3GI8H 3O0RL 1ZVSA 2YUXA 4KPHL 3T2QA 1S78D 3QHFL 4Z76B 5AEAA 1LE9A 1ZT1B 12E8H 3C6LD 4HFWA 1WTLA 3BH8A 3VCLA 2PN5A 1T7YA 1K4CB 4DFIA 2AEQL 4LPVA 5DJ2B 4M9PA 4MA8H 3UO1L 3WBDA 3ZL4L 2VJXA 2A6IA 1DSFH 1AHWA 1IC5H 1MOEA 3TJEL 3K7UA 3IB4A 1FFOA 4O58H 1CGVA 1JFQH 3NFNB 2D2OA 4JFFB 4O4YL 2EDYA 4M1GL 2LTQC 4DW2H 2XWBA 4IRSA 3LN4B 1F11A 2DQEL 2GW5A 1MFCH 1W0WB 1HI6B 3BYTA 2EEBA 5J11B 4RNRA 1GC1H 4WW1A 4NM8H 1D5BB 3I6LE 3FRUA 3I84A 4GQ9L 2V7NA 3DRQB 3HC0B 1WF5A 5C6TL 2C1PB 4PRID 5L8LB 1KF9B 4LHUB 1QUNA 1I1YB 2PF6A 3IGAA 5J12B 1V7NL 4OQTL 4H8WC 3ZE0F 4OV5B 1L0YA 1MNUL 2DQUH 1NGXB 4R26H 5I1IH 4HUVB 3PDOA 2OCFD 4NYLB 5KZCD 5EZLB 3V6OE 5D8JH 4TQEH 3BIKA 3C09B 1D9KC 3RAJL 5BRZA 1NFDF 3DRTB 2O5XH 3GO1H 5CSZA 1KEML 2YK1H 4G7VL 4Y16B 2AXGB 5MI0B 2R2BB 4DGYL 1A0QL 4BSWA 1EEQA 1H5BB 2V9RA 4Q0XL 4R2GC 3WUZA 3LDBC 4PP8C 4M1CC 5E7BA 5GS0L 5I73B 1C5DB 4R97C 2EE2A 1CS6A 1MWAB 4PTTA 3L6FB 5J06A 3AAZB 2G5BA 1UKQA 5F3BA 2RQ8A 5EZIH 1QFUH 1SMOA 2UWEB 4C56D 5FUCE 5E2JA 5D7JA 4YFLI 4P9MH 1LK2B 4E5XB 3QWQB 4GUPA 5L2KB 3VDCA 2IPKA 1B4JL 4NNPH 4FXGA 3NCBB 2WUCL 3QIWC 4HLJA 4RRPG 3V6ZA 3ZZ1A 5F7NC 4S1DC 5H94B 4OZIB 2C3XA 3T0ED 4OZHB 1GHFL 1KCVH 4PLOB 3RHWF 4KRNA 2YRLA 2DQDL 3S96A 1VESA 3X12A 4QOKD 3GSNB 3R8BB 3X11A 2EDOA 4B5EA 5DHVB 4AQ1B 1OTTD 1FFRA 1VPOH 1A02N 1BJ1J 5HYJD 1LO5A 5EU4A 5AWNH 3IFOB 3O2DL 2JE8A 2UWEE 1YEDA 3KXFA 3EDDA 5FYKH 5KAQF 2CGRH 5MP6H 4R90L 5FK9B 1OW0C 3EYSH 3CSPA 3RVXC 5L2KE 2QR0B 5IMKA 5JA9A 2R15A 5HI3C 3MLUL 4KK8D 4MNHB 4Z7NF 5HGHB 2DOCA 3NZ8A 1IMHC 1YNLH 1QSZA 3OX8B 4GAYA 1U8NA 4OZIE 2JJVA 4FQ1L 1TENA 5EIVA 1PLGH 1ZLSL 5DS8B 3I3EA 2VAAB 3VFTA 5ICZA 3L3KB 4LARH 5CEYB 4WFFE 1QSED 3ARGB 1L0XA 3IDYB 5F9WC 3FJTA 3STLA 1HNFA 5DURD 4NQED 4XP4L 3C9NB 3RGVA 1JNNH 4JKMA 2HJFB 5E2VL 4QTIL 2FR4B 4NQUA 4LASH 3MBEB 1S7VB 4Y19A 3BD5A 2FEDC 1R3IH 2Y07H 3GB7A 3PQYD 2CRZA 2I07B 2I9TA 2HLFD 3OJDA 5KANI 3MC0A 3T0AA 4W6WB 3VI3F 1DANU 4ZQKA 1OT2A 2BOCA 2DM2A 1QO3B 4HGMA 4LPUA 1KB5B 4UV4H 5HDLA 2FHBA 3REWB 4NOBA 3E2HC 4PJIB 3EYQD 2F19L 5F96H 1FRGL 2BDNH 3CFDA 1NUDA 2NQCA 3UYRL 2A73A 2WANA 4I18A 4CDGC 4FZ8L 4HKZB 4H0IA 3TZVC 2AXFA 3QIBB 3JV6A 1F58H 1CCZA 2IBBA 4LCYB 4UTBH 3GSUB 3LEVL 1CDYA 4HJJL 3U7AA 1ZLVK 2F54A 4XMLH 5JXEA 1UJ3A 1UQSA 1YEEH 4FQXB 4DKEL 5JXAH 3SGEH 4EDWH 2WBJA 3CSGA 4JFZL 5MEQA 2EYTB 1NGYA 5D1XC 3VFMA 1DBKH 3ZDZF 5C6WH 5F21B 1KTDB 5IF0A 1NCDH 2AERT 1PX4A 4K9EL 3OJMB 2GAZA 1IGFL 4D3CH 4AEEA 1PG7W 3B9DA 2Q8BH 1B0WA 1M7IB 2DM7A 1G9NH 4X5LA 2YRZA 2YKLH 3FB5A 2PYEA 1BGXH 1WCBA 4HK3J 4OBSA 5CBEA 3BSZH 4L3EA 4DZBB 3SDAD 1XCTB 1PKQB 3NACH 1FHGA 3W2DL 3VGAB 2Z8WC 4HCRL 3R8QA 3HE7A 4LLQB 4X7SL 3WFBH 4X6CA 4PJ9A 3QNXA 4E41A 5T3XD 4WJ5A 5F7FA 4BSJA 1A7PH 4P2OD 5TE6H 3F7VA 2VWEC 5BXFB 4YE4H 1U8MB 4WCYH 2ZOKB 4F57H 3QQNA 3MXVH 4LCUA 5F9OL 3EJZD 3H9HA 4JO4H 4FNLL 2NXYC 4P9HC 4I8DA 2NW2A 1HINH 3D39A 3ULVF 2OJEB 2EDKA 3RY5A 5IQ9A 1MCIA 5FB8A 4BKLA 2BK8A 4LVHC 4NZUL 4FQJL 4F9PC 3C2AH 2NCMA 5I66A 1JPFB 3AB0B 4P2RD 1A1NA 2MQCA 1WWWX 4Y1AB 1PKQE 5GGUA 1I7UB 4CDHA 1SJVA 3RI5K 1AIFB 4HHAB 3ZKMC 1HHKA 1OGTB 4Q74A 3UCRA 4XBGB 5D5MA 1JWSA 2F58L 4OF3A 2H45A 2NTFB 3MA7A 3CLFL 2M2DA 1G6RA 1J5OL 1WLHA 4U1JA 5FYJD 1K4DB 4MDIB 5D2NC 3MRGA 2VUYA 4L3AA 1JGDA 5E4EB 5FDWB 2A0LD 3MRHB 4L9LB 3PXJA 5E1AA 4XNMB 1WIUA 4UIKH 4Y1AE 4YHLH 1VEPA 3DXAB 3MRJA 4WO4D 4GG6A 2QSTA 3VRJB 3SY0B 2QBWA 2GUOA 4FP8H 1PX3A 4XXCA 3HMXH 3RJDA 1X9QA 1GGCH 3FQTB 2UZIL 5F7UA 2V7HB 4OM0H 4W4OC 5D7KD 5HGBA 1XR8A 3O8XC 3DETC 2AK4B 3WFHA 5L8JB 4DKFH 4N0FB 2FL5A 3RX8A 1XIWC 2XKSA 4EXPX 5EU6D 5TH2A 3QIUA 2VMFA 1ZGLP 1I8LC 4NGHH 4Z78B 1NFDA 1SVZA 3TP4A 1CFSB 1YJDH 3UP1A 1WBXA 2OLDA 3S34H 1EO7A 1JHLH 1U8IA 1CICA 1JZ5A 4CGTA 3DXAE 1EA9C 2YMXL 2P43B 5C86A 1VFUA 5CMAA 4EVNB 1LWRA 3FB6B 1KJ2B 2DN7A 3KPSD 4LEXH 2XG4A 4K3EL 4WV1B 2Z4QA 3O3AB 3UPCA 3HNSH 2DQFB 3FT4B 3GHBL 2AK4E 5CJ8A 1OT1A 4HWZA 1TTUA 2FGWH 4BH8A 1F6FB 4WU7A 4JG0H 5HDQL 3VFRA 4Y5VC 4U33A 3IU3B 5DD0H 1PG7L 4RFOH 4YK4C 3WHE1 3SPVB 3QEUA 1RJYB 1FGVH 2GI7A 1EVUA 5E8EB 3B8SA 4YXKH 4K94L 4GRLC 4P46C 3MLXL 