4PRDA

Crystal structure of a hla-b*35:08-hpvg-d5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prdA01
1MCOH 3ARBA 4NHCH 3FB7A 4RGNC 4YWGL 2X9YA 5C2BL 2APBA 3HAEA 3T77A 3Q3GB 1UT9A 3EFFB 2E6PA 4OFYA 5ISZE 5IB3B 3QFJD 3BEWB 3GSOB 4NQCD 1VGKB 4V2BA 5GGVY 4NQED 1F97A 3O8XA 1I1RA 1BFTA 3LB6D 3Q0HA 1A7PH 1U93B 2AABL 1VFOA 4OM1L 3TIDA 4POUB 1MREL 1XIWC 2OZ4L 2WINA 4O02H 1PEZA 1HCVA 3C9NA 4QHUA 3FO9B 5F9WC 5EIVA 4WUUA 5E00A 4CVWA 4HHAA 1RIHH 1ZVSB 4WY7H 3MRLA 3DO3A 4GQ9H 1A0QH 3GK8L 2OL3H 2Z31C 1QACA 1AC0A 2KBGA 3HI5L 1IAIH 4O9HL 3CK0L 4NZRH 4E9LA 1S78C 1G6RB 3EYVB 2V2TB 3CCHA 4R2GB 1Z5LB 4JHWL 4P46C 2V9TA 1OCWL 1EXUB 4OD1L 3QQNA 5CP3A 1T6VN 2J4WH 1OAXH 1TETL 1CICD 4FNLH 4GQ9L 3IGAB 4Y4HD 4XNUL 4ELKB 1JNJA 5DS8A 2DBLL 2VQ1B 1IAIL 1MIEL 4BFGA 3MRRB 4JJHA 5MI0B 3TJHA 3B9KD 3BI9X 5EZOH 3U2SA 1QHOA 3LKQB 2AW2A 1VADA 4R96A 1FGVH 4MNGE 4X6EA 4HKZA 3R0NA 2J4WL 4NC2B 4RFOH 2HFTA 4MB3A 1NMAL 4YK4B 3QUZC 4RIRA 3DXAD 2ADGA 3QI9C 1OF2A 5E8OB 3JWNC 3VXNA 2YSSB 1INDH 1BQUA 4NIKB 2DB8A 1EAJA 2ICEB 1EUUA 4KV5F 3O3DB 5DD1H 4PY7A 2UY7A 5EZOL 3BIKA 5E03A 1HE7A 1FGVL 2XZQL 4QRUB 3WS6A 1NGYB 3IU3B 4YUEL 1NLDL 4X5XA 4L4VA 4NQXB 1L0YA 1DQQA 4CN6A 3FN3A 4R97B 3VG9C 2HYMA 4LQFL 4QHNA 4X9IA 4I9WE 3KJ4C 4X7CC 1FHGA 2GTWA 1FNGB 3EIFA 4YGVB 2YPKB 1IEAB 4UAOB 4JE4B 4OCRL 3I02A 5E4IA 5AZEL 2BMKB 5FOBB 4PRHB 1T0NA 5FUCC 5IVOA 1N0XH 3JUZA 3WCYA 3PWVA 3NA9L 3W9DA 2R4RL 3BZFA 3NABL 1T1YA 1BFOB 3FCTA 5EUKB 5FM5O 2B5IB 4K8RD 5A1AA 3MREA 2QLVB 3NCCB 3KYNA 4EBQH 4Y1AA 1LE9A 3OKLB 1HQ4B 4P5MA 2WUBH 3ULSB 4OI7A 1S5IH 3OXSA 4PJ5D 1Q72H 4ZSOB 1CVSC 3WXVH 3ZKND 5EU5A 4MAYC 3O6FA 4KDVA 3VXMD 4WWKA 3E3QC 1A3LL 1TNMA 4XAWH 2W0LA 4KRNA 3LS4L 2ZJSL 3GHBL 3S8WA 4LPUA 4HUXA 3VXUB 5C0BE 3OKEA 5I1EL 2D0GA 2WUBL 5DO2D 5C07D 2EYRA 4K07A 3P4OB 1CLOL 3REVA 3SE4A 3DX8B 5JXAL 3NACH 1FLRL 3CXHK 2BY0A 3WXVL 5D5MB 2D7PA 2NY5L 3D85A 3EOAB 4P2OC 4PJXF 1MI5B 1EUTA 4XP1H 1YA5A 3V0VA 5JOPE 4OGZA 2V17H 3WFBH 5J0BA 3AS1A 1EHLL 1PYWB 4GBXA 1T6WA 4JQVC 1I1CA 4NQDD 2A77H 2PO6D 3UZEA 1AGEA 5J6GB 1ZLWK 3FO1A 4TSAL 1RV6X 1T66C 1S7TA 4HDIB 4NN7C 2P49B 5HBBA 1LO3H 4LLAA 2YUWA 4P5TC 4MWFA 4OIIL 3LQZB 3CVHA 4GAJH 3SPVB 5BMFL 3VXTA 2N4IA 1I9IH 1OGAA 1KIQA 1ZV5A 5IWLA 1R3HB 2Y6SC 1KCSH 4ZAKA 1E6JL 2R2CA 3WFBL 4P23C 3ZDZF 4U6VL 2DQIL 5F21B 4F9PC 5JOEA 1A6WH 4I0PD 3SE8H 1UCTA 2JE8A 3ABZA 3C2SA 3KWWA 1A3RH 3A67H 3MNVA 5JW4N 1EO7A 4B41A 1DZBA 2QHRH 3QXDA 4D0BB 4UDTB 3HI6H 3VWJD 3PP3K 1UEYA 4EXKA 2GK2A 5DQJB 4AY0A 4MA8L 3UBXG 1KCSL 4RAVB 3OR7B 1A7QL 4P9MH 2H32B 4P3DA 1JWSA 1W72B 4WTWA 2PR4L 3H9HA 1FPTH 4HJGB 3BPLB 1T89A 3O6MH 3BO8B 4U0QB 3SE8L 2EDYA 5TPWL 1UZ6F 4FMFA 1TQCB 3KNBB 1VKXB 4TVPL 3BJ91 3S3JA 2OTWA 1AGFA 3RUGF 1UXWA 4U1HA 1QLFB 4UV7H 5IF0B 2LFGA 4P9ML 1EEZB 3DSFL 3BP4B 4KJQD 2CXGA 4LP5A 1FPTL 3UPCA 4FG6D 1CFTB 1KNOA 1N7MH 3CJJA 5F97E 4IS6A 1FJ1B 2UUDK 3RTQA 2WP3O 2YKLH 3MLUL 3MYZA 4G8FA 1LEIA 1Z9LA 3BJLA 5TDPB 4Z7QF 3P73A 2W0KA 2YHGA 1DQDH 3QUYC 4XWOD 2VH5L 4NO5A 1INQA 1UB5B 1SYSA 2JJUA 3GSNA 2LU3A 3U46A 1IILE 1CF8L 5HGAA 1BFVH 4HLZH 4S1DC 4X0KB 3V6OA 2DRUA 3D69A 4PGBB 4NKOA 4HWBH 4OZ4B 2A6KA 3ARDD 2YKLL 1NBVL 2C3VA 2XPGB 1LQSR 1E4XI 2B4CC 4TRPL 2BY2A 3N1QC 2Q6WB 6FABH 1I9JH 2HFEA 1DQDL 4OGYH 5TDNA 2IPKA 4FQQB 2XZCH 3TYFA 1L9NA 1MH5A 1GC1H 4L9LC 1WBYB 1BFVL 5I0ZA 3VXQA 3ZO0A 5HYEA 3QWOA 5EZIL 4EN3A 1DDHB 1X5IA 3U7WH 5HVHB 4YXHH 1NCTA 3TVMB 1CFQA 3FFCE 2DTSA 2EE9A 5CLTA 4YZFF 1R3LA 3H6JA 3ZKMD 1BJ1J 4OLWH 4OGYL 4EI5C 1IGTB 5E8NB 3K74B 1MHHA 3MFGB 5DC9B 5HI4C 3MRDA 1YUHB 1YDPB 1FO0H 3B6SB 3F58H 5IVXF 2SEBA 3QO1A 5BV7B 3CUPA 5I8OH 4PLJD 3LN5A 3NFPA 2Q7NA 4ZYKA 1IGFH 1A64A 4XCFL 4H1LG 4NP4L 3U7WL 4GFTB 2P42B 3ULVE 1WJ3A 2FWOB 4ZXBD 1U92B 5AWNH 3T04D 1Z0NA 4UUJB 4WFED 1U8MA 4JFXA 3MOAL 2JJVA 3TPUA 4PP1D 4Z7WA 1MWAH 1FO0L 1E6OL 1RZGB 1JHTA 1ZWIA 5I71C 1MCPH 3S37L 1QRND 3IJSB 4NUJA 4Q9CA 1A1NB 1ZLUK 3C2AL 3T09A 4NKDA 5KTEH 3QDME 2Z0BA 1NFDE 5C7XH 5AWNL 3IJHA 2D9QB 4M5YL 5DEFB 3QUXB 3FTGA 5FGBA 3DVFA 4HH9B 3GGWA 3MXWL 1U3HD 4XWGL 4HF5L 5ADOH 2F15A 1J0ZA 3LQAL 3P0VL 5E95B 3NZHL 3RUGB 4I48A 2DYPD 4HZLB 5CEYB 2NY1D 5KTEL 3E6HB 2N1KA 3IYLW 4K94L 1F4WL 2AV1B 5HYJE 1AFVH 5C7XL 3UYRL 3TNMB 1JRHH 1KB5B 5D7JA 1ADQL 2GQHA 4KJWD 5ADOL 1TVBA 2BOCB 2YD2A 2W9EH 1NEZA 3OR6A 3BFOA 3WHXA 4JPKH 2ESVA 1YY8A 4JHAL 4WWID 4Q2ZA 1ORQB 3MRJA 5INDA 1U8HA 3Q5TA 2W60B 1JI2A 4JRXE 4JG0L 1OB1B 2HJFA 3GHEL 1OAZL 4PJ9B 5I1IH 4LSQH 3LKSA 1HXYB 3EKCA 1BJ1H 2YD9A 3CFDA 1R5IA 3DTXA 3JZ7A 2PF6A 4JFQA 4B7IA 4ZQKB 2IAMD 5JIPA 1YPZF 2W9EL 2ZSVB 4PP8C 4NKMA 3KPNA 2VXSL 4OLVH 2QTEA 1N6UA 3GSUB 3MLWL 4PJIA 3DRQA 4UU9A 2EE3A 4XVTH 1C5CL 1IGJB 2EXYC 4JO1H 3RWFA 1JI1A 1AO7A 3SDXF 5T33L 5KAQG 4POYA 5GS0H 5I1IL 1G7JA 5J8OA 4LSQL 2PUQT 3VW3L 4ONGH 5H2BA 2X4NB 3H7BA 5FK9B 5JPMB 3LEVH 3O6KH 3T4YB 4IIQC 4YFDB 5BVPH 2WWKO 2R1WB 5D96B 3RWIA 4MSWB 1E4WL 3TJEH 1NCWL 1JMXA 4OLVL 5IJVB 2IH1B 4XVTL 2VABB 1GGBH 3DX7B 5IVXB 3RAJH 4PGEA 4ZUWA 3VFWA 2DQJH 1ORSB 1LDPH 5I6XC 1GGCL 1NFIB 2OMNA 4WNQB 3MOBH 3BUTA 