1LEKA

Crystal structure of h-2kbm3 bound to dev8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
273
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVSLRTLLGYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 76
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lekA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1lekA01
3MNZB 4X7TA 2N7BA 5DD0L 5CZXD 4NUJB 3P3YA 4LP4A 5I1LA 1RJLB 1JUFB 1FLRH 3QISA 4P2RA 1NBZB 1YC8A 3C87A 4P5MA 3BH8B 3A6BH 2Y9RT 3VXSD 2P7TB 1XR9A 2NR6C 4M62H 2YK1L 1RUQH 1ZHNB 1MCIA 2V6HA 3UP1A 4DVBA 1XZ0B 1H15B 5I1HH 3RWCB 3HZKB 4G6JH 1FFNB 4YDIL 3WFBL 4JY6A 4G7YL 2YR3A 2DBJA 2E5EA 2X4TA 2EICA 3TBSB 1FL5A 3T0EA 3S4SB 4PRHE 1Q0YL 2BSSA 3LZFH 2VLJA 3ZKND 4PJ5A 1F8TH 4JRYA 4LLVA 1EERB 2D4DA 4O02L 1MCEA 1S7UB 4JG1H 3ROLB 3G04A 5FGSA 4U1KA 4ZD3H 2XRAL 3CFIC 4J3TA 3TYGH 4FQ1L 1HKLH 4KXZI 35C8L 4GMTH 3SKNB 3PJSA 5FCSH 3GBLA 2APBA 1AR1D 4JFDB 5T33H 3B8YA 3VXRE 3UTQA 3QUXB 4KUCD 4U0RC 4YHIB 5EOCL 3BH9A 5I1EL 3OJDA 2HKHL 4JJ5A 4HWZB 4P23D 2DQIH 4X99A 3ULUE 4MA1B 3L95A 1NLDL 4BQ6A 5GS0L 4GAJL 4QXGH 1ZGLB 1BVKB 2RFXB 3AU1A 4EBQL 1J8KA 1N5AB 4X6FA 2VXQL 4LPXA 4F9LA 1A0QH 2PO6A 1IGCH 3MSPA 4LKXB 4TVPD 1OARL 3EOTL 3HZMA 3IYLW 4M7ZC 1A6VL 1MLCB 1Y18B 3C8HA 4CVXB 3RGVB 4ZFZA 3QIUA 1QHPA 5EA0H 1FC1A 4R97C 3W11D 1NGXA 1E4WL 4CADB 1SYSB 1S5HA 3JTSA 1QSED 2NY0B 3QDJA 4RFNB 4KHTH 1TPXC 4MAUL 1HZHH 2DQEL 1NANH 3IJYA 1E27B 5DHYB 5DJ8A 3ULUC 3NABL 3FN9A 2D0GA 2XZZA 5SV3A 1HYRC 3MRFA 5HGAA 1M71B 5DUPH 2BNRD 3DXAA 1DUZA 1S7RA 4FFWD 3V7AE 3S97C 4UILH 3CDCA 3NPSB 3LS5H 4GG6A 3NZHH 5MEPB 3LRSB 2R69L 2DTML 5EU3A 4KKNA 4ODUA 4OFVA 2I26N 5IGXH 1EMTL 4MDIB 1T66C 2F5BH 3ZKXB 3HHRB 2HMIC 5FYLD 4OAWA 1KPVB 1U91B 4BSVB 2FIKA 3D5OF 5HGBB 2E27L 1L7IH 1KGCD 2IH3B 5IJKA 4QHUA 3U0WH 2LFGA 5HYJA 3BUTA 2P5EB 1TZIA 1YMMB 1S7QB 3O3EA 3QUKB 3KHOA 3O2DH 4MMXC 3R8BB 1U8KA 2XZQH 3B3IA 1O7SA 3EOBA 4KK9C 3MJ9A 3QDAA 3QJHA 5HVHB 4DGIH 3S34L 5FOBA 1LO3L 3OF6D 4MCZA 1X5YA 2IAMC 2NYYD 4KTYA 4P2QB 4HIEA 3OAYH 3ZT5A 1LE5A 4IMKA 3QIBD 3OXSB 5MI0C 3WFHA 3WKML 4J23A 2EE9A 4YO0B 4HK0B 5D7IF 5GRXG 4MS8A 3DSFL 4H88L 2ARJA 1OF2A 4XGZA 4J4PD 4X6BA 5H94B 5KSBB 3C08L 2P44B 2R23B 4F15B 1NAKH 3SY0A 3DMMD 3RJDA 2W9DL 1T04A 1JIBA 1K8DB 4N0FA 4LARH 3N0PB 4Y1AE 5HGHA 4JPKH 2FX8H 2YD8A 2QJDA 4NCDA 1YDPB 1CU4H 4JFHE 4KUZL 3VMOA 3WIIL 4CN6A 1I8MA 2X9XA 1BBDH 3AMLA 3BXNB 3MRCB 3RHWK 1NDMB 4KMQA 3U36A 4LSPH 3BP6B 4S1DC 1YEHL 1H3VA 2NW2B 4D0DB 3L5IA 3HCVB 5FGCE 3UYRL 2XFXB 4BSWA 3B9KC 3G5YB 3IXAB 3L3KB 4NC1C 4WENB 2LVEA 5J12B 2BJML 4PJFF 2P8MA 4JM2F 4G3YH 4S0UC 2L7UA 5GS1A 3GUTA 4BFGA 1M6OB 2GTWA 2G5BB 2V17L 4DUWA 1ZVSA 3CLFL 3W2DH 4TUOA 5J89A 4XNYL 4ELMF 4FQHA 3FCTB 4XRCB 3RUGA 2IQ9H 2O93L 2AJXH 3O3BA 3QFJD 3BYTA 3GSWA 1KXTB 3ARED 4NM4H 3SDDC 4L4JA 1IRAY 2XZCH 1DZBA 4CL7A 4PG9B 1WWAX 2IWGA 1HINL 4KJQD 3TZVC 2YA0A 3QWQB 3S37X 4JHWH 1J05B 3RA7H 1HE7A 3QHZL 3M8OL 4UINL 5T3ZE 1HOCA 4LL9A 3WN5B 5I1CL 1UENA 3JWDC 1A7OL 3DX9A 3T65B 4L9DA 1T3FB 1GZPB 1CLZH 4DKFH 4XWOC 1I1AA 4S1RH 2EKSB 3RWIA 2I27N 4ORGA 3SGEH 2FWOA 2QQKL 1I7TA 1EHXA 4LSTL 5EC2A 1CI5A 3EYUH 