1RJYA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjyA01
2XTJE 3RA7L 1KTLA 1T04A 1IKFL 1IGCL 2JIXD 3SO5A 4S0TD 3BSZH 3A0OA 3IXTA 2EZ0D 4U1MA 4CMMB 2DBJA 2NY3B 3MRPA 3RNKB 4DOHB 1JNHB 5HHQA 3HNTH 4XVJL 1UXSA 3VFMA 3O4LB 4I0KA 1U91A 1UWEL 2KPNA 4U1JB 3TCLA 4UQ3B 4Y4FA 2EYSA 2FCBA 1FCGA 3D48R 1TZIA 4Z5RB 2HRPH 2MQ0A 2ADJA 2BC4B 2UUDH 5F1IA 3QNZB 5DGQA 1C5BH 4HLZH 4KROC 1J0YA 1JRHI 1OAXH 1E6OL 3MV7A 1U8LA 1ZT4A 3V4PL 4YBLC 3VA6A 2I60H 4I1NB 3P9MB 1NBQA 1FL5A 5JQ6L 1JPGA 4BH7A 1T2JA 4LL9A 2FB4L 1DANU 3PDOA 1FG9C 4PJGB 5IGXL 2FWOB 4CU6A 1VHPA 5EBLB 1XH3A 4XPBH 5E2VL 1RFDL 4EDXB 2J2ZA 4QCIB 3IDMA 3OR6A 1UB6A 4IRSA 4PTUB 2VLJA 2VLME 2X4SB 3QIBD 1UXWB 3MJGX 4K7PY 5EFIB 4L3CA 1T4KB 4HS8L 1IGIH 2XA8L 4LCCC 1OGTA 2OXGA 4MQXD 4X5WA 5D2NE 1CGWA 5LBSH 4LSTL 4MS8D 3TIEA 4YHMH 4RGNE 4JM2B 2ARJA 3S35X 1EERB 1NGYB 5DVKA 3L5XH 5EC2B 5MEOB 4KJPC 4KK9D 4MNQB 3RZWA 3E2HB 4LARH 5D5ME 5DJCB 5ID1A 3ALXA 3RY5A 5IJVB 2PKDA 1MNUL 2HAZA 3WKNA 3QDMD 3MXVH 3SCMD 3JXAA 4KV5F 3BZEB 3H9ZA 3QUXB 2C5DC 3P3YA 1KJ2B 4I2XE 2VLKA 4RBPH 3T0EB 5F7UA 5IW6B 5ESVB 2ESVB 3T2NH 3QRGH 3WS3B 4MD4B 1NFDE 1E4WL 3KXFD 3DV6A 2YA2A 5IKCB 1UH3A 4IOSD 5DQDL 2EDOA 2Q3AA 3RGVD 8FABB 4BZ1H 3JWDL 4OM0H 4PJEB 5HI4D 3WDJA 3U1SH 1OP3K 4UTBL 4JFFA 4TUOB 4D9RD 1G6RH 3CUPB 2BCKB 5JHDE 2YK1H 3CPLA 4HWNA 1U93B 1WISA 3BESR 3L6FB 5ICZA 3KHQA 4WENB 1S7SB 2D7OA 1LILA 2FR4A 4S1RH 4QRSA 3TVMC 2EYTB 2MKWA 5F6IB 5DHVH 5HHME 1F42A 3DGCR 1K4CA 2R4SL 3SE3A 1LE9A 4FQLL 3O41A 1MHHA 3HAEB 5C08A 3TF7C 3IAQA 4PLJD 1R5VA 4NHUA 1XR8A 1FNGA 3S5LG 4U1HB 4PV8B 1I7TA 1YMMD 1IT9H 4ODWB 1FYTA 4MCZB 1G7JA 3LS5L 1NKOA 3U46A 4QY8B 5HHVH 4UB0L 3VD7A 2NY3C 5CMAA 1ZV5A 3VG0L 4ZAKB 1W0VB 3DVNB 3I3EA 2XPGA 1DANT 5L2KD 3WNMA 2ID5A 5C0BD 1A7NH 1PY4A 4L8CB 4POZD 4BSJA 4LSSL 2Q86B 5FDWA 2J6EL 3V2AR 4PJHB 4HUWA 2X09A 1I9EA 3DETD 3HUJB 5CZXD 5F7WC 1QFPA 4YHLL 4LHUB 3UC0L 4LLYA 2G5RA 4PUBL 1CFNA 3IFPB 4FS0A 2FBOJ 3BOVA 5EU4B 5GXBB 3ILQC 1Q0XL 1QNZH 5B38A 4ZXBB 3GSWB 4L9LA 1CD0A 5CD5C 4QF1A 5BZDB 5C6PB 3CXDH 3DVGB 2G75A 3OXRB 4HC1A 1XGUA 4F7EA 4G6AC 3HNVH 1OTSC 4KXZI 3SE8H 1KB9J 3QJFA 2D9CA 5ALCL 1T2XA 5C0CE 3VXUB 3JV6B 4HFWA 2DQHH 2ICWA 4CBPA 1HK6A 4GLRH 5GGVH 2B0SL 3EO1A 4JN2B 3D0LA 1VFMA 3VJ6B 5JORB 4W6YB 1W0WB 4HIIA 3CLEH 3L9RB 3WUWG 1YNTB 2NY6B 1MI5B 3Q3GB 2H9GA 3CVHL 1MJ7L 1BEYH 2IBZY 3LEXA 4CNIB 3A6CL 4JM2C 5EUOF 4ETQB 3IT8D 4TVPL 1JF1B 1CK0H 4WU7B 4NM4L 2IANE 1BJ1H 1R3LB 1YQVL 3IVKB 3O3EB 1FN4B 2CIIB 1VEOA 1JPSL 4J12A 1WV7T 3MV11 3BWAB 2UZIH 4LIQE 2F54B 2W9EH 3OKDB 3NFPB 1NCBL 4IDLA 4JFXB 5MP6H 1A9EA 4K7PL 3REVB 3TPUE 1Q0YH 3HI5L 1S5IL 4HPOH 5BVJB 3QUXC 1JNLL 3P4MA 3TA3D 3NCYP 3TESA 3T0EC 4OI7A 3P0YL 2HFFA 1J5OL 4ZFZA 3S35H 3T0WA 3OXSB 3VFGH 3TN0B 4PJBF 3UTQA 2VZTA 1W8NA 12E8L 3QH3B 4XMLH 3IF1A 2FEDC 4NP4L 5DJ2B 1RZGB 2XZQL 2HLFD 1YEJH 1DN2A 1B0GA 2R1YA 1CDHA 1YDPB 1X5XA 1W72B 1ZHBA 2AJSH 3W2DL 4S1QH 1NGQL 1VFBB 5TFSH 1MUJA 1DN0B 1UENA 1F58H 1G7PB 1MFAH 5E8PA 3BD5A 4RAHA 1OW0C 1FL6B 5CP3H 1YPZA 25C8L 5CSZA 2VB5A 4HIHB 4HW6A 1MAJA 3U0PB 3U7YH 2FECL 1VSCA 5I8EB 1FG2B 1CN4A 4AEHH 1KGCD 5JXAH 2Q7NA 3CK0H 1GC1C 1X4ZA 1UZ8A 3MLSL 3KYOA 3FRPA 4P46B 3E0GA 2M1KA 1QACA 5I1GH 1J8HE 1NCCL 5BW7C 2UY6A 4OV6F 4YQXH 4NQVB 2RAMA 5FOBB 5E9DD 4HH9B 1CVRA 1XF5B 4YUEL 4FFZH 4PP8C 1A6TB 5HI5C 5K9OB 1GYAA 1EVUA 5IT2L 5EZLA 3UJJH 3V7AG 1OSZB 1FSKB 3ZTJG 3IJYB 3OG4B 2EIBA 4P99A 4YXHH 3MYJA 3MNVB 1L7TL 2HYMA 3C8KA 5AZ2H 5KS9E 1OOAA 3TT1H 6FABH 4WCYH 4HKZB 4H25B 4EJ1C 3MRQA 3LDBB 1OB1B 2YUXA 4NFBA 2VN7A 4X4ZA 3IDNA 4N8VG 1CIUA 2K7QA 3O8XA 3SGJA 3GUTB 1PD6A 5F9OH 5E8DH 4JFZL 4IS6B 4DGYL 4YHYB 3PG2A 1HIML 2Z4QA 1CU4L 4IOFC 2BNRA 1KFAH 3GSOA 3BVNB 4HWEL 4KDTC 5I0ZA 5EBWB 1N4XH 4JY6B 4I77H 4K7FB 2J4WL 4QYOA 1P2CB 4L8BB 4KK5C 3O2WL 2VDOH 4OLZL 4HV8B 1RJYA 1A7QH 2BMKA 3G6JB 5ETUA 4JB9H 1ZLSH 4BH8A 3RFZC 1RUML 4HK0B 3RBGA 4EN3D 4QNPE 4N1EA 1CQKA 1M05B 4QHNA 2NY6C 3B8YA 1T6VN 4M7KL 3BGMB 3BQUB 4LVEA 3VCLB 5DMYA 4BKLB 4DFHA 1KIUA 4PGBB 1UA6H 1IVLA 1D9KB 2X44D 1KELL 5EIVA 1I1AA 4RMSA 3T1FB 1ORSB 4NOBA 1P5VA 3WL9B 1IFHL 3V6FB 5ITFA 3RWFA 2W0FB 4Y8AA 3O6LL 4S1DC 2MCG1 1H8NA 3BHBB 4KTEH 1WVZA 4MA8L 1MH5B 2VAJA 1HDMA 5CILL 4PJCB 3BAEH 3FOLB 3LEYL 3SBWA 4MLIA 3TN0C 5EUOE 1FH5L 5TPWH 2EIZB 4Y4KA 2IPTH 3QI9A 2UYLB 4GXVH 5JUEL 3S88L 3BRFA 1OM3L 2FYYA 3BDBA 1V3KA 4JQIL 3W11D 3QUMH 1AP2A 2E27H 3HC0B 5BO1L 3D39E 4ZOEA 3VXRA 2W60A 4AENA 4F57L 3GSNB 2Y5TA 2BVOB 1IGML 4JO4H 1QBAA 3S36L 3BZFA 3ALWA 5IOPA 3SDYH 1QSVA 3RUGA 2WLYA 1S9VB 4PLKD 5L2JB 3FOMA 3UEZA 5CIPH 4J4PA 2A74A 5ESAA 5H8DA 4MYWB 1JZ4A 5HDBE 4C57C 1LNUB 1VDGA 1HSBA 5SWQB 1RIUH 1UH2A 1WUNT 2C4FU 4PJAB 4ZYKA 1JGDB 5FYKU 1JGLL 3S34H 1LE5A 2FLBT 3GK8L 4P46C 3RZCA 4Z0XA 1REIA 1OCWL 2YD8A 4ELMA 1LO5B 2VR5A 3BIAX 5DUML 1MFEL 1GGBH 4K94L 5EU7E 3SQOH 2XKNB 2IAMD 3VFRB 3UTZA 4FQCH 2ENYA 1EXUB 4NSKB 2EIEA 4MVBA 1AIFA 1HHHA 4K2UH 3T4AB 2B20A 2Q3ZA 3VWJA 4Q9BA 1FFOB 2VL4A 1BIIA 5D2LF 2AJVH 5ECJE 1QRNB 3UAJC 3K8LA 2GIYA 1AXSA 5D8JL 2RCSH 1G7QA 1AGEB 