1RJYA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 72
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjyA01
5JDJA 4I9WD 2XOTA 3QEQA 5GQBA 4NQCB 4UT7L 4W81A 3W0WD 5C0FB 3OXRA 3DJ9A 1PY9A 1MCJA 3L7FB 4GLRI 1UZ8A 3P30L 3VFGL 1CD1B 5E56A 2XNAB 2ATPB 3RGVA 5T1KA 3LEYH 2CRIA 2NY3D 5EWIH 5IUSA 2BOBA 4Z7WE 5L7XH 2C3XA 5L88H 4FFZL 1S3KH 1LK2B 1NGPH 3BPCA 1YPZE 2XN9A 5DJCA 3AREB 3IETA 4MA7H 4OLVL 4M5ZH 4QEGA 1X4XA 4LHUD 2IPUG 3UYRH 3GDBA 2YA1A 1UJTA 4Y1AE 5EU7C 3H9HA 2IH3A 4ELKA 5HY9B 2EDKA 2IFGA 2DKMA 1RZIA 1JV5B 3GSQA 5DD5H 4ORZC 3TPKA 3TZVC 1CGYA 2W0FB 1OPGL 2DQGL 1K8DA 2G75A 5JUEH 2W0LA 4WFED 1HHGB 4BQ6A 1A7OL 3WSQH 2ZUQC 5DUMH 1MVFA 3G9AB 5EOTB 3EFFA 3JWOL 1K9TA 3R06A 4DGYH 4X7FC 5C0BD 1U8IB 2XZAL 4GRMB 1VB9A 2CIIB 4PRHB 4NO5B 3MRBA 1NGYB 3WIHA 3WNMA 3QDME 1PSKL 4JY6B 1KIPB 1VA9A 1RV6X 3LEXA 1MOEA 5FO9B 1NFDA 4R0LA 1DTUA 4P9HL 3T0XA 5EU6D 5ITBH 1I8LC 1L7TL 3KS0J 1HEZA 3DX8A 4F33A 4M7JH 3MGTA 1JPGB 1S7SA 5C0ND 5E4EC 3ARBD 3MRHB 1NUFA 3RVVC 3TIDA 4KPHH 4X9HA 4PJXB 1YNKH 4LARL 4XPTH 2MHAB 3ROLB 3U1SL 4D0BB 1RK1A 5C09E 1VGKB 2BY1A 1HXMB 4JGMA 5H94A 1R3LA 2AW2A 2DQTL 1I1AA 2YXMA 4TYUA 4HIEA 5IM7B 3DX7A 3FB8A 3GSNB 3BVNB 1D5ZB 4M6NH 2EDTA 1R3KA 2WUCH 3FO1B 5D1QB 1A4KB 4EN3C 3UO1H 3B4NA 4XVSL 2YPVH 4G9DA 4GAJH 4AENA 2R0LH 2MNUA 3BISA 4U3HA 1LVEA 1F58L 4YPGB 3WYRA 1Z3GL 2YD4A 3ARFD 3FOMB 3VD9A 4GAFB 5J6GA 3MRCA 3MZGB 1BIIA 5IB1B 2BDNH 3RU8L 1NCAL 3OKKA 2FL5A 3MRKB 1T3FB 1QFOA 4KGLA 2ERJB 2MKWA 5B4MC 2H9GB 2NZIA 1AQKH 1BX2B 2R0KL 3I2CH 5IHBA 1KJVB 1G0XA 3FB7B 3GO1L 5I1JH 3X11B 5IROC 3TM6A 1ZLWK 1ETZA 4ALAL 3WUWA 1N7ML 3PXHA 4W6WB 2NY5L 1SBSH 2X42A 1IAMA 2AXJA 2IANE 5GS1B 4NKOA 5IJVA 5C3TA 3O8XD 2HVKA 1OLLA 3OKNA 4KRMB 1K4DA 3KYMB 4HKXB 4M61B 5FXCH 4LPYA 3IVKA 3D18B 4QCIB 5IHUL 1S7VA 1UCTA 1WCBA 4YDLC 4TSCH 3WUWB 1FC2D 5TQ2L 4JQVA 4M9PA 3B9KD 4U6YA 3QIWD 4DQOL 1G9NL 1RU9L 1BX2A 35C8H 5LBSL 1ZHLA 4YXKL 2EIZB 2CUIA 4FXGA 4AK1A 3B9DA 3SGDH 2IAMB 4DK6A 2QHRL 2AK4D 3VFRB 2IC2A 5BZWB 4HPYL 3QJHB 3QEUA 3EHBC 3BP7A 3HI5L 1EVUA 3GIVB 4NCC1 3TH4T 4KZEH 4Q9QL 3ARGA 1DBKH 3BP7B 2A77H 2H2SD 5HHQB 4YIQB 4F9LA 4FS0A 5L2KD 3DXAA 3GSNA 4KKLC 2B1AH 4JKWA 1NSNL 1XF4A 4LSVH 1IGMH 5I1AA 5GS0D 5MP6L 5MEQA 3CLEH 1WWWX 2AKRB 5FK9B 1D6EB 2ADGA 2R23A 5E99H 3QHZH 5EO0B 2FO4B 1ORQA 3SGJC 3LRGA 2X4OB 1LO2L 2DM7A 2XQYK 2L7JA 1UYWH 1EXUB 3OJDA 1E0OB 3OJVC 4WFFE 1FL3A 1A7QL 1OGAD 3HI1A 1IE5A 4YDKL 3GMOA 5FA3B 5DVLA 2A77L 4OSUL 1RFDH 4Y4HD 3O2DA 3TN0A 1B90A 1DZBA 3P0VH 3P0GB 3BN9C 5ICYB 3OKNB 5FM5M 1ES0B 3KPSA 1OARL 4Q58C 5HHOA 3F58H 3H42H 4AY0A 1CLYH 2XPGA 5KSVB 4ZAKA 4NPYA 3ZTJG 2QSQA 4WW2C 1MHCB 1ZHBA 1J1XH 1CFQA 1TIUA 4KUCF 4M5YH 4MA8H 4M8VA 4YHLH 4R26H 5DFVC 4JPVL 3ZL4L 4R0LC 5D1ZC 5E2VH 3KPNA 3VXUA 3F7VA 5D6CA 1YY8A 4A6YH 2BNRD 3KPLB 1DBML 3KXFA 2BNUA 1INDH 5DJZB 5J3HC 1MF2L 5FEBA 5B8CA 3A67L 5FGBA 2YC1B 1R5IA 3QUYB 2VSDA 3RNKB 5T5NG 4XPHH 2DM3A 5J6GB 1QYGH 4KUZH 2ADFL 3QQ3B 2CDEA 3WHE0 1I7TA 3SGJA 2VXTH 3ZE1E 1U58B 3REVB 3M8OL 2AEPL 2Y06L 2FATL 5T3ZL 1CN4A 5TPWH 4JHWH 1ZWIB 1TCRB 2KH2B 5EULV 2VXQL 5GZND 2K1MA 1T7VA 1UZ8B 3ISWA 1OT2A 3PJSB 1TLKA 1NBVL 1XR8A 1PVHA 3T77B 1NAMB 1KCKA 4F9PC 3MQIA 3SE4A 3QDGB 4KUZL 3BP6A 1GGCH 2DF3A 2IFFL 3RA7L 4BQCA 2BMKB 1TZHB 3D85B 3CIQA 5J9PB 1UJ3C 3OHXA 2W9EL 4X4XB 2W0PA 1FCCA 3H0TA 1GAFL 5CJQL 1NANH 1L6XA 3U2SB 2FATH 3MXWL 4Q2ZB 1WICA 4U2YA 4R0LB 4FQXA 3QO0B 4OTXL 4MXWH 3BOVA 3U46A 4X98A 3SE9H 4YJZL 4Z7VA 4JRYD 3UEZA 5HVHB 2XTJB 2GTZA 4G9FD 1A1OB 5IK3B 1BFOB 1DQTA 3MJ9A 3VG0H 4POYA 3MO1A 3I6KA 3MBEB 1DUYA 5EU4A 4Y8DC 1NGQH 2HKFL 3HMXL 3CH8A 3GMLB 5GJTH 3U4BL 3HTLX 4HMCA 1F3DH 3V0AC 5HGBA 3O11A 4NRYB 1A6WL 2W9EH 1J10A 4LCCA 4YHML 3QFDA 5EIVA 3DRTA 3O8XA 1NBVH 4CU8A 3E6FB 4L3AA 4MDJA 2PO6B 2BSRA 1EUTA 1S8DA 3NZ8A 3DSFL 4JDTH 4E41B 3BXNA 1RVFH 4A2LA 3LOWA 3KPPA 3U0PA 1YJDH 4EN3B 1OGAB 3DROA 4F9PA 4W68A 2R0WH 3LDBC 3WXWL 2B8OT 1H3TA 3Q5YA 2BVUA 3DYPA 3SE9L 4ELMA 1EFXB 5GRVK 1KJ3H 3BO8B 2EDNA 4GRWF 1RJCA 3DUUB 1BECA 5TQ0L 1ZOXA 4PUBL 4EIZC 4M43H 2FRGP 4LF3B 4FQXC 4KI5C 3VI3F 4WV1B 3S36X 3UJJH 2IBGA 5DRZB 3V5KA 1IC5H 5JW3L 4XWGL 1FRGH 4I2XA 5BW7C 1ZHKA 5JNYA 5HYJB 1P4LA 1SHMA 3QZWA 2APBA 3B9EA 3LS5L 1HIMH 4RGND 3RDTC 4ESKA 1W72B 3MSPA 4APQB 1RAMA 4GRWB 4CJ1A 1H15A 4ODWB 5LQBL 3D69B 4LVNC 1VGKA 1XGYH 2AXFB 3MJ6A 1NKRA 3RVTC 1YQVL 4OV6F 5EBWB 2HRPL 4X7SH 5D5MB 5CJBA 4LSPH 2W1NA 4XAKE 5B39B 1CF8L 3BPOB 2BHUA 3UJJL 4LCWE 4PJFB 1CQKA 3RIAK 3F5WA 3WUZA 4N9GA 2Q8BH 3UYPA 3FQNA 4E9LA 4JO3L 2VLMD 2LTQB 1BZ7B 2OTUB 1BAFH 3HE7A 2J88L 2FH6A 1GRWA 5MENE 2M26A 3CLFH 8CGTA 2DKSA 3TZVB 3VFSB 3ARWA 2L7UA 1RZKH 3LEVL 1JP5A 5CP3A 5JIHA 3DV4B 1XGYL 3R06B 5E9DA 1KCGC 1KXQE 4LKCB 4GKNA 4YK4B 2FIKB 3RKDD 3ULVE 2GJZA 1ZA6B 1S9WB 2NTFB 3NFPA 3NZ8B 4PJAB 4L8DB 1GCFA 4OKVA 1X5HA 5F88A 2VABB 4GQPH 4DUVA 4XCFH 1VACB 1QFUL 3LSOA 4YDKH 5BS0D 4Y5VC 1JJUA 3QR2A 3ZTJH 4KKCC 4KC3B 2OYPA 3D0VA 4MHHI 3UTTB 5B3NA 3V5DB 4GBXA 4R97B 3QEHB 1X5XA 1CFNB 4NNXB 3EYUH 1YQ2A 4KVNL 1E4KC 1H0DB 3MZTA 4OGAC 3UTPD 