1DVFA 4KROD 5INDA 3BEWA 2AV7B 3QUMB 4PLNC 2VL5A 1C08A 2JB6A 5HI5D 1ES0B 1URLA 4KKAD 3VXMA 3D9AH 4XTRD 1KEGL 3C8KA 1RUPL 4BJLA 4ZUTA 1YDPA 1R3KB 2P5WD 3HMWH 4DEPC 1HH9A 4OM1L 2DDQH 1BX2A 4MDJB 4BA8A 1HILA 3KYOB 4RGMB 5E8PB 3AREA 4G8IA 3S36H 3HUJE 4YBQC 1LO0H 4NZDA 5CJXC 1MI5D 4EN3B 5F89A 3KAAA 4PG9B 4UQ2A 5EUKB 1F90L 1L4IA 5IGXL 4ZTOH 2R8SL 5DJYB 4KZDH 4MWFA 5DYOB 4B50A 4D0CA 3QUZD 1A9EB 3CFKB 3ARDD 1L0QA 4JO2H 2ARJB 3DX8A 2F5BL 4TVPD 6CGTA 4Y4FB 1X5KA 5FO9A 1XH3A 1EUUA 3QQ4B 2R56H 4E0RB 1JWUA 5JMRA 4FHBD 3FMGL 4FTVD 1HYSD 5IHLB 3GIZL 2R1XA 2ERJB 5I16B 3EIFA 4QRSA 3MNVA 3ZKXC 2EEAA 1MHCA 3E3QC 4I3RL 3BKMH 3QO1B 1YECL 3QAZB 5C0NC 4V1DD 1S7XB 4FXKB 2VLKA 3D0LA 1MRFH 3TNMA 3X3FH 5LBSL 2GJZA 4Y5XC 1QBML 3FQNA 3QHZH 4LSUH 4XVTH 3I02B 3MLTB 4PJDB 4H1LH 3QEHB 5E9DB 3C87A 5F88B 4ZUSA 1CIDA 3Q3GB 3EGSB 2ADIA 3PP3K 1FVDB 4G8GD 5E5MA 5K9KA 1NBYA 3GSXA 5AZEH 2OMNA 4MAYC 1QZ1A 5F6IC 4LLDA 3HMXA 1I75A 1LGVA 3QFJD 1T4KB 5JPMA 4GH7B 1YC7A 1Z3GH 1RFDL 2R1YB 4LF3A 1MRDL 1J8HA 5MERA 4YGVB 1IKFL 4O02H 1TJHH 1CZ8L 5F1NB 4CU7A 5C2BH 5J1TC 3RVWC 2C1OB 4LDOB 4QWWC 5I1CH 2YR3A 1U91A 3I6LD 3PWNA 2PO6B 4PJDE 1EEUA 3BP5B 4LPWA 3T2NL 2DQGL 2I9LB 1QRND 1HXMB 5E9DE 3CDCA 3WFDL 4P57B 3HPLA 4TNVK 2YZ8A 2X7LB 3TT1H 3D18B 4MQTB 3CXDL 5B8CC 1VDGA 1XGUB 3IDXH 1NANH 3M07A 4NRXB 1JTPA 4OLWH 5C0AB 1RSFA 1Y6MR 4M7LT 5I1LA 5C0BB 4J3XA 2VITA 1BQHB 1U92B 1NEUA 2QQLH 4J6RH 4PUBH 4BZ1H 4N1EA 3NIFE 3QWOA 2D7MA 2ZOLA 5D93B 2DYPA 2Z31C 3IYLW 5I8EB 2YA2A 5ICXA 5GSVA 3C8DA 4MCYA 2NY1B 5CILH 3H42L 3ZKND 5BCAA 1CLZH 2RR3A 3GSRA 4Z5RB 4MD5A 3MLSH 2ZCHH 2FD6L 2MMXA 3CPLB 4LHUD 4CVXB 5E08H 3KHQA 4GO6B 2SEBB 3KPRA 4NDMB 1FNFA 2HN7B 5JUEL 2BY1A 3D2UB 2VDPH 4GAGL 1J11A 4KUZL 5H35B 4S2SB 3T77A 1NLBH 4OD1L 4OTXH 5C3LD 1QHOA 4CBPA 1CDIA 1ZVHA 2XZZA 5C0BE 4R4ND 1NFKA 3KPNB 1ZVSB 4M1DL 3O3BA 4KDVA 4WEBH 4RX4A 3BQUB 3CH1A 1LE9B 3ES6B 4HFWB 3VCLB 4KUCD 4QTHA 4K94C 2O5ZL 1HK6A 4KMQA 1I9EA 5AYQA 4KC3B 4FFYL 1EGJL 4PLKD 1EO8L 1NLDL 4GXUM 4XP6L 4PYGA 2A6IB 4WNQA 4D9QE 3TN0B 5IUSA 1FFOB 2OTUA 2APFA 4KHXH 1BZ9B 1I1AC 3V6FA 1MFAH 4ODVH 4M6NL 4XVUC 1JVKA 2XWBB 3BJLA 4TSAL 4IRSB 2F5AL 2ZPKL 5L2KD 1F11B 5IMLA 3MGAA 4QNPE 5K9JH 1QFOA 4RNRB 4X7TB 3VXRD 4WW1B 5IJKA 3CMGA 5DD5H 3FRUB 4MB3A 4YDJA 4NN7B 1RULL 4PJHA 3KYNA 1YQVL 2V7NB 2PR4L 1DQDH 3WJLC 1FNGA 2HKHH 5C07A 3SDDC 4GAFB 5T3ZE 3C5ZB 1W0VA 2DKUA 4NQTA 2GTWB 3F58L 2VLME 1FYTD 4WFFD 3V4VL 4FG6C 2H8PB 2Z35A 5I8KH 4D9RE 3PDOB 3SDCD 1IGCH 4PY8J 1OTSD 3CX5J 3ARUA 3JV5A 4QHKI 3VU2A 5BRZB 4KK6D 5CSGA 2EDDA 2IBZY 4H1LA 5CSZB 3VGEA 5C71A 5IFJA 1YN6B 4OLYH 4ZYKA 4EBQH 4BSWB 1EAPA 1GGBL 1D5IH 4LVEA 4NKDA 3CU1A 3KLAA 3F7RA 2VRAA 3UTTA 4B41A 5FYLH 2G5BB 3WUWA 3RGHA 5F3BB 1JGVH 1QFPA 3GMOA 4UINL 3VG9B 2X40A 4L1DA 3S36X 3ZO0A 4TTGA 5D7JB 3BT2H 1M1SA 3BZ4A 4GUPB 2CUHA 2LU4A 2LV4A 2AK1L 2IPKB 2VYRE 3ULVD 5JORA 3OKYA 4LL9A 4F15C 4FXGB 4HC1H 5ISZD 4ONFH 4DJMA 5BRZE 3V8OA 1JPGB 4POZD 4QGTA 1EMTL 4JQXC 2DL2A 3LD8C 3V6ZB 2DQIL 5AG8A 4F7PA 4Y4KC 1CGTA 3O6MH 5H37G 3V4PH 3S96B 3HTLX 5D7IB 1J0JA 1IARB 3X11B 5KSUB 3HE6D 4PJXF 5L8KB 3ARYA 2BRRL 3RWCA 1YY9D 2VH5L 3MZTA 1AD9A 4HH8A 5EU4B 3MV9D 4IEFB 4NCC2 3KXFB 5KG9A 4LMQE 1T2QH 2B2XL 4RWYL 3IFLH 4IRJA 2C4XA 4WUUA 4NNYA 4G9FB 1RD6A 3QP3A 3FO0H 3DO7A 5IMKB 1AQKL 4YX2H 3TFKD 4XAWH 2XY1A 3NZ8B 5CJQL 4C59B 4GAYB 1U8NB 4P5KB 5TPWH 1FORL 5DVNA 3O6FB 2Y06H 1LO3L 2IAMA 4KV5F 3C60C 3IRZA 1S78C 2NPLX 5ICZB 5F7EL 5BVPH 1BJMA 1LQSR 3STLB 4OFKA 4U2ZA 4TSBH 3MLPA 2DQJL 3L5IA 3KXFE 2VISB 3RGVB 2IF7A 5ITFA 2OS7A 4KRPD 2ITDB 2DKSA 4Y19B 3WYRA 2FLBT 2YHGA 1G84A 3GB7B 5LJYH 5IW3A 2I9TB 1FO0L 4P59H 1AGFA 5ERWA 3OJDB 3T3PF 4J3VA 1FBIL 2J4WH 3KJ4B 1VFAA 3QCUL 2EDLA 5E24E 4ZQKB 3SCMD 3GNMH 4PGBA 2W60A 2VE6A 4ZSOB 4ELMF 3CFDB 3BN9D 5EOQL 1OPGH 4F3FA 4Q6IA 3UMTA 5T3XL 3O4LA 3AM8A 4I18B 3DARA 3MR9A 3S3PA 5F6HJ 5F8QC 4RGOH 4WY7H 3RBGA 4X80H 2AXFB 1CTNA 3IFPA 3JV6B 5DI8A 1DUYA 2HH0L 4WWKA 2B1HH 4WEUD 4AIZA 3MRNA 2F54B 1B6UA 1UQSB 3W11D 4Y19E 5TE7H 4DVRH 3ARBA 4N9GA 2WBJB 2AEWA 3SE9L 4L3CA 1NGYB 3VFMB 5C0CA 