1IM3A 3MRKB 5ESQA 2V17H 2OL3B 4QRPD 5L8KB 4X98A 4L4VB 4K71B 5C0RL 2ZCKL 3FO0H 4KU1A 5FYLE 5ADOL 4OZIA 3KLHC 5JOPE 1EO5A 1RHFA 2JF1A 2R56L 3KLAA 4JAMA 2DQIH 4RZCA 5FUZL 3REWA 4ZFOA 2R2EA 1LDSA 4KHXL 1KCSL 3VWKC 2P5EA 4HS6B 2ZUVA 4KKAD 1TDQA 3GO1L 2FHCA 2P5WB 2EKJA 3EJYD 3F7RA 1NL0H 4QHKI 5DLMH 5E2UH 5I15H 3C87A 5E6YA 3SHSA 1YEHH 5DHXB 4XNXH 3C8HA 5J6GA 3MV9D 4XP9H 2EDFA 1AJ7L 4GRLA 4XMPL 4P4KB 4TQEH 4ZTOL 3HS0A 4P2RE 3LAFA 4LEOA 1F45A 5ICXB 5LQBL 2OJZL 1IC5L 1WQVT 1TVDA 2V7NB 3MGOA 4XC1H 5KSBF 1XCTB 4MXVE 3G6AB 2AK4E 3OPZL 4WFED 4F7TB 3BQUC 1D5XA 3QIBA 5EOTA 2NY2D 4TYUA 2NY4D 3ALPA 1NLBH 4HKBB 4HCRA 5AG9A 4MAUH 4Z7VE 4F37K 4ZQKA 5J13C 3GMLB 1MCIA 4PP2A 4PRIB 2OQJB 1H5BB 4XPAH 2YMXL 4DJMA 5HYEA 2PF6A 1K6QH 2H41A 4QXGL 5E0QA 3BH8B 3QEQE 3IDGB 1BGXL 1QYGL 2OMNA 3BPCA 3LKPB 4WO4D 1D5MA 3PWPB 5TDPA 3IDJA 3ULUL 3QEGL 4P2QD 4F33A 1T5XB 3V0AC 3HI6L 2VO5A 5GS1B 5I1LB 1WK0A 3QDMA 3SCMA 4AMKH 3EFFA 1HH6B 2CLRA 2XWBA 5F7KC 4L29B 4JZJB 5B4MD 3TT3H 1BD2D 3MXWH 1SEBB 4GW1A 1QSEE 1BLNA 3NCJH 4FXGB 4NO3B 4R90L 4XCEB 3WKMH 4Y19E 1HHJA 3QPXL 2DYPD 4L1DA 5DJ0A 3CSPA 3KXFA 4DGIL 1G7LA 4Z8FL 1RJLA 4K55A 4HMDA 1Y18B 2CSPA 5AYQA 5SX5K 2O5XL 4GMTH 3RGVA 2HTLD 3D85D 3B9KB 4G3YL 2YEZA 4XP5H 3MRFB 1KJ2H 5HHXL 5KSAC 4HMCA 3BDYL 4PRNB 1F4WH 2C3GA 4MA3A 2VQUA 3K81A 4WW2A 2C4XA 5BMFH 2X7LA 5E8NA 1EK3A 3PDDA 4P3CH 1AI1H 4Y89A 5FECA 4IHOB 1UM4H 3MLTA 5EC1B 3ZDYE 3PV6B 4JEGB 4IBLT 2ED8A 3U9UB 1N64L 3UYPA 2VQ1A 4RMWA 5ALBH 4XBGA 4O58H 4LHQB 1A3RL 3WUWA 1HQ4B 4EOWH 3HB3C 4UMGA 4EVNA 4JFDE 2APTA 1HILA 5EO9B 3VXQA 2AXGA 1FGNH 1U8NA 1FVCB 1DVFD 5DK0B 1GC1H 1Q1JH 1CG9A 3TO2A 5J1AB 2VSDA 4AT6A 5E00A 4L3ED 3HAEH 5TGBB 5L2KA 1BFOA 3DXAE 5C0BA 1BJ8A 5HVGB 1DCLA 3CFEB 3HMXH 4JPWL 2DJSA 1ES0B 2IFFH 3AVEA 1ZHLB 4XPTL 3FTGB 1MCCA 4JZNB 1SHMA 4L9DA 3FZUD 4HKJA 1MCEA 4QHLA 1YA5A 2UY7A 4PJGF 5IK3B 5EU5A 1RZIA 1YUHA 5D72L 3X13B 1I3GH 3IKCA 5EOQL 3FFDB 3UTTD 4KDWA 4P4KC 3BP7B 5FOJA 3P0VH 4N5UA 1ZANL 1NJ9A 2HVJA 2AJ3B 4I0CC 1PGRB 1P9MC 4LRNL 2IWGA 1CFSA 4M8QB 4Z78A 1HN1A 3D1MC 1R5IA 4YAQA 1U8HB 4DUVA 3CXHK 3ARGB 3E3QC 1BM3L 1NAKL 2J88H 4HBCH 4I9WE 4OTXH 1XGYH 4WHTB 4GAYB 5EN2B 4RCAA 5CLWA 1S9XA 2BVPA 2FD6L 4FQXB 4LLVA 2Z31D 1OGAE 4P4RB 1R0AL 4LLUB 3U2SA 2D31B 1AQDA 1DQDL 4JM2F 2GUOB 1FHGA 1H5BC 1LP9B 4HZLA 3HR5B 2HTKC 1JWMB 1UACL 1ZGLM 4CDHA 3INUL 4DQOL 4QOKE 1PEWA 4XNUH 3GBNH 5KSBE 1MHEA 5T5FL 5DZNA 1IQDB 4GAGH 5IFAL 1CT8A 2XNAB 1BX2B 2F74B 1YY9D 2B1HL 3KYAA 4AEEA 2OI9A 5GS1C 1RK0A 1PSKL 1INEL 3TA3A 4MJ2A 4NQCB 3BPNB 3CX5J 1B0RB 2YRZA 5GIRB 1ZLVK 1KIPA 4JFPA 3ZSSA 2QKIA 3ARVA 2X89A 4N8VA 4DCQB 1DQQA 4XXDB 4PJEF 1A1MB 1KULA 1G7HA 4NNPH 5HHMA 5SX5H 3MYZA 3TWCH 1XGPA 1ZA3A 5FV1L 1T1ZB 4CU7A 3OKEA 4JPKL 2NLJB 5D6CB 5E08H 5FHAL 2AXFB 4X6FA 3B9KC 4R97C 4KJQD 4D0BA 5BRZB 2VZ1A 4G7YH 3AS0A 5J11B 4WGWB 5GGTA 3QISA 4KI5E 3MBED 4J3TA 3PQYB 4NN6B 3MLWL 4N0FA 1VEMA 4JVWA 5DQJB 1JWUB 4U1GB 2FO4B 2X4PA 4WEMB 1UYWH 4OCYL 2V2WB 5F9WB 1OARH 1AGDA 1F13A 3QIUD 4TVPD 3GBML 1QA9B 1CE1H 1W72H 2BSSA 4FP8H 1K2DB 1TJGH 4PJ5B 1OY3B 5F88A 1F3JB 1NPUA 2ICWI 3RX5A 2A6KB 3FFCE 3O45A 5KTEL 1NMAH 3QWOA 4CW1A 4GRWE 4YC2C 4G9DB 3SY0B 5E94A 3QFJD 4BUGA 4N9GB 2YPKA 1RZKH 3C60C 1QD0A 1XR9B 3PHOA 4P59L 4I3RH 2VIRB 4PJHF 4ZPTA 1FNHA 4LPXA 3HUJF 1FC1A 3SO3B 2FO1A 2F8OA 4DKEH 4IMKC 5A2KH 2A83B 4W6WB 2R0WL 3N1MC 2DL2A 3F6IA 4MXWH 1AE6H 2ICWJ 3UX9B 4XVTL 3JUYA 3MFGB 4B50A 1ZHNA 4NQXA 4KH2A 5K9KA 4R7NB 5HHPA 3VGEA 3BIKB 4NZJA 4DUXA 2QJDA 4DOHE 1G9NL 4UZGA 4F37F 3GIVA 5C0EA 4MMXC 4PRAB 3ZKMD 3S3PA 4P3WA 5D7SH 2C3HA 1KPVA 3L3GA 3WIHA 2EE9A 5C70A 2FBJH 4JKMA 4LIQL 1QBLL 5H94A 1GHFL 3MA9H 5DVLA 1JCKA 3X11A 1FNSL 4LDOB 1WFOA 2WUCH 1M7IA 4ZFGH 1HHKA 2BSRB 1UWXK 4RAUA 3D2UB 1QEWB 2FHFA 3UJIH 2XFXA 1U8IB 2PYED 3UTPE 3W82A 2W92A 1SQ2N 1VADB 3OV6A 4FQXC 1KEGH 3TPUA 1BECA 4R7DA 4OD2B 5IBUG 5A16A 4DN4L 2ATKA 2JKXA 1MIEL 2DQTH 4UNUA 2KBGA 4KJPD 1VACA 4GAJL 1Q72H 5B8CB 4NN7B 4ZD3L 3VFWA 3QP3A 2XV6B 4O9HH 2DQUL 2G60H 4UOJA 1NCDL 1ROWA 5IQ7L 5CUSL 2EC9T 4DZBA 3SGDI 1B3JA 1WFUA 1AXTH 1LO2H 4Y8DC 2DL9A 3BUYA 1FVDA 3VD5A 3TFKC 1MWAA 3V79C 2CRZA 3LEVL 4XXCC 5B3JE 1V7NH 1KENH 2KQMA 2Y9RT 3VFTA 1EMTL 2XY2A 3I6KA 3PABB 4DFIA 4XVUC 1C8PA 3EO9H 1P84K 4JKLA 2JB6A 4M7JL 4WUUB 2DN7A 3V6BR 5I75B 5BV7L 1MCWM 2XXMB 1XGTB 4QWWC 3VFNB 4ELKA 1XZ0A 4ODVH 2EDDA 1KG0B 2RBLA 3N1QC 4BM7A 4G9FA 5T3XH 1ZT1A 1CCZA 5KVMC 1BZQK 2NX5B 5IUSA 2P7TB 2F58L 5HVHB 4PRPB 4Y5XB 4NN6C 3T4YA 3TVMD 3GMMA 3WFBH 2LTQB 4LASH 2HG5B 3NFSH 4JHZA 4U1GC 1WZLA 5K9QG 2W9DL 4LF3B 5F9WC 4R3SA 3PNWA 3S4SG 4B7IA 3KYKL 4U6VH 1ED3B 5I18L 4GW4B 4LSUL 2HJFB 3GSNH 2OMBA 1JK8A 1T7YA 2X4RB 2IAMA 2DQDL 2ZOKA 2NY3D 2KQNA 3WFDL 1A7RL 2LU7A 3O4LD 1S7VB 3GHBL 2VISB 3RL2B 5IFJA 3QBTB 4M03A 2APWA 2BDNH 2PR4H 4BQ6A 1NAMB 1ACYL 1WJ3A 2VL5A 2FJFA 3KPRB 3ZE0F 5H35B 1KTKE 3FB5B 1FNEA 2YC1B 1QSFB 4D2NA 4QRPA 4XX1G 5DJDA 4L3AA 3LV3B 2NW3B 3ILQD 3WXVL 3GSRB 4PRBB 4LSPL 5IVZA 1ZKAA 4Q0XH 4Q9CA 2HT3D 4NRZA 2HKFH 3WEXA 4YXLL 4YDJA 1P4LB 5DURD 1YZZA 