1KN2L 4JFDB 1DUYB 2XN9D 4ONHA 3VRLE 3SDYL 1FJ1A 2JCCE 4ZAKC 4HK0A 2CLZA 3PL6C 5CGTA 3RBSA 1FE8L 2CLRA 2AK4B 3HC4H 1MCHA 1RU9H 35C8L 3ARPA 2ZPKH 4HWNA 3GI8H 4PJDB 4X99A 2R2EA 3W5MA 1CZ8L 4WRLA 4N9GB 4LASH 2OXHA 2JB6A 1X5ZA 3IB4A 1CD8A 2ZJSH 1LO5A 3V6ZB 3RI5K 3K4DA 1ZS8A 5MENA 3JSSA 1B88A 4GG8B 1F4XH 4MA3B 2DL9A 4DGIL 3QA3A 2VDPL 4U1SB 1UM5L 2XKNA 4PJ5A 4NKQB 4NFBA 3I02A 2BOCA 3NCYS 3ZDZE 3ZHLA 1I9RH 4NYLB 4LCWA 4MJ2A 4M1CC 4NZTH 2A74A 4P23A 2VUOA 3FRPA 4WWKA 3TVMB 1MLBA 4QRPD 4FQQB 2AXGA 4YHOL 4F3FA 2F58H 3FQXA 5FGCB 2AV1A 2V17L 4UQ2B 4YFLI 5FYKH 3TJEH 1BP3B 1N2RB 2P46B 2LE9A 3N1GC 4J4PD 1D5MB 4RMSA 2NZ9D 4ISVA 1CXLA 4V2BA 3G9VA 3MFGB 3MRMA 1GZQB 2CK0L 4DN4L 1KCRH 1QFWI 4DGIH 1MWAB 5HYJE 1S9XB 5DHYB 1PJ9A 4CBPA 1JZ4A 3VG9B 2ITDB 1INEH 2OTPA 3N50A 3VGEA 2KQNA 5HGGS 5EZLA 1P5VA 5EG6C 4YNYA 5F96H 4WHYG 1LDSA 2CMRH 4BZ2H 5E6IA 2IANB 3O6FB 4AL8H 4R4ND 4ELME 3F6LA 2VR4A 3UPAA 1RJLA 1F02I 3EOBA 3HMWL 3SOBH 3VFPB 1TMCA 1ES0A 5J1AA 5GS2D 3KPRE 4CKVX 4OCRL 5HVFB 1MHPL 3QFDB 5ADOL 4ZFFA 1X9QA 3GM0A 2P5WD 3B5TA 4LPXA 5K59E 1BGXH 2BCKB 1Q9LB 2EDOA 5B38A 3BDYL 3O6LH 1KJMB 4YHIB 2BC4B 3EYVB 3NPSC 4X6BB 4GG6A 1Q94A 2BXYA 2J3SA 4LOUD 1LGVA 1BFOA 5JQHC 3IFOA 4NC1C 2EC9T 1AKJD 1I9IL 1WEJH 3DO7B 3TN0C 4FFZH 5DLML 2BSSB 1KG0A 2NX5B 3KWWA 3G5XB 4K7FA 1DDHA 5I8OL 4PDCE 4HKBB 3VXRD 1VESA 2FO1A 3S98A 1ED3A 2YRZA 3LN4A 1QFWM 2HMID 2JTDA 3CDCA 1KCVL 1CFVL 2JJWA 3BD5A 5DK3A 4F58H 5J9PA 4Y5YB 3R4DA 4QRTB 5HI4D 1G7IA 3C8KA 4J3UA 3KAAA 1AGBB 3TESA 2ERJC 4P2OA 1FHGA 2ICWJ 4NUGL 5IVOA 3L3GB 15C8H 3CMOH 5IMLB 2CXKA 4I48A 3L3OA 2X4UA 5D2LB 4G8EA 3FFCB 3QG6B 1OM3H 2KUTA 1MAJA 2R2HA 4R96A 3DUSA 1QBLH 2NW2A 4QWWD 5TDOA 4K3JH 4PLOB 1A3LH 3EYOA 5KAQG 1JYXA 1KCUH 2VQUA 2GQHA 4YBQD 2RCSH 1M7XA 4OFPA 1J8HE 4PJBA 1N0LA 1A7BA 4FQIH 5C1MB 4PJBB 1P7QB 5D1XD 1NDGA 3T09A 1HSAA 4RSVA 4MNHB 3FCTB 5KTEL 1QSEB 3OKYA 4LPTA 5CEYB 3V4VL 4UAOC 3LKSA 3PGFL 4PGBA 1A1MB 5EU3A 4M1CD 2DD8L 3UPCA 1WV7T 4Y5XC 5CP7A 1A0QH 3PWJA 1KEGH 1U0QA 3CFBA 5C0AA 4WCYL 3TF7A 1LEKA 5AZ2L 3HS0B 3CFJA 5EA0H 3U9UB 2NX5D 3KS0H 1B0RB 1Q9WB 3E8UL 4J1UA 1BZ9A 3QFJD 3O3BA 5FGCE 3KYOA 1SY6A 5EOCH 4Y5YA 4QTHB 4PGDB 4LU5L 5DUBB 1T4KA 2D31A 1CDBA 1S7WB 4UV4H 2EICA 2ZSVA 1IAIH 2WUBL 1T1YB 3OZ9L 4TNWK 3RHWF 2DD8H 2VISB 4KAQL 1C08A 1DBBH 3RWGB 5JW4Q 4ZS6C 5B4MD 3RWGA 2WWKT 3IFOB 4PRIB 4P5TC 1T0NB 2BVOB 4MVBA 1RZ7H 4WU5A 4KKBD 4P5MA 4PJ8A 5I18L 4ODHL 1FGVL 5GGQL 5DUBA 5HDOA 4HWEH 2EKSA 1AO7A 5KANG 1ZGLA 4V3EB 1BEYH 3PDOA 5DVKA 5I9QB 4ZS7L 3IXAB 5B21A 2YN5A 1BZ9B 4PRNB 3JWNC 5FM4A 3MR9B 2B5IB 2NW2B 2O5ZH 1BVZA 3UJIH 1JHKL 2AEIT 2X7LA 3FT4A 4RAHA 5HHXL 3RWIB 3WFCL 1AGCB 4L3EE 1ZAGA 4IOIB 1LO3L 3T2NH 4R2GC 2QKIB 1KXTB 3CFDB 3M17A 1T66D 4UILH 4KK9D 4IRZL 4AEFA 1QSEA 1VDGA 4HQQH 3O3EA 3DI2B 4QF1B 1Z0MA 2AJZA 1MAMH 3EFDH 4OQTA 5K9OA 2AJXL 4X9GA 1GZQA 4QRSB 4ONOA 3KDMB 4X80H 4EUPH 3OB8A 5CMAB 4Z8FL 4IMKC 1MCIA 2DQEL 1N2RA 3R0NA 1HI6A 3WJLC 2YHGA 4QHNB 4HWEL 4OZHF 2G60H 1KJ2L 3C8HA 3P4NA 2C4FU 2QV2A 2G75B 4NGHL 4XNYL 1RUPH 1KFAL 4ZQKB 1QFPA 1RURL 1KACB 4LQFH 4Y2DB 4WU7B 3AXLA 3JXAA 1NFIB 4ZFFB 1ETZB 4FFWD 3FZUC 5MENB 1KC5L 4WEBH 5HY9A 1BQLH 2F19H 2J4WL 4ELKB 1S9VA 3EKCA 4XH2B 1C5CL 4DWHA 2JB6B 3KPRA 4BZ2L 3N1MC 3GB7B 5E8EB 4IRJC 25C8L 2CDGA 3NFSL 3SGDI 3W9EA 4XNZB 4MQ7A 2F53B 2LAGB 3EOTH 2XZCH 4PP2B 1OAXL 5DD3L 5IWLA 4HIHA 2XI9A 1HOCA 3QO1A 1G1CA 3BGFC 2Y36H 4CNIA 3IDXH 1L9MA 1HNFA 2EECA 5HGDB 5DEFA 5ESVA 1Q9KA 4DUXA 2BX5A 3ZE1F 3OGCA 4G8GA 2IPKB 1BWMA 5ACZB 2C9AA 1XGRA 1Z9MA 3WKMH 4P3CH 4MSWB 1A1NB 4WNQA 4GBXC 3CSGA 3QI9B 4PYHA 1ZVHA 3QULB 4L3CB 3DWTA 5BRZE 1YEFH 1QNZH 3JWOH 1D5BB 1L0QA 1AP2A 1W0WB 3TC9A 2HT4C 1V7MH 5LGJB 1UACH 1KGCD 3QIUC 3OJ2C 4HAGA 4OCWH 1U8OA 5EZLB 3FFCE 4LL9A 3HPLB 4HUUA 4F33B 4MA3A 3DX9B 4ZDHA 1MRDL 3EZJB 2K7QA 3FAWA 3QI9C 5C8JB 4Z7OE 2DQDH 5F70A 1J1PL 4HJ0D 3FT2B 4PP1D 5DJXB 2X10A 3LDBB 3LPFA 1JMXA 2V2XB 4Y88A 5JOPD 1JGDB 5E94A 3QFJA 3MRBB 2R2EB 1SVCP 3O4OB 5SWSD 5IMKA 1LQVA 3RVUC 2AK1H 4RWHA 4IDJH 4I77L 2HH0L 3T0EE 2YKLH 3QHTC 3DGGA 4WDIA 5CEZH 3HCVA 2VIRA 3C2AH 1AD9B 4NN7B 2H3NB 1FDLL 3FJTA 5CINL 3S5LG 1SJEA 3WIIH 4J3OC 2W0FA 5FYJD 1RHHB 2EH7L 1PG7H 3JV5A 1U8JB 4FZEL 2XWBA 1ZLSH 1OP5H 1HCFX 1UQSA 1H3PL 5DJAB 3FQUA 1MPAL 3PDDA 4P23D 4YQXH 2DL2A 1YEGL 1CE1H 1CTNA 3O41B 5BO1H 2OL3A 1LO5B 3EJZD 4QXWA 3TFKD 2CKNA 5K93A 5IBLD 3LH2L 1X44A 4TQEL 4TVPH 4JG1L 2WP3O 1YEJH 1FIGL 1WZ1L 5F71A 4UT6H 4X6FA 3DVNB 3V6OC 5D93B 1MVUA 1ZEAH 5EBMA 5DD1H 2QSVA 3MJ9L 4NNYA 4L8SA 2ARJB 2E8YA 2JJTA 4F37K 1O7SA 4ONHB 5IMMB 1QR1B 4MS8C 1P7KA 1T2JA 1UM4L 1AXTH 4EI5C 4FABH 5HDBE 4NJ9H 4Z7WA 3VXNB 1VFAB 3ZKMC 4NRZA 2LV4A 2PO6A 1G0YR 3SQBA 1P6FA 4PJGA 2GUOB 5FDWB 3LSOB 4QTIH 3QB7C 4YK4C 2DBJA 4KQ3H 3VXRA 1IGIL 2D7PA 4JKMA 3BZEB 1NMBH 1CQYA 5BO1L 4FQCL 5JOFB 2E7LC 4ZXBA 1P69B 4JN1H 2VIRB 4MNQD 4LSQH 4AH2A 4XNUL 1BEYL 1ACYH 1IVLA 1L4IA 5JW4R 4X6DA 3NCJL 3MO1B 3EHBD 3WN5A 4R97C 4Z7UF 1JGDA 4AJ0A 3VFSA 5HDQH 3TO4D 5DD0H 4GH7B 1K4CA 3RY6A 1HK6A 1T89A 4FTVB 3BEWA 1YN6A 3CFKB 