1RJYA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 72
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjyA01
4XNXL 3O9WD 5IK3A 2CDGA 2ZUWA 5CGMA 3PP3H 4MAYB 1AO7A 5DJDA 1BREA 3MRLA 1HINH 5EC2B 5FO7B 4OBSA 1T22A 2BSRA 4ENEC 1T7WA 5FUOL 3LB6D 3AXLA 1YY9C 1A3RL 5FDYA 2IQAB 4JY6B 4JY4A 1XR8B 4GAJH 4PRIA 5GRVK 3CSPA 2FGWH 4M1GL 1YMME 4PLJD 1EHNA 4BYHA 3OAYH 3EO9L 3OKDA 1MHHB 4Z8FL 4PV8A 4FXGB 4JRXE 5DYOB 2BFVL 5JOEA 2M8XA 1U58A 2CDFB 4XVJL 5HPOA 2CSPA 3C6LA 1KJMA 1QHPA 2F58H 5E00B 1EJOL 3VFNA 2KBGA 3IKKA 5JUEH 5ANME 5D1QC 4S0TD 1ZT4B 4Z5RA 3QNXA 4P3CH 1JZ2A 1MI5A 4Q58C 4UILH 1D9KA 1UA6H 3CPLB 4L8CB 2VH5L 1A6UH 3PP4L 3UTSA 5SWSD 1CBVH 3T08A 1MHEB 3CH8A 1R0AH 2CGRL 2ID5A 2EH7H 4DAGH 4TRPL 2GSIB 2NPLX 1ZVHA 3PDOA 2B20A 4R9HA 1A9EB 2OR8A 3ULUC 2FHCA 3AM8C 1EHAA 2BOBA 4ODVH 3DVNA 5C0AD 1I9IH 3QFDA 1JWUA 2HFGH 5MEQA 2FIKB 1ZA6B 4AL8L 2Q6WB 1HWHB 1I7UA 1OGAB 4L5FL 3WLWC 1KIQA 4QLRA 3J8F7 1AGDA 1TCRB 4XWGH 2CKBH 1K8IA 3DPBA 4MXQD 2DBLH 3TLRA 4MVBD 3HI6L 1H8SA 2JB5H 2HRLA 4U1IB 1BVLA 2D7QA 1QSFE 4NFCA 5C0DB 4G6ML 3PXHA 2ICES 1JZ8A 3S36X 3IFNL 3LN4A 3VFTB 2WWKT 5DZLA 1XGTA 4GKSB 4P99A 1MJJA 2X05A 5AUMB 3U9UB 2C3HA 5I71C 3W9DB 2Y72A 4Z7VF 1G7JB 1NLBL 3R1GH 3ZTNH 4DN3L 3LIZL 4CKVX 1NUGA 5FHBH 3EO9H 3WS6C 4WFGD 4E42A 4RMWA 2DAVA 1AR1D 4Y16A 1QD0A 3UTTE 5C08E 3BGFB 4MJ5B 3WXWL 5ISZB 3OB8A 1AQKL 5JORA 4F37F 4LQFH 2O26U 4AENB 4YEFA 5CJQH 2VDRL 5CZKA 3PL6C 1HEZB 1TQBC 3GBLA 3FT3A 3MBXL 1XCTA 1B0RA 2CLRB 3VFUA 1QACA 4DZ8B 1EFXD 1EUUA 5TDPB 2YMXL 1L9MA 4PGBA 2VXSL 4GW4B 4OGAC 1YPZF 3BP4B 4W6XB 4OD1H 3SKOB 2VXVH 3LQMA 4O5LL 1EJ6A 2KL6A 3LB6C 4G8EA 1FFQA 4XPFL 1XF5B 2IPTL 1FNFA 4Z78A 5ERWB 5I74C 4I5BA 4K8RH 4OT1L 4YHOL 5E8OA 4PLJC 4JRWA 5DO2D 5GXBB 2Q20A 2GHWB 3J7HA 4G6KL 4NC0B 2JJTC 4LEXL 1X6NA 5L88H 3CFBB 3MJ9L 3KNBA 2CLVB 2PW1B 2BHYA 4ZUSB 5FCUH 3ARSA 4Q74A 1DLHA 1SQ2N 5CD3A 3O2WH 2APXA 3HPLB 3GJFH 1NFDA 5GGRA 3WXVL 3VXPB 3HFML 2UZYB 4G6MH 4S1RH 4QRRE 1S7TB 4ZXBC 4ODSH 1IM3A 4BFIB 5SX5H 4HZAA 3W0WE 1WT5C 2FH8A 1CF8L 5EBWA 4JCMA 1MHPH 5IMOA 1TZGH 4HK3J 3QDGB 3KPSD 1A0QL 4XNQB 3MJ6A 2XZCL 3TBSA 2R4RL 2YA1A 2F54B 3OKEB 5FHBL 1MRDL 2CDEB 2EE2A 2IEPA 4ONFH 4JPVH 1S7WA 1T83C 4BQ9A 2J6EH 4PJ5A 1OM3L 3BDBA 4HWBH 3S3JA 1S7RA 4F9PA 2Y5EA 2ATKA 3H0TA 3OKMB 2AJVL 2ZSVB 4QRPA 4AIXA 3NFPB 4MXVE 4NQCA 3VG9B 4R97C 3HI1A 4NKDA 2YUWA 5BV7H 1AO7B 4PB0H 5FYJE 4LK4A 1J0KA 3PNWA 3DROA 4PUBH 2LTQB 5KG9A 4FFWC 3BEWA 2RBLA 4M00A 4KC3B 1OAKH 2AV1A 4HZLA 2C26A 2ICWA 4BQBA 4KKNA 4CMHC 4KHTH 3U9PL 2DQJL 2YN5A 3TT3L 5I73C 3FOLA 2V5SA 1YUHB 1WF5A 3TFKA 4JKMA 1QYGH 3OKNB 1FCGA 2VISA 3KLHC 4QHUA 3RX5A 5C0CE 4WI5A 4MD5A 3I2CL 3IDJA 3VU2A 3X11B 3CSGA 1TZIA 1J1XL 2DBJA 2EO9A 3LRGA 4FN0A 3ETBF 2QQLL 1NBVH 3O4LD 3L3DB 4YHLH 2XFXB 5ALBH 1MCEA 4R0LC 4D0BB 5ICYA 5B3JF 2DLIA 4JY6A 2WW8A 2IPUG 4MCZA 1FJ1B 1XZ0B 4TVPE 3VFUB 1U8LA 2A9ML 3QUMA 1E27B 1FNEB 3O2WL 1NL0H 1QSFD 4GBXB 3HFMH 3RZWA 3BOVA 4S1RL 3E6FA 4L3AA 5EIIB 4OCWL 3WMSA 5IGXL 1QBMH 4HK3N 1CDCA 5FO9A 1ERNA 2ITCB 5F88A 3PWUB 1Q0XL 1CXIA 1QSEA 2CR3A 1X5IA 3MLSL 4Z7UB 1UWXH 4HIJB 1GHFL 1D6EB 3EYUH 3QA3B 1J11A 4OUOA 3SDXE 4FABH 3G9AB 5BQ7B 3U0PA 3HE7B 1EBPA 1KB5L 3MTRA 3ROOA 4TSAH 4LPYA 4EDWH 4AYFA 2W9DL 3M17A 4PJ9B 2X4SA 2WAHA 5EZJA 4NO2B 5FDWB 3IFLL 1FYTA 1XF1A 3HMWL 4HLZH 2HMIC 5MEPB 1MVUA 4NM8L 4QGYA 1CFSB 3GGWA 5CP7B 2A9NH 5IJVA 1AHWC 4P5MB 3L3OB 1HQ4B 3PGCA 1RZ7H 2ESVB 4POUB 5EWIL 1F6AB 4JQIL 3MO1B 3MZGB 4PJ5E 5DXWA 4DUVA 1OVZA 2ORBL 3CMOL 2VB5A 3O8XA 5SWZA 3FO1B 4HMEA 1Q94B 4Z7WB 3C8HA 4ORGB 1F6LL 1WQVT 4FFYH 4NNPH 1T3FB 2WIMA 1QLEL 3LEXA 3LHPL 1OW0C 4GS7B 3NN8A 4GKZB 4P5TA 4XP5L 1N2RA 3WUWA 3QUML 2ARJB 4TOYH 5F3BA 5IB2B 2Z31C 1PG7W 5IB2A 4DKFH 1N59A 3GSWA 3WFBL 4KUZL 5F70A 2LVCA 3LV3A 1N59B 3GSWB 5TDOB 3Q3GB 3TT1L 1VDGA 3RWJB 3WJLC 1F8TH 2V6HA 4LNRA 3T2NH 1WFNA 4HMCA 5L6YH 4L4VD 4G6AD 1N8ZB 4Q6YA 4KXZI 1MCDA 5ERWA 2AJYH 1EO8L 3LKPA 4HS8H 5HGHA 5EOQL 4P4RA 5EIVA 4QRSB 5IW3A 2QV2A 1U8QA 4JFZH 4LSVL 2APBA 5KTEL 5TQ2H 4ZD3L 2IADB 1DJSA 3EOBB 1RJZB 2VDOL 4JFFE 5I8KH 5D7LB 4MB4A 4Y4HB 2IGFH 4UOW0 2W65B 5EBLA 4BZYA 1TNMA 5E5UB 2BY2A 1P1ZB 3D3VA 4FFWD 4MXWL 1Z3GL 1S8DA 1IGJB 5KOMC 1GHFH 2GJ6D 4PTTB 3VFVA 3TO4D 4KZDL 3U4BL 4MA3A 2OJZH 3GSNL 5A3ID 2XWJB 4LF3B 2XNAB 4PJBF 3ILPB 4IHOA 3TBWA 1BGXL 3VWKA 4L9LC 1OT1A 3GRWA 3JVGC 2IQAA 3MUZ1 4LCYB 3V2AR 1HE7A 3IJHA 5CSZA 5ETUB 3D2UA 1JI1A 3BKYH 1NAMH 2DF3A 3WUWG 3DI3B 5L8KB 1ZOXA 2AJZA 2E7CA 2FWOA 2FR4A 4V1DE 3PHQA 3WNNA 2DLHA 4ERSL 1G7JA 3CUPB 3SDCB 3QNYA 3ARGD 3NFSH 1MCJA 4EOWL 3TZVC 2P5EB 4BSWA 5TJWK 4HUXA 1P4LA 5IMLB 2FATH 1B6UA 1BVLB 3O6LL 4LVOB 1PDKA 4D0BA 1MVFA 3HHRB 1K9TA 2EDYA 3RVVD 5EU6D 3GSUB 1F4YH 2XZZA 2ZCHL 1T7XA 4BQCA 1HWGB 1LNUB 1UENA 2HRPL 3OL2A 5HI5C 5C2UB 1OY3B 1JNLH 3WFBH 2UZIH 3C08H 4QRRD 4APQB 3RWGA 2OSLB 4P2QE 1T1YB 5F7YC 3QEHA 3BIAX 2H2SD 4QHUB 5C07E 2VISB 3IAPA 3ZE0F 4F2MA 4WHDA 2AJYL 3PGFH 4KKAC 4MJIE 4X80L 1A2YA 4PGDB 1I7ZA 3CCHA 3HA0A 1BFOB 5CS7A 4JFZL 1HHKB 4JRXD 1SJXA 5IUSA 3WFHA 1KTLA 2R29L 