4PRDA

Crystal structure of a hla-b*35:08-hpvg-d5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prdA01
4BQ8A 3QDMD 5A3ID 4D8PB 4XC1H 3MLUL 3WHE1 3HRPA 3T0DA 2MNUA 4HJGB 4KTEL 4UDUB 1OAUL 5KVGH 1GGCL 4LBEB 3F5WA 2D31A 4U2YA 1UB6B 2E7MA 1A7BA 4M7JH 1CVSC 4Y2DC 5J1TC 3RX5A 1KTKE 2ZSVA 3QEGH 5EU5B 3CFJA 5LWYL 3LS4L 1KCSH 1XGUB 1TZHB 2V5TA 4L4VB 2FB4H 1QTYT 2H41A 3C6SA 5IT2L 3FFCB 4AYFA 1K6QL 3QEQD 2APFA 1KCLA 2WINA 2HT3C 5I73C 1LO5A 3QQ4A 3UTTB 4EIGB 1RZJH 1H5BB 4APQA 1P4BL 1NBYA 1KCRH 1VFBB 2FX7H 3QWRD 5TE6H 4C57C 1G1YA 4FP8H 1KJ3H 1A7PL 5GGTL 1MCJA 1I1RA 2BSSB 4OV5B 3B4NA 2GSGA 4XWGL 4WHYG 3WFCL 3O6ML 2ADFH 3LV3A 3KYOA 3QG7H 3TV3L 3LPWA 3WJJC 1R0AH 1QSFD 1N7ML 1LP9A 1FPTL 2A1WL 4AEIL 4JFFA 3FHQA 4Y2DA 5CGMA 4C59B 3DLQR 4FN0A 3F5WB 5DURD 1OSPH 5ENWB 1JWMA 4NQSB 5JW4M 5HGBB 3F6LA 3MOQA 1EMTH 5CEYA 2XY2A 3D85A 3WLWD 3KLHC 3CFJB 5J12B 1QQDB 1KB5A 3IDNA 1IGMH 4PJDF 4PJBB 4TSAL 5DJZA 3WFDH 2Y23A 1T20A 1S7WA 3C6SB 1F11A 1GH7A 4NFCA 5CINH 1JPGA 3MRQB 3GSOB 5C0EB 1VGEH 2EIBA 2WINB 3DHMA 2XNAB 1LO5B 3QQ4B 4PBVC 2RFXB 3P30L 2A74B 4H88L 5DEFB 4XP9H 3MRHA 3W2DL 4APQB 1Y0LA 4NDMA 4N8VA 4RNRB 5FUZL 4KJWD 5GS0H 1AXIB 3A6CH 3WJJA 5IMOA 2DM4A 3BKCH 2L4OA 3KYKH 3K1KC 4XX1G 3V2AR 1GAFH 5FYLH 4M6ML 5HYJD 3LV3B 4AL8L 4PB9L 3BI9X 2R23A 3W39A 2JB6B 1IM9A 4XPAL 4S1DC 5E4IA 1LEIA 1H3WM 3WIFA 1RIUH 1N5YL 4ORGA 5MEOA 1SYSA 4P9ML 5J4MA 1RUAL 1ADQH 2BHUA 4YXLL 1RHHA 3S5LB 1CGTA 3X11A 1I9EA 4PJGE 2DIJA 5J13B 5IK3B 3SDXE 1RUQH 5JW4Q 3CLFL 1EJOL 3RVUC 4HHAA 1KB5B 4NQUA 2AXHA 3RHWF 5IFJA 2JJUA 4LCWA 3HUJA 4IOFD 2X09A 4NYLB 2ICEB 4IEFB 3FN0H 5DJZB 5C07B 1T20B 3DVNB 4L9DA 3T0EE 1FDLH 2Y06H 1I1CA 1F11B 1MHEA 1D7FA 1QA9B 5H2BA 3JWDL 1MCWM 4UBDC 5LAXA 3EFDH 3PL6B 3SKOA 1A14H 4NDMB 4N8VB 3QI9D 1QBAA 3S37L 2VZTA 3OL2A 1JRHL 3MLTA 3A6BL 1RZGA 5F89A 4X7SH 4ZAKD 4MVBC 5C0CA 2R23B 3W39B 1KN2L 4X4YA 4YBLC 4TUKL 2HT2D 5ESAA 4YIQA 1Q0XL 4MS8D 1A9EA 4LSVL 4TNWK 1E28B 5D7LB 3GMOA 4ORGB 5MEOB 1SYSB 4CVWA 1B0RB 3JTCA 3TO2A 1PX4A 2XN9A 1EXUB 3QDJA 5EZLA 1T4KA 4YHNB 1T7ZA 3ESUF 1NGQL 5KJRL 2YD7A 4EDWL 2DJSA 2VLKE 4TUOA 3GJEA 4HHAB 5D70L 4YBQC 1FNGB 1U93B 3ZHKA 4PP1C 1CF8L 4KI1A 2ZCKL 4NRYA 1NCAL 3U7YL 5C9JB 2XKSA 4OGXL 3BEWA 2GSIA 5H2BB 3AMKA 3Q5YA 3ALPA 4FOMA 3V4UH 4JRXA 5F7UA 1IGTA 1CG9A 2VRAA 2VDKL 4Z0XA 3SKOB 3TPKA 3UTQA 1FNFA 3QUZD 4QRPB 4MVBA 4JB9L 4JRYE 1JNJA 1YECL 1IQWH 4LPWA 1TJIL 5INCB 1WBZA 2VXVH 1RZGB 3EO9L 4HUVA 1KCVL 2NCMA 1WIOA 5CLTA 4GW1A 4NHUE 1MCEA 4OZ4A 1U8PA 3FQNA 5ESAB 4P5TC 2HKFL 3C5ZD 2F19H 3I6GB 4YIQB 4N8CL 5SV3A 3U9UA 4Z7VF 2PTUA 2ATPA 2Q7YB 1T80A 2OJEA 5F7MC 3TO2B 3STBA 5D72H 5EZLB 1T4KB 4DGIL 4LIQE 1UM4H 4S0TD 1HH6A 2AXGB 3VFNB 4CRPA 2I25N 4PJXF 1YQVH 3T0ED 5JXED 2UWEA 4LDLB 3LN5B 2V9TA 4TUOB 1NCDH 3WUWB 1G7PA 1RFDL 5D9SA 3WFHA 3KJ4B 4PJAE 4FG6D 5E9DB 3ARED 2LU7A 5GRJL 4PRAA 3CPLA 5DEGA 5H94A 4NRYB 4NM8L 3UZQA 3V5KA 4OD1L 4CNIB 3GMQA 4R2GB 4KI5F 4PGEB 4XP6H 2GI7A 4JRXB 1IGTB 2A6DA 1CG9B 3R1GL 4ZXBC 5CEZH 3V6OC 4QRTA 3CXHK 1QFUL 2IH3A 4RISL 3MJGX 3F7VB 3TJHC 3PP4L 1OAYH 3OKDA 1WBZB 4HUVB 4P5TA 1WZ1L 4MJ6B 3JUZA 4AJ0A 3T3ME 3P0YL 4JFDA 1Z3GH 4GW1B 3D3VE 2IADA 1I75A 1TJGL 1U8PB 2YPVL 2VH5H 4OF7A 3KVQA 4XPFH 1K9TA 1RURH 2VLKD 5F6HI 3JTTA 3P4LA 4IRJB 1RZ7L 2ATPB 4G9FE 5DUPL 2NY5H 4M9PA 1HH6B 3O9WD 3BFOA 3PDGA 5ETUA 4P99A 5I1DA 4JG1H 5E6IB 4JCLA 1J87A 5D9SB 1D5BA 3WFHB 2OZ4L 5HI5C 3P9LB 1LE5A 4M5ZL 3SN6N 4ZXBA 1U92B 4PRAB 5H94B 1N4XH 4M3JA 3V6OA 3VW3H 3GMQB 4JRYD 1MWAA 5IROC 3WLBA 3GI8H 3TJHA 1LDPH 1QSEB 2X4PA 5T3ZH 2AABH 2ZOKB 4J7RA 4X9GA 1KN4H 1U8IB 5DYOA 1A7NL 2VAJA 4OM1H 5AD0A 2AEIT 3OKDB 2OBGA 1R3KB 4P59L 2A9MH 2VDML 4P5TB 3WO4C 1NBVL 4I48A 4Z7OF 4ZFZA 1KOAA 5IVXB 1CVRA 5C2UB 4UMGA 2IADB 2D03H 3GKWH 3LKNA 3OKLB 1OD7A 3BN9D 5AEAA 3EJZC 2BZDA 5ALCL 4KJQD 1IQDA 1CDCA 2CK0H 4GG6F 4F7CB 4H20H 4OF3A 3MV11 3NBNA 1CU4L 3MV9D 2Z0BA 1ZLWH 5DDHA 5ETUB 3TN0D 4WENB 5F21B 1OCWL 5I1DB 1CZ8L 3BXNB 1CXFA 3U1SL 3C60B 5IROA 2GT9B 4JY4B 4QRSB 4XNUL 1LE5B 4K9EL 1N8ZA 2DQFB 4I5BA 4MJ4A 4QWWC 1MWAB 3WLBB 5C0JA 1SMOA 2Z35B 5E2TH 4QRQB 4F3FA 4K3JL 3RUGA 4BFGA 4JN2A 5EZJA 2K3TA 5DJAA 3TBWA 2D0FA 2NY2D 3D3VD 3TA3C 3I6LD 1A22B 5DYOB 1KGCD 5AD0B 3DUUA 1M05A 2QQNL 3IDYB 5FO8A 3BUYA 4G9FD 3WDIA 4ZFZB 3VG0H 1CFTA 5IWLC 1SQ2N 3RNQB 1YNTB 1DQLL 4EEEA 2KL6A 3IF1B 3BVNA 5TPWL 2ICCA 5IHZA 3QIWD 4HQQH 1IQDB 3SO3B 3W0WA 1JNHB 3EW3B 5EC2B 1IM3A 3SCMB 5E08H 3G08B 2WSKA 3L3IA 5D6DC 2EIEA 5E1HB 5DDHB 3NVQA 2ARWA 3BAEH 1DQML 3G04A 1K8DA 1JGVL 4MNQA 2P47B 3LS5H 1YEFH 2W9DH 1WAAA 4I5BB 3EKCA 4RMTA 1DDHA 3BH8A 4LPVA 4WJ5A 3TA3A 5C0JB 1CFNA 4R4FH 2CLVA 1UXWA 1D5XA 4F3FB 2Y36H 4UUJB 3RUGB 1M7DB 5E2UL 5EZJB 4I3RH 5DJAB 4OUUA 3TBWB 1OP5H 2N7AA 2X4UA 2VSDA 3JWDC 5DHVA 2ILLA 3DUUB 1M05B 5IWLA 3HTLX 1BOGA 5F9WC 2XIDA 4XBEL 3THMH 1NC4B 4PD4K 5FO8B 3BUYB 3FRUA 3IT8D 3PDDA 1ZOXA 3O4OB 1CFTB 1E6JH 5GIRB 5IW6A 2R2EA 3CCHB 2DL2A 3D39D 1A3RH 3QHFH 1BZ9A 4N68A 3VGEA 2FCBA 3QIBC 5D6DA 2QSVA 5IHZB 4HS8L 2LU3A 1XF5B 2WUCL 1Y18B 3H3PH 2VLLA 4DGYL 1IM3B 