3CC5A 4LHUG 1IC7L 3Q0HA 5F7KC 5IF0B 4JVUA 5D1QD 3VH8B 2GAZB 2VTFA 4HD9A 3D48R 4ZSOE 3FB5B 4Y2DD 5HI4D 1QG3A 3ZE1E 2PYEB 3VMOA 1WCBB 1A6UH 4QRRD 4Z6AT 3RU8L 5CBEB 1OAKH 5C9KA 4P48A 3RY6C 2OK0L 4P5MA 5DC9B 3HE7B 4WTZG 4X6CB 4PJ9B 3QNXB 4GMSL 1UYWH 4PRPA 1EEYA 5FYJL 1GAFL 2F54E 4WJ5B 2WIIB 3BZFA 4X6FA 5LAXA 4PJBF 4ZD3L 4XNXL 5MEOB 1CE1L 4LIQH 2HKFL 4IBLT 3Q48A 2BHUA 3BRDA 3H9HB 1ODAA 4OD3L 4TPRL 1X3DA 3PGCA 1LEIB 2RJMA 2QHLA 3H9YA 1L7TL 1KUMA 2NW2B 4TUOA 1N2RA 2Z8RA 5CEZD 4YHNA 3T0EC 1XMWA 3LN5A 5IQ9B 5FB8B 4BKLB 2X4TA 2O5YH 5EZOH 2WAHA 4TSCL 2PYEE 1JCKA 3I85A 3WIFB 5I66B 4OFIA 1A1NB 4OJFH 3G6DL 4HC1A 1LD9B 5GGUB 2YEZA 3MYZA 3EFDL 3DVFA 2X89A 2B4CL 3F7PC 4X6CE 4P4RA 2HLAA 1I85A 1ZANL 2R4SH 5GSRA 5JTWA 4PGCA 1HHKB 5D5MB 1KBGH 1JWSB 4P23B 5HY9A 1JFQL 3MA7B 3VG0H 4GFTB 4KK8C 3TIEA 4Z9KB 1INEH 1WICA 5FM5O 1JE6A 3NAAL 5KVDH 3D39E 1MRCL 4NP4L 2EYRA 4ZFFA 3RZCA 4MQ7B 4HXAL 2FBJL 4NNXB 5E1AB 1S3KH 5TDNB 4HPOL 4KXZH 1RMFL 5DJDA 1XGYH 3OF6A 3TO4D 4I3SL 2EXWD 1I8KA 4RFNB 3MRJB 5BZDA 2BVUA 5J56B 4D8PA 4Q7DA 4GG6B 5JDSA 2ADGB 2PNDA 5C7XL 2GUOB 4MJ4A 1T2XA 4F9LC 5D5ME 4JFPB 1T7VA 3LS5H 5DJ0B 4XVSH 4RAUA 5HGBB 1XR8B 3P0GB 3ESVF 3WFHB 1A6TA 4ZO8A 4NO0B 4LLYB 3MJ9H 3ZT7A 2HLFC 2MQ3A 1QSVA 2FL5B 4GW5A 4YNYA 1E4KA 3KR3H 3LRGA 3TF7C 3NIGF 3BISA 5FYKE 5TH2B 4KAQL 4PP2B 2CPCA 1NFDB 1XF5A 4L4VA 4WHYH 4G5ZL 3JWNC 3PL6A 3W5MA 1R0AL 3GJEB 4X6EA 5JMOC 4UU9A 1CICB 5DFTA 1DCLA 1FC2D 3DX9B 5C09D 5I19L 3BGMA 4GG6E 1Q9KA 4KI5E 3RBSA 3TO2A 5CMAB 5D2LA 3SJVA 3P9WB 3O3EA 1KB9J 3EDKA 4DCQB 4IMKA 2DL9A 1K6QH 1EEZA 4K3HA 3ZE0E 4JG1L 4OCRH 1KCLA 5E94B 4HWZB 4MXQD 4BH8B 2BP3A 1AY1H 3CCHB 4WFED 1YMHB 4HUMB 1KN4H 3LEYH 4L8SC 3VFRB 2V5RA 1A9BB 1NFDE 2EH7L 3HI6L 2FRGP 3SKMA 3QEUB 4XNQA 4PJ7A 5D72L 3SDAC 1E4XL 1DVFB 5INDB 5CAYB 1BLNA 4RISL 3GBMH 2BNUA 2C26A 3U9PH 2WWMD 1DBBL 1FE8H 2VL5B 1C08B 2JB6B 3ARVA 4TVPL 2CGRL 5MP6L 1EJOL 4P2OC 3WO4C 3STZA 3VXMB 2F8XC 1H3UA 3MCKA 1F97A 4MAUL 3EJZC 5GRJL 3C8KB 2VR4A 3I6GB 4XBEL 4ZUTB 1YDPB 15C8L 3FQUA 3JTTA 3FN9A 1T20A 1HH9B 3HR5A 4OKDA 1CLYH 1BX2B 1Q1JH 3JV4A 1EUTA 5LQBH 1S5IL 5SWZA 3SEPA 4XB8A 1HILB 3B9KC 3IS1X 3AREB 2B1AL 4G8IB 2EO1A 1U8KA 2CKBH 1MEXL 5H8DA 5KVFH 4LCIH 3T1WA 5F89B 3ECBA 1CG9A 4UQ2B 3EYFA 1XF3A 4ZPVA 4XH2A 2J8UF 4U7MA 5GRUL 3EFFA 4JHZA 4PJ5D 5CD3A 4MWFB 2J5LC 3V5HA 2VKXA 4MHHI 4N8VA 4GKNA 4JGJA 4D0CB 3VXME 4XMKH 2DM4A 4JY5H 4Y8AA 2ICES 3DX8B 5KJRH 4HIXL 4KDWA 1XH3B 3IDIA 4Q58C 3CSBA 1BEYH 3G6AA 5IK3A 1RUQH 1WCQA 2R0KH 3V52H 4PJ8C 1RURH 4UV4L 2A9NL 4Z7NE 2R1XB 1Q0XH 4KRMB 3DTXB 1OAXL 4QRSB 4EOWH 3DROA 3MNVB 4FRWA 3S7GA 1MHCB 3P4LA 4OFYA 4YQXL 1J12A 5KVEH 1BF2A 2EC9T 2IFGA 2JJWA 5GGQL 2VLKB 4WO4C 3D0LB 3CX5K 2ENSA 5J13C 5I30H 2DLEA 3RTQD 2GJZB 3AMKA 3FQNB 1CT8A 2YC1B 3WFEL 2ATKA 3BPCB 2B4CC 3BRGC 4XPBH 2NX5A 2Q1EA 3F7QA 2E7CA 4ZUSB 2PTVA 3QCVH 5E0QA 3ARWA 3VFVA 5K9KB 4JN1L 4OLVL 1NBYB 2PCPA 3GSXB 2NW3A 4WHTA 3O2WH 1YEGL 2NY1D 4KU1A 3EOTL 4QRUA 1JUFA 3LEXA 4LLDB 3BVNB 4OCLC 3VXTA 1BQUA 1BBDL 1Z5LA 4X4MA 4LF3B 4KQ4L 3DVGA 1HWGB 3D2UD 1J8HB 1UGNA 3EYOA 5MERB 1NCAL 4ZXBB 4YFDB 4PLJC 2XACC 4NQDD 4MA7H 3W0WA 2VLKE 5KOMC 2G60H 2VXUH 3OXSB 3EOAA 1DEDA 2W65A 2VAJA 3EO0B 2DQTL 3CFJA 4B53A 3K2UL 4OCXH 5IBTL 2DS4A 4U6TA 3K81A 3HPLB 1Q9WA 4FQIL 4X6DF 1VADA 2VLMD 2F8OA 1QFWH 4EI6A 5HHNA 2DMBA 4D9RD 4OLUH 3GGWB 1P4IH 2IG2H 5I1LB 4DGIL 1J8HE 3U2SA 2DD8H 4IMLA 5SV4A 4OF0A 4HPYL 4JGUA 4XNUH 2ZOLB 1OB1B 3ULUF 4LLVB 1JPST 1TCMA 1I8IA 1MHPH 1FL3A 1XF2A 2DYPB 1C16A 5J1AA 4KKAC 5GSVB 4XTRC 4DZ8B 1FFPA 4MCYB 2BHZA 1NAKL 1CR9H 4PRDA 4YR6A 3KYKL 4MD5B 4KZEH 2GITA 2YD8A 3L7EA 2AJUH 4R4BB 4TULH 2HT2D 2E7LA 1PBYA 3OG6B 1F4XL 3OAUL 4S1RH 3NCEB 2HFFA 3KPRB 1MCLA 4XPGL 5D4QA 4ONHA 5JOFA 3T77B 3ILPA 5D71H 2IPTH 2CIKA 4UIKL 5FHBH 1UZ8A 5J9PB 1KELH 5FGBC 4M93B 3IDNA 3MRFA 5BW7A 3O3BB 2BSTA 3WLWC 4BZ2H 1QPXA 4FQLH 1AXTH 3U46A 3INUH 4QTHB 5I75C 1OF2A 3N9GL 5KANG 3BP7A 1FIGH 1RZGA 2BXZA 4G3YL 2NY4C 4K3JL 3ARDC 2VC2L 4KTEH 2CKBA 4WNQB 2EH8L 2JJSC 4XCYA 2PTUA 4DK6A 2B8OT 3D87B 3KPRE 3ELAT 4FFWD 4RRPA 1DBAH 1NCCH 