4D9LL 1TTFA 3PNWB 1RFDH 3V4UL 1EHXA 2MPAL 3FT4A 1IC4H 4LHUG 2X4TB 4ODTH 4PGCB 3EYVA 1CDHA 4CN4A 2VE6A 1N4XH 3DV4A 4ZSOB 5GJTL 5E6YA 4XX1G 3QCVL 3HKFA 4Q97A 3SKUD 1A1NA 5JR1L 1EAPA 5DWUH 3ULUL 5FGBC 2QQNL 3EIFA 4X6CF 3HLAA 2CQVA 5HVWA 2R56H 1QSEE 1FYTB 1WZ1H 1X9QA 4PJXB 1MRFH 3VXUB 3LD8C 1OCWH 5C0BE 4PJDF 1AC6A 3WYRA 1J8HD 3VXTA 4PLKD 3TIEA 3B83A 3H9HA 4F7CA 3M8OH 4N0YH 2M2DA 3I85A 4PRIB 1UXSA 5C0CD 3UZEA 3BD3A 1LK3H 1CICA 3V5DA 1I9JL 4QO1A 5KN5A 4HWZA 1INEL 2E7HA 3C5JA 1E4WH 4HS3A 3V6ZB 1T1ZB 2OXHA 3V6OC 5GGRY 3WFHB 4DFIA 5BS0D 5I75C 3BO8B 1JGUH 2DB8A 1BIIA 5FYKD 4FZEL 4HJ0C 4X6BA 1UB6B 3AFLA 4UDTB 4ZFFB 3UPRA 2GQHA 3OV6A 3S35X 1WFUA 3C08L 2AI0H 4X4XA 4MA1C 2COQA 4N8VG 1UEMA 5JUEL 1J8HA 1Q9KA 3KYNA 1GOHA 5DJ8A 1QBLL 2QHRL 5GRYA 4LKXA 1TJGH 2XRAH 3SDDC 1KT2A 4U6XB 3ZSSA 3KYMA 4PJCF 4MJ6A 5CEXB 4GUPA 4UQ2A 4M3JA 3BP4A 2R0KL 1D3CA 3MXWH 1YUHA 4NQCE 4HX1B 3RGVB 3DO3A 4X8JA 2Y5TA 3V4UH 3SQOH 2HFTA 4HJJH 1GL4B 2Z31D 2YD6A 4HGMA 3L3GA 5IMKB 3WHXA 4CN1A 3FT3B 2HJFB 2NXYB 4AQOA 3QCVH 1L4IA 4OCYL 5D70H 3RL1A 4PJ9D 5B22A 1DBKH 3PWVB 4HLJA 2YPLA 4Y16C 4B7IA 3KPMA 1JGVL 3TFKC 5F3HA 5E8NA 3P4MB 1FFOA 5T3ZH 3N0PB 5HI3D 1MLCB 5T3XL 2NY1B 5DF0A 3SE3A 4QNPE 4L1DA 2VIRB 3ROLA 5C0RL 5DD3H 3NOIA 3SJVD 2LFGA 3RI5K 3LD8B 1FVEA 4JAMA 1XGTB 4X83A 5I1AA 4Y5XA 3TBSB 2XA3A 5F6HI 3UJJH 4NN5C 4NO5A 4KMTL 4R4NC 1RK0A 5C0JA 3VGBA 1FNGA 4LVOC 4PJGE 1ODAA 4XPHH 4C56D 2P7TA 4U33A 2OI9C 3ARFA 3N9GH 1ITCA 2DLEA 4PGEB 5ELIA 3TZVB 2Q8AH 3EOBA 2X4OA 1FFNA 1KJ2H 3AAZA 3AMLA 4O2EB 3X14A 3A6CH 1XMWA 1F90L 1EFXA 1R3KB 1G7MA 5TH2A 2FL5A 5CJQL 5JW4R 1J05A 5E8EB 3NCCB 2C9AA 3MRQB 4XPTL 4JHAL 4YWGH 5E9DE 5T5NF 2Y6SC 3L6FA 1H3GA 1JYNA 2HTKD 5CINH 1OSPH 5FOJA 3GJFA 4V3DB 2YD4A 3C2SA 4GW1B 3UPRB 4RFNB 3GDBA 3RDTD 3GJFB 4P48A 4ZXBA 1IKFL 1LO2H 3D5OF 3NIDE 3BP5B 3U30B 2B1AH 3V4PL 3WUWB 1PGRB 3T8XA 3MA9L 5L9DL 5DS8B 2VZVA 1ZSDB 3MXWL 3OXSA 2W92A 3QIWD 2OL3L 5J1SC 1HXMA 3QZWB 1QFPA 3WLBB 2ESVE 1NCWH 2AERT 5D9SB 4F7MA 3LRSA 3UTZB 5F9OH 3NCYS 1C8PA 5E03A 4H88H 4OGZA 4WFFE 3P2TA 5ADOL 4Y5XC 3CMGA 2K9UA 1S7QB 15C8L 3VRLF 3EO1B 3O0RL 5FCUL 5T3ZL 4DQOL 4KUCF 2FHBA 1UEYA 4JFYA 3M1BA 3M17B 3D25A 4PJ9A 1FFRA 5K9OA 1P4IL 4WWKA 4LBEA 3UEZA 1U95A 2IBZX 4EKXA 5T1MA 5EU6E 2MFNA 1A02N 3BPCA 5JDSA 3WFZA 4YHZL 4YBHA 4UTBH 4N0CC 1LP9A 3FB7A 5DEFA 1UYWH 3EJJX 4KJWC 5EU7C 2ITCA 5F88B 1BLNB 1KSRA 2BSRB 3GB7A 4GAYA 4JFDD 2W1NA 1Q9LA 1F3JB 3EDJA 3MFFB 4PRHE 4NWTH 3DI2B 4Y4KD 4MD4B 3QXWA 4JPVL 5IK3B 5KSBA 2IAMB 2NY5L 3QWQB 4W81A 3CXDH 4LQ1A 2P49B 1PY4A 1CLYL 2BNRB 3SDDA 5L2JB 5L8JB 3QEQD 3MRNB 2VC2H 5FXCH 5GGSB 1MIEH 3BP6A 1KB9K 4FQ1H 1E4JA 2AJVH 1FRGH 4PJ9C 3MGTA 5DHXB 3SGKC 4M48H 3GI9L 4QHKJ 3QUYC 1QSZA 4JM2F 5F21B 3DXAB 1CGUA 4NQXA 2IBBA 4TPRL 2V7HA 1G7LB 4PTUA 2DWEA 2WLYA 1RURL 5IHBA 1X5KA 2DWDB 1QFHA 5DJ2A 5MI0B 2BCKA 5C0AB 3NAAH 1EO7A 1TIUA 3KAAA 1WVZA 1Y0LB 3IXAA 1DCLA 2VQ1B 2VXUH 3V6FB 3DX8B 4GQ9H 3WO3B 3TN0B 5HHME 4NWUH 1WC7A 3QNYB 4U0RC 5SX4I 2J88L 5C0EA 2R8SH 4JM4H 5C0BD 4WUKL 5HYJA 3ZKSD 3P77A 3Q0HA 1X7QA 1K3ZA 3S8WA 5T5FH 5HHOB 5D5MF 1T04A 4DCQA 3RY6C 4HKJB 4I3SH 1BBDH 5E1HB 3SY0A 4KK8D 2LQRA 5D8JL 1RZJH 1AHWB 1MFCL 5F9DC 2VYRE 4L3EA 4QWWD 1KJMB 3V8CA 1UWGH 1TITA 2EYRB 3F6IA 2FJFA 3VI4E 3IDYB 3B3IB 3GMOA 3MNZA 4JFYB 3VA2C 3ILQD 5D7JB 2VTFA 1T03L 5LGHH 4AEIL 1MCQA 5HHPA 3QHZH 5D7JA 3C60D 3LSOA 3GI8H 4M7JH 5K9KB 5MI0C 4OUUA 1MFNA 1IEBA 3MBEA 2BDNH 5EUOA 4OCLC 1A1NB 3SE4C 1OOAA 3SO3B 3WDJA 3LQZA 5EZLA 5HI3C 5D1ZD 4LCWA 2CKBA 4UT7L 1INDL 2NY5H 1NUNB 2OR7A 3H9YA 4MVBC 2BVUA 3NBNA 1N5YL 1MHCB 3WN5C 5FECA 3RBGA 2D03L 5EFIB 4NRZA 4UINL 3VXSA 3C8KB 4P2OC 4EI6B 3DSFL 5F7HA 2BSSA 2I27N 4M48L 3JWDC 3O3EA 5I1HH 4IOSD 1MNUL 2Y1VA 3GM8A 2DQHL 2GJ6E 2G5RA 2AAVA 2DKMA 3ARPA 3FN9A 1IC1A 2JJSC 3DBXA 3UX9B 3QQ9D 4JJ5A 4YGVA 4NQTA 4WGVB 3ZT7A 5LXGH 4I4WA 1QR1A 1J0ZA 4XCFL 4WW1B 4PYHA 2O5XL 2A83B 2YR3A 4LIQE 3VXQA 4GQ9L 2J7LA 1BQLH 4UUJA 4OFKA 5IIEA 1MFDH 3TZVA 2R8SL 3TPUE 2NY1D 4HWUA 2DLGA 2DQGH 3KPPA 1WEJH 2VLJA 3WUZA 3DGGA 4APQD 3PHQB 5FUCE 3I3EA 4BSWB 1L7IH 4HC1A 1FCCA 3MCKB 1XR9B 1NAMB 2BNUB 3HC3H 3QULB 4QHNB 3UJTH 4OI8A 4XCCH 5BQ7A 3HE6C 4LHJB 1ZHNA 3ZKQD 4QY8A 2E27L 2ZKHL 1K4DB 2VDOH 2CRZA 3QYCA 3ES6A 5TE7L 3O45A 2F8OA 3DTXB 2WP3T 1BFVL 4F57H 5K59F 4WUUA 4CVXB 4DK6A 1CICC 5E5RB 3F58H 4MNQB 5E9DD 5KBNC 4K3EH 1YMMD 3DO7A 2YZ8A 3C09C 1KF9B 1AIFA 4UT7H 4JGMA 4L3CA 1TZHA 3E2HB 3HPJA 2JJUA 4FTVD 3SPVB 4MQXC 4RBPH 2VAJA 3MLZH 3RZCA 4U1IA 1N5YH 4HUVA 1QQDA 4MCZB 5J13B 5FM5O 2IH3A 4NNXA 4D9RE 2XWTB 3WNOA 1CLZL 3FT2A 2ARWA 2G60H 3D6GA 3O11B 4G6JH 1FPTL 1MNUH 4CJ1A 1U8QB 4PBVC 5GRJL 2IAMD 2FIKA 1YEJL 2GSGA 4M1CC 2WIIA 1FC2D 4FQXD 3WHE1 3I6LE 3BQUB 4JDTL 1EK3A 2Z31A 5ESVB 3X13B 5BXFB 1IM9D 2Q3AA 3KPQA 4XVUD 5SWZD 2YA2A 4P46A 1BZ7B 2RFXB 2UV3A 4I1NB 3TO2B 3A67L 1JFQH 3ILQC 5C2BL 3AY4A 2RCSL 3I6KB 3OKOA 1N5AB 2GK0A 2HT4C 1BQLL 3FKUS 1Q1JL 1U0QA 5C0BA 5HYJD 1SVCP 1H3XA 5EFIA 3IDNA 2YPKB 4RQQB 2A74B 1DBML 1N64L 3AB0C 4R4FL 1YMHB 4FXLA 5TFSL 3TF7A 3WIIH 1FE8L 