4PRDA

Crystal structure of a hla-b*35:08-hpvg-d5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 79
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prdA01
2Z31C 1CI5A 4WUUB 4QRUB 3MUGA 3JUYA 4O02L 1DBML 3GHEL 5J3HD 3LQMA 3PDDA 1DLFH 3FFCE 3MRMA 3D5OF 5I8KH 3BESR 3NFNB 2NY2B 5EZIH 4P3DB 3QHZL 5E6ZA 3STZB 1XAUA 5DK2B 1M71A 2DWEA 3H42H 3RU8L 3VXNB 1CFTA 1GH7A 2JK5A 1T3FA 2DMCA 2RCSL 2BVYA 5F9JA 2Z31B 4YE4L 2D0HA 2C9AA 2VLKB 2CDGA 3FRUB 4EI5B 5I1AA 1OGTB 5F3BA 3V8CA 1NGQL 5E7BA 4JO3L 4W6XB 4NPYA 2NYYC 1XR9A 3I50L 4NQCB 2R4SH 1ZA3B 3UJTH 3SKOA 2MQ0A 1SHMA 4AG4H 4U2ZA 3VGGA 4PLNC 3MV01 5LWYL 3N1PC 2H3NB 5TE7H 1A14L 4DOHB 2ICEA 4U1KA 4CNIA 4PR5A 4M9PA 1CBVL 1ZA3A 2EDKA 3Q6GH 5E03A 1XF2B 3NCJL 1EMTL 3T2NL 1QBML 3O9WB 1R3JA 2VL5A 5FO9B 2F5BL 4Q6IC 2WM0A 3OB8A 3L7EA 4QY8B 2HH0L 2GJ6E 3BIKB 1YY8B 1QACA 2R0LL 3U46A 4LPXA 3ARVA 1UC6A 1RZ7L 1E28B 4P9HH 4AMKH 1RJYB 4HS6A 5I30L 1IGCH 5EU6E 3O3AA 2W0FB 5DUML 4GXUN 2W65A 5EU5B 1K4CB 4XMLH 1ACZA 3R4DA 3VRJB 1CDCA 1RK1B 1LK2A 3MQIA 3VXSA 4Q74A 5DMYA 4U1IB 3L3HA 2FDBP 4P2QE 2ZUTA 3JV6B 2BXZA 3G5YB 3D48R 4CW1A 4EOWL 3E2HA 1MAMH 4L4JA 3NZ8B 3OKYA 1JRHH 5ANMB 2K9UA 1NCDL 1OY3B 5F9OH 2ZJSL 4FXGA 4JPWL 3GMQB 2DBJA 3GSNL 3EYFA 3RI5K 5AD0B 1HOCA 5FA3A 3TZVD 5D7JD 3CXDL 1Q0YH 3DXAD 3U2SB 2HJKA 3WHE1 1BQHB 2X4RB 4ZO6A 4Y1AD 4WW2F 1NGYA 4X9IA 4R97C 5ISZE 1HOCB 4I2XE 1NGZB 2ZUQB 4UV7H 3WS3A 4TULL 4P59L 1MJ8L 2EDDA 3GSOA 3RUGB 3OAZH 3BSZL 3U48A 1BZ9A 3MLWL 5I74B 4O58H 5F6IC 3WN5B 5L2KA 4V1DB 3QUMB 4L4TD 1FQ9C 5T3XD 3W5MA 3C9NA 3CLFL 4Y4HB 3CDGB 5EBMA 2DQUL 5CZVH 2PCPA 3QRGL 4G6KL 2CMRL 3DX9A 4ISVB 1NPUA 2NX5E 3GRWH 5K9OB 3ULVE 4IBLT 4MDJB 1M05B 3L9RB 5E2UL 1NC2A 1PKQB 3AS3A 4YHYB 4G6MH 2DQEL 4XP9L 2P8PA 3TO4C 4PYHA 4APQA 1VHPA 3RRQA 3MRLB 1JIBA 4MB5A 1R3IL 4YPGA 1CXHA 1XH3B 4O5LL 2VLRD 3QQ9C 4PY7B 2IQ9L 1JGDB 1FAKT 1N7MH 3LEYL 4OCXH 1Q72H 4QT5B 3WUWA 5J11C 5FCUH 1FORH 1IFHL 4K2UL 3T8XB 4ACPA 1JE6A 1Z3GH 4U05A 5IG7B 3B2UD 1PSKL 3ARRA 1CGWA 1UB6A 1V3MA 3EFDL 1JMZA 1R24B 3K2MC 5A40E 2KZWA 1LO5A 2EH8H 3CFBA 4LCYB 1CL7L 5A3IC 2F15A 5C9JB 2B0SL 2DQGH 2V9QA 4ZUUA 1OSZA 4PRPB 2UY6A 3TYGH 1HH6A 4CVXA 2C26A 2DIAA 1WK0A 1Z6JT 2ZPKL 3RAJH 5F7EL 3TA3A 3E3QC 2VZ1A 4NQTA 3DVGB 3G5ZB 1EEZB 4Z7VB 3U1SH 4PJCF 5DK2A 1F58L 1BEYH 3HB3C 2QKIA 3ETBF 1CCZA 3L5WA 3IRPX 5GSRA 2J8UA 1PKQA 4DFIA 2XTJE 2XZQH 1J8HA 4M62H 1SQ2N 3G6JB 3L1OL 1YEJL 3CX5J 4YGVB 1F4YH 3DUSB 5I19L 3FAXA 4UV4H 1W0VA 2JELH 1IL1B 1CE6A 4FZEL 2QADB 2A74B 1LQVA 2WIMA 5KBNC 1MCDA 3G6JE 3QNXB 3I6GB 3KPQA 4FQXB 5J1AB 4FRWA 5IP4A 1J8KA 1TCRA 3U0TB 1R6VA 4KVNL 4U3HA 2NLJB 2RIKA 3HNVH 3RTQD 2G5RA 3CK0L 4M9OA 4YC2C 1U8MA 4LU5H 1T0NB 3NIDE 3BP7A 4R3SA 4G59A 4KMTL 5F7KC 1CFNB 1LO0H 3BZEA 1I1FB 3HAEG 4PJAB 1R3IH 4JY4B 4PFEA 3C6SB 4G8GB 4LEOB 1SYSA 5DVOA 4R9HA 1K9TA 3FB7B 3TP4A 3QDJD 2VTFA 3UTQA 4AT6B 1INQA 1OPGH 3FAWA 1XZ0A 1XR8B 4DGVH 4PJBE 4HIXH 1BJ1H 1N59B 1Z0MA 5CHNA 3VXRB 3PF2A 5F93C 4XNZB 4YEFA 2V7HB 2FR4A 5HGHB 1UYWH 5B8CB 1YPZB 4FQLL 3WFBH 3U6RA 2A77L 2ED8A 4U6HB 3UDWC 5C08E 3DURB 1RI8A 2BZDA 2GK0A 4YHPA 5FF6A 1LK3L 2W07A 2ZCKL 3TCXA 1JK8B 4GG8B 1L7TH 1A3RH 5CIPB 3O6FC 3CFEB 1IAOB 3SY0A 5KSAD 4ZS7L 4D8PA 1ZK9A 5I1HH 4MQ7A 1UKTA 5ADPL 4IS6A 3HCVB 1G7JA 1A6TA 4NHUE 1FGVL 4OD1H 4NQXB 1R3JB 1BIHA 4LSQL 4J4PA 1X7QA 3O81A 3W9DA 5AEAA 2JELL 4DGIH 1CQYA 2DTML 1EXUB 3W5NA 2B2XH 1A0QH 4QKXB 2XA3A 5L2KB 1H8NA 3GIVA 1U8OA 3GBLA 4FFEX 2DYPD 1S7UB 2JK5B 4L29B 3ULUF 3ULUE 3Q1SH 1I3UA 1MJUH 3CFJB 12E8H 1HHHB 4QXWA 4TSAL 4U2YA 1ZT1A 2PNDA 4YHIB 3DUUB 4WU7B 1ZVHA 3U7WH 2ZSVB 5GRZA 3V0WH 3QG7H 1IKFH 5KSBE 3CFEA 1IBGH 4MXVE 3GK8L 3ZDXF 1IBGL 4MJIB 2IH1B 3V52H 5AZEH 3GSWB 5ALCL 3GMQA 3U7WL 5SWSA 4MHHG 3MV7D 4E41A 5HPMB 5E00B 1SMAA 1J87A 3FN3A 3PL6B 3HG1A 1KIQB 2P5WB 4FQ1H 1A7RH 3M8OH 3FRPG 5F88A 1XF4B 4KKNA 1G9MC 4UTBH 3SBWC 4K3EH 4KWUA 5GISH 1MY7A 4BH7A 4KJYA 1V8HA 1F6FB 1UCBL 2P45B 4JRYE 5C0BD 4BYHA 3TFKD 2NYYD 3C5JB 4GSDL 5B22A 1JF1B 4U1LA 1K3ZA 3VXMA 1ND0A 2DJUA 4NZDA 1W72B 3BN9C 1NFIA 3LQAC 3ULVC 1CU4L 5C0IA 1WWCA 3SE4A 3BRGC 1I1AC 1GJIA 3LRSB 4NQVB 2YD2A 4TUKH 1B0WA 2V5MA 3W0WB 2AKRA 4L4TB 1J0YA 4OZHB 1YEFL 3VCLA 1FO0H 2VRAA 3HS0A 4I77L 1QFOA 3EO9H 1KIRB 4EEEA 2YZ1A 1UEYA 4ZOEA 2A74A 5DMIH 3QA3A 2B1AH 1DANT 4JVWA 4GRMA 2K3TA 2XTJB 4GUPA 3EAKA 1A3LL 3BZFB 1YUHB 2FJGA 2PR4L 4KKCC 3MUJA 4LMQI 4OZ4A 1BQUA 3LMJH 4LLMB 4IIQA 4PRHB 1GGBL 4WWKC 2QL1A 3FN0H 5D93B 1M6OA 3TBSB 4S1DC 3QBTB 1I7UB 5BV7C 1P53A 4NNPH 5HYQA 2AJUL 3RDTB 1P7HL 3M45A 3FQWB 1JN6A 2BY0A 1ORSB 1N0XH 4CVXB 3DYPA 3RY4A 3ERYA 1L7IL 2IBGA 3MFFA 4MNGA 3BGMA 1OVZA 3DIFA 3D3VD 2P7TB 1RIHL 3LKPA 5CP3H 4X7EC 4HK3N 4JJ5B 1TLKA 3O8XA 5GRJL 5CEZL 3Q5YA 3QQ4B 1C5BH 4HGKC 2YC1A 3UTTA 2X9WA 4FQPA 1MIEH 4NC1C 5BW7A 3MRGA 4HIJA 1MUJB 3IJSA 4Z0BH 2X4OB 4RNRA 1YYLH 2AXFA 4G9DA 3FRPA 3IRZA 5H37H 1CGSL 1LEGA 5IFJA 1CXLA 3FO0L 5ESQA 3I2CH 1P69B 2V17L 5HDOA 3UX9B 4FQXA 5J1AA 3IXAA 2VDLH 3E2HC 5I8EB 1QRNE 1T2XA 2X4SA 4FQIH 5AYUH 1DLHA 4DUXA 2DKUA 3LQAH 4OLVL 4X0KA 4XC1L 3BXNA 1D5ZA 