3Q1SL 3HNTL 3PE9A 3QPXL 4GKOA 4XPTL 3QXUA 1E27B 2AI0H 5IMLB 3A6OA 4UT6L 4URTB 1KENL 3LY6A 2OJZL 1TNNA 5DO2D 4NHUA 5HHXH 4YDJB 4C4KT 3UTQA 2MCPH 4JREB 3KYNB 4XI5D 1Q72H 1J1OL 2P48B 1FNGB 2MOVA 3UJTL 3QPQD 5C07B 4JFQB 4JPWL 1W0VB 3BP6A 5A16A 3ULVL 2PTTA 3VXOA 1HOCA 2DWDA 1OP3H 4OCYL 2Z35B 4GKSB 2VXQL 2AP2A 5KSBA 4KVNH 3TJHA 2ZKHL 2DLIA 1Y0LA 2C3GA 3B5GA 3M1BA 3LKSA 5I8CA 3GMLA 1N5AA 1G1YA 4APQB 4RFOL 1CD0A 3SBWC 4H1LB 1RUKH 3ULUH 4OSUL 4JFDB 4ZYKB 2ED9A 4G6AD 1NMCC 1PDKA 1EAPB 1NBVH 4UT9H 2YPLA 4UOJA 4LAJH 5CZXD 3IKKA 4NKDB 4PJHE 4OUOA 3UTSA 2Y7QB 5C07E 1G7MA 3UTTB 4F7TA 3K8MA 3WUWB 2ZCLH 2IH3A 1GYAA 4IDJH 1RIUL 5T1KA 3GMOB 4ZAKD 3HZYA 4UB0H 1BF8A 4QHLA 4YDIL 2XI9A 4IIQB 3BZ4B 2P8MA 1UA6L 3BKCH 3DSNA 1ZTXH 3RIFF 5JORB 4NKOA 5CEXA 5FM5M 4BK5A 5EA0L 5DA4A 2X1XR 1CD8A 3DYPA 1MCOH 3SKJL 2PXYA 4P5TA 2OX5A 5CHNA 2E27L 4LRNH 2NY0D 4F7PB 4JFDE 1DDHA 3RHWK 4HULB 4JKWA 4GS7B 4HDIA 2E6JA 4LPTA 1UACL 1MJJB 3L3HA 1R5WA 2FYYB 1X5AA 4I0PA 5LXGL 5EBWB 1X5IA 3R1GL 2LVCA 1N7MH 2W59A 3MRKA 5IFAH 1D6VH 3UTTE 3PHSA 5TDOA 4GBXA 2XKNB 2I26N 5DMYA 1A6ZA 3GMMA 5IBLC 2J8UA 4R4FH 3ZKNC 3OKNA 1BQHG 2VERN 4KVCH 4IRJB 4WUUB 4NNYB 3DPBA 5J12C 3H3PH 4U3HA 4HIIB 3HB3D 3GMNB 5C08B 3NTCH 3BD4A 4G9DA 1I7TA 4NJAH 2J6EH 5JW4R 2EDJA 3A6BH 1OSPH 3IFNH 4JHWH 3OKMA 2IAMB 5DFWH 1TTGA 4TRPH 5B39A 3IJSA 3W39B 2ED7A 3L3OA 3V0AC 5MI0C 5IT2H 1CFTA 4LRIC 1CGUA 5HTSA 5L0QB 3CSYB 5I73C 4PLKC 2HJKA 4UDUA 4L3ED 1H8SA 5ITFB 4WUUE 1PEWA 3NCYP 1CDGA 1WBZA 4OCNC 1OCWH 3OV6A 4CVUA 5K93A 3DMMA 3B9EA 3NCYS 4E41D 5ADOH 5IJVA 4NWTH 5ERWB 5DQ9B 1VB9A 1YEKL 1Z3GL 3IS0X 3RUGF 1VFAB 4XWGH 1KB9K 3Q5OA 3WDHA 4X9HA 1U95A 4TUJB 1MFNA 4M5ZH 4PGBB 3VFSA 1JNHA 2VE6B 5K33A 1S7QA 3IAGC 3D39D 1JGEA 2GKIA 4FOMA 3I2CH 5IM7A 1DQQA 4XNZB 3MR9B 2KPNA 4DTGL 4IHOB 2WUBH 1MVFA 1DUYB 1P9MC 1MREH 2H9GA 2J3SA 2NTSP 4K71B 4WWKB 5DT1L 3SQBA 3V5KA 1T3FA 4AIZB 1CFNA 3MRNB 2N1KA 5B4MD 3G5YB 4D94A 3SDCC 1HWHB 4XX1E 1S7RA 4Z7WF 3BUYA 3O9WA 3WLBA 5CEZL 2FX8L 3ARBB 1Z0NA 4HWBL 4N9GB 3WIIL 5I1DA 3RKDD 4L3CB 5C0CB 3CC5B 3SO3B 2C4FU 3TYFA 3T08A 4L8CA 4OLXH 3I50H 1AQDA 4S1SH 3WHE0 3ULSA 2NNAA 4PRNB 1WIPA 2CDFA 1Q9LB 1ZEAL 2V5TA 5FYKD 3ZHDA 1JN6A 4LAQH 3BP4A 4G42B 4P5MB 3S88L 2BCKA 2ESVB 3E1F1 5I8OL 4EEEA 2D0HA 2E7BA 4PRPB 3ARGC 1A1MB 1EEYB 3IDYC 4F7CA 1TJIH 1RZJL 3BZFB 4X6FB 3V7AE 5LAXB 4EUPH 1V05A 1FIEA 2KH2B 4KI5D 2FDBP 3PGCB 5C0CE 2FB4H 3R0MA 5I1GL 4POZC 2DQHL 2NY5L 1R24A 3I9GH 4TUOB 1N2RB 1HCFX 4JJHA 4XAKD 4YHNB 2D9CA 3ERYA 3CFCL 1CU4H 4JZJB 2X4TB 1BFSA 3KJ6L 3QEGH 5FXCH 3GJFH 5GJTL 5DEFB 4FQCL 1IAMA 3QIUD 3SOBL 2YEZB 4XP9L 4IOIB 1CLOL 3T0XA 5EDXA 2ESVE 4JPIA 4P4RB 4DFHA 3QI9D 4IOFD 4PRPE 2FJGA 2ZZUT 5GSRB 1Q0YL 4PGCB 1B2WH 5FOJA 4D0DB 1TXKA 4RA3A 1AGBA 5HY9B 3U7YL 4HKXA 5KTEL 3G5ZA 2ICWA 4ORZC 3GBNL 3TNNA 5FYLE 5DD3L 5GHWL 3RWIA 1T1ZB 1NMBL 2EYRB 1P2CB 3IDMA 3OKLB 5FUOH 2G2RA 3RZCB 4ZFFB 3CK0H 5GS1C 1RJLA 2IALA 4KJPD 2R9HC 4L9DA 1JZ4A 1NC4A 2VLRA 5D9SA 2OL3L 2LVEA 5DJDB 2IFFH 1OGAA 3QSKB 3TLRA 1RZIB 2J6EA 4NKIL 1I8KB 1BM3L 3U36A 5BZDB 5I9QC 4D8PB 1A6PA 5D7SH 1S9WA 5JDSB 2Q76A 1CDUA 4YBLC 2CUIA 2VSCA 1U8OA 2H26A 3VGAC 1OP5H 1ED3B 3EJYC 2VIRA 3P4MA 3ILQD 4RAUB 1NCBH 2P5ED 2LAGB 1A6TB 1MJUL 4AMKL 4LU5L 3WNPA 1P7HL 2X4RA 3VXMD 4GW5B 1D5ZA 4OD2A 4YNYB 3WIHL 4EIZC 4L4TA 1JYWA 1KIUA 4DK3A 2YPVL 3I75A 3IXTA 4H0GA 3SCMC 3HN3A 1XF5B 3MJ8A 1FNEA 2P24A 3BGFB 3PL6B 3BN9C 4X6EB 3HZVA 4ZO6A 7FABH 4Y4HD 1TMCA 3NABL 3ARTA 4RDQG 4N8CL 2AJXL 1AP2A 3LQAL 2UY7A 4AJ0A 1B0GA 4HS3A 4EQ3A 5I15H 3BGMB 2VDRL 1Q9KB 4LQFL 3AB0C 3WDJA 3TO2B 5D2LB 3SJVB 4NM4L 1JYVA 3O3EB 3OR7A 4TNWF 1AXSA 3W11C 3X13A 1LK3L 2C3HA 4OCSH 1EEZB 2CDEA 5JOPE 5EFIA 5E56A 5I18H 3B43A 2RCSH 1NDMA 3MV11 4ODHL 4U6YA 5JLZA 5D1QC 3W9EA 3BGAA 2FIRT 5GZND 3GSQA 3SDXA 1KCSL 1AFVH 5TQ0H 1NDGA 2XRAH 3SKMB 4X99A 4JEGB 1MFDH 4W81A 5E4EC 3KPQA 5HI4C 5C6PB 4K3DL 3BH9A 5M7QA 4XNQB 2P8PA 2X9XA 4F8QA 4PJ7B 3FN0H 4YHKL 3VMNA 4NIKB 3TBTA 1J1XH 1BLNB 4PJXB 1PVHA 2BNUB 1MCDA 3MA9H 5D2LE 3SJVE 3VH8G 3O0RH 4NFDA 4KPHH 3EOBB 5E70A 3EYVA 1IAIL 3QHFH 