4JO4H 4E41D 2QQQA 4JFEE 3GSRB 4FABL 1U6AH 4I2XB 3G04B 5DGRA 4AZ8A 3VFRA 4P9HH 4BH7A 4NJ9H 3NA9H 1TNMA 1MVUA 4GRWH 1UZ6E 3BH8B 2BXYA 5I17A 3E8UH 3TA3B 2NY3D 3GSQB 2CLVB 4XC1L 1UXWB 4HCRH 2APXA 3PHQA 4JGUA 4CN4A 3U9PH 3HZMA 5KVGL 2X4UB 3F7RA 1OPGH 5GS2D 4QXWA 3V5DA 4ONFH 5LG1A 4M7JL 2CGRH 3ULSA 1BOGB 3LKPA 3QCUH 3QIBA 3QEGL 4EVNB 2YD1A 3IRPX 3UYRH 4G6JL 2HVKA 3IFOB 1KCSL 5IW6B 4N90E 3DTXB 1BZ9B 3GMRA 1FZKB 5IB1A 2FB4L 4XBPA 1I7TB 3D18A 1UH4A 3RIFK 2FX8H 1PZUB 2VLLB 5I1LA 4FQ2H 1RZJL 1FG9C 2FX7L 3K0WA 5TE6L 4FP8L 1EA9C 3QYCA 1KJ3L 2Q76A 1I8MA 4BH7B 2YN5A 4HFUL 1YC7A 3LQMA 1UWGH 4X4MA 1MJ7H 2ADFL 3L9RA 3QG7L 5IBUG 3VI4F 4JM4H 3WNMA 1MVUB 3O41A 4U31A 4AK1A 4JKMA 4TRPH 1R0AL 2W59A 5I17B 3SDDD 1S5IH 4MGXA 3PHQB 4H1LA 3QB7C 1R5IB 3K2MC 5C0RH 1CGYA 5F9WB 3HZMB 4FFEX 1A4JA 4WNQA 3V5DB 1S7VB 1OSPL 4HMCA 5KSBA 2ZUXA 3ARRA 3QFDA 1EMTL 3LKPB 5HHME 1CGSH 3QIBB 4FMFA 2OSLA 3O6KH 2FLBT 2HVKB 5E95B 4LMQI 5HY9A 3S4SG 5HHQB 4MNGA 1EUTA 1IGML 2NX5A 4JFED 1IGYA 3RBSA 1ODAA 3WFDL 3BZEA 5HHOB 3B8YA 5CINL 5CKAA 2YEZB 1GCFA 5EO9A 1VGEL 2EC8A 2RGSA 5GHWH 5JOFA 1TZGL 2NNAA 4XP9L 2H6PA 4F57H 4PG9B 4CMHC 1NEUA 2AGJH 5GS0L 2Z91A 2XWTA 3BKCL 3KYKL 1GAFL 3BO8A 1DQQA 1CE6B 1VFMA 2LAGB 4U1JA 2J8UF 2RR3A 4YDVA 4QHLB 1F6FB 3BGMB 4FQHA 3O41B 5IQ9B 1ONQB 2BNQE 4WUUD 4FXKB 1RIUL 2D2OA 2CIKA 4ZQKA 1CXEA 4N90D 1HK6A 4JGJA 5BV7C 3FQWA 4PJ7E 5KSBB 5EC1A 1RUQL 3MRJA 2ARJB 1UJTA 4O9HH 4U6XA 3MBXH 4KRPC 5DQDH 2FO4A 1IC5H 5IB3A 4MNGB 4LLYB 2NX5B 4YHPA 3QPQD 5TQ2H 3FN0L 3LPFA 3IKKA 5I66B 1MHPH 5FO7A 2VNCA 5E7FA 2R0WH 1FDLL 2IQAA 2WIIA 3QXDA 5IIEA 5F3HB 3PQYE 3EFDL 1HXMA 1N59A 3H9HA 4KFZC 5K33A 2J8OA 4HFWB 2NNAB 1ZT4B 2H6PB 1A14L 1HQRA 1MJJA 4XH2A 2AEQH 1A8JH 1P2CA 4ONOA 3BP5B 1L0QA 4BZYA 2Z91B 2BY0A 1B2WH 3BO8B 2CXKA 1KENH 4U1JB 4J1UA 4X7SL 2AW2A 4FQHB 3MCKA 4XGZA 4PTTA 1NEZA 4G8GB 5HHMD 5ALBH 5M94B 2DWEA 3MA9H 4OF0A 3ARWA 2D0GA 4ZQKB 3FQWB 1E6OH 1LILA 1PG7X 3L7EA 3MRJB 3VRJB 4U6XB 1HILA 5FDYA 4YEEA 4MSWA 4CL7A 3V6FB 5ISZA 4YHPB 3O11B 4EUPH 4PY7A 4OSUH 1IVLA 4NWUL 1KYOJ 3ZHLA 4L8SC 2WBJC 3QXDB 4MDIA 5IIEB 5EU6A 3V4UL 1A21A 3GHBH 3SDAC 3H9HB 2X4OA 3SQOH 4ZFFA 5BXFA 4J12A 4WTZA 1HQRB 1MJJB 4HWEH 3NGBB 4A2LA 3QH3B 4X8XA 1IQWL 4LASH 2BNQD 4L4TE 2VXVL 1T7YA 2PW2A 3V4VH 4J1UB 1PYWB 5I74C 4J3OC 2EDKA 3F7PC 4OI7A 2VISB 2NZIA 5F71A 5HGAA 2F19L 5KW9H 1P9MC 2VIRA 1F4HA 5BV7B 5EH1A 1SYVB 1S9XA 2DWEB 3OJ2C 1DZBA 4D0DA 3QQ3A 5D72L 2AK1H 1UM4L 1QKZH 3WL9A 4X6DE 1C5BH 2WWMC 1YQVL 3OGOE 1NCDL 4JJHA 2PO6C 2FECI 4Q6IB 2V9QA 2WBJA 3KR3H 4CVUA 2VQ1A 1DSFH 4OZGE 4K3DL 4HK0B 4PYHA 4PY7B 3SDAA 4F37F 2OXHA 4RX4D 1BZ7A 3HZVB 2X4OB 1OM3H 4RRPG 5CEZL 3GMNB 1BFTA 3E3QE 5EN2B 3Q48A 4DEPC 2ESVB 4JDVA 1OAYL 1A02N 2PW2B 2EECA 3ULVF 3ARBB 4U0RC 1P9MA 2BSRA 4PFEA 5SV4A 1S9VA 1YEDA 4YHYB 1GOHA 1Z3GL 1UA6H 1YEEL 5KANG 1NH6A 4ZFGL 4XPFL 5GSRB 4XNQB 1RURL 4QLRA 1F4WH 1E4WH 1MH5B 2V9RA 4PP2B 2DF3A 2V5SA 4LHUG 3GSUA 2PO6A 1UC6A 4LFHG 5JZ7C 5C70A 3BPNC 3C6LD 2J88H 4R4BA 5GS1C 4JG1L 1JNNH 3LKOA 1E0OB 5AZEH 2IWGA 2MCG1 4XAWH 1A9BA 1OQOA 1KJ2A 3VW3L 2EDEA 3BPOC 5DJ2B 1U8QA 3S36X 3GI8L 4QCIA 5HD8D 1LDPL 4QHMA 4F7EA 1X5LA 3FCTA 4JFQB 5T3ZL 2AABL 4JVPA 3ALXA 5I74B 2ICWA 1KN4L 2FR4A 4JFPA 4DKDC 4ZUSA 4OM1L 1T1WB 1QRND 1URLA 2A9ML 1FO0A 4HIXL 1D6EA 1OGAE 4YBQD 2BSRB 5FV1L 1YEDB 4KK6C 2MWCA 3Q0HA 5KG9A 5AAMA 4AH2A 3CU7A 4LSPH 5I16A 2I60H 3GKWL 2D03L 3ARDC 5A2IH 4IIQB 1KLGB 4K8RC 4L8BA 1YDPB 3E1F1 3SY0A 4TTGA 4NO0D 3Q6FA 1FGVL 5GS1A 4MXVF 2CK0L 3U6RA 4H20L 3GSUB 1ZHNA 2CRIA 4P57B 2PO6B 1IARB 4OZHB 1CXKA 3MMEA 2D9QB 4HIHA 1VFOA 5FOBA 1Q38A 1YNLH 3LKOB 5HDBF 4TVPE 1UVQB 1V3KA 2W1NA 3EDJA 4I0PD 4F7TA 2WLYA 3CMGA 4PJFB 5F7DA 5HYQA 1C08A 4OCSH 1YPZF 1KJ2B 4U1HA 3GNMH 4NPYB 1F00I 3HG1E 2VMFA 4UT9H 1IFHH 5E2TL 5ILTH 4F7EB 4G59A 2X42A 3FCTB 2FEEI 1LGVA 4Z0BH 4U0RB 2ICWB 1WISA 3C87A 4JFPB 4OI9A 5FDWB 5JDSB 3S9DB 3O6LH 3ARDA 3NFPA 3UTSA 4JHWH 1D6EB 2BVOA 5GS0C 4ODUB 1RY7B 3TNNA 5KG9B 1L7TH 1F2XK 4AH2B 1R5VA 4XWOD 2D7QA 2OTWA 2BNUB 2EDDA 3BUTA 3RI5K 2XXMB 2FNBA 4MA1C 2P5WA 4HQQL 3RX8A 5GS1B 4LCUB 3U6RB 2A9NH 4MZ3A 3SQBA 1CQKA 1ZHNB 4N5ED 4NFBA 4XPHH 2BVQA 5E08L 1F58H 3MMEB 4K94H 3VXRE 1AI1H 3BAEL 5MENA 1MLCA 5CBEA 4ETQA 2X4TA 5IEHB 3LS5L 4BZ1H 3BPOB 2OI9C 4UOJA 3BQUC 5HYQB 4X5WB 2W9DL 4L5FH 5ABDE 1BECA 4DN4H 4U1HB 5F7EH 1T5WB 1EBPA 4PRHE 5SWZA 2D4DA 2IQ9H 4M93C 4LVHC 4R4FL 4Z78A 4ELME 3IKCB 3V9FA 4PJHA 2Y36L 1OGAD 2P5EB 3IAPA 4I3RL 1IT9H 3D2UA 3QFJD 5KOVC 4KJYA 1EEUA 5LCVH 3MLPA 4JLRA 5DD6A 1BEYH 5GZND 3UTSB 5ERWA 3THML 4GQ9H 2NXYC 3DUSA 1W72H 3D48R 2R4RH 2Y9RT 3JWOC 4OZIE 3TNNB 5I1CL 1E6JL 1OAQH 1A3RL 3QHFL 3M1BB 5KBNC 3LMJH 1INEH 1J1XL 1CDBA 3MNZB 2DKMA 3VXUA 1Z5LA 2GFBB 1EHXA 4FTVE 4TVPD 4YPGA 4M8QA 3PWUA 1N2RB 2BVQB 4JO4L 4HIEB 2OI9A 2NW3A 3BQUA 1NC2A 5MENB 1NJ9A 5H37H 5CBEB 3HG1D 3RAJH 5D1ZD 4P9HL 4GUPB 4NJ9L 3RVWD 2FWOA 2ADGA 2FGWH 3NACH 1L0XA 4U1SA 2W0KA 3NCYP 4GSDH 1QLRB 5GGUA 4FQIL 3WSQH 2JJWA 5T5NF 4G9DA 3T2QA 3E8UL 3K4AA 1AD9B 5SWZB 3FT4A 4Z78B 1UZ8A 2H26A 1MCLA 4HCRL 