4M1GH 2G9HB 4I2XE 4KKLD 2OJEB 4E0RA 3ARQA 5CEZD 5D93C 4Y2OA 3K7UA 1R24B 3O6KL 3OHXB 3NCMA 1LP9A 5KJRH 1KIQB 1FFOB 4KZEL 4MZ3A 4QYOB 4K23H 4BUGA 4MJ6A 4NQVA 5I2IB 3RPIB 3BEVB 2Z8RA 4XCEA 2K9UA 5LJYH 1F4YL 3QG7L 4TUKL 2AJYH 2PXYB 5GGVY 5DTFA 4G6MH 2QR0A 4JFEE 1N3NB 3MR9A 3RIAF 4PJIE 4FFVC 4PRBA 5D2NA 4N0YH 4HGWB 4U1MB 1UH4A 4URTB 5FFLA 1OSPL 4PRDB 1FL5B 2DJUA 4P2CG 1EJ6A 3WS6C 4ZQKA 3E6FA 5DVNA 5DEFB 5JW4N 4MAUH 1TZGH 3L3HB 4P49A 1ND0B 3PHOB 1X7QA 4JFZH 4IDLA 4RGNC 4LCCB 2J8HA 4XPBH 1XIWB 3CFEB 1X5GA 4LF3A 4K23L 3QQ3A 1L0YA 2R0ZH 3BGFB 3BO8A 3SKNA 3T1WA 2ATKB 4LVHB 1RUML 4FZ8L 2FX8L 1PZ5A 4Q7DA 2FEEL 3IXTB 5AYUH 1FG9C 1NUNB 4APQC 1A14H 1OARH 2GK0A 4R4BA 1I1AC 4Z7VB 4IMLB 3CX5J 2ZUWA 1F4YH 1G84A 4XAWH 1KB9J 1KIUA 3LCYA 2UWEB 2ILLA 5DMJB 4KI5E 4Y4FC 2N7AA 5I15L 5EORL 3ALPA 5A2IH 1EJOH 2OCFD 5LBSH 3NIFF 4FQLH 1FZKB 1J18A 5D2NE 1QBAA 5I8CB 1TZHA 2P4AB 2UZXB 3CPLA 1MI5D 1TJHH 1KIRB 1BPVA 3QP3A 1IBGL 4O2EA 5EU3B 1KB5B 5IJKA 3S34L 4XGZB 4EBQL 1FP5A 5CZKA 1QFUH 2GITB 5EN2B 3U4EB 3W81A 4OAWB 4YC2C 5EC2B 5FKAA 1MRFH 4LHUB 1DQLL 2F5AH 3GMNA 5HYSB 2O61A 1MFAH 1KT2B 3KPMB 4TTDC 5DZLA 4MDIA 2IG2H 3I75B 2WWMD 5F7EH 3D5OF 4UIMB 3VFGH 1U3YA 1HINH 1D9KD 1XIWC 5TDOB 3VFTB 1MY5A 2YPLD 1OAKH 2O5XL 4JRXB 2B0SL 1XF4B 3BKYH 3VFVA 2OI9C 1CXEA 1EAPB 5I76B 4X6DE 3S3PA 2VISA 2FGWL 3QUYA 4FN0A 3DOSA 2OX5A 4HJJL 3QXAB 3LY6A 1CYGA 5ALCH 1DANU 1NUGA 4P4KB 5IIEB 3BP5A 4JZNB 2Y25A 4PJEF 5TE7L 4XXCC 2FX9H 5CKAA 3NCFB 1ZWIA 1P5UA 5IVZA 1A6UH 3PF2A 4UQ3A 3T8XB 5EZIL 2EKSB 3U9UA 2OR7A 3HS0A 4Z18A 5F7YC 3UP1A 4E41E 5CBAA 5C07A 1CDHA 1I4FB 4CVWA 5C0NC 3FFDB 5F7UA 3HUJA 3EYFA 1FAKT 3ARDC 3EYQD 5E2WH 2CDEB 4LRIC 4OGYL 1QLEL 3HZYB 4PGBB 4LLQA 5I1EL 1HQ4A 5INDA 4JDVB 2OR9H 3LPGA 5H2BB 5TFSL 3I6GB 4FRWA 3RWJA 3IDXL 3WNOA 4JO4H 1A6TB 2QLVB 3P9WB 1BQHG 5EZJA 2HLAB 4GAYB 4ONGL 5JMRA 1YECL 3T4YA 4O02H 4GW1A 4PJ9C 4MNGA 5INCB 2EXWD 3KYOB 1CFQB 2C4FT 2CMRL 5GZOD 2MCG1 1J5OL 3DLQR 1QRNA 3C6SB 4XVUC 3TT3H 1CI5A 3QNYA 3QG6A 4G8EB 1NMAL 1V8HA 5JOEA 4KMLB 2OZ4A 3T65A 5C0DB 4FNLH 1XF3B 4YIQA 1IGML 3TT1H 4NZUH 5EWIL 5GISL 4KKAC 3U4AA 4YBHA 3IJHB 3H7BB 5DGRA 4ONGH 5I1CL 1MHPH 4UAOB 4Y4FD 1BQHA 4XVSH 1IL1A 3WBDA 3LKOB 4M7KH 1CU4L 1IKNC 4PJEB 2X4OA 1NCCH 1FGNH 2V5MA 5TFSH 4Y5XB 1DL7H 5I66B 1B2WH 3P73B 3SE8L 2QADB 3CXDL 2R15A 3QI9D 1F45A 2YD7A 4KHTH 3VWKB 3TJHA 1I7ZA 3L95A 1HH9B 3W9DB 3MLVH 3SCMD 3DX7B 1U95B 3OAUH 3MJ8A 1T89C 2HKHH 3CU1A 4WI2A 1WWCA 3LV3A 4LFHG 5FUCE 2QR0B 4LHUG 1KB5A 5C0RH 5HYQA 1FPTH 2XKNB 4PJ5B 1FORH 3QA3B 5ITBL 1SY6L 5DMKA 4MAYB 4R26L 5J06A 3KYMA 4XCEB 1OF2A 1L7IH 2FJGB 3QUML 1DBMH 4ZOBA 1JRHI 1FL6B 3VFPA 3C08L 4YHMH 3MGTB 4P59H 5DURD 4FG6D 3EDDA 2J5LC 1S78D 4YXLL 4G8GE 3G5VA 3O6FA 2IANA 4OZGF 3WO3B 5SWSB 3BWUC 3B5HA 2AK4A 5E2JA 3HA0A 3MA9L 1FV1A 1XGTA 4XZUA 4GW4B 5DZOA 1MRCL 1A02N 5KSBE 4NO0A 5I17A 4B7IA 1MIEL 2BZDA 3DURB 5FYKU 2FBOJ 3UAJC 4C56D 5I1IL 3DMMA 1BJ1H 3FOMA 2A6DA 3QUZB 3B9KA 1S5HB 4XCFL 5JR1L 5ETUA 3UTTA 1A7PL 4M6MH 2D7OA 3C08H 1ZHNB 4MYWB 5EOQL 2QHLA 4G9DB 3OPZL 2F54E 4JY4B 5KOMC 2NY2B 4Y4KC 3EOBB 1QVOB 1RJLB 5DSCB 3IFNH 3RVTD 2D0FA 5D71L 1GC1L 3NAAH 4EDWH 3RVWD 3X11A 3VGGA 1B4RA 3PV6A 1OAUL 3H9SD 3SDYH 4P5TD 5E9DB 4OCXH 2ICES 4JCLA 4YXLH 1QLFB 4KGJA 4DW2L 1PYWA 5DHYA 5I2IA 2G5BA 4NNYB 4FQLL 4KMQA 2BNRA 2VXUL 1CIUA 5EBMB 4LSPL 1FH5L 3JV6A 2DLTA 4KTDH 1GGBH 2XZZA 3RRQA 4WFHD 4UQ2A 3KPSD 5HHOD 4ZFOB 5C6TL 4P46B 4OF7A 5HHMD 4TSCL 1YEIH 3WN5B 1FJ1B 3BQUC 1MFAL 2AXFA 4YBLC 5H8DA 2DLFH 3ES6B 3MRQB 3PHQB 1JUFB 2HTKC 2JJVA 1HINL 1JUFA 4MQXC 3S37X 1HHJB 5A3IC 2OK0L 1NCTA 3NZHH 3T0EB 5KW9L 5DGQA 2NXYC 1FNLA 1ZLVH 4V1DA 1AD9A 3U0TA 2ZG3A 1T0PB 1I1AD 2CD0A 3RWEA 1CVSC 1A9BA 4MNGE 1DQJB 3U30B 4DGVH 4ZUSA 1MFEH 2IEPA 4HUVA 4NQCD 3G5ZA 4R4FL 3HNTH 3MGOA 1DFBL 2W07A 5CKGA 4DFIA 1P6AB 1R3JA 3DIFA 1OB1A 1PX3A 4NQEA 1RSFA 3BUYB 1CXFA 4J3TA 5JORA 3V6FB 3ZE2E 5AG8A 3BKJH 5AYUL 4PJIB 1IC4L 4NHCL 2OLDA 2EZ0D 2ZCLH 4XCYA 4XMPH 3UTPE 2XN9E 5KN5A 1URLA 3LS5H 3SDAA 3JTTA 4I13B 3DVNA 1INQA 2OTUA 4RCAA 5C07E 2NW3B 4E41A 1RIVH 2JB5L 1YEHL 1DQJA 3NIFE 1HHGA 2QQLH 2QTEA 4DCQB 2AXHA 1UXSB 5AUMA 2UYLB 1A3RH 5JMOC 4JHWL 5D5MA 2A9NH 3CJJA 4JFHD 2IADB 4KV5F 1OD7A 5J1TC 2WBJC 3QEQE 2NY6C 4U7KA 2V9QA 3D2UB 4X4MA 4YUEH 3RJDA 3UYOD 3AU1A 5TH2B 1BBJA 4LCYB 4D9LL 5EIIA 1C1EH 3ULUH 2A73B 7FABL 4BZ1L 2V7HA 1NBZA 2NZ9C 3SBWC 1CLOH 3MLYH 4HV8B 5IR1A 3KYAA 3WNPA 3TCLA 3QRGL 3MYZA 1RK0A 3SDCB 5T1KB 3IDIB 2EXYC 2CDGB 2CRMA 1SEBB 2K7PA 1HNGA 2L4OA 4YGVA 4DKAA 2OQJB 3WIIL 1EBPA 3QJFB 4JANB 3SN6N 4K55A 3ARFB 1NC2A 5FUCC 3E1F1 5DJ2B 1MCEA 3C6LC 3RGVD 4P9HC 1JWMA 3H9SB 1OAXH 4R7DB 5DD3H 5E00A 1CFTA 5EO9A 3O4LB 5IV2A 4B0MM 1MCWM 3QPQC 4I9WE 4BZ1H 4KY1H 4WFGE 3SE3C 5ID1A 3RZCC 1HILB 4PV9A 5TE7H 2VQTA 1MIMH 4PRID 3A6CH 2PN5A 2XY2A 2Z35A 2CKBH 3AROA 4OQTH 4HJ0C 4X7EC 5I74C 4J4PA 3QIBC 4HF5L 3BYTA 5C0IA 3MODH 1LWRA 4NN5C 3T4AA 5I1KH 2DYPA 4ZPVA 3THMH 5JHLL 1VGEH 4ZOEA 3MNVA 1U91A 4OGXL 4H25A 2D4FA 1DANT 2OJZL 3RVXD 5E08H 4YHZL 3RA7H 5K9OB 4Y1AD 2P5WB 3NN8B 