4AM0B 3EFDL 4G59A 3PWPA 5IJVB 4YHOH 3NPZB 3NIGF 2Y06H 1OGAB 1XGTB 5ILTH 3GMQB 1M1SA 4U0QB 1JZ4A 5C0CA 1ZVYA 3IAQA 3BD3A 3TPUE 1AD0B 1UVQA 5F3HA 1KCGC 1DR9A 2BOCB 4TUJB 5K33A 3V8OA 3PNWA 1H3PL 3E1F1 3LAFA 5C09D 2NX5B 2AQ2A 2R0WH 4UDTA 1WCQA 5IK3B 1MELA 3T2QA 3B6SA 5CBEB 4N5EA 4OCWL 4X9IA 2BNQB 4YHML 3WHXB 2HVJA 2DYPB 3FOLB 5D7KE 1FZJA 5A2IH 1CG9A 4FA8A 5EUOA 1YUHB 2XA8H 4LVNC 2PTTA 2Z91A 3IU4H 3LEVL 1U3HA 1YN7A 1EJ6A 4MZ3A 4DVRH 4OLYL 3QXAA 1ULVA 2LV4A 4P2OB 5JIPA 1AJ7H 2CLZA 3D18A 4IRSD 2D0HA 4WV1B 5J13C 5ID0B 1PYWA 1M05A 4XMPL 4QRRD 1U8IB 4LLQB 5GZNC 2A83A 2ZSWA 4OQTL 5E56A 5IIEA 3IGAA 4U31A 2VLRA 3V6BR 3O3UN 3TO4A 3QCVL 5DHVH 2OQJA 1YA5A 2BDNH 2Y5EA 3GHBL 4AZ8A 3QB7C 1IAMA 1RZKL 3VGHA 5I1IL 1FNAA 4KMTL 1BX2A 3KPTA 4HBCH 3CFEB 1XF2A 3MRQA 5JORB 4MJID 3SJVA 1PKQB 1S9YB 4P99A 5IHZB 3C9NB 4OZFB 4P59L 4YHPB 5AAWA 3CU7A 5DJDB 3UTTB 3TO2B 4N8VA 1L4IA 1QRNE 1NC2B 4LCWB 3GMMA 3NGBC 4JM4H 1BVLA 2GT9A 2RR3A 4P46B 1OSZB 4H8WL 2GI7A 4JQXA 5EU7E 5DVNA 4WDIA 1NPUA 5DD3L 3DVGA 2H9GB 3RIAK 3MLYL 2BVOB 2X4SA 5DD6B 4NRZA 1I1YA 1XGQB 1S7TB 1G6RB 4OZ4A 2NY4D 1IGJB 1DUYA 1CXKA 4GRMB 5CINH 2R29H 3VI4F 1IEAA 4G8EB 2A1WL 3BGAA 4RMVA 4XPBH 3V0AC 4MJ5A 4NQDE 4P23B 5FGBA 1MUJA 1QFPA 4RISL 4TOYH 3PHSA 4ZFFB 2C1PB 5EORL 3TFKA 3TN0B 3OAZK 1P1ZB 5T1LA 1SMAA 2MSPA 4K3DL 4HXBH 2C1OB 4QHLA 5JR1H 4QRSB 1OTSC 5BW7C 2FL5B 3G6JA 1VPOH 2C7UA 5DJAA 5IFJA 3TJHC 1GZQB 1JE6A 3L5XH 4K3HA 5JTWA 3DVNB 5CIPH 3FFCD 2KPNA 3QDHA 1B4JH 5ACZB 2HFGH 5HYQB 2BNUB 3RU8H 4RAHA 1MRDH 1T80A 3KYOA 2D03L 4K8RH 2VZOA 1XF5A 2VZUA 5DJXB 3D9AH 2G2RB 4QT5B 1UH2A 3EHBC 3STZB 3LD8C 2DM4A 4NUGH 5CSBA 3O6FC 1R3KB 4KAQL 1U0QA 3RL1A 5LXGH 4DUVA 3MJ8A 2WY3A 2CLRB 5HHQA 3D3VB 3DETD 4MJ6A 3ZE2E 4NQEB 4F8QA 3RWDA 4B0MM 4I5BB 1F3JB 3VXME 2YBRA 4XI5D 2QADD 2DQJH 5TF0A 3BAEL 5J56B 1JHTB 3AAZA 3V5DA 2JJTC 4KVNH 4I4WB 4O51B 4OCLC 4PJ9C 1HN1A 3MV8B 4QRPD 4X0KA 1MFAL 4Q2ZB 1MH5B 3DPBA 4AH2B 1Q72L 1XIWC 5GHWL 3E0GA 5HHMB 4LIQE 5CHNB 4NQCA 1QYGL 2IANE 3KPSE 5E6ZA 4ZXBD 3ULVF 2Y72A 3K1KC 3U9UB 3CVHL 3H3PH 2F19H 1UJTA 3S37L 3T0AA 1PZ5B 4HS6B 2GSGB 4Z0BH 4CN4A 4LSUL 3IFNL 5FUOH 6FABH 3S3PA 3T3ME 1H3WM 2AXJA 3IFPA 4KJWC 1KJ2L 2VITB 3D0VA 3QQ3B 1EUUA 1NCCL 2DB8A 5FO7B 3ILPB 1BZ9B 4ODWA 1A7PL 5EO9B 2Q6WA 2Q7NA 2CLVB 2ZUQC 1CQYA 5J4MA 2NY5C 2CK0L 4ZUWA 3V4PL 2X4QB 3I3EA 1J1OL 3W5MA 4KGLA 4X6CA 1BQHA 4BFEA 2ZUSA 5BO1H 1AI1H 2IF7A 2R9HC 4OF5A 2H32B 4OKVA 2H8PA 4DW2H 4PJIA 1MJJA 3WHE1 3GJFA 4YE4L 4Q9CA 2Q8AH 1FFOB 1YQ2A 3FB7B 3WJLA 4X7SH 1QKZL 1YPZB 4HSQA 5JW3H 4DUXA 4XAKE 1FC2D 3GO1H 5E8NB 5GISL 3RWHB 4FFYH 4LPYA 2ICEB 5JXAL 3P0YH 5FIEA 1YEEH 1BLNB 1TTFA 5TE6H 3QJFB 2VE6A 3V7AG 1E4KC 3HMWH 1DP0A 1FO0H 3C6LD 3FO9A 1EO8H 1N0XH 2J8UB 4IOFC 1QQDA 3Q6FA 3KYNB 4FP8L 1S78C 4F7TA 1MCJA 5DJZB 1ZEAL 4FQQA 4MA8H 1ZV5A 4X6DE 1WBXA 4F7PB 2PYEB 3BPOB 4ONHA 1N7ML 5GS2H 2B0SH 4J12A 2Z92B 4TPRH 3AREB 2BERA 4EJ1C 4MNGA 3OKEB 4Z7UB 1LO4H 4MNHA 1GAFH 1JWUA 2QHRH 3HG1A 5HPMB 4XP4L 3AY4C 3VWKA 4LSSH 4OSUL 3VFWA 5IOPA 2HRPL 4V1DD 3VRLF 4OZHF 1UZ8B 4V2BA 5J06A 2D9QB 2HLFD 3WFEH 4X5WA 4JFZL 4Y4HA 3PWNB 2ORBL 4HIXH 3VFPA 