5C0IA 4Y4FC 3U9PL 3D2UB 5LQBL 2ADIB 3TYGH 4WI9A 3TBTB 1OPGL 5KSAB 1KYOK 4ONFL 4XMKH 2OR8A 7CGTA 2P8LA 2CGRL 5ERWB 1QEWA 4M43H 3DUSB 2RBLA 3QCUL 2DYPA 4MA1B 3HNSH 3UYRL 2G75A 4V3DB 1CT8A 3SE9H 2JCCF 2VWEC 5DJDB 4D0CA 3VXRD 3QZWG 3WEXA 5ANMB 4OFIA 1ITBB 4OZFH 4YPGB 4M8QB 2FX8L 4IHOB 3PWUB 2VYRE 2YSSA 2NY6D 4FQ2L 4KMLB 5T1LA 2CD0A 4O2FA 2OI9B 1F6LL 2DLGA 2NW3B 3MO1B 3BQUB 1NC2B 3A0OA 3BDYH 1NJ9B 1W8OA 1A5FH 4PRHD 4JZOA 3OR6B 2ADGB 2W0PA 1DEDA 3EYQC 1T83C 5E1AA 3BW9A 2NYYC 4M93B 4LVHB 3VFSA 4U1SB 1MJ7L 1KT2A 3LOWA 4JM4L 3MUGB 3HE7B 4Y4FA 4PLNC 4KTYA 5L8KB 4R0LC 1S5IL 2AJYH 5EOTA 5HDQH 2H26B 4MNHA 3ZYZA 3RWHA 1CFVH 5C0RL 1CD1B 4PJ8B 4XZUA 5FECB 2P8LB 1N26A 1Z2KA 2WWKT 3FT3A 5IQ7H 1CGSL 2DYPB 3O6KL 4Y4HC 4HSQA 4YEFA 2G75B 1CT8B 3C8DA 3QUYC 1OHQA 5IR1B 1EUUA 1JGLL 2ZZUT 5DRXB 2DM3A 3WEXB 2ZSWA 4MDJA 1U3YA 1HHJB 2JJSC 2R2HA 1MSPA 4BA8A 5GHWL 5B3NA 3QRFM 4O2FB 1T83A 1T3FA 4F57L 4MAYD 2AGJL 4BQ6A 2KH2B 3ARQA 4R0LA 3FJTA 3BW9B 3L6FB 1YEIH 3IGAA 1WF5A 1KT2B 1BHGA 5D7IA 2F53A 5GZOC 4Y4FB 3O3EB 3CDCA 2BFVH 4JAMB 4H0HB 5DUBA 2YWZA 4MNHB 4DVRH 4U33A 3RWHB 5MEPA 2IH1A 2CUMA 3MUHL 5BZDA 3RKDD 1Q8MA 2QQKH 3QUYA 3QCVL 3FT3B 3S97C 3MBXL 3KS0H 2C3VB 4HPOH 1IC5L 2JJSA 3EDKA 4K07A 1ZLUK 3MYJA 1G7LA 3QQNA 2D4FA 5TQ2L 1JF1A 3GKZA 4YBHA 2ZSWB 1MHPL 1CDIA 4MDJB 2R0WL 3GMLA 3OR7B 4BFEA 4DOHE 5DI8A 3H42H 4HF5H 4U7KA 4EN3B 1I1YA 1J0YA 3B5GA 3DRTA 5D1XD 4GKZB 2AEQL 2VUYA 1C5CH 4JEGB 4ONGH 2D7MA 4R0LB 1B2WL 3Q5TA 4YC2B 3IGAB 2GITA 5CZVL 1QVOA 3GJFA 4J3WA 2F53B 1CQYA 1HI6B 4OBSA 4E0RB 1OD9A 4JPVH 1IJ9A 5DUBB 3BN3B 3S3SA 4GS7C 1YEGH 5ALBL 5MEPB 4G6FD 1H15A 1DLFH 5BZDB 3MA9L 4WV1C 5BRZA 3RGVB 4XVUC 4I8DA 2CLRA 4N5UA 1E6OL 1CFQB 3IJSA 4P2RB 3DI2B 4RAUA 4GAGH 5I0DA 4OLXL 3MYJB 1G7LB 5KZCD 8FABB 3MUJA 5E6ZA 1U8OA 4C83A 3IXAB 1KACB 2BNRD 2YMXH 5DI8B 3UPAA 1XF3A 3GHBL 1BVZA 3SQOL 4K7FA 1I1YB 3ARFC 5GISH 4PJDB 4HWEL 4POZC 1QHOA 2R0ZH 2EC9T 4YPJA 3NCJH 4LASL 3V4VL 2C7UB 2GITB 1QVOB 1NAMH 1OARH 4WV1A 3EO1A 3MX0A 3H3KA 5GGVH 1U8JA 4GXUM 4BJLA 5KW9L 4P49A 1HEZA 1DBKH 3ZKNC 1XF2A 5DVOA 2C1OA 2BY2A 1QKZL 5GRVL 1C5BL 2XZZA 3QEHB 3O0RH 1FZMA 3O3DB 5BVPH 4RAUB 5BS0A 3DXAE 3KR3L 4JZJC 1NUDA 4U6YB 1DSFL 2EEAA 4NO2A 3U36A 1N64H 1H9VA 3ARFA 3HC3H 2CIIB 1U8OB 5FAAA 4C83B 5L6YH 1UWEH 1RIVH 2V2XA 1XF3B 2ICWJ 2YXFA 1OM3L 4K7FB 5GRVK 4NRZA 4UTAH 1BJ1J 2E6JA 3MA7B 2MOVA 3VMOA 1FP5A 3ET9F 5IHLB 1FFRA 3ARVA 4KRPD 3D1MC 4IS6A 4GS7B 2V7NA 3RL1A 1FGNH 3J7HA 1UA6L 4LSUH 2Y6SD 4WV1B 3EO1B 1AP2B 4KI5C 3CC5A 3CDFA 3DMMB 4PR5A 1HEZB 3H7LA 1F4WL 1JL8A 1E4WL 2YPLB 5D7JB 3ZDXE 1XF2B 1YEJL 2C1OB 5T5NG 2GY7B 4QHUB 2W60A 1IC4H 4JZJA 2FSEB 1I3RA 4Z7WE 4Q9RH 3QQ9D 3HE6B 5E2JA 4BM7A 4BYHA 2J88L 1V3LA 1JNNL 1A3QA 1GYAA 5AZEL 4EOWH 4Z7VA 3NFSH 3CFCH 3D0LA 5JMOC 1DCLA 1QBLH 4XAWL 4NO2B 4PRIA 3BKYH 4KUCD 4OLYH 4PJ9C 5DS8A 4HLJA 4D94A 4PJXA 5HVWA 4B7LA 4E42A 1RZIB 4ZUWB 4DFIA 3WN5C 2ZP0T 1IZJA 1PEWA 4KK8D 2R0LH 5IF0B 5IHUH 4WW2F 3UTOA 1T21A 1F3DH 1DLHB 3TLRA 3N1MC 4XAKE 4LSPL 2I60L 3PWJA 1TQBC 3U7WH 3KS0J 4PR5B 2R9HC 3S4SA 2AEPH 4ZG1A 2QADC 3DXAD 4HEME 32C2A 2W60B 5IBTH 4JZJB 3OXRA 4YUEH 2OR7A 3RVTD 2BMKA 4NQDB 1T1XB 2AJXH 2YA1A 1YNLL 5IVZA 1M71B 1CD0A 4PJ9A 1J8HA 4Z7VB 2JF1A 1NGYA 3D0LB 2WQRA 4OCSL 3T2PA 1T7WA 2OX5A 4H25A 3GNML 2ZG2A 2ZOLA 4R7DA 1TTUA 3WN5A 4NNXA 3STLA 4ZFOL 1O5DT 1JPSH 5E7BA 4UT9L 4P46D 4E42B 5EOCJ 1IFHL 5ILTL 1CGWA 1ZSDB 1BD2E 4Z0BL 1A6PA 3FRPG 1VEPA 2XFXB 4H0IA 2BX5A 3L95B 4LLWB 4HGWA 4M6AA 3O6LL 1JWSA 1AO7E 4ZO6A 1HKFA 4JHWL 5E24E 2EYTA 4FQQA 4BK5A 5DZOA 1QFWH 1L7TL 1S7TB 2WP3O 2GJ6A 3UX9B 3S4SB 4L29B 1P69B 2X5PA 3L3HB 2A9NL 4M7KH 3VWKB 32C2B 3TO4C 4XPHL 3ILPA 1F58L 3JSSA 3OXRB 4K94L 1BQUA 3ZT5A 2PYEB 1AI1L 4LLMB 4XPTH 3TEUA 5JHLH 5SWSE 1KTLA 3L5JA 3RPKA 2DJ4A 4PJ9B 4BZ1L 3VD4A 4HW6A 4GG6A 4L5FL 5TFSH 4DN4L 2XRAH 5F7EL 5EWIH 2ZOLB 2K9UA 5C6WH 3WN5B 5FGBC 3AY4C 4KDWA 1G9NH 2IQ9L 4GBXB 4LPXA 2YK1L 4RWHA 4TTDC 1MCWW 1K2DA 1QFWI 3MRFA 3SJVE 3H6JA 3V0WH 4XXCC 1FE8H 3D87B 1IT9L 2BSED 1JHKH 4XAKD 3X13A 3WO3B 5FYLE 5LCVL 1KULA 2IANA 1JWSB 1BEYL 1RJZB 1AE6H 4GQ9L 3FO2A 1W72L 1NFDA 4FQQB 2R4RL 3A67H 2F54E 4NP4H 2QADB 1AKJD 4KKCD 2F5AH 4OQTH 2GJ6B 3LMJL 1INEL 4PJEE 2R2CA 4MA3A 5E03A 3OKNA 2IAMC 2H8PA 1K3ZA 4FNLH 2AK4E 5HI4C 5DXWA 3RTQC 2G5BB 1CXHA 3LKSA 3M17A 1ZA3A 4LSSH 4GKOA 1VB9A 3RVVD 2KQNA 3RAJL 3HR6A 2QTEA 4MAUH 3I02A 5FGBA 3AY4A 2FGWL 3GSVB 4XCCH 4NQCD 2V5MA 3NACL 1BD2D 4GG6B 4P2QB 1XGRB 4XXCA 4NKDA 3WXVH 3WSQL 4DFHA 4RA0C 3I9GH 5DMGC 1AO7D 4NC0B 2ZG3A 1KLUA 1CL7H 5AYUH 3BIKB 1TCMA 1N6VA 3I6KB 1S9YB 3HB3D 4XXDA 4Y4KC 5F7NC 4QHNA 3TYGL 4PRPB 2YR3A 2C3GA 1XCTA 3X13B 4XMKL 3BZDA 5GGRA 5IG7A 3ARGC 3REVA 3TBYB 5AZ2H 4M43L 1G7HB 2DI8A 3HNSL 3MLSL 3SE9L 5A1AA 4MWFB 4Q58C 2IAMA 3OSKA 2AP2A 4NOBA 4MA3B 4OUOA 2Q86A 5SWSD 3OKNB 3RTQA 4DN3H 2UVFA 1J12A 2W65A 4L4VE 5B4MD 3BDYL 2IPTH 3FFCE 4Z7QF 5K93A 4RRPA 1CL7I 1OW0C 3DVGA 1QBMH 3UTTE 3W82A 3SJVD 3MGOA 4NCDA 3CSGA 3DARA 4FXGB 3TBVA 3IU4H 5FYKH 1MI5A 4MQXC 2L7UA 3E2HB 2BXZA 3QNYA 4Y4KA 2VXQH 