1WBZB 4EVNB 4HK3N 3GSVB 3DURA 3MACL 4FXLA 3OG4B 5E70A 3CH1A 3RTQC 4ODUB 2ZSWA 2BNUB 1QG3A 4DKFH 2VO5A 4LCIH 4MD0A 4U0RC 3MFFB 4D94A 4Z77A 5HI4C 5FYLE 2IALA 4JFYB 5C7XH 4ZO8A 4WFEE 4P23C 4NPYB 3U2SA 5BVJB 1TVHA 4NJAL 4G42A 3OR7A 2MMXA 3QHFH 2FWOA 5DURB 5DMGC 1B0GA 3OAZH 4JO1H 1NPUA 4OF8A 3RX7A 4JFEA 1CFVH 1E4WL 1AO7B 3SJVB 1NAMA 3LS4L 1BD2B 4PR5A 2EO9A 1JGLL 4QHUA 1UADC 4JKLA 2E8ZA 3VRIA 1NBYA 2I26N 4KK6D 1JF6A 1PG7L 4RBPH 4MWFA 1U95A 3ULVL 1HQ4B 5INDB 3WMSA 3HR5A 4PJ8C 2GKIA 3HZYA 1ADQA 5I1DA 2XKSA 5C70A 1OM3L 2ADGB 2R23B 5I8EB 4PBVC 2M2DA 2ZSVB 4JPKL 1OAZL 4CL7A 5B38G 5C09D 3C09C 3UTSD 4TUKH 4XC3H 1LILA 2I07B 4K3JL 4YH6A 4ZD3L 4TVPL 4X9BA 1OGTA 1BREA 2VL5A 4JGUA 4LVHC 4NFCA 4PS4H 5DVOA 1G9NC 1U6AH 3HMWH 4TUJB 4U49A 4K7PY 1FNFA 4P5TB 5E9DD 1HZHL 3JTCA 3PWUB 3GIVA 3TH2T 5CHNA 1JWUA 5FF6B 3MCG1 1J8KA 3IDGA 3X3GL 2GSGB 3S35H 1YDPA 4MXQD 4QXGL 5DQDH 3ULVC 1OTSD 4NWUH 4NUJA 1DQDH 3JBG7 1AI1L 3MLPA 2C3VB 3GNML 1S7RA 4PBXA 3IKCB 5SX5H 3SDAC 2I9LB 3W0WA 5JW3H 4NQSA 1F6FB 3NIGF 1EFQA 3K4ZA 4GAYA 4Z7OF 3KPMA 4NP4H 1KT2A 2I07A 3TN0B 3O3AB 5LGHL 2X44D 1JYNA 2HG5B 4NT6A 3RNKA 1RMFL 3FZUD 4KTEL 1FSKB 3MRLB 3ZE0E 4EQ3A 2ZOLA 5CS7A 3CSPA 5IQ9B 4I3RL 5A40E 4MXVE 5JR1H 4LLMA 2FNBA 2Z92A 4U1GB 5I71B 3PDGA 3TVMC 5E4EB 3HI6L 1S7WA 4R8WH 5GRUL 4EN3D 5BV7B 4G6AD 5I9QC 4NKOB 3MV7B 1U3HC 4G6ML 3SJVA 3HHRB 2DWEA 5C6WH 2E7BA 4GLRH 4JFPA 5ABDE 2PNDA 1G6RL 2AJVL 3C5JB 4JB9L 2VL5B 1EERB 1T66C 4HUXA 4ZTPL 4HHAB 4WHTB 1YEHH 1E4XL 4IOFD 5HPMA 1QFWH 4F7EA 3MRKA 3D87B 1UWGL 2NY7H 1UCBH 4GJTB 5F93C 3G5XA 5F7HA 2DQIL 1OSZA 5E2VL 3FB6A 4UDUA 5T3XH 3T04D 4L9LB 5J13B 1M7IA 3OAZK 3V0VB 1YMMA 2WUCL 1X5LA 2AK4E 3RDTA 2EYSB 3IU4H 4RFOL 3ULSA 4PJHF 3QUZD 2H1PH 1EAJA 2DIBA 2YN3A 3NMEA 5GXBB 1MJUH 5D7IE 5F89A 4HGWA 3OGOE 3N9GH 4XVJH 1QHPA 4U6HB 4I8DA 4PG9B 4OFYA 2BDNL 2CKBB 1B0GB 2FWOB 2XXCB 3DUSB 5DJ8B 1TCMA 3L3DA 3TBWA 3U7WH 3B9VA 4KXZH 2QL1A 1OP3K 3NGBC 5TF0A 1XCTA 1MEXH 4JRYA 3MFFA 4GT7A 2UY7A 2R1XA 1TJIH 3MV9A 4IIQC 3QIWC 2EIZA 4ONFL 5J6HB 1G6VK 2VDRL 3PWLA 1MCQA 4Y2DD 4C4KT 1OGTB 2IQ9H 2H6PB 2QSCH 3S37L 5ALBL 1DFBH 1KEML 2NR6C 2RQ8A 2AAVA 1RZJL 2BVPB 5IG7B 4D0CB 4NC2B 3QDHA 4X9FA 1DDHB 4HG4K 3QCTL 5HHVL 3MBED 3MRDA 4MXWL 2R9HC 1F5WA 4ODXA 5SV4A 2KBGA 1T6VN 1YUHA 3GI9H 4UINL 1RUKL 2QEJA 2EH7H 1P4IH 4MJIE 5TQ2H 4N8VA 2XTJE 3T3PE 2IGFH 3P9MA 4KRPC 4YHKL 1WWBX 5BV7L 4LVNB 3TT1L 2BY3A 4WTZG 2BY0A 4QT5A 3GSQB 4C54A 3TBTA 3JV4B 4U1KB 5SV3A 2YUZA 3B43A 3S5LA 1A6UL 2ENYA 3CZJA 1KTDB 3ZKMD 1YEJL 2X9XA 2ZUVA 2PXYA 3ET9F 4DCQA 5IMMA 2FBJH 1Q9OB 2Y07L 3GI9L 3SKUD 3QDGD 5EBLB 2Z31D 1MCLA 1TQBC 2ZNXA 4GRWH 1KLUA 4Q9BA 5JLZB 3D85D 1T7YA 3R8QA 4BH7A 2ZSWB 2DMBA 2FECL 3O4LD 4DZBB 3NCEB 5JXAH 3RVUD 1WBZA 1H8OA 2WMPA 2GHWB 3QEQB 3HZKB 1E6OH 1UB6B 5DT1H 1UYWL 1CBVH 43CAB 3UXFA 4KJYB 1D7FA 3G6JF 4JVUA 4JFDE 1A4JB 1JF1B 3VRJB 3VXPA 3MUY1 4R2GD 1GGYA 1DQML 4U1JB 3VH8B 4ODTL 3OF6D 4LSQL 2NYYD 3QUXC 1N5AB 4I3SL 2GJZB 2NTFA 3NFPB 5EA0L 3P9LB 1PY4A 1FNSH 4PV9B 3AB0C 4XCCL 5AAMA 3SDAB 3G04A 2GAZB 1MRCH 1A7OH 5EPMB 1A5FL 3HFMH 3O4LA 3DX6B 4HBCH 3NFSH 5E94B 5FYLL 1NFKA 3DVGA 2CUHA 3CMGA 4RMUA 5SWZA 5SWQB 4KFZC 4P3DB 1PD6A 4U6VH 5SWZE 5MI0C 4HWBL 1SBSL 4WUUE 4LMQE 2VJXA 5EB9A 1JK8A 1FGNL 3NIGE 4F7CB 1LK2A 1HXYA 5C6PB 3A67H 1E4KA 2VLRA 3GKWL 2BP3A 1W0VB 3OPZH 5HVGB 3JTSB 3G04B 3HRPA 2ZG1A 2X1OA 3PUCA 4K94H 1NDMB 1BFSA 5EBLA 3NA4A 2RCSL 3PL6A 4NO3B 3RIFK 3WEXA 4ODBD 2BNQD 5HGAB 2DLIA 3VXOB 3VXUE 1BBJB 5BJTB 1FPTL 1NEZB 5E8PB 5FYKD 1KOAA 4DUWA 3WD5L 1BLNB 4HWUA 4GAJL 5GRYA 1RZIB 2E9BA 5FV1L 5FECB 4H0GA 4XPBL 1Z2KA 1JGLH 3ECBB 1WVZA 3OX8B 2X4NA 3SGKA 2HAZA 4M6NL 1WBXA 4QRQB 1QSFD 3U83A 4PY7A 5TF1L 4IEFB 4PUBH 4TSBL 5JXEA 2AGJH 3QH3B 4H20H 4H88L 2J6EH 1LE9B 2ZKHH 4WEUD 3O8XC 2DTMH 4RA3A 3HNSH 2R0KH 4RGNE 2AK1L 1JPTH 4X6CB 3QUYD 2DLFL 5CFHA 1GOFA 3KPRB 3VXSD 1J8HA 2RFXA 4WO4B 4MB3A 3NCJH 4QHMA 3LKPB 3WFEL 1S9KC 4U1GC 4OD1H 1I8IB 3BXNB 5FGSA 2VZ3A 2PF6A 3HNVH 4G80A 4OLZH 1KJ2H 1QVOA 3RVWC 4CVXB 3DXAE 4TSBH 1U8OB 1FL6A 5D9SA 4ZPTA 5FCUH 1HHIB 2QADC 5I18H 4HIJA 4OGZA 3DGCR 1ONQB 2LVEA 1N5AA 3KGRA 1FIEA 2P5ED 5DJ8A 3I50H 4O58L 4WW1A 3Q6GH 3MRIA 5T3XD 1LP9E 1GIGL 4NN7C 3WJJC 4JM2F 4JFED 5ACLA 5DJ0B 2BFVH 3CVHA 4YAQA 2H6PA 1XGTB 1H3UA 4OM1L 5HYJA 3QO0A 3U46B 5EC1B 5FYJU 1IAII 1ZT1A 2ZCKH 3BJLA 4BKLB 1QO3B 1HOCB 4HIHB 4Y5XA 4B50A 4QOKD 1J1XL 4MA8L 4QRUB 3BGMA 5F7LB 3UJIL 4CMMA 4XMLL 2QKIA 4LPWA 4MQ7B 1CDIA 2C7UB 4JPIA 3QCVL 1QLRA 4M03A 4PRAA 3ZDZF 4LHQB 4JPWH 3ARBA 1MH5B 2P7TA 3EO1B 3VFUA 2YBRA 5I0DA 3QCTH 5HHVH 3MBXL 3CDFA 5KVMC 3IXAA 4FQCH 3EO9L 3ULUE 5B8CC 3DHMA 2DWEB 3GMQA 4UV7L 3B83A 4I5BA 1I75A 3UZQA 3RZCA 3ARDA 4RRPA 5T1LA 5ERWB 4P5MB 1F8TH 4XNYH 4YBQC 1ZHNA 4JVPA 5GGTA 2OP4H 2RJMA 3L1OH 4PRIA 1AGFB 3J7HA 4X5XB 3BQUA 2JJSA 5CGMA 1CXHA 3FB6B 4ODXB 1BD2E 4XMKL 5IBUG 1M6OA 2YC1A 1J1PH 5J8OA 5FO8A 3P0YH 4NGHH 3VRLF 3PIQB 1EO8L 4K3HA 3C8DA 1T4KB 4WHTA 5IJKC 1IQDA 2XG4A 1BJ1J 1S7QA 4X8JA 1XF3A 4MXQA 2JIXD 3BIKB 4HUKB 1I4FA 1KPVA 3NFNB 5J6HA 5BOZG 