3B5TA 3PGCB 2Q76B 4H20L 1P2CB 4XMPH 3SGJC 5JIKA 3VFWA 3PWNB 5HD8C 2D7TL 4P2OD 3RIFK 1J7VR 4HC1L 3VRIB 1MEXL 1G1YA 4PJ7E 4XCCL 5IOPA 5E08H 4D2NA 4X6DB 4WO4D 3OKDB 1M6OB 3KDMB 4XMKH 4YDLB 4HXBL 3QQ3B 5LAXB 1C16A 2R1YA 4ZG1A 2H3NB 3ZO0A 2A6JB 4DEPC 5IMOB 4NYLA 2A83A 3THMH 3UZQA 1IGIH 1N6VA 4TTDC 2EYRA 4I2XB 2R2HA 5HGGS 5TGBA 3QEQB 1RULH 2R0ZH 32C2B 2R2BA 4HWBA 5GGUB 5BRZB 5FKPA 1KTDA 4J4PC 4AMKH 3FO9A 2IAMA 3T3ME 5BZWA 5AYUL 3PWUA 2X5PA 3EJZD 3PHOA 4OM1L 2EXYC 1PLGL 4JPKH 4LPTA 5FO9B 3HN3A 2GW5A 4NQSA 4IRSB 4XBGB 1PSKL 1T0NB 2NCMA 5HYIA 3A6OA 4LPXA 1TJHL 2A6IB 5I19L 3QRFM 4M03A 5E2UH 5C0ND 3BJ91 4X9GA 3EJYC 1M4KA 3HCVB 4JM2D 1F4XL 1UM5H 2MKWA 2NY2B 4C57C 1YMMA 3Q1SH 3HR5A 1J5OH 5M95B 3BWUC 4HUNB 2Q7YB 3TP4A 4X9FA 3HR5B 1N3NB 2DLFL 4X0KB 3U36B 1SBSH 1XGYL 3TNNB 1CGSL 4U2YA 1LP9E 1RUKL 4IMKA 4OZFA 2OJEA 4YZFF 1KXTB 3SQBA 2YK1H 3LKSB 3PG2A 4OGXH 1Q38A 1OF2B 2ENYA 2W0FB 3RPIB 3NCBB 2AI0L 3GIVB 5D1ZB 5TFSH 2PCPA 3D0LB 2VDMH 5K93A 4M1GH 1YZZA 1MQ8A 2E9JA 3GBNH 3BGAA 1HZHL 1AH1A 4BSVB 5BZWB 4Q6IC 2QHRH 1V3MA 1AY1L 1CXEA 1BAFL 3BQUC 4RAHA 3IJHB 4HC1H 1X7QB 2F53B 4Z8FH 4IIQA 2VN4A 4LHUD 3DHJA 4ZOBA 2JKXA 5B4MC 2Q1EA 5BVPL 1BZ7A 2RFXA 2H1PL 4OZGE 2Z93B 1UJTA 3D85D 5INDB 3NIFE 4MZ3A 2GTWB 3DX6A 5IP4A 2DJSA 1F2QA 5FHAH 2OI9B 4PRAB 1B2WL 3EZJB 5SV3A 2DTSA 1RULL 2R0ZL 1SJHB 4EI5B 4MS8A 2EDJA 1BBJA 4X6EA 3C09B 5D7KD 4AMKL 1EEYB 4XNQA 3OPZH 2VH5H 2PO6A 4Y4HD 2RGSA 3MRRA 5EU3B 1T5WB 2H2SC 2JELH 5CCKL 3HAEB 1NPUA 2OCFD 2EC8A 3G5ZB 1PSKH 2NLJA 1I7UB 1FV1B 5I30H 5FUZL 2D31A 4KRMB 1CXHA 1H3TA 5D93C 2Y07H 1E6JH 1OT2A 4KH2A 5HD8D 4G8GA 4P23B 4YE4H 1MIML 3GMRA 1AQDA 5IW1B 1KPRA 3FZUD 3MV7A 4YHYB 3RP1A 3VG0L 2NY0B 1U8JB 1WGOA 2XA8H 1MCCA 1N2RB 5FYJD 1RHFA 4OV6F 4YDIH 5LKNA 2QADB 5JW4N 4APQA 2JK5B 1NAMA 5DD5H 1PKQB 3NABH 4RGNE 3UZVB 3HZVA 2X9WA 5BV7B 4WCYL 3VFOA 2DQUH 3LKQB 3VFNB 4EIZC 4X9HA 2BMKA 3QCUH 4O4YH 5SX5K 3LKSA 1QQDB 3ARGC 4O2CB 5I1EH 4MCYB 3B2UD 2J12B 4KRPB 4LVHB 1I8LC 4GAGH 5DMJB 5K9QI 4PV8B 1GIGH 2QKIB 3FRUA 1AI1H 4XHQA 1GZQA 3FONB 4JREC 5E99L 4K3GA 5I66A 3IU3B 4BFEA 4ZAKB 1BZ9B 4X98A 3SDCA 3WS6A 5C09B 4IBLT 3EO0A 4EXPX 3IRPX 5JZ7C 1KEGH 5KSBF 3MRFB 4BUHA 1CFNB 4KU1A 3L5WB 3JWDH 2BNQD 3O6FB 4OF0A 1P4BL 3OKOB 2CD0A 3VFMB 3P4MA 4HUKB 2XQBH 5ADPL 15C8H 1K8DA 1XT5A 5A43C 5ESAB 1RD6A 3MMEB 2QADD 1IQDB 2NY6C 3T1FB 4JM2A 1ZHBB 3H7BB 5GISH 3VWJD 1I8MB 4WY7L 3U9UA 4DW2H 5D6CA 4WENB 1MY7A 5D7JC 4WI6A 4K8RL 3SDDD 5EUOB 1H0DA 2FNBA 3S37H 1PKOA 3C60A 5FV1L 3CSBA 3PUCA 4X6CB 3O4OC 1JMXA 3DIFA 4PBXA 4XNZC 3UTSD 4K9EC 4ETYA 3UJIH 1PYWA 3OF6D 1QR1B 1ZEAL 3TH3T 4J6RH 3BUYB 1HKLH 2EDXA 2YPVL 4CDGC 1YEDB 1M05B 1WT5A 4KY1L 1Z9SA 4YQXL 4PJFA 5I16B 1VB9A 3PDOB 3GSXB 4RX4A 4HQQL 1CLYH 1DBJL 3DX6B 3RUGF 1TTUA 1L6XA 1MIEL 2FO4A 3WBDA 1RZJC 2FZ3A 1EGJA 2DQCH 2ZUTA 4Z77A 5F3BB 1N0LA 4K9EH 3BO8A 4PY8I 1BJMA 5FA3A 2AW2A 1A0QH 4OKDA 3UXFA 3ARFC 3MJ8A 5H2BB 4GAGL 3B43A 3G6DH 3OJDB 3OKMA 3G5VB 3ARUA 3KLAA 3QEGH 2PCPB 1IEBB 3D0LA 5HHVH 3K2UH 3QO1A 5KSUB 1EA9C 5INCA 1OAZH 4MMXC 1G6RB 4O58H 5GS0C 1GGBL 2X9YA 4JGJA 4MAUH 2IQ9H 3FB6B 1BD2D 2B4CL 1DANT 4JQVC 2A1WL 2OMBA 2E7MA 5J11C 2EECA 5IQ7L 5BMFL 1P4BH 4GBXC 2QSCH 5IR1B 3SDCC 2P8PA 3TBYA 1RZJL 1JHTA 4QOKD 1S7TA 4LSSL 2OR9H 2C3GA 4OF3A 1U6AH 4QRTA 1T22B 5E4IA 2P5ED 3H9SE 1Q9WA 1VFAA 3ARGA 4MD4A 5HI4D 1QFWH 3DYPA 1F3JA 4DGYH 1ZK9A 2ATPA 1CCZA 1D5XA 4RMUA 2JIXD 2QQLH 1YDPA 2WWMD 1YNKL 5BV7C 2AJZB 1R3IH 4M7KH 3QDGE 1BWWA 1NBQA 1C1EH 2DQDL 3V6ZA 3MRFA 2APTA 1ZLUH 2Z8SA 3GO1L 3ORJA 3VFMA 5BRZA 4RMQA 4HFWA 2YPVH 5DRXA 5F1NB 5B39B 2ZNXA 2B4CC 1RUPL 3KPOA 4Y4HC 1RK1A 1AFVL 4G8IB 3CDCA 3MCKA 4LCIH 5GS2D 2QSTA 4S0SD 3SDXA 3JWNC 1G7IA 4H1LH 4BZ1H 1BZ9A 1DBAL 1HSAA 2DQCL 2NY0D 1QBML 3PWLA 5C0FB 4O2CA 1VADB 3TCLA 2IFFL 4HPYL 2E7LC 4F7EA 1H5BC 3LMJH 1ZVSB 4MS8D 4A6YH 1EAPB 3QEUB 1HIMH 4QYOB 5FKAA 3IXTA 3QEGL 4NUJA 5DHYB 4PJFF 5F9JA 3LKQA 3EFDH 3K2UL 2OZ4A 4HKBA 4O2FA 5GIRB 4EDWL 3LDBB 3VXOA 1T04B 1RAMA 3SKNB 1KIRA 4YHPA 3IKCA 3FN0L 4LHUA 3FB7B 4JRXB 1CN4A 1ZANH 5CSZB 5ETUA 4ZXBB 2Y6SD 3KXFA 4RA3A 4YR6A 4QOKB 4ELME 5FGBA 5IF0A 3T0DA 4OLWL 2XV6B 1FV1A 2J1KA 4JQVA 2OR9L 3HG1D 1PYWB 3L3JB 4GRLD 1BMGA 3RGHA 2EKSB 35C8H 4P23C 5MERB 3QUMH 3ALWA 5TE6H 5J6GB 5HDQL 1HHGB 4DGYL 1AGDB 1TCRA 1CFVL 4LKCA 3CX2A 3RWIB 4LAJH 3HC4L 1FZJB 3UTSE 3V8OA 5D72H 3H9SA 1CU4L 2EDRA 1NANI 1YNLL 4NQDA 5KSBB 4P3DB 2PTUA 3QDJE 5FIEA 4LSTL 1XF4A 4OF5A 2EH7L 5JPMA 5C1MB 1A7PL 3BP5A 1AFVH 3KNBB 1XF3B 1I85A 1F6FB 1DEEB 2YD9A 3PHSA 5F71A 1E28B 3HUJF 4I0PB 3V9FA 1ZT1B 1AXIB 4PRNA 5D7JD 5I8KL 3L6FB 4ZAKC 1RV6X 1NJ9A 2R23B 4R0LB 1IAKB 5C09A 1EMTH 1MCOH 5I1GH 2BVQA 4IRSC 1CXLA 4OD3H 5GRXG 4KRPC 3E6FB 3IS1X 2JB5L 3EOAA 4XNXH 1FFNB 3F7RA 4E41A 4FOMA 2E5EA 3DSNA 1QLFA 1OWRM 5I1DB 1AGBB 4LLDA 4PJCE 5I1DA 4X0KA 5I73B 1G0DA 1MVUB 3DV6B 2XQYK 3NTCL 3TJHC 5IMMA 2EDNA 1Q1JH 1A6TB 2Y4SA 1NFKA 1YEGL 4OD2B 1MREH 1MWAL 2CLZB 3RVUC 3JVGA 2VUOA 4XNUL 4H0HB 3W11C 2CXGA 3WIIL 3NFSL 4D8PB 1YJDL 4XHJD 5LBSL 3ZLQC 3BRDA 4YHYC 4WTWA 5LG1A 1UJ3B 