5FO9A 3P4MB 3TZVD 4K3HA 2BHYA 3FL7A 2XN9A 5DD0H 1CXEA 2WSKA 4KKLD 1MFNA 3DBXB 4PJCE 1K5NA 1KV3A 5KS9A 3SGDI 3X13B 4NHUA 2C1PA 2H2PD 2HLAA 4DW2H 4H1LA 4HUKB 1XGQA 4FFYH 4BJLA 3F7VB 5D1ZD 2HKHL 2WBWB 4DZBB 3QNYB 1BP3B 4PRPB 3SBWA 4HD9A 3U4EA 1F2QA 1AR1C 1IE5A 1IKNC 5FM8A 3L9RB 5IHUL 3ARBD 4I3SL 4X9GA 3BP6A 1JNNL 5C70A 2KDGA 4NWUL 4XNZB 1BQSA 1X3DA 1CFNA 4JVPA 2J7LA 5KVEH 2CO7B 4JKPL 4OZHA 2RBLA 1KT2A 3FQUA 3PNWA 1JNLH 4OFYD 5F1IB 2JIXB 4U4BA 5F1KC 3QEGH 5C0AD 1FRGH 4RGNB 2P24B 4FZEH 1BD2B 1X5JA 3FQWB 4MAUL 2Q86B 2G9HA 2VDOH 1Y6MR 4JM2A 3CDGA 3SGJC 3TNNA 5EUOF 1DBBL 1MLCB 1F6FB 2CUHA 4DKFH 2Y5TB 4K2UH 2KKQA 1U3YA 5F7WC 2EYSB 4NYLA 4MNQA 2BSRB 2H3NB 4ZDHB 2DICA 1NAMA 4DKAA 3QUKA 4PJ7A 4UIMB 3BKCL 3UZVB 5SX4H 3QXAB 5IB5B 1FBIL 1UYWL 1XIWB 1FRGL 1LVEA 4BZ1L 4FZEL 3FHQA 3SKOA 3BXNB 3EZJB 3FT2B 1XF4B 4YDJA 1OW0C 2BVPA 4ZTOH 4XZUA 3EDJA 4ZFFB 4KQ3L 3P3YA 3IDXL 1F5WA 4BSVB 2Z31B 1JZ5A 4N8VA 5EZJA 3PL6B 1YPZB 1L9MA 1K8DB 4QXUH 3UO1L 5DHYA 2R1XB 3OKNA 2FR4A 3G5ZA 4LDOB 3TBTA 4U6YA 4P46B 1ND0B 3SDXB 3WO3B 4YH6A 3BMVA 4PUBL 2ZCHH 5EO1A 3OJMB 4W6XB 4ONFL 3N0PB 4GKNA 4F7PB 1PBYA 4DOHE 3QNZB 1LP9A 3ALPA 4UINL 4AEIL 4UI2A 1XZ0B 5DC0A 2B8OT 2HMIC 1ZHKB 1S8DB 1D3CA 3B2VH 1TVDA 4Z5RA 2A83B 2HVKA 3ZSTA 2ATKB 1UVQA 1XCQB 3HZKB 1G7QA 1S3KH 3IF1B 4MD0B 4GXUN 4J7RA 2A9NL 4PP2B 2ZCHL 3A6BL 3T0DA 1A1OA 1K3ZA 2HRLA 5HI3D 2BOBA 3BUYA 5ALBH 4APQA 1T04A 2HT4C 2Y25A 3QUZB 2NX5A 1HEZB 1T20A 1KJ2A 4JRWA 3B2VL 2WMPA 1NL0H 1AI1H 4L4VD 4WFFE 5D71H 4YXKH 5GGSB 3PHSA 2CKBH 2XICA 1HXMA 3QHTC 5ESQB 5ACLA 3LKRA 3ARGA 4OAWA 3RDTD 3L1OL 5IEHB 3SDCA 3IAGC 1G6RH 3C8DA 3N85L 3AUVA 4P0DA 5C08B 2WBJC 5E2UL 4J4PC 1W0VB 3BZ4B 4HWNA 3QDGB 5JW4R 1D5ZA 4Y88A 5L0QC 3VG9B 3G6JF 4G6AC 1AI1L 1QBMH 1ZMYA 3FRPA 5DK0B 3O3EA 3PE9A 1SJHB 2QQQA 3MO1B 4TSBH 1M7IA 2BSTB 1NDMB 3OL2A 4XHJD 4OCWL 3F62A 4OD3H 2CXKA 4UTAH 4C4KT 1UZ8B 1K4DB 4PBWD 1YN7B 4RA3A 4Y1AD 1ZHBA 5E6IA 4P2RD 4RWHA 4PRAA 5EUOB 3L5JA 5CP7B 1YQ2A 1PJ9A 3QJFB 2CRZA 4HFUL 5CHNB 3TCLB 4FP8H 2JELH 4QRQB 5IESH 4LKCA 2QHLA 5L88L 3V5HA 2NY2B 3SQBA 1HH9B 1NCNA 2F54B 2Z8SA 5HXMA 1S9VB 4U7KA 3FONB 4MAYB 4TTGA 4UQ3A 3TF7C 2YPLE 3D2UD 2NPLX 4ODUA 5D6CB 1LD9B 3P9LB 5B39G 4OZGE 2F5AL 1HHGA 2VXVH 4NJAL 2XTJC 5FV2A 1M7DA 3S88H 3SCMC 1U8NB 1AXIB 3D39D 5JPNB 1MFCH 4LCCC 4ZOBA 4FN0A 3VXUE 4QRTA 1QRKA 4MVBD 4ZTPH 2AGJL 5DI8B 2W0FB 1PDKA 4NRYB 2YA1A 5IUSA 4EIZC 4P2OB 5IBTL 3D87B 3LD8C 1MRCH 5DQ9B 3VXRD 4HS3B 5E6YA 4XMPL 2IBGA 4RX4A 1R5VA 4Y4KB 1QBAA 4BQ6A 3BEVB 2Q8BL 5ITBL 4H0IA 1R6VA 5ISZA 4PRBB 3NVQA 3Q6FB 4NN7B 4GUPB 5D1QA 1NSNL 5DRNB 4U31A 4HGWB 1QHPA 4P5TB 1U95A 1PEWA 2YR3A 4OCYH 4Y4FC 1YNKL 4FHBD 4ODTL 1FV1B 1M05A 3D9AH 2YWYA 4XNMA 4ELME 1IARB 2C9AA 3ARED 4JFHE 1P7QB 4XBPB 2EDTA 4HKXA 3RVXC 1FNLA 5C0FA 4DGVH 4Z7VB 5GZNC 4JO3L 1BVKB 3B2UC 5DK2B 3GI9L 2LE9A 3UMTA 5ID1A 3IETA 1JVKA 2CR3A 1U8QA 3GMRB 5LGHL 1LQVA 3QDAA 4ODWA 1ZT1B 4UB0L 1B4RA 1AJ7L 3BH9A 4OM0H 4PRNA 4UQ2B 4WDIB 4XVSH 4F7CB 1RZIB 1VERA 4JFDE 1DTUA 2EEBA 2W65A 4CU6A 1WUNT 3KPQA 3VDCA 1NGXB 3O8XC 4GO6B 2NNAB 4LRIC 1GPOL 4F7EB 7CGTA 2OCFD 1T4KA 2Z8VC 3LPFA 1AP2B 2L7UA 1J10A 3C08H 3OPZH 4BH8A 4Y0GA 6CGTA 4Y19E 3G08A 4LOUD 1KTLB 2R4SL 4D2NA 1DVFC 2FX8H 4R7DB 3K80A 1N5AA 4MNGA 1ED3B 4HJJL 1FNEA 5HY9A 2Y07H 4ERSL 4PJBB 4LCUA 1DUZB 3MGTB 4XPHH 3SQOH 5GGTA 4DUWA 2X89D 1I9RH 3C08L 4ZS7H 4H5SB 3LZFH 4ISVB 2Y06L 1NKRA 5B8CC 1ZOXA 1R5WA 1FORH 2VLJD 1EVUA 1SQ2N 4Z95H 2IAND 1Q0XL 4WW2A 5CUSH 5C3LD 4G9FB 3QUYB 4HLZG 4R3SB 3G9AB 4IHOB 3DURA 1G7PA 3EOTL 4QTHA 3HI1B 4Y2DC 4V3DB 1MLBA 4E41E 2EIEA 2H32H 4A6YA 2X4SB 2X4RA 3L3HA 1X5XA 2FB4L 1CICB 4FABH 3TO4D 3TJHC 2QADD 3EGSA 1J5OH 3WKNA 3LZFL 1KTDB 4PJAF 3VFVA 1FORL 1MJ8L 3P30H 4Z95L 5C86A 4Z7OE 4KI5C 4NO0A 3CFEA 1LMKA 3TFKC 5GGVL 1CBVL 3CPLA 5GSVA 3OB0H 5BS0E 4NCC2 3UPRA 3UTTE 2J8UE 3PABB 2IBZX 1AQDB 1W72L 4J3TA 2XQYK 4LFHG 5CGTA 4F3FA 3O81A 4M7LT 4MXQC 5IVZB 2AXGA 3SE9H 1LO2L 2I9LA 1ULVA 1SY6H 3ARYA 3U4BL 4C55A 1U8JA 2XQBH 1JCKA 5IEKA 1CK0H 3O2DA 3PXJA 2VZ3A 1W2KT 2YD1A 3X12B 1L4IA 2EYTA 3EYSH 3QQ9C 1IT9L 4RZCB 4ZPTB 1IC5H 2HVJB 1QUNA 3S35H 5C0BA 2CK2A 1UWGH 4F9LC 1SY6L 3U7AA 5JZ7C 5DJ2A 1S7VA 1SJVA 4POZD 5F9AC 3GBNL 1DANT 2NTFA 4WHDA 1H5BB 2ID5A 2ITCA 2XWTA 2BNQB 4FXGA 1P5UA 4PS4H 3QBTB 5C0RH 4DN4L 2ZUVA 4NCC1 5E2WL 4OD2A 2XFXB 4TUOA 1JWUB 4DGIH 1HINL 1A6UL 4MQSB 4TUJB 1A5FH 2DQEH 1JFQL 4J8RA 5IKCB 5IBLD 1E4XH 3L5HA 1U91B 4QY8B 1PLGH 2CLVB 2ADIA 3U9PH 2VIRA 1QSED 4V3EB 1ZHLB 3TIEA 5C0RL 2VUOA 5I66B 1K2DB 1DLHA 4H8WC 5ETUB 3QB7C 5BV7H 3VH8A 3SE4C 3TT1L 4RRPG 4HT1H 4EI6B 4IJ3B 1VGEH 4NJ9H 3UTOA 2MQ3A 3EOYG 1OP5H 3GJFA 4DK3A 2HKFL 3IXTA 4G8EB 4RSVA 2DQEL 1JJUA 4E0RA 1D5IH 4GW5A 2ZOLB 3WFDH 3U0PB 5E2JA 3GO1L 3U9PL 4J1UB 3T0WA 2JLLA 3QDJE 4WUKH 5DMGD 4AMKH 3MRBB 2MHAA 2VE6A 5FUOH 3O41A 2PYED 3WD5H 5K59F 1K8IA 4GBXC 4F8TA 3VD5A 4JDTL 2XRAH 5E1AB 1J88A 1EHAA 4W6YB 3QUMB 1G7HA 1EIBA 4YBQC 1RUML 4PJAB 4G43B 4NO2B 3CLFL 3MCG1 3OKDB 5KW9L 1QLEH 4PGCA 1RUPL 1CCZA 5I1GH 1Q9WA 2AQ1A 2E7BA 5AUMB 3CFKA 3PWLB 