4PJIB 5ILTL 4OLVH 3D5OF 1E28A 4M1DH 3RTQB 4GW5B 4ZS7H 4LVHB 4NJ9H 4RFEA 4Y5VB 2OL3H 4X6CB 5E2TH 4G6AD 3NCYS 1NC4B 1OTSD 4X5LA 3CFCH 3RU8H 3DSFH 3X3FH 2AV7B 4O02H 1Q38A 3L1OL 3EYVA 5DJAA 3P0GB 2DM3A 4K07A 3BZDA 3MV9A 3G6JF 4HUVA 2VLLB 4JFQA 3QRGL 4KRNA 3QG6A 3V5KA 4WDIB 3MODH 5D6DA 5D1ZC 4XP1L 4YDKH 3Q6GL 3QEHA 4JM2D 2FNBA 1KCLA 3QFDB 2CUHA 3L3DA 2AEIT 1G1CA 2EDWA 3QHZH 3KDMA 3EOBB 5AWNH 3H3KA 1U92B 2AERT 1XAUA 2O26U 5B8CC 5LCVH 1RPQA 3HE7D 3MMEA 2AJYH 4LLDA 4OZ4B 3FB6B 3H7BA 1U3HB 1J1XL 4WFFD 4JO3L 4QGTA 4QRUB 1JMXA 4CUCA 3UBXG 5J9PB 32C2B 1MREL 1XF2A 1EBPA 2R23A 1XF3A 1BBJB 2GHWB 3GMNA 3RWIB 5FF6A 3BKCL 4BA8A 4PJCF 4ODUB 2B2XH 1MI5E 2ESVD 1G6RA 5HYQB 3QUKA 2AGJH 3OGCB 1FL3A 2HJKA 3IJSA 4WO4A 4XRCA 1F4YL 5KVEH 4GAFB 5TH2B 4PJBA 5I75C 4P2QA 2D03L 1G0YR 4WFGD 3GMPA 3MBXH 1I7UA 5DHVA 4HPYL 5JZ7D 5D1QA 5GJTL 1BAFL 2H26A 5IEHB 1T0MA 3IRPX 5I1CH 5T33L 1CICA 2R29H 4I8DA 1HI6B 43C9B 3UZVB 1BD2A 1MRCL 4PY8I 2BOCB 2DYPA 5HVHC 1MY5A 4LOUC 3NTCL 4M5ZH 3L7EA 4L4TE 4PJAF 3DVFA 4XP6L 3H3PL 3VFUB 3N85L 2X4TA 3U7WH 5ERWB 3D85A 5FYLL 3K3QA 1YC8A 2WIIB 4UDTA 3ZYJA 3EOAA 4MJIE 1QVOA 1QNZL 3HG1E 3MV8B 5KSUA 3THML 2F5AH 3MGAA 1BQHA 4G5ZL 4OM1H 3DROB 2HT4D 1N6UA 1NDGA 4YX2L 1FIGH 3QNXB 1R3JA 3RWDA 3VXOA 3BXNB 4ZAKD 1AHWB 1NEZB 1I1FB 3JVGA 5C9JA 2MPAH 3F58H 5INDA 1DLHB 4JO2L 4NQDD 4TRPH 2C3VA 4M61A 5MEQB 2AABL 4TULL 3VGBA 5IM7A 4EI5B 2HA1A 4IEFB 3OMZA 1BFVL 3MOAH 4MNGB 1U36A 1I9RL 5BJTB 3GRWH 2QSCL 2YWYA 4LHUD 4UT9L 4DVBA 1DVFA 1K9TA 4N8CL 4M6NL 5F7HA 2O93L 3CVIL 4OLXH 5J6HA 1FNAA 3NPSB 1GOHA 1FZJB 4ZXBD 2N4IA 1KTLB 4QTHA 2P49B 4L3EA 4RWYL 4K3DH 4MZ2A 4TNWK 3HC4L 1C7TA 1U95A 4LCWB 4NNYA 4PJDE 1QFWH 1HCVA 2VH5H 3D3VE 3L3HA 3EUUA 2H2PC 1MRFH 3IXTB 3RTQC 4U1MB 2ZNXA 4Y5VC 3FN0L 1HXYB 2AK4A 2R8SH 3MLRH 5JQHC 1SVZA 5MP6L 3MRPB 1X5ZA 4FOMA 5ANMB 5CD3B 3GKWL 5INCB 4V1DE 1HXMA 2JJWA 3VXUD 3V8CA 5D1XD 9CGTA 4NN5B 1FLRL 3LN5B 1LK2A 2BXZA 3UTTA 1KCGC 3DX6A 3HCVA 3VFGL 5JW5A 2ZCHL 5GS0C 2ITDB 4WNQA 3GDBA 5JOFB 1MQ8A 3GGWA 1QTYT 1CLZL 1JFQL 5J8OA 3HAEG 3CSYA 3B6SA 3QEQA 1U8LB 5ACZA 4JFHE 3VGDA 2VDRL 3GJFB 1FL5B 3KPQB 5B3NA 4G6FB 1MLCA 1CGYA 2DLEA 1MFAL 3BIBX 2F54D 2Z31A 1G9ML 3KPSB 4ORGA 4U31A 3RI5K 5E95B 4AEHL 3U9PH 4XVSL 3OR6B 1A6ZB 4OSUH 2A9MH 4LCUA 2VDML 2X70A 3B3IB 3PWVB 1FFPA 5CP3A 5HHOE 1JTPA 3WHE1 3KGRA 4LHUG 2YHGA 5DD5H 3NA9L 5KOVC 3SKNA 4WWKC 2X4NB 4GG8A 3K2UL 3V4UH 1N8ZB 5IW1A 5DYOA 2P8MA 2GCYB 3DPBA 5J4MA 1I9JL 4F80A 4XNMA 4Z7NF 2VC2L 1A47A 5GRJH 4QTIH 4N8PA 5ADPH 1JGVL 5FGBC 3ZKNC 3G5XA 4MJ4A 4JPIA 3PGDB 2WNGA 5E2WL 5GGSB 5DK2A 5KOMC 3WFCL 1T89A 4YHZH 2V5MA 4P49A 1GRWA 3DBXA 3VFVA 5F7EH 1MOEA 2FX8H 4LBEB 1WBYB 5C07B 3WNLA 1J05A 1A6VL 4JANB 4P57B 4BJLA 2YSSB 2XT1B 2A9NH 5IJKA 1HH9B 2IH3B 3N1PC 3MBEA 5IG7A 2COQA 4OIAA 1EEZB 3S96B 3G5VA 3R0NA 2QR0A 3QDJB 4PV9A 2H3NB 5FUCE 1KTDA 4R26H 2M8XA 1AHWC 5HGBA 1GPOL 1QRKA 3SGEI 1NMBH 5D2LA 5IHZB 3LKSB 4G8FA 3BPLB 3FO2A 3HPJA 2VDOL 4NWTL 3S37X 4KMQA 1JYWA 1IGYA 2N56A 2L4OA 4EI5C 3FT3A 1I9IH 3SKOB 5DC9B 5HYJE 3FB8A 2A73B 3QUZB 3VRIB 4PJXE 2WWMC 4BSWB 2VERN 2AEQH 1UKTA 1RIHL 3B2UD 4PP1D 1FFNB 3QFJA 3LY6A 5FYJU 5GRVK 1AD9B 5TE4L 2Q8BL 3NPSC 4KJWC 5B39B 2RFXB 2PW2B 4JQVC 3N9GH 1XR8B 1T20B 5I1JL 1U2HA 5SWZE 4V3DB 1Z9LA 3JV4B 2JJTA 4KRPC 1FYTB 4JKPH 3U46B 2VMFA 2M2DA 4PD4J 1S7UA 5CMAB 4D3CL 2NY0D 1WGOA 1CZ8H 4MNHB 5SV4A 3ROOA 1OF2A 2J5LC 3SE9L 5JMRA 4D0DB 5L0QB 3FQUB 1JPTL 1FAIH 3FT4A 5L7XH 3LH2H 5DHYA 2NZ9D 1EJOH 4EDWH 4FQHA 5CEXB 5DD3L 5LGJB 2R0ZH 5I66B 2E8YA 4QXTA 2BSTA 3B9DA 3TYGL 3BQUD 4O2CA 3R06B 1OAQL 3KAAA 1QFHA 4MSWB 4PREB 4J3XA 4KY1L 1J11A 5EU3B 1TIUA 2RR3A 1YN7A 3PJSA 4P2YA 3S4SA 3ES6A 2D7TH 3V5DA 3NACH 1D9KD 2VE6B 3BE1L 4LCCA 4N0YH 1DUZB 4X8XA 5M95B 2EE2A 2PYEA 5HDQH 4PJ8B 4QF1B 1LP9F 2VABA 3BT2L 4DW2H 5T3XD 3BP5B 1LD9A 3QUMA 1FFQA 3U48A 2GSGB 1A7PL 3P4NA 5D7LE 3ULVH 3BYYA 1Z0MA 5A3IC 3QXUA 4HBQA 3E3QE 3BEWA 3ZMRA 1WZ1H 3TJEH 4HFWB 3GMOB 3L5WA 5CIPA 3PWLA 1VGEH 5KW9L 1CR9H 4FQCL 3L3OB 4KZEH 1KJMA 2LABA 1N5YH 3DX7B 1CGUA 1WBXA 3SDXE 4JFYA 2EEDA 5TDNA 4DK3A 2IAND 4XZUA 1SBBA 4Q2ZA 2DWEA 3STZB 1VKXA 1EGJL 4JRYB 2AS5M 1B88A 1NGZA 3MRHB 4N9OB 1I8KA 5GGRA 1CDCA 2DLTA 3I75B 2GITB 1KN4H 4LKCB 4RAVB 3BKML 4AZ8A 5KVGL 4LNRB 2BVQA 2WWKT 3Q2CA 4HEPG 1FORL 3BH9B 1A9BB 4UQ2B 4IRJB 3X3GL 3VXTA 5I1HL 2ZUUA 2ZJSH 2DKUA 3GJEB 1U3ZA 2DD8H 2NY7H 3EW3B 3HRZB 4HIEA 3ARWA 5HI3C 4Q9QH 4X8JA 2MFNA 1CDUA 1JP5A 3TVMA 1YC7A 3JTSA 5DUBB 4S1SL 4NJAH 5FUOH 2YA1A 5D96B 1RQ5A 3V4VH 4TNWF 1QRND 3NFNA 3H9SB 3TF7A 3PP3K 4XNXL 5DT1H 1R6VA 2VLRE 2F8XC 4D8PB 4L4VD 4PRDB 4V3EB 4CMMA 1KLUB 5DC0A 3RNKA 4HUKB 3QUZC 4P23D 1JNHA 5EOCH 1TCMA 3FAXA 4XC1L 1F2XK 3O4LA 4U1JA 4WV1B 5CJQL 3BKYH 4UQ3A 4MD5B 3SE3C 3QR2A 4Z5RA 4MHHG 5I0DA 1DE4B 1WT5C 2BC4A 2P5WD 3QNZA 3FAWA 3S37H 4G42B 5HGDB 4E41E 2XRAL 3OZ9L 1CE6B 5ICYB 1QPXA 5EZLB 1KC5H 1MHCB 4U05A 3P9MA 3T2PA 4P4KD 1NAMH 3ARFD 3DTXB 2DDQL 4X9HA 2RQ8A 4PJGA 3IFNH 2YPVL 2FWOA 2WUBH 4OGYL 3RI5F 5EBLA 2P1YA 1KXTB 2ZCLL 1MVUA 2JELL 5I1DB 2Y4SA 4EDXA 