2FATL 4JQIH 1I7UA 1I3GH 4Z9KB 3BFOA 4HC1L 4ZS6C 1NBVL 3ZE1E 3V7AG 2BNRA 2ITDB 2VXTH 4M5YL 1TZIA 1P6AB 3LS4H 1P7QA 3QHTC 2YK1H 4OLXH 3RIAK 1FVEB 1KCRL 3MGTB 3SE4C 4ETYA 3GBNL 1AY1L 3MFFB 4FZ8L 3M17A 1KNOA 2H2PC 5IEKA 3UTQB 1I8MA 3OKNB 3G5VA 4NKQB 4WUKL 2DLGA 4G5ZL 3VI3E 5SX4I 3WBDA 1B0GA 2R2BB 2XT1B 1ZT4A 5D71L 5DYOB 1RJCA 5HHMB 4Y2DB 4AMKL 4HHAA 4ZFZA 5IGXH 1HHKB 4KMQA 4WWKA 4N0YH 4QRQA 1KACB 3MLTB 2DQFA 4LKCB 2AXHA 2PW1B 5DVNA 3NCEB 3LCYA 3UCRA 1XH3A 4WNQB 1U3HB 1JGLH 3AXLA 3TBYA 4G9FD 2OR8A 5CIPA 2H3NA 3O11B 1L0YA 4LCWB 5DJ2A 3DV4B 1KG0A 4Y4KC 2RGSA 3L3GB 3GJEA 4LCUA 4IDLA 4O4YH 1T03L 2JTDA 2GUOA 4X6BA 1NSNL 3V6FB 1BVLB 4GG6B 3L3DB 1IKNA 2BNRB 1SBSL 3MRBA 2W9EH 2YEZB 2Z92A 3LKSB 4IRSC 3ZDZF 3QQ3B 4FQQB 3ZE1F 3LEXA 2NZIA 3ULUC 2VQTA 1R3HB 1T6VN 4ZSOA 2AAVA 5DJCB 5I6XC 3UPAA 4PRIB 1I9RL 1R3KA 5INDA 1LO2L 2EH7L 4BH8A 3SO5A 5IT2L 5FDYA 3U0PB 1CXFA 1F3DH 5IJKA 4G80A 2MCPL 5F6IB 4FG6D 1GYAA 5BVJA 3PWLA 3CH1B 3DX8A 1NC4D 4PRIE 4EN3A 4R7NA 3C09B 3GMPA 1LWRA 5D1QC 1HSAB 2DWDB 1X4XA 2FSEA 2VAAA 2HRPL 1T0PB 2IG2L 4YK4B 3GMPB 5HVFB 1NLDL 3OJDA 5CJOH 1F5WA 2H8PB 2HKHL 2VITA 4WEBL 4WV1C 1A1NA 3TV3H 4JFZL 4XC3H 2YUVA 2VAAB 3WIIH 3GSWA 1RZ8B 1NMCC 5E5UB 1XF4A 3S36X 3W2DL 3WYRA 4B5EA 3PV6B 4WUUD 2CDEB 1JZ6A 4I9WD 2HFTA 5FHBH 5AWNH 5KVDL 5IVNA 1CGSH 3FHQA 3BEVB 3V0VB 3V4UL 5ICXB 4OAWA 3TBWA 1OF2A 4UV7L 5FHBL 5AWNL 4S2SB 1KIUA 4QHUA 1KSRA 2WK2A 4RBPK 3FB5A 3T65B 5E6IB 1ETZA 1B90A 1D5IH 4J6RH 2QJDA 5IEHA 3BWAA 2HFFA 4P23C 3CCHA 2YBRA 2GQHA 1AQDA 1Q38A 4YZFE 2M26A 2AJYL 3F5WA 1UXWA 3OGCA 2ARJQ 5EO0B 4PRPE 1JRHL 4WWKB 3QXVA 3HE6C 3VMOA 4X6CB 3SKOB 5FB8B 1T80A 5IWLC 2NMSA 4X5XA 2OI9B 4HH9A 3A6OA 3UTTE 1RZGA 1BQSA 3DGGB 3QWRA 4WEUD 4JM2F 5B39A 4LLUB 2MCPH 4X6CE 1N3NA 2GJ6A 3MCKB 1B4JL 4OBRA 3Q6FB 5H2BA 2BVQA 1T0MA 3NIFF 3W11D 1RZKL 2X05A 5DJAB 5EUOB 5KANI 4NQEE 4J1UA 5LBSL 1WWWX 4RBPH 3UBXA 3C5ZB 1P7QB 1NAMA 4PBVC 3WDHA 2G75A 2VLME 4P5TD 3WXWH 1KUMA 1F8TL 3ARGC 4Z77B 5CBAA 2AV7B 5EZLB 3U83A 2E3VA 1EO7A 3CDYA 4PJFF 3ISWA 5EU6D 2M8XA 4BM7A 2ADJB 3MLZL 2Y07H 4G43B 3TA3C 3D9AL 4Z0XA 3QI9B 4MA7H 1EFXB 3EDFA 4PBXA 1KTDA 4UDTA 1FCCA 4KROC 4P48A 2H6PB 2IPKA 4ZFZB 2IAMC 2I9TB 3FONA 4ZD3H 2GTZA 1T1XB 2OXGA 2BSSA 1EFXD 2A6KA 3EKCA 6FABH 1DE4B 1QD0A 3GNMH 4YQXH 2CJUH 1A22B 2X4OA 2GTZB 5GRYA 1QUNA 2DLFH 5D5MA 1FL5B 1TCRB 3VXUD 1NAKL 4H1LA 4BZ1H 2CIIB 3SDDC 1MWAH 3MODL 1XR9B 3PHOB 3OJMB 2QSQA 3C8DA 4OM0H 1KGCD 4KZEH 3H2WA 3K80A 3ULVH 1CL7I 4YNYB 3RL1B 2NX5D 4QXGH 2IQAA 4KUCF 1ZGLP 1RUAL 2DMKA 5FXCH 1KCVH 4FN0A 4FMKA 1LP9A 3GSNA 4X4XB 4XMKH 1TQBB 4JHAH 2HMIC 3F7QA 4BK5A 4QXUH 1T1YB 1YEKL 5TF1H 1TVBA 5C07B 1QEWB 3HE6D 1IC5H 4KV5E 4XNMA 4Z7UB 4DGYL 1FYTD 2YKLL 5JDJA 2VQ1A 5BXFA 2ATPA 1WFOA 5ADPH 5D2LE 2OTUB 4YXKH 1L0XA 3C60C 2FWOA 3RNKA 3DYMA 3VE0A 4NQCD 4WI2A 4G42B 2VWEC 4H26A 4M93B 3UBXI 5IMLA 4ORGB 2VDQL 3HUJF 1MOEA 1U3HC 3E6HB 1M1SA 1BQLH 1MCBA 1IGTB 2CK0L 2H8PA 3X3GL 2CDFA 3CLEL 1NANH 1YECL 3S6CA 3L95A 1B3JA 1DQLL 1K4DA 4YNYA 5HHOB 2HVJA 2PKDA 4GAGL 2IFFH 3UZQA 1D5XA 2FRGP 1A6TB 2E8YA 3C60B 3R1GL 5T5NG 1ZGLM 4E0RA 1A1MA 3RL2B 3TF7A 3UTOA 3K8LA 4MNGE 4NWTH 3QUZA 2RB8A 3NFPB 1EEQA 1FLRL 1SEQL 3QRFM 4YO0A 1QFWL 1OAUH 4F57L 4PJEB 2QR0A 4WHCA 3OF6A 3M17B 3PWPB 1A6AA 3TJHD 4JFYB 2QQQA 5JTWA 3MV9A 5DMGC 1AQKL 3A67H 1EJOH 5HYIA 3WFDL 4PJEE 1ACYH 5FGCB 1R5WA 4LHUB 3ZT7A 1BMGA 4KQ3H 5J6GA 2HWZH 4BSVA 4W4OA 5FO8B 4M1GL 5CILH 1CE6B 3OKEB 2GTWA 1OAXH 2B1AL 4KHTH 3VXME 1DBKL 5DMIL 2ZKHH 5GGRB 1K5NB 2G5BB 4MJIA 2VLMD 2WQ8A 4JLRB 4FZEH 3QCUH 1WC7B 2E7HA 4XNQA 1BQLL 4B41A 3G08B 2AJVL 4QHMB 2VAJA 5GGTH 1FHGA 1A1NB 1QBMH 3JWNC 4G9FE 4TSBH 3VFUB 2XG5A 3ZTNL 5HYSA 3G08A 4MA7L 5CGYC 1UT9A 3NH7H 3ZZ1A 4PJCE 1KFAL 4UILH 1MEXL 5C07D 2GHWB 2NY7H 4MNHA 4BFIA 2DDQH 4GO6B 4CNIB 3NN8A 5LKNA 4NRYB 3D2UA 4PJCB 4R2GC 1PLGL 2ARJB 1A6WH 1FVCA 3SE3A 4IJ3B 5JHLH 3C5SB 2FYYA 1UCBH 1U3HD 4N90E 1NCAL 3OX8A 1EO5A 5KG9B 5ITBL 1QSFB 1RUPH 1OTUC 2NY3C 4OZGA 2FEDD 1I85A 1MCSA 3VRJA 3FCTA 3AREA 3B5GA 4L8CB 1YC7A 1RFDH 1VPOH 4RGMC 1AGBB 5I15H 3SGEI 4OGXH 3KPSA 4D9RE 4HUWB 1U8IA 4O2FB 3AREB 4EQ3A 1DBMH 4ESKA 1DBKH 5ABDE 2HJLA 2EZ0C 4UINL 2NNAB 2A83B 1ADQL 1FFNA 3I85A 1BFSA 3OGCB 4GUPB 3U4AA 3IS0X 4F33B 3T3MF 1QPPA 3HR5A 5K9JH 2NY6D 4DFHA 1OAYH 3AMKA 1XF5B 5DD3H 4MJ4A 4O00A 3IETB 3F58L 1QFUH 4KI5F 3DSFH 3GMNB 4NJAH 4JFPA 1IGFH 3QZWA 2YPLD 4PS4H 3VDCA 1BJ1J 3IFOA 4NRXB 2VDPH 3P73B 3PE9A 1TQBC 3KNBA 5IGXL 1U93B 5FYKD 1M7IB 5E4EC 3WFEH 4Y5YC 4YR6B 3QAZB 1TNNA 3MV8D 3QI9A 1Q0XH 4TUJB 1G7QB 1UB5A 3WFHA 3FTGB 4KRPC 2ADJA 2H6PA 3C9NB 3CFIC 5HD8D 3S36L 1UJ3A 3UPRB 3GBNH 4PRAB 5D72H 1PQZB 1JNNH 1XGPB 5DDHA 1MFNA 2NXZD 3MBXL 5MEPA 2V9TA 1WBXA 2IAND 3WHE0 2IJ0C 4JAMB 4PJXA 3VW3L 1YEDB 4KJQC 3MLUL 3QXUA 4ALAH 2Z9TA 1T0MB 4H88L 3KYOA 1BF8A 1RZJL 1UCTA 3X12A 2MTPA 2DQDL 4Y5XC 4K71B 4DVBA 2X09A 5D70L 3ARFD 1VESA 3BAEL 3GSNH 4ODXA 3NFPA 3C6LD 4JZJA 3DJ9A 5CJXC 2VDLL 5D6CA 4JY5L 4GRLD 2LVEA 1SBBA 2EKSB 2F74A 3QDGA 3QEGH 3I6KA 2PW2B 4F7PA 2JF1A 1FDLH 4P2RE 2Z93B 1NBZA 4JZJB 