4PRDA

Crystal structure of a hla-b*35:08-hpvg-d5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prdA01
1CE1L 2IGFH 2PCPA 4X7FC 1JYVA 1MVUA 4L8SC 5IMMA 1G9ML 1GPOH 4P2RD 3SKOA 2EZ0D 2R1WA 4XXDB 5IVNA 1DBJL 5SV3A 2Y6SD 4BSWB 1MJ8H 1I8IB 1KIRB 1YPZB 3MRJB 2YOCA 4YHZH 2MMXA 3MJ6A 4HUWB 2D0FA 4IIQB 2I9TB 5ISZE 5IMLB 2G2RB 1QRNA 2BNRD 4DKEH 5B39A 2CIKB 4WDIB 3W81A 4D9LL 1MRDL 4X6EB 4UQ2B 1DL7H 3ZE2F 4C4KO 3TV3L 1UKTA 4EBQL 1F5WA 4PP2B 4N9GB 1LMKA 5D2NC 1N0LA 1JGEA 3MRQB 5MI0B 3GSWB 1F3RB 1ES0B 2EEDA 4RMUA 5K9JH 5IWLA 3MREA 1KOAA 4KKNA 3DLQR 4X6CF 1WZKA 3DRTB 1KLUB 2Z0BA 3MODH 4ZSOE 2CIIA 3HPJB 4Q9RL 1C12B 3NACL 2I5YH 3LEXB 3MRNB 5CINH 3VXNA 3MRKB 2D2OA 4P9ML 3WE6B 4C59B 1F58L 1NAKL 3D3VA 3S34L 4G6KL 5ESVA 1Y6MR 1EJ6A 1QBBA 2YEZB 3D18A 3TCLA 1BBDL 1MHCB 2OJEA 2CO6B 4OFIA 4RGOL 4NJAH 1R24A 1R0AL 4NN6B 5D1QC 3MLYH 3SPVA 4Z0BL 1WAAF 3RWCB 2DD8H 4NQCE 1CCZA 4MNQE 3CUPB 5BVPL 4RNRA 5HVHC 1S7SB 3FOLA 1FYHB 5GRJL 4D0DB 1DZBA 4Y8AA 3IGAB 5EPMA 3QUKA 5J3HD 2VXSH 4N1EA 5H2BB 1UCBL 3MUHL 1FL5B 4OF0A 4GW4B 3P4LA 1HHIB 3Q3GB 3QJFB 2OR9H 5HHQA 2ZPKL 4M3KB 4QXTA 5IHLB 1J7VR 1LE5A 2P8PA 1A3RL 2NY5H 4KHXL 1HKLH 3MPCA 3PJSA 3QIUC 3MBEB 3TBWB 4YX2H 2X9YA 2JCCB 1AC6A 3VRLF 3TIEA 1IQDB 1JHTB 2PXYB 4MQXC 3UJIL 5E8EA 4JB9L 4XWOD 1SVZA 3MYZA 4Z76B 3NMEA 43C9A 5K9QI 1F4WL 3DWTA 4HAFA 4YC2B 4G6JH 3OF6D 2P5WA 1B3JA 4EZMA 4JFDB 4J4PD 4YHKL 2H2SD 2H32B 5F89B 1MY7A 3KPLA 1R5VB 3TN0A 4M7LH 1RURL 2EDTA 3RVTD 1ZLSL 4MJ6A 3FMGL 4RA3A 5TE7L 3QCUL 3QXDA 3AREC 1DQMH 3QIWA 5E2JA 1RJLB 4NP4H 3MOBH 4GAGH 2OK0H 4P5KA 1DQLH 4KTDH 4XVTH 4V1DB 1IC5H 2ENYA 5EZLB 2DLEA 4OBSA 3TNNB 1XF5A 1OP5H 3FFCB 4NRXA 4GRWB 3WL9B 1TZHB 5JQHC 4KHTH 1P7QB 3HZVA 4R7DA 3QFJB 4GFTB 3D25B 1A4KA 3RWJA 5H8DA 1OGAD 4P2RA 5AZ2L 3ZE2E 3D9AL 1CDJA 4Y16D 4CADA 4FQPA 4UB0H 2X4OA 4U0RB 1TJGL 4XZUA 4Z5RB 1AD0B 1IM9A 1A5FH 4HK3N 4F9LC 3T77A 1WK0A 4QRQB 3UJTH 3B83A 4JO4L 4X6CE 5F6HI 2BOBB 4R9HA 4EOWL 3R06A 4FQ1H 1DUZB 2EE2A 3C60B 3LD8B 3GSNL 1J0JA 2BNRA 5AZEH 5I1CH 4XC1L 3DVIA 5FM5M 5E9DE 3VXSE 4F33A 5BZWA 2ADGB 3KPOB 4KH2A 4Y4KB 5HHOE 1BIIB 1G9NL 4MLSA 1KB5A 5ERWB 5TE4H 1QBLH 3TT1H 5DD6B 1QTYT 5J12B 1K3ZA 4DVBA 4E9LA 2R0ZH 1BBJA 3QIBC 4PJAA 2FBJL 3BYTA 3OX8B 4O2EA 1CD1A 5DVKA 4NOFA 3T3PF 1WAAE 4XVUD 4KPHH 4NJ9H 5D1XC 2CLRA 1C16A 5GGSA 3IU3A 1FO0B 4M5ZL 2OP4H 4OLUL 4JVPA 5DUPH 4PTUA 3HG1A 2AGJL 1J1PL 1WJ3A 4ZUSB 3U4BH 1GYAA 2R0KH 4FQJH 4BFIB 1G6RL 1EUTA 3GB7A 4RMRA 1EAPA 3MRIB 2HFGH 5EUOA 5B3JF 5KSVB 5T5FH 1U93B 3NPSC 5IB3A 3QISA 5CILL 1BD2B 2KQNA 3QQ4B 5F3BB 5FKAB 3GMNB 3VJ6A 1D5ZA 2P49B 1VKXB 3VRLE 1J0HA 4GW5A 1CBVL 4DK6A 1JPTH 2IBZY 3BGFC 3WUWB 1GHFL 1PBYA 2YN3A 1K4CB 3VFGL 2AQ3A 2VZVA 4S1DC 1AHWA 1G7HB 2ZUXA 3KLDA 2JJVA 4Q0XL 2EYRB 1JGVH 2X4NB 2HKFL 2B1AL 4JN1L 5LAXA 2Y25A 3JWDL 3O2VL 2RCSL 5FCSH 4CN4A 1YEKH 4J3SA 1GC1C 5CZVH 1UADC 4KK8C 2X1QA 3WFCL 3SDXB 5GS0D 3F65A 3UO1H 4IHOB 4LRIA 1WZLA 4XT1C 5DSCB 5FM4A 3LOWA 3GHEL 5J9PA 1UT9A 1NGYA 1WV7T 3QZWA 4DKAA 5IGXL 5L7XL 4IRSB 3OF6A 1HYRC 3M17B 1R5WB 5DD5H 1T6WA 3OKNA 1NFDB 4J4PA 2P45B 4A2MA 1MCBA 5K9KA 3AM8C 4QEGA 4Z95L 5L6YH 4Q2ZB 1C5BH 4LAQH 3JXAA 4WFHE 1UKQA 4Z18A 3QO0A 5CLTA 4KK6C 3TBYA 2D31B 4PRIB 2CR3A 4DWHA 4Y19B 2DWDA 3RVXD 15C8H 4FQQA 4YUEH 2Z4QB 5ACZB 1EBAA 1XR9A 2X7LB 1IFHH 4YHOL 1NEZG 3TA3B 2BSRB 4NRYB 2NR6D 4XMLH 4MAYB 4JDVA 2E9JA 2R56H 3INUH 3I6GA 3FRPG 2OJZH 3OXRA 2VITB 3V4VH 3O41A 4P23D 4K3DL 4L9DA 1OGAA 3S5LA 4YHNB 4Y16A 4P2YA 1KENH 4KUCF 3OXSB 1CGUA 1S7XA 1OP3K 3UTSD 5JR1L 5C0IB 3CSPA 1ZEAH 1OT1A 1AXTL 2Y36L 3HC0B 3OAZK 3DOSA 4LQFH 5IB5B 4BSVA 4XH2A 1GIGL 1YN7A 3T3PE 4JRXB 4ODVH 1N8ZA 2AEPL 5DJ8B 3QCVH 3BUTA 2EDJA 2JLLA 2X4PA 2O5YL 3HI5L 4HH9A 3QSKB 4BQ9A 5HI3C 3F12B 4LPXA 3IS1X 4YHML 3D6GA 5EN2A 1J87A 1PW3A 5B3JE 1LE9B 3IDNB 4E5XB 4P49A 5C71A 5L0QB 4EN3D 4NSKB 2DTSA 4UU9A 2KBGA 1AGCA 3T0ED 3DO3A 4R4NC 5HVWA 5C8JA 3TN0C 4JM4L 4PS4H 3W39B 5JMRA 5K9QG 4J12A 4R4FH 1P7HL 3OAYH 1NMAH 2IFFH 2XN9D 3QIWC 4PJIA 3A6CL 1WBZB 4HMDA 5DJZB 1U92A 1A21A 4IDJL 3RX7A 5BQ7B 3GI8L 5IVXA 3ARFD 5FYJE 1U8JA 3KPMB 1YDPB 2J1KA 1VPOH 4KRPC 2LU3A 1CLOH 1LNUB 5EWIL 1O5DT 2A83A 3RDTB 2NY6B 5ISZB 1T1ZA 5KSBB 3D85B 4GLRH 3MLRL 1T22A 4KJQD 2Y6SC 2X4QB 5GGVL 5ICXB 2NTFB 1ZLUK 4WEUD 1JMZA 4PJ5E 1IILE 4MJIE 3KPRE 4ZUUA 2YMXH 3QEGL 3VU2A 3NCFB 1A6UH 4NNPL 3TO4B 4HJ0C 5A40E 3M1BA 1CR9L 1UB5A 5EBWB 2VDNH 1P1ZB 5I1HH 4P9HL 3OSKA 1U8QB 3V6FB 3BUYA 3ORJA 1Y18B 3D39D 5CEZL 1TETL 4HH8A 4U1HA 4E42A 1DBBL 1OAZL 5EIIB 1IAII 3VGAC 1FH5L 2DIJA 4PJCF 1GOGA 5CS7A 4P3DB 3QBTB 4PGEB 1CE6A 4CKVX 1DBJH 4TVSa 3WJLA 1A6PA 2MWCA 1FNHA 2FX7L 2GFBB 1E4XL 2DL9A 3JWOC 4NWUH 1DP0A 5GZOC 1RUPL 3VFNB 2C5DC 4L3EE 5DWUH 3WFHA 3QT2A 4WU5B 4NQCB 4MNQB 2A6JA 2HP4A 4BH7A 1ORQA 5HBBA 3V6ZB 4G6AC 2VSCA 2BMKA 2NPLX 5DO2D 5T1KB 3DVFA 2XPGA 4XHQA 2XNAB 1AFVH 3RUGB 2Q86B 2Z8VC 2EIBA 4EBQH 1VEMA 5DVOA 2IQAA 2AABH 4L29A 3VXTA 3CMGA 4F7PB 1Q9KA 4H20H 1QSFB 3RY5A 5E7BA 2YZ8A 1BIHA 3AU1B 2XWJA 3P9WB 1NL0H 1URLA 2B0SL 2PETA 3UYOD 1K4DB 4P23A 5ACMA 2WAHA 