1OGAD 5I8OL 1AD0A 2PNDA 3MRJA 2BP3A 4KK9D 3H9SD 1JNJA 2VDRH 5ID0A 1ZT1A 1OP9A 4KTDL 5KZCD 5EPMA 3L7EB 1I4FB 4PRPA 5TQ0L 3EDFA 1BZQK 4OZIA 1I1CA 1NC2A 2HT3C 4JVPA 4PRPB 3D18B 4UBDC 4ZODA 3QI9B 5ICZA 1M7XA 1JNLL 2F58L 2NNAB 4PJHE 3U83A 5D72L 1CU4H 3LEXB 2YWZA 3WFCH 2CKBB 3GUTB 3AMKA 3IDIA 3HS0A 5CEYA 3UMTA 5C6TH 4I48A 4JB9H 2GKIA 4ZUWA 3GM0A 1U3ZA 4YHOH 3QFDB 3O2DL 4XCEA 3D2UD 4WIQA 2X4UA 1IM9A 5EC1B 5GGVH 2JTDA 5E2UL 3MJ9H 4IOFC 2PYEA 4LSUH 3VH8A 4B41A 1EMTL 3QHTC 1I9RH 3C6SA 4Q6IB 3MPCA 4Y19E 1IT9H 1NQBA 1S5HB 1J5OL 5I9QC 3IDNB 4Y5VA 5DWUL 2MHAB 3GFUA 1M1SA 4ALAH 3DRQA 2GK0B 4DOHB 3UC0L 5HI5D 3GMQB 3DRQB 3ALXA 1JZ7A 3NTCH 1TMCB 3NGBC 1A2YB 3F7YB 4I3RH 4KMLB 4XNYL 5E7BA 2A2QT 2ESVD 3LQAC 3NFNB 5F7DB 2PO6C 2OL3A 2OTUB 1UWXK 1KLUB 3GIVA 4OB5H 1S7WB 2EDEA 2EDBA 4FXGA 4IDJH 4YFDB 5DFTA 3DX7B 1LK3L 4LCUA 5JXAH 3VXNB 4JFOA 4N0RA 1XFPA 1FG2B 3WL9B 5IESL 3EFFA 1JYVA 4C83A 5DVNA 3PXJA 3P4OB 2NZ9D 5D6DA 4G80B 3F7QA 5FAAA 4MA8H 3G08A 1CE6A 3KPOB 1A6PA 5D7SL 2NX5A 3FHAA 2WQRA 4PB0L 4O02H 2AJUH 3QHFL 1IILE 4KI5D 1I1YB 4U6HA 5J13C 1U91A 4QRUA 3QUZA 1QBLH 3U9PH 3ZT6A 5EOCH 5T33L 4LMQE 3H42L 3DVIA 4OFDA 4FQQB 4Y4FD 1K2DA 3U4AA 5DVOA 5F89B 1CICB 5HGBB 4JFEA 4DEPB 1EO5A 5FUCC 3U1SH 5IEHB 1JHLH 2WUCL 2I60H 1JF6A 3PWVA 1RUAH 2B5IC 5CZXC 4AH2B 5GGVL 4OT1H 1S78D 3F7PC 4MA3B 2VLRA 4PJ5B 2NYYC 3SDYH 2WMPA 4OIAA 5HTSA 5DHYA 4W70A 1S8DB 1UZ8A 5F9WC 5IROA 3JWOL 2CLZA 4GRWF 4U1KA 3TPKA 4R4BB 4K94H 3IF1A 3KPPB 4MVBA 3KDMA 1U92B 1BPVA 2AJ3B 1NH6A 1AGBA 3HUJB 4MQ7A 4ZUUB 2HT3D 4UBDD 3VXQB 4AEHL 5IKCA 4KI1A 4ZUTB 3BWAB 1X6LA 1S7VA 4LLYB 3EGSA 3FQRA 2WZPD 5B38G 4RDQF 2FWOB 3MBED 4POYA 3MRPB 4KK5C 3UP1A 3E1F1 4LNRB 2BC4B 3RDTB 2EDLA 3CFJA 4X6DF 5KVEH 4L29B 4PJCA 1MRCL 3Q3GA 5CEZH 1S9YB 5HYQB 5L2KE 1OAYH 1OW0A 4XCYA 1E4KA 4NHUE 3ZKXC 2W9DH 4PPTA 5E8PA 2XNAA 1YJDC 1CDUA 4G8GB 3VFSA 4PJDB 5EA0H 2WIIB 4NRZB 3IKCB 4XPTH 1DE4A 2C5DC 2HT4D 5JXEA 5F1SA 4KTEH 4P2OB 5C0GA 3CMOH 4B50A 2RJMA 4KHXL 3H9HB 2IADA 3HRZA 2UWEB 3OXRA 4WHYH 4WU7A 5D7IF 1F00I 2O5YH 5KVFH 5I76B 5CGTA 3TF7C 2X40A 5K9KA 1TZHB 4LHQB 2C1PA 2Y36H 1QRNB 5C08A 2N56A 4NQEA 3LSOB 2XTJB 4Y89A 1C5DA 4IMLA 5DI8B 5EO1B 1F4WH 3TWCH 3L5JA 2D7PA 1UXWB 3G6AB 1QFOA 3NH7L 1SEBA 3BQUD 3QO1B 3SGKA 4WEBL 3S88L 2JE8A 2VE6B 5F9OL 2P8MA 3BZDA 4Y19D 4H1LA 2W38A 5BW7C 4YHML 3JWOH 4PJ8D 2X4TA 5BVJB 3CK0L 2GJZB 5ADOH 2C1OA 3EDEA 2VZTA 1J0IA 4OSUH 4DCQB 1ZEAH 3V6OE 2APWA 4JRYB 1MCSA 3PDDA 2A9MH 4YQXH 1JGLH 4QRUB 5EU5B 3DGGB 3CCHB 3WHXB 5T3ZD 3BMWA 2EYSA 2HTLD 1GSMA 4QCIA 3MUHL 4E5XB 4M7LH 4MQ7B 5EBMA 1Q9WB 1YYMH 3OB0K 1G7LA 1HH9A 3BP7A 3EAKA 3RDTC 1RJZA 3UTPE 3QDGD 4MCYA 4MGXA 5KVEL 5JLZA 4KZDH 4MWFB 2YRLA 5EUKB 5HYFA 2W60A 4OLVH 3P3YA 4JQXA 4UUJB 1IL1B 4FQIL 1YY9D 2W60B 2GFBB 4FTVA 5GGTL 5IVNA 1DL7L 1KB5H 2DKUA 4J3OC 1NAML 1N8ZA 2V17L 1X5ZA 1I7RB 3P0YH 4UIMB 4D3CH 1GGBH 5K33A 4LASL 2IAND 4ERSH 5KG9B 3TA3C 4KTYA 2Z0BA 1UB6A 4K3DL 5T1KD 2OXGA 3R4DA 5T3XD 1ZHBA 1HOCB 2W91A 3C8KA 3H7BA 1Y18B 4D0CA 5EO9B 2IJ0C 3B9AA 4X99A 4J3TA 4ZXBD 1A7RL 3MRJB 3BPCB 5JDSB 3WNPA 5DMGD 2DS4A 1KUMA 4PJBB 5DEFB 2OX5A 1P7QB 1BFTA 1G7PB 1XEDA 1X5FA 4Q2ZA 2AABL 5JOFB 4NP4L 2UZIL 3MBEB 2H3NA 1XF2B 4N8PA 4ZAKA 3MCG1 5SWSE 3BPNC 4KI5C 3S5LB 4PJXA 1G84A 1HI6B 4YIQA 4LU5L 1YNKH 2QKIA 1OTUD 4K3HA 1IC7H 3NA9L 4Z7UE 2VNCA 1BBDL 5T1KA 4E41B 2YA0A 1LO3L 3KYAA 4CJ0A 2YD5A 5GS0H 4RISL 4NKMB 4MDJB 3LRSB 3UTZA 1N6QL 1ZS8B 3LPWA 3K4ZA 4L1HA 3HI5H 5IB1A 2PETA 3W39A 3RX8A 4CU6A 3QRGL 5H94B 1T03H 4U1JB 1S78C 4PIRF 5LQBH 1A1MB 1NGQH 4JE4B 1PY9A 2XTJC 4GJTB 1I1AD 2QQNH 4IOIA 3C2AL 4UU9B 1HIML 5C0IA 1L6ZA 4I18A 4XZUB 5I1CL 4R7NA 4P3DA 4XPBL 2YSSB 1SY6H 4RFNC 1L0QA 4KFZC 5TH2B 1VGEL 2FB4H 4JFEE 1TETL 5MENE 5D5MA 2Y06H 1FZOA 3ZE1E 3PL6B 2AJXL 5EBWB 1TZIB 4JZOA 3KPRB 1GGIH 1F6AA 5KZCB 1GZQB 3FONA 3WD5L 1BF8A 3HUJA 5B3JE 5DR5H 3FB8A 5JW5A 1GGYA 3TBTB 1DDHB 2BXZA 4OLWH 4ODBD 4Z7VE 4L3ED 4FZEH 3EYQC 4GAYB 1KC5H 1ZHKA 4XCNB 4EIGB 3MLPA 1JRHH 1EEUA 1NC2D 3MX0A 2P5WB 3VFRB 4GFTB 5E6IA 1Y6MR 4S2SA 5B21A 1JTOA 4NN5B 3FOMA 3PIQA 5F3HB 2XACC 4FFVD 3N1QC 5JZ7D 4TNWF 4KMQA 4I5BB 4IM8A 1KJ2A 3NA9H 3SKNA 5IBTL 4LLUA 3RVXC 3QULA 4QHNA 5I0DA 3JV5A 3NCYP 5HHXL 3TH2T 4WW2B 3QUYA 3IDGB 1KNOA 1R3JB 3MRMA 4YDKH 3TIDB 2Z9TA 3V6OA 4TULL 4IRJD 1S7QA 1ACYH 1B90A 3RIAF 1MCBA 3FRUB 3M1BB 3ZKND 1YY8B 2ADFH 4N0CD 5KVDH 3QRGH 3P9LB 5IBUG 4M62L 2EEBA 4K07A 3KLHD 2PN5A 1F58L 1T1XB 2FIRT 4NO3B 4XXDA 1ORSB 5GGSY 5DRNA 2WY3A 1EEYA 1NMCC 1YYLH 1JYXA 5GGRB 3GIZL 4JREB 2WNGA 3F58L 4G7YH 1I8LA 1OL0A 1MAMH 1JNHA 4OGYL 5AD0A 3QNZA 5KS9F 1D9KC 4LLMB 5HSFA 3OF6A 1BD2B 5IF0B 4RFOL 3T8XB 2OP4L 2R0LL 3H3PL 2AV7A 1YDPB 1OCWL 4I18B 1BWMA 5GGTA 4HUUB 4N8CL 1FNSH 1G9MH 3QZWG 4HWNA 4YDJB 4PG9A 5DJYA 4P0DA 2YC1B 4X7EC 4I0CC 4F7TB 2BC4A 1JUFA 4NN7B 1DLFH 1IGCH 1T1ZA 4M7ZC 1RZKL 4MDJA 1QHOA 1S7RB 1UG9A 4WGWB 4KJYA 2A77L 2GT9A 4DKEH 3A67H 5C2BH 1YY8A 1CDBA 5DJ0A 2PO6B 3AAZB 3IJSB 2B0SL 1A14L 4P2RE 3RY5A 1FLTX 2X4PA 4L8BB 1I1AC 4QRPD 5KJRH 1CS6A 4FRWA 4PG2C 4PR5A 3RRQA 