2CDEA 4NM8H 3N1FC 4HWBA 5HYSA 5ERWB 3CH8A 3WD5L 4YPGB 4D0CA 3HS0A 4AQOA 4JRYD 2VDML 1JL8A 4M7JH 4WO4A 4JR9H 2H6PA 4UIKL 1H3WM 2D7OA 4JZJC 5FGRA 4IIQB 4JKWA 5IQ7L 4G59A 5L9DL 1KB5H 4HCRH 5J13B 1J8HB 5I1GL 1OY3B 4OTXL 5A3ID 5I8EB 3T0EC 2A6DA 2Z4QA 5IROA 2XN9D 2AK4B 3DRTA 5EPMA 4U3XA 2L7JA 1MJJA 1T89C 5I6XB 4FTVD 5CJXC 4PRIE 1UG9A 3MLSH 4M7JL 4JR9L 2CUIA 4A2MA 3MA7B 4X9FA 5T5NF 2J1KA 3OF6A 2E8YA 3GSXB 3LCYA 3IDMB 4UT9H 5GRUH 2MKLC 1JV5B 4L8CA 3RJDA 4N0CD 4U0RB 3E6FB 5CGMA 1UENA 5CWSB 2EO9A 4KKBD 3A6CL 3VDBA 4KC3B 3RL1B 1OAQH 5HD8C 1HQRA 4LSRL 5D7IF 2MPAH 3MLSL 2YBRB 1QQDA 1HZHL 2OR9H 1KEMH 5E94A 4U1GB 5D2NC 1V7MH 1MWAA 4LVOC 4JPIA 1X5GA 1UA6H 5DMYA 4ZFOA 4UT9L 2I07B 2AV7B 1XGTA 2A0LD 3P9MB 4R8WH 5I19L 5JQ6H 4LARH 3BKJH 5GHWL 1QFWI 1RI8A 3FFCA 4B0MM 1FVDA 3WXWH 2IADA 1C7TA 4JM2D 4OF3A 2F53D 3V6OC 1I3RB 5BO1H 3V9FA 2E27L 3OKMA 32C2B 4KVCH 1VPOL 1EO8L 3QZWB 4L29B 2OSLB 3TBVA 3UJTH 3BVNA 1Y6KR 4RDQG 4MNQD 5T3XE 2FIKB 1BBDL 1FZKB 1TPXC 4PJDF 1MQ8A 3WE6B 5L6YL 1RIUH 2JK5A 3GZKA 4LARL 4RGNE 4O2CB 4IRJA 1I4FB 5FECA 3PHQB 3WXWL 1C16A 1MCFA 4F37K 4ODHH 3D1MC 2C1OA 1SYVA 3IB4A 4KVCL 3V4PH 4RRPA 3OAZH 3QIWA 5DJAB 2YUVA 4XMLH 7FABH 4L3EE 5T1KB 1VFAA 4MDJA 1ROWA 3ULUF 4AEHH 2MCG1 2QR0A 5HHVL 4R4BB 3VCLA 3UTZA 3QDMA 4LGRB 4XBGB 5MEND 1YNTA 3T0XA 1NFDA 4BFBD 1FFOA 1IAKB 2MCPH 3F65A 5I15L 3WNKA 3MJ9H 4NOFA 4QGTA 1TMCB 4QWWC 2X4UB 5T3XH 2HLFC 4MD5A 1FCGA 5F1SA 4NC1C 1PQZB 4G6JH 4P2QB 1D5MB 3HRZB 4AEHL 1A6VH 1I1AD 2RIKA 3RX8A 3CSYB 3EFDL 5E5MA 5JW3H 4NUGH 1TQBC 4M4PA 4OLYL 2PYFB 5HYJA 2ZCLL 1RIVH 2MCPL 3QIBA 1SEBB 4KKCC 3VRIB 5JW5A 3MJ9L 2ITDA 1XGPB 3GUTA 2Z35B 1KACB 1KJMA 2HJKA 2NX5D 2GI7A 2M8XA 4XGZA 2DN7A 3T2OA 3O4OC 5F1NB 2RAMA 3ZE0F 3CIQA 5KZCD 1TDQA 2PCPB 2XG4A 1PKQB 1NUDA 1N0LA 4ENEC 4PGDB 3NIFF 2GYSA 1BVLA 3IAPA 2Z93A 4RNRA 5FGBC 5JW3L 4MMXC 3QJHB 4JRXA 3CMOL 5CSBA 3L3DB 1M71B 2B0SH 3JTTB 4IOFD 1EJOH 1AQKH 3EYQD 3MUGB 2B1AL 3GIZL 3SEPA 2XKNB 2I9TA 1U2CA 4JFOB 4KXZI 5HGBB 3C5JB 5HPMB 3MJGX 1RU9H 5D7JC 5CIPB 1QFHA 2HJLB 2B2XL 4Z7UB 2NW3B 4KK5C 2B0SL 4K7PX 1UM4L 4JY5H 1AQKL 4L1HA 1NC4A 5LCVH 1DN2A 1T0MB 3QRFM 3RWJB 4ZFZA 1QR1B 2PXYD 1B0GB 3PGDA 2G60L 4LLWB 3MFFA 4LHQB 3RZCD 2LTQC 4YBLC 2A2QT 5D7LE 1YEDB 1GAFH 2V2XA 3AM8C 4JPVH 4PJ8B 5EC1A 2IFFH 1RY7B 4TVPE 5INCA 1AD9A 1AC6A 5IG7A 5J6HA 5DDHA 3G5XB 1SVZA 3MCLH 1F4YL 5FUCE 1K6QH 3QEHB 4PJDB 5LCVL 5EFIA 3P0GB 1XH3B 4Z77B 5FIEA 3RX5A 4U6TA 2ATPA 4PJCA 5F9JA 1NC2B 3WJLA 4O4YL 3D25B 3G5YA 3D48R 3K2UH 2BNRE 4JPVL 4OBSA 3Q5OA 1HOCB 4PTUB 4MQXD 3BWUC 1FN4A 3IKCB 3WSQL 4UTBH 3MCLL 4XNQA 2YN3A 5DJYA 4LHUD 3U48A 4Y89A 3CH1B 4MCYB 5HVFB 1IQDB 3E3QE 1NGPH 1OLZA 2XTJB 2VZSA 3QULB 3DUSB 2ZWLT 3K2UL 3SCMB 3FQTA 1DBKH 1P6FA 3TBSA 4EVNB 3FB6B 4LCCB 3K81A 1RK1A 2QSTA 3X3GL 4KZEH 2ZSWB 3TN0D 1A7RH 2M1KA 1JZ6A 2X1QA 2AJZB 2FHFA 5ISZD 4L3AA 4S0SD 3S3SA 4LSSL 4KJPD 1MCLA 5CSGA 3O3BA 4K7FB 5KSBF 4P9HL 5FB8A 2VXQL 5HTSA 4QXGH 5D9SB 5GPRA 5ELIA 2BRRL 3VI4F 3H9SE 3S5LB 1FZOB 1KENH 4LF3A 3I50L 2R2HA 5TE6H 3HMXH 4KZEL 2DWDA 3KS0J 1A7RL 3GMOB 4FQXD 4EDWL 5KVDL 3HNSL 2GK0B 5ICXB 1CI5A 1F42A 3MRNB 5ID0B 4KHTL 1G7IB 4RBPH 3BN3B 2IEPA 5KSAD 3P4NB 3VDAA 2I27N 1E0OB 2R2EA 3WL9B 1UQSA 1ZT4A 3ARBB 5C0CB 3FB7B 3MV7E 5F9OH 2C7UA 3VXPA 2FGWH 3GMQA 3HAEB 3NAAH 3T77B 1VACA 1JZ7A 3TO2A 4Z7VE 1I8IB 3ZMRA 4R0LA 2LVCA 3C6SA 1EVTC 1YY9D 2CKBA 3QH3A 2VO5A 4PB0H 4M6OH 3EYVA 3K46A 3O8XB 1XFPA 1Z5LA 3VE0A 1ZA3A 1SJXA 3VRJA 4NNPH 3JUYA 1Z9MA 3PV7A 4HIXL 4M1GL 3TIDB 1I75A 1JYNA 4KKAD 5KVGH 4LLQA 4ZO9A 2J6EH 4QHUB 1FVEA 3B9KC 3HG1E 4WUUB 2VB5A 5E00B 3EO0A 4R4FH 4ELKA 3JSSA 3V4UL 3MRLB 4NFBA 4NWTL 2X4OA 3LH2H 2EDLA 4XX1E 1MEXH 4U1IB 2RHEA 1QVOA 4OFIA 3CCHB 3AROA 1DBML 4GMTH 4KH2A 2UZIH 2J6EL 3CSBA 5CBEA 3STZA 3MRMA 4PJBE 1XMWA 1U8IA 4JZNB 3IFLH 5LKNA 4YAQA 1NJ9B 3P0YH 4Y2DB 4E5XA 3CFCH 3LH2L 4EUPA 5DS8B 1BWMA 1RUQL 2EDKA 3MGAA 2X9WA 3ISWA 5AZ2H 3F8UB 4H25A 3U2SB 3KS0H 2G2RA 2HT2C 1VADB 5EU3A 4R96B 1EFXD 2XKSA 4X6EB 4HKZB 4X7TB 4NZTL 3AAZB 3IFLL 4M7LH 4S2SA 2BDNH 5DJXA 3EOBA 2ADGB 3M07A 1OF2B 3IFPA 3VXNB 3KXFD 3STLA 4MJ5A 3GI8L 1T2QH 1OSPH 5AZ2L 4YIQB 2P44B 4L8SA 2D03H 4PY7B 2X4PA 4XH2B 3ARGC 3BIKB 1RULL 2R9HD 2VDRL 3OX8A 3SDCC 1TJIH 4X5XB 2AJYL 4XP5L 4AIZA 3HB3C 4M7LL 1DQQB 3VFOA 1JPTH 1VSCA 4QHNB 4M1DL 2EDFA 2GTWB 3CX5J 2DM4A 2YPLA 3UCRA 2D9CA 3V5KA 3I02B 5F7FA 4AZ8A 1JK8A 4Y5XC 4OZGA 4MA7H 2GEEA 4HLJA 1T0NB 4LNRB 3OZ9H 2E7CA 3PWVB 3TBYA 1T1XA 3BZFB 3RY4A 3Q6GL 3RP1A 4HQQH 1EFQA 1T1YB 2VLLA 4CW1A 3VXUA 1CGSH 3FCTB 3SDAC 5JTWA 1WC7A 3MREB 1RURL 3KYNB 4Y1AB 1LE9B 4OZFA 4Q9RH 4P4KA 3SJVD 5KANI 4ODXA 2R0ZH 1RSFA 1JPSH 3OXSB 2BNQE 1IC7L 1FGNL 4HKJA 1RUAH 1SM3L 2DQHL 2PO6C 3OZ9L 3O6FB 4WWKB 1DUYA 3DV6A 3WN5A 3QXVA 5I1JL 4LVNC 2DQCL 4XVUC 5IFAH 4HUXB 2UWEE 3OKEB 3JTSA 2XZAL 2HRPH 3BKYL 4MNHA 3GMMA 2EYRB 3LN9A 2KQNA 4LIQE 3REVB 3CMGA 1N4XL 3BRGC 5IHLB 4UBDD 5FGCE 5ILTH 2OMBA 4ELMA 1FIGH 1UKSA 4G80A 3D85B 2ARJQ 1LK2B 5J12C 4PV9A 4K9EH 3V0VB 1J8KA 4DQOL 5IGXH 4WHTA 9CGTA 3IRPX 2O26U 4GBXB 3WFEH 