3NACH 3QDGD 5DUBA 1J88A 4D0BA 1FNGB 4D8PB 3QRFM 3O9WC 1F58H 4GG6A 4R7NA 3UTSA 4YDKL 3S34H 3LPGA 4G6KH 1ZHKB 3BMVA 1EVTC 3BHBA 4ORGA 3P30L 4U1IA 3T04D 1V7NL 1K2DA 1UM4H 5E56A 4PJ8B 4RGOH 5ID1A 1R0AH 2VISA 1U8LA 1TZIB 4LRIC 1FVCA 3GRWH 3DETD 4WNQB 4HG4J 1LO5B 3H7LA 5BVPH 1FN4B 3T1FA 3H9ZA 4HUNB 2EDFA 1U58A 3NTCL 5C2BL 4J4PC 3RX8A 2JE8A 4EN3A 2COQA 5J89A 5FYKD 3T0EA 2XXCB 4H26B 1ZLVH 1ZT1B 2ZPKH 3QNYB 4YDJB 5CIPH 3VRIA 4DAGL 5D7KE 5FA4A 3RWGB 4GKOA 3UDWC 3OG6B 1A3RH 2XN9A 5GRUL 5LKNA 3HC3L 1RK0A 5GISL 3CXHK 3L95A 4XVSH 5F1NB 2J8UF 4L5FH 1XF1A 2JIXB 3C08L 1ZT4B 4H88L 4OGAC 4UDTA 1M4KA 3ARBD 1RVFL 4MQSB 4Q6IB 5D7JD 3UJIH 1QPPA 2D03L 4N8VB 1TITA 1TPXB 5EU6E 4HIHB 4YR6B 1F4WH 3KWWA 4X6CB 3ZO0A 2FLBT 5DQ9A 3FOMB 1FE8L 4U1KB 5JIKA 4S1RH 3WIHA 4YHKH 4NKQB 5E9DB 3VXSB 5A2IH 4UV4H 1RURH 1WIPA 5FYJH 1PG7X 3P4OB 5TE7H 1X5FA 5DHYB 3QCUH 3QUYB 2NY7L 2FSEA 4PD4K 4XCEA 4FXGB 3EYQD 1JZ5A 4JFZH 5E2WL 1YEDB 3S3PA 5B22A 4ESKA 2BCKA 5AG9A 5HYJE 3CFJA 2NCMA 4CVZA 4LVHC 2NXZC 5T1MA 2VZOA 2B20A 2DMBA 2Z8WC 3LS4H 2XQBL 4XBGA 5IP4A 3D39A 3MNVA 5EIVA 1TQCC 3DPBA 5FA3B 3RWEA 2VMFA 4CU6A 4M02A 1HI6B 1BJMA 3BIKA 3HE7B 2D7TL 3FQNA 4A2LA 5HGBB 3QEQB 2HMIC 3ECBA 3QXWA 3MRLA 1A64A 3VH8A 5DFWH 1W8NA 4JZNB 1TJGH 3BPNB 5M95B 2HTLC 2NY0C 3IDXL 3K2UH 2NXYB 2KDGA 5D2NE 3K8KA 3MV7D 5HGHB 1N3NA 2XICA 5FKPA 2HT3C 1I1AB 4EOWH 5JXED 1A1MA 1V05A 2F54D 4ZYKB 2WK2A 2X10A 2VYRE 4X4YB 4XC1H 3FTGB 4FXKB 4RBPK 4P99A 3KYAA 2Q8BH 4QTIH 2DWEB 2FHCA 3H42L 1J05B 4RX4D 1QP1A 4PJEA 5DJAA 4GKSB 5DUMH 1QLRA 4M7LT 4QY8B 4EI6A 1IEBA 2D7MA 2CLVB 5I17B 1KJVB 2FEDC 4NQTA 2YRZA 5CCKH 3SDCA 1FFNA 3QDGA 4QCIB 2Q76A 1OAQL 3JUZA 3FT4B 5C0RH 5JNYA 2ED7A 3VFTA 5KVEH 2VAJA 3X3GL 1ADQL 1J1PH 5DFVC 2J8HA 5F3HA 2YXFA 5I8OH 5EOCJ 5CBEB 4NHUA 3VFVA 4YXLL 1AP2B 2GHWB 3LKQA 3ZYOA 4RAVA 2XWBB 1RULL 1BJ1H 2OI9B 5E00B 1I3RB 5CILH 4NCC1 3S88L 3PWUA 4CN6A 4KZDH 5HI4D 1EBPA 2A1WL 1S78D 2V2WB 4YZFE 4JFFE 3SKMB 1N64H 4P59L 5FO8B 3HCVA 1UJTA 1YC7A 3WJLC 4NYLB 2BNUA 4GKNB 4HK0A 1KB9K 1EK3A 3FB6B 3ZKMD 1AE6H 1F6LL 2BJML 4Q0XH 1TVHB 4YDVB 2Q7YA 2C7UA 2W9EH 1HHJA 2APXA 4JN1H 4YFLI 4RCAA 4PJGF 3DVNA 1JV5A 3JWDH 4CNIA 3O2VH 3MV9B 2IH3A 2V7HA 3MJ9A 4RGNB 4G6FB 5DLML 1W0VB 3WFCH 4JR9L 5ETUA 4I4WB 4ZO9A 4U33A 2UWEA 2YD1A 3ARBA 5D7JA 4HPOL 1CXEA 4P5TA 3GHEH 1OW0A 2XQYG 4PP1C 5MEOB 2F15A 1NUFA 5IGXH 4K8RC 5FM8A 1QSVA 2AV1B 3OJDA 1JPST 4H0HB 5ADPL 4IOIA 3SKJL 2BHUA 5CIPB 5KW9H 1BVKA 4WI7A 5GSRA 1TCRB 4OZFH 1D3CA 2NZ9C 2EYTA 4JPIA 3P73A 1GGYA 3WS6A 3O6KL 4G5ZL 3I84A 3GSQA 3JV5A 5DRZA 1TTFA 2W0PA 2FNBA 1JI2A 5TQ0H 1IAKA 5HPMA 3MGTA 1JTOA 1ZVSB 5JHDD 3VFWB 5I2IB 3G6JF 3H0TA 1HEZA 2ZCKH 2L0DA 4Y4HC 3NOIA 4M7ZB 3P11L 1IM3A 1KF9B 4JPKH 2OTPA 3QPXL 1A1NA 3KYMB 2YA1A 5D93B 1IKNC 4OCSL 3TH3T 4J3UA 2NY2D 5IOPB 4K3DH 3L7EA 4PRAA 1E6JL 1RHHB 3KYOB 3L9RA 1NCCL 1YEEL 1I4FA 5DJDA 3MV7A 4R2GC 4JRYE 2J6EH 3E3QC 3LDBC 1KXQE 4K7FB 1AXTH 2Y36H 2QKIB 4YHPA 5JXEA 2AEQL 2UVEA 4N8CH 5TPWL 3TM6A 2F54A 1OLLA 4WTXA 2QQQA 4Y5XC 3OKKA 1W72A 3FHQA 1GIGH 4PJDF 2DKUA 4OF3A 2DQDL 3R4DA 2VDPL 3PP4L 3DI3B 1V8HA 4LEOB 2NX5E 1U8KA 4G80B 2Z35A 4IJ3C 4YPGA 2O5YH 3HI5H 4PJ5B 3RNQB 3KPNB 2MFNA 4MJIB 3KPRB 3TEUA 4GXVL 1EZVX 1TVDA 4XB8A 4ZAKD 4I48B 1UENA 1VGEL 2A0LC 2BY3A 3FB7A 4PYGA 1NBZA 1HXMB 3MNZA 3O3AB 5KANI 3LKSA 4JM4H 1IBGL 3GSUA 4OIIL 2AERT 1JNHB 2ZOLA 2HN7A 4YHYC 1U8HB 3WN5A 2VZ3A 1IC1A 4Q97A 4JPWL 3GNMH 5JORA 3HI1A 4TSBH 1HSBA 3BPOB 2P8LA 5DD1H 2XZQH 5C0CA 5DZLA 3TCXA 4IDJH 1YUHB 5C07D 4QRSB 25C8L 4OKVA 3GI8H 1INEL 3EFDH 3X13B 5J1AB 5GRYA 2K9UA 1EO8L 3AS0A 4ZNEA 4UT7L 1RUAL 1QBAA 1OWWA 1A3LL 4L3EB 4H5SA 2ESVD 5DMIL 5TF1L 3QDJB 2YRPA 5K33A 5EH1A 3MLRH 5C0GA 1T1WB 3SEPA 3F7QA 3MLUL 2G9HB 2AJYL 1UXSB 3PXJA 4WHTB 1N7ML 5GGVH 4DOHE 4G43B 4HS8L 1UXWA 1WLHA 5F1IB 5CWSB 3UAJD 1A14L 4GRLC 3QQ9D 4MCYA 1D5MB 3AB0B 3MUGA 3QEGH 1NMBL 3RY4A 4UIKH 5F70A 2IPKB 3CCHB 2VQ1A 5I8EB 3QA3B 2CMRL 1WT5C 1G6RB 1Z0NA 5ACLA 5I8CB 3TJHD 3TO2A 4FA8A 4TNWK 3BPCB 4J23A 4F2MA 4URTB 5D7LD 3L7FA 1E28A 4YBLB 1TETH 3NFNA 4Z7VA 1KCRL 1DBBH 3LPFA 2D3VA 1T2XA 4KVNH 4L4VD 4JKPL 4YQXL 1FH5H 2HFFB 3SDCC 5HYSA 4NQEA 1MQKH 3V5DB 4LSQH 5EU7C 5T3XE 2FX7H 2VXVL 1EFXB 4JVUA 5IK3A 5BS0D 5BW7A 1RUPH 1JJUA 1R3JB 2FHFA 3L3JA 3MCKA 2VE6A 4XPHL 3ULVD 1WCBB 3CK0L 4JZJB 4D94A 2GIYA 4R97B 1KJ2H 4XNQB 4ZOEA 5JHDA 5L2KE 3QWOA 1G7IB 4Y1AD 4P0DA 1SJXA 1OTTC 3JSSA 5KS9F 3QXTA 4LCCA 1UB6B 3D0VA 2VAAA 4NO0B 4I0KA 4PJDE 5I1KL 2B0SH 3DBXB 1A7PH 3VWKD 1CDIA 3PWVB 4NBYB 3T2OA 4Y2DB 1M05B 1T1XA 1S7TA 3VD4A 4FQIH 1BMGA 1Q9LA 3R8BB 4OZFB 2GSIB 2BVTA 3SDDC 4QYOB 4CU8A 4I18B 3CDFA 4OQTL 1CFBA 4X7CC 3IS0X 3LKRB 4JGJA 5CHNB 5KJRL 3LHPL 4P4RB 2GJ6E 3VXQA 1REIA 35C8H 1JNNH 3P30H 1WTGT 2M26A 2CRMA 5FO7B 1H8OA 5B8CA 1I9RL 1C7TA 1IGJB 1KIQA 4HKJB 5HGDA 4P4KC 1LEKB 4P5TC 5LGJA 3OB8A 4G8GD 1HHGB 4JY5L 1FIGL 4LF3B 1QACA 1W8OA 5IMKB 1A7BA 1K85A 4CU7A 3D48R 1RK1A 3BH9A 5F7HA 2HG5A 3FO9B 5TJWK 2Z31D 3ZTNL 2R4SH 5HYJB 1MOEA 1OB1A 5IEHA 3UTZB 4FTVD 3S7GA 5GSVB 4HMCA 4DAGH 4Q74A 4R4BA 3HE6B 