3AS3A 5F1OB 4QCIA 3WFEH 1R24B 3I9GH 1QQDB 1SBSL 4PTUA 2IPUG 2ZUSA 1OAYL 2X4SA 4KHTL 4U6XA 1UXWA 1GGCH 4OZHE 1IGTB 2NY1D 3VFPB 3CU1A 4LSQL 1ACZA 3TV3L 3T65B 3W0WB 4AIZB 5L9DL 1VB9A 2MNUA 4K8RC 4PRID 4PJ8C 2ZNWA 3WFZA 2WBJD 2HTKD 4KVNH 3LKNB 4JM2A 5IVOA 1VEPA 2H1PL 3C9NB 1NGYA 1O7SA 5EC2A 5MEOA 1KBGH 4MNQA 1CLCA 3PWPD 2IJ0C 3E2HA 4UNTA 1CYGA 3UTSB 5DJCA 3HE7A 4CVZB 1UADC 5IJVA 4NUGL 5CHNB 4K3EH 2GJ6B 4YBHA 3L5IA 2ZSWB 3BZEA 5JPNB 4ZS6C 2X4UB 4AL8L 4HG4K 1KJ2A 5L88L 1XEDA 3T0EA 5IW6A 2VDPH 4OJFL 3NGBB 5ESVA 1LP9E 2ESVA 4EBQH 1A6PA 2XZAL 3WS3A 2WP3O 4MD4A 2QQLH 5IKCA 5KN5B 1T03L 5A40E 2EXYC 3B9KD 4PJEA 2CJUH 2FRGP 4MAYB 5JW3H 4JRXD 4MCYA 2BK8A 4UV7H 1KPRB 4TUOA 1SMOA 3CUPA 2BCKA 4IRJC 4U1IB 1HDMB 5F3HB 5I2IB 4J3UA 1TNNA 4J3WA 4P9MH 1AGBB 4APQB 3N0PB 1U93A 4QHUB 1OLZA 2WANA 2ADIB 3P77A 3L6FA 3BP6B 5JIPA 1S7SA 2DI8A 1H3TA 3QHFH 4UT7L 3H7LA 2IFGA 3D39D 1AKJB 4HXBL 2EYTA 2DQGH 5JR1L 1P4BH 1CTNA 1HNFA 1NCAL 3KPOB 5I1KH 1MAMH 3PP3H 1NLDL 3HAEA 3PGFH 4X6DB 3RWEB 4AENB 3FONB 3SPVB 1MFNA 1HCFX 4U1HA 1RUKL 3BZFB 3HMXA 4PV8A 4AYFA 3PQYE 4ODWA 5C6WH 5HVFB 4DKFH 4MCZA 5KJRH 3OSKA 4QY8A 5DFVC 5JXED 4M6OH 4ZAKA 4KK8C 1W0VA 1FLTX 3GFUA 4NQEE 4NQDA 4ZNEE 4WV1C 4L8CA 4ELMB 5GISL 4LPCA 3FMGL 3IB4A 2Q86A 4EI6B 3NABL 1XGYL 1ZXQA 4PJ5E 5JMOC 4PJHA 3G5YB 3QAZB 4IOIB 4PJ7B 3RPIB 4ZOBA 4ZOCA 5FGCB 2XTLA 1K3ZA 1HHHB 3HUJA 4J6RL 5MENB 3MGTB 4LHUA 1WTGT 3IFPA 5D70H 5EU4A 3TP4A 1KYOJ 1MFBL 4PJIF 4OLUH 1PJ9A 4OD1L 1HEZB 4ZXBA 4QRTB 2JIXB 3RIAK 4PJ9D 4X6CF 5ESQB 1PLGH 4RFNC 2CRIA 3STLB 3DVGA 2GJZB 3VI3E 1LEKB 4KDTA 3OXRA 3U0WH 3WIFA 3O9WB 2QHRL 4XNQB 3ARGD 4OFYD 2GKIA 1HOCB 4OZFG 1UKSA 5TE6L 4JAMB 3VXUA 4RZCB 2ADFH 2O5YL 1YEIL 3O8XC 1G7IB 1IGJB 4JN2A 3SGJC 4DN3L 4RX4A 3VJ6A 4YDIL 1J1PH 2DMKA 1W0WA 3L9RA 1YNTA 1KLFA 3Q3GA 3VXNB 5FYKD 4KZDL 2BRQA 1P1ZB 4EEEA 3V52L 4CNIA 5DRWB 1P7KB 4D9QE 4XNZB 3UYRL 4WU7A 1DSFH 1R3LA 3IVKA 2R2CA 4X6BB 5KVDH 4LFHG 3O3EA 5I30L 1FN4A 2CIIA 2AP2A 3U6RB 3BWAA 1CTOA 2OLDA 4K3JH 2IBBA 2F54A 4IRZL 3OKDA 3NFPA 1U3JA 4JFXA 3VRJB 4WY7H 3REVA 1AO7B 2V2TB 3L3JA 4U49A 3OGOE 4NQCD 3QDGB 3GJFH 3NGBC 1RMFH 2DMBA 3OXSA 1V8HA 4X99A 1TJGL 2OP4L 1WEJH 4WFHE 3QH3A 3CCHB 4MDJB 1ADQH 1SJHB 5JA8B 5DJ2A 1RZGA 4LU5L 1W8OA 2QQNH 1PQZA 2EC8A 4JLRB 1BOGB 1YDPA 3RVUC 2I07B 2I24N 5BRZD 4MGXA 2FATH 4MAYC 1W72A 2IC2A 2A0LD 2HKHL 1VFBA 4P2OD 1DN0A 5TF1H 2Q87A 1G7PA 2VZSA 1JV5B 5CJOH 4JDTH 4HIHA 3IDJB 3U0PA 2H32B 3SBWC 4APQC 4OD3H 4Y4HD 5I8EA 1AGCB 1FG2A 4J1UA 4MXWL 3SCMB 5IP4A 2C26A 2P45B 4Y4KC 4P46A 2FX9H 4PJFB 1Q9LB 2R0KL 4TOYL 2RGSA 5LXGH 1KCUH 3O2DL 2NX5E 1HHJB 4AG4L 3RP1A 4NQVA 4HH9A 3UJTL 2R69H 1XF5A 3MJ9L 1RJLB 2B1AL 1P7QB 1V7ML 2VN4A 5KAQG 5K9OA 1V3LA 3ZE2F 3NIGE 4JY4B 1OSZA 3N06B 3K4DA 1C08A 3GM0A 3IJYA 2NXZB 4WW2B 5MI0B 1RZJC 3RY4A 3MNVA 4HLJA 4UT6H 5GRUL 3MLTB 1BJ1J 2CIKA 4X4XB 4HKZA 4Z7UB 4BELD 4H25A 2E7BA 4MVBC 1DR9A 3PWNB 3C09C 1OB1A 1DEEB 3E8UL 4TSBH 4L8SB 1T7ZA 4JFDD 4ONGL 4HF5L 5D7JB 1UCBH 4ZO7A 1CLOL 4G80B 3CX2A 3GUTA 4IS6A 3QO1B 2YD5A 3MACH 1KJ3L 1GZQB 1BBDL 3RWJB 1HILB 4ONFL 2DQEL 1IM9B 1K4DB 1YMMB 2CMRH 1A5FH 3BVNA 1LEIB 3SJVE 2EZ0C 3MLXL 3ULVD 1QSFE 3IU4L 4NIKB 4JY6A 4K7FA 2XA3A 4U3HA 5MHSD 3O9WC 4BSVA 4XCCL 3PP4H 3M1BB 5EZJB 1P2CA 4L8BA 5I8KH 5ISZE 4HV8A 1BFOB 3QNYB 1A3LL 4HJ0C 1TTUA 3OX8B 1AR1C 3DRQB 3G6JA 3T2QA 4OFKA 4FZ8H 4QHMB 1U8PB 2XOTA 5I73B 1D6VH 1LMKA 5EU6E 4O5LL 5HDOA 4HK0A 4PYGA 1G84A 4X6CE 1LDPL 4CU8A 4BZ2L 4Z6AT 5EWIH 3BGMA 3BQUA 3VCLA 1R5WB 4U6YB 4BKLA 4N1HB 3MLZL 4GH7B 4F58L 4F7PA 4ZSOB 4YPJA 3ZT6A 4I0PD 3IKCB 4PGBA 5DEGB 3QSKB 3GI8H 1D9KA 1ORSA 1Z9OA 4NKMB 2F53E 1MCSA 3WL9A 2HVJB 4Y2OA 4KTDH 4HULB 4G6KL 3BO8B 4Z78B 1F8TL 3BHBA 2E7LC 4YAQB 1RIVH 1RZFL 3F65A 1MH5A 4JY5L 4PR5B 1A14L 2GY7B 4PJCA 4J23A 1IAOB 3FOLA 1UZ6F 4WUUD 3HFML 2OK0H 3QIBC 2EE3A 4KKLD 1S9XB 4LLVB 4K8RH 1OAUH 4C4KT 3FQWB 1DBKL 1UM6H 2EIZA 2UYLA 4MQXC 3ARUA 4NBZB 1OPGH 3T0AA 3HC0A 4MS8C 4OF0A 1KCVL 4XGZB 3GSNA 5L6YL 4PRPD 4IIQB 2BVOA 4DZ8B 5K9JH 4MLSA 1NH6A 3IDYB 1S9VA 5L2JA 1A2YB 4KK9C 2CGRH 4OGXL 4G7VL 4LK4A 5SWQA 4WI7A 5LJYH 4PJAA 3IFLL 3O6MH 4N0UB 1JGDA 3MLYH 5ENWB 3SCMC 4Q6IB 4U3CA 4Z77B 1M71A 3T1WA 4ERSL 2ITCB 4OLYH 5CLTA 1LO5A 5IROC 2HFEB 1SY6H 3TA3B 3FHAA 2XKNA 1L6ZA 3VFRA 1NBYB 3BPOB 1EXUA 2VXVL 4NSKA 5DD1H 3ZHLA 4M1DL 3ARZA 3ARRA 3T4AA 4OF5A 3BMWA 3AMLA 3ARXA 1FFOA 2E3VA 3ZT5A 2GJJA 5IMOB 1QUNA 4PGZA 4KI5D 3RIAF 3KPRD 5HI4C 4HIJB 4JKKA 1QRNA 5GZND 1MJ8H 4HDIA 1AGEA 3CMOH 4HJJH 1IBGL 3MRKA 2NXZC 4WW2C 2OL3A 2Q6WB 4MMZC 1MQKH 4A6YL 1DBAH 4L4VA 1ODAA 2ICEB 2BRRL 4P9HC 3JV5A 4GSDL 4TSCL 2I27N 4K3HA 4M6AA 4U0RB 1MF2L 2BNQE 4P23A 4YXKL 4NNXB 3TEUA 3FFCD 5MEPB 2Q7YB 3OJ2C 1E4XL 3OJDB 4L8SC 2VKXA 2BSSB 2DQFB 5I9QB 1MCPL 3ZDXF 1D5ZB 3WS6A 2X4QB 2MCPL 2W59A 4HS6A 3B2VL 3MOBH 2J7LA 4PLJC 1DLFL 2P5WA 3O3UN 5E9DB 5IWLA 3JUZA 4YE4L 3LMJH 3EAKA 3LIZH 5IVXE 4ODTH 2ARJQ 3PF2A 4P4KA 4HSQA 2GY5A 1XIWB 2VZ3A 3V6ZB 1P9MA 5ICXA 3VFOA 2EDYA 1TITA 2V7NA 5I73C 5C2BL 1ZHNB 3GB7A 4NQXB 1T7VA 3DETC 2Z8VC 1XF4A 