4UMGA 3RWDB 3MXWH 4GW5A 4Z78A 2XPGB 2J8UA 4PREA 2EC9U 4AM0B 4FHBD 5H37H 3NOIA 1G9MC 5I16A 3BKMH 5INCA 1CG9A 3BUTA 1KLFA 4YEEA 4P2RA 5DHVA 4DTGH 4P9HH 4L8SC 4PJ5E 1S9YA 1EMTL 3VMPA 4NWTL 5J89A 4A6YA 3BRFA 3LV3B 4Z76A 4FFEX 1CE1L 4U6HA 4O00A 1AHWC 2EXYD 3V7AG 3DVFA 1N6VA 4AEHH 3EYQC 3HC3H 4OCSH 4YDJA 4LLQB 3V79C 3Q5OA 3W0WE 3MXVH 1XFPA 2W65A 1YNLH 5LCVL 3X12A 4ZYKB 3BWAB 4CMHC 4N5EA 2IQAA 1CICA 1TPXB 5I8EA 2V2WA 4JLRB 3RGVC 4P3CL 1KN2H 1S78C 4H1LH 5IESH 2E9JA 2D7MA 3C5ZB 3RZCD 4P2RE 1H8NA 4EXPX 2JCCA 3QPQD 3SOBL 3T8XA 1G9ML 3FFCA 5D7SH 1YJDL 3MNZA 1VSCA 4RMWA 3M8OH 2YD1A 4DOHB 2C1OB 4U6VL 5BQ7A 3VRIB 1H3XA 2EDDA 5HHQA 4Y19B 3WFHB 3G5YB 3S88L 2ADJB 3QIBD 3EYSL 5D6CB 5I1LB 2ICCA 4G6FD 4W6YB 5MERA 4LEXL 3OKOA 1P7HL 4HXAL 3VMOA 3IAGC 1EGJA 4MB5A 1I7UA 3IFLH 5CEZL 3HC0B 3LKQB 4KKAD 2P8MB 3TFKA 4RZCB 3VI3E 5I73C 1WFNA 4EJ1C 3B6SA 1WBYA 4JFYA 1A3QA 5LKNA 3RL2B 4L9DA 4PJ7F 4XNMB 2KQMA 4NHUB 4Y1AA 3C6LD 4UIMA 1S7QB 3DO7A 4HT1H 2GK0B 4OGXH 1P1ZA 2WBJB 4OB5H 5F7DA 1MHHB 4PRPA 1YPZA 3JWDL 1V3MA 4XHJD 4BSJA 3S88H 2MTPA 4FQ2L 3MLRH 3BZFA 4WI5A 3QDJD 2D0GA 4Z7WF 2X1QA 1T7WA 5D7IB 5D7SL 3CU7A 5DMGD 5GS1C 4OFKA 4JM4L 4QXTB 4OUOA 2B20A 4Z5RB 5ERWA 4EDWL 4CN4A 1DVFA 1MCPH 2P8MA 1WZMA 4UU9A 1E6JH 2PXYC 2X4UB 5D2LA 3HZMB 4EXKA 2LQRA 3TH3T 4IMLA 4LRIA 1CDYA 3P4OB 4R4BB 5DTFB 3MOBL 2GY7B 2DJSA 3EO0B 4P5TA 4PRHD 4D9QE 5BCAA 3WFHA 3QJHA 1JWMB 3H9SA 2CPCA 4Z0XB 4EVNA 4PTTB 2GJ6B 4FMFA 1U8KB 3KLHC 1IEHA 3G08B 2CUMA 1TNMA 5HD8C 4DKEL 2Z8WC 1GGBL 4N0CC 1JRHL 4N1HB 3MRRA 5KSBF 3TA3B 1P9MC 2KPNA 3QDMB 3KHQA 2NXYD 4ZPVB 4Z7VE 3DO3A 3IDIA 4AENB 5L2JA 2IQAB 2PCPA 1C5DA 4L9LC 5ICZB 4ZD3H 3CVHB 4YAQB 1MLBB 5JZ7C 2P8PB 1CK0L 4IS6A 4Y5VA 4FA8A 4FXKB 4U1MA 1WCBB 3MRJB 3K8LA 4JHAL 4M6AA 1QKZH 4NO0D 1N5YL 4XX1E 1HSBA 1DE4B 1PAMA 2ARJQ 4DN3L 5CZXD 3TV3L 5DHVB 1T04B 1JRHH 2Y1VA 4Q9RL 3BEVA 4MJ6B 4NQVB 3SDAD 2IAND 3O6FD 4NWUL 1DVFC 5D7IF 2CO6B 3OSKA 1CDUA 4UT9L 3VXTA 1RZJC 1UXSA 2ZUXA 4MQSB 1HEZB 3DX8B 4JO2L 3VFMB 3RAJH 5JQ6L 1KELH 15C8L 4OM0H 2JE8A 1INQB 4OF0A 1CK0H 1NFDB 3SDCA 3TJHC 2DTML 2Z93A 2VDNL 1QR1A 1F00I 1BAFL 4YR6A 4NSKA 3CDGA 3EDJA 1R5WA 1I7RA 5F1NB 1KCUL 2BXZA 3MUZ1 3BQUB 5IEHB 4OGAD 1A3RL 4WY7H 3KXFE 2A6KB 1ND0A 2PETA 2AQ3A 3VXRB 1ZE3C 9CGTA 1FBIL 1VACA 4GS7C 3GJEB 5A3ID 5DK2B 4WI4A 2CK0H 4DN4H 5C0JA 5ICXA 5FO7A 2FZ3A 2UVEA 2EEAA 2Q1EA 1U8JA 4N5EC 1N3NA 1KCLA 4ORGA 3UBXB 2QSCL 3S37H 5KVDH 3U30C 3RAJL 4EUPA 1SJHB 4O5LL 2QQKL 1IC7H 3D39E 2B1AL 4WUUB 4JPIB 4H1LB 2BSTB 3OMZA 2N56A 2HTLC 2AQ2A 2W9LA 1HHKB 3S8WA 4BH8A 3QFJB 2PXYD 5GRXG 5D2LF 2LVCA 3WHE1 5HHNB 1P4BH 4BKLA 3UYRL 5JO5A 3LEXB 2EDJA 4V1DE 5FO9A 4X9IA 1A7RL 1RUPL 1FG2B 4EI6A 1AXSA 2G5BB 1T1WB 5FHBH 1SJHA 1NFDF 3FQUB 4JFDA 4LRNL 3WDJA 1KLGA 2IG2L 4O51B 3KJ4C 1UM6H 3VFNA 1MFNA 1WIPA 1RHHA 1TXKA 3EFFB 1CFNA 1I8LA 3PV6B 5CP3H 4LSUL 4OBRA 1S7TA 1U93A 2P8LA 2QQNH 3IRPX 3Q5TA 3TJEL 3D0VB 5DUML 4L4VA 4Y89A 4BSWB 1MJUL 4NCDA 4P46A 4PG2A 5C07D 1PG7W 1MQKL 3QYCA 4KTYA 3SDXA 3SHSA 4O4YH 3PGDB 3K74B 1FFRA 4NZTL 5IB5A 2VSCA 4WV1A 4LSRH 4G80B 4F15B 3GUTA 4BYHA 2BNRE 2IH3B 2X9WA 2A9NL 4CRPA 2EE3A 1OP3H 4KQ4H 5GZNC 5IHZB 3MLUL 5JHDB 2ESVA 3WDIA 1QYGL 3HPLA 4HUUB 3TZVA 3ZE0F 1ZEAL 4PP2A 3UBXI 7FABH 3AGVA 4GKSA 3PABB 4OI9A 2QBWA 3LB6C 4YDIL 1KTRL 3VA6A 4I1NB 1VFBA 2XNAA 3K3QA 1A7NH 4I3SH 4BFEA 3GUTB 1JWSA 4LLUA 2FX7H 5LAXA 4NBYB 2N7BA 4JZJA 5J12C 5TPWL 1XGUB 1VFMA 4P2QD 1BGXL 3MLRL 3OAUL 4PJCE 4MJIA 2ORBH 5CBEB 2XA8L 8FABA 1BLNA 3RUGA 2HP4A 4M43L 2A6DB 3DTXA 3QUZA 3ARTA 3V7MA 1U9KA 3QCUH 4RGNB 3GSRA 5EUOB 5JW5B 4K7PL 3N1QC 1I85A 5KSBA 1YMMD 3WIFA 1RZ8A 1IJ9A 4HCRH 4YDIH 2X4PA 1RFDL 4JJHA 2XIDA 4F7TB 5FHAL 4LLYB 3T0ED 4XBGA 5JO5B 4C59B 2Y7QA 4NKMA 4CADB 4R7NA 2BVPA 5IG7A 1T03L 1AIFB 4JRYE 2LU7A 4JGJA 1JMZA 5F1KC 2EH8H 3QIUA 3KLAB 4DGYL 4S2SB 1RZGA 4OLWH 5DHVH 1U8PB 3DVGB 5SWZB 3BMWA 5SWQA 5I1HL 4M00A 5FGBC 1UKSA 3TO2A 3ROOB 1GH7A 1JNLL 2NY4C 2WIMA 4K8RC 4XHQA 2MFNA 2VXVL 4EN3A 2Y36L 2UUDH 4GMSL 1UWEH 1XZ0A 4LHJB 2ZUUA 1NC4B 5FHAH 1M1SA 2GJ6D 4A2MA 3PABA 2VLJB 1DLHA 2D3VA 3QNYB 2WSKA 5FYLD 4U1JA 4WI9A 4KMTH 3IDUA 2CKBA 4F2MA 1MCKA 2CDFB 1QNZL 1XT5A 1CL7H 1JI1A 3BE1H 3LRSA 3AUVA 4UBDC 5TDNA 4F57H 2OM5A 4MNQB 2BK8A 2OTWB 3M1BA 3RWJB 1E4WH 5BMFH 5CJXA 4Y0GA 1XIWD 2Q6WA 4K8RL 5L9DL 3IJYB 3UTZB 2VKXA 2GTZB 2EH8L 2EIDA 2ZCHL 1YY8B 1I8KB 3SE3A 5JLZA 2FDBP 4H26A 4XZUB 4K2UH 2ZUTA 3T0WA 4UDUB 4IM8A 1JPSL 3UO1L 3FQRA 4WHCA 4KMTL 5EU6B 3ZYIA 1CXKA 4PB0H 5KSVA 3LIZH 1RUAH 5I1GH 3VFOA 1OAZH 1KEGL 5E7BA 1I7UB 3O0RL 3RKPA 4PRNA 1ACYL 2P24B 4FQHA 1H3VA 2BMKA 1A6AA 1ZVSB 3HZVB 4QY8A 5D7JB 2V5TA 4JHBA 5F7NC 3JV4A 3V8OA 4JQXC 1GHFH 4NQXB 4Z0BH 4NM4L 5C09A 3MV7A 1CGTA 1KPRA 1NGWA 3I3EA 3LN5B 4OFVA 5BQ7B 4OLYH 5E9DE 5JHLH 4ZXBD 1TCRA 4MD5B 3HI1B 4FXKA 1LO2H 3L95B 3WIHH 4MS8D 2XRAL 4ZO6A 4ZFZA 1WK0A 4ZUWA 3HNSL 2DWDA 3B5GA 5I66A 4XP6L 3CFIC 3MRLA 1NKOA 3W82A 1UVQA 5C07B 2H32H 3QDMA 4XP4H 5MEND 1OVZA 4PGDA 4Y2DC 4PG2C 3TVMD 1GHFL 4N0CD 4YDVA 1FGVH 4LEOA 2VDLL 5IT2L 3D2UD 2YSSB 4XGZA 