1D7FA 3JBG7 1G7JA 3EBAA 4HWZA 3WS6C 4L8CB 3S4SG 4FMKA 5GRUH 3Q1SL 5SWSE 1J8HD 1GAFL 2ERJC 4ODWA 4RISL 3BZEA 2SEBB 3NH7H 3CU7A 3B5TA 4AIOA 3GMLA 5CD5D 5C07A 2RGSA 2RQ8A 3T4AB 3U0WL 1ORSB 3C08H 2P48B 2W60B 1IEAB 3MNWA 1VESA 5MEND 1NKRA 1U8OB 3ZHDA 3PGCA 4KKLC 3FN9A 1LO3H 5D2NB 2D03H 2DMCA 1BFSA 3SO3B 3QXAB 4GRMA 2OQJA 2ESVA 3I75B 3OB0K 2R0WL 2MSPA 4P2QA 5BVJA 1FE8H 5IV2A 3T0VA 3RA7H 2C3VA 1MH5B 4U1MA 1LQVA 1MHEB 4QNPF 2X89D 5DTFA 1IGTA 4OCWH 5ANMA 4QTHA 1TQBB 3HB3D 4Q9QH 1DDHA 1MJ7H 4UDUB 4WWKC 4E41D 1BZ9B 1EEYA 4OZGA 5GZND 2VLRD 5DEFA 4M00A 3FO1B 3LKOB 2O61B 4KXZH 4XNZC 1KYOJ 3U46B 2WBJD 4QHKI 1XCTA 4NKMA 4J6RL 5DYOB 3TJHA 3MOAL 2MCPL 4BZ1L 3CZFB 3GBNH 2AXGB 4LU5L 5CBAB 2XWTB 5D7LA 2UZIH 2XQBH 3HTLX 5FYKU 3SE4A 5C0JB 4U0QB 2HJLB 3D87B 5MERB 3I3EA 3VFOB 3OGCA 5JUEL 4XP5L 5AD0B 1F42A 1MI5E 4X7SL 4LLDB 4JDZB 3VXUE 1XEDA 4BFEA 2D7TH 5DS8B 4OT1H 3W0WB 4L4VA 3G5XA 4LLMB 3N1GC 4TYUA 4PB0H 1BECA 2YPVH 4DW2L 3BFOA 4K94C 5KS9E 4K71B 4XMKH 4Y4FC 3IDXH 1B0GB 4HF5H 5J1SC 3D69A 1X5GA 3WN5C 1C08B 1UVQB 5MHSD 5BS0A 3T2NH 4PJHA 3VG9B 12E8H 1YJDC 5ECJE 1BQLH 4LLYA 2J8UB 4JFFB 5IW6A 5C0BE 1YEJL 3BGAA 5KANG 1H0DA 2HLAB 3SN6N 5EUKA 4Y1AA 3H42H 1EEQA 1N59A 3WBDA 2E7LC 2WQ8A 5HI4C 1T5WA 5E2UL 4KI5D 1YEGL 4I9WE 1X5IA 4NKIL 5D1ZB 5GGTA 3PHQA 3O8XD 1WUNT 2D4DA 1MLBB 2F5AL 3DRQB 3UBXA 2R1YB 4U2ZA 5MP6L 4M8QB 1X4YA 3QFDB 3U0TB 2B5IB 1OAQH 1LEIB 5SWZB 2CD0A 3AREB 2ILLA 4N90D 3U36B 4OF6A 5ABDE 2PTTA 2YD5A 4JVWA 1XT5A 4PPTA 4RWYL 1IAIL 5IW1A 1HWHB 3SOBL 2AKRB 4YLQT 4G8GA 1CIDA 2FCBA 3KXFD 4KTEH 5E1AA 4C56A 1IJ9A 4X5WB 4JFEA 4ONGH 4P59H 2Z91A 2A9ML 3CX5K 2Z31A 4HBCL 4ZXBC 3RVUD 1RZIB 4ZFOB 3UEZA 3ULSA 3DIFA 3V52H 5IW3A 3T2PA 5H35B 4LHUB 3GMQA 3VGDA 1S9XA 4XAKD 4FTVA 1LK2A 1FJ1A 5H94A 3BW9A 1NUDA 1I1FB 5BW7C 2NZIA 1FC1A 4N0FA 3VG0L 3QI9C 5IM7B 1P4BH 4QNPE 1J8HA 3EUUA 4BQ6A 1FFRA 3PE9A 4DQOL 4D9RD 2WV3A 3GHBL 3DNKA 4HIJA 5DLMH 3ROLB 3TWCL 3HMXL 4JR9H 5J6GA 5MENA 3B2VL 1NDMA 4CVXA 4ELKB 5B39G 3QR2A 4HPOH 1ZLWK 2E5EA 4JRYB 2V5SA 3SCMC 1WWAX 2R2CA 3CFEB 2OZ4H 5HHMB 2IMNA 1QFUH 1FZMB 1CD8A 3QIBB 1MHPL 3C6SA 3CLEL 4MNGA 1GGCL 5ADPH 5I19H 4ODSL 1UJ3A 2NX5B 2XOTA 1YN6A 1O7VA 3F6IA 4E41A 1FZOA 2VLRA 3UTOA 1RSFA 2X4TA 1YEHL 4MDJA 3Q48A 4G5ZH 5F7EL 3BYYA 2WBJA 1KBGH 2MJWA 3RAJH 1K8IB 4A6YH 4KV5E 1AGBB 1C7SA 1UQSB 1OD9A 4IDLA 1OF2A 3NPSB 4NNYB 4OZHF 2R0LL 2YPLA 5CJ8A 2B1HL 3QPQD 5IHUL 3FB8B 3FO2A 4QHNB 4PBVC 1J1OL 4U1SB 2OXGA 2ADIA 4NKDB 1WZ1L 3O6MH 4PJ9A 1AD9A 1FP5A 3MRBB 3TBVA 4PGZA 5I1DB 4NQUA 4KZEL 3V5HB 1SYSB 4LMQE 5DC4B 2OTWA 4MXWL 2CDGB 1NCCH 1YEEH 3JWOH 2NNAA 3OKEA 4RGMC 1A6AA 1XCQB 2R2HA 5GIRB 1JWSB 3DYPA 1NGXA 4ZPVB 5GS1A 1QO3A 2VLME 2DQDH 1RMFL 3RGVB 2HJKB 2Y07H 2VLKE 3KJ6L 3DYMA 2MKWA 2DQJL 1IGYB 1TCMA 1FVDA 4GXVH 4XCCL 5CEYB 1NBQA 5D7SH 5E6ID 3TF7A 1VGEH 1FL6B 3O8XA 3ILPA 3DUSB 5E5UB 4JHAL 1YC8A 1XF3A 2N56A 1BQSA 1RZ8B 3LKNB 4BUGA 4QRPE 3ZLQC 4WCYL 2X4RB 2P5EE 4Z7WF 2DQIL 4JPWH 2WUBL 1UH4A 2DBLL 5DJCA 1X5JA 2HWZL 1Z5LA 3G6JB 5BRZD 1FBIL 5F6HJ 3DGGB 3D0LB 1INEH 3QHFL 4NNXA 1EO8H 2BVYA 3L3DA 3C5SB 1RUAH 2AJSH 1JNLL 1S7RA 2EEAA 3KXFA 5DMIH 4FMFA 4KWUA 2YD6A 1DANT 1S9YA 1EERB 3UZEA 4WI3A 3G5VA 3Q5OA 3VD7A 3ARGC 3FQRB 4KKBC 2IPTL 3U9UB 1U8NB 2A73A 3CPLA 5IF0B 3M8OH 4HS8H 1NFIA 4BH8A 3C87A 5L2KB 4PLOB 2JK5B 2DQFA 1NSNL 5DDHB 5F7DB 4U1NA 3RHWK 3TGXA 4P3CL 4PGBA 1KG0A 3BN9D 4WFED 2X40A 3T8XA 4PJDB 2NTSP 4S0TD 4V1DD 4LLVA 1RUQH 3AROA 5IFHL 3ZTJH 3TPUE 4OI7A 2IG2H 1GGBH 1S5HA 3MBXL 3NCBB 3W9DA 3LIZH 4F7MA 3FFCD 1Q94B 1J11A 4F7TA 3EO1B 3QFJD 2EYSB 3BKML 3QNXB 1E4WL 4GBXC 3JVGC 2R69L 4MDIB 1I8IA 1KIRA 3MRJA 3GMPB 3OKOB 5FUOL 5ILTH 1RFDL 4HUWA 3REVB 1EIBA 4OFVA 1DN0A 3ZKNC 3QYCA 2DI8A 5IMLA 2G2RA 3NIFF 4TNVF 1MUJB 3THMH 3C60D 4XPHH 5JOPE 2ZSVA 2OS7A 5HYFA 4WV1B 3CK0H 1L9NA 3IDUA 3NFPB 4YO0B 4Y4KD 4HUUB 4UQ2A 1NGPH 2YD4A 3JV6A 4GKZB 1EO7A 4H8WL 1B4RA 4F3FB 1IT9L 4KRPB 4N9GA 1D9KC 1F6FB 3MRQA 3GSWA 2R1XB 4L8DA 3E3QE 5MEQB 4XPAH 3S96A 3DRTA 1AKJB 3O6FD 4MB5A 2HT4D 1C12A 3LEXA 3MRNA 2C1OB 4HC1A 1CS6A 2OX5A 3WE6A 3TIDB 1NEZB 4LSDA 4ODTH 2FL5B 4TOYL 4OQTH 5CMAA 3O81A 4FZEL 4OLYH 3SKNB 3G04A 1Q0YH 2WIIB 2YEZA 4K9EC 5KJRH 3CLFL 3MJ7B 1IAMA 1MFAH 1MHCA 1KCVH 1OP5K 1U8PB 4A6YB 4N8PA 4IRJB 3STLB 1I9RH 3PWJB 3MLPA 2F8VA 2ADFH 2F53E 3CGTA 5I30H 3KDMB 3CUPA 4XCYB 4U6HB 1FIGH 1S7SA 1ZHBB 4OV5B 5J57B 5FGCB 4WW2A 3IGAA 3VGAB 1IGIH 1OTUD 3ZTNH 5LWYH 5E6IA 5KN5B 3KPPA 5HI5C 1FL5A 1QYGH 5IB4B 4LSPL 4GW4A 3Q3GA 3QJFA 1T0NA 1G7QB 1OHQA 3QZWG 3HB3C 5AUMB 4QRRE 3F5WB 3LH2L 2K3TA 3GI9L 3VWJD 4JQIH 5EO0B 3UTPE 4LARL 2X4UB 4C57C 1NAMH 1T1YA 1U91B 1DLHB 3VXUB 3X14B 2BY0A 1OAYH 3MBEA 3TBWA 4N5ED 4JFXA 1ZXQA 2JCCA 1JPGB 1BVLB 4EUPA 5BRZA 3U0WH 3UTTE 1F90L 1JHTA 4P46C 5KS9B 4LLUB 4B7IA 1JFQL 4Z76A 4LIQL 3WXWL 5ENWB 4EI5C 3GK8L 2X42A 1XGUB 3IKCB 4I77H 2KH2B 4OLXH 5C0DB 4PJ9C 4IRSD 4OTXH 4KU1A 2R0WH 3TLRA 5F9WB 1D6EA 4ODUB 1MREL 1CXLA 4LQ1A 3EO9L 2H32A 3QNZB 2EDYA 1T21B 5LVEA 3BP4A 3N9GL 4XTRC 1ZAGA 2VZSA 3HZKB 3S5LG 5FOBB 1RJLA 1SBSL 4PRID 