1IKNC 2OMBA 2NR6D 4LCYA 5DRNB 3CSBA 4NQDB 2IPTL 3O41A 4O4YL 4GW4A 4GQ9H 1E4JA 2J6EA 4PRPA 4OLUH 2DBLL 3VFGL 4JB9L 3TN0B 1A3QA 2WBJA 2CH8A 1Q0XL 2NZ9D 4JRWA 1K4CA 3MNZB 5I30H 5ECJE 2BDNL 3ARWA 4B53A 4GAFB 4PJHB 3QIBB 1LO3H 5F71A 1PLGH 3E6HA 5E56A 2VDPL 2J8UB 4XZUB 5TE4H 1EO8H 2BDNH 2G60H 4LCIH 5T1DL 5C08B 3DYOA 4PJ7F 4K9EH 4QOKB 1F6LL 3RIFF 4WRLA 2FGWH 2VE6A 4X80H 3HAEA 4P4KD 4N0CA 4RAUA 3J7HA 2IAMD 3ES6B 3MGOA 4LIQL 2YN3A 4U1MA 5TE6L 5K9JL 1I9RH 4YHKL 5DS8B 4R4FH 1MI5A 3QWRD 5KS9B 4RFEB 5D2NE 1SEBA 1FZMB 3O45B 3B9KD 1FVCB 2YK1L 3N1MC 4PB9H 1D9KA 3B9VA 3CH8A 1J5OH 1E4KC 4YGAB 5KZCB 1YMHA 5IB2B 2V5YA 3HC4L 4V1DA 1MI5B 4Q97A 1AI1L 2KDGA 5IBUB 4JO4L 3CSYB 1ZHNA 3H42L 3RU8H 1YN7A 1YJDH 2BNQB 5I6XB 1FYTE 3T77A 3EJYC 4NZUH 3REVB 3S35X 5T3XH 2WP3T 3IYLW 4Q2ZB 1WIPA 1GC1H 4P5TC 2BRRH 2G60L 5JPNA 1CG9B 5F70A 3MX0A 5K9OA 3DNKA 3MLXH 4Q2ZA 1BOGA 1U3ZA 1BHGA 2Z8WC 4PJIB 3C2AH 4MDIB 5EO1A 4LSSH 5E2VL 1S9VA 1OCWH 3LZFL 1EGJA 4EUPA 3T0EA 2O93L 2K7QA 1H9VA 1MHEA 1JK8A 4D0CA 1Y0LA 4IRJB 5TDOB 3IDNA 3KYMA 1YUHA 2FJGB 4N0UB 2XIDA 4JPIB 1UZ6F 1FZMA 2F53A 5FIEA 2BFVL 4HXBH 4KK8D 3VXUA 3CLEH 1MPAL 3NA9L 2IPUK 5KW9H 1NH6A 4ODVL 4AEEA 5HYJD 4K94H 3QUXA 1JPGB 4L3EE 1Y6MR 1FH5H 1EXUA 2LU3A 4GRWE 2X10A 3WUWG 1RJYA 4NDMA 1DQJB 4ONFH 2R1XB 4X6FB 2FO1A 3CGTA 3LB6C 2HT4D 1KLGA 4HC1A 2LAGB 1P4IH 3MYJA 5F89B 4AENA 3GZKA 1OWRM 1EERB 3FT3B 4NQSA 2W92A 2AQ3A 3F5WB 5I1IH 3WJJA 1EFQA 1NCDH 4N1EA 2VXVL 4LSUH 5HXMA 1VA9A 4G3YL 4ZQKB 3BPCB 3O0RH 4OSUH 1QNZH 4F8TA 3K8KA 4XZUA 4R4BB 3AAZA 2EKJA 3KDMA 2X4UA 1A4JA 5ELIA 1H5BA 2Z91A 1R5VA 3T1FA 5ALBH 4G8GD 3PL6A 3MCLH 2VLJE 4HD9A 2C3VB 5EBLB 3EYSL 3BGAA 5DMKB 4GLRH 43C9B 5E00A 4JQXC 4XVTH 2FLRT 3TH3T 4PJXE 4U33A 5KTEH 4FFYH 3QFDA 2A6IB 2J1KA 5FUCC 4C83A 2VZUA 4ENED 4N5EA 2APFA 1N6QL 2E9BA 1SBSH 4POZD 1F42A 1NBZB 4JJHA 2UZIH 2AK4D 4K7PL 1OSPH 5DD5L 1OLLA 3TO4D 1IEBA 3VXRA 4J3VA 3BD5A 3KPNA 1HHHA 1XZ0B 2O61B 5E2TH 1GIGL 2R69H 3FHAA 4Z5RA 1YN7B 5IR1A 4QYOA 5IVOA 1RVFH 3IFLL 3JVGC 2VLKA 5JOFA 2I9TA 4PRAA 1LEKB 3DBXB 3QIUA 2FHBA 5DRWB 5FGSA 1DE4A 4RMUA 1WBXB 1XCQB 2YD6A 2AEPL 3S96A 2WP3O 3U7YL 3N85L 3SDYL 4CKVX 3T1FB 1LO0L 1ZWIA 1P1ZA 4MMZC 4KDWA 3KDMB 3IDXH 4OGYL 4IS6B 5DD6A 4QRPE 2UYLB 12E8L 4D9LH 4RFNB 4XAKD 3BWUC 3DVIA 2HKFL 1S9WA 4XCFL 3IKKA 5E2TL 3TZVB 1A7NL 2C3GA 4XXCA 3T09A 3WNKA 1ZA6B 1TNMA 4FFWC 4OZ4B 1O7VA 1LP9B 1E4XL 1OSZB 3EO0A 5FGRA 2DTMH 3D2UB 4MQXD 3IU4L 4IRJD 1IEHA 3OWEA 3PP4H 3O3AB 1CD9B 3L1OH 2BOBA 4LSQH 1RVFL 3IFLH 3MJ9H 4P9ML 1DBJH 1DQJA 2AJ3B 2AJZA 4F15B 2Z93A 3VXPA 3TN0A 1ONQA 2EIZA 4I3SH 4L8BA 5HI4C 4WHTA 4HJGA 3P9LB 2D7TL 2L4OA 2O5XH 4U1SB 2R0KH 2VUOA 1DQLH 1TVHB 4L4VE 4Y2DA 2I5YL 5GRVK 4X6CA 2AJVH 4U1SA 2DM3A 1J12A 5EIVA 4TVPL 1QBBA 5D2NC 1N0LA 2V2TA 5LCVH 2VDNH 1KB9J 2I9LB 4UDUB 3T0EB 5LBSH 1CL7H 1QP1A 5I1LB 1LHZA 2LV4A 5DJDB 1BBJB 2XKNA 1G7HA 5FKAA 3UDWA 1B4JH 5K9KA 1GPOL 2YPLB 4ZAKA 1RZKC 1JUFB 1SY6A 3GMMB 1DQML 2FHCA 3CFKA 4R96B 4KJYB 5F7HA 5HD8C 2HFEB 2GSGB 1WAAE 5D4QA 5DI8A 4OM1H 4JRXA 4D0DA 4ALAL 4UT6L 5DLML 2NY6C 2GJ6D 4LEOA 2VLLB 2OTWB 5D7JB 1YEIL 5F9WB 2RFXB 3DRQB 3STBA 1R0AH 3QDJE 3MV9B 3LD8B 4JFYA 1I8IB 4N5EC 2D7NA 1TJGH 4NUGH 1JHLL 2CUMA 1ED3A 2R29H 5ID0B 4F37K 4JPVL 5B38B 5IB2A 2R8SL 2HT3C 1ZHNB 2DM4A 3ZKMC 4LEXL 3QDAA 1U92B 3FO1B 5EU4B 2E6PA 3GSXB 4X99A 3L5XL 1UXWB 4XNQB 3PP3H 1CF8L 4HUMB 3ZT6A 3QIUC 1IGYA 1JP5A 5KS9E 3QO1B 1GRWA 2GAZA 2JJTC 3IS1X 3LKOB 5DK0B 2IALB 5EB9A 1W72L 2XI9A 1AR1C 1KGCE 5DMKA 1EDQA 1ZS8A 4JRYB 3P4OB 2VZSA 5D1ZA 5IVXB 4FP8H 3UBXG 4P2OA 2MQCA 3B2VL 2EDOA 4ZPVA 1ORQA 1ZVYA 2R39A 5GIRB 5T3ZH 1IMHC 2GUOB 3KPRD 2NCMA 2QSVA 3WKNA 1IRAY 1WISA 4XMPH 5IVXA 2UV3A 5HDBF 1A8JH 1ZAGA 3MGAA 3S34H 1NC4A 1RD6A 3LPGA 3PDOB 4K7FB 1TXKA 3TT1L 1QSFA 1OD9A 4L9DA 5J0BA 3VH8A 1AGFA 3QEQA 4YHNB 4YDKL 4HAFA 2N1KA 1SJXA 1ONQB 3DX6B 3L7FA 4FFZH 4ZXBD 5I8KL 4YBLB 3D69A 2DLFL 4U1HA 1NGPL 3LRSA 4NQVA 5HPOA 1NCAH 3CPLA 3OKKA 2B8OT 4EI5A 3FRUA 5B3JE 2YUWA 4XMPL 3T2OA 4U6VH 5HBBA 1ITCA 2NX5B 1BZ7A 4LARL 2X70A 4RMTA 1FL3B 4UILL 3GSUB 5FUCE 3MJ6A 5L7XH 3EIFA 4R3SB 1MHCA 3RWCA 2FEDC 3HAEH 3QCTH 1NFKA 5DZLA 4OIIH 2D4DA 1RULH 2QQNH 2Z92B 1HN1A 2Z4QB 1X3DA 5FUOL 4CU6A 1T4KA 1Q9LA 2MKWA 4RA0C 2R56H 4M1GH 4ZUSB 5GS2H 2C7UA 2DICA 5JNYA 3EJZC 3PXJA 5EU5A 3TBVA 4KKCD 2O61A 3H3PL 1AY1H 5KANG 3FONB 5GSRB 2OP4L 4L1DA 4N9GB 1IC4H 4YXHH 3K46A 2CUHA 4EXPX 3ZKQD 1FV1B 1NEZG 4BSJA 3QEGL 4OF8A 3NZ8A 3MRQA 1KF9B 4OZFG 4OZGF 3SDCD 4XP9H 4PJ9A 2OI9A 4IHOB 2OP4H 2FIKA 4WU5A 4DAGH 2EXYC 3I6GA 1TZGH 3S97C 5IW6B 3BGFC 1C08A 5EZOH 2O5YH 3G5XA 3BP4B 3QZWG 4KUZH 1KJMA 1VADA 4WW2B 4XBPB 4P46C 3NGBC 3QUKA 4J1UB 4HX1B 5MHSD 2W38A 4OGAC 1S9WB 1QKZL 2ZUWA 3CFCH 3NAAL 3GI9L 5E6YA 1JN6B 3FQWA 2LABA 5D7LE 1HWGB 3KS0H 4IMKC 2AW2A 2CKNA 4QHUB 3WNMA 5I73C 1IC7H 4PTTB 2DJSA 5GZOC 5J13C 1UKSA 5FK9B 1MVFA 3V5HA 3D3VE 4M1DL 5I16B 3H8NA 1ZHBB 3K8MA 3MLYH 4I4WA 1NJ9A 5JOEA 3MRJA 2D03L 3AC0A 4Z76B 4Z7WB 2MNUA 4XNUH 3DX9B 4ISVA 1AGDA 15C8L 3RKPA 4CJ1A 3KPLB 1BX2A 3AY4C 3O3BB 2QHRL 4G9DB 