4G8IB 3MV9B 2I5YL 4G59A 2C3VA 3QEUB 2XZCL 5IFJA 1G9NH 2JLLA 5TDPB 1FFNB 3ZL4H 1MHCA 1ZHBB 4I3RH 3KJ6L 1FQ9C 1F6AA 4LSSL 2D4DA 5F9JB 3HNVL 1I7RB 3UCRA 1DQQA 3PWUA 3FB5B 2VZ1A 4PJ9A 4NNPH 1LO3H 2KZWA 3ULVH 4M3JA 1AR2A 1NDGB 3CSYA 4LNRA 3RVVD 3GBNL 2NNAB 4S1QL 3CLEL 2UUDK 1J0KA 4U3XA 4CDGC 2O61B 4CGTA 4M7LH 1UEYA 3BYYA 2APTA 5IFHL 5J1SC 6FABL 4E42A 3FMGH 1WCQA 4GAGL 3DETC 5ISZA 2FEDD 4W70A 1J87A 2Z31C 1BVKA 3PQYB 4OD3H 3VJ6B 2HYMA 4DGVL 2JF1A 3L3OB 3V4PL 2V5YA 2R29L 4XP9H 2B39A 1U8HB 1C7TA 1FZKA 1S7UA 4NQDA 2GTWB 2R8SL 1JBJA 1NCUA 5CUSH 3HE7D 4HDIB 1MCSA 3OL2A 4JY5L 5IOPB 1J5OH 1K3ZA 2R1YB 2MQ3A 3TPUB 4WEMB 2H9GA 5K9QG 4AZ8A 2IAMD 3IT8D 4QGTA 1RJYA 1TETL 5AAWA 1BQLL 2F19L 2J4WH 2QSTA 1YEKL 3P0VL 3RPIA 2FGZA 4R90L 3MNZB 2EIEA 3PWPD 3L3JA 2DKUA 5HI3C 4H26B 4K3DL 4TRPH 3BFOA 1NLBH 2PW1A 4G6KH 3OKEA 3VFTA 2P44B 3QEGL 4XP1H 3EOTL 1QO3A 3GSVA 3SDDC 1RUQL 3OB0H 1A6ZA 5FYJL 3I75A 1P7QA 4ONFH 1JHLH 4MDIB 2BSED 3HMXA 1B4JH 5KVGL 1JFQH 1PEZA 5IFAH 1I1AB 1YYLL 4ETYA 1J1OH 4LKXB 4XMKH 4FZ8H 1DBJL 3OKDB 3SPVB 1WQVT 2UY6A 5F9DC 5IWLC 1QRKA 2VE6B 3R0MA 4P2RB 4D3CH 3BPLC 2C3HA 1I3RA 1B6UA 5JIPA 4OLEA 4MJID 3MRHA 4RGMC 1QUNA 2H2PC 4TTDD 5IV2B 2IGFL 4I0PC 3UPRB 3BPNB 4TUJA 1RD6A 3GSXB 4ZUVA 5F72S 2D03H 4TSAL 1EX0A 1YPZB 3FTGA 3F7QA 1N6QL 5FOJA 3V6ZA 1CT8B 3NA9H 1N59B 3G6JB 1KB5H 2RFXB 4WO4A 3TA3D 1YYLH 3BH9A 3D3VE 2DQDL 2FR4B 3TNNB 2DBLH 1OPGH 5AD0B 4G8FB 4S0SD 3S4SB 2ATKA 2YZ1A 1Q1JH 3RJQB 3UROR 4AMKL 2NLJA 3U6RA 4K9EH 1MVUB 2HFEA 3UTOA 4AEHL 1T5XB 4PJAF 5I8OH 5D5ME 1GAFH 3VXRE 1JGVH 1D6VH 1QTYT 2VN7A 4XC3L 1DBAL 1EZVX 2CLVA 5MI0B 4PJGE 4H5SB 2NY6B 4YHIA 3OX8A 4ACPA 3UDWA 3T0EC 5BMFL 1I3VA 5DFVD 2C1OA 2WBWB 1O0VA 4KDWA 4NRZB 1R3KB 4RQQA 2DJ4A 4WENB 2BHYA 1VGEL 3MLZL 4P4KC 3NACL 5GGRB 1T1XB 1OW0C 3WNLA 1WTGT 3LMJH 2ZZUT 3PNWB 4H20L 4M62H 3E3QA 5C71A 3ARBB 5CD5C 4Q0XH 3WEXB 4PJDA 4Y4HC 2AEQL 4G3YH 4JM2D 1DCLA 1GC1C 3FQWA 1SYSA 1FFOA 2APVA 4KJWC 1BOGB 1J7VR 4CVZA 2Q8AH 4XCCH 4HK0B 1KXVC 2NY3C 3O3UN 5CILH 3TGXA 3VGAB 4FQ2H 4XVUD 5KG9A 2OSLA 4PJCB 5FOBA 4HK3J 1X5KA 1GSMA 1PQZA 1S9YB 3MGOB 4HSQA 1T1ZA 2DQUL 4GQ9L 2ZOKB 3WS3B 4FQJH 2OL3B 2EEBA 1ZA3B 1UM4H 1NGYA 5SWZD 5M95B 4IRZH 1MAKA 2YPVL 3DX6A 1AXTL 5J56B 1EA9C 2YD2A 2PR4H 4FTVD 3SDXB 5C6TH 4KROB 3O2VL 5CWSA 3MLWL 3OKLA 5J3HD 3WJJA 1BHGA 3T0EA 3ESVF 5AEAA 4YHNB 4Z8FH 3BW9A 4FMKA 4XRCB 4OT1L 1FRGL 5HVWA 3IJYA 3UTZA 5D9SB 5I75C 2YMXL 3VRJA 3QFJE 4O51A 4RWYL 2D7TH 4KJYA 2PTTA 3GMRB 4MAYD 3RWCB 4J7RA 4DVRL 1HZHH 4DJMA 3MBEC 1JN6A 5FYKE 4ALAH 4L1DA 1E4XI 3MROA 1C16A 4ZAKD 1NC2B 4UV4L 3HE7B 2FJFA 5JZ7D 5C8JA 3GI8L 2PR4L 3MOAL 3MRGA 1AJ7H 2P42B 4PJFE 4TN9A 2P48B 1YQVH 4ZOCA 4JE4B 1QSFE 4U1HB 3BZ4A 3WFBH 1RK0B 5I19L 1KTLB 2P5EB 2BNRB 1VEMA 2VZVA 5C2BL 3STBA 3BH8A 4OT1H 5BRZA 3NPZB 4G5ZH 1BOYA 1Y0LA 1K2DB 4YX2L 5E2UL 5L0QB 2F54A 4S1DC 3H42L 3F58L 3QDJB 1IQWH 1OGAA 3DROB 3O6FC 1CIDA 1DP0A 5IB3B 1T20A 4DN3H 1MNUH 3UTTE 1QBLL 2C7UA 2EE6A 1XGRB 4YC2B 2GJJA 1AY1L 4L3EB 3TJHD 4APQD 1Q9KB 1X5YA 5ESVB 3FKUS 1A5FH 4JREC 5E6IC 4CADA 2VABA 1G7QA 2DQCH 5DRZA 3V5KB 4DVRH 3BPNC 4WHDA 4XB7A 1JYVA 3HG1A 3VI4F 1L9NA 5DJ0A 5ENWB 3V4VH 1T5XA 1S5HA 1UJ3A 1OL0A 2HFEB 4WFHE 4XI5C 3DRQA 2R39A 5HYIA 1KB9K 4FQ1H 32C2B 1R5WB 5AD0A 3I6KB 3MBEA 4TNWF 1WAAF 4RAUA 4ZTPH 1D5XA 1T80A 5E8NA 3BUYA 4XP4L 3HLAB 1AFVL 3TWCL 2V2XA 4GW4A 4XPGH 1WUNT 2R1WB 4U31A 3BT2L 5EZIH 3G5ZB 3AAZB 4NKDA 2X4SB 4K3EL 5J0BA 3G5VB 1S3KL 4HWZA 3BSZL 4JM2C 4OF6A 3V4UH 2GT9A 3HB3C 5CD5D 4MLSA 1BIHA 1MCFA 1IBGH 5C0CE 1ITCA 1I8IA 3U0TB 1NGXA 5I1EH 4V1DB 1MLCB 1V3KA 2AJUL 3IDMA 4MB4A 1G0DA 4MAYA 4D8PA 1I8MA 2WINA 3U9PL 1BFVL 1DE4A 5E2TL 5T5FL 5D4QA 5DO2C 5IW1A 32C2A 1HKLH 2CKBL 5IK3A 3VDBA 3AM8C 4S10A 1A7QH 3R1GH 3KYNA 2IPUK 4Q74A 1F90H 4JFXB 4RAVA 3V4UL 4WU5B 1QSEE 1U58A 5I71C 2B2XL 2AJZB 1BJ8A 3RDTD 1W8NA 2VN4A 3V95A 3EIFA 1EHLL 1YMMB 5IBUB 5EFIA 1Y18B 1M7IB 3V0VA 3H0TB 4PJHA 4Q6IB 3BD4A 3E2HA 1JGUL 1NMCB 2HT3C 4M48L 1FFPB 3ZT7A 1QRNE 1TTGA 2Z9TA 4W6XB 3IJHA 1K5NB 3M07A 3KPLA 3KXFB 4POZC 1RZJH 1RULH 1QBBA 2I60H 3TFKC 4KK8D 1AO7E 2FHCA 4JDTL 4JM2A 4ZFOL 2I27N 4WO4D 5JDSB 1NFIA 12E8L 3JTSA 2G2RB 4LFHD 2CJUH 3Q6GL 1UT9A 4UUJB 1TQCC 3QRFM 2WV3A 3MRGB 3NPSB 4OGYH 4Z5RA 1G1YA 4MCZB 4MHHG 2DLEA 2X89A 5ACMA 1CVRA 5JA8B 1QHOA 4LSDA 2VLJD 3HUJE 5GS0H 5IQ9A 3LKSB 4GXVL 5D1XC 5CEYA 1G7PA 3KVQA 1QEWA 4PJ5D 2Q20A 4QHNA 5D1ZA 3UJTL 3I6GA 2O93L 5DEGB 1ORSA 4XVTH 5ILTL 4OZFH 4CMHB 1NCNA 1A1OA 3BW9B 2W92A 1MHHA 4YHYC 1Q8MA 2WBJA 3VWJB 2AVGA 3WL9B 2EDYA 1UWEL 3STLA 2MQCA 4R4FH 2VLKB 4EOWL 3EYOB 4J1UB 1DUZB 4K7PX 1B9ZA 4WEBL 5CBAB 4PJ7B 2A6KA 1DQQB 3NH7H 3CFJB 5TE4L 3VGBA 1UKQA 4P2RD 1UB6A 4UZGA 4IOIA 1EO5A 2FHBA 2VR9A 3GO1H 5I1JL 5T33L 2QQLL 1CF8H 1LQSR 1ZKAA 4XVTL 4F57L 4P4RA 4KZDH 1AGBA 3ZKQD 5I6XC 4YDVB 4PJBE 1FL3B 1CGXA 3GNMH 5D7KD 4X5WA 1EXUA 3OJDB 4LVEA 3X13B 4ODSH 5BS0A 3DV6B 4Z6AT 1FAIL 3O81A 1QFHA 5C9JB 2FO4A 4LQ1A 3MREA 4P3WA 4JQIL 3KWWB 3RY4A 4AQ1B 2GK2A 3Q6FB 2J6EL 2W0KA 5CIPH 5CJOH 5DYOB 1JFMA 2ED7A 1I9EA 5GGRA 