1KN4H 3QCTL 4HKBA 3UZQA 4V1DA 5GS1C 4J6RH 5EU7E 1IAOB 3RIFK 2MCPH 3MOAH 4BZ1H 3HAEH 3TNNA 3BDBA 1IZKA 4LU5H 1P4LA 1KPVB 4N0CA 3FFCA 4MAYD 3VI3F 1TZHA 3BEWB 4JFHD 3DV4B 1P7QA 5JUEH 5F21B 4XP5H 3QFJA 5ITBL 3GUTA 3D25A 4X7SH 2D0HA 2WBWB 4G8EB 1GOFA 4K8RH 3V2AR 3VFSB 5FGRA 4LDOB 2GAZB 4Z5RA 2DJUA 5E0QA 5TGBB 1I8MA 1ED3B 3V0WH 2IEPA 1CXIA 1F6AB 5J11B 1KJ3L 4QOKE 1DUZA 4FP8L 4PLJC 4TVPL 1M71B 3C60A 4Z6AT 1VFMA 2FGWL 5JW3L 3L3OB 4PY7B 1HXYB 2V5MA 2FYYB 1Q9WB 3KPOA 4M6OL 3P4NB 4Y4KA 3R0MA 1A1OA 2CGRH 5EG6C 3B5HA 1BAFL 3O2WL 3ULUC 4LPVA 2OBGA 5EFIB 4WEBL 3WNMA 5DD6A 3UYPA 1FYTE 1YYML 1N0XL 5DI8B 4NKIH 3U6RB 2PUQT 3BPLC 3O6FA 2VZTA 4P2OC 1W0WB 1F4XL 5CSBA 1PZ5B 2VABB 1CVRA 4B0MM 4ZS6D 4M1CC 3PNWB 4X7DC 3VRJB 1E27B 4MVBD 4ZUSA 4BFIA 5C7XL 3NFSL 1K5NB 3EJZC 3MRIA 3VXMB 5JA8B 2EXYD 5EC2B 1MCQA 3MACH 5KSVA 1U93A 4X4MA 4RWYH 4QHMB 3QQ4A 1WISA 4WUKL 2O5XH 5F3BA 3KLHD 5FKAA 3GMNA 2NY6D 5ISZD 2F19L 2IPUG 1NUNB 3ILQC 1VKXA 3CVIL 2O5ZL 4JZOB 3OHXB 1J0ZA 3IF1B 2A9MH 4HBCH 4J3WA 5EU3B 3MJ8A 5C6TH 2JJWA 3WHE0 4LVOC 2O26U 2K7PA 1G7HA 5CJ5A 5CLWA 4IIQC 2X4NA 3WSQL 5SWQB 4O5LH 1GC1L 1IRAY 3EFFA 5JOFB 4HWEH 2B8OT 3L6FB 4N5EA 3TBTB 1KCGC 3WYRA 2GJZB 2ITCB 4JPVH 3X12B 5E99L 3MLTB 4S10A 5IHBA 2RBLA 3GHBH 4MCZB 3TWCH 4MYWB 3UPAA 3HMXH 4IHOA 4JLRB 2FR4B 1P6AB 4MX7B 4WENB 5DSCA 3EOAA 2V7NA 2HKHL 4JY6B 5I1GL 1KIUA 4MXQD 2Z93B 4Y5VB 3LKPB 4IRSA 3DURB 2J5LB 3M17A 4KJWD 1UEYA 4G9FE 4YPJA 3IDYB 1NFDA 4B53A 3VI3E 1T0PB 4Q2ZA 4M7JL 2VLKB 4G42B 1NAMB 1AXSB 4NQCD 3NAAL 4Z7UF 4FABL 4ETYA 2GTZB 1ZSDB 2D31A 4OD2B 4UILL 4PRIA 4Y19A 4X5XB 5F7EH 5CGYC 5T1KD 2A77L 2IC2A 3OAZH 4NN6C 1J18A 1CGTA 3TA3A 4QRPB 4NRYA 1DVFB 5D2LF 2R0LH 4IRZL 4MAYA 3ZDYF 4TULL 3RPKA 1S8DB 4G7VH 1J1OH 3BZFB 2P5EB 3EYSH 4M1DL 1WZ1H 3CVHL 1H15A 2FRGP 2VITA 3G08B 4YHNA 2H3NB 4PRPD 5DJXB 4Z78A 2FD6L 3HNTL 1WVZA 4HV8B 4YGVB 4J3TA 4KZEH 5IHZB 3OXSA 4MXWH 2E7LE 5CJXA 5D70L 4RMQA 5C0IA 1I75A 3HC0A 3MBEC 3BQUC 2KZ1B 1CT8A 3I2CL 2X44D 3L1OL 1W2KT 3IDMA 4L3CB 3RTQB 1JK8B 3E2HC 4JJHA 1JI1A 4YH6A 2VLLB 2FIRT 2PXYC 3HAEB 1QNZL 5DJ8A 4YXKL 1H3GA 3DTXB 3MRDB 1CFVL 3RKDD 1UCTA 3FHAA 4LP5A 5TDOB 3K1DA 5GHWL 5DMKA 4YC2C 3DUHA 4XCCH 1LE9A 5HSFA 1RJCA 4NSKA 1EDQA 4JHAH 3TPUB 3CDCA 3W39A 4TPRH 4M3JA 1U8IB 4WCYH 1Z9OA 4KROB 4LIQE 4U7SA 4J1UB 1JGUL 4OBRA 3MA9H 1FGNH 2DQIH 4MVBA 4ISVB 5K9OB 1FGVL 3A6BL 4QT5B 2HVJB 1RZKL 5BQ7A 1JZ6A 1FBIH 1JHLL 3C6LC 4OZHB 5BOPA 5I1IL 1ROWA 5J4MA 1YDPA 3QHFH 4N0CC 2MQ3A 2Y72A 4Y4HB 1LNUA 5CJBA 3DV6B 4JM2C 5JMOC 2UY7A 2PTUA 3FN3A 2V5YA 3HUJF 1YECH 5ISZA 1FRGH 1FSKB 4OGYH 3O6LL 3EOBA 4HFUH 1T3FB 1E0OB 2X4QA 4U0RC 2NTFA 5E9DD 3H9SE 2IPTH 3SDAB 5HHOD 2CRIA 2E9IA 5EZOL 1NSNH 4KY1L 5CJOH 5C86A 4R2GB 4WW1B 3VH8G 2C3HA 3HN3A 2VUOA 2R2EB 5DQDL 3LD8C 5D5ME 4XX1E 4ZSOA 5DK2B 5I16A 1E4KC 4NZTH 2F8XC 4MD4B 5EBWA 1P1ZA 5IFHH 3WNOA 1ZKAA 3OKDB 3V6FA 2QSQA 1Y18A 2R2BB 4Z7UE 4KDWA 4W6WB 3J8F7 2H26B 3HE7D 2VDKH 4TVPE 5LJYH 3NZ8A 1ZLVK 4TSCL 4CBPA 4P3DA 5C0AB 4PGEA 2YR3A 3BP5B 3MLSL 2R69H 2Y1VA 2GFBA 2RR3A 2NXYD 4HXAH 3ZDYE 1MY5A 4YHYB 2F53B 3OV6A 3PQYE 4FFVC 1I1AD 4NQCA 4HZAA 4WU5A 4MNQA 4UT6L 4FFZL 1VACB 4YIQB 3L5HA 5T1KA 3AAZB 1UZ8B 3I3DA 2BC4B 5TDNB 4ERSL 2Q86A 2V2TB 2ATKA 4H8WH 4LOUC 4QRRB 3UPRA 2E6JA 1JZ3A 3AFLA 1KCUL 2BRRH 2VO5A 2Z92B 1FFPB 1X7QB 1OARH 3MLXH 3MLZL 3U83A 4IBLT 3KLAB 3UTTB 3C2AL 1FNGA 4NQSB 1U3HD 4K94H 4P2CG 1AO7E 2VKXA 2I60L 5BXFB 5C92A 2QLVB 4TOYH 5FUZL 4CJ1A 2BP3A 2R23A 3MRCA 3RWDB 2EIEA 4F8QA 4N9OB 3TBSA 4AH2A 4LLWB 5JXAH 2N7BA 5D9SA 3H9HA 1TZIA 1A9EB 1LO5A 4O51A 4GW1B 1FN4A 3FO0L 4F8TA 1D5BB 3VCLB 5EZIL 3HNVL 1UGNA 3VW3L 1DCLA 4LSPH 4LCYA 4YDJA 3QNYA 5I1LA 5HHPB 3LH2H 3GI9H 3HUJE 1L7TH 1F4AA 2H9GB 5F1NA 2P42B 3SBWA 3QG7H 2E8ZA 1DBML 1F3JB 1ZT4A 2YA2A 4JE4B 1F90H 1MCJA 3TA3C 1PD6A 1N5AA 4WJ5A 4MAYC 4OUUB 2UUDK 1JFQH 3FCTB 4J8RA 4HIHA 4QOKB 4LIQH 3WXWH 4XP1L 3FOMA 4U1KA 4KAQH 3EO9H 1G0XA 3B8SA 4YHIB 5E9DA 3VXSA 1JHKL 5A2LH 3EDKA 1DUYA 1I8KB 5HHOA 1M7IB 4LSSL 3SDDB 2FEEI 3P4OA 1G6VK 5DHYA 3QUYA 4KQ4H 2FZ3A 1QSEE 3EHBC 5CGMA 4FXGA 1FYTB 5EUOF 1JIBA 1XF2B 3QCTH 1ZANL 1YEDA 4AK1A 4U1LB 1OQXA 5L9DL 4HWBH 1WAAA 5I1AB 3ARDD 3RVVD 5FA3A 5DQJA 4RBPH 1Q1JL 1HI6A 3HE7A 4RDQG 5ITBH 4NN7B 4EVNB 5ALCL 5L0QC 4U6VH 1JZ8A 4P57B 2OXHA 4UBDC 1T83A 4JZNA 1QHPA 5FYJD 1B6UA 3OKMB 4E0RA 4DUWA 3QUXB 5DEGB 1J1XL 1KJ3H 3OGOE 4LASL 2WUCL 1KN2H 3EYVB 1I1AA 3VXRB 1SY6L 2Q7NA 4FP8H 4TVPH 5I18L 2W9DL 1EX0A 2VLJD 2NY3D 5GJTL 1OOAA 2CDEB 2FJHB 3U1SL 1FDLL 4FXKA 3HFML 3NA9L 4KDVA 4OLZH 1N4XL 3K4DA 2NY4B 3ZT6A 1J05A 3KYNB 2X9WA 4PJ5D 2E7MA 3V4UL 1EHLH 3VMPA 4GKSA 3RDTC 1QOKA 3H3PL 2EE3A 1RZGA 4WEBH 4MS8D 4QY8A 1JRHI 3PWPE 2CLVA 4JO1H 3UBXI 1HINL 1KJVA 3H3KA 4XHJD 4L4TD 1KSRA 1F4XH 1RIHL 4RZCB 3W82A 4YXHL 3FT4A 1U3HA 4WWKB 1XH3B 3NZHL 3SE9L 4DK3A 5FO9B 4C54A 3TO4C 1GSMA 1F2XK 4KI1A 3NA4A 4OCRH 2PW1B 4XNZB 5CBEA 5GS0L 3NFSH 2B4CL 1SBBA 2X4SB 5FDYA 1MCPH 2XY1A 3G9VA 4G9FB 1QBML 2OI9A 4PGCB 1EEUA 2BVOA 3QRGL 5C0FB 2G60L 1I3RA 1GJIA 4WUKH 1I1YA 3O4LD 2YXMA 4HZLA 2BDNH 