5CJ5A 1I1AB 2NW3A 3O6MH 4XPGH 2WP3O 4RIRB 4Y16B 4FHBD 3MRBB 4YDKL 5F97E 2VLJD 4YO0A 2UY6A 2Z91A 1D6EA 4WFHE 5H2BA 4OZHF 1FGVL 4LP5A 1U3YA 4P5KA 3SEPA 5DQDL 4XMKL 1EEQA 4TVPD 3F62A 5HHOD 1U93B 4NN7C 2VWEE 4XAWL 3GKWL 3RAJH 5FKAB 3TM6A 5CJ8A 4M6AA 1OTUC 6CGTA 5IM7A 4QRTB 5KSVB 4JFHE 2DQIH 5ESVA 1MAKA 3T2OA 2GFBA 1SM3H 2ZCKL 4ZO7A 3P11L 4X4ZA 4Q0XL 2QSVA 4PREA 1FZOB 2OP4H 2R0LH 4PRHB 3OBAA 3CDGA 4PREB 2I5YH 4JPKL 1SY6A 5C0RH 1LNUA 5LGJA 3GKZA 1K5NA 4WHCA 3VWKD 2FEDD 1HQRA 5AWNL 1UYWL 4LOUC 4MWFA 5KOVC 4MQSB 3AC0A 4LGRB 4KMTH 2LU7A 3EYOB 3FQWB 1Z0NA 3V4VH 4EN3A 3G6JA 1ITBB 4M4RA 2CUIA 4IDJL 4JRYE 1H8OA 2BNQE 3D69B 4GRWE 5JXAL 4M5ZL 4IRZL 5TE4H 4M9OA 3I84A 4F9LC 2MMXA 2XKSA 1HXYA 4HS3B 2NY2C 1KJ2L 1T7VA 3NMEA 4DGIL 3HI1B 1SBSL 5CD5D 3KS0J 4LAQH 3ARDA 2LVEA 3MXVH 5D7SH 3CNKA 2GJJA 4I77H 1RJLA 4FQCH 3PQYD 5DK2A 1ED3A 3WHE0 2G2RA 1OAQL 2AK1H 2ZPKH 1C12A 2BNUA 3HZYA 5IR1A 2CDEA 4PRBB 4R7DB 1KENL 3LKNB 5DEGB 3HLAB 4BSJA 2HA1A 3S4SG 2Q8BL 4XVUC 4X6DA 3VXUA 5J9PA 4HIXH 3W11D 1CXFA 5JOFA 4Y19A 4JVUA 2B39A 1NGWA 3RBSA 3G5YB 1JHLL 2HT2C 1ZGLP 2OTWB 3JTTB 3QUXA 5I75B 4MJIA 1K4CA 3HNVH 5J6GA 1UQSB 2CO6B 4WFEE 3I9GL 1T66C 3DX9A 1WZMA 3SO5A 5DLMH 4CVZA 5E2VH 4OFVA 1BOYA 5IVZB 5D8JH 5EC2A 4XB7A 5FF6A 1AD9A 4OLYH 2HP4A 4NQED 4ONGL 4PG9B 2C7UA 3MNWA 4YGVB 1NCUA 4R90H 1ZV5A 3HRPA 4LSPH 1FP5A 4WWID 5M7QA 1OQOA 5DURB 5C71A 4OZHA 5D7IB 5GS3A 4ZNEA 1WZLA 3QQ4B 3ZZ1A 4MS8C 2VRAA 5D7IA 1QA9B 2RR3A 3HTLX 5E6ID 3MNVA 4KVCH 3AB0B 2E6PA 4LHUB 1MF2L 4CGTA 2VDPL 4QY8B 3QNZB 1KB9J 1W0WA 2Z31B 3QB7C 3GI8L 4WI7A 3FO1A 4GKZA 4MJ2A 2P43B 4XMLL 4E41E 1EFXB 3KR3H 2VAAB 3CZJA 4CVUA 1FC1A 5TE4L 1INDH 2D9QB 4XNMA 1KELL 5MEPA 1IGFL 3UPCA 1P4LB 5IMLA 1AXSB 1L0YA 3L3OA 4NWTL 5ESQB 4OQTA 3RUGB 3PV7A 1B9ZA 3Q6GL 1XIWB 3AVEA 5DD5L 4FQCL 5INDA 4FG6C 4P23D 5F6IB 1Q72H 2CK2A 5E95B 3RHWF 1NGYA 4EZMA 2ED8A 1OGTB 1NJ9B 5F96H 1ZLWK 2VDNH 4OZFG 3S6CA 1XH3B 4NNYB 3E2HC 2N4IA 4MLSA 4XHJC 1HH6A 3AUVA 4NNYA 2Y36L 4JFEB 4CMHB 2ADIB 4N8VA 1E28A 1H3UA 1AQDB 2CK0L 4HWEL 4MXQC 4LOUD 5C0EB 1ZHKB 4XCNA 1QR4A 3OGOE 2CUMA 1MFDL 1NEUA 2CO7B 1IGJA 3MLRH 5CBEB 2I07B 1MJJB 5HDBE 3ULVH 1RZFH 2X4QA 1F3RB 3A6BH 3O6FC 4OZFB 5E2VL 4CAGA 4QTHB 3S5LG 3ZHDA 1H8NA 1PQZB 4KKCC 2F5AH 4OLYL 1KB5B 4KRLB 3ZKMD 1ZGLB 4G3YL 5K59E 5DVMA 3PGDB 2Z35B 2HFEA 4J4PA 2HWZL 2F54D 5DJ8B 2EKSA 2ZKHH 4YHIA 3MRDB 2BNRE 3PQYA 4P9MH 1SBBA 2B7DT 4MDIA 1R5VB 4F57L 3IB4A 1AC0A 5C6PB 3STBA 1QLRA 2MQCA 2VL4A 3W0WB 1DR9A 4DVRL 1DFBL 5GJSL 4G7VL 1FAKT 5FB8B 5IW1A 2K7PA 3DYOA 1DUZB 4XBEL 3BKCL 5ITBH 1U2CA 1AJ7L 4FQIH 3GSVA 3LPGA 5K9JL 4D9RD 2JJVA 5GRZA 5FKPB 2HT2D 2LTQC 5KN5B 2VL5B 5FF6B 2ZCLH 1KCGC 3OAZK 2ENSA 3MO1A 1A47A 4XI5D 5IKCB 1HQ4A 4M3KB 4Y5VC 4H8WH 1NSNL 1DQMH 3QQ3A 5LAXA 3ZL4H 4JN2A 1A6WL 1KULA 3WN5B 2J8OA 3PWLB 5HHOE 5C0FA 3JWOC 4OCRH 4JO1H 3JV4A 3AY4C 2B1HH 1FVDA 3VWJC 2EH8L 4NO2A 4Z7WF 1IFHH 1YMMB 1C12B 1G7PA 5CD5C 1YMHA 3MLRL 5FYLE 4UOJA 3FTGB 5DRZA 1NC4B 5C07A 2VZ3A 3A6BL 5B8CA 3VXPA 4YGAB 3IFOB 3ARDC 3CD4A 3ZHLA 5TPWL 1IC7L 3P77B 3JXAA 4ZQKA 5T1LA 3T2QA 4NOBA 4PGZA 4Y1AE 1MEXH 3LN5A 4J1UA 3QEQE 5CMAA 1I3RB 5EPMB 1X5YA 4J3VA 1FJ1A 4MYWB 4FQPA 5BRZE 3P30L 4EN3C 3OAYK 4TUOB 1A6VL 2BFVH 4KGLA 5JIHA 4HXBH 4WEMB 5HGDA 4RBPK 1L7TH 5CILH 1Q0YH 2E27H 4F58L 4FZ8L 1I8IA 4NZRL 1NMAH 2H26A 2ZUSA 3BZEB 4OZ4A 1M6OA 3W5NA 5EUKA 1I8IB 1WBYB 4WV1C 1MWAB 3U2SB 4OD2A 2VDKL 4JPWL 3DX7A 1LO5B 3QXAA 4LARL 1Q9KB 2NMSA 1PG7H 5E6ZA 5IMMB 5B3NA 5DRWB 1MFBL 2FSEB 4MSWA 1OGAE 3O3AA 4X4YA 4X6FA 4WW2F 1EHLH 3TIDA 3BT2H 4DTGH 2AJXH 4Y4KA 3WNKA 2I9LB 4HHAB 3OXSB 1GGIL 2HFGL 4PRNB 1LP9F 1EVUA 4KK5D 1WSST 1VA9A 5D71L 3ARQA 4L5FH 4DN4H 4MAYD 4M6NH 5B38B 4A6YL 1KPUA 5JA9A 3JSSA 4JG1H 2EH8H 4GW1A 2FO4B 5KS9E 2JLLA 4GO6B 1VGKB 3H9SB 1M05A 3LOWA 3LZFH 3RJQB 4OGXL 4C58B 3MLTA 4J7RA 1MI5D 3PF2A 2NTFA 3DURA 3KYKH 4EVNB 2ZWLT 4GRWB 1DBMH 4X5WA 2Y25A 1VACA 4OZGF 5IBTH 4EVNA 5ACZA 4U6YB 1HHIA 1QZ1A 3RJDA 4PV9B 3LCYA 3AU1A 1JPTL 4HULB 3K8KA 4ZUSA 4MD0B 2BNRD 2P44B 3GSVB 4RAUA 3MNVB 3HNSH 3U6RB 1OD7A 5ICXB 4PB9H 4Y2DC 43CAA 2DOCA 4FZ8H 5HDQH 3VGGA 2CLVA 1T83A 3O6FD 1F58H 3LQAL 1KG0A 3KYOB 3UAJD 1ZLUK 2C7UB 3HC4H 3MNWB 5H35B 3VXRD 4ZFOA 2FDBP 4OGYH 3SDCD 5AD0B 1ZLWH 5IQ9B 3FT2B 3LIZH 1HHHB 1KGCE 1W0VB 3OGCA 4Q9QH 2FHFA 4RFOH 5C09E 2IH3B 4LDOB 1U8NA 5I30L 3TIEB 1MFAL 2NY4D 2VUYA 1CWVA 4XP9H 5CP3A 5AEAA 5HYSG 3VRLE 1FNHA 2NR6C 3U0TB 2EIEA 4LCWE 3GMPA 3EOAB 1TENA 1IAMA 3C5SA 5ANMA 1JPGB 1MCOL 3MBXH 4G8IA 5I1GL 2HKFL 2VLRB 1IEAB 4ONHA 1X5LA 3OTTA 1KJ2B 4DFHA 2YN3A 2HJKA 1UKSA 4UV7L 4WUUD 1TVHA 2YMXH 2OZ4L 5FYLD 1T6VN 4OI9A 3BDYH 1G7HA 4S2SB 5D1ZC 5I71B 4OD1L 1CGSH 3CFKA 2ZOKB 3ARWA 3F65A 3KYKL 1LDSA 3VFGL 3DX8A 4XNUH 4R2GB 1QFUL 3B8SA 4NQDB 5KVMC 4XPGL 1UC6A 3U0WH 4ACPA 2A6DB 1AI1L 1JHTB 1Z0MA 4GRMB 3FB5B 2R4SH 3ZTJH 1W72A 4PJAB 1GGCH 5JW5B 4HX1A 3RGVA 3VGEA 2P42B 3MRHA 4UT6H 4PB9L 1UJ3C 1CD9B 5EDXA 1FIGH 1JRHI 5SX4H 5TQ0H 1FIEA 1JWSB 1DANU 3U79A 5DJ6A 1OB1B 3BZFA 3MLTB 1SYVB 2PXYA 3RIFF 3GKWH 1RI8A 1WTGT 2IALA 