5FYLD 5HDQL 1F3DJ 1YQ2A 3MLRH 4Q6YA 1KLUB 3ARGA 4QXTA 3AXLA 5D1QC 3HN3A 1CFVL 4XXDB 4QHNB 1LD9B 1XCTB 3BZ4A 2MCPH 1AY1H 2Y4SA 4ZTPH 3MFFA 4YZFE 5IQ7L 5C0AD 1EAPA 5TE7H 1FSKB 2HTKC 4IOIA 2VE6B 4OKVA 1II4E 1WTLA 2GTWB 1SJHA 2AK4D 2E6PA 4OIAA 4MJID 2AQ3A 3G6JF 5AUMA 2I9TA 2KPNA 1WBXA 1S9WA 4YX2H 4S2SB 4JN1H 3FTGB 1OW0A 4O00A 4PJBE 4R6UA 5F6IB 2E9IA 1P7KA 3CUPB 3Q5OA 2A2QT 2O26U 4Y19B 5ICZB 1JK8B 1YJDH 3DX9A 2VL5B 5C09A 5I15H 3F7QA 5LGHL 3KYAA 2X7LA 4UILH 1YEIL 3TBVB 3R4DA 1EK3A 3ZYOA 5E5RB 4Z7NE 2AV7A 5D1QA 1QHPA 1B88A 2BFVL 4EI5C 4EJ1C 2VSCA 4G42B 5CEZE 3VGDA 3KWWA 4DVRL 4XNZC 4QXTB 4LIQH 1LQSR 3VH8G 2PXYD 1A6VH 3FZUC 1D9KB 1P7QB 2YOCA 3VFUA 3BZ4B 4LHUB 3MFFB 4JO1H 4JHBA 5F3BA 1MCPH 2HG5A 4HPOL 2NY4C 1FN4B 4L4VD 3VCLA 3FFCD 5AUMB 1XH3B 3HMXH 3MV8A 5DO2C 3UTTD 2UZIH 3ULUE 4LLUA 3H42L 3MGTA 2B4CH 4HF5L 4PUBH 5C07E 5AYQA 2HA1A 3HCVB 4ZPTA 4WO4C 2P8MB 3DX9B 1C5CL 4MB3A 4ONGL 4EI5A 3PV6A 5HYFA 2PTVA 4YGAB 2AV7B 5D1QB 4P3DA 4LLQA 5C08B 4LAJH 1X4YA 1DVFC 3GZKA 2B5IB 3V5HA 3F58L 1YEGL 2CDEB 1JYWA 5IMKB 2YXMA 1DLFL 4PP8C 2J8UA 5CJ8A 2GAZB 4NO5A 3RWCA 4PV8B 1MY5A 4F9PC 4GXVH 3GI9H 5D7LE 4NNYA 1JNLH 2HG5B 1X5YA 1U8LA 5K9QG 3WYRA 3B9KC 5JHDD 1MRDH 4GAGL 1AGCA 1NUFA 3MBEB 5DTFA 4ZNEA 4FFWC 4X4XA 3VCLB 1U41A 3BYTA 3N1GC 1DE4B 4WO4A 3DV6B 2YMXL 4LLUB 2Q7NA 3MGTB 3OX8A 3IETA 4GLRH 3VGGA 1A6AB 1LP9F 2JK5B 5GISL 2C9AA 2FIKB 2PNDA 5JNYA 5FCSH 4YGVB 2R0ZL 1J1OH 4EBQL 4L9LB 3NCJL 4P4RA 5CEZD 1DVFA 1SY6H 5I1JH 4Y4HD 2AJ3A 3R8QA 4RQQB 3PV6B 3D25A 4QRPE 3CX2A 3TBSB 4UV4H 4XNZB 4UIMA 3NIFE 1NAML 1OARL 1CD8A 3V7AE 4LLQB 1X5GA 4N9GA 5GGVL 2FJHB 3ETBF 4J8RA 4F9PA 1DBKL 5KVEH 1K5NA 4GRMB 4A6YH 1MFCH 2HRPH 2J8UB 2YD2A 3B9KA 2R4SH 4NO5B 2DWDA 3ARSA 3O0RL 4GLRI 5BVPL 1NFIB 3ULUD 3BGFB 3RL2A 2BVUA 1PG7W 4WUKH 5C07D 1HYRC 5ITBH 1N64L 1INDH 3HC3L 2DLFH 4WO4B 1V8HA 3PL6D 5L6YL 1UWEL 5E9DE 1RIVL 3OX8B 5INDA 3O6FA 4TN9A 3TGXA 1CXIA 5CEXA 3D9AH 3S88H 5IMMB 5GQBA 8CGTA 5JNYB 2JIXA 4HC1H 4BQ9A 4OD3H 3WHXA 1YN6A 5J11B 4JRXE 4P4RB 3KDMA 1DUYA 2LTQC 3IDUA 1F2QA 3KXFB 4POUB 1XMWA 4JPIB 1EO8H 4LPYA 3MR9B 1JZ7A 4CDHA 2APWA 5GS2H 3IFNH 1FGNL 4PJ7F 4HKXB 3QNZA 2K1MA 3LQAC 3IDIB 1DBMH 3HUJF 2OCFD 3LY6A 4KKBD 1FIGH 3PV7A 5D7LD 1K5NB 1YY9D 1XGQA 3MRDA 1A1NA 3QZWA 1JZ8A 4EXKA 1DJSA 1IC4L 4Q9RL 2DWDB 3G5ZA 1K4DB 3CLEL 2EO9A 4X8JA 1BM3H 1EFXD 3ULVC 5I75C 2GUOA 2WAHA 4EOWL 1W72A 4P5MA 3NFSL 3RL2B 3CFCL 2ZJSH 3GRWH 4KGJA 4LVNC 4OFYA 3TVMD 1QBLL 1UH2A 4P2OB 5IJVA 3BKYL 4OLYL 1U2HA 1J05A 3ZTJG 2MKWA 1IBGH 5KANI 2X9XA 3OAYH 5I1KH 3FB6B 2VLME 3O6FB 1RAMA 4KQ4H 5FGSA 4QRPD 3BP4B 5H35B 5CEXB 2IFGA 3H9SA 4IRSC 3NIGE 5CWSA 3WHXB 1YN6B 3C08H 1QSEE 3KDMB 1DUYB 1CIUA 2R0LL 2NLJA 4HUUA 5IHUL 2FHFA 1HDMB 3UMTA 3DX8A 2I9LA 1DN2A 2LU4A 1A6ZA 3MRKB 3SDCB 1PEZA 4TUJA 2GTZB 1JHLH 2ENYA 2UUDH 1RJCA 3U7WL 4OTXH 3RZCB 2AEPL 4S1RH 3DROB 5FM8A 5IVXE 3UZEA 1KEGH 2R69H 3LEXA 1JZ4A 1QFPA 5IBTL 4YUEL 4S0SD 3VWJC 3G5ZB 3GSXB 4PS4H 4X8JB 1CDUA 1BFOB 2QSQA 3KPSE 3LRHA 4XP1L 5IESH 3KPNA 2AJXL 1V7NH 4PGZA 5ACZA 2QSTA 3W9EA 1VENA 5E9DD 2G60H 5DD0L 3MV7A 3U4BH 2E7CA 1FV1A 3T0VA 4R2GD 3D6GA 3BPLC 4CW1A 1J05B 5ID0A 4JRXD 1JPSL 4IRSA 4AENB 4O58H 3HAEG 4MQ7B 3T3PE 2Q6WB 5CIPH 3N0PB 4D0BA 3H9SB 5EIVA 4XI5C 4DAGH 3Q2CA 1SEQH 4OIIH 5I1AA 1JTOA 2UWEF 4ODWB 3DX8B 3EOBA 4KTDL 4X6DF 1A6ZB 4W6YB 4TUJB 3FB5A 4AEFA 4IRJD 5DLMH 4AIOA 3VWJA 1MFBL 1U3ZA 3U0PB 4KV5E 2EKSA 4PLJD 4OFVA 4Z7UF 1VA9A 3L1OH 1QLEH 4M7KL 3QG6B 5GPRA 1LQVA 4WU5B 5E6ID 4P4KC 4GAJH 4XBGA 5JHLL 3C5JA 1VFAB 4XPTL 3GUTB 3W9EB 4LLAA 2VLMD 1KCKA 4CJ1A 2MJWA 3AFLA 3MV7B 5DRNB 5TFSL 4KDTC 1VDGA 2XRAL 5DEZA 5B39G 4C4KO 5EWIL 3C5SA 1I7RA 1QSED 2IBZX 5GSVA 4IRSB 1RUKH 1G9NL 3NZ8A 1OTTC 2DQCH 4F7PA 4RFOH 1QFOA 1FE8L 4LSDA 4D0BB 4IBLT 1JHKL 3ROOA 1INQA 1UB5B 3QIUD 1U8MA 3S34H 1AE6L 3RHWK 4PREA 4PJ5B 2R1YA 5K59E 3EOBB 2OM5A 2O5ZH 3A67L 4NP4L 4G8IA 4L3EA 3NIDE 2F5AL 4OQTL 3FB5B 3KPSD 1UCBH 1YN7A 4P4KA 4U1IA 4KZDH 2HT4C 2P7TA 4M1GH 2YA0A 5DD1H 5DFTA 4G6AD 1ORSA 2LE9A 2VR5A 3VRLF 2IFFH 4FNLL 1XCQA 3SHSA 1V3JA 4KDTA 3C60D 4JVWA 2BSTB 1DFBH 1SJVA 4NQEB 3LB6C 4MAUL 1EFQA 2PW1B 3TZVC 4XCCL 4EIZC 1OTSD 4LVOC 4I2XE 2FZ3B 3T77A 1DP0A 1A6WL 1H3GA 3WXVL 3C5SB 2QR0A 2Z93B 3TPUB 3I9GL 5IKCA 3NZ8B 4IDLA 1CL7L 5AYUL 3EZJB 4R26H 1UXSB 3G6AA 2MPAH 4U1LB 4KRMB 3ROOB 1YPZB 5C0BB 1FYTA 5CD3B 3QULA 4YHLH 4HH9A 4NKMA 3NCBB 5AZ2L 3K8KA 5ITFA 2BC4A 2V5YA 3ZE1F 5EZIH 3MNVB 1IL1A 3KPOA 2L0DA 4G8IB 4L3EB 2H2PD 1TVHA 4RSVA 4LKXB 5E5MA 1IEAA 4HXAH 1YN7B 2Z8SA 2GK2A 3LKQA 2LQRA 4U1IB 3LD8B 2VQUA 3SCMD 2ADJB 3IYLW 4BFBD 4DN3L 1KV3A 5HHPB 3PWPD 5JQ6L 4ENED 4CKVX 3TZVA 4L8CA 2UVEA 2IPTL 3O3AB 4Y8DC 3EJJX 1T2XA 1QBML 1P4LA 3OB8A 1CBVH 3PP3H 2VZOA 1QLFA 4NZJA 2EEBA 3IU4L 5F72S 2A6JB 3RZWA 4Y5YC 5FYKL 3T77B 3GBLA 2VXUH 2QR0B 2VXQL 5E4EC 5EBMB 1U91A 3MLRL 2ORBH 2H1PH 4X6BA 2K7QA 4RGNE 3M07A 2AS5M 3FO9A 5J3HC 2MCPL 1AY1L 1NC4D 4ZTPL 3TNMB 5A3IC 5TE7L 5F9JA 4HWUA 3MJ8B 3MRNA 4LCIH 4XCNB 4S1SH 3QXAA 1WAAF 3LKQB 1JGUH 2OK0H 3VG9C 4YX2L 1NMBH 3RWDA 4JN1L 1I7UA 