1P6AB 4LKXA 4JREC 5DRZB 4JFDA 4CNIA 3FO1B 4S1RH 5ILTL 1MPAH 1S7TB 1FIGL 3C6LC 5CD3A 2COQA 25C8L 8FABA 4MWFB 2X10A 3CVHB 5GRJH 2ADFH 3VXTB 3DSNA 1OGAB 1ZXQA 4K9EL 4ZAKB 4HC1H 1JF6A 4HK0A 3OAZK 4LEXH 2H1PH 4JB9H 4WCYH 4Y19A 3OG6B 4LIQH 5I1HL 1K85A 3NCMA 1MHPL 3X17A 4WI7A 3MXVL 3WFEL 5C1MB 4E42A 4OCNC 3T1WA 3S35X 4JO4L 3KWWB 3C5ZA 5E4EC 2VQUA 3KR3H 1T83C 2NYYC 4WFGE 4BK5A 1JGDA 4JZJB 4Z7WF 3QXDB 3MMEB 1PVHA 4LFHD 4K8RL 1KB9J 1GHFH 4YDVA 4LDEB 3RGHA 2ED9A 1LHZA 2AK1H 5I74C 5T3ZE 1ZVHA 1T5XA 4QHLA 4WCYL 4KROD 5J56B 2WZPD 4J3SA 4MLSA 5D1XA 1JWSB 5HI5D 4FOMA 4MA3A 4XWOC 3UPAA 3H9HB 1J8HE 4OIBA 3HLAA 5JIHA 3ZHLA 1NMBL 4YE4H 4X7SL 5ITFA 2AJVL 4XVJH 3KGRA 2BVEA 3MRIA 4AM0A 4E41A 4GS7B 5C09D 2VL4A 5CJOH 2OTWB 5DJ6A 3ARDC 1AGFB 1UXWB 4U1HB 1KG0A 2EDQA 4KDTA 3GMLB 2W1NA 2H26A 4X0KA 3T3PF 3MPCA 1H3VA 4Q6YA 1KNOB 3ZLQC 4S1QH 1T80A 3LMJH 2NY3D 4U3HA 5D70L 2IMMA 5DTFA 4IS6B 3B9EA 2XPGA 3FFCD 1RZKC 5IT2H 3F6IA 4S0TD 1BGXL 5BS0A 3UTTA 3RTQB 4LVOB 1V3JA 3QUML 2J8UA 4G8FB 1IJ9A 4HXAH 3I2CH 1LEIB 4TPRH 1KGCD 3ROOA 4YX2H 3P73B 4MJ2A 1FNSH 3RRQA 1Q1JL 3O9WD 3TGXA 4NO5B 1INQB 1SYSB 1EX0A 3GSNB 4QF1A 4O58L 2OJZL 1A2YA 5HGAB 5EU4B 3FN0L 5DWUH 3D69B 1I7UB 1ZLSL 4XPGH 4IRJD 4NKOB 2X05A 1CLCA 3VGAC 4LU5H 2A6KB 1EGJL 2C3VB 4HXAL 3I2CL 3H42H 5SWSE 2XG5A 4XT1C 3SKNA 3DX6A 1TPXB 5CCKL 2H2SC 4ZXBC 4PJIF 1OAUH 4NRXA 5TDNB 4LASL 2IPKB 3SKMA 5ABDE 2GKIA 3TYFB 2YZ1A 1JF1A 1MH5B 5GJTL 2YRLA 3VXQB 3NFNA 4LLMA 5T1DH 3QWOB 3QDMD 4EN3B 3ZDYF 4GSDH 1KLGA 4BFIA 3BYTA 4BZ2L 4UUJA 1CFQB 5I1DA 4N0YH 1EEUA 1R3LB 2LU7A 3WLWD 3MLVH 3AVEA 4L8BA 5ENWA 1CZ8H 1RZGA 3DMMD 1P4LA 3MRDB 5JDSA 1GJIA 3BE1H 4GRLD 2SEBB 3F5WA 1ZTXL 2IPTH 2XY2A 3CUPB 3LN5B 3ZE2E 4GSDL 4ZYKB 2CJUL 2MQCA 3U0WH 4DVRH 4IRSA 5GS0D 1IGIL 4FFVD 5SWZB 5KS9F 1KN2H 1U8MB 4JFXB 5KSVA 4Y16C 1TQBB 5TFSL 3TPUB 1A9EA 1BZ9A 5C6PB 1H15A 4BH7A 4QRSA 2PN5A 1JHTB 1ZWIB 4KJWC 1T3FA 2IPTL 3LS5H 4QRPD 3KAAA 2E9BA 4NUJB 4NKDB 2OQJA 3QDJA 4HCRA 3HE7C 4QTIH 3IJHB 5DJCA 1KN2L 1Z9SA 3FTGB 2YK1L 1T1WB 3EBAA 3GGWB 1A7NH 4OZHF 1PKQE 3LS5L 1CG9A 1QFWL 2IAMC 2W60A 1D5BB 3C60A 5E8EA 1KIRA 3PIQA 1GOGA 4GG6B 4BYHA 2FECI 1AY1L 2NZIA 2FJFA 1N6QH 4JM2F 5I8KL 4RBPK 5D7JB 4WTXA 2ZSVA 4L4TE 4M43L 2GAZA 3GKZA 2VLKE 1TVBB 3CXDH 1NEZB 3OR6B 5DURB 1MRDH 1EZVX 2L4OA 4QRRE 1QSFD 3WHXB 2DBJA 4PJ7F 2ESVB 1YY8B 4Q2ZB 3MRJB 5BRZD 5INDB 1U8HB 3K8MA 1TXKA 3QDHA 2HJFB 2P45B 2X4NA 4ZUTA 2FEDD 2H9GA 2I5YH 3LQMA 3CFDB 1R5IB 4MSWA 1N3NA 3TZVC 3NCJL 4IBLT 4CJ0A 4PRIA 3KPNB 2WLYA 4PJIB 3DRQB 4UU9B 4KPHH 3KLHC 2HH0L 3RWFB 1VCAA 2NXYC 1AO7B 3X14A 3VFGL 4Z0BH 1U8LA 2H2PC 3MRQA 1KFAH 4MMZC 5D7KE 2OJEA 4WO4C 5H2BB 3RA7L 3H7BB 2I5YL 1LP9F 3RWHB 3MV8D 4J3WA 5CIPH 3AS2A 5E8DH 3X13A 3RWIB 5DYOA 5KAQF 2CD0A 3QEQD 2F19H 5TE7L 3M8OH 5JXEC 2R0LL 3FT4B 4PGEB 4DZBA 4ZUWB 1UH2A 3VFWB 2KQMA 2FJGA 4MGXA 4KV5E 4NQVA 5F96H 5GZOC 3TYGH 3K4DA 4KXZH 3TA3D 4XCCL 5FO9B 1PGRB 1P69B 5JOFA 1CTOA 5B4MC 1K5NB 3AXLA 4LAQH 1ZHNB 5KS9B 4G7VL 4V1DE 3EAKA 3BIBX 4L5FL 2F19L 4JGMA 2C1PB 3RY6C 1MHCA 3KDMA 4H1LB 5HHXL 1XGQB 5TQ2H 4KK9C 3MA9L 5DMJB 3U7YL 5F96L 4QXTA 3VD3A 1KEGH 4KHXL 3CGTA 3H3PL 5ECJE 3U4EB 4ZD3H 2O5YH 1GGTA 1OTUC 3HC4H 4FQ2L 1I3VA 3BP6B 1DCLA 1WTLA 2BSRA 3ULUH 4L3EA 1FAIL 5JW4Q 1CFNB 3QXAA 4OZHB 2DM2A 4FQHB 4JFZL 2FDBP 3VGEA 3FQUB 1KT2B 1XIWA 4NQSA 1DN0A 4PJHF 3BD4A 3U1SL 1G7MA 3JVGA 1E28A 3LAFA 1QNZH 3VXSE 2G9HB 2O5YL 4JM2B 3TNNB 1MRFH 1OAKH 4BSVA 5C0CE 3ULVC 2FSEA 3ULUL 4OFDA 1L0QA 4NYLB 4MNQB 5KVFH 5CD5C 5B3JE 1NAMB 3QUKB 4PJ7B 1ND0A 3KPTA 5KJRH 3OAYK 1NCBL 3QNZA 4WTZA 4YDJB 4RGOL 1KBGL 1CDCA 3PDOA 1OAKL 2BVPB 4XMKH 4XZUB 1F3JA 5HYIA 3G6AA 2JB5H 1GGUA 4N8VB 5EZJB 3BP7A 2WP3T 5F7HA 5DHYB 1RJYA 3OKNB 3ET9F 1QG3A 2FR4B 3G5ZB 1U2HA 15C8L 1HNGA 4CU7A 3TBTB 4U6YB 5KJRL 1RQ5A 2ORBH 1F4XH 4Y7MA 1ZLVH 1RZ8A 4H20H 5EO1B 1EO5A 3QUZA 3RDTC 3QI9A 4GKNB 4OGXH 5CJ8A 1GIGH 1LP9B 3HAEH 1T2JA 2JB5L 1L7IH 5FYJU 4Z5RB 2HVKB 4OQTA 1G7QB 3RGVC 1M4KA 3IVKA 1MFDL 5K93A 3ZTNL 2ORBL 1WFUA 4XB7A 3TCXA 3BZ4A 1A1OB 4M9PA 2AKRA 2CO6B 4GXVH 3BUYB 4JVUA 4APQB 3HZMA 1T04B 4K3EL 4PRHD 2NX5B 5AYQA 5GS2H 4F58L 1T20B 3QPQD 5D7LA 1KJ2B 4G8GE 4G6FB 2VZ1A 4KI5E 3MNZA 5KZCB 1MFEL 3WIIH 4JKKA 1HXMB 1BQHA 3LKRB 4Y2OA 1EMTH 1DLFH 3ARGB 5I1AA 5JMRA 4OAWB 2DI7A 3RY5A 3SDCB 5EG6C 1OTTD 1CGWA 2YPLD 3R8QA 1UZ6E 5CP3H 5TH2B 2BNRA 1HYSC 4XPBL 5C6TH 3O3EB 1R24B 2GSIA 3HMXA 1T03H 5JW4M 1V7NH 5EBWA 1NCDL 1EMTL 1VEOA 43CAB 1FCCA 1BQLH 4Y5XB 3VXUD 3O6LH 4MAYA 5TF1L 2XOTA 3CLEH 1UXSA 3E3QA 1T21B 1MSPA 1NPUA 1ZHBB 4RMVA 5E6IB 2C4FT 4RGMC 3C87A 4PRAB 4F57H 2EC8A 4LDLB 4QYOA 5C6TL 3IU4L 4Z7QE 1T03L 1MI5D 5FYKE 3WJLC 4KRPC 3I6KA 4LKCB 5LBSL 3V5HB 2IGFH 1DE4A 2UZYB 4P2OA 4WW2F 4OFPA 4UQ3B 3OHXA 3KLAB 2NR6D 4ODUB 2VISA 3THMH 1K9TA 1MNUL 4M6MH 1X4XA 4HEPG 3H9SA 1JGVH 1HHGB 1P7KA 4JFHD 4JQVA 1Q0YL 1M7DB 2YPVH 1WBXA 4KVNH 5CJBA 4FFZL 4CBPA 3RWGB 4F2MB 2FD6H 3CFBA 4P5TA 1MAMH 2GTZA 1M1SA 3KPRE 3T0BA 1IGML 3BDYH 4P23A 5DJDA 3GMPA 4MB5A 3AB0B 4F9PA 5F7EL 3MV7A 5FYKH 4RMQA 1R5VB 3MBEA 2VWEE 2NZ9D 