4L3ED 3TJEH 5I6XC 1YNTB 2V2WA 1EZVY 2F19H 4LLQB 3SKMA 3CVIH 4I0PC 5FO8A 2AW2A 4LNVA 2WP3T 8CGTA 4Y0GA 5EBMB 4FG6C 1INDL 4NFBA 3GBMH 3LQAL 4Y4FB 4JQXA 4V3EB 1EXUA 3MCLL 3FB6A 1LP9E 1XIWB 4HHAB 4R0LB 4WUUB 4YDVA 1TVHA 3WSQH 3F7YB 3N06B 4N1HB 3M45A 1KEGL 4JO3L 1ZA6B 3LN4B 4XBPB 1M6OB 4J3XA 3I6KB 4FRWA 4AT6B 1I8LC 1W0VA 4WFFE 5E99H 4I4WA 3GRWA 1QKZL 1DEEA 3U30B 3PV6B 2BHYA 2HKHH 5KVDL 3VI4F 4GO6B 5GGRB 3S36L 3FRUB 1BQHB 2C4FT 3FT3B 5D7IF 3OMZA 5A16B 4CDHA 4DN3L 1NC4B 2AV1A 2CDFB 3NCYS 3P9MB 4XNUL 5L8KB 4KQ3L 1TCRA 1KLGB 4LSUL 5MEPB 3B9KD 3I02A 2PNDA 5JLZB 1XGTB 3NAAH 4FABH 3WJJC 1F13A 4KK5D 2D7OA 3WDJA 4MMXC 4Z7OF 3IETB 4PJ8C 1ZVSA 2A77H 4KJYB 2Q87A 3CH1B 5I2IA 1HHHB 1A8JH 3F58H 3QHZH 4JO2L 1AJ7L 1LVEA 1ZK9A 3K81A 4IRZH 1WF5A 5M7QA 3RNKB 3KYMA 4M1DH 3ZKXB 2VDOL 1NANH 2P1YA 3CVHH 5IOPA 4Y2DD 2F58H 4ZXBB 4HX1B 4FQ2H 1RHHA 3RJQB 4PLKC 3QUZD 5ICZB 4MQ7B 2VDQL 5EU6D 2APBA 3MGOB 2Z9TA 4K7FA 2QKIA 4IMKA 1ZWIA 1KTLA 3I2CH 3L1OH 1AC0A 4LCWB 2IQ9L 5F72S 1LO2L 3AXLB 3U0PB 2J4WL 2CUIA 3H9SB 1CG9A 1QNZH 4NZRL 4Q6IC 7FABL 1MFEL 2DJ4A 2YWZA 1CFVH 5E5RB 5IB1B 1MCIA 1CFSA 1TPXC 1NLBL 5D96B 4PJ5A 4MJIA 4HIEB 3IU4H 4ZO8A 3SCMB 4I48A 4BQ8A 2NW3B 4WI4A 2OL3A 2QSCL 2WQRA 3B5GA 3Q6GH 5HYJD 3O3AA 1C1EH 4Z7UB 3HE6D 1JNHA 5T33L 1QQDB 1U8HA 3QUYC 3SE3A 5FECB 2X1XR 4DN4L 1JGUH 1OAXL 1J5OL 4HPYH 3B9AA 4K9EH 4N68A 1T6VN 2BSSA 1H3PH 2GUOB 1YUHA 3A6BH 4OF5A 4QRSA 2P8MB 4O02L 1YPZE 1C5DB 3V6OE 1JHLH 5I1IH 3VA6A 3V0VB 5D2LB 3DROB 2H8PA 4BA8A 3HMWL 3MR9B 1HSAB 1MCSA 2EIZB 1MHHB 3PQYB 4L3EA 2JELL 1T5XB 4IMLA 3WO4B 4XAWL 1U6AL 4JM2F 2DQUL 3O6LH 1T1WA 1EHXA 4DZ8B 2G9HA 1UXSA 3PIQB 1VFBB 2MTPA 4WHTA 4X7TB 1J10A 4O00A 3OPZL 3BPNC 3AS2A 3S37H 4GG6F 3BH8B 3FB5B 1K8DB 5CWSA 5E8DH 3VI4E 4LGPB 4YNYB 1D5MA 5EZOH 1HHKB 1SJEB 4KY1H 2P44B 5D7IE 1I1AC 2IPKA 3CCHA 5I8EA 3QA3A 3SGEH 2VR4A 5DQDH 2FJGB 4I5BA 2EE9A 1I3GH 1WICA 5I8CA 3WXVL 4TUOA 4L1DA 5EB9A 5EBGA 4NQDE 5D1QD 4NT6A 3BXNA 2AEIT 2LVCA 1AO7B 2ZUWA 4F58L 1TFHA 1ZMYA 1G9MC 4AIZA 1A3QA 3ARPA 4Z7OE 4PRHE 3BGMA 2F9BT 5JTWA 3FQWB 5FIEA 1PQZA 5DRXB 4MA8L 2HFFA 4TRPL 5F8RC 3MLSH 3V5DA 3U7WL 3B3IB 3O4OB 2IAND 1OAUL 2AXJA 1EFXA 1QRNB 4CMHC 1R3JA 1NC2D 1UH3A 2GK0B 3UBXG 3FAXA 3QIUD 5IVZB 4UT6H 1P84K 2AJZB 3BMWA 4WI6A 3CSBA 1JGEB 2OI9C 1Q38A 4MQXD 4APQB 3NCYP 3KS0H 3HR5A 2APFA 3PDOB 3HUJB 2X5PA 5DRWB 4TUKL 3VXNB 4XP6L 1KCUH 2HTKC 2WW8A 4GAJH 5FYKL 3ARGB 4R90L 3BVNB 4Y2DA 1RUML 1M05A 4HJGA 5TQ2L 4XPGH 3O0RL 4ZUWB 5EBLB 2EH8L 3C2AH 4JQXC 3QUZA 4JY4B 1FNLA 4I18A 2I60H 3ARED 1PYWB 3DMMB 3MJ9L 5EU6A 5C9JB 2ED8A 5A1AA 4JG0L 5FXCH 3DUUB 4JFDE 4RGNC 1GXEA 2FJFB 2DLHA 1G84A 1OAKL 5FO7A 3ZE0E 3E6HB 4HKJA 1IGJA 3TFKC 2G75A 3HNSL 5EPMB 3QUKB 5ITFB 2EDHA 1LEKA 1BHGA 1HHGA 2K7QA 4R8WL 3BKYH 5IMKA 4L8SA 4RFEB 1QSEB 2MQCA 3FO0H 3CVHB 2R29L 4HBQA 1AGDB 2A6DB 3BISA 5EZIH 3HNVH 4GBXB 5HYJA 4M6MH 2LVEA 3OB0H 1RAMA 3VW3H 3WMSA 1ONQB 5GSVA 1RJYB 4GRWE 4Y5YC 1QFWM 2J88L 3HE6A 3IJYA 2J6EA 1V7ML 3TIEB 4HCRH 4L8CA 4UQ3B 1WFNA 4AMKH 1RU9L 6FABL 1B4JL 2Y5EA 5A3IC 2SEBA 5F1OB 1DTUA 4Z9KB 4OIBA 1ORSA 5JDSB 1MIMH 1IEAA 3NIGF 3X3FL 1DBMH 2GSGB 3O3DB 5INDA 2H1PL 1U8OA 3R1GL 1MSPA 4M7ZC 4KGJA 5D2NA 1D9KB 2P5WB 4JRYD 2QHLA 3QXAA 5D93C 1CIUA 1I7RA 4XP1H 3I75A 5DD0L 5FGSA 4XP9L 4HWUA 4PJXF 3MLWL 3QIBD 4GG8A 3TNMA 3C5ZC 4LDLB 1MH5A 3QXDB 4RRPA 1MHEA 3MJGX 2V9TA 1CLYH 3U4EB 4G8FA 2XZZA 5D1XD 4UDUA 1BZ9A 4DKFL 4P5KB 4ZFGL 5T1LD 1W72L 4HUMB 4JEGB 2YK1L 3MLVH 1VADB 3FO1A 3LKOA 2O61A 1EVUA 4FQXC 3EO0B 3PWPB 1ZANH 2VDLL 1C5CH 3U46A 3S37X 5DYOA 5JQ6L 3W5NA 2ZKHL 3HZVB 3CZFA 1KGCE 4Z77B 4CVWA 5JDJA 5L9DH 5CBAA 1A4KB 5D1QA 2XWTA 1KPRB 4I8DA 5I76B 3VGBA 3RBSA 2HJLA 2DQCH 3VFOA 3HS0B 1Q1JH 4CADB 2P43B 3MO1B 3MSPA 4JDZA 4LLDA 4PV9A 2PYEE 2VR9A 1WQVT 2IAMC 1ACZA 3OJVC 4NCC2 1F00I 5ALCH 4LLMA 1FZKB 2CO7B 4S1DD 3R06B 1BD2E 5SV4A 1B0GA 3KJ4B 4HDIB 1JP5A 1UWXH 1C08A 1UVQA 4EJ1C 1U42A 4LASH 4X6BB 3R8QA 5F9JB 2XTLA 1NC2A 3GSVA 3QDME 4F33B 3BPOC 4HJJH 3QIUA 4JFFA 1OY3B 1SY6H 5I18H 5KAQG 3QUMH 2W9DH 4X98A 3W9EA 5T3ZD 3FQUB 4KK8D 4YFDB 3C5JB 1VHPA 2AEWA 4I2XE 1CDHA 2ITDB 1SHMA 1FDLH 1X5KA 3U1SH 3HFMH 4CGTA 1G9NC 1KNOB 5H37G 4P46B 1N4XH 4DVBB 5DR5L 1WIUA 2DI9A 3V4UH 1FNSH 4PJBE 4X99B 3H3PH 8FABA 4WU7B 5GXBB 5D1ZA 1VB9A 3BO8B 2CLRB 1HINH 1MLBA 3DRQA 1UWEL 2R1YA 3NCJL 3SDXE 4M8QA 3QFDA 1RIHH 1MAML 2ZUSA 3AB0C 3GB7B 3NZHH 4KK6D 2DDQL 3AREA 5KZCB 1VEOA 1WTLA 1OSZB 1KPUA 5IJVB 3DVGB 3MC0A 3U36A 5FB8A 1KJ2A 5GS0H 5D72H 2B4CH 1PZUB 2NYYC 5T3XD 1D5ZB 3CSYA 1G9EA 3MA7B 3LN9A 5E4EC 1X6NA 3QRGH 5FYJU 4YBLC 2G60H 4X8JB 1R3KB 2AKRA 1Q72L 2MKLC 1A2YA 1YY9C 4L9LC 5IBTL 3NIGE 4PR5B 1ZLWH 3DHJA 1RZIA 4ZFOA 4LHUA 5L2KD 2W91A 1NCDL 2D9QB 1B0RA 5LAXB 3K8LA 3MCLH 4KDTA 4F9LA 4YWGL 4PJXE 1EO5A 1UKSA 4BFGA 5IM7A 3JWDC 1BFVH 1I9IL 1KACB 2VXUL 5D6CA 1KEGH 4I3RL 4JZJC 4OCNC 3SDYH 1FZJA 1XGYH 3N1MC 4R97C 1JGDA 3CFCH 1RY7B 3IB4A 3U4AA 3ROLA 4ZOBA 1FCGA 1QKZH 5HI3D 1K6QL 1TJIL 5FCUL 4JRYA 1U9KA 1CL7H 2JJSA 4PGDB 5KVDH 4JG1L 1JZ2A 2GJ6D 5K9KB 5F71A 3S36H 3CFEA 