4Z7UF 4MJ6B 4M48H 1FV1A 1HSAA 1Z2KA 2DWDA 5FYLE 4X83A 3PNWA 5DFVC 1X5ZA 1FL5A 2GYSA 4IHOA 3MLSH 2XZCH 1OB1B 4K7PX 5EIQA 5BRZA 1LP9F 2DQJH 2A38A 1W2KT 5DC0A 5F7DB 4HUVB 4FZ8H 4U1MB 1CTOA 1O0VA 5GGVY 5ETUB 2NY4B 2ZCHL 5TDPB 1QLEH 3RDTA 2R2HA 2P48B 2R0LH 4TQEH 2PYEE 4LCCA 4PP2B 1BVLA 4GG6E 3VFTB 2BVPA 5TDPA 3QULB 5IBUG 3U82B 1UEMA 2Q6WA 1T03H 3LKSA 4WFED 2RR3A 1LE9A 4KTDL 1I9EA 2NY1C 5AG8A 2Q7NA 1I3RB 2YOCA 4PJIE 4K8RH 3MLUH 1K2DA 5F7LB 1J8HB 1EEYB 1GGIL 1KELH 3RGVA 1B6UA 1VENA 5CAYB 2DQFB 1NGQH 1ERNA 4MAYC 1S7RA 4Z78B 5IB3B 3ZLQC 1ZLWH 3DGGA 1CS6A 5T1LB 3SDAC 5FA3B 4HK3J 4Z7QF 5LQBL 2JCCF 2OX5A 3OG4B 3QDGE 2QTEA 3NA4A 4XVTL 3I3DA 1A6VH 4LPCA 1BREA 4NWUH 2Q86B 2FJHB 5JLZA 1MRCH 3MNVB 3DHJA 3PGFH 4KK5D 4CADA 4M1CC 4QXTA 2DI9A 4GG6F 5HVWA 3L6FA 5GRVL 1CWVA 1FJ1B 4PLKC 3VFWB 3AFLA 4GS7B 1GHFH 2F8OA 3QUXB 5EORL 1DR9A 3DOSA 5GGTA 1RUKH 3VFSB 1KN4L 5TJWK 5I17B 4QNPE 3H0TB 1NGXB 3V5DB 4OM1L 3JVGA 3MOBH 1CD1A 1E28A 1DQDL 5I17A 3SEPA 1VFOA 2R0WH 4ZOCA 3X13A 3LS5H 4LSRL 1F90L 2JJVA 3DO7A 5MERB 3GRWA 3KLHC 3JV4A 3S3JA 1U8HA 2Y36L 4RRPA 3LDBB 5IB5A 3TFKC 1G0YR 3JWOC 5F1IB 3HLAB 4M7LL 4MNQE 5CD3B 5IQ9A 4HUKB 1XIWC 2J6EL 2AEQL 4YK4C 2Y6SD 3PGFL 4YH6A 3AREC 3TWCL 1A2YA 1FNSH 1F4XL 1A6VL 5C0RL 4QO1A 5JHDD 8CGTA 4GW1B 3FO9A 1YYMH 3MOAH 5J12B 2EE9A 3V6ZA 2EYRB 1DBJL 2YXMA 4MNHB 1RZ7H 4P9HL 1CICA 4KJPC 1MRFH 1YNTB 3B83A 1JV5A 4YFEA 2V7NB 1JPFB 3A6BL 1IARB 4HH8A 1S8DB 1PDKA 4QCIA 1RU9L 1N2RA 4RIRA 3BP5A 2WZPD 4KJWC 4QRTB 5I1GL 2YD7A 3MRMB 3QJFB 1W8NA 4PJXF 2AV7A 5EZLA 3S5LA 1MAJA 4M8VA 1TETL 5D7LB 1H15B 3UJTL 5E99L 3BQUC 3CVHL 3QISA 1K8IB 3IDXL 1UJ3B 5EWIL 1TFHA 4PJDB 3UPRA 4JFEA 4JQXA 4GBXA 2VKXA 5A2IH 1HEZA 3VRLE 3DVNB 5EO9B 2IMNA 2PO6A 2IH1A 3KAAA 3QIBA 5DZNA 1S9XB 3U9PL 3AXLB 3PHQA 1MIML 4POZC 4YC2B 2YUXA 3RVVD 3ZE2F 2CLVA 3QHZH 4L3EA 4QRSB 3BI9X 3CK0H 1M7DB 4OZFB 4OGYH 4WU5B 5IVXF 4OCSL 3WFZA 3W82A 4GBXC 1MCNA 4ZPTB 3VWKB 2BHYA 1QRNA 1HXMA 5ERWB 5C92A 1UACL 3ZHKA 3BEWA 4JGMA 1EGJL 5I76A 2ILLA 1J1PL 5E9DA 4GKNB 3HMWL 2EIEA 3V5HB 1O7SA 3MGTA 2BRRL 1SJHA 1VFAB 3O6FD 3H3KA 1S7TB 3NTCH 5C0RH 3LKQB 5IEHB 2X7LA 3B3IA 3SDDD 1FL6A 2ZUXA 5JW4Q 4GBXB 4QRRD 4O2FA 5F9JB 1KJ2L 3GFUA 1E6OH 4KAQL 4MDJA 1CF8H 3KPTA 3HG1E 1ZTXL 3W9EB 1UB5B 3WFHB 3WXWL 5EBGA 2P46B 2WV3A 3CMOH 3KPMB 2CKBB 4HV8B 3TNNB 1OP3K 1F3JA 2ADIB 3EJZD 5H37G 1Q9WB 4P4RB 5M94B 5CSZB 2CDEA 4KRPD 1XIWA 2E7MA 3DGCR 3LS5L 5D96C 5E99H 2R8SH 2X70B 4L8DB 5EPMB 1UENA 2DS4A 3Q3GA 4X6CF 1JWMB 2EEDA 3MRPB 3ZL4H 2CD0A 1E4XI 4JFDD 5CLWA 1U2HA 2EYRA 1GGCL 1JWMA 4Z7VF 3MCG1 4HG4J 5F7MC 1NBQA 2VLLA 4LCWD 2VLKE 4G9FB 3TIDB 1B0RB 4YAQB 4NWTL 1ZE3C 1NJ9B 3SN6N 4KK9D 3V6BR 1WBYA 5E24E 5EIIB 1C5BL 2J5LC 4XPGL 2A0LD 5INDB 3VFRA 3PHSA 5T33L 3VE0B 3PWVB 4HQQH 3U9UA 5T5FH 3UYOD 4LQFL 2X89A 1TQCB 5IWLA 3JXAA 1KBGL 5ANMA 1S78C 3UC0H 1FZOB 3TPUE 5HYJB 3BOVA 1IGML 3AROA 1CFSA 4HLZG 3ALWA 3ALPA 4R4BA 4NBXB 3CNKA 3SJVA 3HE7B 3UMTA 4J12A 4XT1C 5C0BB 1CLOL 1GGYA 1UFUA 2NY5H 3DHMA 4ODBD 5E8PA 4C56B 1TZGL 3OGOE 1U58B 5KVEH 5FHAL 4I9WE 3RX5A 1ORQB 4QXTB 4JFPB 4XWOD 4FQHA 3U4EA 4JO4H 5KSAA 4ODTL 1S7WA 3S88L 3NOIA 5JLZB 1GL4B 2E6QA 1AKJB 1T22B 4QY8A 5GJSL 4RMQA 2CGRH 3RPIB 3BP6A 5KSUB 1GC1L 1QSEA 1CDYA 4HFWA 5DURB 1RFDL 4OLWL 4NRZB 5L0QB 2KUTA 1Z3GL 4M61B 2CSPA 4APQD 1XMWA 3O6MH 4ONGL 3WD5H 3ZT5A 4AIXA 3W39B 4KVNH 2XWJA 3G9AB 1HSBB 3MJ7B 3P9MA 5ID1B 5EU3A 2CUIA 4OT1H 2G5BA 1KEGL 4EDWL 2NXYD 5MP6H 1YEGH 1YNKL 2X40A 3BDBA 4NZRH 2Z31A 5D1QA 2AGJL 5HY9A 2F8XC 5DQ9B 4UT7H 1NDGB 3HRZA 1J1XH 2DLEA 4KFZC 1JUFA 5JUEL 1NKRA 1P1ZB 1KXVC 3P0VH 3V2AR 3U7AA 1FIGH 3HNSH 2EDRA 3GSUA 1BVKB 1VGKA 3M8OL 4HULB 1GZPB 4OZHF 5T1DH 3EYUH 3RNQA 4RRPG 3I50H 1X5IA 1ITBB 3MV9D 4YXLH 3ULSB 4LCCC 1CFBA 2OXHA 5HHNB 2J4WH 3MUGB 4HGMA 1FFPB 3VFNB 3C6SA 3GI8H 4WHYG 2AV1B 4K23L 4LEXH 3ULSA 3NIDF 5EUOE 1FC1A 3IT8D 5FM5O 4Y4FD 5IFHL 4UT9H 3VFGH 2BX5A 4M61A 1MVUA 3FQNA 3BDXA 4ERSL 5MENE 3U0PA 1VFBA 1U8QA 2FATH 3GSVA 4JQIL 5JA9A 4G42A 3DRTA 3S4SB 3T0ED 4NQDD 1EHAA 5FO8A 1QFPA 1KCRH 4U49A 4OFIA 5DHYB 1A1OA 3OB0K 4PLOB 2HT4C 5K9QI 1NC2B 5FKPB 4DUWA 1LVEA 2DB8A 3NABL 3SY0B 3MBEA 4YPGB 2NW3B 1INDH 1S9XA 1C1EH 4TRPH 5LG1A 3HZYA 1IAKB 1C08B 3INUL 2ENSA 1BFOA 2Y5TA 3BZFA 3MLRH 3ORJA 3R06A 5TDNB 3QUKB 1T83C 5TPWL 2VLRB 4HGWA 4H25A 3I84A 4W6WB 1A3RL 1FFRA 1U95A 5FGBA 1T2QH 1N0XL 3QJFA 3W81A 3LQZA 1YYLL 1W72A 5IK3A 2F74B 3GI9H 5F7YC 1CYGA 5HHME 2ZG3A 4OJFL 1KPRA 2AJ3A 2W60A 1MFCL 3EYVB 3RWFA 1EHNA 4LVHB 2HVKA 3ILQD 4PJAE 3KPPB 4UIMB 4WI5A 1DSFL 2YPKB 1VGEL 3MV8B 1DQDH 2R1WA 5EO9A 3TESA 1RIVL 5JOFB 2QLVB 2HMID 1FVDA 3LRHA 1U8PA 1T7XA 3P77B 3NZHH 1IEAB 4O2EA 2FD6L 4PJHE 4IDJL 4M5ZH 4PJIA 1AXTL 2WUBH 4XPBH 4Y4FB 1G9NC 4LDLB 1MHEB 2H1PL 3FN0L 5D1QB 43C9A 3MBEB 5K59E 4PUBL 1MRCL 5EZIL 3ULUD 2P44B 2P5WA 1NEUA 1WCBB 4Y4FC 5BS0B 5HHQB 5DK3A 5ETUA 2FX7H 3EOBA 5J4MA 4WFHD 5DUPH 3RL2A 4B7LA 4KI5C 1CZ8H 1NAMB 5CD5C 5IOPB 2VKWA 5GS1B 2CK2A 3IFOB 1OM3L 4MD4B 3EO9L 4P0DA 3VXSE 1BAFL 3DETD 1YEJH 5DJYB 4JFXB 4O2CB 4TSCH 4KGJA 1S5IH 5DHVB 3ZDYF 