1JHLL 3QIUC 4Z7VA 4ONHA 3N9GL 5ISZB 2YXFA 3ARPA 2AVGA 3LRHA 1MCWW 2A73A 2FD6L 3NCYS 3MLZL 5D1QB 2CQVA 3C6LB 1MAML 3O4LE 1X4ZA 3CX2A 3ARFA 4XP4L 4Q97A 1U95B 1YEKH 4QOKE 4C56E 3MGOA 1M05B 3C5ZD 3T08A 4TQEL 1NGXA 4XNMB 1L0XA 3QCUL 2NNAA 4JCLA 5EULV 3HG1A 3MQIA 3EZ8A 4S0UC 3FO2A 2WWKT 4HKXB 1E4KA 5IB1A 4H8WH 4WW1A 5E4EB 1JHKL 5D1XD 1UM5H 1Y18A 1B2WL 1FE8L 5ID1B 5F88A 1U8QB 4ODWB 3BH9B 4PRNB 2DTMH 3U6RA 1JGLL 4R0LC 4YLQT 4M1CC 5I74B 2W9DL 4JG1L 2Z8RA 2W65B 4DWHA 3KPQB 1ADQA 4PJBA 1AE6H 4ESKA 4YHMH 2APVA 2HAZA 3WFCH 3T0EE 5EWIH 4OCLC 5HHME 5HYQB 1T4KB 1RJZA 1MAJA 1DJSA 4G3YL 4IDJH 5HHQA 3G08B 4F7MA 4TNVF 2DTML 3QUYA 3JWOC 4FQ1H 4D0DA 1LK3H 4OCMC 3IFNH 3CVHH 4FQCH 4PFEA 1MJUL 5BS0D 1N5AB 2MTPA 4HIEB 1FNEB 1D5XA 5IMOA 5HY9B 3KJ6L 3REWA 4LCUB 3QRGL 1RZ7L 1QBLH 4D8PA 1CIUA 2QQKH 1R5WB 2ARJA 5AYUL 5A2IH 3KPPA 4MD4A 5H94A 4FQ1L 4WW2B 3TVMD 5E08H 5D2NE 4L9LA 2GCYA 4HWUA 2QKIB 1G7PB 2YC1A 4QTHB 2UVFA 3LHPH 4X8JA 3MV9E 4LRNH 5CGYD 1AQDA 1HSAA 3GB7B 4L4JA 2O5ZL 1JNHA 1QFPA 1PZ5A 1DBJH 3EO9L 1LE5A 4ZUUA 4A6YB 3L3HB 5A2FA 1CLYL 1TJHH 4JM4L 2PKDA 3VGAB 3QA3B 1QBLL 2UVEA 3EGSB 1OLLA 3VFVB 2FX7L 1G9NL 5CEXA 3MRGA 1BOYA 4EI5A 1OWRM 3S6CA 1EJ6A 1KTKE 2X7LA 4QHMB 2W0PA 1D9KC 3INUH 5D8JH 1CL7L 3FZUC 2CH8A 1F11A 1KJ3H 2R29L 4NO0B 3CFEB 1N5YH 2QQLH 4D9RD 1U0QA 3ILQC 3TWCL 5GSVB 1WAAE 4LRNL 3UPRB 1N26A 5HHOE 1R3JA 2Q8AL 3MCKA 2IH3A 3I9GH 1MCDA 1A6ZA 4JQXC 1TJHL 4L8SC 5FDYA 4HIIA 1DBAL 4D94A 4F3FB 1FFQA 4XTRD 3Q1SH 1AH1A 2I9LB 1NAKL 3RKDD 4ZFGL 3W82A 5HDLA 1N5YL 2X41A 1U8JB 3H9ZA 4IRSD 3LEXA 2DMBA 1KELH 3NCBB 3QUXD 1LGVA 2ZUTA 2BNQA 5DVNA 4XPTH 4YEFA 4KZDL 5IEKB 5I8CA 1V05A 3I9GL 3HE6A 3RJQB 2YRPA 3GSNH 1GOHA 1QP1A 3QZWG 3T2NH 2EYTB 3L3IB 1WISA 1YN6A 3Q1SL 4L9DA 4N68A 2ZUWA 5EBLA 2VLRE 3L3OA 2DM3A 5DD3H 2OS7A 3WBDA 2UWEA 4LLDA 4FZ8L 5C0BB 3O0RH 4HC1A 5HVWA 3BRFA 5DJ2B 1NH6A 1S7VB 2DD8H 4BA8A 3PWUA 3B9DA 4KTDL 4PB9H 5DFVC 4YHLH 5SWZE 2NTFB 2V7NB 2AJSH 3RBGA 2ITCB 2XWTB 3PQYE 4FXGB 3FJTA 4YXLH 3GSNL 1U58A 4OD2B 1WITA 4P4KC 1P84J 5SV3A 4TUOB 3HE7B 2BY3A 4I13B 3RX7A 3TV3L 1XR8A 1RHHA 2XI9A 2CDFA 1L7TH 3O0RL 4LP4A 4J8RB 5E9DE 1BJ8A 4PB9L 3WN5C 4RAUA 2ADIB 2VIRB 4XI5D 5KOMC 3I75A 1CE1H 1NUGA 2AQ2A 3TIEB 5EOQH 2CMRL 4YXLL 1G9ML 1DLHB 3GBLA 4HJ0D 3RVWC 3VH8B 4OUUA 3BN9D 4G42A 2ZP0T 3LKOA 5ALCL 5IP4A 5JORA 3GJFB 5CEZE 3IXTB 4E0RB 4GW5B 4YFLI 1J12A 1UEMA 5CZVL 5F8RC 2J5LB 3E8UH 1CE1L 4TTDD 5GGRA 4G6KH 3MZGB 2VE6B 5KOVC 1RZJC 1KIUA 5A3IC 3O41B 1H3PH 1UJ3A 5M94B 1K8IB 5CBAA 3BISA 3QISA 4PRID 3FB8B 5IW3A 1A8JH 3QAZB 2EXWC 2GY7B 5BOPA 4IIQA 1J9CT 1G7HB 5DSCB 5E24E 1L8JA 1J8HA 2JCCE 3VMPA 1U3ZA 1C8PA 4NZUH 1VFUA 4PGCB 4X80L 4CMHB 1Q9WB 4G6KL 4JFFE 3CFKB 4N0CC 2CDEB 4TOYH 3TC9A 2G5RA 2NXYB 5HYSB 3RVUC 4KKBC 3HS0B 3MA7A 3SOBL 2VSCA 5CEZH 1FL6A 4WO4B 2XA3A 2H6PB 3OMZA 3U79A 4NNXA 1FVCA 1A14H 5CWSA 3EYUL 4PRPD 5F89B 3JWDC 5CILL 5MHSE 2YD6A 5FYJE 3WIHA 4WIQA 2A6DB 2Z4QB 3EO1A 3HPJB 4HPOH 5DJZA 5I2IA 2DQUH 1D6VH 1ZLVK 1JGUH 3CVIH 3DRTB 4PREA 3G5VA 1MJJB 1CDJA 3ZKXC 4OLZH 4KUCD 4MJIE 5T3XD 2IQ9H 1A9BA 2JIXD 1IKNA 2ZKHH 4OGAC 4PLKD 5D7SL 4NC0B 4L8CB 3V95A 4RGND 3RL2B 1ZSDA 1QD0A 2YEZA 5D2LF 1BD2D 1NFKA 3D18A 4KDTC 4KMLB 4HPOL 2DQUL 1Q94A 4DVBA 1JGUL 3O3UN 4GXUM 4HPYH 1BFSA 3HZVB 5SWSA 1DEEA 1HQRB 3G6JE 4L29A 1YEGH 3JV6A 3SDDC 2FECL 1FYTB 3GM8A 5E94B 2R0KH 3QFJE 2EC9T 4AK1A 4ZS6C 1RMFH 3NH7H 1C1EH 4JPIB 3NZ8A 4NQCE 4ZFOB 4YDLB 4NQEE 4U2ZA 1XIWD 1XGTB 3QHZH 1ES0B 1I4FA 4ZO6A 5FYJH 4YHOL 1AXTH 3WDIA 2VDLL 3NOIA 5E99H 1U8OA 3FFCB 2FYYA 1FVDB 3V52H 4HMDA 5BOZG 1XGRA 2IADB 2P8PA 3GEWB 4X6CE 3E2HC 2VR4A 3HFMH 1JRHI 2Z31D 5EORH 1EERB 2NY7H 3TBVB 1S78D 3BVNB 1OW0A 4QT5A 2PETA 4FRWA 3KPSE 4P46D 1HWGB 3VWKC 5E99L 2JK5B 1I1AC 2B1HL 3HZYA 1I8MA 5FECB 3UP1A 1NDGA 1RAMA 2C1OB 4G7YL 1SYVB 1IEBA 4LSVH 4RDQF 4QCIA 3S5LG 1CQYA 3QIWB 3O2VH 1VFAB 2Y1VA 4X4YA 4MDJB 2QR0B 1ACZA 4Q0XH 3VCLB 1NUFA 3QYCA 1DQJA 4XPAH 4KQ4H 3RQ3A 1W0WB 2XTLA 3QDMB 3UTZB 3VRIA 3LEYH 1YNTB 1LO4L 2NQCA 1NFDB 1FFOB 5FEBA 3U30C 2OX5A 3QUZD 2HTLC 3O11A 3RU8L 1TZGL 4AIOA 1MIMH 4LSDA 2PCPA 4FMKA 3DXAE 1PKQA 4MD5B 4NGHH 4M5ZL 4NKIL 4PGDA 1YMHA 4NM4H 4QEGA 5E5MB 4Y8DC 3J7HA 1IQWH 5C08D 5KBNC 3NBNA 5DRXA 5HYJB 3QIBB 1MQKL 5JW5B 2ITDB 3V4VH 1UJTA 4L4TA 1KJMB 2HJKB 1EEQA 2ZNXA 2VLKA 3GBMH 4XGZB 1OHQA 2WBJA 2XWJA 5D7LD 1NAMH 1I8LA 4MS8C 4NGHL 4QRRA 5C9JA 4HUMB 2R69L 4YDKL 1J1PL 1UWXH 5IHBA 5LXGH 2Z93B 4RNRB 1T22A 4S1SH 1IQWL 4JRXB 5FAAA 3VMOA 1LO0H 5M95B 1CFVH 1A4JA 4DUXA 3RWJA 2H45A 3W11C 2I9TB 1F90L 4OZIE 1YEJH 1TCRA 4Q74A 2E5EA 1ZVYA 2A38A 3Q48A 2BNRD 2NXZC 1HN1A 3K1DA 2IPUG 2MSPA 1WSST 4I5BA 4KK8D 3WDHA 1ACYH 2ZUSA 1OAYH 1LO0L 2F54D 1CFVL 4QXWA 4MAYD 1U8PA 4DGYL 1CR9L 1GH7A 1T5WA 4MQXC 1YMME 2GITA 5JHLH 1NC4B 4PJ5E 1A3QA 4ZFZB 4N1EA 2FO4A 5J7CC 5MERA 3MFFB 3VXME 4CJ1A 2Y36L 3TF7A 2F58H 2DJ4A 1IM9B 3ECBA 1INEL 4C59B 3IKCA 3NTCH 4XC3H 3TT3H 5ADPH 5INCB 4RGMB 4DZ8A 5IG7B 4MQTB 5J1AA 5J6HB 5C07E 1UWEL 4OJFL 2N56A 1A6AA 4P2OD 2R1YA 5EFIB 1YEHH 4LEOA 1LNUA 2W91A 1EAPA 4DKDC 