3IDMB 2ZUYA 4OCXH 4L8SB 5GPRA 1P53A 3UPAA 1HCFX 2R69H 1CF8H 4QOKA 5TDOA 4LVNC 3N85H 5L2KD 1OAKL 5A2IH 1T21B 3F7YA 4X6CE 3VXRA 5JHLL 2DQJH 3TT3H 3C5ZB 3RHWK 3B6SB 4K8RD 5D5ME 4JB9L 1MUJA 3VXUE 4C56A 5FECB 1LQSR 3MV01 2H2PD 3LH2H 3OG4B 1MY5A 1M7DA 4CU8A 2IMNA 3D0VB 3JUZA 1K4CB 4LSUL 1UXSB 3V52H 2J5LB 4OZIE 2BCKB 5C0AA 1HYSC 1F13A 1ZLSL 5JXEC 4KKAD 4ORZC 3BDYL 4KZEL 3V0WL 1WBYA 1IGML 1N3NA 1QRNA 4Z18A 5C08B 1S9WB 3MXVL 5DUPH 1BEYH 1IGTA 5CEYB 3Q5OA 1E4XH 4XC3L 1PQZA 3GUTA 1LK2A 3RNKB 1E4KC 3MGOB 3EJZC 2W0PA 4BFBD 2ZPKL 1QFUH 1I9EA 5BCAA 5DS8A 1Y6KR 2I07A 4CVXA 4OKVB 2ZUXA 1GGCL 5FFLA 3GZKA 3FFDA 5MP6H 4HLZG 3LV3B 1FG9C 4HUUA 4NBYB 3PHOB 5MENA 2P1YA 5E8PB 1FO0H 2WBJB 1NL0L 5LCVL 3IFOA 3CSYB 3FQTA 4BKLA 1WBZB 1CE1H 1Z5LB 5EWIH 3MRQA 4JDVB 1CDYA 3REVA 2ORBH 3TH4T 4L4TE 4KQ3H 4LCCC 4IMKC 4RGND 4ODWB 1NAKH 1ORQB 4AY0A 1Q0XH 1URLA 1DUYB 4FQ2H 1KGCD 2L7UA 1QLEH 1UWEL 5ADPH 1A9BB 4ZTPH 4ZUVB 3VXMA 4GRMA 2DL2A 3H42H 5DSCA 4HUWB 4KXZH 4YZFE 1HHJB 1AO7D 1XCQB 5AG8A 5CEZD 4TSAL 3VFWB 2BVTA 1KIUA 5JQ6H 4OFYA 4U1KB 3KLAB 4FTVE 4JDZB 4MJID 4M7KL 1KLFA 2UVFA 3IDGA 3QUYB 4YAQB 1HCVA 4U1LB 3VDCA 3UAJC 3HE6B 3HMWH 4JFFB 3W2DL 5HGHB 2VLKE 4W68A 5IHLB 3BSZL 4N90D 3Q5YA 1ZGLM 1R3LA 1AGFA 2YS4A 4QRQB 2R23A 1EO8H 1S5IH 1J18A 3EZ8A 4HH9A 1BQUA 2WM0A 3V0VB 4TNVF 3VFPB 3KXFD 1GAFL 1WFTA 3VMPA 1A3QA 2F54E 3CVIL 3VXRB 5KTEH 4U1NA 2IAMC 3O3EB 1CLOH 3V0WH 2P5WA 3VFRA 2DM7A 5IFAH 1XF3A 3HB3C 3Q6GH 5CBAB 5I18H 4ODHH 4L8SA 3AU1B 1QFWI 1R5VA 3LMJL 4TOYL 3PQYB 1RU9H 1NKOA 1IAIH 5D2LE 3DX9B 4DKFL 1UFUA 3BXNA 5E56A 5IBLD 1SJEB 4FNLL 4ZYKB 3T2NL 2AK4A 5F1IA 2CK0H 4HWEH 3RZCB 3AS1A 2VZ1A 5IJKA 2VLRD 1VFUA 3RVWC 4R7NB 1YC7A 4Y5XB 1MLBA 1VFBB 4J12A 5EUOE 1BQHG 5ESAA 1AGCA 4MXVF 3T4YB 4K2UH 4X6BB 2IGFL 3QH3B 5CP3H 1GJIA 4P2YA 2J3SA 4HFUL 3NZ8B 1F4AA 2UUDH 2QSCL 4RNRB 2VJXA 3ES6B 1BVKA 1U8HB 2D9CA 4RAUB 4P2QB 4JGUA 1P7KA 4IIQB 4LLMA 1U8IB 4HD9A 4OTXH 3QNXB 4NQUA 4L29A 4PJCB 4TTDD 4LSSH 4S1SL 2HKHH 1J05B 3CU7A 4K71B 2FYYA 4P9ML 5E1AB 4BSVA 4WUUE 2J8UA 2HRPH 3RNQA 2R2CA 3D85A 4PFEA 1RIUH 3C6SB 1DSFH 4Q6IA 3GMPB 3IRZA 1UM4H 5CJOL 4A6YB 2R15A 5J57B 1R3HA 2PYEB 5J1TC 3RUGA 3DETC 3MODH 3VGHA 2VSDA 3TESA 1HI6A 4HH8A 5ITBL 1UACH 1A5FH 1C1EL 1FVCA 4P4KC 1FL3A 3O8XC 4X7TB 4U3XA 3ULUD 4YDVB 5KSAB 5EZJB 5FDWA 5DK0B 3LEYH 4AH2A 3EHBD 2EIZA 4QHMA 1RUQH 3JV0A 5K9QG 2FATL 4JDVA 3REVB 1ED3B 4BZ2H 4HG4J 1J88A 1IC4L 3MQIA 4RFEB 4ZDHA 4GXUN 3L3KA 4HEPG 4HCRL 2XI9A 3OKNA 4M7LT 3QXTA 4N5UA 2VR9A 4ZFFA 5GJTH 4U1GB 4EUPB 3FOMB 3PIQB 3VD9A 4M1DL 5CZVH 1P6AB 1UZ6F 3UTPD 2AEPL 1ZLVK 5GGTH 3DUUA 4P9HC 3BYYA 4XP6H 5C0DA 3B4NA 5FA4A 4CVZB 4LCWB 2D7MA 4C56E 4U6YA 5E2JA 1MREL 1MWAH 2RB8A 5HJ3B 4N0YL 3MJ7A 1K5NB 4RZCA 3DRTB 3H8NA 5GZNC 4XPAL 3CIQA 4OLZH 5F7NC 4ZMAT 4Y19B 3L3DA 1I75A 2EDQA 4PJ8A 1KV3A 1IAII 2GY7B 3EOTH 2EE6A 1MSPA 2VXQH 3AS2A 2I9TB 4DZ8A 3QT2A 3P30H 1A9EA 4TSCH 1A6VH 1O5DT 1A7OL 2EIBA 2GITA 5GGQH 3O4OB 4XNZB 2R9HC 4NGHL 2G2RB 3MLXL 4JPIB 3BESR 2XXMB 2QEJA 1YN6B 4LVHC 2XN9B 1YEEL 5CILL 1WZ1L 3QJFA 1U8IA 3GRWH 1TMCA 3HPLA 3D1MC 4ZO6A 2BJML 5ALCH 3SCMB 5FA3B 3SCMA 4I3GA 4LPWA 1PG7L 5F7MC 3MC0A 4Z95L 2JB6A 4QRPB 4TYUA 2VLMD 2DIBA 5C6TL 2XRAL 3KGRA 2ERJC 3BH8B 2FSEA 1I9JH 1SEBB 4LPVA 1INEH 4OIIL 4D9QE 3O2DH 4M5YH 4LRNL 5C7XL 4JZNA 4R97B 5F1IB 4P46C 3LKOA 1FZKA 4HIIB 1HILA 1AGEB 2MWCA 4HCRA 4OCYH 4Z0BL 5D71H 5D93B 3KPTA 4NO3A 4XXDB 2DYPD 1CDGA 4BFGA 2K1MA 1EBAA 1H0DB 3U30C 5IB4A 1WBXA 2P5EE 3D3VE 4PJBA 4HKXA 4L4TD 5KSVA 5A40E 1J8KA 5HHQB 2X6MA 1P84K 2AKRB 4ZFZB 3QDJD 3MRLB 2VLLB 1RJCA 1IQDA 3OB0H 5F72S 3RY6A 2CJUL 2GSIA 2VLJE 4UB0H 3M45A 3WJJC 5DFVC 2YZ1A 4P5KB 3R06A 4U1NB 4HF5H 3EBAA 4RFEA 1KTKE 1OP5K 3RZCD 3TPUA 3GMLA 25C8L 3CFJB 1C08B 1I7RA 3BPLC 1KEMH 4RA0C 3MRDA 4OLUH 1JF1B 1CGYA 3X3FL 2NY0C 5EIQA 4JN1H 2JJTA 2R1YB 1N0XH 1A7OH 5ACMA 3E3QC 3WCYA 2OYPA 1LO0L 3HE6A 3MLXH 3JTSB 4X7SH 4JHAH 1PW3A 4ZUTA 1ZGLA 2DDQL 4L3EE 1GOGA 4WEUD 1OWWA 1U58B 1EJOH 1VERA 3MACL 4JN2B 4P59H 4Y4HA 3CFIC 5DD3L 5IIEB 5J1AA 1A1OA 2FLBT 5CINL 1LO5A 3TCLB 1UH3A 5E6IC 4HUWA 4OQTH 1NEZA 1YN7B 2BRRL 4H5SA 3UTOA 4ZSOE 1UA6L 2FYYB 3NIGF 4IJ3B 2P48B 3GMMA 1A6UL 4MNQE 3VFOB 2CGRH 4X9IA 5CJXA 2F8XC 1YEFH 3HAEH 4EBQH 5JORB 2NY7L 2I60L 3GK8L 2VQUA 4R0LA 2YC1A 4EI5C 5HGAB 1DUZA 4JFXB 4B7LA 3P73B 3L7FB 4XP9L 5IVXE 5FB8A 1ZHLA 4Z76A 2F9BT 4AL8H 1U3HB 2UWEE 3NZHH 1GC1H 4K94L 5JDJA 4WHTB 4GBXA 4NZUL 4DQOH 1OSPL 1CD1A 2DBLL 3W39B 3BKMH 3SE8H 4I18C 4WWKC 5BOZG 3FFCA 1HHIB 5J89A 5DUBB 2B1AL 5GS1C 3V4PH 4JG0L 2DLTA 3MFGB 3UC0H 5M94B 2IG2L 4GG8B 2BX5A 3KPRA 1S7SB 2AXHA 4UTBL 4PJDE 1G9ML 4XI5C 1NLBH 3SE4A 1MRCH 2P7TB 2CUHA 5E2WL 4O00A 4OZIF 4YDLC 4PLOB 2ICEB 1S7XA 4S1QH 3SJVA 1KNOB 1R3JA 3MRMB 3SGEI 2B2XL 1X44A 1S7UA 3RKDC 3DTXA 4JN1L 1AQKH 3OZ9H 4KKCD 2JB6B 3RQ3A 3H9ZA 4DKEL 4UT6L 2JIXA 4MQXD 4XP1L 1E6OH 4EUPG 3W0WD 2DDQH 3QFJA 5DURD 4NQEE 1FRGL 2YPLD 2AXGB 3VXOB 4MA8L 1REIA 1IC5L 1ES0B 3ELAT 3CFCL 1SMAA 1R6VA 5I1IL 2AXGA 4G59A 2VMFA 3WS3A 1CZ8H 1DN0B 5KS9A 1AGFB 4O02L 4U31A 