3GM8A 1MI5E 3CFJA 1W0YT 4IOSD 1WGOA 4L8BB 1DJSA 4QTHB 1LE5B 3RPKA 4K9EL 3DVGA 1J7VR 3MLZH 3OPZH 1TTGA 1HQ4B 3FT4B 3RJDA 3DO3A 5MHSE 1HE7A 3IDGB 2NNAA 1OGTA 5F3BB 1MQKL 3D87B 3J8F7 2XRAL 1HXYB 4XXDB 2J12B 3KHOA 5FV2A 5L9DH 4NNXA 3TO2A 4NQCA 3NFSL 1R5VB 4C54A 5C08A 3IJYA 4MXQD 1B2WH 3PWPE 3KJ6L 4M8QB 1RUMH 1E27B 3FMGL 4L3EB 4MJIE 4WDIA 5BMFL 5GZND 5FKAB 5CJ8A 2IQ9H 4JPIA 3H9SD 3U7YH 2FD6H 4M7LH 3U46B 4M5YH 3DXAB 1WT5A 1WBYB 3HE7D 4NRYA 4PJCA 4A2LA 4M43L 1XGRA 2H45A 5FYJU 5CMAA 2AJYH 1BZ9B 3ECBB 4NDMB 3FB7A 4W6YB 3K74B 3FB8A 1N59A 4R0LB 4H8WH 1ED3B 4I3RH 5ID0A 5I1HL 3UTTB 4P2OC 2H2SC 3BKMH 5BV7B 2WBWB 2MHAB 4G6AD 4A6YB 2D31B 1AXSB 2YA2A 4M1CD 5IROC 1JNNL 4NSKB 4GRWH 1N5YL 1J05B 3HZKB 4FQCL 5DQ9A 5LJYH 3BMWA 4R7DA 5FA4B 4JFEE 1WITA 4PGDB 5CEZH 3LSOA 3MRFA 4WEMB 4GG6A 2Z91B 4PP8C 3TBSA 5DD1L 5C9KA 2VXQL 2X9YA 4Q9BA 4JHWH 4DGVL 1EGJH 4EUPH 4Z77A 1G9EA 1S8DA 1GSMA 4NT6B 4YDVB 4KZDH 3BKML 4OFKA 4KRPB 2VXVH 4M7KL 4BFGA 2W0LA 3QUYC 2ITCA 3VG0H 4JKPL 3TA3B 4NJ9L 2DI7A 1B0RA 4YAQA 1YY8A 3SBWA 4POYA 3NIFE 4KTDH 3MA7A 2YC1B 2YPKA 5BMFH 1OTTC 2JIXD 1EX0A 3MOQA 5DF0A 4RMRA 3MOBL 4A6YH 3F8UB 3EHBD 4RNRB 2H9GA 4LRIA 4Q0XH 3MXVL 1U2CA 3ROLA 1K6QL 3U36A 4CVUA 1AQDB 4HEME 4PLJC 3CVIH 1CICC 2NY2D 1RUAH 4LFHD 1MF2H 1IAII 4GXUM 2A9MH 4ZDHA 4HIHA 2NW3A 2XZZA 1RURL 5D2NA 4HJJH 2FB4H 2FJHA 3OJVC 4P5MB 5D2LB 5GS0C 4G8GE 2VDMH 2M1KA 4IIQB 3LHPH 4FTVE 1LDSA 2Y07L 2DQCH 1TZHB 2R2EA 3WXVL 3RWJB 3IVKA 4OFDA 2UY7A 1JGVH 3SDXB 2DTSA 4K7PH 3PIQA 2Q7YB 4UNVA 5JHLL 1N6UA 3KXFD 3MV11 2ZSWB 4YEEA 2MOVA 1MRFL 4BSWB 5HDLA 5I8CA 1JTTA 2ESVE 2OL3B 4OF6A 3BVNA 3RWEB 3RUGF 1K8DB 3TYFB 4FQ1L 2C4FU 1PJ9A 1YNLH 2OM5A 4OFPA 3RVVC 1X9QA 1YJDL 3MYZA 4PV8B 1BD2A 3GDBA 1U92A 3FO1A 3DUUA 5CZXD 5GGTL 1YA5A 3HMXL 3T0EE 1KYOJ 3RAJL 3TVMA 3WUZA 4Q9RL 4NQDE 5ALCH 3QDMB 1KN2L 2WQRA 2CXGA 1MNUL 1UWXK 1F6AB 3IGAB 4A2MA 2XN9D 5DUBA 1F2XK 3BT2H 2J7LA 2BSSB 4XVUD 2DQEH 4CJ0A 2BC4B 3AS0A 3U4BL 1RJLA 1NGYB 3ILPB 4HWBA 5ACMA 1V7MH 2HTLD 4XAKE 4G8FA 3O6FB 3SDAA 1FZJA 3EUUA 1X5FA 2Z4QA 3V6FA 3BP7B 3EO1B 4NQCE 4ODSH 3T0XA 1EIBA 3X11A 3QEUB 2WIIA 2HFEA 4PJ8C 4TVPE 2YEZA 1A0QL 2R0ZL 4XNYH 4XNXL 3PWPA 3FFDB 4Y1AA 4YDJA 3HI1A 3AY4A 1HILB 3U79A 5KW9L 2VDRL 1NANI 2ERJC 2VNCA 3KPSE 4LQFH 4Z6AT 1N26A 3PDOA 2QSCL 4M6AA 4R2GB 5KSBA 3QWOA 2JB5L 4YDJB 1FNEA 4S1QH 2DQTL 4WWID 5AUMB 1C7TA 4G7YH 3EZ8A 1EEZA 3O2VH 1MRDH 5IHUH 3TIEB 4Z7VA 2QSCH 3JZ7A 2FIRT 1NUFA 3PQYA 5GS1C 5HJ3A 1RHHA 1FYTA 5L88L 4OLZL 1D7FA 1HHKA 1QKZH 3NAAH 3OKKB 4UQ3B 1OAQH 2YWZA 4EUPG 4WI3A 1QFUL 4N0RA 4DN4L 4X5XB 5GRUL 3VXQA 4J2XA 4OCNC 4NFDA 4P5TB 1ZEAH 4H5SA 3LV3A 1A6PA 1YY9D 1OGAD 3C5ZD 3P4LA 4ZYKA 1IAKA 4PB0H 3IAPA 5E4IA 1P5UA 4K3DH 4EVNA 4GKZB 1H3GA 1HI6B 5EZJA 5DMJB 5FUZH 2V5TA 4FQIL 1AO7D 5AYUL 4HWBH 1IILE 3HG1D 3F12B 3BJLA 4LLDB 4OAWB 4PTTA 3TBWB 4OLYL 1WLHA 2JB6A 4P4KA 2C1OA 3I2CL 1NGPH 3VFMA 4FABH 1Y18B 3HUJE 2IH3A 1I8IA 5DZOA 2YD3A 3QULA 5E8EB 1LEIB 4B7IA 3T0WA 4LGRB 5CIPH 4LCCB 2APTA 2XZAL 2AABH 2FLBT 2ZUQC 4PP2A 1LE9B 3BKYL 5I2IB 4RGNC 1MWAL 4EI6B 2XKUA 1A7QH 2FR4B 3BUYA 1MQ8A 5JUEH 1GGTA 4JFDE 3U6RB 1QHOA 3RJQB 3IGAA 3SPVB 5ICZA 3L5IA 3EYQD 4ZDHB 2FNBA 3WDJA 4FP8L 3HZMA 2Y25A 4N8VG 1P4BH 4NSKA 1MJ7H 3OKLB 4UIKH 5HVGB 1GGBH 5TE7L 4G5ZH 3O2DH 1CLZL 4MNQB 4I0CC 1CFNA 3OXRB 3U4BH 2E27H 4X7FC 1OGAB 5HYQB 1PKQE 1NLBH 1BECA 4OD2A 3VRIA 2BSRB 2NXYC 4KQ3L 4LNVA 3BAEH 1G6RH 2CO7B 3IJHA 4I4WB 5FHAH 4F15C 2D2OA 4RWYH 1U8JA 1AGFB 4CMHB 3WN5C 5BZWA 2AEIT 4X80L 4QHNB 5FF6B 4DAGL 4Q6IA 4ENEC 1K8IA 1YY9C 2D9CA 2XQYK 3I9GL 2XWBB 4IDJH 4M5ZL 5BZWB 5CEYB 3AU1B 1XGQB 3MLTA 4OZIE 1NBVH 1EAJA 4J3TA 5C09D 1HIMH 3FFCD 1YEEH 4ZTPL 4D94A 1RIVH 1ZLUH 1I3GL 1CXKA 4X5LA 5FB8A 4LSVL 5M95B 1A7QL 3MV8E 25C8H 4N0UA 3DV6A 4LP5A 4CBPA 1RZFH 1ZLWK 1NGZA 2AABL 5IFAL 5EH1A 3N0PB 4FXKA 2VLRA 3TJEH 1GOFA 1DL7H 1EVTC 4M3KB 5BZDA 4WFGD 2CO6B 1L9NA 3WNPA 4NC2B 2JCCA 2IPUG 1DEDA 3F7YB 4JZJC 1MFEL 4F9PA 4ZUSA 4JY5H 4DCQA 1H3VA 2W0KA 3MLRL 3QR2A 4JO2H 1AGBA 1OF2B 4JFFA 2CKBH 4LHQB 4QTIH 3VD7A 5IB5B 3C8KA 1UZ8B 3GJFK 5DRXB 1NMAH 1JGUL 1T04B 5CUSH 3FTGA 4U4BA 3JV5A 3CSGA 5DQJB 3N9GH 2CRMA 4J8RA 3T4YB 4F7TB 1LMKA 5DUBB 1AXSA 3ROOB 4W70A 3JTCA 1AJ7L 2X4SB 3SDXE 2VITB 5GGQH 3NA9H 4GKSA 2NQCA 3IETA 3HA0A 4KPHH 4XB8A 5EN2A 3ARZA 1MCOH 1MCLA 3MGOB 4MWFB 1E0OB 4RCAA 7FABH 5KAQG 4OFYD 2H2SD 1A4KB 5DUMH 1QRKA 4Y19B 5TGBA 3FKUS 2ICCA 5EU6B 5LQBH 2L7JA 1BLNB 3EJYD 2P8MA 4P2QD 3MNVA 3NFSH 4C83B 4L5FL 3IU3B 3Q6FA 3BPLC 3UYRL 4IOIA 2W9EL 4YQXL 3QEQE 4LRNL 4JM4L 4X5WA 3BEWB 4ZAKD 2FECL 2Y7QA 3LIZH 1MHHA 4YDLC 3NCYS 4JFXA 4O2CA 2I25N 1E6OL 3T2NH 1UGNA 1WUNT 3P0YH 3VU2A 3D0VB 4K8RL 2H32H 2NY4C 4JM2B 4BUHA 5IM7A 3VXSB 2ATPB 4WTXA 5CBAB 5E6IA 5T3XL 1Q9OA 4QWWD 1CD8A 5IMOB 3HC0B 4IRSB 5LAXA 1RQ5A 5KSBB 2IADB 3RVXC 1MCPH 1I1YB 1S7QB 2BSTB 4OV5A 3UTSE 3MNZA 4RA3A 2GFBB 3WIFA 4LF3B 4BQ9A 2KQMA 4L5FH 5FYLD 3ET9F 2PTTB 1NCNA 1QLEL 4LVOB 3NCFB 4LAQH 1TITA 2ZCHH 3TBYB 4L3CA 3E0GA 1RZGB 4ELMF 1FZJB 1FRGL 4MA8H 5T1LA 2HKFH 1DVFB 5HHVL 4YUEL 2BOCB 5SV3A 