3G6AA 5CZXC 1QZ1A 4F7TA 1QBML 3G04B 4YR6B 2R29L 5TQ2L 4HKBA 4UINL 1RI8A 1U3HD 1G9EA 2VXUL 4N0CD 2DWDB 4JO1H 3BEVB 5F1NB 3RVWC 3LOWA 4AQ1B 3GMLA 5E8OB 1PZUB 4PRIA 2OQJA 1H5BA 1NGPL 3SKJL 1U8JA 2WBJA 4O51B 2YBRB 2F19H 3BH8A 3ARQA 1SJEB 2VDNH 3IDGA 3MV7E 4I4WB 4BFIB 3IDIB 3H9HB 3PWPA 3BD3A 4NCC2 3OR7B 3U0TB 1I3UA 3RVXD 1JNJA 3GBLA 1MFCL 3VGHA 4WW1B 4Q9RL 2CLVA 5GS1A 1U2CA 1MCLA 5A16B 1X5YA 4KFZC 1HH6A 4EN3B 4UILL 1HINL 5FA4B 4L29A 1JRHL 4JZJA 1IGFL 5H2BB 1SEBA 4FXGA 4NO3A 4UV4H 4XCEA 2VLJE 3HLAB 5C6TL 5FCSH 3QO0B 2CDFB 1I4FB 1H8SA 3C8DA 2OTUB 3QPQD 1MFDH 2XN9B 3QZWB 3MRDA 1Y18A 2AQ1A 3IDYC 5GQBA 1A64A 4Z7WB 3B9KA 3KS0J 3C2AL 5D71L 3MRFA 4JJ5B 5DTFB 1X4YA 2OI9C 4JRXA 4QRRD 1JL8A 4Q6IC 1DFBL 1J88A 1C5CL 2IQ9H 5IBTH 1DBMH 3MV8D 2HH0H 3TA3C 1BZ7B 5GS2H 5HPOA 4IHOA 5EC1A 3D6GA 3PV6A 3GRWA 2OX5A 4L4JA 3K0WA 4ELKB 3U9UA 3C6LD 1ITBB 2RJMA 4DTGL 1CGVA 3NAAL 2F5BH 3C5ZD 5FYJH 3GMQB 1HQ4A 4EI5D 3HZVA 4KKCD 2VLKE 5D7IB 1CIDA 5HJ3B 3NIDE 3TNNB 4NWUH 5EO9A 3T4YB 1KB5L 1FVCA 1IC1A 4R8WL 4OCRH 4I48B 4HUMB 5DK0A 2CXGA 5J1AA 3KPPB 1I8LC 5FKAB 4NHCL 2OR8A 3JWOC 5JXEA 3U4AA 1MJUL 4U0RC 3CC5B 1VESA 1P4IL 4PRHB 4XAWL 4WGVB 4LCWD 5TGBA 4PPTA 1T1WA 5I9QC 1WSST 4JFFE 4KK6D 3C08L 3FO9B 2CKBB 2CDEA 1ES0A 4JFED 3QCTH 1ZHLA 3FTGA 3OKKB 4JZNA 1QHOA 2HP4A 4NKOB 3VH8B 3EFDL 3T09A 3MLVL 3D25B 2BY2A 5IK3A 4HWBH 4OSUL 3X13A 4OQTL 4F3FB 5C0GB 4XCFH 1F90L 3QT2A 4NFCA 3BP7A 2O5ZL 5C08E 4OCNC 4PJ9A 1YNKH 4FQ2L 1XIWC 4PB9H 4NHUE 1NCWH 1FNEB 2AJ3A 1CD1B 4JN1H 3TJHD 4K9EL 4QRPB 1JMZA 4M8QA 1ZGLP 2JB5H 3V4UL 2KDGA 5DGRA 4M1GH 3D0VB 1FYTE 3ARGA 5F9DC 1WAAF 2ZP0T 1I1CA 4G6FD 4WHTA 4GAYA 5EN2A 3A6OA 4YDJB 4Z95H 5ADPL 1FPTH 4P4RA 3KPSD 1NEZG 2D31A 3AMKA 1EAJA 2GUOA 5J7CC 1MCQA 1A6WH 1KUMA 3HR5A 5EO0B 1JWMA 3QQ3B 4JG0H 2J1KA 1P69B 2MQ3A 1KIQB 3MPCA 1JBJA 3V5KB 1NUFA 2XNAA 1BX2A 2F74A 5AYUL 2APFA 2C1PB 4XXCA 3AREB 2IALA 1JHKH 2DTMH 4EN3C 3MJ7B 4NQCA 1A4JB 1B0RA 5GIRA 4U3XA 1JN6B 2AK1H 1S7TA 2DMCA 2NR6C 2VOTA 4LLDB 4DCQA 4XXDA 1A1MA 1T1ZA 3PL6D 2NLJA 5D6CA 4BQBA 2CKNA 2AXFA 3GNMH 5C07D 2Y1VA 1RULL 1MPAH 2Y07H 5FF6B 3U36B 5HI3D 5BRZA 2J3SA 4KPHH 1R3KB 1TJIL 1EHXA 2HJKB 3IXAB 3AXLB 2WV3A 1L4IA 4NZUL 2BFVL 1YECL 4PLOB 1NCNA 5DQJA 1JWUA 2FO4A 3QDJD 4PD4K 3T3PE 3VMPA 2V2WA 3NA4A 1I7UB 3LKOB 3ULSB 1QA9A 2Z9TA 2OTPA 2CR3A 4FQJL 5B22A 1OT2A 4WUKH 3MNZB 1HZHH 1T0MB 3DLQR 1JZ6A 3F7VB 2ORBL 1K2DA 3W11C 4Z0BH 1UCTA 1NFKA 1F3JA 2A6KA 3BRDA 3U4BH 3R1GL 3MUGB 4IMLB 2EEBA 2DYPB 3X14A 2XKUA 2H32H 4G9DA 4KVCH 4FFYH 5AEAA 3HZYB 3SY0A 2VTFA 2J8OA 1P6AB 1O0VA 4N9GA 2YXMA 3SKMB 4ELMF 1KN2L 3MLUH 2OM5A 1XR9A 2VIRA 3EOAB 2UWEB 3UO1L 4PJ7F 2BP3A 3KPTA 2R4RL 1VGKB 4XCNB 4LLAA 2A83A 3QA3B 1DQMH 5CEZE 3WN5B 1YPZE 4DGVH 4LVOB 4V2CB 3I6LE 3ETBF 4OI9A 1FGVH 2ILLA 4R7NA 3BIKA 3ILPB 5DXWA 1AC6A 1FDLH 3DI3B 4M61B 3EYOB 1UB5B 2P42B 4PRAA 4Z7QF 5DVOA 1DL7L 4G6JH 4OUOA 2DLFH 1GOGA 1RU9L 1CR9L 4P9HH 4F2MB 1L8JA 5F9JB 1FP5A 3I84A 5HD8D 3MRNB 3S6CA 1MHPH 1BFTA 1YEFH 4XB7A 2BSRA 1X5HA 4W70A 5ACLA 5C0FA 1H8OA 4LMQI 3D2UA 5J0BA 1IRAY 4RMVA 1U8IA 4K8RD 4PJ8D 1IQWL 1F5WA 1VADA 1C1EH 4OD2A 4ODBD 4KKAC 2EH7H 3MUY1 3WNNA 3C2SA 4XT1C 4NZRH 5B8CA 3EJYC 4OF6A 3V6OA 1F2QA 3GHEL 1BMGA 2CUIA 3GEWB 3W81A 1VFAB 3E1F1 3HCVB 3ARBB 3OB0H 3W0WE 1DBBL 1Q9OB 4XHJD 5D6DC 1OAZH 2BNRE 1KPUA 4ESKA 5B39G 1LO0L 5DJXB 3AREC 2PCPB 2FGWH 1BQLH 4JRYD 2VR9A 3PABA 4OFIA 2AJXL 3QUYB 4P3DB 4WUUA 1MLCB 4YHNB 3UTSE 1XGTA 3VFNA 2YR3A 1QLEL 1KG0A 3S98A 4GBXB 4NGHH 1IC7H 2GW5A 1S3KL 4HXAL 4Y1AB 4IRJD 5BVPL 4Z76B 3MLPA 5DMKB 4YHOL 2FX7H 1LO3H 2P7TA 5GRVL 4HFUL 4R4FH 2W65A 4PRPA 4Y5XA 1CL7H 1D5IL 2DM4A 5DR5H 1INDH 1E6JL 2HG5A 4H1LH 3S37L 3IU3B 4PJFF 3QCUH 1A4KB 4LF3A 3B8SA 1P5UA 3H9SD 3HI1A 1ED3A 3DYPA 4GW4A 4LSRL 2A1WL 2EYRA 3X12B 1JYVA 4Q7DA 2X4RA 1YEKH 3DNKA 5DD0H 2IGFL 3ARYA 3G5XB 2I5YL 4TPRL 5DFVD 3BP4B 1DBJL 1DZBA 4KK8D 5H37H 1ND0A 3NIFE 4YGAB 2JCCB 1S7VA 3RL2A 4M43H 4MB3A 5HHNA 4WW2F 5FA3B 2Y23A 1NAMA 3KPRA 2Z91B 1EJ6A 2BHUA 1I3RB 3VXRE 5H35A 4M1CC 3FB5A 2KKQA 1EUTA 4Z7UF 1NBVL 4GG6B 3Q1SH 1WZMA 5IB2B 2YC1A 4S0SD 4ODXA 5JW4Q 3KR3L 2ZUXA 1BOYA 3RUGE 3LV3A 2NW3A 5I19L 3GSRA 3WN5C 1HKFA 3FRUB 4PRBA 4LVOC 4NKIL 2EDLA 3QIUB 4JGUA 1AR2A 3VXPA 3JVGC 3EJZC 1S9YB 5I1IH 2NXYB 3LZFH 1P4LA 3R4DA 4PJIA 5CGYD 3CLFH 3OB8A 3RTQA 3LS4L 4ELME 4GW5A 5E6IB 5GS0L 1E4KC 4MHHI 2EXWC 4X6CA 2VDLH 3MX0A 3OBAA 1NC4A 3FB8B 2UZYB 5F6HI 5D93B 5DMGC 1IAIH 3JWOH 2W1NA 3KPNB 4KKNA 4Z7OF 2AV7A 2R2HB 3U79A 4BQ9A 3EDEA 3MCLL 3TBWB 3TGXA 3IS0X 3FT2B 2VLLA 1CVSC 4G8IB 4H0HB 3BISA 4GKNA 4WDIA 5C0IB 3FKUS 4KQ4H 3LRSB 4CN1A 4CVUA 2R15A 1ONQB 3JWDC 1YEEL 4I18B 4N90D 2GTZA 1JI1A 2EH8L 1VPOL 2ENSA 3RNQB 5GGSY 2L0DA 1U92A 3MUZ1 4X7SH 4OZIE 5GZOD 5I76B 3WE6B 4NM8L 1U42A 3BFOA 5F6HJ 2P44B 4OZ4A 4LSVH 3FB6A 1U3HA 4N0CA 4QRUA 1WTLA 3FT4B 4HIXH 1CF8L 5J9PA 3GI9H 1T3FB 32C2A 1MRDH 1U6AH 5DHYB 3ARBC 2P5EE 2HJLB 2BJMH 5CCKH 3EOTH 4QXTB 1BBJA 3RWIA 3W39B 2CH8A 2P43B 4ODUA 5A43C 1DQLL 5CKAA 4DEPB 1A3QA 5I1KL 3GIZH 5HYQA 1PG7L 3OGCA 5GS2D 