2XG4A 4PGBB 5CKGA 2EDFA 1RZKL 3FQTA 5HHOE 4L8CB 3Q6GH 4LVOB 1KXQE 1YJDL 2VN7A 3LAFA 4Y5YA 1J0IA 5BMFH 1MFNA 4WY7H 1P4LB 5I15L 1YYLL 1I1FA 4UILL 1QLFB 5HHVH 4Y16B 5T3XH 1HCFX 5IHBA 3AC0A 3MUZ1 3GSNL 3QDMA 1UKTA 4JO3H 3L7FA 4LIQL 3P4OA 4RMRA 5IOPA 1A6VL 4NHCH 4X6BB 4KXZH 3FO9B 3RJDA 5SX4H 1D3CA 1MCPL 5F9JB 5FYJU 2VB5A 3HNVH 1JZ2A 1LMKA 3RQ3A 1CS6A 4N0CD 3FMGH 1WC7A 5TF1H 3GB7A 1VADA 3QXAB 3HMXL 1CGUA 5HVGB 3SDYH 2UZIL 2NX5E 2NXZB 3R8BB 1I7UB 4ZNCD 2B4CL 4PUBL 3WFZA 4POYA 3QAZB 3MLYH 2YRPA 3FQTB 2JCCB 3WLWC 3PJSB 2XYCA 4HKJA 3QEQA 4YNYA 3FRPA 5DK2A 3OAUH 4JGMA 4LDEB 5E4EB 3EYVA 1I1FB 1KTDA 4KXZI 3QWRA 5LGJA 3SGKA 1BQHA 5E8OB 5SX4I 4RGND 5K9OA 4K23H 5I76A 3VXMB 3NH7H 4DKFH 1B0GA 1R3IH 5BQ7A 4KJWC 2P43B 3QDMB 3W9DA 4ODTH 2F8OA 4EKXA 4J3SA 5IOPB 3JTSA 3O4LB 4G8EA 4G8GE 4XB8A 1QSFA 2BVPB 3SOBH 4GXVL 4W81A 4WHTA 3GI9L 1HINH 1JNLL 3RX7A 4D9RE 3F65A 3PABB 5ADPH 2R29H 1MRDL 3HRZB 3KPQB 1CE1H 3DSNA 2V7HA 5HHOD 1HH9A 1WC7B 1ZLVK 1VADB 1KJVA 1WWAX 3UJJL 3S96A 3EGSB 6FABH 3VXPA 4HDIA 4XP5H 5EPMA 4Y2OA 2ZG1A 4DK3A 2DKSA 4J3TA 2ZWLT 5JMRA 2FJGA 1RJLA 3QISA 3PWLA 4XNYH 1X5AA 4U7SA 1J1OL 4IOFC 1QOKA 5DK2B 3EYVB 1SY6L 5I1JL 5L88L 2I5YH 5JIKA 5LVEA 1KTDB 5LGJB 4UV4L 3KNBB 2JTDA 5EBGA 2ITCA 4N0YH 5D93C 3VD7A 1JTPA 1B0GB 4MZ2A 3ZKXB 1KPVB 1NGXB 5HYJA 5BJTA 4OD2A 4QXUH 4A6YL 4Q97A 3L5WA 2ZUUA 1MFCL 3QI9C 5KVEL 2X1WL 5DMJB 3JTSB 3KPRD 3ELAT 1N5AA 4ESKA 2R4SL 4G8EB 3VFWA 1QSFB 3CDYA 1G9NC 4AIZA 4ZAKC 4TVPH 4WHTB 1RIHH 3F6IA 2HT2C 4GRLD 3N85H 2PYFA 1GGUA 1HYSD 3S3PA 4WUKL 4MS8C 2IGFH 2VLRB 5ITBL 1WJ3A 4L1DA 1HH9B 5LBSH 3SGDH 1INDL 3S96B 2DLFL 3B6SA 1G0DA 4O51B 1MLBB 4HDIB 2AAVA 2EXWD 4HWZB 5EPMB 3UTPD 3T0XA 3PHOB 3D9AL 1AXTH 5KVDH 3F12A 3S88L 1RJLB 4HC1L 3PWLB 2XA8H 1FG2A 2VLJA 4OD3L 4RMVA 3QNXB 1ZHLA 3ZSSA 4DWHA 3KHQA 2ZPKH 3TWCH 4KJPD 1TXKA 4HIJA 1EO8L 4WW1A 3IFNL 1XFPA 1XF1A 2LVEA 2P8PA 3DPBA 3QI9A 2ITCB 2ESVE 4G8GD 5DJCB 4XCYB 1DBML 1CXLA 3EDEA 1QPPA 1FIGL 2NY0D 4D9RD 2EYSB 5BJTB 3QUZC 1UFUA 5HYJB 4ZAKA 4DGVH 1RSFA 3LSOA 1AGDA 1YMMB 3SGDI 4GFTB 4FFVD 3V0VA 3VFWB 2X1PA 1QR1B 4MS8A 1OP3H 4AIZB 2CKBA 1BM3L 1JFQH 1AHWC 1AJ7H 4F7MA 2Z31D 3FHAA 1FZJA 3KJ6H 4K7PX 1FORH 3C5ZC 1Q9OA 2J6EH 2ZJSL 3GRWL 5A2FA 2CPCA 3WD5H 1T2JA 3LRSA 1O7SA 1WICA 3T65B 3A6OA 3O8XC 1NCCH 1HNFA 3ZKSD 5LXGH 1IBGL 1A7RH 5I1KL 2A6KB 3T0EC 5EZOH 5JXEC 4KQ4L 5EO0B 5CGYD 1OVZA 3F12B 2XTJE 2VLJB 1EX0A 3C08L 3UPCA 4FG6C 3DNKA 1ZHLB 3AREC 5D93B 2B7DT 1KEML 4HIJB 5E94A 4WW1B 5F7KC 3OKEA 3QUZA 3QI9B 2DI7A 3VD3A 4JFZH 1JHLL 3OAYK 4W68A 5E8PA 2BOBA 1ZGLB 4OTXL 3OKMA 4S1RL 4I4WA 1AHWA 3UEZA 3LSOB 1KEGL 1AGDB 2R69L 4TYUA 3IVKB 2VQTA 3C5ZA 3L5XH 1QACA 4PS4L 4PJGA 2CKBB 3SDXA 5IESL 4LRNL 1V7NL 1ZHKA 2V6HA 4WW2C 4OV6F 3VA6A 1KLFA 1OAKH 4OZHE 1Q9OB 2G60L 1LNUA 3CH1B 3C2SA 5I1HH 4KKAD 3U4BL 3LRSB 5JXEA 3T0EA 1KIRA 1J88A 3CFDA 4PJCE 5IV2B 4O58L 4PJFE 1W2KT 1TENA 3O9WC 3AREA 4OF8A 1PKQE 4N1HB 4UU9A 1MNUH 2ESVD 4DAGL 1B9ZA 1SEQL 3ZMRA 3ARBD 3VH8A 4NUGH 1XGTA 3MLZH 4OIIL 3OB0K 1RZKC 3FONB 3UJIH 3QHTC 3OKEB 5CMAB 1YJDC 2OL3B 4OFKA 1MJ8H 3PWNB 1ED3B 5MI0B 4GAYA 5DLML 3OKMB 1S7UB 4LGPB 4I4WB 1ZVYA 4XP4H 4LNRB 3L1OL 1QLEL 4WW2A 1HHKA 5HPOA 4I13B 2VLKA 4GAJL 3AAZA 3CAFA 3ZDYF 2X89D 1U3JA 1X3DA 2ED9A 3B5HA 3FT2A 1OTUD 1T5XB 3VFTB 1ZAGA 3HZKB 4ONHA 3BN9C 3O9WA 2APVA 3QDGE 4KJQC 2XTJD 4FMKA 5SWQB 2XWBB 4UB0L 3R0MA 1NMCB 5JIPA 2DQCL 4XX1E 3QJFB 3TN0C 4RFOL 3V8OA 4LL9A 2A83B 4OQ1A 2CO7B 2YD4A 4YQXH 4JRYA 1B6UA 1A0QH 1UACH 2FD6H 3VH8B 3S34L 1XGTB 5A16B 2Y07H 4HIIA 2P5EE 3ZDXF 3JBG7 3NTCH 5FA4B 1T66D 1FRGL 2O5ZL 5AAWA 2O5YH 4NHUA 3JV6B 1T1ZA 4K3GA 1TQCC 3G5VA 1NANH 3UTSE 3IFLH 1UCBL 1FBIH 2NY2C 4QOKB 3GSNA 2FIRT 4KZDL 3MJ9A 3MRGA 4RZCB 4WW2B 4M1GL 5DD1L 5HVHB 2IFFL 3CSYB 3D0VA 2VLKB 3AAZB 1ZA6A 1DFBL 3W81A 3FT2B 4N0UB 4PJAA 3TESA 2VR9A 1YY8B 3MV9A 5F93C 2X1OA 5MENE 3QIWC 3TN0A 1QRKA 4NZTL 1TCRA 3D5OF 1FVCB 5I71C 2X41A 3V0AC 3FOLB 5EO1A 4R26L 3VXSB 1MUJB 4YHLL 4HIIB 2DMCA 3WXWH 4S1QH 4F8TA 4H1LG 4LCCB 4EI6A 5EZIL 3WKML 3D3VA 3T2OA 1CGXA 5IB2B 1GGTA 2VDRH 1TVBB 1MCBA 3G5VB 4HXAL 4G9FA 4BKLA 1P4IH 3MRGB 4WDIA 2XG5A 2R39A 5ANME 3QDGD 1X5XA 3D0VB 2GJZA 3S37X 1WWCA 1ZA6B 3QIWA 4KK5D 2VAAA 3R06B 4U1GB 4KC3B 1F8TH 3TH2T 1CBVL 4W6XB 1G6RH 1XZ0B 5BVJA 4C56B 3IFPA 2PR4H 3MV9B 3TN0B 1ES0A 4Z95H 3LDBC 3SGJC 1C7SA 2VXUL 2GK0B 1I4FB 2EKJA 1QBBA 4P0DA 2P5ED 3GBNH 4FXLA 2ORBL 5EO1B 5B21A 3BWUC 1Q1JH 3DETD 2H1PL 1G0YR 1FVDA 2H2SD 1JYXA 4FQXB 1S5HB 1BIIA 1KJMB 3CFEB 4GO6B 3CJJA 3L3JB 1PFCA 1UJ3B 1U42A 5IEKA 2NY2B 4TSCH 4OGZA 3D3VB 4F37K 2NY3C 4ZYKA 4CN1A 4LPUA 2MFNA 4LCIL 4S1SL 4GG8B 1RU9H 1JGUL 1FL5A 2OK0L 4KH2A 4BKLB 2CRMA 1NMBL 2VZVA 1ZKAA 3H3BC 4D3CH 2Q1EA 3D39A 1MHCA 1MELA 4PJHF 3I3BA 5MEND 5EA0H 1H8SA 3Q6GL 1I3VA 1D5ZB 3QIWB 2VAAB 2ERJC 3RNKA 5BMFL 4WY7L 3SGJA 1Z9MA 5I71B 1U0QA 4E41A 5BVJB 3O45A 3KPMA 5FKPB 5HHVL 3VI3F 5T3XL 4U3CA 5BOPA 3FQXA 4ZODA 5DHYA 3UO1H 1HSAB 4PGJA 5F8QC 4I77H 2J2ZA 5KSAD 4H8WH 1BZQK 4NHCL 1T04A 4HC1A 1BIIB 1GRWA 5I30H 1QP1A 5E8NB 5HHXH 4OFPA 