3QUXA 1V3LA 3MCKB 3LRSA 1OL0A 5DRNA 1WZMA 1QA9B 1T80A 2Y5TA 3A0OA 5DRXA 3QUKB 3FQUB 3JTTB 3BPOC 4NUGL 1T20B 5FCUL 2AEQH 3HR5B 2C9AA 3U4AA 3UO1H 3GBLA 4EUPA 2P7TB 3ZL4H 5SWZB 4NJ9L 1GSMA 3WXWL 3TJEH 2XWJB 3P9LA 4HG4J 4CVZB 3F6LA 1U8KB 2HVKA 2VSDA 1YEFL 4PJ7E 4M4RA 1BIIB 3KWWA 4CADA 1ZKAA 3VRLF 1ACYL 2AQ1A 4JRYA 3ECBB 4M1GH 5J89A 1CG9B 4PJXE 3EYFB 4XH2B 2DQEH 5E6IB 3O11A 1WAAF 4M5YL 5CD3B 5H37H 3V5HB 4IJ3C 4GKNB 3NFSL 1QD0A 4NBYB 3SGDH 4HWEL 4U7SA 5CZVL 2UUDK 2X70A 3QWRA 4GQ9H 5C6TH 4NN5C 3IDIB 4P59L 4P2QD 4UNTA 1V7NH 1OY3B 3G6AB 5IK3B 4PJCF 4OQTH 3DLQR 3PV6A 2EDNA 4UI2A 1MNUH 5SWZE 5FFLA 4JHBA 2NY5C 4LIQE 4Y8DC 3TO4C 3DHJA 3DROB 4KV5E 3D85A 4NRZA 4ZTPL 2R69L 2P1YA 3O41A 3RAJH 3RWHB 1A7NL 3RPIA 1XGQA 4U1IB 1U6AH 1KEMH 5DHXB 2UZXB 4DAGL 2H2PD 1CT8B 4DGYH 3HZKA 4LGPB 2ATKB 1A0QH 3WMSA 3E0GA 3NOIA 3F12A 4OFVA 4Q0XH 3AMLA 1JTTA 5GS0H 1YMMB 3CXHJ 5C0GA 3VXNA 5F9DC 2PCPB 2NW3B 4WHTB 4QRUB 4JFHE 1JUFB 3LEXB 4OF5A 5DUBA 2VR9A 3VXTB 1Z5LB 2W0FA 5T1LA 3DVGB 3EYOB 1B4JH 3ALPA 4POUB 3L5HA 3JXAA 4N5EA 3W0WB 2WUCH 1JF1A 4RGMC 4EZMA 3QXDA 1BD2A 3EOAB 1U8PA 2K9UA 2W65B 3D6GA 4HMEA 3CFJB 1GHFH 5JR1L 4MQXD 5L9DL 2DQDH 1FZKA 1DZBA 5FUZL 4RX4D 1KJ3L 4RQQB 4X8JA 1VCAA 4S10A 2OTWA 2ZCKH 1RAMA 3L3GA 5TF0A 5DK0A 4R7DA 1Q9WB 4MXQC 2AJYH 1VADB 1CFQB 3O2DH 3RVUD 3P9MA 1FJ1B 1IM3B 4PREA 3WJJC 2WY3A 1WGOA 3PWLA 4X9IA 2CDGA 3GIVA 4R90H 5EZOL 2MKLC 4X4ME 4LVNB 2Q8AL 5DVOA 3U2SB 1LEKB 4IMLB 1UT9A 5CS7A 3W0WE 3MLUH 4NQCA 3WFZA 4ENED 4PJFA 3ZDYF 1MUJA 1X5ZA 3B4NA 1T04A 4ZUWA 4AG4L 4U1SA 4JM2D 5KN5B 1I8IB 4FQ1H 3KLHD 1XF2B 1ZLSH 4HQQL 2I5YL 4JRXB 4ACPA 3M17A 4YR6B 1CD1A 3EO1A 4C57C 4HH9A 2GITB 3L7EB 1DQLL 3BO8A 1MJ8L 1NGWA 2HFFB 2VXTL 1UXWA 4XP4H 4ONHB 1BZQK 5JOFB 1UCBL 5E2VH 5HVHB 4QTIH 3ILPB 2YD5A 1VGEL 4JO3L 4WRLA 1UZ8B 1AGEA 4LFHG 3IDNB 4P3WA 3MRFB 4Z18A 3P40A 2V2XA 43CAB 3DSFL 5ENWB 4CKVX 1OF2B 3EJJX 3GI9L 3BP7B 1BVLA 1RZGB 5D1XA 1WISA 2DTML 3ZSSA 5BJTA 3V5DA 4JRXE 4R2GD 3S97C 2F19H 4QKXB 1FRGH 3IKCA 4K23H 2CKBB 1MAKA 3UYRH 1QQDA 4XCYB 5JQ6L 2E7LE 3AGVA 1A14L 3IAPA 4FZ8H 3RVVD 1N0XL 5DMKB 4Y0GA 3LEVH 4HJJH 1C7SA 4K7PX 3AS3A 1T22B 5GGRB 1KIPA 4L8BA 4ETYA 5E7FA 1F02I 4JFZH 4NHUB 3MACL 1JGUL 2DWEB 3LZFL 3THMH 3ZYZA 1NH6A 3W9DA 3WS3A 3QIWD 3TA3B 1ZT7A 4OQTA 3RTQC 2VABB 1BBJA 4S1DD 4K9EH 1VKXA 4WGWB 4H5SA 4ODUB 1NFIA 4UAOB 5DLML 1IGFH 3VE0A 1TPXB 2QKIB 3BP6B 5A16B 2PTTB 2BNRA 3VXOB 1HOCB 1S9XA 2DWDB 1P7QA 1EXUA 2HA1A 2PKDA 4F58L 4LCWA 1JIBA 1F5WA 3KYAA 5DRWB 2XPGA 4BFIA 5C0RL 5K9OB 3W2DH 2NY1C 4HCRH 1Y0LB 3VGDA 4X7SH 1R3LB 3M1BB 3LKSB 5I8CB 3GMLB 4IRJD 3QDJA 3MLWL 1X6NA 1SBBA 4XZUA 1RZFL 3NIGE 5DJXA 5JNYA 1RHHA 5F9OH 4NHUE 1RK0A 3SKOA 1WUNT 3MV8B 3SE8L 1P84J 2YPLB 5HI3D 4FNLH 3VFPA 1Z2KA 4ZOCA 3QG6A 3UTSB 1E6JL 2EKSA 2RAMA 1G7MB 5E8DL 5D2NA 5EG6C 2RHEA 2XQYK 4NZUH 3C5SA 3HZYB 4FQJH 1PY4A 3GFUA 3JSSA 4QHLB 4Z76A 1ZT1A 2P8MB 4PBXA 1JHTA 2FX9L 5KSBE 1FG9C 1FLTX 1L9NA 4NKOB 5CEXB 1K4CA 1I3GL 4HBQA 1AHWC 4MYWB 1NCNA 4AK1A 3MRLA 3K80A 2PXYB 4LKCA 4P5TB 5GGSY 3VDBA 4UILL 2F58H 3EW3B 4BFEA 3RWDA 2EIBA 3CLFH 4ZFOL 3WHXB 3NFNA 4HDIB 3IVKA 3MV8E 4IRSC 4JFFA 1J5OH 2YPLE 4F37K 1QP1A 1R5WB 4AEHL 1CL7I 3O2DA 3LN4A 4I0PB 3UTSE 1NAMH 3MRKB 2K3TA 4A2LA 1IE5A 5TDOB 4GBXB 3O8XA 4EI5A 1V8HA 5HHQA 3JUYA 1A6ZB 5C8JA 1D5BA 2J8UB 3OKNB 1QEWA 1WAAA 4XVJL 3O4LD 1M05B 2Y72A 2GK2A 3U48A 4G6JL 1F4AA 4WWKD 1BEYL 1JTOA 5CJ5A 4G9DB 1K3ZA 1I7TB 2AJSL 4HKJA 2X4QB 4HUVA 1MCSA 2UZIH 4EOWL 4PJCA 2CK0L 2IWGA 3OKMB 1RPQA 3P4NA 3VW3L 5B39B 3IJYB 3IJSB 2B5IB 1ONQA 3K74B 3TBWA 5I6XB 1RUML 1SYSA 2Y25A 3ZLQC 3QDMA 4UT7L 2J8OA 5I30L 2X5PA 4M00A 4PRHD 1BFOA 1CFTB 4Y16A 2AXGA 4U3XA 3MO1A 3CZFA 1H5BA 1RY7B 2J8UE 2OXHA 3QUYA 2HJKB 1IGIL 4FFVC 4JDVB 3TVMA 2CRIA 5D7LD 3L6FA 1WBZB 3QJFA 3VG9C 3AAZA 4FFWC 2YMXH 3DMMB 1G6RL 4PRPD 5D7JC 4HUXA 5IJVB 3S37L 1KT2A 3RL1A 4K3EH 4E5XA 1QVOA 4WFGE 1DJSA 1T1XA 3ME0A 3OAZH 4J2XA 3CU7A 5DO2C 4ALAL 2ICWJ 4G8EA 3GHBH 3WS6A 2PW1A 1Z0MA 2Z9TA 3FONA 5IM7B 3VXSB 4XI5C 3QB7C 4NZTL 1HIML 1GCFA 1NJ9A 4OZIA 3WXVL 5HDQH 4OZHA 1YYML 1RZKL 