3ES6B 2XZZA 2VWEC 4M7ZB 5GGQL 5TH2A 4X7EC 3G9AB 3RVUD 3WSQH 5ABDE 2OZ4L 5FKPB 2Z31C 1EHLH 4XWGH 1B4JL 2VABB 3WXWH 1F4AA 4DKFL 5C09B 4GBXC 5FYJD 2XZCL 5IEHA 3EYUH 2E7LE 1EEUA 5ID0B 3PXHA 3IGAB 2DIJA 1HI6A 5FGBA 43C9A 3ZTNH 2J8UB 1JHTB 3VXSD 3P11H 4EIGB 4C59B 3IKKA 3MRLB 4APQD 4YDVA 2BOCA 5A2IH 1TETL 4U1SA 2Y06L 2GQHA 3QCVL 3MR9B 5TQ0H 3VFUA 5GRXG 5I17B 5E70A 5ERWA 3I6GB 2A38A 1DJSA 4WTWA 1YY9C 2WIIA 2HFGH 1FIEA 4RA3A 2X6MA 3C5SB 1KCRH 5CBEB 2DBLL 3VE0B 4JHBA 3MV8A 3NH7H 4YFDB 4LGSB 4YZFF 3DROA 1NGZB 2Y6SD 1GGIH 3NZHH 5HY9B 3QNXA 3I2CH 3T04D 4J3VA 4ONOA 2Q8AH 3BXNA 1AHWA 1NEZA 1I1FA 2CDGB 3FQNB 3RJDA 1T89C 4R9HA 4C56B 1DLHA 3QDME 4KQ3L 4WEBL 5MEQA 3C5ZA 3M8OH 3DO7B 3L7FB 4EI5A 3D9AL 4KJQC 3O0RL 1Z3GH 5IJKC 4MNGA 5BJTA 3G6DH 4X8JB 3B43A 4KAQL 4WEUD 5LGHH 1H3PH 1N0XH 4YWGL 3MBEC 2H2SD 5MEND 4XTRD 4HH8A 3TC9A 2MJWA 3KXFE 4M62L 5FK9B 1E4JA 1IL1B 3O6KH 3LHPH 1BPVA 4OCXH 1QP1A 1EDQA 1CGSL 1FZJA 4U4BA 2VR4A 3F8UB 3QIUC 3MV01 4JQVA 2NXYC 4LCWA 1EAPB 4RGOL 5IESH 1EA9C 4D9RE 5T1DL 1QKZH 1IC4L 4YHPB 4HUNB 2XQYK 4XBEH 5E6IC 1P84J 2ZKHH 1HXYA 3WBDA 3O9WD 4JFEA 4JG1H 2PTVA 4WY7L 5FAAA 5CD3A 5ANMA 4M5YL 5INCA 4AJ0A 4TTDD 4HJ0D 4TUKH 1AGFB 4H8WH 1AR1D 4PDCE 3LN5A 1WLHA 4M6MH 2VAAB 2CKBH 4NZTH 2ITDA 5JOFA 3HZKA 5F7DB 4OB5L 5JHLL 3TJHA 2ZUQB 3NVQA 4I18C 1YMME 3UMTA 2JJTC 1FBIH 3C6SA 5F1SA 5T3ZE 1TZHB 3GJFA 3KPQA 2ZWLT 5FHBH 4C55A 1I7RB 3CDFA 2J8HA 4FQIL 4ALAL 1ADQA 1OHQA 5ITBH 5DURB 4ZUWB 3KJ6L 5L2KE 4LDEB 4NBYB 5CJOL 2DQJH 3KPSA 5C0BE 4JDTL 1AO7D 1KLGB 1MVUB 3ZKMC 1AQKL 1ZLUH 3MNWA 5DC4B 2CQVA 5DQ9A 5D7KD 5GJSH 5C0AB 5BXFB 3RWCB 1A6ZA 3QDGD 4U6XB 1QSZA 3B3IA 4UIMB 3PWVA 4RMRA 4DEPC 1BIHA 1QFWI 4WI9A 1YNLH 5EA0L 2MSPA 1AY1H 4OKDA 1GAFH 2X4NA 4M7ZC 5HBBA 3FCTB 3V0WH 1N8ZA 1JE6A 1DP0A 2GCYA 4KI1A 1DQJB 4V2BA 2NY5H 1HKLH 3P9WB 3SOBH 4E0RA 1MCBA 2PYFB 2CR6A 4ONHA 2EECA 2DQCL 2OJEB 3HE7B 4HQQH 3PGDA 5GGSA 4ETYA 4Z7WF 1AFVH 2C1OB 4UT6L 4MA1C 3PL6A 4YNYB 1RUQH 4LPUA 4LBEA 1WBYA 4X83A 5C07A 5K93A 1GOFA 3RA7H 2YRPA 1UWGL 4JANA 4P57A 1IGCH 4P5TD 1N3NB 4YIQB 2YSSA 3RWGB 2W91A 4URTB 1QFOA 1HH9A 1EO8L 2IH3A 2YD1A 3OAUL 1ZGLB 4ZUSB 1EEZA 3S96A 5L8LB 3FB7B 1P7QD 3V7AE 3BRGC 2EDJA 4F7CB 3QDJA 1JPFB 4R0LB 2H3NA 5DJ8B 4XVJH 4MCYB 3TO4B 1UWEH 5D7IF 5FXCH 2NXZD 1FQ9C 5IHZA 3LKSA 2DRUA 1SVCP 1B2WL 4LKXA 4OZGB 4Z18A 1KEML 1RUAL 3SKOA 1J0KA 3UXFA 1U3YA 3P77B 2A73A 3QUZA 3VRIA 4BSWA 1N6QL 1D6VL 1E6OH 3V4PH 4OIIL 3S5LB 3O6FB 5D7JD 1FFNA 1S7WB 2MTPA 5JQ6H 4M3JA 4CMHB 1AD9A 5B39A 2FB4H 2RFXA 1WT5A 2VXSL 2PW2A 1TJHL 1T2QL 1HNGA 5IGXH 4QXUL 4FTVB 1T20A 5SX4H 2A6IB 2QADD 1IM9D 3GI8L 5E2VH 3D69B 3JV4A 3NCMA 1RFDH 3LD8B 1FVEB 4KTDL 4HJGB 1IAKA 5C71A 2R2BB 1DUYB 1ITCA 2BNUB 4MNHA 3LSOB 4NQDB 2HMID 2AEPL 4D0DA 3FQUA 4AK1A 3MZTA 4HS8H 2XA8H 4K7PX 5LGJA 5SWSB 3KWWB 4LAQL 4LSTH 5CEXA 5I66A 1JZ2A 2E6JA 1CFBA 2VDQL 3R06A 5BS0B 2W07A 2XTJB 2ZUQC 4MSWA 4HC1L 4PREA 4JR9L 4AQOA 1JUFB 5J56B 5EU3A 1GXEA 3RVWD 2VE6A 2HT3C 1DUZA 1PVHA 4X9BA 1MLBB 1EEYB 5I16B 4PJ8A 1MNUH 1LO4L 4GOSA 3QQNA 1IE5A 2F9BT 3LQZB 2GT9B 3ZZ1A 5IIEB 2X1QA 3BP5A 4TUJB 3SDDB 1TTGA 3WIFB 3LPWA 1JHLL 2GSGA 4AH2B 1Q8MA 4MD0B 1GVIA 3A67H 4OLYL 1WIUA 4H20L 1QR4A 3GMOA 5D1XB 5DQDH 4MB5A 2VXTL 3CDGB 3L3OA 1G6VK 3DX7A 3JWDH 4OKVB 4QGYA 5FFLA 2K3TA 4H5SB 5KANI 4YJZL 4UTBH 4KMTL 1JZ7A 2D0GA 1A7OL 3STZA 1SY6A 2XY1A 4JRYA 1EH9A 3MRHA 3E2HC 5BQ7B 4OFPA 4RAVA 3HE7C 2GITA 3I75A 1FE8L 4LKCA 4FABL 1L9MA 4LNRA 1DBAL 3L3JB 3BH9A 4DWHA 1A9BA 4UQ2A 4IRJA 5F96L 2R4SH 2OTWB 3GJEA 1MIML 4FQLH 4J7RA 4PBWD 4MB4A 4BQCA 3HRZA 5JIHA 3H42L 3DRTB 4X99B 4YGVB 1INQA 5D2NB 5DD6B 3CU7A 1CLYL 4QRQB 3HTLX 5CEZL 5DUBA 4M48L 3PHQB 5IB1B 1M7DB 1PQZB 3LS5H 4RGNB 3K1DA 1BJMA 4UB0H 4B0MM 3VG0H 3H9SA 3V5HA 2SEBA 5JZ7C 3QXAB 1ZTXL 4OCSL 4XWOC 4KV5E 4LSSH 5D5MB 1NUGA 2N7BA 4D8PA 4PRDA 15C8L 5DWUL 1KLUA 3QEUB 4YHLH 5I74B 4J1UB 3UC0H 1FZOB 2WM0A 4I2XB 4PUBH 5F6IC 1YEDB 2MHAB 2UWEF 4PIRF 4G6ML 4WV1A 3O6FC 1Q0XH 4MD5A 4G9FE 3V9FA 4CMHC 4KMLB 1PX3A 4XP4L 1DE4A 2ARWA 2WBWB 1TVHB 1SEQL 3TBSA 3ZL4L 4M9PA 4G42A 3QQ9D 5HGDA 5K59F 5DMIL 1NDMB 1CE6A 5ICYA 3CSBA 2HT4C 3LD8C 4R2GB 1MHCA 3H0TB 2YPLD 3KYNB 2CRMA 5JHDB 2VJXA 4P5KA 4ZAKC 1C08B 5IFHL 3DTXA 1XIWD 5H37G 4Q58C 2JJVA 2B0SH 5I1EL 4OBRA 3ULUC 4G43B 4JRWA 5I1DA 2NCMA 2CIKB 3EDJA 3P2TA 4OLWL 4G8EB 4GKOA 5HTSA 1R24A 1YMHB 3CVHH 4XBPB 1MJ7H 1QQDA 5E99L 3DWTA 1V3MA 3A6CH 3BDXA 2AI0L 4TVPH 4LAJH 2LV4A 5DDHB 1IGTA 4NM4H 3VFPA 1YQVH 1WAAA 3T65A 5CSGA 3W0WA 2IBZX 1JPSH 3P4OB 4I5BA 4ZXBC 4AIZA 4S10A 1WWBX 5CZKA 1A1OB 5CBAB 1NCBH 3TBVB 5L8JB 4K7PH 4FQ1L 3HI5H 5EIQA 3LKNA 1S5IH 4EIZC 2OR9L 4QRPE 1JNLH 3SDDC 3VXMD 5J89A 4BSVB 3C9NA 4KDVA 3P0YH 1J5OH 2NY0B 1B6UA 3UTSA 1CD9B 2PW1B 4CVZA 12E8H 4AEIL 1FV1A 5CHNA 1R3IH 2GJ6A 5D1XC 4TSAH 4NP4H 4HHAB 2OR7A 2ZSWA 2XZQH 5JPNA 1TLKA 2B39A 2DI9A 2X4UA 1CQYA 3K8KA 3GSVB 2Y36H 2O61B 1I1YB 5T1MB 3W2DH 2NR6D 1NGQH 5C2UB 5EOCJ 4S0UC 4F7PB 2XN9D 5KN5A 3T8XB 25C8H 4OGAD 4PYHA 2DS4A 3MV9E 3RWHB 4NWUL 1B90A 5HGGS 7FABH 4MAYA 3MLSH 3WIIL 