1C7TA 1R5WB 2AXGA 2OCFD 1AGCA 1G9NL 4ZO7A 4U6XB 4BZ1L 2EC9U 3SPVA 1GH7A 2EYSA 2K3TA 4HXAH 4YEFA 2ICWA 5B39A 4IRJA 5DTFB 1U8OB 1FFRA 4YPGA 4IDJH 5DR5H 3MLVL 3V0WH 1EGJH 2BSTA 3MRLA 1IAIH 3QEHA 2A74A 3F5WA 3DECA 5DO2C 3WXVL 5E5UB 1YMHB 1L8JA 3S5LA 5MEOB 1YQVH 1JF1B 5F71A 2DICA 4PP2B 2D31A 4TYUA 3PWJB 3JTCA 5BMFH 1UXWB 1M4KA 1N8ZB 2PTUA 3KPOB 4X4XB 2QKIA 1CDHA 2YWZA 4NKDA 4FMKA 7FABH 1FZKA 3KLDA 5I75B 4MCYB 3GIVB 1RK1B 5GSRA 4I0KA 3MR9A 2G75B 2DWEA 1QSFD 3U46A 4MA7L 1KXVC 4HWEL 1OAXH 3V52L 2ERJB 3DV4B 2R1WB 5C0FA 1CDCA 4HKJB 4N9GB 1AD9A 2V5YA 5FDWB 5D1XD 3RVUC 3V4VH 4QY8B 3DX6B 4P0DA 5JZ7D 3UJJH 4Y4FC 4MB5A 4KQ4H 4XP1L 5LAXA 3LKOA 1A6AA 1KC5H 4KZEL 4MHHG 3KYKL 3BUYA 5C07B 5ANMA 4JFXA 5KVDL 4LBEB 5GGVL 3QFDB 1WZ1H 1WAAA 5DC9B 3WUWB 4FQJL 1UM4H 4I0PB 2HT3C 1TIUA 1KT2A 4UUJA 3K4AA 3HC0A 4L5FH 4Q6IB 2P8LB 5I1JH 5I8EA 4OB5H 4WCYL 5JW4R 2UZIH 4QCIB 2EEBA 5ENWA 4WWKD 4GAFB 3PWVB 4PJAA 3P2TA 5ALBH 1RAMA 3IKCB 4M61B 2F54B 3KPRA 5CP7B 1W72L 3HE7A 5D2LE 1HQ4B 2J6EA 4PJXE 2RBLA 1A14H 4LVHC 2HP4A 2N1KA 2WBJA 3KR3L 3LIZL 4JN1H 1JMZA 4TSBH 1J8HE 2JJSC 2CR6A 4LPUA 4G6FD 5D7JB 1JPGB 2J12B 3FL7A 3MRKA 4NGHH 4C56B 4PLOB 2GJ6D 3IB4A 4KVCH 1MIEL 3RWEB 1EHAA 4YDLC 1MFEH 2D7TH 2VSDA 1ZLVK 1NGYB 1ES0A 4GKOA 1LE9A 5E6IA 1ORSA 1IGMH 5B3NA 3QXDB 4DKEL 3IDJB 4NO2B 1FNEA 2FB4L 2IPTL 2OR8A 5I9QC 4WY7H 1RUKH 1ZHBB 4NT6A 2NTSP 5GGSY 2EH7H 2Z8SA 2AEPH 2EIDA 3WIFA 1G9MC 2HH0H 3MLSL 4S1QL 2ID5A 5KZCD 4F33A 4EDWL 4MD4A 4JZJC 2XWTA 5EOQL 4OBRA 1U6AL 1J0IA 1KTDA 1ZA3A 3QO1B 3C60B 3ZYOA 3UZEA 43C9A 4K07A 4N1HB 5C08D 4DK3A 1ZWIA 1HEZB 1IGYA 4NYLB 4YXKH 3F58H 1D9KC 2OMBA 4G43B 4JM2C 3U4BL 4N0UA 4J7RA 2EDLA 2DBLL 2AXFB 1A64A 3O6ML 1HHKA 2OX5A 1SJEA 1AY1L 5GGUB 1NCBL 1PDKA 2J5LB 5EZJA 4EI5C 5F89B 1MRFL 1AHWB 1JGUL 4NN6B 3BW9A 2UY6A 3PP4L 4H5SA 1KLUA 4I18A 3O2WH 1JYWA 4R0LC 4MLIA 5CKAA 4NNYA 1MRCL 3DHMA 1B9ZA 5IW1A 3O4LD 2A9ML 1WJ3A 1DBKH 3RAJL 3ARDD 2X09A 5D1QB 4Y2DB 5KOMC 4GKZB 5JO5A 4D9LH 1LMKA 5B4MC 3PV6A 1NJ9A 1D5BB 2QR0A 1RD6A 2EYTB 3DRQA 5AWNL 1PW3A 1BEYH 2JCCB 3QDMB 4Y5VB 1SJVA 5HJ3A 1VEPA 1AFVH 5J9PA 4QNPE 3STLA 2X2YA 4ZSOE 4P2RD 5D6CA 4Y4KC 3FOMA 1VSCA 4OF0A 1BJ8A 4FQCL 2VYRE 4G8GB 4DJMA 3MLUH 4S1SH 5KVMC 4M6NH 3SDCB 3EGSB 3ZKNC 3SE4A 3UJTL 2CGRH 4GMSL 1RZJH 3PGDA 4QOKE 4KI5D 3KNBA 1ZS8B 1G1CA 4XBEL 1FP5A 1T4KA 3UO1H 1N6QH 1EHNA 1YNKH 2BRQA 3T0ED 1LP9B 2RCSL 2V7NA 2VLJD 2Z35A 4JDVB 4PJ5D 4JRYD 3SGKC 3DIFB 3P4MA 3F7YA 2FD6H 4ERSH 4APQA 4R90H 1ZTXL 4ENEC 3INUL 4W6YB 3IDGB 4Q58C 2O61B 2GEEA 1T2JA 2KH2B 2KQMA 5FECB 4NZJA 3ALWA 3WFDH 2BSRA 4OGYL 4HT1H 3UMTA 2CIIB 5IBLD 1KB5L 3FQWB 2VAJA 1LK2B 2EDYA 3SE8L 2PW2B 4O2FA 4WRLA 3MV7A 3DI3B 3QIWA 3V79C 1RMFL 2PO6D 4MXWH 3D85B 4G6KH 4FQ2H 1F6LL 4U1NB 2LTQB 4ODHL 4LHUG 3QIUD 1U8LB 3MGOB 4UB0L 3QR2A 2E7BA 4M1DL 5KS9F 2HJKB 5DJYB 4M7JH 3LKRB 3QDJD 2FO4B 1S9XB 3FO2B 1DBJH 4PP1C 2AJVH 2BOBA 5DQ9B 4GXUN 4V1DB 5GRJL 1J0JA 3KS0J 4K9EL 4M93C 5SWZA 5TDNA 3QUMH 1EEZB 2IPKA 5I1DA 4GRLC 2BY1A 3DXAD 3OTTA 3CZFA 4U6YA 5TGBA 1T7VA 3H9HB 3RNQA 1JGEB 1RZ7H 2GUOB 1EFXB 3F7VB 3ARFB 4PRIA 2ZOLB 1MHEA 4PJDE 1QSZA 1FFQA 2QSCH 4XNMA 