4X6EA 3QUKA 1A6WH 3GSOA 1GPOL 1P7QD 3PXJA 5D1XB 3S5LB 5CEXB 3HR5B 3MV8D 5CJ8A 1C12A 3DXAB 4Y4KA 3U0WH 5EO1A 5T33H 5E8DL 3F12B 4Y5YC 1ZSDA 5DDHA 5HTSA 3T2OA 1XH3B 3RTQB 4KJQC 3D25A 4HHAA 3QUMH 1RVFL 4HKXA 4M61A 5T1KD 2X70B 4P9ML 1YC7A 1LNUB 5C0DA 3T65B 1FAIH 3GSWA 3K4AA 4PV8A 4NRXA 2F15A 1AH1A 2NCMA 2PKDA 3C6SA 4AIXA 1LEKB 4PJ7A 4HKBA 2EDQA 4XCNB 2HT3D 1IILE 4IDJL 2VDKH 4U6YB 3BE1L 1CR9L 5AZ2H 4I18C 2YKLL 4KROC 4NM8L 1J05A 4JG0H 1OAYH 5T1DH 4GKZB 1EHNA 2ZOLB 1Z9OA 5FO8B 1Q94B 3VXMD 4KAQH 4MQTB 4WGVB 5D1ZB 2ADIA 1QEWB 3CDYA 4RRPG 2G5RA 2RR3A 5I1KL 4MNQA 2HRPH 2YWYA 1YY9D 5IGXH 3D18A 3U0WL 4N0UE 2DM2A 4MAYC 2WNGA 1MFCL 3U4BH 4Z7QF 4HS8H 4UU9B 5EO0A 3BZDA 1K4DB 3T4AB 5D7LE 3GGWB 2VMFA 3FO9B 3L9RB 1UA6H 1HWGB 4KRLB 4PG9A 3CNKA 2X4QB 3C09B 4NDMB 1H5BB 4P23B 4GUPA 5KVDL 5DJDA 4C55A 1F4WL 4XPGL 1KJVA 4UT6L 2D2OA 1JHKH 5FF6A 1ZV5A 3MLXH 4GFTB 2EYSA 4Z7NE 2P7TB 4I4WB 2EDHA 1JPTL 3H7LA 5IB1A 4WI7A 1CE6B 2Z4QA 1MFCH 1MWAA 2CXGA 1JTOA 4PJXA 2FJHA 4RDQF 3L3JB 2WWMC 3TIDB 2FGWH 4OV5B 2DQHL 4TNVK 4NHUA 3QJFA 4JANA 3QXDB 2VLKD 2AJ3A 3VXSA 3U9PH 4HWBA 4TNVF 4HBQA 4K7FB 4HFWA 1Q0XL 4HFUH 1T7ZA 2AJXH 4N0CA 2Y7QB 2E7MA 4WI6A 3PG2A 1XCQB 4NQUA 4LIQH 4X80L 1D5ZA 4LSVL 1MJ8L 4KXZI 5TGBB 3SDDB 3EJJX 4MWFB 4P5KA 5JXED 5F6IC 1AC0A 4JB9H 4L4JA 1OTSC 4AEEA 5TH2A 1KN4H 1R3LB 1ZSDB 1N4XH 3HKFA 1Q9LA 1OD9A 4OQ1A 2WINB 1E4XH 4G7YH 3BD3A 2ENSA 5DF0A 5BV7H 1XEDA 4ZODA 4N90E 5HDQL 2VDLH 4ZPTB 1RURH 5C0EA 1TPXC 2UYLA 4O9HH 5BV7C 2VITB 3Q6FA 1U2CA 4F9LC 4G42B 1F2QA 2BNQA 3L3IA 2WAHA 5GJSH 4UIKH 3ALXA 4N0RA 1RUQH 3JTTB 2ZPKL 2NY1C 4RIRB 4WW2B 2YR3A 4OCMC 4A6YB 1YEEL 1JNHA 5CSZA 4MCYB 4R9HA 2DQJL 1OOAA 5KVFH 3SKNB 2X40A 5CIPB 1WFUA 1C5CH 1YN7A 3GBNH 2FEEI 2EXWC 5I16B 4RFNB 1M7DA 2YPLE 5E5RB 2UV3A 3H3KA 1T0MB 2X2YA 4M7LL 5DRWB 3OXSB 3ELAT 4L4TB 1EDQA 1MEXL 3THML 4DVBB 5MEOA 3FQXB 3UJTH 4FZEH 1ZLSL 4U1LB 4F3FB 1GYAA 5FM5O 2EDBA 3STLB 1FL5A 4L4VB 1CGSH 4X8JB 5HVHC 5D70H 5DJAA 1A7RH 1UQSB 1HILA 1BFVH 2VNCA 2VXTL 5H94B 3VXOA 3Q1SH 1DR9A 2EC8A 1WIOA 1K2DA 1Y0LB 1G7PB 4PB9H 3RWHA 3B9AA 2YEZB 2P5EA 1A14L 4GRLC 3OJMB 4NJAH 1JPGA 1S7SB 5HSFA 4WWKC 4X99B 4QHUB 1UACL 4Y8AA 3DUUA 1CGSL 3L7EB 4HZLA 2P5WE 3LB6D 4NJ9L 3MROB 1MCNA 1NLDH 3V52L 1JZ7A 2IAMC 1AD0A 5KVGH 1BFTA 4C4KO 5EPMA 5LCVH 4IRJA 3TZVD 2VWEC 3T2PA 1P84J 3P9LA 3QEHA 4GBXB 4I0PD 5TJWK 2WBJD 5DUPL 4JN1L 1I8KA 4H8WC 2AEQH 2NY6D 4G3YL 3O2DH 5C0JB 3BZEA 2F5AL 3QDGE 5F44A 4U7MA 4L3CA 1P4LB 3IGAB 1A4JA 2Q7YB 5IQ7H 1G7MB 4GXUN 4X83A 2WUBH 2UZIL 3WE6B 2A83B 2KL6A 1VFAA 4G9FA 4PS4L 4P2QB 2BRRH 5BZDB 4YXHL 5IEHA 2PYEE 4P2QA 1NGZA 1C8PA 4CDHA 2X89D 4XCYB 4MGXA 4ZUUA 4AIZA 3CDGB 3ZDYF 3C9NB 3O9WA 4OZIE 1DEEA 5L8LB 1K8IA 4K7PH 3MACH 1FV1B 1E27A 1JCKA 5FAAA 4B5EA 2EDEA 4H8WL 4LK4A 4QRRD 1U8QA 5E8EA 4P46C 5HI5C 1L7TH 3BPLB 5GGUA 4C83A 3RWEB 5GGVL 3GMMA 1VPOH 4Z7UA 1DN0B 2H8PA 4FFVD 4WV1C 5DJ2A 3AAZA 1K6QH 1A47A 4N1CA 5FYLH 1U3JA 5EZOL 1XF5A 1HHJA 3CFCL 3PGFH 1JNLH 4AQOA 3MCKB 3Q2CA 3ES6A 4K71B 4XBGB 3TCLB 1HH9A 3W9DA 2HFGL 1UJ3B 1MCWW 2HJKB 3QH3A 2GJ6E 4X98B 5JNYB 4RMTA 5C2BH 1JZ6A 1ZT4A 4XXDB 1H8SA 4HFWB 2X4NB 4XC1L 1I9IH 3JV6B 1PX4A 2C3GA 4YX2H 1CS6A 1F58H 2Z91B 3FN3A 4QNPE 4L8CA 5EOCL 5DWUL 4L3EA 1HIML 4BUHA 5KSAC 5F6IB 2JIXB 4BQ8A 3K0WA 3QBTB 5D2NC 2H8PB 3FTGB 2XA3A 1WIUA 5IB3A 3E3QC 4PJBF 5MEOB 3PJSA 5ADPH 3EGSA 5LQBH 1PSKH 1U6AL 3PL6B 4NO3A 1MI5B 4X7CC 3STZB 2YOCA 4OD2A 3KR3L 3CSBA 5I0ZA 4LIQL 2X7LB 3QNZB 4TUOB 3S96A 5I8KL 3C9NA 3OKDA 4JY4A 5MHSE 5IHZA 1I3UA 4KPHL 3N85H 3QQ4A 1HDMB 2WLYA 3U36A 5BZDA 2NY0B 3I3BA 5HGDA 3RWCA 5LWYH 3BZFB 1A9BB 4OLXL 3AC0A 3SO3C 4MX7B 3MOAH 2JCCF 1IM9A 4L5FH 3P11L 4GKZA 4NKIL 1GOHA 3IAQA 3NCYP 4LSTH 2E7LA 3WFBL 3T2NL 1TFHA 2E27H 3MOQA 1FORL 3GRWA 5KAQF 4KTDL 4FQXB 1T1YA 5FK9A 4F8QA 3BDXA 3SGKC 3K2UL 3EJZC 3HI5H 1CXIA 1NCDL 2D0HA 3ARGD 3KPSE 5HHOE 5C0AE 4ZTOH 5HHME 2H2SC 1FYTA 2HLFD 3HI6H 3MUGB 4UQ3B 1ODAA 2J7LA 4NRXB 3CC5B 3T0AA 2VYRE 5ALBH 3BMVA 3HAEB 2O5YL 1ERNA 3AS2A 3O3BB 3HZKA 5ICYA 1OHQA 2IPTL 3AXLB 4EDXB 4Y2DA 1XR8B 3MC0A 4OCWL 1TNNA 4N9OB 2ID5A 2IBZY 4BH8B 1EV2E 4BH7B 3F12A 4ZNEA 1N8ZB 2XYCA 2R2BA 3BP4A 3QNXB 5CEXA 3PQYA 3GSOB 4AG4H 5ADOH 2YUWA 5CZXC 4KUCD 3IDJB 4KH2A 5IB2A 3FCTA 1CZ8H 1WC7B 4EUPB 4M6ML 1KV3A 1MRFL 1CICB 3I85A 5JHDE 1DVFD 4JKKA 1JFQL 5K9QI 3C60A 4PJEA 5SX4H 5B22A 4KKBC 2HT2D 3GMNB 5A2FA 1WZKA 5HYSA 4LHUA 1NMCC 2PW2B 1P2CB 2UVFA 5ESQB 1MWAH 3GJFK 3SY0A 1IKNA 1EEUA 4OSUH 3X3FL 1G9MH 2A1WL 5D8JL 4IJ3B 1KC5H 2DMKA 3DBXB 4UOJA 2VDML 5GGSA 1JGEA 1IC7L 2GW5A 3LKNA 4OZHB 4ZO7A 1KJ2B 4OD3L 3ZSTA 3TNMB 4LPUA 1LK3H 2IAMA 3L1OL 4MCYA 2QQQA 4G8FA 5FHBL 1O7VA 4GXVH 2MKLC 4PJFF 4Y7MA 4D0CA 3RWDA 4HC1H 3QEQD 2Y23A 4TOYH 4POUB 5EIQA 1UM6L 5HD8D 3VE0A 5KSAD 4IRSA 3T4YB 3F65A 3VE0B 4ZS6D 3TBVB 1HQRA 4ZUTB 3AS1A 4GG6E 3ARBC 4RMVA 1CGWA 1I1CA 3UPRA 4PJ8B 1CFBA 4PGEB 3GMOB 5FA3A 3WLWD 4WVRA 4N68A 3W39B 1T21B 4N0UB 2DWDB 5C0EB 3TNMA 5I1DB 1DEDA 3GSWB 4PV8B 4QRPA 2EDWA 3B8YA 2YK1H 3ZZ1A 3C5SA 3V0WL 3PWPE 4RA0C 4TRPL 3F7RA 5JA9A 3PHOA 2B5IC 