5I6XB 3DX8B 4LCIL 4WVRA 1KPRA 4WHCA 2VSCA 5C0JB 3ARDB 5C0CB 2IG2L 3O3DB 4ORZC 4U1IA 1RVFL 5F3HA 5I2IA 1EPFA 1A0QL 1NCCH 1NBZB 2X40A 1AGBA 4APQA 4WFEE 4QHUA 5DJYA 2ADIA 4MA7L 5D2NC 3BP6A 3ERYA 35C8L 5F7NC 1AKJA 1A02N 2YN5A 5IT2H 3KPOA 5KG9A 4RGNC 3KJ4B 1CDJA 1V3JA 2IANB 1X5JA 4X6DA 3RWEA 3FONA 3SPVA 3ABZA 3L3IB 1RZJL 1L7TH 3WHXB 5EUKB 4PB0L 2JCCF 3RVVD 1OQOA 2YUZA 5FM8A 1NQBA 3MTRA 1N59B 3IDXL 3Q6FB 4P2QE 4PJBE 5I74C 3W9DB 4PRHD 5F72S 1M71B 4HWBA 1RZKC 1YEGL 3DIFB 5CWSB 3U4EB 5I8CB 4GG6F 4EI6A 4JFZH 5EORL 4DGYH 3G5YA 1HIMH 5E4IA 4IOIA 1CU4H 4PJ7A 3RPIA 1BD2E 2DI7A 1FPTL 3VRLF 1LK3L 4LQFL 5MENA 3MGTA 1CDIA 4JHAL 2R39A 3RGHA 4DAGL 4HWEH 5IHBA 2J4WH 2QQKL 1ERNA 4R2GC 4NT6B 1IEAB 4JGJA 3O2WH 3QZWG 4OLZH 1HEZA 2Z35B 4HDIB 4QRTA 1UM5H 1FSKC 2JIXA 1X5LA 4XPGH 4DVRL 4X4MA 1L7IL 4ZFOL 3VI4F 4J3OC 3P30L 3STLA 2GJZA 3P73B 3RRQA 1LEKA 1RJCA 3O2VL 2BNQD 1FZKB 5CS7A 1RUMH 3O9WA 4KGJA 5EZIL 1J10A 3ORJA 4JHWL 4XNQA 3AGVA 3Q5OA 4M7KH 4O4YL 4P23B 3LDBC 1HOCA 2DTML 1J8HB 5F44A 3B2UC 4PP1C 1OP9A 2APBA 1TZGL 3PDGA 1G7IA 1IGJA 1I3VA 1TVBB 2HLAB 3DO3A 4YHYC 4B53A 4S11A 1IFHH 3OAZK 3VXNA 5I8OL 3I50L 1P1ZA 3O6LH 5IB3B 3BJLA 1ZAGA 5DRWA 1P7KA 4MA8H 1MPAL 3EYSL 4GMSL 5CILH 2Y72A 1KV3A 4ZUVB 1GH7A 1KTRL 4X6BA 3LEYH 1FNFA 5EZOL 3ARFB 2NY0C 5KS9B 3U6RA 5JDJA 1MAKA 2XYCA 5KBNC 4L3EE 1FH5H 3CFKB 1KNOB 3U30B 4HCRL 3VFOB 3VRJA 5JUEH 1HSAA 3S88H 1AO7A 1JNNL 3ARED 1OM3H 2V2TA 2E7LA 1K8IB 4JQIH 2NZ9C 4M7LL 3GB7B 4BUHA 5BO1H 1ZOXA 1XF4B 3QDGA 4F57H 4UDUA 2WIMA 1IGMH 3CDCA 4HLZG 4Z0BL 3S36H 4QHKJ 2NY1B 4MDJA 3CCHA 1GJIA 1Y6NR 1SJHA 1U8OB 3EKCA 4MZ3A 4BK4A 1I85A 1D9KC 1QR1B 4HWZB 4XAKD 3UTTE 4JLRA 1TENA 1BOGA 4MS8A 1U8JB 2I07A 2WBJB 3QXWA 3GK8H 4XNYL 3VW3L 2J8UF 4H26B 1OCWH 3LQAL 3G5ZA 5DUMH 1MFEH 4K94H 1JV5A 2E9JA 2VWEE 2YWZA 3RBSA 2H32A 1AGCA 2CLVB 2C4FT 4N5ED 4NUJB 4LSDA 3TIDB 1Z9SA 2P4AB 4WWID 4PJFA 3WMSA 1CWVA 5IROA 1Q9LA 2V7HB 3KJ4C 1QHPA 5D8JH 1G9NC 4FXKB 2VUOA 5IEKB 4OF7A 4FZEL 2Q1EA 3SDCB 5C9KA 3MRDB 1P7QA 4CKVX 5C0RH 2ZCKH 4JY4A 1OTUD 5GHWL 5ADOH 3NN8B 4NZDA 4JRXB 2R56H 1OTTD 4M1CD 1GGYA 5FUZH 4OCWL 5DRZB 5HDLA 2CRYA 2AQ2A 4NRXB 4KHXH 1KCSH 3VDBA 4K23L 4H88H 3GO1H 4X4XA 1RUPL 4Z7UA 1GIGL 3PWNA 3EJZD 1X5IA 3D39B 1DEEA 1M1SA 5LWYL 4L8SA 3HMWL 5T3ZL 2JCCE 4U6TA 2YD2A 5D7JA 1H3WM 3BKJL 1A6UL 4G80A 4HG4J 3CZJA 1AJ7H 2DM2A 3HZVB 4XMPH 5FCUL 2EXWD 1F4HA 1EZVY 3QO1A 4NO2B 4ZTOH 3ZKQD 1GZQA 4IDJL 3RWJA 1JWSB 5DMGD 2HWZL 5LQBH 1IM9A 1K4DA 2OJZH 1IC5H 1YMMA 1YY8B 1LEIA 4LEXL 4K71C 3LKQB 5DRXB 3OPZH 3M1BA 4UTAL 5EZJA 2ZPKL 3DURB 2BVUA 1YJDL 4P23C 2EICA 1PZ5B 2FGWL 2KUTA 3EYQC 4NQTA 1T1WB 3DECA 3QNYA 4JM4L 3OX8A 2B4CL 5D2LE 3DRQA 4YHKL 1J1OL 2VXQL 1MEXL 4QHMA 3WS6C 1U8PA 2CDEB 3OAZH 1CGTA 2AJUL 2YMXH 4CDGC 5IWLC 4ACPA 3OKOB 3ZYOA 3UTOA 2V5YA 3NCFB 4QXGH 1R5WA 3TNMB 4U6YA 1BGXH 1QYGH 2XQYG 4ZO6A 5C08D 4ZSOA 3J8F7 3QFJE 1TNMA 5DFTA 1FYHB 5DEGA 1JGUL 3ARBD 3ULUH 3QEGH 1X6LA 5GGUB 1J87A 3ARFC 4PJ9B 2GTWB 4NKMA 4E9LA 3HI6H 5DR5L 4YFEA 3U30C 4KTYA 3BO8A 5FGSA 1HHGB 3ZT7A 1BZ9B 5IHUL 4PR5A 3QUYD 1F4XL 1BQHG 1IAOA 1ZEAL 5BCAA 4R90H 1F6LL 3EGSB 4IM8A 5F9AC 5I71B 1C5DB 3QPXH 3WFHB 1T83A 1A7BA 4WI6A 4DGIH 2NY1C 3FQWA 4Z8FH 3QG7L 3HC3L 4HWUA 4H1LA 4GBXD 4R96B 2O5XH 4Y1AD 1U0QA 5FM4A 4Y5YB 5DA4A 4G3YH 4XPHL 5HHXH 4XGZA 3BDYH 2WBJC 4O00A 5AZEL 3R0MA 4IIQA 4ODHL 4DZ8A 2IQAB 4P2RB 5JW4M 1CBVL 1A2YA 1OSPL 1OAKL 4XH2A 1N64H 4X6EB 2PYEE 1LQVA 2X1XR 2WK2A 4N0UA 5ENWA 4NO0B 4Q6IA 4Z77A 2IALB 1A3RH 4Q74A 2BVTA 1RK1B 2ITCA 4QT5B 4OFVA 2HFEA 4EUPB 4JZJC 4HS3B 2Z92B 1S7TB 1NBYA 4LLQB 4Z7VB 4U2YA 5CKGA 5GGTL 5C7XL 4XPFH 1YYML 2VUYA 2A77L 3SDCC 1WFNA 1QLRB 3DARA 4U6HB 3Q5YA 5IMOA 4NDMB 1ZS8B 4RFOL 1HHIA 3K74B 2J12B 2YD9A 4HIJA 4XC3L 1OWWA 4OZGF 2FH8A 2YKLL 4UAOB 4XX1E 3BW9B 4P2OB 2AW2A 3RAJL 1SM3L 2Q6WA 4JPWH 4WU5B 4UIKL 4KQ4L 5FM5M 1I8LA 2ICEA 4XPTH 4Y4HB 4FQPA 4NNXA 5KVFL 5C1MB 5MEPA 2Q7YA 2NXYD 1X3DA 3NMEA 4J8RB 3OJDA 3STBA 2DQFA 3FO1B 2BVEA 4XMKH 4Y19B 3A6BL 1D5ZA 1D6EA 2X4QA 1Z2KA 5E6ID 2FEEI 2DLHA 2XACC 4HUXA 2XQBL 3X14B 2FZ3B 1ZANH 3LN9A 5E9DA 2VDKH 4WRLA 4LRNH 3MROB 4ODSL 5TE7L 1NSNL 5CAYB 5DO2C 3ISWA 4LVNB 4JCMA 2JLLA 3SGKC 3OTTA 1BM3H 1NAKH 5JXEC 3ULUF 1EIBA 5EU7C 1XIWA 1YYLL 2IPUK 1R0AH 4RSVA 1ZLWK 3V6ZA 3OKLB 5EDXA 4POUB 1DQDH 4GQ9H 3WIHL 4R4BB 1ZHKB 1N7ML 1FRGL 1UJ3B 4RWHA 3ZLQC 5DUPL 4WI4A 1UACH 3RY6C 4DQOH 3INUH 5EBMA 3G04A 4YR6A 4NPYB 4CVXA 4JFDB 4U7KA 2OBGA 3O4LE 3ESVF 4L5FL 1MCOL 2DWDA 5CP7B 3BEVA 5F1NA 4JVPA 5E8OA 4DKAA 5IFAH 5C8JB 2B1HH 3DV4B 4PJ9C 5F3BB 3RVTD 1II4E 2I9LB 5CZVL 2GK0B 3FQRB 2XWJA 4O51A 1PSKH 1CFVL 3MJ8A 4D9LL 5JLZB 2YBRA 3LPFA 1LEGB 1INEH 4ZTPL 2CK0L 1SJEA 3DHMA 3CH8A 3VXMA 4I4WA 5C0FB 5IBUB 4BFIA 5FB8B 3DXAB 3IDIA 3H9HA 4FNLL 3ARGC 3MRJA 5I71C 5IBLD 3OR7A 3U0TA 4DKDC 4WW1A 4PJGE 4JPKH 3JV0A 5C09D 2FJHB 2EDNA 5FHAH 4EN3A 1ZVSB 3LKRA 5JA9A 4OT1L 3RIFK 5FA4A 3T2OA 1IZJA 4RISL 3H3BC 5H2BA 1O5DT 1A8JH 1MWAL 2WAHA 1A22B 3HLAA 4PG2A 1PAMA 3MLWH 4CN4A 1IZKA 3QO0A 2CDFA 1I4FA 4HK3J 2OTUA 3WD5L 4I0PB 