2BFVH 3LPGA 2P1YA 1UKTA 4CN1A 3KHQA 2ATPB 4DAGL 2ZZUT 4EVNA 4PJCB 3FB6A 2XWBA 4KJPC 4KRPB 3G5YB 3H9SD 2J88L 2VDNH 1OPGH 4PRDB 4V1DA 1V3KA 2ZSWA 4Z0XB 1HKLL 2F58L 4WGVB 3G04A 3NTCL 4XC3L 3TT3L 3BT2H 3WKML 1FN4B 1RD6A 1T66D 4XNQB 5DJYB 5DMKA 3F7PC 4NQDE 3HNTH 4JVWA 4LCIL 1A7OL 1TZIB 1WFNA 4P5TD 5DHVH 1KJ2L 1YEHL 1AD0A 5F6HI 5TQ0H 5IR1A 1R3KB 5HPOA 4RA0C 1NBQA 1F2XK 2Y6SD 2UYLA 3TBSB 5KSAC 4JN2B 1MFBL 1P7QD 1RK1B 3HC3H 2DDQL 4Y4FA 5IMMA 3PGFH 3D0VA 1SBSL 2OI9A 3MRNA 4PDCE 1II4E 3HNTL 2E7LE 4WU7A 5TQ0L 3O3BB 3HNVH 3A0OA 5FB8B 3VXSA 3K8LA 4AG4L 3SN6N 5C0CA 5IHZA 3BP5A 3IRZA 5JLZA 4LF3B 1I3GH 1DQMH 2IF7A 2R2HB 3RI5F 3MLXH 2DWDB 1SEQH 1BIIA 3PGFL 1I8IA 3OKKA 2Q7YB 1R0AH 5LQBH 3ALWA 2DQTL 4J3OC 4N5UA 1JWMA 5FHAH 3QCVL 3QG7L 1U9KA 1B4JH 4YQXL 4M7KL 1PSKH 5I1CH 4LRIA 2NY4B 4OZGF 1MCOL 2R2EB 5KANG 4NHCL 1P4BH 3ZT7A 5L2KB 1UQSB 1ZT4B 1I3GL 2MJWA 4XXDA 5FCUH 1H3GA 1WIUA 2LU4A 3JVGC 3RHWF 2C7UB 5LQBL 1DVFA 3VXPB 3GMQB 2B20A 1X6NA 1VACB 1A6TB 3C09C 3TO2B 4LMQE 1BBJB 4R0LB 1B4JL 3C6SB 5ICZB 2CKBB 3KPOB 3QH3B 1BREA 1PSKL 3NGBC 1A7PL 1IAOA 2NY5C 4U1IA 4G9FD 3QUYD 12E8H 3BH8A 5D5MF 4DOHB 5I1KH 5K33A 3QFDA 4O02L 3VE0B 1ZA3B 3VRJB 3VD4A 2EE6A 5B8CA 1WIPA 4S1DD 5FA4B 3QEUA 4LLQB 4NSKA 2FJHA 4JZNA 5E70A 5J11C 1RIHL 4WY7L 1FVEB 1P53A 4P5KB 1A0QL 3EO0B 1NJ9A 2OL3L 1F00I 4Y2DA 5FA3B 1CDYA 3CAFA 3SE3C 2X4OB 4NZRL 3QP3A 5CJQH 3EDDA 5HDQH 1QVOB 4ELMF 2AEPH 4G8GA 1BZQK 4X7TA 5J89A 5K59E 3BW9A 3STZB 1KPRA 1OAXL 2MOVA 3AAZA 3B9VA 5CBEB 1VDGA 4FNLL 3MRMB 3TFKA 4I77H 1U8IB 2R9HC 3V5DA 2VN7A 3ELAT 4JGUA 4YAQB 4E5XB 5CJQL 3FQNA 4PD4J 4EUPB 4WI9A 4YIQA 4NNYA 5F6IB 5HI4D 5AG9A 4XH2A 1AHWC 1S7WA 4H25B 4MXQA 3MRHA 3ARSA 2G2RB 4RFOL 5EU3B 5EIIA 2FHBA 3T0AA 5TE4H 4WI2A 4ZNEE 4S2SB 5DJXB 1INDL 3EOBB 1RUKH 3IFPB 3STLB 3QXWA 4MJ5B 4ORGB 5DD1L 4W6WB 4XNXH 4WFEE 4L8SB 2X4PB 3ZE1E 3AU1A 3O45A 2BVOA 2XA8H 3OX8B 4G8IA 2BNQD 4LNRA 4F9LA 5I9QC 5GGTH 1RZKH 3DVGA 1MUJA 4AIZB 5TE4L 1FG2A 3KYMA 3PP4H 4F15C 1IKFH 1F6LL 3VFOB 2EKJA 3ZYIA 1MJ7H 3HCVA 2YPLB 3V5KB 2HFGH 4OSUH 2RFXA 2XA8L 1CS6A 1JK8B 4F80A 4OZGB 4A6YH 5CS7A 1N0XL 2MNUA 4M6NH 3I6GA 5D7IE 3BGMB 3BWAA 1IKFL 3TBYB 1T1XB 5DUPH 2VLLB 1MCKA 2BSSA 1KIPB 4CW1B 4EBQL 1G0DA 2DKMA 1WC7B 3C8KA 1N2RA 3R1GH 4OZFB 1S5IL 1YYLH 3KPRA 4P4KB 1CGVA 1Q72L 4A6YL 4ODXB 3VGDA 1GL4B 5DQDH 3WNPA 1LK2A 3DROA 4HKJB 4XAWL 4KRLB 4AT6A 1JYVA 1OP3K 1DUYB 1S9XA 3DV6B 1S9KC 5DUPL 5IW6A 3KPMA 3WN5B 3E1F1 1KF9B 1NMCC 2ZOKA 4OCSH 3O4LA 3R1GL 4HS8H 2VC2H 3JTSB 3NACL 3IDYC 5DRZA 4MNHB 1T7VA 1PY4A 3GMMB 4I2XE 4QOKA 4C56A 2V2WA 3O2DH 5DQDL 5ACZA 1CXLA 1CD8A 4WFGD 1HSBA 2WWMC 4ELMB 1CQKA 4G80B 5DEZA 1J0YA 2AJ3A 5DF0A 3LIZH 1GGYA 4XP1L 5EC2A 2V17L 4XCEA 4PV9B 1BX2A 3TH4T 4Z8FH 4WHTB 2A77L 1J8HD 3MBEC 1J0HA 2HTKC 3O2DL 1QO3A 4LKXB 4MJ6B 3MZTA 4JFDB 4CNIB 1LO3L 1TJGH 5J3HC 4JZJA 2AK4D 4XNYH 3OV6A 3MMEA 1KLUA 1AKJB 4GAJL 5CD3B 1I9IL 8FABB 3ARFC 1IAMA 4WV1A 3RVVC 3T0EA 5HHMA 1TTGA 1AGDA 4OLUH 1CGUA 3PV6A 2V7HA 4HK0B 1A6WL 4Y19B 2MQ0A 3CU1A 5CJXA 4UNUA 1A3RL 3A67L 1T7YA 4E42B 1E4KC 1AR2A 5C0NC 2P5WB 1BZ7A 3MODH 2QHRL 3LQAC 4FQLH 3ZDXE 3HI6L 3C5ZB 3O2WH 1N8ZA 1JGDB 1IRAY 3P4LA 1JYXA 3GJFH 3CDFA 3GMLA 4YDVB 1NEZG 5LVEA 1F45A 4K94C 3TBWA 1T5XB 3VI3E 4QHLB 5A16B 2QQNH 4M8QA 2DLIA 5D1XB 3O6ML 1EZVY 1MCJA 5F7DA 4MA3B 5FO8A 5I17A 2CIKA 3HLAB 3K3QA 5MEPA 5D2NA 4I18C 3ZKXB 4FQLL 4EDXB 4WHYH 5F71A 1H8OA 3O2WL 5ITFB 3MRIB 4AM0B 2GHWB 3LY6A 3MV9A 1KCUH 4E41B 1UH3A 1QFWM 5JIKA 5DT1H 4UV7L 4U7SA 5DJ6B 2FIRT 1KG0B 2H26B 5EU4A 1E4JA 3HRPA 5C0AE 1I7UA 1N7ML 4LQ1A 4PJFE 1UWXK 1QLRA 5GGQH 5DTFB 3VXOA 2CPCA 1WAAA 4HAGA 5BS0B 5HHOA 3UTTB 3S4SA 5D93C 5DJ8B 1I1YA 2J8UB 2Z91A 3ROOB 5FOJA 1FYTE 1XEDA 2A74A 3K0WA 5T1KD 1HILA 2VDQH 3MUZ1 3WLWC 3BOVA 2F8XC 1AGCA 3UDWA 5LAXA 5L2JA 1TCMA 3E2HB 4QF1B 3DMMC 1A2YB 4OKVB 4HWBL 4GRLC 3G6DH 4IRZH 1G1CA 1AIFA 1F58H 4DTGH 2IBBA 2NY6B 3S97C 4P48A 6FABL 1I9JL 5F7YC 1YYMH 3SKNB 2XZCL 3DX6B 4GAGH 1GC1L 4NRXB 4P2QD 1IBGH 3WO4C 2VLRA 3SKMB 1JF1B 4LSTH 2P8LA 4YXHL 2HMID 3NFNB 3QHFH 4LLMB 3S7GA 1MCHA 3G6DL 5JR1H 4P3WA 1KLGB 4JKMA 4BFIB 5SWZA 4KJYA 5I1DB 2ERJC 4OLWL 4C83A 4Y5YC 5BW7C 3PQYA 1YYML 5FDWB 2ZG3A 1X7QB 2DS4A 4L8BB 3W9EB 3JTCA 3F58L 5ENWB 1P4LB 5JDSB 5GISH 5I8OL 1YECH 2FCBA 2HT4D 3OJ2C 1IGFL 3F5WB 4MYWB 3WS3A 4EQ2A 4DKEH 1QBBA 3DV4A 1HDMA 3HE6C 5CZKA 5E9DA 4PJEE 5KSBE 4N5EA 4IRSB 2D7QA 5H37H 1T1WA 1J0IA 5T5FH 1MWAL 4XBEH 2X1WL 5KSVB 4ZFOL 4U1LA 4KUCF 1R3IH 2WBJD 4P4RA 1A9EB 2JJWA 1BZ9B 5GISL 1CT8A 2DLFH 1MCPL 4J4PD 1H15B 2QL1A 4BH7B 1D5BA 4QRSB 3OSKA 4G5ZH 1T3FB 4O5LH 3ULVH 2FLBT 1NBYA 2R23A 2Q20A 4GG6A 3ZT5A 4G6AD 3P9WB 2F8OA 5GGSY 2OQJB 3OB8A 3QDJB 1G0YR 1XF2A 5IW1A 5T5FL 2VXTH 5DJCB 2UZXB 1CGYA 4XBEL 4FA8A 1R3IL 4H88H 2MKWA 2DLFL 4I1NB 4FQJH 4PJ8D 4N8VG 1WBZA 4O5LL 1CG9B 3ULVL 2CR6A 3C60B 5E8EB 5LWYH 4U6HA 2JCCA 3P40A 5E7FA 1AFVL 1KIRB 3PIQB 3QPXH 4P2RE 3AM8A 5F7KC 1JRHL 1LEGA 5D7KD 2APWA 2FJFB 2NXZB 4KTEH 4JLRA 2C3XA 4OFVA 3V6ZA 4JFFA 1NC2D 2F5BH 2BXYA 35C8H 3FO0H 4PG2C 2RR3A 1UGNA 5C9KA 4OT1H 