4JRXE 2CK2A 4F80A 3QIBA 4LVEA 4DN3H 2J8OA 2JB5L 1F11B 4R4ND 1EHAA 4XNUH 3TN0D 3TBYB 4DUVA 1IQWL 1MCLA 1JGLL 1PKOA 4KQ3H 2NX5A 4DTGL 4LSUH 1JTTA 3MUY1 1HYSC 3QIWD 3MXVL 3V4PH 5AYUL 4FQQB 4XNXL 5IEKB 4KRMB 5T1LA 1MFCL 2EC9U 4G3YH 2VC2L 5SX5H 4HUXB 3FFDA 2KPNA 3NCMA 1K8IA 1NGWA 4JDVB 4YE4L 5FHAL 4BYHA 2HJFB 1AGBA 1BGXL 3U9PH 1CXKA 1XZ0B 4KRPD 3CH8A 3CNKA 3FB8A 4QHNA 1AJ7H 3PUCA 2W0KA 4U1SA 4GAFB 5IUSA 4NKDA 5SWSD 5F9DC 1P9MC 1OM3L 1AKJD 3KHQA 4IEFB 2FGZA 2KL6A 1S7XB 3MRBA 5FEBA 2JF1A 5I1DA 1MRCH 4LDEB 5F9OL 1IM9D 3V5HA 1SYSA 1KELL 2WINB 4U7MA 1VA9A 4LNRA 4OZIF 4LVOB 2CDGA 5C6WH 3HE6C 2VDQH 1FO0H 2VXQH 2ICWJ 5KSBE 2CRYA 4HJ0D 1XCQA 2V5RA 4LEXH 4LRNH 3REWB 2WSKA 1JWSA 2HYMA 4OB5L 2CLZA 4NCDA 1CWVA 2IQ9H 1LO2H 2OSLB 1T66C 2J4WH 4Z7VF 2WLYA 2CKBA 4NZRH 4PREB 3ZDZF 3V79C 3V95A 5FK9B 5HDQH 3CFBB 1NLBH 4EUPG 3SO3C 4UU9B 3LRSB 3ZDXF 1IGYA 5D7IB 1AGCB 2YD7A 5CEYA 2N4IA 4LCIH 2XFXB 1XF4B 2QSCH 3N85H 4K7PX 1R3LB 1TQBC 2FEEL 3AM8A 4NQDB 1RZ8A 3LKNA 3Q5TA 3MRRA 5GZOD 3HG1D 5T33H 2VDMH 1BX2B 1A6ZB 4FQLL 1MI5D 4DN4H 2XY2A 3VXUD 2WP3O 4BUHA 5LXGL 2XYCA 4HLZH 5IB2A 1U8JB 1MCWW 3QUMB 4PRHB 3OKLB 4G6AD 3EYOB 2HRPH 5TE6L 2R9HC 3DGGA 1JCKA 1YQVH 3CIQA 3D0LA 2BFVL 3O2DA 4XRCB 5CGTA 1CQKA 1RZJL 5GGSY 4D9QE 4FN0A 2DM7A 3IXTA 4S0SD 4XPBL 2DLGA 5JZ7C 2XKNB 1A02N 2P7TA 3SGDH 2Y4SA 4K55A 5JPNA 1U6AH 4MMZC 5C0BD 5TFSL 4LCUA 5I66A 3FQRA 3U9UA 1U8NA 3RUGE 4K71C 4YBQC 5L2KA 3ARQA 3O9WD 2JK5A 4ENED 5F7DA 3ULVL 1QSFE 3M1BB 3OG4B 4UV7L 3VG9C 1DSFH 3W2DL 4I9WD 3BQUB 4OLEA 4PJDA 3HZYA 4G8IB 5E5MA 4P9HC 3E2HB 3WXVH 3W11C 4CDGC 3RIAK 1Y6NR 2PN5A 3IDJA 1L0XA 1DANU 4Z7NF 2RB8A 3WKML 3GIVB 1VENA 2JB6B 3EO1A 3V7AE 1JRHL 4F58H 1CE6B 1T03H 1IGCL 1ZTXL 4YAQB 2EYSA 4OI8A 3GSRB 3QNXA 5ESAB 4W68A 2WMPA 4G9DB 5D1ZC 4XCNA 2GJ6A 2BOCB 4I1NB 4NWTL 1Z3GL 4MA8H 4TRPH 3WFZA 4HFWB 4F37F 3GMPA 2A6JB 2B5IC 3K8MA 2BRQA 4UNTA 1ORQB 1H3TA 5KTEL 1ETZB 1BREA 3UTQB 2DLFH 1MUJA 3I50H 5JPMB 4KRLB 3QEHB 3NFPA 4YO0A 1OSPL 1Z9SA 4OZIE 2VIRA 4HUUA 5CUSL 3C6LB 1S5IL 4OGAD 2D4FA 4UTBL 4F3FA 3GMRB 4HXBL 4POZC 1B0WA 2R1XA 3M07A 2FX8H 1SEQH 3EYUL 4CAGA 4JM2B 1H3XA 4TUKH 4BJLA 2OZ4A 1D5IH 5SWSA 1AKJA 4RAUB 3KPSE 3LVEA 4OLVH 4R90H 2C1OA 4GG6B 5I75B 1RUMH 3S35X 5TQ2H 3O0RH 4PRDA 2V2XB 4WY7L 5DVMA 1YNLL 4KDTC 4LSTH 4RFOL 5CZXC 3TIDA 2FL5A 4OFYD 3TH2T 3SKNA 1K2DB 1R5IB 1TJHH 3AY4A 4JG0H 2F74B 2VISB 3MJ7A 4KKAC 5FYLD 4NO5B 3STZA 1U8PA 2I24N 5HGGS 4A6YA 1I3UA 2NXZD 1CFNA 2BVEA 3HPLA 4IRJA 4LSRL 4W6XB 3STLA 3T4YA 3RI5K 2Y5TA 1VSCA 2JJSC 4AQOA 4R8WH 5DA4A 4EN3B 1ZHBA 4OV5A 5GPRA 1TIUA 4LLAA 2HMID 3T0EB 2YN5A 1T2JA 5FA4B 1IKFL 2X70A 5ELIA 4QWWC 5F7UA 5IB4A 2HTLD 5CP3H 2NY0D 1G7QA 1QVOB 5AUMA 3F5WA 5EO0A 3JV0A 2X4UA 1V7MH 2HT3D 4GUPB 1MI5A 3F7VB 3VXUA 3QEQE 2PYEB 1RU9H 3ARFB 6FABH 1JPGA 1BVLA 1KIPB 4OD1L 3KYKH 3CZJA 3RWIA 2ZCHH 2H1PH 4LLUA 4Y8DC 1F4HA 3R1GH 2I9LB 1NDGB 2MPAH 5ID0B 1XGUA 3IKCA 5C0DA 3QDMB 4XC3L 4O2CB 4OJFL 4PUBL 2OLDA 1UM6L 5DD0H 4ZTOH 4U6XB 4XP9H 2FEDD 4ODUA 5C0BA 3I9GL 1S9VB 2PTVA 4AEFA 2VLMD 3AGVA 3QNZA 5EOCL 1LDPL 1T21A 4I2XB 4QRUB 4IOFD 2VLKD 3O9WA 1P4IH 4DKFH 3MCG1 3IJHB 5FOBA 4ZFGH 5DFVD 4CVZB 4PJBB 2FATH 5JIHA 2ZUYA 5T1MB 1X5LA 4GS7C 3PWLB 3P40A 1RUKL 3T65A 3T09A 1A7OL 2A38A 3D39B 3MNVB 1T2QL 4PV8A 4XPFH 1IAOA 3RGVC 2DTML 3FQNB 1GGIL 4QRPD 1KPVA 2I25N 3CXHJ 3P0VH 3BEWA 5HYQA 4GLRI 5ADOL 3DV4A 5KVGL 5DF0A 2P5ED 3VH8B 5DRNA 5EO9A 1M7DB 3VGGA 3VFSA 4LPCA 5A2FA 4V2BA 2GAZA 5FKPB 5TGBA 1N2RA 1ED3A 2XQYK 5IR1B 1F6AA 3LMJL 3UDWA 1WZMA 5E2VL 1M71A 3N1PC 4M1GL 2VZ1A 2DQEH 1BWWA 4PY7A 1HXYA 1S7UA 2DQGL 2FYYA 5GRVL 4EDWL 2I07B 1HH6B 3P4NA 5IT2L 4PD4J 2BSED 1IEBB 4ODXA 1FG9C 2QQLL 5EFIA 4PJXB 4PP1D 4F7EA 1FFNB 4HT1H 5KVFL 5BCAA 3MV9E 5FM5O 4K8RD 3B6SB 4RGNE 5DI8A 1KT2B 2Q76B 3U6RA 1ZV5A 1MJUH 3KLSA 3MRPB 4JFYA 3GEWB 1PZ5A 1UWEH 2VABA 3Q0HA 3NCJH 3V7MA 2ORBL 5F3HB 1A6VL 5F9AC 5FF6B 5TF0A 4ODHH 1MAMH 2NZ9D 5HTSA 2GCYB 1YEIH 4RMSA 4OFYA 5HVFB 1G1YA 3VRJA 2LAAA 2AJXL 5D71L 1PLGL 2DMKA 2E7HA 5DHXB 4O4YL 1QG3A 1QLEL 5CFHA 3H7BB 5EU5A 5BS0E 1YA5A 1DQJB 2D0GA 5EC2A 4HULB 4OAWB 5M94B 3RVWC 3ALWA 1FNFA 4YHLL 4QHMA 2X1PA 4Y4HD 5E70A 2F8OA 2L4OA 1NCWH 5SX4I 3LB6C 3DECA 3RRQA 4JZOA 5DD3L 3IF1A 5IBTH 4M93B 1CGSH 3QB7C 5FDWB 4QF1B 1B2WL 3MRHB 1HHJB 2HT2C 4TNVK 2PR4L 1NCDH 3LCYA 1FG2B 1NQBA 3ARZA 4R2GD 2IH3B 2V7HB 3O11B 2RHEA 4YWGH 3MQIA 4F57H 4XP4H 2VXUH 5ETUB 4WV1C 3L6FA 4I3RH 3TBTA 2Q8AL 1JVKA 5D7JB 4LFHD 3P4MB 3X12A 4NM8H 4OM1L 3MLTA 5E2TH 4XVJL 4EQ3A 2P24A 3SJVD 2ADJA 1CDGA 3EGSB 3ZSTA 4KI5F 4X6DF 1K6QH 4JY6A 3HRPA 5FCUH 3LN5B 1U2HA 2Z93A 5EOQL 4Y5VA 3LKPA 2A0LD 3DURA 5GSRB 1LK3H 1HDMA 5KAQF 2JB5H 1ZVHA 2EYTB 1NCAL 3P73B 1IQWH 4HWNA 1JGLH 3DX6B 3GIZL 2GJJA 1MFDL 1T89C 2VLKA 4G42A 2F53D 4UOW0 4DGVL 1NAMA 2W65A 1AXSA 3MGTB 2GTZA 1OPGL 1ZSDA 4CVUA 3AY4C 3GO1H 1MFCH 4XWGL 2AJ3B 2GT9B 3HZMB 4ZFFB 5L88L 1IM3B 1GZQB 4D3CH 4IRJC 3QHTC 1BGXH 4QRRD 5I8KL 4QRPA 3UTPD 4ZUVB 1CE1H 3VFUA 3FQTA 5CAYB 4PRAB 4M03A 5I6XB 3BZFA 2P5EA 3BIBX 1G9MH 1OM3H 3L9RB 3RGHA 3VA2C 3G08A 