1DBAH 3QDGB 5C0CD 3MRCA 2GEEA 1Q9KB 4JKPH 1S7WB 1OP3H 1I9JH 1BLNA 3GMOA 3UTPE 3D39A 1AXTH 2WUBL 3U9PH 5GSVB 5D1ZD 5CCKH 3L3JB 4G6ML 3VRLF 5I19H 5HDBE 3RX8A 1JZ2A 1ZKAA 1G7PB 3KPSD 4IJ3C 5TQ2L 2AV1A 1DQTA 4S2SA 1RAMA 5HGBA 1XGTA 3WDIA 4DVRL 2EEBA 5DD0H 1Q1JH 1FZKA 3MJ8A 1S7XB 5JW3H 3S9DB 3RTQC 1QSFE 5D6DC 4QRPA 1BFVH 5H8DA 1OSPL 2GITA 2OBGA 2R2CA 4EI6A 4JFOB 1MCFA 2SEBA 4M6NL 1CK0L 4H20H 4M6NH 4ZFOL 4CW1B 5DQJA 1UM6H 5FYJE 5CSZA 2XQBL 4RAVA 4WO4C 4OD1L 4XVJH 3RY6C 1U36A 4FFYL 4ELMB 1AP2A 3EOAB 1HYRC 4NP4H 3P2TA 3QDHA 3Q0HA 1H5BC 1U3HA 2LQRA 5E2VH 3TA3D 4PYGA 3GUTB 4PJGB 4QWWC 5IROA 1N7ML 3LEYH 5HGAA 5DFWH 1RY7B 1V05A 3M1BB 3C60A 2Q8AL 1AH1A 4HCRH 5KVGL 4RISH 3QB7C 4IOIB 5GSVA 4P2OD 1KCVL 4LK4A 3ARXA 3CMGA 2Y36H 5K93A 2LTQC 1VACA 1QSEB 4HWZA 2HTLC 3WFBL 1X5LA 5DVKA 1VEPA 1DBAL 4X6EA 3C5ZC 3ZSTA 4ZS6D 2VLJD 3DO7B 1KLGB 3K81A 4HIXL 1YMMD 2GJZA 1FG9C 2XY2A 1R3KB 4GXVL 4XX1G 4BZ1L 1PEZA 3G5YA 3RNKB 1QSED 4WHDA 4XVJL 5J3HC 4ZO9A 1M71B 1P5VA 3MC0A 3QEQD 3X3GH 4WGWB 3VWKC 5F7NC 5JIHA 1LNUA 5DRZB 4ELMA 4UOJA 1HEZB 3WIFB 4Z7OE 1FO0L 4UB0H 4XPHL 3O11A 1FPTL 2F5BH 4OF0A 1MCEA 2BFVH 4NO0A 3QIBC 3BHBB 1RSFA 3MTRA 3D2UD 2XTJC 1UM5H 1HHGA 1D6VL 1MFAL 1XGUA 2VL5B 5DTFA 3UTSD 2GJJA 3RUGA 4QXUL 2NW2A 3OKDB 4LSDA 4IMLA 1U93A 4PLJD 4KHXH 2BK8A 4F3FB 1DCLA 1RZKH 3FO2B 3FB8B 3SO3B 1EFXA 2DOCA 2H26B 1NFDF 1QTYT 4Y1AE 1I8MB 5C6WH 1U8LA 4F3FA 4GRLC 2ZPKH 3GIZH 1PQZA 3K2UH 4BSVB 5DC4B 3MZGB 5L2KE 1MCRA 3FOMB 4AY0A 4MQSB 1ADQA 1ZT7B 3NACL 2CGRL 3K4AA 3ZTJG 2CJUL 3S98A 5DA4A 3HKFA 1BX2B 3JV6A 3BN3B 4HZAA 1MF2L 3CIQA 3HNTH 4BQ6A 2E7BA 2NX5A 3QNXA 2BVOB 5T3XE 1D6VH 2AJXL 3Q48A 1YDPB 2AK4B 5JXEC 1TETH 5CZVL 3BHBA 1QYGL 4M8QA 3RY6A 2EXWD 1MJ7L 4ONOA 3D3VB 1KLUA 2GK2A 3KLSA 5I1GH 3DLQR 1IQWH 4HKJA 3UJJH 4K7PY 4PJBB 1A5FH 1NCCL 1XCTA 4OJFH 4PGEA 4ZFOB 5J8OA 3P4MA 2BVQB 1I7TA 4WFGE 4XPHH 1YNKH 4NZRL 5DFVD 3SCMA 3LD8C 1X5XA 2YN5A 1JWSB 3L5XH 2QV2A 5FYJD 4CDHA 5D7JC 2HT2C 4Z7WF 2RBLA 5IFAH 1NCBL 3DIFB 3QEHB 3VD4A 1BGXL 5HDQH 1U8QB 3GSVB 3BP6B 4WFEE 5KSUA 1HZHL 5IHBA 4YBQC 1F11B 5IUSA 2OJEB 4HK0A 2OTUA 4AJ0A 5F8RC 5F96L 3O6ML 3QIBD 4JM2D 3U36B 3IFPA 4S1SL 4KRLB 3MACL 3RWIB 2R29L 2XTJD 3IDYB 3PJSA 1N5YH 4ZUVB 1HNFA 1I7ZA 4EBQH 4HF5H 2CDGB 4GKSB 4POUB 1KTKE 1YDPA 4PJ8D 4EUPB 3TVMD 3ARBB 1WAAF 1IAOA 3OZ9H 2Q1EA 3BRDA 1A02N 2EDYA 3R1GH 5ANME 1RZ8A 2K1MA 4L9LB 4N5UA 4X5WB 4HKZB 2IQAB 4F58L 2A0LC 3GMMA 5E6IC 1NLBL 2ED9A 2Y06L 2JB6B 1KEMH 3SDAD 1FE8L 5JPMB 1ES0A 2X9XA 5I15L 1JGEA 2EKSA 2R15A 5D7SL 4AQOA 3H3PH 1H0DB 1WZMA 4UTAH 4YIQA 4S1SH 4YWGH 2B5IC 1CLYH 5CJQL 3MXWL 5T33H 2D0GA 2NXYB 4I3SL 3FQUB 5FOBA 2QQKL 1RIHH 4JCLA 2GTWB 3OKEA 3UTZB 1EV2E 4X6DB 4I2XB 4XB7A 3G6JF 2VDRH 3FQUA 1YEDA 5FOBB 3O2WL 3I6LE 3K4DA 3QUMH 2BNUA 3O2WH 4HMCA 4M7JL 4R4NC 4DN3H 1TPXC 5C8JB 1IL1A 4EDWH 3C08H 5TQ0L 4J8RB 5DT1H 4NNPL 3T4YA 3L95B 1H5BB 4OTXL 3V7AE 4AEHH 3O9WD 4FXGB 5JO5B 4MHHI 4PJFB 5DD3L 1S7VB 1CGTA 2HT2D 3EGSB 4KU1A 5C0BA 3KLHD 2E7LE 1JWUA 5T3ZD 3PWJB 5SWQA 4RDQG 1RZIA 4AG4L 1KIQA 3T0VA 1OTSD 3BPOB 2Z35B 4GAYA 4OCWH 4X6BB 1JPST 4ETQA 2APXA 4R90L 4HKZA 2APWA 4MLIA 2ICWJ 4KXZI 5L2KD 2HP4A 1RZIB 3SGJC 1A1MB 1OGAA 3GHEH 3S34L 3RTQB 1UJ3C 2EE6A 5MENB 2PXYC 4XNMB 3IKCA 4KVCL 1OL0A 2YSSA 4Z7VE 4HWBL 3HZVB 4F9LA 3BQUB 2BSRA 3DMMC 2WSKA 4WCYL 1NCWH 5DFTA 4XRCB 2X89D 1TENA 2FGZA 3FQXB 5HHXH 5IM7B 3QCVH 3OR7B 1CU4H 2EIZB 5I1EH 4OCXL 3SE8L 1EUTA 3DURA 3B6SB 4KTEL 2XWBA 1FBIL 3IFPB 1AO7E 1I7RA 3GGWB 3C6LC 4LIQE 4D2NA 2H32A 5BRZE 2VZTA 4P57B 5H35B 3QDMA 4ZUTB 3MJ9A 3DVNA 2FIKB 5DD6B 1QQDB 4BZYA 3MV7E 5CLTA 4HQQL 1YMMB 2OR7A 4JVPA 5GIRA 5EO1B 4GAYB 5F88B 1VGKB 1BVKA 2UWEF 3HCVA 1FNGA 4P2RA 1AE6H 2IC2A 2DL9A 3P4OA 3TWCH 5LVEA 4JPVH 1XCTB 4PGEB 2V9RA 2WBKA 4TNVK 5IF0B 5I8OL 4ETQB 3C6LB 1Y18A 2FEEI 3KPOA 1TTUA 3GJFB 2ZSWA 2A6DA 2FYYB 5GS2D 5L6YL 1TDQA 1GGCH 3L3IB 4DCQB 3JSSA 1J8HD 4IMKA 4JKWA 32C2A 3JTTB 4DKEH 4C56D 3INUH 1IEBB 2R1YB 3QQ9D 1B88A 1SJHB 4K9EC 4LKXA 5D1XA 1I7RB 3G6JA 5C0AD 4YDLB 4S0TD 3PJSB 3MJ7A 3QPXH 2FL5A 1MFEH 1PZUB 1FNFA 1KOAA 7CGTA 5EORH 4YDIL 3THML 1FVDB 5I66B 2VXSL 2ADFH 3O3EB 4WVRA 5I1CL 3EYFB 1R3LA 2BY1A 5JOPE 4HBCH 2OTPA 5EUKA 3L3GA 5IVZB 3VI4E 4LLMA 5L8JB 3PDGA 3WLBB 1NEZA 3HI6L 1CGYA 5HTSA 1EHLH 2C1PB 4PJ5B 4LSVH 4K3JL 1M6OB 1ULVA 3PABB 3HB3D 3MPCA 3IDJA 2HH0H 5BS0E 1I1AA 3FFDA 4Y1AB 4UV4L 3KJ4B 3ZKSD 1T5WA 4PTUA 2VWEE 3MREB 5BQ7B 4ZODA 4TOYH 1UACH 4LP4A 1IGFL 3MYJB 4M6OH 4PP1C 4NRZA 1MCWM 1RUQH 2ZUSA 4K7FA 4MAYD 3L5JA 3FT3A 4Y4HA 1Q1JL 4WU7A 5JDSA 2MSPA 3D0LB 5C0IB 4W68A 4PBWD 4MCYA 3X3FH 4Y16D 1C5CL 4OI8A 1X5GA 1XT5A 4OZHA 4L4TA 3S4SA 4GQPH 4D9QE 3W11C 1HCVA 4KK5C 2XG4A 4Z78A 4DOHE 2YBRB 5IB3A 1I8LA 5DUPL 3S5LG 3QIUB 4KI5D 3R0MA 4Z95H 3BN9D 4CVZB 4GMSH 1A7OH 3CZFB 3GIZL 4L4VA 4QHMA 4QT5A 3WUWB 1ZV5A 2X42A 3KXFA 1CFSB 2GSIA 3TCLA 3LB6D 4LLAA 3ZKMD 4KK6D 3PGDA 1NFDE 5HYSB 1RUML 3GB7A 4GJTB 1FORL 3IDUA 1AD9A 1N8ZB 3T2QA 3TPUA 5DS8A 4NO5A 1A7OL 5CEZD 3LH2L 3QEUA 2P5EA 1RUQL 1AGCB 3ZDXE 3IDYC 5GS1A 4MD0B 2D4FA 1HILA 3GJFA 