1EHNA 5IEKB 3FQRA 1C8PA 1I1AB 3SDDC 1A6TA 3HNVL 3DUHA 4PTUB 3FMGL 5TF1L 5C8JA 1FL5B 2X10A 3SDYL 2HH0H 1WFNA 4IMKC 3I3DA 3ARZA 3D39B 1IILE 1MHCB 3MLYL 3EOAA 3G5XA 2Y7QA 5HPMA 3PGCB 3RNKB 3FQUA 3OTTA 3OAUL 2EE2A 5E8EB 3VU2A 2HWZH 5I2IA 4KU1A 1QNZH 4YR6A 4E41B 5JPMB 1KC5H 3O45B 3KPMB 1PZ5A 3HE7D 4JKWA 1VGKB 2I24N 1FFPB 3DX7B 3QEUA 4K23L 5JW3H 4DKFL 1R3IL 1ITCA 2F53E 5FB8A 4PJ8D 4ODTL 4ODSH 4UOW1 1T04B 4C54A 3SDDA 3K4DA 2NY3B 3AB0C 3DSFH 3SOBL 1AXSA 4YK4C 3PNWA 3HI5H 5DJ0B 1HINL 3C09C 3BHBA 1T22B 5ADPL 2LAAA 2R29L 4PJIF 1A6TB 2QLVB 1FYHB 4IMKA 3U2SA 1CE1L 3WKNA 5IVNA 5C8JB 4P2RE 1E4XH 2YC1A 5ESVA 4JY6A 2CDGA 2OTUA 2AXFA 5E2WH 6FABL 5GGSA 4XP5L 5B39A 2DI9A 4JFEA 4RAVB 3EOAB 4ZO7A 1LEKA 3ROLA 1CICD 2SEBA 3HAEB 4XNYL 3G6JB 3DO3A 1W0WB 3OF6D 3QPQC 5F8RC 4CADB 2GY5A 4NZRH 4PJDE 1PZ5B 5J9PA 3MLWH 5K9QI 5CS7A 1ZXQA 3MXVL 3AS0A 5D5ME 4N0YL 1WQVT 3VD5A 4YZFF 4IDJH 2DLHA 3U7AA 5FF6A 3WNNA 3B3IA 1XIWB 4PGCA 4PRBB 4MCYA 4QXUL 3VXNA 4OAWA 4BZ2H 3N06B 1E4XI 3B2VH 5DC0A 4LGSB 4Q2ZA 1ND0B 4HUKB 3GHEH 3SDDB 1AXSB 1JF6A 3PNWB 4RMSA 4TVPL 4WUUA 1UYWH 3BHBB 3RU8H 2W0FA 4Y5XB 3N85L 4P48A 5IFHH 2IEPA 3BH9B 4NT6A 3U2SB 2IGFL 4LCYB 4PDCE 2YC1B 5ESVB 5LBSL 5C3TA 5D7IF 3RIAF 2VXTH 4FFYH 1S78D 2AXFB 5B38A 2DTMH 5HDOA 5FM4A 4EN3D 1U58A 2M8XA 5F9OH 5B39B 2X4QA 3O3BA 4JFEB 5TDNB 4Y1AB 1JIBA 3ROLB 3T4AA 1AXTL 3CVHH 5KVDL 2XA8L 3QXTA 1S7RA 1IAOA 4K2UL 2ZPKL 2X40A 3TWCL 3C8KA 3UAJD 3CFKA 3C9NA 5FF6B 3B3IB 6CGTA 4LAQH 3AB0B 2D31B 1KUMA 4MCYB 3U79A 2JJVA 3X12A 4DGVL 3C09B 3RGVD 5J0BA 5I1GH 5D7KE 2ZSVB 3T3MF 3ZL4H 4P2RD 1LO3H 5HHMA 2DDQH 2YPLE 4WUUB 1S9KC 4CVXA 4FA8A 5D2NE 2H32H 1SM3H 2W0FB 3KJ6L 1FORL 1ZE3C 2J6EL 4X7CC 3WD5L 3AM8C 5BZWA 4WTXA 3WV0A 2D7OA 2MQ3A 1BAFH 5CJBA 1NCCL 4R3SA 3EJYD 1NBYB 4MJ2A 1A7RL 4O2EA 1U58B 3F7YA 5EZOL 5JOPE 1FNAA 1X4XA 1OP3K 4ODBD 1AR1D 2GSGB 2XQBH 1MF2H 4UZGA 4O5LH 1S7RB 1OSZA 3O2VH 4JM2C 3KYOB 4PY8J 3MJ7A 4NN5C 1AQDA 5K9JH 4QY8A 5CJQH 3C8KB 1T0MA 4KROD 2WQ8A 3UJTH 1LP9B 3CFKB 4JFZL 5E6YA 2F8XC 2BNQA 1BIHA 3MRBA 4JFFB 4BUGA 4Y2DB 3LN4A 4JFOA 2W92A 4YHZH 4HJJH 4KK9D 4WU7A 4MA7H 1I9IH 4FQCH 2VABA 2MMXA 1JWMB 1UKQA 3IDJA 3FAXA 5L2JA 2WY3A 4KQ3H 5CEYB 1F3JA 3D85B 4PJ7A 3SPVA 3TCLA 3I2CH 5FA3A 3WIHA 1WITA 3L5XL 5HHMB 3AM8A 3IDNB 2DL9A 4YE4H 4CVXB 5JORA 1Y6NR 5I73B 1TPXC 1S7WB 1OAKL 4NQDE 5E8DH 5DMKA 1JPGB 5I1HL 3TYFA 3HAEH 2WZPD 2M26A 3MRHB 4Z7VE 1Y0LB 1FNSL 3MV01 3QR2A 4J6RH 4O2EB 4LLVA 3RA7H 3F7YB 5ESQA 3C6LC 5JO5A 2VZUA 5IMOB 3RI5F 3QRGH 4RX4A 3DYOA 1MNUL 1SVZA 4CAGA 43CAA 1OSZB 5HYIA 3RPIA 4NUGL 4O2CA 3BDXA 3EYSH 3MLZL 2N1KA 1IM9B 1LEIB 5FYKE 1PAMA 3UJIL 1T0MB 3HMWH 3MZGB 3N9GH 5D7KD 3DMMD 1H3TA 5HD8C 3WIFB 5CZXD 5DZNA 3MRBB 1MJ8L 4KI5E 1QG3A 2YPLD 5D7JD 4WU7B 5CJXC 4XP4L 5FIEA 3IDJB 1RHHB 5L2JB 5EB9A 3X11B 5I1EH 5ELIA 3SPVB 3HE6D 4PJ7B 1P5UA 5F1OB 5IFJB 4LCWB 3HUJB 3MOBH 3RWEA 5JORB 3IDMA 1I7ZA 4OIBA 1MHEB 4XNMA 5DMKB 5JOPD 4LDOB 2PYEE 3C6LA 2EIZA 5LAXB 3RWFA 3TYFB 3P40A 4OI8A 2WM0A 3IU3A 4PBWD 5JIIA 4LLVB 2C1PA 4X6EA 5JO5B 3C8HA 3OZ9H 4NN5B 3B5TA 3N50A 3IXTA 3MLTB 4YQXL 2HMID 4W4OC 5JW4N 5CILL 4I0PC 4D9LL 1A0QL 1UACL 5F89B 2FD6L 4UDTA 1SJXA 5C0CB 2WBKA 2Y07L 3OG6B 2PUQT 3E3QC 2LFGA 4X4YB 3RGHA 2Z8WC 3NTCL 5MP6L 3L5HA 3ZTNH 1YUHA 5DFVD 5IFAH 5CJXA 2O5YL 1A9EB 4U1MA 3IDGA 3GMOB 3O8XD 1QRNA 2XN9B 3QDJB 4L4JA 1S7SA 3IFLL 1GXEA 1FBIL 1HKLH 1EHAA 5JXAH 4NQDD 2GJ6E 5DD3H 1T0NA 4X6DA 3GJEB 4NO0A 3SKMA 3RWEB 4XWOC 4Z7OE 1SHMA 3LPGA 4OZGA 4Z7UA 3BEWB 3OKOA 2GSIB 4M4RA 2X4NA 5EOQH 5T33H 3RWFB 4Z0XB 2Q8AH 3IU3B 1P1ZA 4N5EC 4W4OA 2EH7H 4I0PA 3L3DA 3OHXA 5HTSA 3UTQB 5GRUH 4GRWF 3DGGA 5F7YC 2YUWA 4P2QE 4WIQA 2C1PB 4GG6E 1IE5A 5FYKD 4X6EB 4WI6A 1HIMH 1L7IH 3E3QA 4ALAH 4EQ3A 4BSVA 3IXTB 3MROA 4YBLB 3T4YA 4YFDB 1HE7A 4UDTB 4NZDA 3K81A 5KN5A 3WXWL 2EDXA 4LEOA 4S1QL 3ILQD 2XZAH 2FH6A 4OZ4B 3FQNB 4TULH 1YUHB 4PRPE 3U9UB 12E8H 1BQLH 4U1MB 4C55A 2VDRL 4NN6C 2OJEB 1QRNB 4NCC2 1KB5H 3ULUH 3VWKD 1A2YA 3CU1A 3X14A 1TMCA 2DQUL 4XVSH 2UWEB 1T0NB 3B2UD 4X6DB 3WNLA 5GZNC 1FL6A 2PYED 5HYSA 1G7PB 3P11H 1JPST 1GPOH 2CDFA 4NO0B 2B1AH 1VSCA 3CPLB 1EDQA 1L9MA 1F8TL 1R5WA 5DEGB 3V5KB 4N5EA 1GZQA 4TSBH 4Z7UB 1G6RL 1WEJH 3OKOB 5B8CC 2X4NB 3ABZA 4MMXC 4Q0XH 2A6DB 4Z95L 4HJ0D 4GBXD 4P2CG 3QUMA 1EV2E 4NO3A 4QRTB 2IH3B 3R0NA 4I0PB 3GBNL 3MJ6A 1YYMH 1MAMH 3G5YA 5T1MA 4S0UC 1Q1JL 3QWOA 3VFPA 3MROB 2D7TH 5D1ZC 3RVWC 3CSPA 1IKNC 4KV5F 4JFDB 5KN5B 1M7XA 1OGAA 3MOAH 4LEOB 4OGAD 1J0ZA 4M3KB 4NBZB 4U6TA 3QFJA 1MJUH 4TSCL 2OMNA 2GJ6D 4YHIA 4BELD 1QR4A 3JTTB 2DTSA 5FO9A 1RU9L 1X5IA 3X14B 4HKBA 1ZS8A 4I3GA 5F96H 5EBLA 1FAIH 1JVKA 3DHJA 4D3CL 3FO1A 1S7QA 1OT1A 1D5BB 5EA0L 5B8CA 2CDFB 3S5LG 3TT3H 4ZXBB 2FJFA 4P2QD 1GZQB 4LSTH 1G7QA 4Y19E 4M5YH 3H0TA 1B3JA 3GEWB 1KIQA 3CSBA 1NFDF 2R2BA 5DGQA 3LHPH 2X4PB 4CGTA 2NY6C 3HG1A 5D1ZA 1PGRB 4ACPA 4NO3B 4MD5A 1MCCA 3K46A 3G5YB 1ERNA 1NKOA 3UO1L 3QJHA 5AG9A 4I77L 4PRPD 5GGTA 1MCKA 4I48B 3DYMA 5DJYA 4NN6B 4Y5VC 1OGAB 5I30L 3LKNB 2C3HA 5HHXL 3QFJB 3ZE0E 4OLUH 1NUGA 4YHIB 5FO9B 4DZBA 3B9AA 1A3LH 