4HIIA 3OR7B 4F2MB 3QCUH 5H37H 1ZHKA 1P7QB 4F9PA 3L7FA 4WUUE 3SKUD 4Q9QL 3VD9A 2EXWD 4NP4H 4K94C 5L8JB 2WUCH 4KKAC 4JY4B 4JDZA 1RFDL 5DMYA 2R8SH 2JB6B 3OWEA 1NDGB 2DQDL 1JGDB 2CKBL 2IALB 3AMKA 4P2YA 3U79A 5HYJD 3BZDA 1TZGL 1FYHB 5SX4I 4YEEA 1A4KA 3VG9B 4MNQA 3CXDL 2A6JA 4OGAD 3WL9A 4FXLA 3GMPB 1LDPL 1NMAH 1I7ZA 2BVEA 2VWEC 1VKXA 4GOSA 1CZ8H 1F90H 1W8OA 2XN9E 3V0VB 1IKFH 1AIFA 3LHPL 4KQ3H 3TGXA 1FNGA 3VFNA 4FQLL 4TVPH 2DQTH 3SCMC 1NFIB 4PJGF 4PD4J 4R7NB 4WI6A 4ZQKB 5IVXE 5D2NA 3PIQA 3OKMB 4NM8L 3RPKA 4MS8D 5B3JF 4OM1L 4X98B 1A6WL 1MCCA 5I71B 5D1XB 4OKDA 5ISZA 4DEPB 4PD4K 4RFOL 4DGYH 2WUBH 5K9QI 5DEFB 3UBXA 2FX7H 1LQVA 2MKWA 3AB0B 4HFUH 5T1MB 3D0LA 3VFGL 4LEOB 3V8CA 3FQXA 2ADGA 1BBJA 1TCMA 4PJ7F 4Z5RA 3IU3B 3MREB 4NO5B 2OMNA 43CAB 5CEZD 3FONA 5IM7A 2Q8BH 1NLBL 5L7XH 1OAQH 4YHZL 3FRUA 3U0PA 4DTGL 1I9JH 4A6YL 2CJUL 2M1KA 4AG4L 3LPWA 1FHGA 1S8DA 3EDDA 4XX1E 1W0VB 2MPAH 5E7FA 5HYSA 2FJHA 1NFDB 1IC4L 3BIBX 4I9WE 2H26B 4OLWH 4R9HA 1PG7H 5DEGA 3OGCB 2QQQA 4RQQB 3QUYA 5FYLH 3O6KH 3VDCA 2OJZH 3ZHDA 4ZFOL 4D8PA 3KPNB 1RZIB 3O0RL 3U0TA 2IG2H 3ULVC 5BVPH 3UTPE 5I8CB 1WT5A 4NZTH 4PJCB 4N0CC 4LPWA 4P9ML 1CFVL 2IBZY 1T5WA 3CD4A 4RWYH 2R1YB 1A2YA 1QD0A 3VJ6A 5CMAB 3EW3B 1YY8A 4HG4K 1SYVB 3BO8B 2DQGL 4DZ8B 5IMOA 3MLXH 4TNVK 1T1XB 4UIKL 4KPHH 1MWAH 2HTKC 1R0AL 2IQAB 3NFSH 4RWHA 3U7WH 2Z4QB 3ZHKA 2O5XL 3RWGB 1R3LB 5I30H 3HB3C 5KVFH 1OD9A 2EDEA 4NNXA 4OZGA 4XH2A 4WUKH 4KI5F 1I1AD 3NFNB 4LDOB 3IXTB 4MGXA 4XBPB 3IETB 2Y25A 1Y0LA 4NJ9L 5EUKA 3UJIL 3NZ8B 4KV5E 5DVLA 5E8OA 4L29A 3KJ6H 2UZXB 3FQUA 1DL7L 1II4E 3PWPD 3EYFA 1RHHB 3ZYZA 3V6FA 3L3HB 4Z7QE 2HJLB 4H1LG 3DO7A 1BM3L 4ZFGH 3EJZC 4XNXL 3EYVB 1OSPH 3T1FA 3H9YA 2B4CL 2ZJSH 5C0CD 3P9MB 4PS4H 5C0JB 5CEXB 3U2SA 5J6HB 5HVGB 1IT9H 4N8CL 3TP4A 2DIAA 5EU5B 3E8UL 4L1DA 4HWBL 5DRNA 5KJRH 3W0WA 2XICA 5DFVC 5DZOA 1CR9H 3RWFB 4ZUUA 3O4OB 4ONGL 5FFLA 3VXNB 4P4KC 4Y0GA 3TYFA 3QZWG 4N5ED 2JJUA 4RMQA 5E2TL 2VXSL 2ITCB 5TFSL 2EDXA 5I18L 4XCCL 2FO1A 5I15L 5MENA 3ZDYF 3DX8A 3BISA 3CX5J 4AY0A 4U6VH 1U3HD 1A9BB 1ONQA 1QBML 4JFOA 3WD5L 4PV9B 1PJ9A 1ZHLB 1K6QL 4POYA 4J3OC 4FOMA 2DQHH 4PRHA 5KSBF 3UTSA 5CD5C 2AJUL 1H5BB 3NFPA 1A6TB 1A7BA 4GS7C 2H45A 3VRJB 5K9OB 2LAAA 4P5MB 4IBLT 5DJ2A 1KIRA 1RIHL 4QEGA 4MDJB 5I66B 5L0QC 2VLRD 1KG0A 1ND0B 4LGPB 4P5KA 3TO4D 5D1ZB 4M48L 3WLWD 5C0AA 4PRNB 3FQNA 1AGFB 1SVCP 3KPPB 1YECH 3PV7A 1KN4H 4WEUD 1XF4A 1GC1H 3SJVD 5GJSL 3P73A 4YQXL 2QLVB 1UM5H 1YEKL 4JREB 4F7MB 3QA3A 4JRYB 1TJHL 4PB0L 4G5ZL 5CUSL 3QO0A 4GLRH 4UT9L 3MJ7A 3G04B 2AK1L 3KPQA 4LSQH 5DJ6B 1A6ZA 1AH1A 4OLXL 3SKJH 1NL0H 3SDXE 1T03H 2J4WL 3FZUC 4KHXL 2I60L 3UTQB 4YIQB 5T5FH 4U1JB 2EDBA 2QQNL 4ZUSA 3BH9B 1D6EB 3OJDB 1HH6A 4QF1B 5E94B 5JW5B 5CGMA 1SY6H 2JJVA 3RZWA 2NXZC 4ZG1A 1JI1A 2FX9L 5GRVL 3WNPA 2CO7B 1T7ZA 2OJEA 4O9HL 3BPLC 5EBMB 4C83A 5DUBA 3AU1B 4Y5XC 3O6LL 4YBLB 1HHIA 4X6FB 3MCLL 3TFKD 4PREB 2OR7A 5T1LD 1Z9LA 5FCUH 1HHHB 5E2UL 4GW1A 1A02N 1K4CB 4ZFZB 3QIUB 1J86A 5D72H 3DX7A 4M8QA 4ONFL 5FA3A 5I1KH 1X5AA 4ZS7H 4YHYB 4H26A 4FABL 5DSCA 2IAMA 2ED9A 1FVEB 3IJYB 3MGTA 2VLLB 3CSYA 3VH8G 5GZOD 2BHZA 2GSIB 4R2GB 