4I0PB 1QLFB 2NY1B 5DJXA 5DJDB 1MCFA 3UTTD 1Y0LA 4HV8A 3WNPA 3WEXA 1KELH 1YYLL 4GRLD 1QSZA 2IBBA 3L3GA 4OFDA 4JFQB 5LQBL 3QDJE 4AENA 5EU4B 4QXUL 3IFLL 4L3CA 4D9LH 1JK8A 2NLJA 1MRDH 2Z35B 4JREB 4YEEA 2VLLA 3HAEA 2W38A 3DTXA 3TV3H 1BPVA 4NKOB 3U82B 3ARXA 5TDOA 4ZODA 5IROC 1OLZA 2UVFA 4NO3A 2A74B 1NGQL 4UOJA 4BSJA 5F9WC 3EDDA 2UV3A 5FGBA 3O3BB 4Q9RH 3SDCD 3E1F1 2ZOLB 3TPUA 4JKMA 3ZHKA 5JORB 4P9MH 1ZGLB 3CU1A 2BVUA 4RFNB 4XGZA 3ZL4L 4ENEC 3BD4A 3P9LB 3V8OA 1NAKH 4J1UA 3VDAA 1H3VA 2JKXA 3JTTB 4AL8L 3MMEB 5FHBL 4ZS7L 1S7VB 1BBDH 4ISVA 4RMWA 4QXGL 5K9OA 4NFDA 1FLTX 4HD9A 3C8KB 2HVJA 3V8CA 4FFYL 4X4XA 4H5SB 2BFVH 1OTTD 1RZJH 4Y4HA 5C0GB 3HC4L 1DN2A 1IGFL 4Z0BH 1MCWM 3DV6A 3GJEB 5GRJH 1OVZA 1IKNA 1UXWB 3IXAA 2LABA 1IC7L 1CGYA 2EKSB 1UCBH 4JAMB 4MCYB 1T3FA 5B38B 4Y2OA 4OZIB 2YRLA 4ONHA 3SDAA 2VQ1B 4X6DE 3BX7C 1INQB 3SDDD 5CJQL 3MFGB 5J11C 4KHXH 4WTZG 3W2DH 4MHHI 1FYTD 2R2EA 1F8TL 3E3QA 1J0KA 1DFBL 1QFPA 4JJ5B 3DSFL 3VXOB 3KPSB 4Y5XA 5DK2A 4MD4A 2W0LA 1VFOA 4Z7VB 3OKDA 3HR6A 4U1GC 4P4KD 2R2BA 1GPOL 4F15C 4P5TD 3I3BA 4JB9H 3SJVA 3CFDB 3EJYC 4WW2F 1JRHH 1RJZA 5F93C 3P2TA 4OM0L 2LAGB 1HOCB 1Z3GH 3ARRA 5IK3B 5A2KH 2DOCA 3MCKB 2XI9A 3C09B 2ICWA 2J2ZA 5HHXL 3G5YB 1BZ7A 3E0GA 1ZLSH 3A6OA 3FMGH 2AJUL 5KTEH 3BZDA 2F53A 2ZJSL 4PJCE 4J2XA 1DL7L 3O3UN 1H8SA 2UZXB 1VACA 4YIQA 1RZ7L 2KQMA 3X11B 1TDQA 4WI9A 2IJ0C 4LP4A 1UZ8A 4YK4B 2OR7A 5IQ7L 1TVBA 1U3YA 3D0VB 1S5IH 3HMXA 5TDNA 2V2TA 3H3BC 2J7LA 4KKLD 4N0YL 4UTBH 4S0UC 4QRRA 4HXBH 1MCNA 4RA0C 3EYUH 2FO4A 5CINL 3OZ9L 4R96B 4R3SA 2Z92A 3IVKB 1FFPA 1G7LA 5AZ2H 3D9AH 3MUJA 4HEPG 5KBNC 1FV1B 2PYFA 1LQSR 3KLAA 3TVMB 3UTTA 4NQSA 4WWKD 4RFOH 5BXFA 4GRLA 3ZT7A 1MCOL 4JO4H 3FL7A 1FVEB 3FONA 1A22B 4NJAL 3RWDA 5B8CB 1KIQB 1WT5A 3MLYL 3GSNH 4LLWA 1GGUA 4M9OA 5LGJB 4G9FD 2DD8L 3WLBA 1G1CA 5EZJB 4LSRH 1JUFB 1G9NH 2VXSL 4ZAKB 1A9EA 3GSXA 3EKCA 4GW1A 3BSZL 5IEHB 2OR9L 4Y5VC 2AXHA 3DYOA 4LHJB 2GITB 1WSST 4U1JB 2J5LC 1JWMB 3BRDA 2OMBA 3K7UA 2UUDH 4M43L 3TZVC 2FBJH 2NY5L 3IDYC 4Z0XA 1IKFH 3A0OA 4W6YB 4HWZB 4Y4FD 4JGMA 2NMSA 2YUWA 4IOFC 5HHPA 1OGTA 2FH6A 3WS3B 2LTQB 4ODWB 4CMHB 4M5ZH 1QUNA 4OLUH 2AGJH 3ZKQD 4QLRA 5C0CD 3W0WE 4QGYA 1CICC 2H9GA 1G6RH 4OD1H 4EQ2A 1SEBA 2VN7A 3UROR 2FB4L 4R6UA 3ME0A 2OQJB 4UIMB 5JW4M 1DVFC 1GCFA 1KJMB 3FCTA 1XGRB 4QOKA 2P4AB 3IKKA 1ZT7B 3S3JA 2J8UE 5DTFB 1IGTB 4M61B 1T7VA 3P0YL 4M7LL 2RFXA 3ESVF 1A47A 1DDHB 1UM6H 4PUBH 3RKPA 2WNGA 1CBVH 3LRHA 4AEEA 1GHFH 3I9GH 3VXPA 1J12A 4YHIA 3VFGH 4NP4L 5EOCH 3TH4T 3QG6A 5I1EL 5CEZE 3DX9B 4MLIA 1M7IA 4GAGL 1DQLL 4KTDL 3SDDA 5GGRY 2HKFH 2B1AH 1FYTA 4L8BB 1XF2A 2RCSH 1YMHB 3RTQC 1RUKH 3O45B 3L3IA 1HQRB 4JDTL 1GGIH 4NM4L 4P4KA 5I1AA 5SWZE 4L4VB 5CD3A 1BFOB 4UB0L 4PRBB 4D2NA 1PAMA 3ISWA 5L7XH 1IGML 4EVNA 4Q58C 1A5FL 3JTSB 5FGBC 3VGEA 4ZXBD 2CH8A 4NQED 1G7PA 4YGAB 4P57A 4C83B 5BS0B 1T4KA 3VFPB 3OKMA 4FQ1L 1MQ8A 1EUUA 4Z95H 4Y5YB 4KROC 5IW6B 1KCLA 3LMJH 3QI9D 5EUKB 3EYVA 5IFJB 5AAMA 5E2VH 4M1GH 2DLTA 4IM8A 2IBGA 2CDEA 2FJHA 4K3HA 2VJXA 3O3EB 1T5WB 4EDWH 4GXUN 4YHOH 2R0ZL 3KYNA 1A9BA 2QQLH 1EA9C 1I9JL 3VWKB 3SCMD 1FSKC 3DJ9A 3N50A 5KVFH 3A67L 4KPHL 4NJ9L 2HVKA 5GS3A 3ZYIA 1PVHA 3C5ZB 1ZHLB 3TESA 2Y23A 4X80L 3SDAC 2YD9A 1JPSL 3U4BL 5IMOB 4RSVA 4WWKA 1A6VH 1XH3A 3MRGB 5JR1H 5FO9A 5F6IB 2PTTB 5D71H 5HHME 5T5FL 1D6VL 4AIXA 3EZJB 4EDXA 4UUJB 4FQXB 2X4SA 4O4YH 1QLEH 2C1PB 1AGFB 2M2DA 1V3MA 4RQQB 4G9FA 3GGWA 2VTFA 2AEPH 4MHHG 3BP6B 3MV01 1JPTL 4JFOA 2Z91B 5DK3A 3ULSB 2Z31B 4X7EC 4AYFA 1YNTA 4YHMH 4BM7A 1DLFL 4LLQA 3UXFA 2IAMB 2IADB 1FL3B 3QP3A 1HCVA 2NW2B 4FTVB 5H94B 3RY6C 5DD3H 3BW9B 2DRUA 5EBMA 4MZ2A 2PR4H 4Y4FA 1QHOA 1V3JA 1AQDB 2ED9A 1YEKL 4HHAA 3A6CH 3ALXA 2CJUL 4NOBA 5J56B 4U6TA 3GSNB 4HIJB 1ZA6A 3LN4A 4XBPA 5J6GB 1AR2A 3NN8A 2Q8AH 4EXPX 1IL1B 3WHXB 4MA1C 4OM1H 1HNFA 2EXWC 5F1SA 1KUMA 1OTSC 5BV7L 5C0ND 2E7LA 4PJGE 5EWIH 2HFEB 3OWEA 1P5VA 3LZFL 3PV6A 4KC3B 3C6SB 4P2QD 5GGRA 4F7CB 3GSOA 1BQHA 4OCLC 3FT3A 5EOQH 1U41A 1YN6B 5A16A 5E8PB 4S1QL 1NC4A 1FZOB 1T0MA 2CDFA 3V0AC 2VLRB 5FAAA 1Y6KR 4NN5C 1NCAH 2GW5A 3V6BR 4MDJB 3GIZH 2CPCA 1SYVA 5MEPA 3WIFB 5JLZA 4YUEL 4FFWC 1OPGH 4NNPH 4KKCC 4CUCA 1OF2B 2VL5A 3UCRA 2MHAA 1CR9H 4XMLL 1BQUA 1LWRA 2E9WA 3FO2B 3IETA 4ZUTA 5L88H 4KJYA 3CH1A 2R56L 2VZUA 4LPUA 4P9HH 1HQ4A 3INUL 3U7AA 1N5YL 2OJZL 4OSUL 5E4EB 2C4FU 5I8KH 1MCKA 4BFBD 4MA3B 5CEZH 3FZUC 1GRWA 3GM8A 4PBWD 1OAZH 4BKLA 1HH9B 1KENL 4OCXL 4L9LB 3G6JE 3ARGD 2R15A 2AXFA 4KKBD 4ZXBA 2NNAB 4DVRL 4PIRF 2DQHL 1A6AB 4YFEA 1E4XH 3RZCC 2Z8RA 1F3DH 4MQ7A 3NCCB 1YYLH 3PWNB 2EKJA 2DYPB 3L5WA 2VKWA 3MGOA 4ODVL 3RL2B 4EUPH 3QI9A 4DCQA 3PL6C 3OL2A 1U8MB 5DMGC 4OGZA 5EO1B 3AXLA 4N0RA 5E1HB 3P77B 3U0PA 1BOGB 4HWBA 3H9SA 1IEHA 4MD5B 1FVDB 1SQ2N 4X6DB 5IB1A 2BVPA 3F6LA 3ILPB 1QSED 3SCMA 1XF3B 2FWOB 5F7LB 3IFOB 4PS4L 1NGQH 5D5MA 2NW3A 1U36A 4NDMA 3AMLA 4GBXD 1NMAL 1X9QA 3H9YA 1G7MA 2CXGA 4Z7UA 3ZKND 4TUJB 5FECA 1CD9B 4YDKH 4RRPG 4AL8H 5HXMA 5FHBH 1YMME 4ZS7H 5INCB 1VPOL 4NNXB 4J7RA 4WWID 4QXGH 4HW6A 1V7NH 2P8MA 1C5DA 1PG7L 32C2B 3V0VA 