1HK6A 3FQRB 1CK0L 3O6ML 3KLDA 5D4QA 3N85L 1VADA 2DI7A 5IBUB 1GXEA 1JHKL 3ARBD 2Z8RA 3TBTA 1JFMA 3C6LD 3I50L 3QXDA 3NAAL 1B6DA 2NY7H 4YHIB 5IFHL 1FGVH 3U2SA 3QCTH 3QUKA 4JO3H 2N7AA 1MHHA 3OAUH 4U1SB 3RWHB 4U6XA 4I48B 2FLRT 1KCRL 4X7FC 5LGKA 3MGTB 4NN6C 3FB5A 1RUAL 1KB5A 4ENED 1Z5LA 3T1WA 1GYAA 4FQHB 3GSOA 2DICA 3FQTB 4I3SL 4FFZL 5EU4A 3FQNB 4LDLB 2UVEA 1DLHB 4WTZG 1FO0B 2YEZB 3UYRH 3SE8L 3E6HB 4X7CC 1ZLSH 4JFHD 3WXVH 2ZCKH 1I8MA 3CUPA 2VN7A 3VXSB 2MSPA 5EO9A 3HE7C 1KCVL 2PYFA 4AEIH 3TO4C 4U6HB 1LP9B 4XVTL 5B39G 4EUPA 2Z91B 4NJ9L 1ZWIA 5HDBF 4NQVB 5HGAA 5TGBB 3JUYA 1IZJA 2NW3B 3U82B 3TEUA 2XZCH 2J88H 5I15H 4WUKH 1NGWB 2YD3A 1MRDH 1QOKA 1TLKA 2XFXA 4LF3A 4S1QL 4GG6B 2B2XH 1C16B 4JFDA 1TNNA 2V17H 1YNTA 1YEKH 5HY9A 5J56B 1D9KD 2OK0H 2V7NA 2XIDA 3DV6A 1V3KA 4HWBL 1MFCH 1G6RH 1MQKH 2R0WL 2D03H 4LASH 2F53E 5BW7A 1A1OB 5LCVH 2BVYA 3HZYB 4HIEA 5DDHB 3CXHJ 4FA8A 3RWCA 2DM2A 3TFKD 2ZP0T 5EZOH 1TPXC 1NFIB 1VEOA 2DQHH 5DFVD 4KTEL 1TJIL 1A7RH 3DROB 4DGVL 3OR6B 4JKPH 3TBVA 1C7SA 3G5VA 1CGVA 2O5YL 2YPKA 4RQQA 3WS3B 2A74A 5LXGL 3VW3H 3SKMB 3B6SA 3ZYZA 5IB3B 1JYWA 2Q8BH 1QYGL 2GTZA 4C56B 2AABH 3C5ZD 4R4ND 3EDDA 5H35A 4UOW1 3SE9H 1F4WL 1KG0B 5ICXA 3VDBA 3X3GL 4H1LG 1I7ZB 3IVKA 4Z6AT 4E0RA 1OSZA 3BIKA 3U46A 1P7HL 1QVOB 4YHLL 1S7XB 4PV9A 5ALBL 3SJVB 3OJ2C 1W0YT 1T0PB 3BUYA 5DLML 2OSLA 2J2ZA 4PS4L 5DJ6B 1CD8A 4FFZH 1A6ZB 4MX7B 5J12C 5T1LD 1YEDA 2VDQL 4ZS7L 1S5IL 4YEEA 4F7PA 1WBXB 5BJTA 1F11A 3MYJB 1WAAE 3S35L 3KJ4C 1MCHA 3R0MA 4PJIF 2QQKH 3MV7E 1T89A 3KPLA 3QUZD 3FQUB 2P5WE 3MRRB 2AQ2A 3R8QA 4CL7A 3SDAD 4IRSD 1FNGB 1XCTB 1MJ7L 5DEGA 2VDPH 1JWMB 2XWBB 5HHNB 4AQ1B 4YDJA 3MLSH 3RKPA 2CRMA 2OI9A 3I02A 4JM2C 4JFQB 3ZE1F 3E3QE 4Y7MA 5ISZA 3F5WB 4OCSH 5I1CH 3QWRD 4MA7L 1ADQH 1WCBB 1JF1A 1G7HB 2GIYA 2W9EH 1YEKL 2NYYD 1WEJL 1VGEH 2FB4L 5F89A 5HGBA 4MNQD 3IFLH 3V6BR 3RL1B 5IROC 1R3LB 3IDUA 4BK4A 4K55A 3P0YL 1CD0A 1PEZA 3UJTL 4D3CL 2IBGA 4ZNEE 3DUSA 4JKWA 5BRZD 1F42A 1T0MA 2E8ZA 3LS4L 3NPSB 4ODUA 4HIEB 3MRIA 1FAIL 3D3VB 2X1QA 3TN0C 5FYJH 2FECL 3QPXL 4V2CB 2VDNL 4YPGA 4CN6A 4N5ED 3VXMB 4AIZB 2ZUQB 4WRLA 3BZEA 5I76A 1HHHA 3O9WB 2OM5A 3RIAK 4YXKL 1MWAA 5J06A 1NGPL 4NZTL 4GG6A 2BVOB 3TO4B 4N0UA 3LKOB 4DZBA 4JY4B 3HZVB 2KQNA 4KUZH 4NP4H 5DJYB 4AM0A 4X6DE 3T04D 1F8TL 3NCJL 5HHXH 4YNYA 3F6LA 1PBYA 5CJBA 3CFDA 3KS0H 4XMPL 2DI8A 4JEGB 1NCNA 4XBGA 3UBXG 1ACYL 4CW1B 3QFJD 3DARA 1LO3H 2DKSA 4IEFB 2XZAH 3MCLH 2X70A 4LIQL 4IOFD 4JDTH 1K85A 1HSBB 5GZOD 2HFFA 1U91B 3VWKC 3UDWA 3U6RA 3BI9X 5KVDL 3RUGE 1NUDA 1LE5A 4M62H 2EEAA 3VI4F 4IS6A 2JCCA 5IFJB 1RZGB 2RCSH 4IRJB 2V5TA 5EU3A 3FQUA 1HINL 3OKKB 4JPIA 4NKIL 3P9LA 1R5IB 5J0BA 2HN7B 4PR5B 5IV2B 3IU4L 1NDGA 1AGEA 1JF5A 4U1SA 3RWEB 2AJ3A 3MR9A 2FRGP 1H15B 2DIJA 2EXWC 2Z4QA 2X1XR 3CZFA 1RK0B 3V5HB 3MR9B 4R4BA 4ZTOH 1FE8H 4LCUB 5DJXA 1EV2E 4WW2A 1KLUA 4JZJC 2JJWA 4IDLA 4M6ML 3HS0B 4ZNCD 4YR6B 2IH1B 1NGXB 4HJGA 1PX3A 5IEKB 4U6VL 5E1AA 2DMCA 5F9WB 2A0LD 1I3UA 2IPUK 3T4AA 2DQTL 1RZKH 2B8OT 2F53A 1FAIH 3PWPD 1MCIA 1P7KB 3I6GB 2HTLC 3K3QA 2CRYA 3QDHA 2FH6A 4QXGH 3KJ6H 5CSBA 3QUZB 4PJXF 5DHVA 3UBXA 9CGTA 1WIOA 4YUEH 2JCCE 2C4FT 3L3HA 3RPIA 3VH8B 3VRJA 2FX9H 4GH7B 5KJRL 3FQXB 1PLGH 5DRWA 1HQRB 3O4LA 4ZUVA 1KIPB 3ZDYE 2BVOA 3K81A 2UZXB 2BNQB 4JHBA 2AK4B 3RWHA 3E0GA 4J3XA 5L7XL 1HZHH 4ZOEA 4ODVL 2BNQA 4G43B 2MNUA 3I75B 4YPGB 3D39A 1H3PL 4LIQH 4UDUB 3ECBA 7CGTA 1ZWIB 1XGPB 3IETA 3ZTJG 3DMMB 1DQDH 4G9DB 4P57B 4XWGL 4NIKB 3HI6H 3DECA 3MMEA 2PR4H 5DFWH 5I74B 4NZRH 1RUKH 4Y5YA 3TJHA 4U1JA 2C1OB 1I3VA 1I1FA 2H32A 4IJ3C 1SM3L 5D7LD 4HGWB 4NSKB 5B8CB 1KTDB 1MAML 2R56L 3V0VA 3R1GL 5JW3H 5E6IB 2XN9D 5CCKH 4DN3H 2NY1C 3GMMB 5CGYC 1PX4A 2R1XB 5EOTA 3CX5K 3QDME 4HV8A 4M6MH 1LDPH 3ARDD 1NBZA 1X4YA 3M8OL 1DDHA 4QGTA 1RIVH 2DYPA 4UB0L 1YEIL 3O3BB 1S7SA 2DQTH 1GCFA 4M5ZH 5C8JB 3JZ7A 3ARFD 1I85C 1S9VB 2EDWA 1GOFA 4EN3D 5FHAL 1KBGH 3IFPA 4OLUL 1ONQA 4QXGL 3X3FH 2F15A 3VD3A 1QPPA 1JGUL 3QZWA 2A77H 2YUXA 5ENWA 4F80A 2FJGB 3MJ8B 3CGTA 1EGJH 3N1FC 3VCLB 1NDMA 3QUYD 5GS0D 4ZFOB 2V2WB 2VL5A 4PJ7A 3B9DA 2JELL 3Q2CA 1HYRC 2YUZA 3MLWL 5DA0B 3O3DB 1PZ5A 5D2NC 4GG6E 3KXFB 4TSBH 3QH3A 4JHZA 2NXZD 4PD4K 4AM0B 1BIHA 4UNUA 1H3PH 1KCUH 1TXKA 4WI8A 3GHEL 5DZNA 5E99H 4L8DB 4K7PX 3U4EB 1N7ML 3GK8H 4PYGA 5ILTL 3HNVL 1VPOL 5D7IE 3X14B 2H8PA 4P3WA 4C59B 2HFEB 5GSVB 1A21A 2WSKA 2O61B 1RMFL 3QG6B 4WFGE 3QEUA 4C54A 2PR4L 3C60B 1HILB 2Z8WC 4YDIL 4NFBA 1S9WA 1HH9B 3LEVL 3MV8E 4U1MB 5MEOA 2EO1A 3S37X 3T0ED 1LMKA 4P5MA 3BXNB 3MGAA 5EZIH 1KJVA 2WINB 3BPOB 4QTHA 2DQUL 4JY5H 1JV5B 5E70A 1YNTB 1XF2A 3VFSB 5J4MA 3BKML 3KLSA 2ADIA 6FABL 1Q9OA 1FSKB 4M6OH 1HH6B 4KJQC 4F15B 3LAFA 3HC0B 4M8QA 4BM7A 5IBLC 3GMLB 2LU4A 4TVPH 1GIGL 5F1NA 3AXLB 5B39A 2XZQL 2XYCA 1UGNA 1SJVA 3VXSD 4P2RB 2DMBA 4WFFD 3S37L 5AWNH 4G6FD 1X5JA 3G5XA 4LDEB 1YEHL 4N0FA 5C92A 2BSTB 4MHHI 2V2TB 1RJYB 1KELH 1LQVA 4WO4C 2KZWA 5I6XC 5IMKA 1DZBA 1PD6A 1XF4B 3WFDL 5LJYH 3IXAB 4FQJH 5EU4B 1WITA 3I75A 3FMGH 3QG6A 3QFJE 4UDUA 3ULSA 4PY8J 3U36A 4QNPF 2EDKA 2BMKB 3CFCH 2SEBA 4HIIA 