3MRMA 4HKBB 2HH0L 1KXTB 5CAYB 5EBLB 1C16A 3VXRA 2AJVL 1AGEA 5CLWA 5KS9E 3LH2H 1N8ZB 2FJFB 3V52H 2HWZL 3KPPA 3TFKD 1QNZL 1KC5L 4RCAA 2YPKA 3H0TB 2AJUH 5DK0A 2ZUWA 2R2BB 1X5FA 4JN2B 4PRHA 4X6CF 5JW3L 1F4XH 4MD5B 3WO4B 4ELMA 3WS3A 1A4KA 2P48B 1U95A 4MAYC 5HYEA 5M7QA 4Y5VA 3UXFA 2EH8H 5DZLA 5ICYA 1RVFH 2MHAA 5C08E 1DTUA 2ZKHH 1VFUA 4X9IA 4CVZA 3DSFL 5DJYB 4QRRE 3JV5A 3V7AG 3HI5L 4V2CB 2O61A 3BSZH 1CTOA 4OZIA 3VI4E 2YBRA 2XQYK 3BVNB 3W0WB 2X05A 1E4XL 3RKDC 4DZBB 3L3IB 1MRCH 5E2WL 5T5FH 1MREH 3VDAA 1C16B 4Y19D 2EICA 1K8DB 1AGEB 4MNQB 5KSVA 3ZE2F 1X5ZA 1QFHA 3NPZB 2DIBA 5J6HA 3WUWG 1DDHB 4Q9QH 2HFFA 4NZRL 4WJ5B 2YPKB 3MLWL 1VCAA 1CFNB 4MAYA 1Z9LA 1D5XB 2EDWA 4IDJL 4K7PH 4FQPA 4OUUB 4JQXC 1A4KB 5D1XC 1I9JH 1H3VA 5DHVB 1D9KD 1P7QD 4BZ2L 2BOCA 1NDMA 4N0FA 3B2VL 4X99A 2JLLA 2CLZA 4LHUD 1JV5A 3GHEL 3FRUB 1U3HD 4LFHD 1JGDA 2R2EB 4JCMA 3RU8L 4YO0A 4UI2A 3QBTB 4V2BA 4CDGC 2HFGH 5IFHL 2PTTA 4UQ2A 1HHIA 4K55A 4DKAA 1JPFA 2VXTL 2E3VA 4FFYL 3TIDA 3QO1A 1KCRL 5B3JF 5JTWA 2DTML 4WI8A 4W6WB 5F9OL 3MODH 1MWAH 3DURA 5CP7A 2CRZA 3VFRB 1H8NA 3CVHL 4O02H 4NZUH 5J6HB 3EO0A 2AI0H 4P5KA 2AJSH 2HFFB 4JQXA 1WCBA 1A7OH 5D1XA 2FRGP 3HC0A 4S11A 5KVFH 1PLGH 2VZ1A 3FO0H 5C08D 3U46A 2GCYA 3H9ZA 4MCZA 3KXFE 4QRRD 4LARH 3VRIA 4LAQL 5J57B 5EFIA 3H2WA 2BOCB 1NDMB 3ULSB 4X99B 5I1GL 1JV5B 3ZL4L 1TTFA 1LO3L 2DDQL 3GSWA 1NGPH 1DBJH 3MBED 2P45B 3GMRB 4F80A 1SM3L 2EDYA 5IB1B 5EIIA 4XBPB 3D18B 2HAZA 3U4AA 2XTLA 5I1LB 2X44D 1BOYA 5LWYH 1BAFL 3P73A 4RWYH 3QO1B 1NSNH 3NCCB 2Q76B 3A6CL 5CP7B 1I8MB 3MRPA 4QNPF 3PWVA 2XQBL 2EXYD 1MIEH 4NKIH 5FYLL 1NBZA 1MF2L 3P4NA 4O5LL 2BNRA 1AGBA 3L9RB 3O2VL 3RFZC 2HLFD 2WUBH 3H9YA 1MCDA 1X4ZA 5DFWH 2ED8A 5K9JL 4RFNC 5CJQL 1ZLUH 1X5JA 3HC0B 3U46B 3UJTL 4H1LB 1UKSA 2EDHA 4MCZB 3PUCA 4YHZL 1A4JB 4HJJL 4WNQB 1MAKA 1I9IL 4MA7L 1ADQL 2C26A 4FQCL 5C0DA 3MRIA 4X6FA 3TCXA 4NQXA 4KQ3L 2HVJA 3QFDB 4RFEA 3CZFA 5F70A 2OSLB 3I2CL 4UT6H 4HUMB 4XCFH 4YE4L 3GSWB 5HY9B 4B0MM 3NABH 4G6FB 3OXSA 2Y6SC 1IGYB 5EBWA 3HHRB 4GH7B 1QYGH 4ISVA 4ZDHA 5EIIB 3BZEB 3E6HA 2Y06L 3P9WB 5E8DL 4ELKA 4LPCA 4JY5H 3E6FA 4U49A 5EO9B 5JOFB 5SX5H 4LF3A 2CSPA 1FLRH 1IC7H 4N8PA 4J6RL 3NCYS 3QQ9C 3RA7L 2ZCHH 1LEGA 3K74B 2XWTB 3MRPB 2XY1A 3UBXA 3QRGL 1DQQB 1NBZB 2UV3A 3F8UB 4YDVB 2BNRB 2OZ4A 2QV2A 3KXFD 3EYSL 4ZUVA 3NCFB 5EUKA 3H9SE 4JDTH 5DHVH 1FC1A 1JUFA 4LSRH 3HMWL 4XTRD 2QHRH 5DVLA 1PY4A 3N9GL 4TNVK 1DQJA 2IPUG 4K9EC 3UP1A 2JJTC 2CIKB 3BKMH 4NQXB 2BRRH 5EC1B 5I1EL 4RFEB 2E27H 1AFVH 3AU1A 4KK8C 5J1SC 2X6MA 2YD3A 1N5YH 2FO4B 2OMBA 5IB3B 3ULVE 1E27A 2X4SA 3MOBL 5EBWB 1VEMA 5FO7B 3IS1X 4CMHB 2HKHH 2IQAB 2WIIB 4J3UA 4P2OD 3E6FB 4LF3B 1HXMB 1N59B 3NA4A 4NC1E 1EEZA 4KWUA 5FHAH 5GRYA 3RVTC 4XH2B 3DV4A 1P2CB 3WIIH 5DJ6A 3OZ9L 3ZT7A 3JWDH 4PV9A 2B1HH 2FO1A 3MCKB 4V1DE 1ACZA 3PXJA 4XGZB 4PTTB 2JJTA 4YWGH 4R7NA 3PIQA 3SDCD 3ZTNL 1NEZB 5T3XE 1WCQA 5IFAL 4P46C 2GHWB 3PDOA 3RZCD 1RK1A 4PJ5E 1PQZA 3DGCR 4KRPB 5ECJE 5KOMC 1HKLL 1AD0A 4WWKD 5EULV 4WI4A 3L7EB 4X7TA 4YAQA 5JXAL 5DD3L 3AU1B 3K7UA 3UZVB 5EUOE 3PQYD 1HILB 1ULVA 4L8SA 4MSWB 5ISZB 5IGXH 4JM2D 1E27B 3ECBA 2VDNH 2V17H 3DXAA 3KPLA 4JHZA 4AEEA 1DANT 5KJRH 4MB5A 1OAXH 4KAQH 4MDIB 4XP6L 5EOQL 5EU6B 5T33L 4JKPH 4ZFFB 5BXFB 3MRLA 2Q8AL 4NQEE 1FFNA 2J4WH 3ZKMD 4OCRH 4XVJH 4G6MH 2EH7L 4MXVE 1P6AB 5GRUL 3DV4B 4LQ1A 1CD9B 2NY1D 2VERN 2ZCKH 5DJ6B 1HIML 1L7IL 1RZFH 1S8DA 2YD9A 4OGXH 4EUPG 4ALAL 1NL0H 4PV9B 3TPUE 4P46A 2ARJQ 5HDBE 5E2VH 3DBXA 1I85C 2XZAL 2VH5L 4TULL 3MCLH 5HGAB 5HGDA 1YPZE 2Q3AA 2VIRB 4UAOC 5C0BE 12E8L 1BQLL 1CLZH 3G6DH 1S9XB 3PDOB 4D0DB 3QQ3B 3L3GA 1KB5L 1VESA 2NY5L 3OJVC 3ULUL 3LQZA 3WL9B 5HGGS 4XVSL 4YAQB 4Z7WA 4PJCF 5L0QC 4L8SB 2WBJB 2OQJA 3P11L 1MIMH 1MCNA 2VQ1B 2B1AL 3ECBB 1XR8A 3SDAB 3DXAB 3KPLB 4KKCC 1N4XL 4TSBL 4MB4A 1BZ7B 1WEJL 4M62H 3BPCA 4L4TD 1EIBA 4JREC 3CVIH 4Q0XL 4OFDA 4MD0A 4Z76A 4R4ND 4V1DD 1YYML 1MAML 4JPKH 3OWEA 3RVVC 4JDVB 5T3XD 4HPYH 1I85A 2D7TL 2ITDA 1RZJC 2MQCA 1MFDH 3DIFA 1S9VB 3QP3A 4I0KA 1Q94A 5FUCE 4PJ5D 1OWRM 3FKUS 5IB4A 3TM6A 2XPGA 2J5LC 4JKLA 4KKNA 1LO4H 1U2CA 1MJUL 5HGDB 5F1KC 1XGPA 5IBLD 3P0VH 1D5IH 3WDJA 3HB3C 1D5MA 4R4BB 2IBZY 1T6WA 4ZSOE 5F96L 1AKJA 2AV1A 3UYPA 4XRCA 1HNGA 2OQJB 1YZZA 2WIMA 4NQED 4GW5A 3TT3L 1XR8B 1Q72H 4LOUD 1A9BB 5JW4R 1HSBA 1HOCA 3HZYA 4LSTL 1FLTX 1FHGA 1U8QB 4M5YL 3VXQA 3AROA 4F15C 4QCIB 4UINH 5E0QA 4QHMB 4DEPB 3LHPL 1JZ5A 3W11D 4Z76B 2C4XA 5B4MC 4NQCA 2FR4B 1BD2A 5CSZA 5J06A 4ZUSB 1KSRA 4QTIH 4ZPVA 5C0BD 2ITDB 5BV7H 1FO0B 3CVHA 4UAOB 3DIFB 5BW7C 1AO7A 1IEBA 3VG0L 1BF8A 1YNKH 5I16B 1TZIA 1VACA 3OBAA 4L8BB 4OLUL 3QXVA 3MNWA 3S35H 3WHE0 3SY0B 2Q20A 1XGPB 1JJUA 3Q6FB 3BPNB 4KVNH 2E7LE 4JHAH 4DW2H 5KVMC 5FOJA 2X1XR 1TITA 1A3LL 3INUH 4WVRA 4HIHB 3VXTA 3HS0A 5FOBB 1AKJB 1J0KA 1AC0A 1EBAA 4XRCB 2W9EH 1FZOA 4F7TB 5SWSA 1YEFL 2YKLH 4JREB 1G9MH 5F7DB 3P3YA 1C08B 1HOCB 4NKOA 3V52L 4MXQD 2JCCE 5FKAA 3WNOA 5JQHC 3MLVH 2AJUL 5K9KA 3K8MA 1F4XL 4GJTB 3SE3C 3SJVA 1G7JA 2X4RA 4NQCB 5BW7A 2EH8L 2EYRA 2J5LB 4ZPVB 1RVFL 3ARDB 3NFPB 3VXME 1ZVSA 