2GAZB 2EIZA 4JPKL 4HWZA 5HHPA 2VAAB 3MUJA 5LWYL 2BHUA 4BFEA 3ULUD 1XF5A 1JMZA 1UJ3C 5HHNA 3V7AE 4ZUTB 2CGRH 2XTJD 3NIDE 5I0DA 2EKSA 5JA8B 4XHQA 1O0VA 2F5BL 2H9GB 3IDJA 3RWHA 4Q6IC 4K3JH 1CDBA 3SCMD 1J18A 4W4NA 3MRKA 3SO3B 1QFUH 4N1CA 1N3NB 2WNGA 1A1MA 4YHNA 2QV2A 4PRIB 2YD5A 1FLTX 4JO1L 2C4FU 3BKMH 4HW6A 3D39E 4MJIA 1J87A 3FT4A 4M8VA 2P4AB 5GS0L 5E2TH 2VKWA 1KXQE 4DK6A 5C0EA 3X14B 4F33A 4ONGL 1U8LB 5F6HJ 1H3UA 1LO5A 5DD5H 3V8OA 3LEVL 2CGRL 3MRQB 4TUKH 3O6KL 2OJEB 3VXRE 1WEJH 4EEEA 5BVPL 4N0UE 3TJEL 1ZHNA 3G6JA 4M62H 2WQRA 5ANMB 1QYGH 3IFOB 4LSUH 2FL5B 1HNFA 3QSKB 1OQOA 4G6MH 5DYOB 3BHBA 3BKML 3FRPG 1TNNA 1GGBL 3QFJA 3RAJL 5I73C 4NQCA 2DQJL 4OCXH 3DHMA 1LDPL 4NQEA 3MOQA 5DD5L 3MOBL 4MHHG 2FJGB 3EDKA 5DD0L 3W39A 4NQVB 3RVXD 3VXSD 4X6CA 3FMGH 2WIMA 4M62L 1CXFA 5JOFB 4PTTA 3B2UD 5C0CD 3AXLB 4G6ML 3OG4B 5J57B 4R2GC 4DW2L 4FQHA 4FFYL 1MHCB 3KDMB 3KPSA 1I3UA 1BJMA 1BVZA 3O8XD 4QXTB 3IS0X 4EKXA 1IM3B 3FRUB 5CZXC 3ROLA 4KAQH 5DUMH 2VZTA 5FO7B 4K7PH 1GGIH 3W2DH 1HH6A 3EYOA 1KN4H 5KVEL 4JAMA 4Y4HA 4WUUD 4JHBA 5GS2D 4L3EB 4XC1H 1JNLL 1B9ZA 2OP4H 4WEBH 4U1MA 3QEGL 1F3RB 4NQSB 5DJ0B 4JJ5A 1DN0B 3HA0A 4YK4C 5C8JA 2VDOL 1G7MB 5F9WB 3B9KA 4X6DB 1E28B 3BAEH 4DJMA 4YHZH 3IXAA 4KAQL 5DUML 5C0DA 3HUJB 5L2KE 4X83A 3C09B 4DKFL 4K2UL 2P7TB 1I7TA 4K7PL 4NN6C 4M61A 3JV5A 3BQUC 3DXAA 2FSEB 1U8KA 2P8MA 3NGBB 4XP6H 4XC1L 2DIBA 3CFJA 3UYOD 2ZUQC 2OP4L 4Y2DD 1SBBA 2VLJE 3FFDA 3E0GA 3MTRA 3MLYH 2IANE 5J1SC 4YHZL 3BGFC 3LN4A 3KVQA 1IC1A 1UACH 2I25N 4ZTOL 3TJHD 3ME0A 3PDOB 3VD7A 3GMNA 4UAOC 1O7SA 1F3JB 1HHJB 4QXUL 3G6AB 4EQ3A 1BPVA 3BP7B 3PWPB 4UNTA 3TFKD 2EE2A 4OV6F 1RJYB 2DQGH 3MLYL 3T65A 2P48B 4XCNA 4ODVH 3VFPA 2DWEA 4AEEA 3ARZA 3D3VE 4PD4K 1PG7X 1UACL 3K7UA 1RZ8B 3B83A 3WDJA 2AI0H 3QI9B 4OZIA 3EW3B 1HIMH 2VXUH 1OTTC 2AEIT 1RK0A 4GLRI 4HIJA 1NCAH 1S3KL 4Z7VF 2FBOJ 2GT9A 4YFEA 5JNYA 3M45A 3UX9B 4HAFA 3IVKB 4HX1A 4M03A 1FZJA 1I8LC 5ALBL 3PG2A 3CD4A 1YMMA 2GUOA 4PJ5A 2AKRB 1CU4H 2K7PA 4KGLA 4U3CA 5DHVA 3QQ9D 1S7SA 3HZMB 4R7NA 3EJZC 2VXUL 5TH2A 3VXMA 1NL0L 3KJ4B 1MY7A 4MXVE 5D7LB 3JWOH 5DGRA 5D71L 1NCAL 3DETC 4YXKL 1R24A 5JZ7D 2CKBL 3MACH 3BESR 3MNZB 3QCTH 43CAA 2IALB 4Y5XA 5FYKD 1G6RL 1BQHB 1DFBH 2VOTA 5HGGS 5C07A 5I1AB 1WT5C 1T21A 4HK3J 2VRAA 3GSVA 5MEQA 1G84A 4RFEA 4TNVK 3BPOC 3QXUA 4ODSH 2GIYA 4LLUA 4UT6H 1QBML 5E6ZA 1K4CA 4PJBF 3SDAA 3WV0A 4HUVA 3CC5A 2QSCH 3O6FD 4TSBL 3MACL 2BNRB 3QCTL 4OD3L 4WWKD 3DPBA 2GSIB 4UTAL 4EUPH 4M6AA 2DJUA 4Z7NE 5EBWB 4XXCC 3BRDA 4U6XB 3PWNA 4NQDA 1NCCH 2GJ6E 2PO6A 5E0QA 3VRLE 3T3PE 1JBJA 5HJ3A 1P4IH 3B9AA 1UXSB 3KLAA 1QSEE 2JJTA 4ODSL 3NN8A 3T8XA 1T7WA 2X09A 3D85D 1M7XA 2X1PA 1EGJA 3MV11 4QYOB 5D72H 3S3PA 3SKJH 4FP8L 2JELL 5IESL 3BD3A 2A9MH 5BVJA 2X1OA 2XACC 3RWGA 3I6KB 2ARWA 4F2MA 1NCCL 2PW2A 4I0PA 2E7LA 1YEEH 1P4IL 3F12A 1DE4B 3MLPA 4O2FA 4GBXD 3EJYD 2V5SA 3OHXB 3ZYZA 4U49A 2VISB 1TZHA 4NPYA 2PYEE 3BPLC 3H9SB 2VXVL 2DIJA 4YBQD 3KYKH 2XV6B 3BPNC 5E8PA 2W59A 3HPLA 1TQCC 1P7KB 4N0FA 4OI9A 4KK6C 3S88L 5FYLE 4BKLA 2X9XA 1OGAD 2EH7H 1NBZA 1NGWA 1MFCL 4ZTPL 4ZAKD 1WBXB 1GCFA 3C6LA 4WENB 5DEGA 1Z3GH 4YC2C 3PHOA 3OJDA 2BVYA 3CFBB 5MEOA 3WFHA 1MRCL 2ENYA 1QR4A 5AD0A 2GTZB 4S11A 2ICCA 4L3CB 2OI9C 3S36X 4P23B 5DJDB 3GMPB 4JRYE 1X5FA 2BC4A 3MV7B 4TNWF 1NEUA 2EH7L 3MBEB 3T0ED 4ONHB 5LGKA 5GGRY 1T83A 4R4NC 4OZFH 1GZQA 3DARA 4GW1A 2A73B 4WVRA 3DYMA 2R39A 4OCYL 4PJGE 5DA0B 3ARFB 4W4OA 3D9AL 2A1WH 1DL7H 1QFOA 3MGOB 3TM6A 2VDKH 5FYLH 2D2OA 2BSED 3AMKA 4FTVE 2Q3ZA 5B38A 2VLMD 4LBEA 3HG1B 4D9QD 3QO0A 4DGVL 5AAWA 5HYQA 3VH8G 5B22A 2X44D 3FO2B 5IB1B 4B5EA 3VG0H 2UWEF 1P1ZA 3GIVA 4WW1B 5DHXB 2DF3A 5GGUA 1IFHH 1Y18B 4OM0L 4AL8H 5IV2A 1BMGA 3ARDA 5F88B 4XVSL 1CDIA 2P5WE 1DSFH 4DN3H 4JO2H 2Y9RT 4EZMA 3U6RB 2VDPH 1G7LA 3RTQD 1HHIA 3SO5A 4HIEA 4BSWA 3MV9D 4K23H 1T0PB 4HXBH 1ODAA 2X70A 4WHYG 4JFEE 3I6LD 1RZJH 3VG0L 3OPZL 5CGYC 3PUCA 5JDJA 4N9GA 5I18H 3F7YA 1IFHL 1P9MC 1RJZB 1GZPB 5HHQB 4X99A 4F7MB 2FX8L 2APTA 2FX9H 3DVIA 2QKIA 4D0DB 2F53E 3PP3H 4KY1H 2O5XH 3GB7A 3OBAA 3SDYH 3DO7A 2BNUA 2Y07L 3MJ7A 1B0WA 3R06A 5HYSG 4IMLA 4YGAB 4W70A 4Z18A 3T1FA 2Q87A 4D9LH 4XPHL 1D5XB 1OM3H 3SQOL 5IMOB 3REWB 1RZJL 3ES6B 4ZS7L 1I9RL 3QA3A 4ZNEA 3LV3A 1EHXA 3NCYP 4QHMA 4D8PB 1E27B 4LLVA 2ARJB 5CUSL 4EN3D 4ZXBA 3KPPB 4XTRC 1MVFA 4MD4B 5H94B 4JFYA 3ARTA 2EC9U 1PY9A 2V5TA 4L9LB 2GCYB 2YC1B 4KFZC 1CFBA 4R26H 3JWDH 4X8JB 1HSAB 4D9LL 2P43B 4HKBA 4FQIH 4FABL 2HT3C 1JNHB 4LPCA 4M4RA 1PZ5B 1LE5B 1J5OL 4ZUUB 1RZFH 3N50A 3V6BR 2UUDH 2UY6A 3P30L 5MENE 1EBAA 5CEXB 3MRGB 4EI5B 1G6VK 1G1YA 2X7LB 3MLTA 1F11B 2HLFD 3AMLA 2X4QA 3L3GA 3VFMA 1U3HA 4XCYA 5SWZD 3DX9A 3JWDL 1VHPA 1Z6JT 5D7IA 3PQYD 2RCSH 1R3JB 3MCKB 2IH3B 3L3IA 1VESA 2R2BA 5CINH 1A6ZB 4KKCD 1PW3A 2EDDA 4HIIB 3SE9L 3L3KA 1YQVH 1A22B 1I7ZA 2ERJB 2ZCKH 3RNKA 3V6FA 2DI8A 4Y16A 4FXLA 4QHKI 5FUZH 3RKPA 2XQBL 5E9DD 3L7EA 3ESUF 2R56H 5I71B 2V7NA 2EDNA 3LEXB 2LAAA 1MCQA 1XT5A 3NFSH 1CK0L 4PG9A 4PJ9C 3TLRA 4ENED 4MLIA 1Y0LA 5I8CB 1W8NA 3HE6B 3EYSL 4BM7A 3HE7A 5H37G 4HFWA 4U33A 