1FVEA 2OI9B 4RISH 2ICWB 5DDHB 5EU5B 5GS1A 2M1KA 3QEGH 4XP1L 4O4YL 3VI4E 3C5ZD 3RZCB 5I1HH 3UBXG 2WY3A 1P84K 2YUXA 4RGOH 4YO0B 3C6LA 3NCCB 1GGCL 2IFFH 2SEBA 3HZVA 4M02A 5FDYA 1G6RA 3MA7A 4WTZA 3VD7A 5JOPE 3RVXC 1XCQA 2WIIB 4M48H 5SWSE 3LQAC 2ARWA 1A9EB 3L6FA 4LOUC 3QUMA 1RK1B 4FNLL 4LVOB 5EU6A 3TA3A 3DV6A 3S3JA 1IGCL 4HLJA 1ZLUH 3VFVB 12E8H 1OSZB 4XX1G 2XA8H 5FYJE 4IIQB 2OJEA 5HJ3A 1U8LA 1GJIA 5EZOH 3RY5A 1CL7L 5C0BE 2XZAH 1EFXD 5I1CH 1HSAB 1H3GA 1ZT1B 5DMYA 2IH1A 1KCVH 4FOMA 5L6YH 2XWJB 1EUUA 4JR9L 4TSAH 3C5JA 2V9RA 2DTSA 5I74B 3B2VL 1U91B 3FO2B 5HHMB 4Y16B 3GBML 4GRWE 5ECJE 5KOVC 4YO0A 4GUPB 3QT2A 5EN2A 5EU6E 3W11D 4G43B 2XTJC 3D39B 1WITA 4RGOL 4N1EA 1X5FA 4ZXBB 4GMTL 1C5BL 4FQIL 1TZIB 5D5MF 3S36L 5CCKL 4HCRL 1JHTA 3WXVL 3CD4A 3VD5A 2HLAA 1OCWH 2EZ0C 5ID1B 4I18B 4HKZB 1SM3H 1ZMYA 2ICEB 3RX5A 5T3ZH 1NFDE 3D1MC 2R0LL 3RPKA 1AKJB 1R3HA 1AQDA 3GIZH 3GJFH 2OR8A 1RZGB 1D9KC 5DXWA 2VXQH 1UWXH 1WT5C 5BVPH 2YA0A 2EYRA 2RAMA 1ZGLP 2OQJA 5J13C 1P53A 4KQ3L 3TYFA 3FB5A 3N1FC 4PJ9B 3MA9H 5F9JA 43C9B 4BFGA 2G2RA 3QXVA 5DMIL 1BIIB 3B2VH 5ELIA 1U8MB 3TIEA 4OZHA 3I2CL 2ATPA 3RGVB 5ENWA 5SX5K 1JGEB 4CVUA 1T5WA 3VCLA 1IGJA 2VUYA 4M7ZC 1NC4D 2DDQL 5I1LA 2XG5A 1XIWA 3CFEA 4X4YA 4P48A 1YA5A 3EZ8A 4MLIA 2CIKA 4NQDD 1QFWL 4DZ8B 1U3HD 1ZTXL 2HTKD 1NCAH 1KJMA 2E7CA 1IC5L 5IVXF 1IAIL 3BQUD 3ETBF 3AU1B 4OKDA 4U0QB 5T3XL 4PRHE 1Z9LA 4D9QD 2A0LD 2V9TA 1QP1A 1ZGLM 4UDTB 4GO6B 2WM0A 2AGJL 5ISZD 4IOFC 2K3TA 1T20B 5F6HI 2DYPD 3EDFA 1IGTA 4Z7VF 5IHUH 3CVHH 5C9JA 4D9RD 4Z95L 4FQ1L 1L6ZA 3PP3H 2Y72A 3O3DA 5F8QC 5I73B 4WW2F 5TF1H 1PW3A 2ZNWA 1KIQA 1F2XK 5E5UB 5F7EL 3ARXA 3DHJA 4HD9A 1YN6B 2ITDA 1JNNH 1GC1H 3OXRB 3DIFB 4NQEB 5JORB 3HAEG 1AXIB 4CW1A 1JPST 4ZSOA 2UZYB 5D7JA 2NXZB 4JFEB 4JY6A 4OCXL 2VRAA 1JGVL 4U1NA 4QOKA 3O6MH 3NIDE 1NCBH 2LTQC 1MJ7H 1SMOA 3MUGA 3IDYC 4HMDA 3OR7B 1OW0A 5F21B 3GMPB 4PLKC 4NM4H 2Y9RT 2UWEA 5EOTA 2X4SA 4HKJB 3TVMA 4IRSC 3L5WA 2FX9L 3VWJA 4LRNH 1F42A 1GIGH 1N64L 1K8IB 1QSZA 4LCWB 5F8RC 3EYUL 1FVCB 3CCHB 5E95B 2ADFH 1JNNL 3AY4A 4M6OH 3PHQA 4ZUUB 1ACZA 2AJSL 1MWAL 3NN8A 2Y5TB 4L29A 1AC6A 5AWNL 4MS8A 4DKDC 3SDXF 3UTTD 3PWNB 4EI6B 3BN3B 4LDOB 4RBPK 3REWA 3HE6A 3QQ4B 3U36B 4Z7QE 3IS0X 5LWYL 5C0IB 5HHNA 3QO1B 3BHBA 4O2FA 2HJFB 3KNBA 3MV7D 1I1YB 4GRLA 4NKIH 1MI5E 1OTUD 5E99L 2BOBB 4YHPA 3PQYD 3GM8A 4KJPD 1KPUA 5JDSA 4EI5D 1T2QH 1L0XA 3V6BR 4Y16C 4DFHA 4XMLH 1IC4H 4NHCH 5T1MA 5CLWA 3VFUB 3U0PB 1CFTB 4JQXA 4XH2A 1MY7A 4OZGA 1U8PA 4D2NA 1U92B 3QAZC 1LEGB 2HH0H 2NY3B 3KLAA 1KTLA 4HUNB 1W72L 3MRFB 4PB9L 4KHXH 5EUOE 1MJ8H 1Y18A 4XWOC 4YHOH 4TVPE 2LAAA 4N0YL 4XNQB 1UM5H 4PP8C 2ZUQB 1FZMB 2VQ1A 3BSZH 4XXDA 1MF2H 4L4VD 4H5SA 4PJAA 4N8VB 3DECA 3FL7A 1FO0H 4NRYA 1IGFL 3P4NB 5HGBB 3MRPB 3DNKA 3QSKB 5ANMB 3P0YL 4GKNB 1YUHB 1JL8A 4JRXE 4PTUB 4V1DD 1NBZB 2APFA 5GIRB 3QIBB 1IM9D 4G6JH 4UT9H 2EE2A 1PKQB 3SE4C 3CAFA 2MWCA 1INDL 3TNNA 4ODTH 3QWRD 3KDMA 4MD4A 2GCYA 5A16B 5C08E 5T5NF 3AVEA 5DZNA 4DK3A 3PWLB 3KPOA 2IBBA 1MJJA 3ZT6A 3DSFH 3LEYL 4KI5F 3AM8A 4ZDHB 3NVQA 3PP3K 3FQNB 3H6JA 1JTTA 1CDJA 1QSED 2X4TB 1YEEH 1NGPL 2NYYC 1JWSB 1OQXA 4LLUB 3PP4H 1M7DB 1DBAH 3VXNA 3O2WH 4KJWD 1XGQA 4NKDB 3WLWC 3QIUD 4DEPB 3JWDH 4YHKH 3ARZA 5EBWA 4NZRH 1EJOL 4R90H 3WS3A 2R4RL 1T2XA 2F53D 3T77A 3L3DB 3CX5K 5DR5L 2NY0D 1DEEB 4NO2A 4Q9CA 1R3IH 3V6FA 4LVOC 4MSWA 1CWVA 1WAAA 2BJMH 1WF5A 1JPFB 1UFUA 3QQNA 1MCOH 1RIHL 1U3HB 1VKXB 1KPUB 4JQIH 5F97E 4EEEA 1SYSB 2I60L 2XQBL 2L0DA 1I7ZB 3WHXB 2XFXA 4GMTH 2W91A 1SQ2N 5ICZA 1DLFL 3HG1D 1C5DB 5DLMH 3ULSB 2Z8VC 3CX2A 3HC3L 4OCSL 4PJ8D 2Q7YA 1I7TB 5CJQH 4KI1A 3P77A 3ECBA 5E8DH 4OF5A 2EIBA 2PW1B 4F37F 1CLCA 3RIFF 3QDAA 2Q8AL 2FSEA 3MRFA 1EEZB 2P8LB 4P2QE 2QJDA 5DQ9B 2KKQA 4TPRH 1U8KA 5D1QD 1R5IB 4G9FE 3HUJF 3MRNA 4OCYL 3GSUB 4OZGB 3V2AR 3GRWL 4UOW0 3SKJH 1TQBB 2HFFA 4HLZG 4P5KB 4HUXB 1RIHH 1CICC 3HPJA 4QTHA 3L5WB 5GRJL 3T1FA 1T1WA 1V7NH 5GRZA 3QWQB 4CU6A 5DD1L 1Q1JL 4KVCH 5DR5H 4PB0L 1W0VA 1J0YA 1S8DB 4CN6A 5T5FH 4LMQI 4P0DA 1H5BC 4O2FB 4KJPC 3WXWH 4OB5L 5F96L 1IGCH 4LLWA 4LSUH 3L5IA 3E0GA 4TPRL 4LAQL 3DYOA 3REWB 4U6XA 1DLFH 1AQDB 2ZP0T 4Y16D 4F15C 5EH1A 4ZUVB 4JZJC 2PTTB 4HT1L 3QPXH 1XGPB 1HI6B 3VFWB 1S5IL 3KYKL 2AERT 2XY1A 5FO7B 3FHQA 3CVIH 5DJDB 5GS3A 1YNTA 1ORQB 4JQVC 3ZDXE 3OKLB 3O4OC 3QI9A 3U79A 1SEQH 4WNQB 3IKCA 5DRWA 5IEKB 1PBYA 2OL3L 3HC0A 3LKQA 5EDXA 5JUEL 1L7IL 4F8TA 2CQVA 3M45A 3OV6A 4QOKB 1LDPL 4I0PA 1ZA3A 5TDPA 3HE6C 1FLRH 5IFJB 3MV8E 2WQRA 4PJIF 2DQFB 4M9OA 2X4RA 3GJFB 3I84A 1DN2A 4U1IA 4JVWA 3ARGB 4M1GL 5KG9B 2WQ8A 3ARYA 5JW4M 4P2OD 2WBKA 3AS0A 3QXAA 3OKEB 4YR6B 3RU8H 4F58L 2V2TA 1T5WB 1FZOA 3FRPG 3VCLB 4OZFG 5GGVH 3PDOB 3PGCB 5DD6A 2F53A 3ZHDA 2Z0BA 3MYJA 3X14A 3HMXH 1NGQL 2HKFH 4OIBA 1ZHLB 3REVA 4J6RL 2RBLA 3CFCH 3CUPB 2VITA 2GEEA 2B7DT 4QXGH 1CU4H 5DQDL 4HPOH 2NXZC 2EYTA 4IOSD 4LP4A 2J88H 2SEBB 6CGTA 1AKJA 1F3DJ 5DFWH 1N0XL 3QG7H 4WUKL 3U4EA 4KU1A 1SEQL 4GG6B 1FNSL 4XT1C 1RZ7L 3NH7L 5B8CB 5HHPA 1KUMA 1T03H 3MJGX 1JHTB 1HE7A 3IVKB 3UTQA 4ODVH 2PYFB 3KPTA 5DI8A 1C12B