4CMMA 5HGAB 1NKOA 1T2XA 1RJCA 1TCRB 2R2BA 4D3CL 3DXAB 1RIVH 3VXRB 1DUZB 1U2HA 1NAML 3RZCB 4DOHE 4NQVB 5EDXA 4HUWB 4JHBA 1ODAA 5CZVH 2EDJA 3MACL 4K2UH 4AEIL 2DLEA 5SWSA 5K59E 3DUSA 5CILH 3MROA 3JWOH 1MJ7H 1FLRL 3CCHA 4OAWB 5A2KH 3AS2A 5F1KC 3A6BL 3IDIB 2FIKB 3BZFB 3JWNC 4M62L 3OAYK 2BVQA 1RUQL 5HDBE 3IVKA 5I1HL 2YA1A 3MRRB 1TZIB 2WP3T 4G6JL 3IKKA 1FNHA 3MCG1 1NEZG 1RZ8A 2AV7A 4NQCD 2X4NB 4NQXA 4HGWA 5F7YC 1U8KB 4U7MA 1RUMH 3B9KA 1C5BH 5FHBH 1CDJA 2CDFB 3QJHB 4DQOH 3HS0B 3IDNA 4LDEB 1UT9A 4UOW1 2DM2A 2YD6A 4UT7H 3ZDZE 1IL1B 3LQMA 5FOBB 5D96C 3QAZB 1AO7E 3LZFL 3QSKB 4M7LT 1F8TL 2DJ4A 4HIEB 3T4AA 4R8WH 2YN5A 2Y23A 2MHAB 1JBJA 2PN5A 5EO0A 3V5HB 5F93C 1T21B 4JG1L 4PJEA 3WLBA 4Q7DA 4ZD3L 3TYGL 1QFWH 2ARJB 1HKLL 1YNTB 1T1ZA 4XGZB 4GMTL 1W2KT 2NNAA 2OL3A 3BEWA 3SDAB 3SDDA 2P24A 5T33L 3KLAA 1KTKE 1U58B 1L6ZA 3I6KB 5DHVA 3TZVA 1KYOJ 4ZO8A 3TVMC 4RAVA 4RA3A 4G9FE 5FM8A 5HGHB 4FQPA 1REIA 2DQIL 3HPLA 4NN5C 5HHOE 3CVHB 3TBVA 5MHSE 1DEEB 5IB4A 4FQXB 3NCEB 5FA4A 3D39E 4QXGL 3LSOA 5MEQA 4HX1A 1A0QL 1IGCL 4EIGB 3W9EB 1KJ2B 5DZNA 1Z0NA 2X42A 1F42A 1LHZA 4Y16C 3IDMA 3LH2H 1JZ7A 3CJJA 5EA0L 3KJ4B 3EO1B 4N5UA 1PY4A 2YD4A 2Y07H 4G9DA 4QYOA 1L9NA 3GSNH 3SKMA 1E28A 4KHTL 5CLWA 1HZHL 4UMGA 1B90A 3GUTB 3M07A 2GTWB 2E9IA 4UAOB 4XVTH 5LWYH 3MV9A 5EBLA 1CD1B 4BJLA 1DE4A 1FYTA 3T77A 1M7IB 5DUPL 4QRUB 1T0NB 4UILL 5FB8A 2EE6A 3LS5L 3BPCB 3NZHL 4Y1AB 4UNUA 1AP2A 5JPMA 3HG1D 4W4NA 2X4OA 4M43H 5IGXL 1YYLH 3EDKA 3VWKD 4O58H 5E4EC 1A7NH 1I4FB 1DDHA 2F5BL 5EZIH 3DV6A 5F3BA 4PTUA 1FSKB 4NN7B 1ZA6A 4YZFF 1E6JH 2OLDA 3T3PF 5F9OH 1L7IL 2ZPKH 3RWIB 5FGCB 3BKYH 1Q1JH 3QNZB 3U0WL 3QG7H 4Y4HD 4NO3B 1F6FB 3UX9B 3PWPB 3O2DL 4EVNA 2XZQL 4R4ND 1A3QA 2ATPA 1N6UA 2Z0BA 3BHBA 4DGIL 5ID1B 4IRJD 5ERWB 4HWUA 5D7LA 4P3WA 3DWTA 2PTVA 3JV0A 3IDUA 1OLLA 4WNQA 3MRPA 4G42A 2C4XA 2EIZA 2NXYC 5EN2B 2EEAA 2C3HA 5CCKH 3DUUA 3MXVH 3ZKQD 1RY7B 3I75A 3PNWB 1QLRA 5LQBH 4FZEH 3O41A 3R06A 3PGFH 4XX1G 2OTWB 4EUPH 1NAKL 1VHPA 3FT4A 5IW6A 2FGZA 1FZJB 2XTJE 1NMCB 4LARL 4S0SD 4RSVA 4Z7WF 1I9RH 2HFFA 4JPKL 4BQ9A 5DJ0A 2FX8L 5EC1B 1CU4L 2EH8H 2NY3B 3F6IA 3GSQA 1BBDL 4KK6D 3L3IA 1MI5E 4ZTOH 4LSPL 3C5JA 3BWAB 4DGVH 2PKDA 1W0WB 2AEWA 4P3DA 5A2LH 1IQWH 3G6JF 5EOTA 1PYWB 1M05B 1Z5LA 3HAEB 2NY1B 5HY9B 2VDQH 3L9RB 3TPUB 2CRZA 1AGBA 4NRYB 3IGAB 4WWKC 1UZ6E 4MWFA 4E42B 1NCNA 3TO4B 3BPNB 2AEIT 1PKOA 5JW4N 4G3YL 2J3SA 3GZKA 3Q5YA 4L8SB 1NANI 4M4PA 4P57B 12E8H 3ARQA 3W2DL 1I3RA 3P4NB 4OLUH 5BW7A 3MRQB 3I6LE 4R4FH 2IQ9L 3TJHA 2D4FA 2GFBA 2AJXL 3JSSA 4OLVH 2WNGA 1S7WA 2AEQH 3KPRD 4NM4L 5JIHA 3WCYA 1OTTD 2XZCL 3HE7D 1T7XA 2CUIA 4JHWL 1R3HB 3REWB 3RA7L 2XY1A 4YHNB 2WBJD 5E8PB 5DWUH 2JB5H 2R2EB 2X4SB 3O6FA 3QQNA 1UEMA 1CLZL 2YXMA 3HPJA 4OZ4B 4DKFL 4S1RL 3MLTA 1DUYB 4JZNA 1BJMA 5K9KA 4U6TA 3ZE0F 4PJBA 3EYUL 1IAOA 4JO3H 4D9RE 3UPAA 3CH1A 4JKKA 3DJ9A 2JJTA 4RGMC 4Z7UF 4YHOL 5HI4C 3P77A 4JFDE 2Y06L 4PJ9A 4RZCA 5ILTL 5EFIB 4BQCA 1ZE3C 4OZIA 1X5HA 1XIWA 5E6ID 5ECJE 1W72B 3GM8A 2SEBA 4XVJH 2UWEA 1TITA 3S35X 4JRXE 1LEGA 2IADB 3E2HB 1YEDA 2C7UB 1H3XA 1IC7H 2R0WL 5HDOA 2FHBA 3QXUA 1NCUA 4ZPVA 5BQ7A 4HHAA 2PF6A 