4FFYH 3KXFB 3DROA 4WHCA 1DBAL 1S9YB 1D9KD 4ZQKA 3G5VB 3HC4H 4C56D 4U05A 3MR9A 1JF6A 2EIZA 1MHHA 3LQZB 3PQYA 4PJCB 2A73B 4JFED 3S9DB 3PDDA 1T5XA 1PX4A 4NN7C 2WIMA 1IC7H 1JPFA 2QEJA 3NTCH 4LBEA 5C2BH 3PIQA 2YMXL 5HHNB 4PGBB 1CXFA 1DE4B 3GMOB 1FCCA 3BH8A 2IALB 3QUXC 5CJQH 2DLIA 4YNYA 5E24E 1HHKA 1SJEA 3UJJL 1L7IL 3WNKA 3MRFA 1S5HB 3HC3H 1F8TH 4WO4C 5GISH 2FJGA 3W9DB 1M1SA 6CGTA 5E8NB 3DSFH 3QH3A 3QEUB 4F7TB 4HSQA 4U3CA 5J0BA 2NY4C 4H88H 1RVFH 5HDOA 1AO7A 3PF2A 2CK0L 4GAYB 5C0EB 3WDIA 4KMQA 3BESR 2R8SL 2LU4A 3FQWA 5DGQA 3WNLA 4NWUL 4OM0H 5CP7B 5DRXA 5HI5D 3ES6B 5DWUL 4C55A 1DN0B 3L3KB 3VFRB 3B3IA 3LSOB 2ZSVB 5HHXH 3WNNA 2D7PA 1UZ6F 1MJJB 2AJUH 3QDHA 2NY7H 2GK0A 2ZJSH 5FGCE 5IVZA 1AFVL 3JV6B 1S9WB 3KNBA 1TNNA 1F45A 4WI8A 1RZ7H 2AABL 2AJZA 5E2WH 3ROOB 4L8DB 4H20L 1G0DA 5BZDB 4H8WC 2CSPA 4P46D 2YZ1A 4XB7A 5IQ7H 1TMCA 4APQA 3S96B 1NL0L 2YPLD 4N0YH 3ARSA 3VMNA 1KXTB 2H6PB 3PDOA 5TDPB 3HUJA 5DRWA 3BE1L 2ICES 4EI5D 1MELA 3GBLA 3WFDL 3OZ9H 4PJ9D 3B2UC 5CSZA 1VERA 5F7MC 3ARGA 2APTA 3BVNA 2BXZA 1QR4A 5CMAB 1U95B 4WFFD 4ZUWA 3G04B 4O2FB 5EBLA 1ND0A 1WITA 2L7UA 1GZPA 4JY4A 3SO5A 1XIWC 4R0LC 4XTRD 1QR1A 2AK4E 2WWMC 1PYWA 3DMMA 4ZO6A 1MCOH 1UM4L 5C9JA 5KZCD 4LHUG 3TPKA 1JYWA 3DUUA 3GRWL 3T0XA 2FJFA 3KVQA 3EDFA 1L6XA 3RL1B 5I9QC 3E6HA 1PSKL 5B3NA 4TTDC 2AQ2A 4WW2B 4NZJA 5ITFA 3U30C 4JRWA 2C4XA 5E6IB 3KPPB 3QQ3B 4UMGA 3BSZH 4RFEA 3RIAF 1QSEA 1T0NB 3CVHA 3V5KB 1H3UA 1AGDA 2A6DA 3CFIC 5ICYB 4MWFB 4GBXA 4M43H 5GRXG 1UWXK 2K1MA 5T5NG 3JVGA 3VFMB 1T1YB 4H1LA 1ONQA 1RJYA 4OZ4B 5IIEB 2ZSWA 4JFXB 3IYLW 4XVSL 2ZCLL 3SKUD 4L5FL 5JW4Q 4EUPB 2ATPB 4PRPE 4S2SB 2DM4A 2ICEB 3X3GH 1MWAA 1ADQH 4UQ3A 5BRZB 3EAKA 4PLJD 5JW5B 1MCHA 1L6ZA 3KR3L 4YXLH 3Q6FB 1P7KB 2FB4H 5F97E 5JDSA 3O3DA 1RULH 2GSGA 5F7WC 5JIPA 1SVCP 3E8UL 2DB8A 3S88H 1U3JA 2DAVA 1D9KA 1D6EB 4OKDA 3ULUD 4S1RL 1H5BB 1CK0L 2FLRT 2XACC 2A1WH 3TYFB 3ZKXC 4UV4L 3QO1A 3P0YH 3BP4B 5C08E 5FYJL 2DIAA 2J12B 5ESQB 4P2OD 1OQOA 3U4EA 5I1EH 4M1CD 1KC5L 1EEZB 2IPUK 4HKBB 4JFZL 4GT7A 2R4RL 2BJMH 1RHFA 1GGTA 1VADA 4XNMB 3LS4L 3EJZD 2VWEE 3EO0A 3PWPA 1P4LB 1CGVA 3WKNA 2IH1A 1BM3L 2XTJC 3PGDB 2EC9T 1UZ6E 4Z77A 3GUTB 4JDTH 2XZCL 1KPRA 1X5YA 4NM4H 5I76A 5D96C 4ZG1A 1MLCB 2OL3L 3HS0A 4PY8J 3MO1A 3ILQD 4TTGA 4PG2A 3K2UL 1I8MB 4WFGE 1IGMH 3VXME 1WBXA 5B4MC 3CFKA 3RI5F 1FZKA 3KG5A 2BNQE 3SKJH 3MYJB 4ZFZB 4K2UL 3LY6A 4NZDA 3WDHA 1FFOB 4HDIA 1EPFA 1WGOA 1X4ZA 4X6BA 1NFKA 4B5EA 4P5MB 5F9JA 3KPTA 2Q8BL 3O6KH 4QTIL 1A1OB 4XXCA 3FQUA 3RFZC 1DEDA 3C5JA 2ITDA 2JJTC 5DUML 1KNOA 4P46A 4OUOA 4K23L 1LP9A 3P11H 3O6FB 1MCEA 4MJ4A 1I9JH 4NBZB 5CCKL 4X99A 3QPXH 4EI5A 4UNUA 3WO4C 3ZE1F 4WU7A 3BD5A 5E6YA 3NIDF 4OCSH 1A6TB 2JJUA 1A7QL 3T0BA 3A67H 3BO8A 5C0RL 1WC7B 5KVEL 1E6JH 1I7ZA 4NQDD 4X80H 4CMMB 1JPSH 1NCTA 3CC5B 5I8OL 5DJ2B 5SX5K 4OD3L 4PJGB 2PW2A 1CXHA 4FS0A 1OSZA 1P2CB 4PRHD 5IJVA 1LO0L 3AC0A 2AEQH 3DVGA 3G9AB 5TPWH 4GS7B 1D6VH 4RMVA 1QFWI 2FIKB 2VR5A 5CGYD 3ZSSA 4KZDL 5C09E 3VMOA 2VDPH 3PP4H 4ETQB 1LEGA 3MA7A 1N64L 4ONOA 5KG9B 4QHUB 4NPYB 4X8JA 5C0NC 1R3KA 4U2YA 5JO5A 1EH9A 1ZGLM 2HAZA 3MJ8B 1DLFH 1DR9A 2W1NA 4U6YA 4PR5A 1AE6L 5FUCE 3VWJB 4C58B 4K7PY 2W9EL 4RIRB 1YEFL 3O4OC 4HEME 3EFFB 1IBGH 4OIIH 4NQVB 1CLCA 1AGEB 1NCNA 3MBED 3BQUD 5F88A 2KZWA 4DGIL 2CJUH 1HILA 2OM5A 4H25A 2M1KA 3EZ8A 1U0QA 3EOAB 25C8H 5DA0B 2PXYD 2V7NB 4KJPD 4LMQI 3PXHA 4APQC 5IWLC 3WIIL 5E94B 4UT7H 3T0DA 5BV7H 2ZUUA 2QADC 1A3LH 3LZFH 4PGDA 5TF1H 4ZPTA 4N0UE 5KW9L 4JFDD 1CGWA 3MLUH 2AJYH 4POYA 1N7MH 1F11A 4P2OA 4S1QH 5EULV 2GQHA 4I13B 3L3HA 1A14H 3DMMC 3F8UB 5TQ0L 5IBLC 4D0CA 4HCRA 4DFHA 4WGVB 1CFTB 1NMBH 5IEKA 4S11A 5E8OB 1QPXA 2ZCKL 3MV8E 2CRZA 3IJSB 2CMRH 4NUJB 1CDYA 4HUXA 3BI9X 3C6LD 4JPKL 2EIDA 3QDAA 2HJFA 4PJFF 1XZ0A 4N0CD 1N5YH 4OSUH 1L0YA 3X17A 5DZNA 1H15B 1P7QD 1AR1C 1D5XB 1KCRH 1ZA3B 4JM2D 1KCSL 4Z78B 3PABB 1Z9LA 1KULA 1YMMB 9CGTA 3S98A 4JKPH 4YQXH 4OCXH 4MXVF 4XXDA 3NABL 4GMTL 4BSWA 4OZHE 5AWNL 2J6EL 1YPZA 3V6OA 3VGHA 4DVRH 2DQHH 4OV6F 2VXVH 2WINA 4N8CL 3OAUL 1CT8B 3BIAX 1YQ2A 1ZE3C 3IDMB 4X9BA 3ZE1E 4NUGL 4IIQA 2I9TA 3NIDE 3DHMA 1NJ9B 2E7BA 3ZKSD 1R6VA 3REWA 2CIKA 4WDIA 4ZDHB 4RWHA 4X6EA 3RP1A 2OSLA 5DMKB 2CQVA 2EC8A 4PP2A 4PREA 1CTNA 4XI5C 5FK9A 1VCAA 3CFBA 1ES0A 5EORL 3C9NB 1JWUB 1Z6JT 3LRSA 5FV1L 5D7IA 1RZFL 1A4JB 5I1KH 5IKCB 1KLUA 1PKQE 2XFXA 1S9KC 2BSTB 2IWGA 1KLFA 3HPJA 1XF4A 4MJ2A 2V9RA 1I7UB 1SJHB 3EDJA 1R3LA 3DXAE 3MRKA 3S8WA 3GNML 5AYQA 1KGCD 4TSBL 4NQDA 4OFKA 1I1RA 5DC9B 2C3WA 4CW1B 5DD1L 2XZQL 4KK9C 2GEEA 4FFVD 3K74B 1BX2A 1A6ZA 4ZMAT 3RU8L 5GGUB 2PYED 1SY6A 3EFDL 5I71C 1E6OL 3LHPH 1BFTA 3QUMA 5C0AE 4PRHA 3GKZA 3OKLA 5HD8D 1RZKC 3EYOA 5HVGB 2QR0B 4XMPL 1H8NA 1PG7H 2FH8A 1BD2D 4LOUD 4XRCA 4Z7WE 1DBAH 2VLJE 3EOBB 2EZ0C 3RWCA 4JY5H 2XKNA 3QDMD 4D0DA 4PG2C 3T08A 1EGJL 5H2BA 1XMWA 4HUKB 1X3DA 5J6HB 2XA8L 1HHIA 4UIKL 3KJ4C 2MQ0A 3BZ4B 3DX8B 5DURB 3JV4B 4MJ5B 1NMCB 2C9AA 1UA6L 4ZSOB 3UJJH 5I16B 1O7SA 4L4TE 1L7IH 3Q1SH 5DJ6B 3BQUA 4PP8C 3RWFB 1GAFH 2X2YA 4G8IA 4QRTB 4RISH 4XXCC 5DHVH 3E2HA 1IQDA