1IC5L 1YN6B 5EBLB 3S35L 4C54A 3L3OB 1UWGL 2AEQH 5CEZD 2UWEB 4LLDB 2WW8A 5DLMH 3VMNA 4CRPA 4BZYA 1YZZA 2R56L 4I2XA 3IJYA 4BELD 2WLZA 4YHKH 2IAMA 3PWUB 5D7JD 3VGHA 2EDXA 2ZUUA 3HR5B 4PS4L 3WJJA 5FGCB 1JPST 1UM6H 4KK5D 4LSPH 3X3FH 2BVQA 4J3XA 3GNMH 2OK0H 1JN6A 1U58B 2W38A 5BQ7A 5DURD 4DGIL 3UTSB 4XP9H 2ESVD 1A5FL 1S9WA 2R15A 1XR8B 2DQDH 1RHHB 4PJHE 5DMIH 2CDFB 1E4XL 2VWEC 1KC5H 1PLGL 1C12A 1VEMA 2LAGB 4YHKL 4RAUB 3I75B 1OGTA 5BV7L 3GNML 2W07A 1JUFB 1ZLUH 3FB8A 4HT1L 2IG2H 1VGEL 4NJ9L 4OUUB 4J3VA 3VD9A 4G42B 1F4AA 1V3MA 4ZOAA 3LKOB 3DYPA 5DSCA 3ZE2F 1D5IL 5JORB 3GRWH 1AO7D 1YNLH 3WFDL 1TENA 3TZVA 4WUKL 4AMKL 4LHJB 4UILH 5IFJB 3EYFA 5FUOL 4JY6A 5GIRA 5GGRB 2DI9A 5GRXG 4YWGH 2XRAL 4ETQA 2E8ZA 2Z92A 5C2BH 1UJ3B 5CBAB 5F72S 2EDBA 4MJID 2Y72A 2K1MA 4UOW1 2WV3A 5DZOA 2HFFA 5BXFA 1QLEL 5F89A 4URTB 4WV1C 2G75B 3HPJA 3QXTA 4NM8L 4PLKC 2JKXA 2AABH 4R6UA 5JXEA 4OBRA 4OM1H 4EXPX 1MREH 4OIAA 2OZ4H 4P59H 2B7DT 1TIUA 3FHAA 3MRPA 4LPXA 1WZKA 1CN4A 5EBGA 3WLBA 4LCWE 1GVIA 5DK3A 5CJ5A 1FL6B 4CL7A 2M2DA 3OWEA 1KB5L 3GK8H 4HCRL 5C0AA 5IJKC 3FQRA 3RIFF 4NNXB 4PJFA 1G9EA 3RL2A 1FVCB 3HI5H 1X5YA 2DMCA 4O9HH 3CK0H 3RY6A 3HR6A 1MCEA 3V7AG 1I8KA 3HZVA 3EO1B 4P59L 5I2IB 4JHWH 5DJZB 5I73B 5DVKA 5ANME 1OCWH 4PREB 5EU7E 4OD1H 3G5VB 3QWQB 3T0VA 3WYRA 1FYTA 1TETH 2WK2A 4Z7UF 1ZT7B 4XNUH 5GRUL 5D6DC 1ES0A 1A9BB 3PL6C 5EO0B 2DBLH 3KPSD 4Y8AA 1MIEH 2BCKA 1CD9B 1ZSDB 2YEZB 2XKUA 3D18B 2R0WH 3LRSA 1OAQL 3GDBA 1Q94B 4DVBB 2MPAL 4UOJA 3MNWA 1DEEB 4M93C 4WFHD 5SWSB 1CE6A 2OR9L 1KEML 1V7ML 3JV6B 1NMAH 1UA6L 1X6LA 2WY3A 4BK4A 4R8WL 3NZ8B 5JQ6L 3NCFB 3BKJL 4GRWE 5EN2A 1U8OB 2R0WL 2FYYB 2ENSA 5BO1L 2DKSA 4AH2A 3UDWC 1XGRB 2P8PB 2XZQH 4XRCA 4YUEH 1NLDH 3UTQA 3B4NA 3WNNA 3MROA 3UJTL 3AFLA 4P99A 3T3ME 5IMLA 4QT5B 4LQFH 5J9PB 5KSUA 1RIUL 1W0WA 4PJEA 5KSBA 4OCRH 3K1KC 4NN6B 4X6DE 3BQUB 4ODHL 1I8MB 3HZYB 5AZEH 4GAFB 3HUJE 1C5DA 1NDGB 2ZUQB 4P2CG 5T1MA 5GRYA 3V4PL 4U1KA 1TVHB 5F8QC 1IEBB 4JY4A 4N9OB 4XMLL 4QCIB 3NA9H 7FABL 2F8VA 2R4RH 1XGYH 3BZDA 3GSQA 3CDCA 1F6AA 1LDSA 3NABH 3RDTA 4OF7A 3BGFB 4P9HC 3OXRA 5DD6A 4GRWH 4X4YB 4LPWA 4LVEA 5SV4A 1DQJB 2HT2D 1PFCA 3HC0B 3VFRA 5GS3A 4YHYC 4APQD 3FT3A 3RGVA 2C26A 3DECA 3O11B 2EIDA 1DEDA 5T3XL 5CFHA 4G6FD 2OTPA 1XGYL 4G6JL 4N5EC 1A3LH 3PWPE 1A6VL 1REIA 3RI5K 3WNLA 3LS4H 2ZJSH 2FBJH 1YMHB 3GHBH 3KXFE 4NUGL 2O93L 3ARGD 2YMXH 4O51A 3SDCD 2WAHA 1RIVL 4H0HB 5I1EH 4P2RA 3ZKQD 5DRXB 1CLOH 4KK8C 3HB3D 5JXAH 1YMMD 2NY2C 2AP2A 1FLRH 1AGBB 2NLJB 4L4TB 2NY5H 2VLKB 5EBMA 2WBJB 2XWJB 3UZQA 1MCSA 1UB6B 4QRRB 5B3JF 2FBJL 5C9JB 2ICWI 3RHWK 2YMXL 5DVLA 5L0QB 3QQ3A 2AJUH 1T22B 1EHLH 3D2UA 1EJOL 3MUHL 5K9OA 1IMHC 1P2CA 5IK3A 1A4JB 1EBPA 5GQBA 5E6ID 3VJ6A 1BF2A 4TSAH 1CYGA 3D0LA 5B21A 2FATH 1NUNB 1S9YA 1RU9L 1TCRB 1ZE3C 4OIIH 3SDAD 5BMFH 4WJ5B 1CFSA 1IM9A 3D39A 3RVTC 2ICWB 4YHIA 1ZGLM 3BPOB 2BY1A 2GJZA 4I5BB 4U1JA 1FL5A 1E6JH 4LPYA 4MVBA 2AJUL 5H35A 2NY0C 3ILPB 4U6VH 1X4YA 2DQIH 4JY5L 4Y4KC 5DVOA 4G9DB 1U8PB 4EUPG 3SJVE 1T5WB 1SMOA 2X40A 3VXRA 2GITB 3PDDA 4N0UA 1YC8A 2FO4B 2FATL 4WI5A 4PRDA 5MERB 1GAFL 3L6FA 4XVUD 4Z0XA 1NLBH 4OQTH 2IFFL 4N1HB 2WIIA 4MA8H 1IAIM 1A7QH 1MY5A 3ECBB 4EOWH 4KU1A 1M6OA 4HGMA 4DZ8B 1K6QL 5J1AB 1TZIA 2PR4H 4CDGC 4W68A 5TPWH 1R3KA 1A6AB 3L7FA 4MQ7A 5E2VH 2R1YB 4LEOB 1LNUB 4GLRH 1EAPB 4JZOA 2X2YA 1QA9A 3AREA 4H0GA 2XWBB 1NLBL 4JN2A 4ZODA 4OQTL 2LVEA 4KI5F 4TVPH 4RX4D 4V1DB 2EEAA 1VFBA 3BZEA 1N6VA 2VERN 3DGGA 1OARH 1JPGB 4EOWL 3LD8B 3G04B 4K71C 4UTBL 3DSFH 5C2UB 3WFZA 4DFIA 2WUCH 4PR5A 5D1QD 5D4QA 3C6LD 1JGEA 5DMKB 1NGPL 4AIXA 3BPNB 4MJ4A 5E2VL 4I4WA 4RMRA 1AD0B 3QIUA 2VL5A 4GRMA 2YD8A 4DEPC 5IR1B 3TH3T 3CU7A 1CD0A 5C0IB 1DBKL 1ZKAA 2I60H 3MLUH 2UYLB 3LB6C 4JANA 4YC2B 3OB0K 3SGKC 1OARL 2Q7YA 4JDVA 3F7QA 3CSPA 1XAUA 4Y4FB 2VH5H 1RVFH 5IMMB 2WUCL 3D0VB 1CF8H 2OI9B 5T1LA 2NYYD 4WU7B 3CZFA 4QXGL 3VXSB 4OZFG 5L2KA 2I60L 3ZTJH 2P5EE 1NBVH 3KLSA 5DZNA 1KENL 5EZLA 5TE6L 4RWYH 3HMXL 4TRPH 5IHZB 3BP5B 5JLZB 3W0WB 5J1TC 3MRCA 1X44A 2FZ3A 2X89A 1RVFL 1A6TA 1BIIB 3OGOE 3OKKB 3VA2C 1BBJA 5AAMA 2UV3A 1JWMB 2VLJA 5ICZA 3KPOA 5F1OB 3B8YA 2IANA 5I16A 1LEKA 1FZMB 5EZIH 1CICC 3VFNA 4MCZA 4Y4HC 2PTUA 2C3WA 4ACPA 2VNCA 3B8SA 4RWYL 5C09E 5FA4A 3K4ZA 5F9OL 4XXDB 4YHPA 2FGWL 4QNPF 3NAAL 3TO4A 4P5KA 4PJXB 1DVFB 5FA3A 2HA1A 5IVNA 4PB0L 4M6OL 1FFNB 4XCFH 4NP4H 1X5KA 1KSRA 3D3VA 4HUUA 5K9QG 3FQXA 5DA4A 1MCIA 1IAOB 4NNPL 3BH8B 2PNDA 1KCRH 3QG6A 5KVGL 3QFDB 2FLRT 1KGCE 3MOAH 3FKUS 5B8CB 1KXTB 1B0RA 3QEUB 4NSKB 2FJHB 1E6OH 4R4FL 4X5WA 2EDOA 2F74A 4N90E 1C7SA 4UMGA 3S37H 4I9WD 2EECA 2V9QA 3C2AH 1ETZB 3R8BB 5FKPA 1NANH 1OP5K 2H2SD 1MEXL 4NO0D 3DJ9A 5K9JH 3MJ8A 2W92A 4OF8A 3H0TB 3RWCA 5I30H 4M5YH 1KCRL 1DP0A 4GMTL 4AJ0A 1KUMA 2UZIL 3ZYOA 1FIEA 3GM0A 3I3EA 3MXWH 4K9EC 4XWGH 4G8GB 4HF5H 1D9KA 3BW9B 1KPRB 3LQAH 3P0VH 3NZHH 1H5BC 3QNXA 4HUWA 5EA0H 3P0YL 3V5DB 3CFCL 2DMKA 4ORGA 4K94H 1F4WH 3FQNB 2C5DC 5K9JL 4JQXA 4NNYB 3UYRH 2AS5M 1C08A 2JJSC 5I30L 4K8RC 1ADQH 1S7WB 3MRHB 4O2EA 3UBXA 5EIIB 4EJ1C 2BDNL 5EA0L 4F7TA 4CVXA