4L3EA 1UB5A 5B21A 3NH7H 4RMTA 4KU1A 2N56A 4ZO6A 5IHBA 3KYOB 3K8LA 2XA8L 1IFHH 3MRIA 3IU4L 4HH9B 1ZVHA 1K2DB 1TENA 1G7LA 4ZS6D 4DVRL 3MJ8B 3FQRB 5I8KH 3BRGC 4BKLB 5HHQB 1CBVH 2NY2B 2CIKB 3EIFA 1AJ7L 4NQDB 1S9KC 1F4XH 5DRXA 2VABB 2Y36H 4QTHB 5T1KA 4EEEA 5JHDA 1KCKA 2CDEA 4KK8C 1NMBH 3DBXA 3CIQA 1EHLH 1S3KH 5GJTH 2XWJA 4OI8A 1DBAH 3FJTA 3QNXB 1F58H 4L1HA 3UPRB 4OUOA 2F58H 1ADQH 4PY8J 3NN8A 5E9DA 1OP5K 1W8NA 2XPGA 3F65A 3MNVA 2NY0C 2BDNL 3PL6B 5F7DB 4NQCB 4RFNC 1D5XB 2QSTA 1IE5A 2DDQH 4KRPB 3OMZA 4YR6A 3NIFF 4HBCL 1IM9A 3NMEA 1TVHB 1E4KA 1HDMA 3CAFA 4HJ0C 1TXKA 2MJWA 1MCFA 3IFPB 2GCYA 4NPYA 5IMMA 5GGTH 4HUUA 4F37F 4LLDB 4U7SA 3NPSC 4Y19E 1Z3GH 4JM4L 4JRWA 2Q6WB 5IFHH 5JOPD 3ARTA 4MB3A 4RGNC 5E7BA 1CGVA 4YUEH 4L4VA 2JKXA 3MOBH 3S36H 2X5PA 5JPNB 5FGRA 4ZUWB 4P2QE 1K9TA 1BQHB 4WI3A 3VXMB 4FMFA 2M26A 3ZKXC 3X13B 3CDGB 5CINL 2R29L 3IJSA 3SGEI 1HNFA 2H8PB 3AY4A 4XPBL 5DI8B 2DLGA 2E7LE 4X4YA 4APQD 1QFOA 3LQAH 2LU4A 4TOYL 3KPSB 4OUUA 2H3NB 3MLWH 2I24N 1KIQA 4KKCC 3GNMH 2ZOKA 5HHNA 1Q9WB 4HXBL 5IMKA 5JR1L 2PO6C 4S0TD 3ARYA 1VPOL 1KN2H 3MV11 2GTZA 2EZ0C 3L5XL 4Z9KB 1INQB 4Z0XA 5BVJA 1B4JL 1J0HA 2HFGL 3MV7D 7CGTA 5AZ2H 3RU8L 3M17A 1MRDL 4F15C 1U42A 4K8RL 3QIWD 1MSPA 3D9AL 1L9MA 1XCQA 2GIYA 4XXDA 4UNVA 1VFOA 1TNMA 2BMKB 4NUGL 5DA4A 8CGTA 1FNFA 3ESVF 5LXGL 1PBYA 4LF3A 4MNGB 4W68A 1UACH 4U1GB 4U3XA 5SX5K 5A40E 1JWUB 1MVUA 2WIIB 3LN5B 4F3FB 5JDJA 2DQJL 5T5NG 1CFNB 1ACYH 2OSLB 4L8CB 1WAAF 1X5KA 4KVNL 5E95B 3VA6A 3I3BA 1MVFA 2DM7A 5SWZD 2BY2A 2B7DT 4I3RH 1PZUB 3VFPB 1CQKA 4NC0B 4Y4FA 4PRID 3H3PL 2F19L 2EYSB 4A2MA 3FRPA 4Z0BL 3W39A 2ICWB 5FUOL 6FABL 1S7SB 1JFQH 3N06B 3QUZC 4JO1H 3H9SA 4X6DB 1EJOH 3KXFA 5IT2H 3PDOB 2YPLA 5E0QA 1KXQE 3GB7B 4GKNA 5SWQA 5JOFA 5HDLA 3D2UB 3S3JA 2DQUH 5JXEC 4MNQD 1YEIH 4H0HB 5FHAH 2GAZB 3EYQD 3MUY1 2QKIB 2A6IB 3WN5C 5BO1L 1AI1L 2ESVE 3VDBA 5L2JA 2NX5E 4DW2L 1X5XA 3U46B 3KYMA 5FYKH 1JK8A 4F58H 4YDJB 5F9DC 3C09B 2Q8AL 1N3NA 2JJSA 4X7SL 4IDLA 1F3DH 1AD9B 2ENYA 1TVBA 5IROC 5JW3L 1DQLH 3JV5A 5ISZD 4L9LB 5B8CC 4WTXA 3GO1L 4HEPG 5D7IA 1G7MB 3U1SH 3ZE1E 4XCFH 1A6UH 4JN2A 5GRUH 4FFYL 3RWJA 2VISA 4NFBA 5C6TH 4K7PX 3P0YL 1YEEL 2CKBB 1LP9F 5TE6L 1FO0L 3HMWL 5KSAC 1EO8L 1N0XL 5ANMB 2VQTA 1JWMA 3V4UH 3T4YB 1H8SA 3WO4B 1U8JA 1FZOB 4YXLH 1OY3B 3FB5B 1P69B 4CAGA 4MA8L 3W9DB 1G84A 3VXSE 1KJ3H 2YA2A 1ZANH 3ARBB 2VQ1A 3L3OB 4EKXA 5ENWB 1INEH 3QUYD 2B0SL 3KPRB 4TPRL 3K0WA 3RTQB 4JZJA 3VA2C 3CFBA 5FUCE 1LO4L 5F6HJ 2NLJB 1GAFL 2QHRL 4R4BB 2DLFH 4G8IB 4NFCA 2V2WB 4TSCH 4LSSL 2C9AA 4WV1C 3KG5A 2WBJB 3PABB 2AK4A 3UTTE 4PJFA 1G7PB 2F53B 3MJ9H 1D9KA 4LCWE 4JM2A 1A9EA 4JGUA 5E8EA 4KRNA 1X3DA 5C6PB 4BA8A 1CXHA 3WFEL 4LEXH 3CMGA 4LSVH 3VWJA 3GIZH 5BRZA 4EI5A 4ELMA 4YK4C 4HIXL 4RGOH 4A6YB 2APWA 1JZ8A 3K46A 4R0LA 3B2UC 4HXAL 5F6IB 3ARVA 2ZCLH 3OKLB 4BM7A 4IDJL 1ES0B 5DR5L 3V0WL 1EGJL 1IAIL 4LGRB 1ORSB 1V7MH 2A2QT 5CD3A 4HIHA 3QZWB 4ZFOB 2X70B 1Q0XH 3MRNB 1YQVL 1XH3B 5CSZB 1X5JA 3WSQH 4XNQA 5E99H 4NO0A 2C3XA 5CEZH 4MQSB 4P46C 2P5WA 5EH1A 5FKPB 5D2LB 5BMFL 4PR5B 4F33B 2X05A 1G7IB 1V3KA 4MD4B 4PY8I 4TVPE 5HPOA 2F74A 1D3CA 7FABL 4Y4KA 