4X7EC 2ZKHL 5GRXG 1PSKH 1RHFA 2BVOB 1AO7B 4PRDA 3QDME 1R5VB 2W0LA 2OTWB 4QT5A 5GJSH 1VACB 3BSZL 3O4LE 3MNWB 1IGFH 3RWGA 3TJEH 2P5WB 4Z8FH 4AIXA 2UZXB 3H3PL 4PJEA 2F74A 3U82B 2PXYC 5C0AA 5DQJA 1MRCL 1U6AL 1ADQA 1MREL 1VPOH 2P24A 5T5FL 3HS0B 2YZ1A 1MLCB 3EYUH 3RWJA 2AK4A 5CHNA 4ETQB 4MJIA 2X4TB 4DCQA 1FZOB 3BWAA 3NA9L 1ZT1A 4ODXA 5D7SH 1OOAA 1F5WA 1GL4B 2AXJA 1UQSA 2CR6A 3EDDA 3SE3A 4Q9QL 2ENSA 5FKAB 4P23D 4Y16D 1EO7A 1NGZA 4PJHB 1H5BC 4M6NH 3V79C 4K7PL 1G7JB 4KJYB 2NQCA 4KGLA 4MHHG 1I9JL 2EYRB 4JLRB 1I3GH 5DD6B 2B0SH 4PRDB 4HJGA 4DUXA 4UDUA 4QT5B 1JI1A 4LBEA 2PXYA 1UB6A 3RWGB 1QSZA 2HFGL 3VXUB 4RA3A 1RUPH 1Z5LB 1KTRL 4LQFH 2EDTA 5EU5A 4OCLC 5C0AB 3KLDA 3CXHJ 2RCSH 1KJ2H 1XGUA 1RK0A 2VLRE 1TZHA 4L4VA 3MODL 2AK4B 4WHYH 1MWAL 4X80H 4PJIA 4MJIB 4XHQA 4DCQB 3FFCA 3NOIA 2FWOB 3AS1A 4O02L 3BWAB 1UWGL 4NZUL 3GK8H 2AKRA 3UTTA 1XF4A 1VFBA 1HQ4A 2AI0L 4LRIC 5GGUB 4TRPL 2AJSL 3CMOH 1A7OL 4G9DB 1BBJA 4X83A 1BJ1H 5KVFL 3FT4B 1PLGL 3FO0L 1UZ8B 3VXMD 1FO0H 4OV5A 1UENA 4K3EH 5C0IB 5H37G 3PXHA 4M48H 4LARL 2NXYB 5M95B 2OP4H 3BEVA 5CSGA 3O4LD 1J9CT 1QEWB 4FTVD 3ME0A 1L6XA 1IGIH 4GMTH 1X9QA 5HYJE 2XKUA 2KZ1B 2EDBA 2X1QA 1Y6KR 1NGPL 1GHFH 4D0CB 1DBJL 1YMME 2PXYB 2Q3ZA 2DM7A 5ENWA 4NQSA 5HGBA 5CGTA 1HXYA 4NN7C 5CUSH 2YSSB 5T1LB 2ICWI 4J4PD 1QQDA 3QHZH 4G6JH 1UH3A 4RWYL 5JHDA 1NSNL 2YRZA 4PJBA 4KHXH 4N1EA 2NR6D 1RK0B 5J13C 4LRIA 4PJIB 4JZOB 3EFFA 3MRQA 1MPAH 3GSOA 2NY5C 5C0EA 5E1AB 4NKIL 1MIEL 3VFSB 3ULUC 3K8LA 2MSPA 2AKRB 2XNAA 4X5XA 2RFXA 5DEFA 2A74A 2BCKA 2WUBL 3O2WH 4OZFG 3WE6A 1XF4B 2FEDD 1HQ4B 4YH6A 2DS4A 4RNRA 1BBJB 3VD9A 4PIRF 5EOTB 3K3QA 2VZSA 2VLJE 3S6CA 2DOCA 3BP6A 3IDXH 3PL6C 4HFUH 4K8RH 4ZD3H 2Y1VA 5F7WC 1FQ9C 4PLKD 4Y4HA 4XZUB 3BEVB 2JB6A 4WTWA 4O9HL 1QUNA 4M02A 5DQDL 4JPWH 4UT6L 4XCFL 3NABL 2FATH 4H5SA 1GVIA 1L6ZA 1QYGL 5MEQA 3V6BR 2VLRD 4KKBC 1HHHA 3S5LA 1HXYB 4N9OB 5IK3A 4R97C 1YY9C 2R2HB 4JY5L 5BCAA 1KPUA 1EHLH 1FLRL 2DMKA 2P44B 1IC7L 5JHDB 1T3FB 4HH8A 4NYLA 2ICEA 5DC4B 5C07A 2E9WA 2ZCHL 5D5MF 3DVNA 4HKZA 3EFFB 4KKLD 1QA9A 3L5IA 4ZMAT 1QD0A 1KENL 2DD8H 4M1CD 4AQOA 4TOYH 1TZGH 3TVMC 4X5XB 3HFMH 3PL6A 5D7IB 5EOCH 2BCKB 3WE6B 2IJ0C 4JDTL 3B83A 3B9DA 5SX5K 3BP6B 4LSRL 2QHRL 2R8SH 2IH1B 3ORJA 3BKML 4Y4HB 1YMMD 1IMHC 3QUYB 2CRYA 2BRRL 4LP5A 2E27L 5IMLA 1AFVL 3MSPA 2N56A 3T0BA 5D7LA 1E28A 4NN7B 3CXDH 1B0RA 1EXUA 4YHNA 4H5SB 4OSUL 1JF1B 5MEQB 3BJLA 2LABA 3D69A 1HHHB 2HKHL 3GMLB 1EFXA 1O0VA 1XAUA 5CD5D 3U0WH 1KPUB 5FHAL 2V5RA 1FNGA 1CDGA 1LO0H 3DRTB 2FECL 1B4JH 4XHJD 1U93A 3TVMA 4FZ8H 3WIIL 4HKZB 5C9JA 4QHKI 1DBAH 4M1DH 2VLJD 2C5DC 3KJ4C 4PD4J 5L2KE 2B1HL 2GJJA 3GJFB 2YUVA 1TFHA 3JWOH 4QRPA 3HLAA 4R2GC 4YWGL 4F33A 5INCA 4M61A 4K7PY 4LVEA 1H15B 1NUNB 1GGBH 2QHLA 5BRZB 2AK1L 2CH8A 4YFEA 2CLRB 1P5VA 3I84A 2PN5A 3I6GA 3IJSB 5IMLB 3HNTH 4JG0H 1Z9SA 1G84A 4QOKE 3W5MA 2Q7YA 4R97B 4YFLI 5IGXL 2J1KA 2VDNL 2XZQH 2V17L 4ZUUA 3QSKB 3PGFH 2AXGA 3VFNA 3D69B 5CZKA 1OAXL 4IRJC 2KBGA 1EZVX 4KAQL 3LN5A 3STZA 4Z77A 1CDJA 1EFXB 1TDQA 4PLJC 4JKPL 3WUWA 3NCMA 4CU8A 4N0UE 2J4WL 2Z8RA 4OCRL 1RZ8A 4XVJL 5E9DA 4G6ML 2D7NA 3TVMB 4U0QB 4NWUH 5E6IC 1RZFL 4CNIA 1NL0L 4PGEA 5CP3H 4U6HA 2FDBP 1DEEA 5E2VL 5A40E 3LZFH 5DVMA 4PJGF 3AS3A 3HLAB 3VXSE 3SDXF 3F7VA 4P9HC 1U8JB 3MCLL 4UNVA 4F33B 4HZAA 4M61B 1CLZL 3G6DL 2QBWA 5EU7E 4MJ6A 2EDQA 2DBLH 4HUNB 4JFYA 5I0ZA 3QIUC 4GQPH 3CH8A 5DR5H 1FZMB 2C4FT 5BS0B 1UM5H 4IRJA 1MIML 4ZUUB 3U36B 3ARFB 4WI2A 4M62L 4OJFH 4CJ0A 3STZB 1BJMA 5E6IA 4Z77B 3CVIL 2V2XB 4PYGA 5L2KD 5HI3D 4NRZB 1QFWM 1RZ8B 4K3DH 4G6AC 3P9LA 2B20A 4C56E 1P6FA 3MV9E 1U92A 4JPKL 2J3SA 1JGEA 3C60C 4HPYL 3WFEH 5FGRA 4IS6B 3QUXD 1QSEA 4U6HB 1MFDL 2V7NB 1CDYA 3RL1B 4Z18A 1DEEB 1OTSC 2COQA 2ZOKA 1BLNA 4UTBH 1J0HA 3X3GH 2FEEL 1PKOA 4C58B 1LO4L 1U8IA 3CC5B 4K71C 3QIUA 4HCRA 4M8VA 1R3KA 3P0VL 1D5IL 4QOKD 4DZ8A 3QDAA 1YEEH 3LIZH 5IVXA 1I3RB 4JFYB 3I6LE 3X3FH 3OKLA 3IDYC 1KG0A 5CJOH 1KGCE 4BSJA 4ZFGH 5JPNA 3KPSA 1N6UA 1PW3A 4HS6A 4F7CA 1Q72L 5FGCB 2H2PC 4PRIB 3V4PH 5DS8B 3P0GB 4PJXB 3SO3C 3BXNA 1TIUA 1DUZA 4YDIH 5IBUB 3SCMC 4JQIH 4UINL 4WI7A 3C60A 4GXUN 1F02I 2PETA 2GT9A 4RBPK 4JY4A 4QRSA 4ENEC 3GJFH 2DQFA 3IAQA 3VXSD 1JGEB 1BQHG 4QHKJ 4QTIL 5BV7L 1ROWA 2Z35A 4M9OA 4QRQA 1T21B 4MQSB 2VC2H 1BLNB 1YNKL 4GRWB 3PWJB 2NZ9D 2VR4A 3S35L 1L8JA 3QIUB 4PJAF 4KVNL 4HIXH 2HFTA 3EHBD 4JHAL 4DW2L 4DZ8B 1ZMYA 2EDOA 3INUL 2BMKB 4HUWA 3RNQA 1KG0B 3RDTD 5JPNB 2A0LD 1YNTA 4X98A 2XACC 5IVZB 3IF1A 2RJMA 3HI6H 1J8HB 3O4OC 1FGVH 3KPSB 2W9EL 1NGYB 1JNHA 4HS6B 2YKLL 1G9ML 5EC2A 3SCMA 3G08A 5D2LE 4FQJH 4GKNA 4C56D 3D39E 3PWPA 4H25B 4R7DB 5F7HA 2WW8A 4NNXB 5DA4A 2OYPA 3STLB 3MLVL 4WFEE 3VGAC 1DUZB 1F4AA 1ZTXH 4Q7DA 4DJMA 1CFBA 1ZANH 4E41E 3K4ZA 1JF5A 2DJUA 4J2XA 1CLYH 4HGWB 4FQXD 4Z7QE 1TQBB 1AGFA 2EYTB 2KUTA 1QSVA 3O3UN 4K71B 4UUJA 2AERT 1M7DA 1PSKL 3JZ7A 5GJSL 1OAQL 3TO4A 4WRLA 5IW1A 1IGFL 3TJEL 2YD5A 4Z8FL 4AG4H 1NC4A 4D9QE 1TETH 2ZUYA 3I75A 2P42B 3P9MA 3ILPB 4QRUA 5GIRA 4HUWB 1LWRA 3CCHA 5JUEH 1VPOL 3EYUL 4X98B 1KTLB 2HJFA 3Q3GA 1XF5A 1Y18A 1UCTA