3D25A 2Q8BH 5E5MB 2DLHA 1DN0B 1G7MB 4X7SL 4N0YL 4L8SA 5E8EA 2PXYA 3QUMA 1RK1A 5ADOH 1PVHA 1L9MA 2DQUH 4WI9A 1Z5LB 1FZKB 4PV9A 3LKQA 1OGAE 4R6UA 2NY5C 2C3XA 5HGHA 3SGKC 3NIGE 3IAQA 5AYQA 2YPVH 1TIUA 2OK0L 1ZLVK 2A9NL 4OKVA 4N0FB 3PNWB 4HAGA 1TJIL 3ARGA 4U7MA 5E1HB 2EDFA 1BZQK 3ARDA 4KJPD 4KMLB 3RKDD 3MRHB 1LO4L 1SY6L 1QBLL 1EUUA 4P4RA 1X4ZA 3PWPD 1PSKH 1GVIA 1WVZA 1MJUL 3VI4F 2EICA 4O51A 1RJZA 2OJZH 3LRGA 4WJ5A 5DR5H 3VXQB 1JHLH 5DHVH 4DZ8A 2WLZA 1NLDH 4PR5B 4M7KH 4Y5YB 4B50A 1PX3A 3RTQA 4AIZB 3TVMC 4F7CA 3VA2C 1EVUA 2QHRH 4J3WA 5JOPD 1KC5H 3VXUE 1MPAH 1DFBH 1NC4B 4P23A 1H15A 4I0PC 2XN9B 4RZCB 1T66D 1YPZA 1GPOH 1PZ5B 4J6RL 3L5WB 3RBSA 2VR9A 1OAZH 4HIEB 3TBTA 2NTFB 3AB0B 3PWVA 3SKMB 4HHAB 4GKOA 4OLEA 5C09B 4BKLB 1T5XA 1ZANH 1X6NA 1BWWA 5DYOA 3CXHK 4EXKA 2OCFD 1VKXA 1DLHB 3ARDB 3S8WA 1RJLB 3MLXL 3HZKA 1U8NB 2V2WB 3RQ3A 3ZTJH 4P49A 4PJIF 3LN5B 5ICZB 3H9SA 5ITFB 4ODWB 1F58H 3AS1A 4WUUE 3NCMA 4RFOH 1CDHA 3HG1B 2ITDA 4P9MH 3VFPB 3L5HA 1IC1A 1IAIM 3ULVD 1HINL 5KSVB 1YMHB 2ICES 5DEGA 3IU4H 1IAIL 3OKDA 4BUGA 2HRPH 2X4PB 4NO3A 3P3YA 5ICXA 5FYJH 3MMEB 2ADGB 3BGMB 4U6XB 4NKOB 3RWHA 5D7IB 4U0RB 4AH2B 4R90H 1YZZA 1IE5A 4L8SB 3BMVA 1OTSC 5EOCL 3STZA 3UAJD 3HNVL 3BVNB 4MCZA 3RWEA 5C09A 4BKLA 2VH5L 3RI5F 2A6JB 4UIKL 4KH2A 2XA8L 1T04A 1NQBA 4HIEA 1VEOA 2V5SA 2I60L 3HC0A 4IRSA 2DYPA 3V95A 1IZJA 1KB9K 3SJVE 5C0AB 1Y6KR 1AIFA 2AEPH 1YQ2A 2JIXB 3BPCA 2OR9L 1LD9B 2Q76B 3OXSA 1OHQA 2UZXB 3A6CH 1A2YB 4ZOBA 3WIHH 2X4UB 3LN5A 3HR6A 1U8KA 2NY7L 5D5MB 4ONHB 5KAQF 4X8JB 2AJSH 4AL8H 1FCGA 2R69L 4FMFA 4LRIC 4ODWA 1P7QD 2ZP0T 3T8XA 2VISA 1CTNA 1I8LC 5CJQH 4ZFOA 3QFJA 2P4AB 5LXGL 1MCCA 4WFHE 4UB0L 3H9ZA 5HYJE 2P43B 3QQ3A 4FQQA 4LAJH 2YZ8A 3SCMB 5HHNA 4CVWA 4JRYD 1DEEA 1MJ8H 5BQ7A 3C2SA 2P5WE 2VABA 1NFDA 2ZKHL 3DTXB 4LLVA 5CEXB 1NGXA 1KCGC 1J11A 3BYTA 4C56E 4Q6IB 1HYSD 3QPQD 4U6HA 1QO3A 4M7LT 3RHWK 1KNOB 4KK8C 5F21B 1LK2B 5CINL 5EOCH 4RZCA 1FNEB 1NUGA 4I0KA 5CEYA 3ZYJA 3G6DH 5F9DC 5I9QB 2BSTA 3HS0B 1JNLH 4XPAH 4LLQA 3VG0L 1JYVA 2G2RB 5F3HB 4YX2H 1UJTA 4S1DD 1CT8B 4U31A 2Y06H 3QA3B 2YXFA 3FT2B 4NHUA 1A1OB 5GJSH 5DHYA 4P46A 5IV2B 2F53E 2GT9B 4H0IA 1WFUA 3I9GH 4F58H 4KC3B 5DJ8B 4H1LB 3H7BB 5ENWB 4AIOA 2BC4A 4TNWK 5I1DA 1T89C 1XF3B 4O51B 2CPCA 1BQHA 3DPBA 4OIAA 4BZ2L 1H8SA 2HAZA 1OB1A 3BPNC 2Q3AA 1CFQB 5FDWA 1WIUA 4UAOC 4S1QL 3GSRB 3DROA 4MS8C 4XH2B 4KKAD 3S35L 2E9IA 4Y4HC 5DQDH 1OT2A 3GB7B 4IMLB 4JM2C 3GUTA 3ARPA 4N8CL 3OKMA 5L88H 5JZ7C 2OTWA 4LMQE 4M3JA 1T7WA 1KIPA 4P99A 2A6DB 4BQCA 1KBGH 5B39G 2MWCA 4PRIA 3V6OC 1ETZB 3VFOA 4YIQB 4ZMAT 1OP5K 4OIIL 4MCYB 3L3IA 4JR9L 4BFEA 1E4KA 5D8JH 3HUJB 5DRXA 4KJQD 1G7MA 5IMKB 1D5BA 3NTCL 3VH8B 1WQVT 4UOW1 3WFEL 4XC3L 1QSZA 1H3PL 4P3CH 4LNRB 4FOMA 5B3JF 2ICWI 3LN4B 5IMOA 4LF3A 4B0MM 1CR9L 3O8XD 5DLMH 1IEAA 4O2EB 2EEAA 1I1YA 1S7QA 4JPKH 2GSIB 4K94C 3LKNA 5D2LA 3TCLB 4ZG1A 5DJDA 4ZNEE 4KUCD 5HHOA 4OGXL 1M7XA 1F4WH 4NO5B 4JRYA 4KROD 4YDKH 5IG7A 5GGUB 4OLWH 2GKIA 3IU3A 4UT9L 3GMRB 5FO9A 2F54D 1A3LH 1AD0A 4WCYH 4G6AC 1KJMB 1FFQA 4UNUA 4GMSL 4PJ5A 5KS9A 1R24A 4RGND 3VMNA 4X6DF 5AZEL 3GMOB 4KHXL 3SO3C 2WINB 4NQXA 4PRHD 4OZIB 3VFNA 5MI0C 3MRCB 4PB9L 2YSSB 3IKCB 5KVFL 4OCLC 1I8KB 5JW5A 3Q1SL 3LEXB 4PY8J 4FNLL 1MLCB 1T1YA 1CBVH 3G5VB 1V3LA 5BXFB 1P7KB 5AUMA 2J2ZA 1FIGL 3EDJA 3HNSL 3LN4A 4DN4H 4Z7UA 1FGNH 3BUYB 3SKNA 4XBEH 5JORB 5C0FB 4P4KC 1NKOA 1G7IA 4WFFE 2BJMH 1CFTB 4JAMA 4PJXB 3FO0H 5IQ7L 1JI1A 3ALXA 5MP6L 2ZZUT 4Y16A 5E8DL 5J1SC 3T3PE 1G6RB 3BD4A 4QRPB 2XWTA 3QH3A 5JW4R 4JREB 4ZTOH 1S9VB 3IXAB 4IIQC 1HHJA 1OP9A 2DM7A 2FX7L 1S5HB 4R96A 3BQUD 3CDCA 3HI6H 1HHIA 3CSPA 2EC9U 5MEND 4MNQA 5FM5M 5CWSB 1YMME 3BUTA 3NPZB 5L8LB 4GKZA 1EJOL 1CICB 2FCBA 2NY2C 5I76B 3V6ZB 5C71A 2NY0C 1JI2A 4G8GA 5AZ2H 3QZWB 2FZ3A 3NZHL 3Q5OA 5FYKL 5I1JL 1JV5B 2VSCA 1D5MB 2P7TA 3LKPB 3EYVA 4I18C 2VERN 1R3HA 3PQYE 4LL9A 1EPFA 1ZMYA 3BKCH 3GRWL 2Y72A 4LKXB 1UWGL 3VXPB 4S1RH 3UROR 5IHZA 4QTIL 2X6MA 3QUYB 5I2IA 4G43A 4XC1H 3FZUD 4PV9B 1PEWA 5I73B 2ARWA 4XCYB 1J10A 4JR9H 2Z0BA 3CCHB 4PV8A 5DJZB 2EYTB 3VWJD 2E7LA 2W0PA 3KLDA 2HJLB 4RSVA 4DWHA 2CRZA 1INEL 5A3ID 2GFBA 2DKSA 2BNQE 4LPYA 1EK3A 1YEHH 4JRXE 1FNHA 5HHMD 1BZ7B 3ARGD 5CKAA 3B9KA 4FQJL 4XWGH 5IESH 2PYEB 1FN4A 3EYSH 3RY5A 4LLUA 3UTSB 4C4KT 3GMNA 4FQXD 3O6FA 2DD8L 4CADB 2B1HH 4UU9B 5I1CH 3QIWA 1P2CA 3RKDC 4Y19E 4JG1L 2ARJA 5C6PB 1IQDA 1Q8MA 1P84K 1GGIH 4GLRI 1YQVH 4KTEH 2VIRA 3T4AA 5DRNA 2FX9H 3OAYK 1NUNB 4OCYL 5ACZA 2ATKB 3BWAB 1HQRA 5M7QA 2L0DA 5EU7C 1AIFB 4K8RD 3N1GC 4EN3B 1KJVB 4YFLF 2FECI 4R8WH 3SCMC 4I3GA 3KPSB 1IGCL 5D96B 1C5DB 1OW0A 3KPMA 1DZBA 2HG5B 4PLKD 2CLRA 1T1XA 3RWGB 3W9EA 2EH8L 2UVFA 4M6MH 4OV6F 4I0PD 3H7BA 5ENWA 4U1NB 5EWIH 4E41B 1U6AL 4RAVB 3QDJB 5FYLL 4K3HA 3NCJH 3RWGA 4RWHA 3OPZL 3K4ZA 4H8WC 5BO1L 4JN2A 3PGDB 1AKJD 1RZJC 1JNHA 1KTLB 4CGTA 4OD3H 1S78D 4DKFH 1YQVL 4FXKB 1MHPH 3MJ9L 1F00I 3I3EA 5L9DL 3RVXD 2BVUA 1OQXA 2G75B 4I48B 1CFQA 1G0XA 5FDWB 2P5WD 2DL2A 3VWJC 2HVKB 1LO3L 4HFWB 1MFAH 3OHXB 1MHPL 1A6AB 5EFIA 2R1WB 1IGJB 2XA8H 1NMBH 2OJEA 4HK0B 