2RQ8A 2DTML 4PJHF 1CZ8L 4I77L 5F96L 1FDLL 4M61B 5IHUH 3VFGH 1LWRA 3TNMA 3KPNB 2GY5A 5DGRA 4JR9L 2EXYD 1QSFA 2VLKD 3BRGC 3L3HB 2K7QA 2X9XA 5EBMB 5FM8A 4HAFA 1OPGL 1KCUL 1KENH 3ZSTA 2JJSA 5HHVL 3DETD 2R4SL 3I50H 5HXMA 1FL5B 1NMBL 5DD1H 4LSQL 4J3SA 4GT7A 1NCWL 2X1PA 1WWCA 3GJFK 4K7PY 4R26L 1MCFA 4HWZB 4H88L 1MELA 4OF8A 4NKOA 4Q9RL 2D3VA 3O8XB 4YBLB 1INQB 1NANH 4J8RB 3HE6D 3P0GB 4OLXH 1ROWA 2FD6L 2R69L 1NFIA 3BWAA 3GSNA 4XTRC 2HJKB 4KJPD 5D2LF 4ZUUA 4QRRA 4AEFA 4KQ4H 3I3BA 5KSAA 5TDNB 1U6AL 1J9CT 2ZZUT 2MOVA 2XXCB 5EN2A 2P8LB 3O2VL 4TVPL 1NDGB 5DJ0B 4ZUWB 5JPNA 5DJCB 3P4NA 3U0TA 4L8BA 4K71C 3CZFB 3DRTA 1HKFA 1MF2H 4R7DA 1H5BB 4PJEE 4B53A 3BH8A 4O58L 1V7MH 3DUHA 3ARYA 2E9BA 4RMSA 4MAUL 5E5MB 3V52L 3OHXB 1FNAA 2HLFD 5I15L 5HYSA 2A6DA 2OS7A 1RUPH 2D0GA 4FQJL 5GZND 3S36L 4Q7DA 4PJDA 4PJIE 2P5WD 5MHSE 3FO0H 2F5BH 4YK4C 4JFDE 2G9HB 2VERN 1HHKA 1MQKL 2R0WH 4M1CD 4FQ1L 1DQML 4FFYL 4NNPL 3T0EC 4OZFH 4XGZA 5AAMA 1OP3H 3UYOD 1DQLH 1YECL 5EZOL 4OGAD 5BXFA 3GBML 2FX7L 5CUSL 1QFWL 2BVPA 2X4UB 1CVRA 2LAGB 5I1JL 2PTVA 3MOQA 2Z92A 3Q6FB 1IFHL 3DXAA 4FFVC 4M61A 5AZ2H 3K0WA 3WDHA 4DZBB 4L9LB 1UT9A 4OZ4B 2H9GA 4OJFL 5I1KH 5C08D 3CDGB 1NEZB 5IVXA 4A2MA 4HJ0D 2J4WL 3FB6A 3VRJB 3H2WA 3TV3L 3SBWA 1OLZA 3A0OA 3BN9C 2L4OA 2OLDA 4LCIL 2EE9A 3B9KD 3L5HA 4U4BA 4UV4L 1I3RA 4Q9RH 2DN7A 5KANI 1A7NH 3K46A 1T0MB 3VD4A 4OZIB 3T3PF 3QPQD 2FD6H 3O3UN 2F5AL 3MOAH 2CPCA 1DN0A 5KS9B 3G04A 4XWOD 3BAEL 1F4HA 4MXWH 4WJ5B 1UWEH 1DN2A 1ES0A 4ZTPL 3IJYA 1ZE3C 2XG4A 3R0NA 4RNRA 1K2DB 5GGUA 3CAFA 1UCBH 3REWB 4F58H 5FK9A 2NZ9C 4I2XA 4YO0B 3B2UC 1WAAA 5JQ6L 3AROA 1LHZA 4JPWH 3NACH 4GKNB 5IW6A 1NCCH 2YBRB 4NHUA 2X4PB 3C87A 4CADA 1ZMYA 1MH5A 4OCSL 3ZDZF 4LLDB 4LSTH 2X4NA 4GS7C 4HGKC 1AXSA 1A7PH 5IHZA 5K9JH 4JZJA 5ACLA 4MB3A 2BXYA 5C0NC 3QIBD 5MERA 2WBJC 1PZUB 4L8DA 5JIIA 1BM3L 4AK1A 2C3WA 3DVNB 1DQLL 3RL2A 4DN4L 3LS5L 5FYKL 5TE6L 1D5IL 4N1CA 2AP2A 4RGNC 5CUSH 4ZFGH 1NC2B 4E0RB 3CH1A 1JZ6A 1IARB 2D0FA 5GRVL 3KPSE 3L7EA 4RRPA 1FH5L 5F7KC 3U48A 4P2RD 3CFEB 3BE1H 5AZ2L 2GTZB 3QDMA 5GHWH 1K8DB 3QDMB 4NKQB 4W4OA 2O5XH 5DD0L 4M8VA 2W0KA 1IGYB 5E4EC 4JFXA 4GMTH 5JOPE 3P0VH 3VCLA 3QWRA 1WWWX 1X3DA 5CIPH 4R8WH 1J0JA 3U7WL 2WV3A 1LK2B 3RNKA 4NPYA 4O2EA 3PGDA 5DC9B 2DQGL 1S7VB 4LLYA 1A7NL 4EI5D 5T1KB 2X4RB 5LBSH 1MCRA 1JPTH 3PABB 2KUTA 1V05A 1BHGA 5DDHA 2N7BA 2E7BA 3MCLL 12E8L 2Z8VC 4YBQC 1SJHA 2ZG2A 2QHLA 4OTXL 3ET9F 1VEMA 2HKHL 1YC8A 3ROOB 1RVFL 4YFEA 1RIUL 1DSFL 3O45B 3ZDYF 3BKJH 4NO0A 3O4LE 3WFCL 2NY3C 1YA5A 4Q9BA 4HH9B 3MODL 2P4AB 1A6AA 1A3LH 1I1FB 2AK4D 1LVEA 4JLRA 4F37K 2EIDA 4PJAE 5GIRA 3NCFB 5MHSD 5BZDB 5TF1H 1GGTA 1TQCB 4ISVB 4ZO9A 5BS0E 4K7PH 4JDZA 3WKNA 3T0WA 3ULUE 1RUQL 3MUY1 4JRYD 4TUJB 3ZKMC 1JMZA 1OF2A 2W59A 2YKLL 2EZ0C 3IETB 3L3GB 4G6JL 4NZJA 1XGPA 1BM3H 3S4SB 3VG9C 3Q5TA 4LPUA 3T65B 4HAGA 1D5MA 4LLAA 1NCAH 3B5HA 1UVQA 2D4DA 1KCLA 2FBJH 3TCXA 5GRWA 1VESA 3DHMA 4M6NL 3BZ4A 1FVDB 1TTGA 1KACB 3GHBH 1U8PB 1D6VL 4YC2C 4Y1AB 1J1PH 4HKZB 4H0GA 2CH8A 2E9IA 5D5MB 4KK8C 1XGQB 1QLFB 1WBZA 2YOCA 5IG7B 1QVOA 4RWYH 3TVMC 4DVBB 1W72L 1YQ2A 3SHSA 4HDIA 2MCPL 4WVRA 5J8OA 1JZ5A 1GZPA 4WU5B 3WSQL 2FCBA 2BRQA 2N1KA 3S96B 3BEWB 4JRYA 1T0NA 1AR2A 3IDXH 1RJYA 1UADC 2WWKO 4JRXA 5EU5A 4JLRB 4Z7UF 4H20H 4NKDB 2G9HA 1TQBB 4MLIA 3S3PA 1JPSH 3TBVB 2WBWB 3WIHA 2VDLL 3KHOA 4YFLI 3RPKA 1T66D 1XH3A 3T0XA 3QJFB 4ZO8A 2MJWA 3FN3A 3MV9A 4NKMA 1NGYB 1DBKL 4NRYA 5E0QA 4ONHB 5FM5M 4Z0XB 3HNTH 5GGQL 2BY0A 4P49A 2W07A 2ED9A 1S7UB 1RZ8B 1NGZA 3VE0A 1C5DB 4IMLB 5DI8A 3THML 5D1XC 3U7YL 1IGIL 2X44D 2YUVA 1XIWA 3B9KC 4EJ1C 1B0GB 1X5HA 5EU6A 4POZC 3ZDXF 3R8BB 4UAOC 1G6RA 1OARH 3KWWB 1W0VA 3OGCB 4N0UE 5EOCL 2P45B 5AYUH 3PP4H 2PF6A 2ZJSH 2VAAA 5FOBB 2NX5D 4AIOA 3N9GL 1HXMB 5IESH 4GXVL 5FA4B 2F8VA 3X12B 2WUCH 2UUDK 1RHHB 4HKJA 1LDPL 4X99B 2EDFA 3HUJE 1HSBA 2UY7A 2HFFB 5SWQB 2W9LA 2EYTA 1F90H 2CDGB 1X5GA 1F5WA 3T0EE 4KROC 3CU1A 3RA7H 4HW6A 1QUNA 3K1DA 4XVJH 1FO0A 2YEZA 2V2XB 5CHNA 4AZ8A 4YBQD 1A4JB 3FQNA 4BH7A 3BGFC 3KVQA 1VHPA 4P4KD 2DLFH 1LD9B 4KDVA 4ZDHB 1NLDL 3VJ6B 5DUPL 3STLB 3D9AL 2FJGA 1EGJL 3D3VD 1W72H 3K4DA 3ALPA 3TNMB 5T33H 4G8EB 2ICWJ 4FTVB 3TA3D 2DMKA 5BOPA 2CR6A 2NY3D 2CJUH 2X10A 3UTQA 3QXDB 4CNIA 3BHBB 1TCMA 1D5MB 3QG7H 4UTAH 2XG5A 1S9XA 1P84J 1JPSL 3MRIB 3QQ9C 4GSDH 1HN1A 5HDLA 3ULVE 4N5EC 2A0LC 3GHEH 3D85B 2HMID 3QIUB 1FO0L 3WXWH 1LEKA 1N7MH 4LMQI 1XGRB 2LAAA 5BVPH 1LO0H 3SOBL 1WK0A 1QRNE 3L5IA 4M9PA 1FIGL 1RJLB 5JW4Q 2BOCA 4KI5F 1DBBL 4V2BA 2P8MB 1D5ZA 3IJYB 5HDOA 1WCQA 3LEVH 1B2WH 2GJZA 1J87A 2ADGA 5DQ9B 4URTB 3G04B 3F5WA 4FQ2L 1U8KB 3TO2A 4JY5L 2ATPB 1JV5A 4YHZH 3GSXA 4UAOB 3JV6A 4WV1B 1CTNA 4GKSA 4V1DA 5CEZL 5AUMA 6FABH 2ZJSL 2AKRA 3CJJA 5HPMB 1OAYL 1YEFL 5AZEL 1MI5E 4MNHB 3VGFA 5IWLA 5D1QB 1BQSA 1T5WA 3L1OH 3QXUA 2P47B 3GNMH 1N6UA 1E6JL 4N9GB 4XNMB 3DURB 1T5XB 3BSZH 5J6HA 4P2OA 3U4EA 1MIMH 4YHMH 5DVKA 4F7PB 3VXNA 1XIWD 1A7BA 3WLBA 4LEXH 1ZA6A 5L88L 1CICD 3MSPA 3EFFB 4UT9H 5JO5B 4JFPA 1ND0B 3QIUD 2IANA 3STZA 5IVOA 2X89D 2ARJQ 3T1FA 1IGYA 1PZ5B