4YH6A 3PWPD 1PG7H 3KNBA 3JUZA 5IW6B 2H9GB 4K7FB 1SJXA 3V5KB 5SWQA 3PABA 5J3HD 4DN4L 1S7RB 3O9WB 2X89D 4OGAC 1FZMA 4K94H 5E8OA 5BO1L 3MLXH 1QSFA 5EBMB 2D9QB 4OQ1A 2ICEA 4QY8A 5JW3L 5I1DB 2WBKA 4OGYL 4X6DB 2MPAL 1A4JB 1C1EH 1AQDB 1RHFA 1S7TB 3ULSB 2NNAB 2G5RA 3KDMB 1FL6B 4G6AC 2CDFB 1KEGH 1JV5B 1K9TA 5GRXG 3VD5A 1RUPH 1FGNL 4HCRA 4U0RB 3RZCD 1PAMA 5IR1A 4W70A 1JN6B 4GMTL 1AR2A 1M71A 5T1MA 5GZOD 5BV7L 2BMKB 3BP4B 4OM1H 2BCKB 5GRYA 4H1LG 4P99A 5HYQB 5CEYA 1ZLWH 3SGKA 4CUCA 4UTAL 1U8LA 3T4YA 4HG4K 1MJ7L 3STBA 4AQOA 3RGVC 3MSPA 1F90H 3AC0A 3E3QA 5IGXH 5TGBB 2R8SH 3MLZL 4YC2B 3TBYA 1UB6A 5L88L 2JIXA 2IBZX 3WUWG 2NY0C 3BKJL 4UDTA 4MHHG 1J0HA 3MBEA 2Y9RT 4M62L 5JOPD 1KELL 1K8DA 3FCTA 1T03L 1XZ0A 1UH3A 4MMZC 2F5BH 1U3HB 3ROOB 3IRPX 3DETD 3KJ4C 4UZGA 1GOGA 2DKMA 1A47A 4OKVA 3MREA 2VKWA 4EDXA 2QSCL 3N1MC 4L4VD 1WV7T 3FMGH 1QO3A 3GIZH 4S0SD 3ARQA 3PL6D 4JPIB 1FDLL 3ULUE 4PJIA 2DLFL 2FJGB 4I18C 4X4ZA 4MAYA 3UTZA 4I3RH 4ORGB 1RVFL 5ANMA 4HF5L 1YECH 1AGBB 3HB3C 3G08A 4YPGA 4HKXB 3G5ZB 1GC1C 4CAGA 5JXEC 1UJ3C 2JK5B 2XZQL 3GSUA 1OQOA 4HXBL 5LBSH 1W2KT 3RWIB 5DUPL 4LSTL 3MCG1 3IDMB 5J7CC 5JIIA 2G2RB 5TE4L 1LO2L 3TIDA 4QEGA 2IALB 3U82B 4CU6A 3O3DA 1NC4B 2V17L 5HHXL 2EYTA 2VLRB 5D9SB 1MFBL 4QRPA 3CXHK 1OGAB 5I76A 5DXWA 2HFGL 4X83A 1T6VN 5IV2B 1KTDA 4L5FL 2P8LA 3HRPA 4MMXC 5DZOA 4JM4L 3VWJB 1XCQA 1RU9L 5C0FA 3ARFA 5A43C 2XT1B 1S9WB 2Q76B 1RFDH 4LHJB 1G0YR 1U8OB 1MRDH 1IEAA 1IKFH 1CZ8H 1EHNA 5JHDD 2VIRB 3P4MB 4DZBA 4HZAA 4P46D 4TUKL 1N8ZA 5F1KC 5EWIL 2B0SL 3MUHL 3RVTD 4X5WA 2X4RB 1D5ZB 2PYFA 4OD2B 4L4TB 3T2NH 2DQGH 3I75B 2Q86A 4WI6A 3ULUL 3HG1D 2XQBL 4NO3A 3ARSA 3WFDH 4R7NA 4XX1G 3MJ8B 2UVEA 2AV1A 3NPZB 2VLRE 1FNEB 2P24B 1TMCB 1OGAE 3HZVB 2XKUA 3CXDH 1J0KA 1JHKL 1DP0A 2EE3A 5DMIL 4RMSA 4NBZB 3VFUA 1HSAA 1B0GB 4HS3B 3LIZL 2P46B 4CRPA 2ZCLL 1P6FA 3K1DA 4ZFZA 1FLRL 1BVKA 4O9HL 1VFBA 3X13B 4CMHB 2CDEB 2ENYA 4LVOC 3RKDC 4N0UA 1NDMB 4HHAA 1G7JB 4U6YB 3QEQA 3W9EB 4L4TE 4MS8D 3GSQB 4J12A 3SDXB 1T1YA 3H42H 3V7AG 3PF2A 2FD6H 1QR1A 2KDGA 4DGVL 1N3NB 4NC0B 1PQZA 1RV6X 2P8PB 3UBXA 3P4OA 5JUEH 3BZEB 4ODBD 1R3JA 3D3VD 4GAGH 3TBTB 5GGVL 4CVWA 4KUZH 4OD1H 4OFYD 3ORJA 1JNLL 4RFNC 5D6DC 2LTQB 3JWOL 4M1DH 1KPUA 3EYVB 3QUXB 5C0JA 4KI5C 2IAND 1C5BH 2F74B 3LRSB 1KJVA 5DRNB 5SWSA 1UG9A 2Y5TB 5DRXB 1R5VB 2O5ZH 2NX5D 3SDXE 4FFYH 1EGJH 1EO8H 5K9QI 4XP6H 4EUPB 2WWKT 3P9LB 5TQ2L 1D3CA 2HVKB 3QIUC 3CMOL 5J6GA 4TOYL 2YRPA 3KWWB 4CADB 1BQLL 4JRYB 4M6NH 1V3JA 5A2KH 1IC1A 4M48L 4TSAH 2F5AH 2ZPKH 3QI9C 1CICC 3O11B 3OKEA 1NGZB 5E8NA 1D9KB 5BV7C 3GJFB 4KK5D 1RULH 2X70B 1PD6A 1YQVH 1CXIA 4BQ8A 1CL7L 3P30L 2PR4H 2EE9A 4EVNA 3FB6A 3LDBB 4JHAL 3VXUA 1PG7X 4WV1A 4DUWA 5DTFA 5JW5A 3F58H 3V4VH 4KJPC 4R97B 3FFCB 2VL4A 2DMKA 1I1FA 3G6JF 2L0DA 5EOCL 4N5UA 2XIDA 3D85B 4NRZB 4A6YL 3PGFL 4JRYE 1JMZA 3O41B 3IU3A 1FFQA 3RPIB 1XGQB 3S5LA 5CIPH 1F00I 5ALBL 2Z8SA 1IAOA 1P5UA 2ZUQC 5GRVL 2XZCL 3HZKB 4K8RD 5E99L 1I3UA 2DF3A 1GGBH 3PGDB 3VI4F 1I7RA 1JZ7A 3ILQC 4Y4KA 1P84K 3UTPD 1AJ7L 3ESUF 5KS9F 4Z7WB 3VXNB 5C0GB 3FAXA 3GMPA 4CJ1A 2VNCA 1G9NC 2UYLA 2ORBL 3VGHA 3DBXA 2Z31D 3P73B 5JPNA 3MBXL 5DUBB 4UINH 2AXHA 4NQXA 4X4XA 1UENA 1NUFA 4Y4HC 5T1LB 2AK1H 3NFPB 3S98A 4FABL 3VFWA 1Y6KR 1WZ1L 3OKDA 2HJLA 3QXDB 1BD2B 3AS2A 1MCRA 2YSSA 4K07A 4LLUA 2DQIH 5E8PA 1S7WA 1SM3L 5E5RB 4ERSL 1A7BA 1I9RL 1ADQL 5CGMA 1FZKB 43C9A 3AFLA 1C12B 6FABL 2OTWB 4EN3A 3L3GB 4NSKA 5DK0B 4H8WL 4R7DB 1J87A 2BRRH 4HGWA 5DJYA 5EBGA 1JMXA 2VH5H 3LPFA 4NBXB 5GZNC 1OP3K 1IAKA 3RIAF 3P9MB 3C6LA 1A9EA 3IXAA 1SJHB 2XOTA 3HC3L 4YZFF 2B2XH 5F9WB 2CDGB 2AJZA 3GIVB 4RWYH 4X7DC 1JPTL 2O61B 1AQKH 5L6YL 4NQCB 3RX5A 1OWRM 4NQVA 1BD2E 1MUJB 5AYUL 1EHAA 1T04B 5DGRA 1X4YA 5CJQH 4DUXA 4U1SB 3IJHB 5KBNC 1FORH 3NH7L 3Q6FA 1LO3H 4KRLB 2IPUK 2LQRA 3RZWA 1O0VA 3M17B 1SMAA 1S7XA 1CD1B 3EO1B 5F7EH 1X6LA 2WQ8A 3BO8B 2FIKA 4B7IA 1NGWB 1SYVA 1UXWB 4I4WA 3MLTA 2X09A 3SDDD 1IKNA 1LILA 2DQJH 3OAYH 3SN6N 4F2MA 4GRMA 3BMVA 5E9DA 4PRIA 5F88A 4FG6D 5AZ2L 2MHAA 3I3BA 1FVDA 3TZVB 5IHZB 3WL9A 1UM5L 2AAVA 4NQCE 4MCZA 4JKPL 2WLYA 