4PJXB 2NR6D 2Y7QA 5C0BA 5I0ZA 1CIDA 1TNNA 43C9B 4JY5H 3HUJF 4N5EC 1UFUA 5EBWB 1J8HB 1OAXL 1BZ7B 1QSEE 4FQIH 4PRDA 1VADB 2XI9A 2MKLC 1A1MA 3W0WD 5FAAA 5DHXB 4HCRA 4PYGA 4ZYKA 1HXYB 3V4VL 2FGWH 1SJEB 3VXPB 4ZDHB 3BW9B 5KN5A 4Z7NE 2HRLA 3TN0C 3SGKA 3UJJL 1KLUB 3HI6H 4KQ4L 3VH8A 4R96A 3WIHA 1TTUA 4X4ZA 5HGDA 1KTRL 5TQ2H 1KC5L 4NNYB 3D3VE 5MEND 4NWUH 1V3JA 2YEZA 1WZ1L 1QBLH 4GG8A 1UM4L 1DLFH 1QVOA 5FYLE 5BXFA 4L5FL 1ZLSH 2ADIB 5I1JL 4OB5L 1FJ1B 1JNHA 1HI6A 2UZIL 3FO1A 1KGCE 5HDQH 1XGPB 5IVNA 4PRHD 3UTSD 4G7VH 4U1HA 5ALBL 3VD7A 4PRAB 4XCEA 4LDLB 3KVQA 4TRPH 1UB6B 4XZUB 5DQJA 2FSEA 4LMQI 5C0AD 2CRMA 4MVBC 1A14L 3MX0A 5EU4B 3P40A 3OAZH 3KNBB 4JN1L 2PNDA 1DN0B 4TSBL 1FZMB 2YPKB 3M1BB 1NFDF 1NCAH 4W70A 4PB9H 2P8PB 3UROR 5LGJB 4NGHL 4WU7B 4NNPH 2Z35B 5DA0B 3A67H 4KVCL 3P4MB 1CLCA 1AGDA 1BQUA 1DQQB 3QQ4A 3ULUD 4Z76B 4JCLA 1HHJB 1QO3A 4LFHD 1MFEL 2D7TL 5DJCA 2N7AA 3DOSA 4JEGB 4PJCF 2VL5B 4RNRA 1DVFB 4K55A 2JK5A 1I3VA 1P6FA 1TZHB 2V2TA 2DMBA 4GRLA 5MP6H 1IGML 1IAII 1KLGA 5DK0A 4RMWA 4PGBB 5KANG 4WY7L 1T20A 1U93A 5ADOH 1FVDB 1RUKL 2P46B 4ZSOB 4CDGC 1YPZE 3C8KA 5IEKB 2EH7L 5C0NC 2AEPL 2HH0L 4AEHH 1T66D 5E1AA 4AIZB 2HMID 2ZCKH 3MV7B 3L3JA 4LLWA 4JLRA 3RIFF 1UWXH 3L6FA 3T2PA 2NQCA 2QQLH 3I85A 3QIWB 1ED3B 4X5LA 2J8UE 3N50A 3VXUA 3GSRA 4GKSA 4YXKL 4X5XA 2BCKB 3I6GB 1DANT 5KANI 2Q7YA 1HQRA 4E41A 3L3GA 1N26A 3SBWC 3QEQA 2X7LA 5FO9B 2IAMD 4N90D 4J6RH 3SCMA 3O2WL 3R4DA 4S2SB 2VLKA 1BECA 3QDGA 1CT8A 2PYFB 2XKSA 4U1LA 4BH8A 1DBKL 4K71B 1MAKA 3MBXH 1CD9B 2PCPB 3CZFB 4D9LL 1I8LC 3NCYS 5JMRA 4LLYA 5I16A 1EK3A 2KZ1B 5A2JH 4PRIB 5M94B 1BEYL 5L88H 5DLMH 2WANA 4GW4A 2EECA 4HIIB 4L4TA 5SWSD 3EJYC 1AFVL 4WHTB 1D5IH 3TIEA 4KJPC 3BPOC 4LRIC 4N0RA 1A47A 2APTA 4UT6H 4Z7OE 3MLUL 4S1SL 3LEYH 4M6NL 3OKNA 4S1DD 3BQUC 1FN4B 3CFJA 2CGRL 1RZJL 4MNQB 1CGWA 3B9KD 3UO1L 3S7GA 1N6QL 2R4SH 1YNKL 3LKPA 3PE9A 4N0CA 3S96A 1JPFB 1AIFB 2XQYG 1NAMB 5HI3C 5C09E 3C5ZC 3VFNB 2CPCA 2EYRA 2V2XA 2FD6L 1ORQB 4ERSL 2AV1A 4R90L 2QSQA 1KTLA 2CUMA 2BY0A 4OZGF 5BJTB 1CGSH 3ES6A 5F6HI 2EO1A 5ISZB 4LSRH 5BOPA 3FO0H 4PJDB 4M02A 3WFDL 3SDDD 1QNZH 4HS3A 4HT1L 4BFIB 4WUUB 4Y8DC 5C70A 3MO1A 2E9BA 2X9YA 2ADGB 3GJEA 4UI2A 5I1GH 3TZVD 2X9WA 1FGNH 1MCRA 4EN3C 4YHKH 1Z9MA 4NKMA 5IB3A 4QRRE 2EDKA 2FZ3A 5F7EH 5F7LB 1C08A 1S8DB 2CDGB 4XWOD 4GUPA 4CNIB 3MRDA 3ZT7A 5I75C 4MXWL 1HK6A 1T1YB 3HR5B 3O9WB 5DT1H 4G6KL 4FQ2L 5DEGB 5HHVH 1UJ3B 4RBPH 1V7NH 1G7JB 4Z7VE 4NC2B 3UCRA 5IKCA 2XN9B 4D8PB 4HKXA 1MIMH 3IFOB 1GGYA 4M7JL 4MSWA 3MZGB 4MJIE 1UGNA 5IVXB 4OCYH 1DBJL 1PAMA 4HJJH 4CBPA 2AJVL 5T3ZD 4L3CB 4GAYA 5F7NC 25C8H 4I48A 4D0CB 3MV9D 4W6WB 3QUML 1FYTD 3HA0A 2EKJA 4JO2H 4P4KA 3HZVB 3LEXB 1RZ7L 4UTAH 4I0PC 1R5IB 2GITB 2QSCL 2IMNA 3QCUL 5HTSA 3RNKB 3BP5B 2A6DA 1JRHH 4ONOA 2F8OA 2JJWA 4NP4L 4N0YH 2WUCL 4WU5A 2YC1A 2GJZA 2GKIA 2BZDA 2R8SL 4XH2B 1VGEH 1EFQA 3FTGA 4NJAH 4RIRA 3G08A 1HH9A 3FQUB 4UQ2B 4OZHA 1GGCH 5D5ME 3MJ6A 3H7LA 3GJFH 5BV7C 5GZND 4OI7A 1NMAL 4HGKC 4AQ1B 5IP4A 3DO7B 1MCNA 4YC2B 1XGUB 4RMRA 3ULUF 1P4BH 3T1FB 1CZ8L 1F90L 5D7LD 4PRPA 1IKFL 3BD4A 4KQ3L 5D7JC 3HC4H 4MX7A 4TVPL 2DQTL 2LE9A 3VCLB 