2XN9A 3QZWA 1LVEA 1C16B 5AD0B 1MCRA 2ZUYA 3G6DL 3ZHDA 3UPRB 4Z7WA 4OCYH 4D0CA 4JJHA 4KGLA 4M02A 1KPUB 3GBMH 2ZG3A 4JJ5A 5DTFA 2IADB 4HKXB 1QLFB 2ED9A 2OCFD 4OAWB 2CK2A 5DEZA 1BZ7A 3BPNC 4MNQE 5KTEH 1ZT7B 3BSZL 4OQ1A 3IAPA 3ARPA 5D4QA 4GFTB 4U1LA 1JI2A 4C56D 1XGQB 5IMLB 3JTTB 3GMQA 3HNTL 5D5MF 3DJ9A 4P59H 4LRIC 3RJQB 3T0EE 4QLRA 5D7IA 1RHHB 2NYYC 2W65B 5J11C 2A0LC 5HJ3A 2ESVE 2JTDA 4GJTB 3TNNA 5DI8B 2P24B 2HRPL 4P2OC 2R0WH 1ORQA 3NZ8B 4I48A 4XVTH 1C5BL 3KPPA 2PO6B 4HT1H 3DUUB 5FKAA 2R9HC 3F7YB 4Y4HC 1OAXL 4PJEE 5GGVY 2BXYA 5JPMB 3HI1B 4WFGE 1N0LA 4BFBD 3CC5A 1G9NH 4PRHA 2I60L 4YK4B 2EYRB 4MX7A 1H9VA 3B83A 3I02B 4R4NC 3FO9A 2CKBA 1LHZA 1SMAA 2BY3A 4LIQH 3SQBA 1QBLH 3TBYB 1G9MC 1GHFH 3OKKA 4XPBL 4NKOA 2EO1A 1ND0B 3VH8A 1FNSH 4GRMB 5HHNB 3D25A 1HE7A 1Z0NA 3VXRD 5J1SC 4LVNC 5C0GA 4F3FA 5HYIA 1ZLWH 5T5NF 3SO3C 1IGIL 4ODXB 1CD1A 4OF3A 4DN4H 1UG9A 1MIEH 5LBSL 4FMFA 3D0VA 1CGXA 4YHML 3RZCD 1UJ3C 4ZD3H 3IETB 3VXPB 3FFCB 3ARSA 2DQUH 2IH1B 3L5XL 3EDFA 1NCDH 5IQ7H 4NQDE 5T1KB 4GRWB 5CUSH 4LARL 3F12B 4FA8A 4PJHE 3MRBB 5C0AD 3MXVL 3QDAA 3HUJE 5EO1B 2GAZA 3LEVH 5EO0A 1EMTH 3QQ3A 3ULVC 2PTTB 1KIQA 3ZKSD 1JGEB 4UOW0 3T2NL 2VITB 4GKNB 4M7JH 3ZO0A 3ELAT 3VDCA 5BV7H 3DGGB 1Q9WB 1T22B 3VGAB 2C1PA 3AREA 3PHSA 4BZ1L 2GTZB 2IPKB 4OM0L 2CUMA 1RZ7H 3U1SL 5LVEA 3MJ7A 1NEUA 4MWFB 2E6PA 2NMSA 1LWRA 3UBXB 1A4JA 1JIBA 1JN6A 1L9NA 3KLSA 2F58H 3OAYH 4NN7C 1G6RL 3V6OC 2XG5A 3QIWB 5E03A 2X4OB 3VXUE 1T7XA 2P5ED 4C58B 1DTUA 4I0PC 1BVKB 2YK1L 2JK5B 4NRYB 1T21B 2W9DH 4S1RL 1H15A 3KYKH 3U36A 2FHBA 5I18H 4LSUH 1R3KA 4FXLA 4KUCF 4GRLD 4JZOB 3MCKB 3IXAA 3AXLA 1K5NB 2DQDH 1WITA 3WFDH 4KKLC 1A7RH 2E9WA 1IT9L 5F89B 4GKSB 3LKOA 3ULSA 4XWOD 2F54E 4FFEX 3GHBH 3TO4D 1BVLB 3MNZA 4N5EA 5HHVL 3RPKA 3F7VA 3KPMB 1ACYH 3MUGA 4IMLA 1A7NL 4YDVB 5BZWB 1S9WB 4Y5XC 2E9IA 4U1SB 4M4PA 4XB8A 3HZYA 2C9AA 2LTQC 4X4YB 3O6FD 3WXVH 3EO0B 4LSPH 5E5MB 2PO6C 3SKMA 5HYSB 1M7XA 3VFSB 4YXLH 2UWEA 4QRRB 4YK4C 2D2OA 3CH1B 4FTVD 5ILTH 1ETZB 3WYRA 1VGKA 4LMQE 4XCNA 3QA3A 3ZYIA 5F8RC 3WN5A 3CXDL 2V9RA 4G8GD 3TH3T 4PY8J 2BHYA 3PWJB 3C6LB 3L1OH 3ILPA 2X1OA 4C54A 3HNVL 2EDHA 1V5JA 5DA0B 3SE8L 3C5ZB 3EYOA 1UB5A 4X7TB 3ULUD 4KI5C 3A67L 2QBWA 3UZQA 5GZNC 1E4KA 3CFDA 1RJZB 2DQHL 5SWSD 4XP1H 5GGVL 1NGXB 3MSPA 4F2MA 3TYFB 3Q6GH 1IKNA 5F9JA 5BS0D 2XTJD 3CLEL 3MRNA 1F02I 5MERB 1KIRA 2V2XA 1BEYL 2V5RA 2NW2B 1CK0L 5IV2B 2XWTB 1NFIB 3OWEA 3HPLB 1J1XH 4JO3H 3FHQA 5BOZG 1EX0A 1KJVB 1MREH 3RIFF 1K85A 4LLWB 4LVHC 3SDDD 4FN0A 4JFEB 2UZIL 2W9EL 3ZE0E 3BKCH 1E0OB 1Q0YL 4HPOL 5KS9F 2YZ8A 1WC7B 1F4YH 3S35L 1VFAA 4FG6C 3ARBA 4G59A 5IF0B 1Q9OA 2D03H 4XMLL 2X10A 5C0ND 3HZKB 4AIXA 4F8TA 4GXUM 5T3ZD 4HPYH 3VGAC 2Z0BA 1BAFH 5GJTH 1YEJL 3QYCA 5DJXA 3KNBB 5T33H 1L0QA 2PCPA 3C6SB 2OSLB 3EYFB 5GGRY 3QUYA 2AJSL 4P3DA 1MRCH 4S1QL 1NC2B 2NZIA 5TFSL 5HGAB 4YHNA 1F58L 3NTCH 3QIWC 3O3BB 4XI5C 1U3HC 4XP6H 3H3PH 3G6JE 3IJHB 4GBXA 3N85H 4N0CC 3U7YL 2VLMD 4Y1AA 5F70A 3WNPA 3MNWB 4WJ5B 5FYLH 2IBGA 4U1KB 4Z76A 4YO0B 5DQ9B 5JXAL 3CK0L 5DMKA 1S78D 2P46B 4PBXA 1FAKT 5SV3A 2C7UA 2J6EA 3THMH 5EULV 5I1GL 3MRCB 4G5ZH 4QNPF 2D7QA 4YQXL 2WQRA 4Q6YA 4YX2H 3VU2A 4RGND 5HGHB 3BWUC 3FQXA 3IU3A 3RVXC 4KWUA 4FFZL 3UYOD 1A4KA 4LDLB 5FYKH 2HT2D 4JO2H 3TCXA 3UJJL 1NMCB 3X12A 2AABH 4TULH 4E0RB 5T3XE 2P47B 1BFVH 4GQPH 4NYLB 1VA9A 3FL7A 2R1XB 4ONHB 3AAZB 4PJCE 5GSVB 1TQBB 1I9RH 4YXHL 1B4RA 4F9LA 3BP4A 2QSCH 5AZ2L 1J7VR 4MJ5B 4UT9H 3TT1L 3QPQC 4N8CH 2JCCA 4M6NH 6FABL 4WCYL 3EHBC 3CVIH 3PL6B 4GKZB 3K2MC 4NKDB 4ZPVB 1WCBB 5FA3A 5C86A 2YUWA 1ULVA 2Z91A 4UU9A 4RWYH 1ZE3C 2D9QB 4EUPH 3HC4H 1I3RA 3PGCB 1G1YA 4W4OC 5F9OL 5EB9A 4GG6A 5E8DL 4JPVH 5IB2A 4IJ3B 3FN0H 2EDQA 5AAMA 1KFAL 4R2GD 3CVHA 3QQ4B 3TZVD 3FRUA 4M9OA 2PXYB 1A1NB 3GKWH 5JHDD 3QIUA 3WJLC 1N4XL 3C6LC 1S9YA 2WSKA 5DRNA 4I77L 4ZFFA 4PG9B 4PJAE 3HHRB 4YPGB 1CL7I 5IR1B 1FLRH 2EKSB 3C5ZC 5HDBF 4LKXB 2X89D 5E6IA 2ZCHH 4KKCC 4L4TB 1A7QL 5HHMD 5DZOA 1R3IL 4TSAL 5HSFA 1CLZH 1JFQH 4JB9L 1TQCB 1ZLSL 3KYMB 3KPNA 1BREA 1D3CA 2R2HA 2VDRH 1OP3H 3TBWA 2Y36L 2H8PB 4MJIB 3VD9A 1H3XA 3HZMA 4NO5B 2QSQA 3HG1B 2LE9A 3FT2A 1NGWB 4G8IA 3FQTB 1QRNE 3ROLB 5C0IA 1UA6L 1G9MH 3LRSA 4P5MA 4F9PA 4KK6C 2PN5A 1ONQA 4QEGA 2CO6B 4I18A 2DM7A 7FABL 5TDOB 5JOEA 4XVSH 4L4VE 1IAKB 3RNQA 2VDMH 4KTEL 4PY7B 5I76A 3WE6A 2AAVA 3HE6B 3BAEL 1T5WB 4HGWB 4NN5C 4MXQC 3NA9H 5E56A 1T3FA 1FO0B 3K2UH 5TPWL 5J3HC 2HJLA 2DICA 3P4LA 2IPTL 3W39A 1I9JH 2D4FA 4GXVL 2P5WE 1X4XA 4I13B 2VC2H 3TJHC 2M26A 4Y16B 3QUML 2E27L 1BQSA 4MJ6B 4PJDB 1JGVH 3D3VB 3OHXB 4FQQB 4N1CA 4JO4L 1A21A 5E2WH 3WFCH 3SDYL 5FKPA 1IAII 3F62A 4B41A 5C09A 4YDLB 4ZMAT 4V1DB 3ARDD 5C0CD 1RIUL 5ID0A 1A6VH 5J06A 4MQSB 3S34L 3IGAA 5ELIA 2J8UA 1JHTA 3MRLA 4KUCD 3N1FC 2R1WB 3VWKB 1GGBL 4F7MB 5T5NG 3SQOL 3GKZA 5LAXB 4NQSA 4MXVF 1I7ZA 2FL5B 3MR9A 2ZSVB 2UVFA 4K2UL 1QBBA 5I17A 5JW4R 3I6GA 4PRIE 2E7MA 5M94B 1GPOH 1UQSA 3WJJA 1U8MB 3C5SA 4Z7VF 2E5EA 1J0HA 1NMCC 2AJVL 3F7PC 5CBEA 3VE0A 4NKQB 4NWTH 4CJ1A 5B21A 2RCSL 3H9YA 1UM5L 3U7AA 4TTGA 4XPGL 5HY9A