1FO0H 2V2XB 4PJFE 2VDOL 4KY1L 2XTJD 4NOFA 1FBIH 1EGJA 2VZUA 3QCUH 1LHZA 3QR2A 5GGRY 1BVLB 5D1XB 5BJTB 3V5DB 3P0VL 1MCNA 1PW3A 1MCCA 5EOQH 5FM8A 2C1OA 3R0NA 5EOTA 5T3XH 4ZNEA 1K5NA 5C9JA 5EIQA 4R0LC 3MXWL 5T1KD 3WFCL 1CLCA 2PO6A 2DICA 2R0WL 1JK8A 3O6LL 1DQJA 1ZHBA 5DSCA 3WNNA 3KPOA 2HH0H 2I9LA 4QXTA 5IESL 2NZ9D 1D6EA 2JB5L 3FT2B 1QRKA 2VLJB 4L8BB 3BOVA 1LNUA 1XGUA 3SE9H 5DK3A 4BQBA 2EDFA 4P5TD 4HX1A 5I15L 5C0AA 3W9DB 1IC7H 4XPAL 1RIVL 1D5XB 1ZT7B 5JO5A 4QO1A 1BBJB 1SY6L 2H2PC 4H5SB 1NFIB 3VE0B 3X3GL 2NXYB 4K7PL 4ESKA 1PYWA 1S9XB 4YHIB 5LGKA 1P7QB 1EXUB 4M7LL 3T0EA 1A3RH 1NUGA 2YN3A 4LCWB 3U9UB 2XPGB 3LKQA 2WNGA 3RU8H 4QOKA 3K2MC 2ARJQ 2OK0H 3MUJA 3TCLA 5CIPA 2KZ1B 5A2FA 1WEJL 4HIJA 3SKUD 4GMSH 1AD0A 4I0KA 1VA9A 1IZJA 5DJAA 5FYJH 1GAFH 2WWKO 4P0DA 2XRAL 4XZUB 4ZD3H 2IH1A 2ILLA 4XNXH 3KYMB 3DX7A 5DJXB 1RHHB 2VLJE 5JNYB 5IVXF 2HKFH 2MWCA 3GKWL 3AY4A 1RK0B 4OD3H 4TPRH 3VFPB 5B38A 4KJYB 1DN0B 1HE7A 5H35A 3QG6B 8CGTA 2EKSB 4I48A 2Z0BA 3L95A 1TJGL 2ZG3A 4JR9L 3S9DB 5E00B 1XFPA 3KPNA 5D2NB 3C60D 2BNRE 4FQ2L 1O5DT 3C5SB 4TSCH 1IT9L 2VDML 3BQUA 4P4KD 3HHRB 4LCWE 3ES6A 2LU7A 3G6DH 4U31A 1JHTB 3RDTD 3EFDH 1BPVA 2XWTA 4M6OL 2B4CH 3RVUC 1QSEA 1KC5L 1ZANH 3AS0A 1U9KA 1XGRA 3MRLB 3QDJE 4WHYG 4LKCB 4MXWL 1G7LA 3TN0A 2FO1A 3RWDB 1BIHA 1AKJD 1BZ9A 3IVKB 4KH2A 2VLLA 4JQVA 4ENEC 3NAAH 1MRCH 4JM2C 4NP4H 3IT8D 1KGCE 3IU4L 3BRFA 3PQYA 3KLHC 4HXAH 2FBJH 5D2NE 3O8XB 4X7TA 4EI5B 1A6WH 1OAQL 4G6FD 5HHQB 2ZG1A 4HPOH 4G80B 4JREC 5C8JB 1BZ7B 1J9CT 1XIWB 4TVSa 1QEWB 1RMFH 2D7PA 2R2HA 2D4FA 1NL0L 4I3SH 4N90D 4GT7A 3CVIL 4P3DA 4C58B 3C5ZA 2GTWA 4UV7L 5C7XH 4HKJB 5D1ZA 2H8PA 5LG1A 4P9HL 5HVWA 4G7YL 4PJCB 1QFHA 3P4NB 1F2XK 4JFFE 3OKOB 4FN0A 1KJMA 1ONQB 4Y89A 3TBWB 3UBXI 1SYSB 3QDMB 2O26U 5TJWK 3T3MF 1U6AL 3RI5F 5T5FL 3VRLE 1BFOB 3I3DA 1YN6A 3MO1B 4KTDL 3CZFB 4KAQH 4PJGA 5JQHC 2HFEA 4G5ZH 3DIFB 3QUYB 1C8PA 1IRAY 1WAAE 1R0AH 3LKOA 4ZUVB 5HHVL 3L7FA 2BZDA 2ED8A 2GYSA 3TVMB 1FO0A 2Z8VC 4YK4B 3U1SL 3QJFB 3RVVC 5I19H 4HUXB 2GK0A 5KS9A 5F7HA 1KT2B 3RL1B 3X14A 4GRLB 4PYHA 1QVOB 1T1XB 4PJCE 3ZTJH 4JG1H 1FFNB 4G8EB 2F53D 4Z0BL 2PW1B 3D0VB 3HZMA 5IVNA 2D0FA 1JPGA 2EYSB 3FONB 3QDME 3MGOA 4YWGL 1NJ9B 1FV1A 1KLUB 2EH7H 3HI6H 5D7IA 3KNBB 4Q9BA 2ZCKL 5KSUA 2ATPB 5SWQB 4HLZH 4DEPB 3PABB 4IOSD 1MLBB 4U05A 3TESA 1BWWA 5E8OB 5D72H 5BS0D 1FZMB 1TETL 1E4XH 2COQA 2AJYL 3RWFA 4KMLB 3KHOA 1FPTL 1QSFB 4RISH 4XCFL 2ICEB 4QY8B 1D5MA 2X4NA 1M7DB 2YBRA 3N1GC 1DBBH 4IRJC 4PJAA 5IFHL 1OP5K 4TVPH 1EJOH 4HMCA 4LSVH 2HG5B 4G9FA 5F70A 4MAUH 3VMPA 5GRJH 1CXFA 4XBEH 4N0YL 5GRZA 4OLZL 15C8H 3CDFA 2IAMC 3WKML 5IR1B 2NY6B 3QJHA 4P5KA 4OV6F 4OZHE 3G04A 1M71B 3O6FA 5T1MB 3V4UL 3QDAA 2BY3A 1S5IH 3OGOE 3PDDA 1A7OL 1CTOA 2B1AH 5A2JH 4I9WE 3AXLA 1MEXH 1U8LB 3T4YB 3L5JA 4KKLC 1T89A 2CLVA 1QSFE 5FKPA 25C8L 4NCC1 5GRUH 2VISA 4KUCF 4HEME 2AKRA 3TBYB 1UB6B 2JIXB 3QH3B 5K59E 4Y88A 2XY2A 4UDTB 1ULVA 4LSRL 2ITDA 1K8DB 1I3RA 4LLMB 3FCTB 2HT3D 5DWUL 3PP4L 5E4IA 1XZ0B 4Y5XB 4BQ6A 1FH5L 4HIXH 5GGVY 4F33B 4OKVB 3MREB 4EDXB 3WE6A 2IBGA 3GRWL 2A9NH 1DEEA 3ZDYE 2XN9A 1OTUD 1NBQA 3CVHL 1AE6L 4ZSOA 1OAXH 4Q6IC 2A38A 3AM8C 4K23L 4MAYB 3UTZB 1KFAL 2Y6SD 3DURA 4YQXH 5ANMB 3G08B 4YPGB 5GGQH 1WT5C 4WWKC 5AAMA 2H3NB 2P45B 3HNVH 4LP4A 1NAMB 3E3QE 1Z9SA 3L9RB 4CN6A 3ARBC 3EHBD 3LPWA 3WFEH 3ZHLA 3TIDB 1XF4A 1P6AB 2X1PA 3KPSA 3O3DB 3HC4L 2VO5A 1W72L 4IM8A 3THML 5IWLA 4QRPB 4JN1H 4OLVH 3RQ3A 5I76B 3N1PC 1YEGH 3EOTH 2P8LB 4MNQD 1XCQB 5C0FB 3VH8A 3ARFB 1T1WA 5E2TL 1BBDH 4PJIE 3G5VA 2FNBA 4KQ4H 4ONGL 1IEAB 5J6HA 3ZE2F 5B39G 1NCAH 5ANME 3V79C 4U2YA 5HPOA 1N8ZB 4ZMAT 5FA3A 2DQTH 2P44B 4X5WB 5DFVD 3K2UH 2WIIA 4FZEL 2PYFB 5IBTH 2Q86B 5MEOA 4NO3B 5I2IA 3JTCA 1MHEA 4R7NB 2ZJSL 2AV1B 1CGXA 4QHUA 1LEIA 3FT3A 4FQIH 4QRPE 2GQHA 5IVXA 3VFUB 4WHCA 1HSAB 1E4JA 1UWEL 4ZFZB 2P5WA 3B9KD 4DGIH 1BVKB 4AEIL 5J3HC 1KIQA 2A83A 3WIFA 4G43A 3EZ8A 1VFBB 3WN5C 1LD9A 3W81A 4X0KA 4TTDD 2VUOA 4XCNA 2BSSB 1H15A 4HPYH 1CFVL 4N0UB 1WQVT 1MI5A 5ICYA 3QEQB 2HMIC 5GS2D 5A40E 4ODSL 1GGTA 4O2EA 2ZUSA 4P23A 3MJ6A 4PJEF 1NAKH 2H41A 