3TM6A 2P49B 5EULV 1NDMA 2VDML 4MJID 1ZHLB 4XRCA 3MUZ1 4M1DH 3KHQA 5CFHA 3QEHA 4F2MA 4HZLA 3MLWH 3RWIA 1A7PH 2A9ML 2A73B 1JFQH 3TVMB 2R2BA 1V7NL 1YC8A 3FN9A 3AAZB 3MRJB 1YN6B 3UJIL 2B0SH 2DQGL 3TYGL 2PO6B 3V52L 2ZCKH 2PTVA 4XCNB 4OI9A 4L9LC 1LNUB 3DUSA 2RJMA 3PHQB 3H9HA 4MD5A 1BBJA 5HYJA 3TLRA 1NBYB 4YBLC 1J18A 3PWJA 5SWQB 4PUBH 3HZYB 2YD5A 1D5IL 4ZO8A 3WCYA 1GIGH 3PGCA 4YFLI 4TUOB 2HN7B 3TO4B 4Z8FL 3RA7L 4ZPTA 3QFJB 1AC6A 2VDOH 4ZFFA 2LU7A 2PTUA 4GKNA 4PGZA 4KZDL 1BP3B 2R4RH 3OTTA 4W4NA 1JPGA 1IGJA 4OZGB 5C07A 1F11A 2P5ED 1S7UA 5C0EB 4GH7B 1NGWB 3QRGH 3SGDH 5D93C 4X4ZA 1FAIH 2B39A 4QTHA 3CC5B 3PWNB 2R1YA 4KKAC 4HUXB 2YD9A 3OQ3B 2VDNL 4U1JA 3LEVH 3MFGB 4H26B 4QNPF 4MXQA 1QSFD 3PQYB 1PG7W 5IQ9B 2J6EH 3RVWC 3I02A 2VLJB 3HPLB 1C8PA 4N8PA 4IOFD 4APQB 1HYSC 3KYOB 5C09E 2UYLA 3WSQH 4J4PD 4XTRD 1NDGA 2XZQL 3KPQB 1F3JB 2X4NB 1S7SA 5IB1B 5IBTH 4NKDA 4U1NA 3VA6A 3WEXA 4G6FD 4DUVA 5KZCD 4CN1A 5DR5L 3T0EC 5ACLA 3KVQA 1QR1B 1P4IL 3WEXB 5CEZE 5IF0A 3PGCB 4JVUA 5E8NB 3FFCB 5DEFB 5EOTA 2X4TA 2X1OA 2DKMA 2X5PA 4P4KB 3L3JA 2B4CL 4QF1B 1FJ1A 3OG6B 4D0DB 3VGAB 1GAFL 1JNLL 4F80A 2AK1L 5C70A 4NM4L 4WI6A 2BHUA 4NN5C 4HPYH 1KJ2H 2VC2H 5DHXB 4X8XA 5LGHH 5IT2H 1S7TA 4FTVD 2W0FA 4WW2C 5LGJB 3FQRB 5GS0H 1HK6A 3D0LA 4GW5A 4I8DA 1OAKL 4OCRL 4ZNEA 1ROWA 4AZ8A 2E9JA 4X9HA 1NCBH 3SDYH 3KJ4C 2ICWA 3DI2B 2BCKA 1ZLSH 4QRQB 3RWDB 3KLAA 3SDDA 2UWEA 3CXHJ 3ROLB 2DF3A 1F4YL 3SJVB 4XNXH 4DEPB 4UMGA 4Y5XB 2HTKD 5E8OB 2GY5A 4N0CC 1UH4A 3LKNB 1NMCB 3H9HB 1FFNB 3O2DL 1KFAH 4PRHA 4TPRH 3E1F1 4L9LA 3TFKA 4CN4A 4ONGH 1IT9L 4WDIB 3EOBB 5HHXL 2VC2L 3CFDA 4WTZA 1RURH 2QQLH 4P5KA 5CBEB 4E41E 3TZVA 3SKJL 2DQIL 4Z7WE 2IBZX 1MIMH 2RHEA 3VXOA 1I1CA 3N1QC 2OZ4H 2J8UE 1DVFD 4F7PB 1MNUH 5T1MB 4DZBA 5EG6C 4JFDA 3QG7L 4QRTA 5ISZA 3VFTA 4OZFH 3QP3A 3UPCA 3VXNA 5FAAA 1P4LA 2DQDH 1KB5B 1S9YB 3SQOH 1AQKH 5FGBC 5C08D 3DBXA 1LEKA 2GW5A 1D3CA 1HWHB 4JFHE 2B4CH 4JEGB 3H9SE 2QADD 4JPKL 3BISA 4QRRB 1OQOA 3DI3B 3WLWC 4NC0B 1A6WL 4DN3L 1SEQH 5I1AB 3MBXH 4NBYB 2NY4D 4XBGB 3BRFA 1SMOA 2CMRH 1MFDH 4F7MA 3O2VL 5IHUL 4PY7A 1C16B 4UQ2A 1FGVH 4L8DA 5EPMA 5F96H 3C09C 3LQAL 3QIWB 1AFVH 3HTLX 4PJBF 4MZ2A 5HDQL 4DKAA 4TSBL 5GQBA 2A6IA 1DUZB 3IVKB 3GI8L 3DXAA 4KDTA 4Y0GA 1XIWD 1BIIB 4Y19D 5HHQA 4I13B 4YHMH 5I9QC 2JLLA 3CZJA 2QQNL 4NJAL 4RGNB 3G5ZA 1F2QA 4JFDB 2H41A 4EJ1C 3Q6GL 2F54B 1P9MA 3ARFB 3RDTC 4AEIL 3MREA 1FFOB 4XPGH 5F72S 1JZ7A 2X7LB 3B3IB 2DQTH 3L3KB 4H0GA 4L29A 1A9BA 4EDXA 1OCWL 4XI5D 4WW1A 3HRPA 2MHAA 4A6YA 4PJ7E 3KPLA 2XFXB 1YEGL 4JO1H 5FYKU 5C7XH 5MEQB 3AM8A 3BO8B 3WKMH 3U2SA 4NM8H 3B9KC 4HH9B 43CAA 5IMMA 1CQKA 2NR6C 4IRSD 4UQ3A 3KWWA 5TDNA 1Z9MA 4OM0L 4KZEL 1JMXA 2OYPA 1AE6L 2F5AL 4IEFB 3SCMD 2PYFA 1AO7B 1CE1H 1I1AB 5DSCA 3V9FA 1NBYA 3OAYH 5EU6A 1ZA6A 4PJDF 1IM3B 3UZVB 4G7VL 4YDVA 4GSDH 3EO0B 2YD8A 3VXTB 3QXAA 2F9BT 3VFVA 1MREH 5F1NB 5CHNB 1WT5C 3O4OB 2MJWA 1WAAA 4GW4B 4X9FA 3WN5A 4DKFL 3OMZA 4KRNA 1U42A 3F58H 3ZMRA 1F3RB 1Z5LA 3ARTA 1G7QA 4LOUD 2QHLA 3H9YA 3P11H 2EE3A 2KH2B 3SDCA 3ZTNH 2V7HA 3FOMA 3P9MB 5ID1A 2E6JA 5C0FA 4LSTL 5IW3A 2PN5A 3SKNB 5LGKA 3U30C 4IRZL 1QSEE 4MQXC 2J8HA 4J3SA 4M4PA 2VLJA 3RVUC 1U8PB 4KTYA 4LASH 3CPLB 4LHUD 3DUHA 4G7VH 4JREC 3JWDC 4CMMA 3NACH 4KKBD 1S5HA 1KT2A 3B9DA 1U8KB 4OCWL 3X17A 4K3GA 4WUKH 1U0QA 1IGIH 1UA6H 3KYNB 5FYLH 5E9DE 1KTRL 2WAHA 4OB5H 4NUGL 2FX9L 5ICYB 4I5BB 1G84A 4P23D 1HDMB 2P47B 3TEUA 2D7MA 4M93C 1D9KB 4BSWA 3GK8H 4O02H 4H25B 5TQ0H 1OAUL 4F57H 1F13A 5GRXG 5I16A 2XY1A 3ULVF 4E42A 5I75C 3TPKA 3NIGF 3X13B 1RZJH 1PZ5A 5IBLD 5E08H 4H88H 2HYMA 4LNRA 3IDGA 1KB5L 2IMMA 5D9SA 1N4XL 4L8CA 3MRGB 3IDMB 2V17H 4TSCL 5B3NA 4FHBD 3S96B 4Z7QE 2V2TB 1H3XA 3Q2CA 4X9GA 1UM6L 4FXLA 4X99B 2OL3H 1XGYL 1FYTB 3QUZC 1DL7L 4IM8A 4JM4H 4XCEB 5A16B 2OK0H 1BFVL 5HI3D 4L3AA 2Z8VC 1WBZB 4J3XA 1X6LA 3FQTB 5I71B 1PY9A 1K3IA 1XFPA 1F4XH 4YJZL 1UWGH 5D6CB 4MXWH 5IB4B 2HKHH 4PJGA 2HRLA 4WEBH 3OJ2C 3JTSB 2ZWLT 2CR6A 4V3EB 2HN7A 2CR3A 2OSLA 2IG2H 5FYKH 4JHAL 1BVZA 2EDXA 2VDOL 4U1LB 5F9WC 2F54A 1BPVA 5D7IA 2X44D 3QXWA 4XPFL 2FH8A 5FCSH 3NCYP 4S1RL 2ADGA 2PCPB 4LHUA 5LAXB 2VN7A 4MA8L 3BZ4B 1QG3A 4YLQT 3BPNB 1B2WL 9CGTA 3G04B 3HC4H 3U9UB 1T20A 3FOLB 4MA1C 2CLRB 2HG5A 4KXZH 4YGVA 1FH5L 1DUYB 4KI1A 5IW1B 1GHFL 3RZCB 2JKXA 2A9NH 5I1DB 2YPVL 5LXGH 2HFGL 3GMLA 3RZCA 3REWB 3TH4T 2NLJA 4MX7A 3MO1B 4RMVA 5K59F 5EN2B 4LVEA 1Z0NA 1RU9H 4TOYL 4NN7B 5DI8B 4X7SH 4ZUUB 3NABH 4GW1A 4MA3B 4PGJA 4XTRC 5KJRL 3VGEA 4RGMB 3MRBB 3WHXB 2WINA 3WO4B 4TQEL 4C57C 2F53D 4N0CD 4PDCE 4P23B 1OD7A 4HEPG 4JRXD 3PQYD 3GIVB 3E6FA 2EDLA 2YMXH 5MERA 4RDQF 5D5MF 4WO4D 3S3SA 3HMXA 5BOPA 1U8JB 1X5JA 3EDEA 3QWOB 3H7LA 3OSKA 4KK6C 1BAFH 2R9HD 3EFFA 5FECB 4MMXC 3VGDA 4Z95L 2VXUL 1TVHA 3O0RL 4OSUL 3N85H 2JJTA 1HXYA 4XXDA 1CZ8L 5E2WL 1NL0H 2F19L 1D6EB 2IALA 4X8JA 3IJYB 3QFJD 4MD5B 1SM3H 1JZ8A 3KGRA 3EJJX 1WZ1H 1LDPH 4JDVB 3EBAA 4JY6B 5DMGD 2FBOJ 4OCMC 1S7VA 3EGSA 4XPFH 4JO2L 4YPJA 4TPRL 4GAJL 2VOTA 2QADC 3HE6A 5D1QD 4QHLB 1KN4H 4R4ND 3RNQB 2QBWA 1IM9A 4C59B 4G8FB 3QNYA 2P8LB 4HBQA 3KG5A