3MODL 1T1YB 3ROLA 5GGTL 1IEHA 3KYKH 5EC2A 4PRBA 1QR1B 3PNWA 2ZWLT 3QUZA 1F4XH 3OAUH 3RZCC 1FZOB 1PQZB 3B3IB 3UBXB 2QADD 3ARDA 3P4OB 4PGJA 3QCTL 3TT3H 4XPGH 1NAML 1R3JB 5GZOC 2JJSA 4MQ7A 4G8FA 4PJ8D 5EU3A 4NPYB 4NNXA 1MF2L 3LOWA 4PIRF 5TDNA 5I74C 5SX4H 1I1AB 1X5YA 2YA1A 4N1CA 4FTVA 1CFBA 5LCVL 2ZNWA 4TNVF 3VWKD 5JZ7D 1RUAL 1KPUB 1KN2L 5C0JB 1GRWA 2VN4A 1EHXA 1KJVB 2ADGA 2EKJA 2W9LA 5SWSB 4M43L 2X4UA 3N9GH 4N0UE 1T2JA 1D7FA 4NFBA 3QEQE 1S9VA 4V1DA 4JQIL 4G3YH 4JFPA 3BAEL 1XEDA 4K3JH 1WFUA 1FVCA 4GXVL 2VC2H 3N1FC 5DJ0A 3WNKA 1F4YL 4ZDHA 2VZSA 2IPUG 1BQSA 2EH8H 4J8RA 3MMEA 4NO0A 1KCUL 5EU7C 3N50A 4LLYA 1EO5A 5J6GB 4FXLA 2YD3A 4K8RL 2BOBA 3IF1A 1NSNL 1MCPL 1IAIM 3Q1SH 4G8GA 3HNTH 3PL6C 1WIOA 3QPXH 4HS6A 1F2QA 4PP2A 4XPTH 4HK3N 1G7QA 4O2FA 3OKEB 1G9ML 4UT6H 5DVKA 3GJEA 1KENH 4JFYB 4N5ED 5E8NB 5SV3A 2OJZH 3QFJA 4JY4A 3DX9A 1BD2D 4PLJD 3OQ3B 3QT2A 1Q38A 5SWSE 4PR5A 5HHOA 4IMKC 1J1OH 3UJTH 1F45A 1JF5A 2NR6C 3VXUB 4KKCC 4JPWH 5DTFB 4HAGA 4DCQA 5JW5B 2DJ4A 3ULVH 3NZHL 4OCYH 2A1WL 1F3JA 4W68A 3U7WL 1NC2A 4OGXL 1NPUA 1AXIB 5E94A 1I1FB 1GGYA 2VXQH 1QRNA 3CCHA 1YMHA 2ZKHH 1HHGA 4HWNA 2DB8A 2APTA 2YS4A 2VDNL 3PP3H 5MEND 4M7KL 4CMMA 1A9BA 2N7AA 3S5LB 1CE6B 1IAOB 5HYIA 4OSUH 4F15B 3FO1B 1V3KA 5D6CA 3BZDA 1I7RB 3ZTNL 1J0IA 3LD8B 2A6JA 4Y4KB 3MLRL 1HHJB 1SEBB 1QYGL 3QDGA 3GMPB 3RVTC 2Z93A 3PHQA 1HSBA 1OOAA 1C1EL 2UYLB 2XTLA 3VXUE 3DBXB 1A3LL 5JPNB 1RIUH 1WK0A 2CMRL 4NQXB 4X4XB 4R6UA 4YDIH 1NMAL 2JCCF 3I6GA 4YIQA 4Z7OF 1UA6H 4D0BA 4Z7VF 2D4DA 2V2TA 2E3VA 3VFWB 5EA0H 3MNZA 3DUSA 3OKDB 3VFGL 3QA3A 2HJLB 3MLVL 1T21A 3SKJH 2YSSB 2E27H 4LLUB 1HQRB 4KFZC 1S7WB 1H3TA 4K7PY 2NXZB 5H2BA 43C9B 1UACH 4Z7QE 4LPCA 1L6ZA 4NSKB 3CZJA 5DD6A 2QHRL 4BM7A 3WLWD 5LXGH 3R1GH 4HGWB 4DKAA 2E5EA 5HHMD 4JFED 1A5FL 1CN4A 3BEVA 4MS8C 2HTKD 1IAKB 1BAFL 2NY4D 3C6LB 3IXAB 1IGJA 2DIJA 2AJZB 4LRIA 4PGDA 1DANT 3QFDA 2ZUYA 2D31B 1T0MA 3LH2H 4QXWA 1ZVYA 4HIEA 2RIKA 4NQVB 4MZ2A 1ND0A 2X1OA 3DTXA 1LE5B 2EDTA 3MV01 3CLEL 1MQ8A 3Q6FB 5I1JL 1R5IA 5DK2A 3QXWA 4LBEB 4PY7A 2FIKB 3H9SA 4QCIB 1SYVB 2BNRD 3H2WA 5EB9A 2YC1A 3QNYA 3BPCA 4I4WB 3BXNA 4F2MB 4GRMB 3HUJF 5I1KL 5IMMA 4PRIB 4M7JL 2AJVL 2MHAB 3WL9B 2CJUL 2WQRA 1IQDB 2DMCA 4MCZB 3QDJD 3BVNA 4UUJA 5KZCB 3NCFB 4E42B 4M7ZC 1YEKH 5GS0D 3MRCA 2FO4B 3V2AR 4OFPA 4EUPG 4AEFA 4ZXBA 1F4HA 1XAUA 4WDIB 2FJFA 4KK5C 1Y6NR 1MCKA 2WINA 1HKLH 3OXSA 1U8QB 5EOTB 3BPLB 3EO0A 1INDL 1H3PL 1K5NB 1N64L 4OB5L 5C9JB 4DTGH 4WTXA 4WWID 4ODTH 1MPAL 1JK8B 1DQJB 1ZHBB 5DSCB 5DT1H 3KPOB 2R0ZL 4QXTB 4PRIE 3P11L 4ZG1A 1D6EB 3O6KL 3F62A 5CEZH 2FX8H 4HWBH 3WIIH 4C56B 1LNUB 3MX0A 1KYOJ 4POYA 1KTLA 3B9AA 4HX1B 3GGWA 4XHJD 2Q3AA 4F8TA 5JO5B 3BI9X 4K8RC 5ISZA 4JFFD 3MPCA 2MQ0A 2CKNA 1KLFA 1PYWB 1EK3A 3KLDA 1ZEAH 3T0EB 2GSIB 1G9MC 1OB1A 3LKQB 4ZNEE 5ACLA 3HKFA 4QOKB 4LLVA 4MB5A 3S88H 3TCLB 3HE6A 3KPLB 5CIPB 4HIJB 4KDTA 4DZ8A 5I8OH 5IBLD 4JB9L 5IQ7L 1AD0B 1JPSL 5DJAB 1GXEA 3KPTA 1RZJH 5HYJB 4RCAA 2IH1B 4R4BA 2GJJA 3DX7B 3MV9A 1NCTA 4C56E 4PJEA 1II4E 1H8OA 4MVBA 3AVEA 1GJIA 4S1QL 4OAWA 5B38B 5C0AE 5F97E 5I1GH 2DQHH 2NY5H 4MXVF 1SHMA 4UNVA 3OAZK 4I48B 5KSAA 3BESR 5BW7C 3L95B 3CFCH 5J9PA 1ZT4A 4XC3L 3TFKA 1OAZL 3KJ6H 4U1HA 1U42A 2JJUA 5DQDL 5GJTH 3T0EE 2B7DT 1C5BL 4FQCH 4FMFA 4Y16D 2E7MA 1A7QL 4QOKE 3SOBH 5ABDE 5GS1A 4J7RA 4XP9H 1CLOH 2XWTB 3QUYD 5CLTA 3T0BA 1QSEB 2YUWA 1XGRB 2F9BT 5LWYL 1Q0YH 4L8DB 1G7LB 2A6KA 5DURB 4PV9A 4ELKA 2OP4H 3JWDL 3U7YH 3OL2A 5KTEH 4O51A 1KLGB 3GBNH 3MROA 4CJ0A 2VLLB 5DD3H 5GHWH 4JO1L 1E27A 4AENB 2DBLL 1NMBH 3PJSA 3PQYB 4DQOL 1NKRA 2MTPA 1FQ9C 4OBRA 3LKRA 2OL3H 2R2HB 3BN3B 2X6MA 4UAOC 3O3UN 4NKIH 3C8HA 1ITBB 4P3DB 1BM3H 1TTFA 3VGGA 4JFQA 2WZPD 1QSEE 3M8OL 5GISL 2KL6A 4I9WD 5IEHA 3QO0A 5D1ZB 1ZLWK 4GKSA 4Q6YA 1UWXK 5J0BA 1HZHL 2L7JA 2I25N 1E4XI 4U6VL 5KSVB 1KJMB 1MJUH 1X5XA 4AMKH 2XTJC 4LU5H 4ZO9A 4APQA 3WIHH 2YPVH 3PQYE 5E5UB 1HQ4B 4JFDA 3Q5YA 4KWUA 5FM4A 1C7TA 4PJGB 5M95B 2HFEB 4MNGA 1ZMYA 5D1QA 2D7TL 2GJ6A 3LKOB 4B7LA 3NABH 4L8SB 4DOHB 1E6OL 3L7FB 4N8CH 2AJXH 2Y7QA 1FO0B 3LQAH 4Y2DA 2VDRH 3NCMA 4LQFH