1DSFH 1J7VR 4YWGH 5EIQA 1WBZB 5AG9A 1K5NA 1R6VA 3ABZA 2WMPA 2VB5A 2EO9A 5ABDE 1NUFA 3MFFA 3WYRA 2PW1B 4KZDH 3VI3E 4DGYL 4OFYA 2WUBL 2FHFA 4NKOA 2FX7L 4NKIH 4F7CA 4HFUL 2ARWA 5E08H 2DTSA 3OR6A 2ZG1A 1H8NA 5DYOA 3DTXA 5IB2A 3DX8B 3LN4A 4CVWA 2Q8BL 1FV1A 5L7XL 1OAQL 1I9JL 2VXTH 1CXIA 4PJHA 1G7HA 5ICYA 1AKJB 4WJ5B 2MPAL 5B38G 3WFZA 4QRPE 1FDLH 4YGVA 3C60C 4XCYB 4OLWL 1PG7L 3FT3B 4DFIA 3BVNA 3NFPB 3WXWH 4JKPH 3O6KL 5FYLL 4I2XA 2OJZL 5E2WH 4E5XA 3P9LB 2IG2L 5C3TA 5BVPL 4IMLA 2COQA 4NZTL 4Y5XA 2JCCE 3QDME 3QULA 1J0YA 4RWYL 5CZKA 3BKCH 1ZLVH 1AHWC 1AC0A 2FBJH 5DDHB 5I74C 1OTSD 2D7PA 3UYPA 5AG8A 3BP4A 2BVYA 4R97B 3TJHD 4QO1A 1I8IB 3R1GH 3O45A 3DYMA 4YDVA 2WLZA 4CVZA 1U36A 4D0BA 3QA3B 3MLXL 4Y2DC 2L4OA 2EDOA 4KPHL 1QACA 4CUCA 1MWAL 3BD5A 4YFLI 4L8BB 5LJYH 3KPQB 2C4FT 3NFSL 3U7WL 3QNYB 3EHBD 4OCXH 4Y5VC 4GSDH 5I30L 5KVFL 5GGSB 4MYWB 3O6FD 1H0DA 2GK0A 4WUKL 5ESVA 1HYSC 2X1QA 3IF1A 3LKSA 2APVA 5IESH 4HUMB 4OFPA 5C0EA 3KJ6L 3SDCC 1YYMH 1IEBA 3EKCA 5GSVA 5J1TC 3FT2A 1T5XB 4U2ZA 5D8JH 4IM8A 5DVMA 4ZFGL 4PJ9D 5D9SB 1FG2A 3QEGH 1UKSA 3DURA 1OSPL 3OHXB 3QH3A 3X12B 2ZJSL 3BYYA 3D69A 4PS4L 1XIWD 1CK0H 4JFFA 1IT9L 3KPMA 4GW5A 2W07A 2BHYA 5GGRY 2CO6B 4WFFD 3B2VH 3OXRA 4B7IA 5KJRL 1KJMA 2X10A 1WBYB 2Z31B 4MZ2A 2UUDK 1GGTA 1CR9L 4I3SH 1RZGA 4NRXB 5FA3B 3H3KA 2N4IA 3E3QE 4I13B 3HFMH 2R56H 1GOFA 1LGVA 4KJWD 2IAMB 2ATKB 3G6AB 4L3ED 5LVEA 1Q9OA 3RPIB 1GOGA 1EEUA 1F3RB 3OL2A 3QBTB 1D5MA 4U6VL 4KJYA 4LU5H 5C9JA 4NHUE 1N59A 1HSAB 1X4ZA 2ICCA 4ELKB 2H6PB 4L8DB 4HUXB 4V1DE 1I7UA 2J6EH 2BY3A 2R9HD 3HI5H 5C0DA 3TVMA 2DQHL 4G80A 5T1KD 3DUSB 5JHDD 4R26H 3HI1A 5F88B 2O5YH 5KSUB 4OTXH 5C0IB 1QUNA 4LCCC 3PXHA 2BVQB 4AIOA 4X4MA 1FVCA 3BE1H 3MYJA 5C8JA 1HILB 5E9DD 2IC2A 3MNWB 5EPMA 2AV7B 2YHGA 2HT4C 4NQXB 4PV8A 5B22A 1I1FB 1X7QB 4H25B 4Y16A 3V5KA 5K9JH 5IG7A 1JNLH 1YECL 2C3VA 1KN4L 1ETZB 3E6HB 3BGFC 1IM9D 3ZYIA 3IDNB 4HDIB 3WS6C 1GC1L 4IOFD 4X9FA 3PGCA 1UM5L 1B4RA 3JTTA 4Y5YB 1S78D 4XPFH 3VGEA 5EO0B 5GS0C 5F9JB 5ESAA 4PJEB 3WLBB 3ARFC 4LSQL 4L4VD 3MLZH 4DOHB 3D25B 2B8OT 2EXYC 3AFLA 1F13A 1T1ZB 3SKJL 1NL0L 1VENA 2NNAB 1VFBB 1QSFE 4YXHH 1T03L 2ADJA 4R3SA 1E0OB 3SDDB 4OD2A 1LO0H 4NBXB 1ZLUH 1KELH 4U1IB 1S7VA 3O8XB 5T5FL 5DHVB 1FFPA 3TZVB 3GI8H 1KPUB 2MQ0A 3GMLA 4EDXA 1SY6L 1FL3A 3VG9C 5FA4B 1NFKA 3LKNB 4BUHA 2PXYB 4HJGB 4NSKB 3IT8D 1S7XB 1K8IA 5FCUL 1WC7B 1JCKA 2R0ZH 2VR9A 3TCLA 3SE9H 4J8RB 4PTTB 3WEXB 3QWOB 2A0LC 3JV4B 2F15A 4KROC 1AO7B 5D72L 1I85C 1C1EH 4JFQA 4PIRF 4CN1A 5I1KL 1CF8H 4ZS7L 4XBGA 2UYLA 1AQDA 5I71C 1E28B 1J0KA 5DO2D 5E5MA 4DEPC 3K8MA 4RAUA 4OM0H 1A1NA 4POZC 2G9HB 5I6XB 3AB0C 2B20A 3UXFA 4RMUA 4OV5A 2RHEA 2FJFB 3T77B 1RURH 1RIVL 5FB8B 4JHZA 5CZVL 4G9FB 5HVWA 2R2HB 1QR4A 4K2UL 4JJHA 5JPMB 5CGYC 1O5DT 3KWWA 2ZUTA 5ETUA 2CD0A 5CILL 3D39B 3DV6B 2OTUB 1MJ7L 3JWOL 3MOAH 4PTUB 5KS9A 1VGKA 2GJ6E 1ZSDA 2ITDA 4KTEH 1GGBH 4JPIB 5E70A 2XQBH 1MHPH 3LCYA 5CIPB 3RVUD 4H20H 5ESQB 4PGEA 1QSVA 4I77H 2AJZA 3GSUA 4Y4FD 4QRQA 1RUML 3TH2T 2ATPB 5FHBL 1C5BL 4PDCE 1EV2E 3BHBB 4Q74A 5F44A 3QI9B 2O5ZH 4DQOL 5FF6B 4UT7L 2B2XH 2CMRH 4LLAA 3H9SD 4R8WL 3RX7A 5EU6A 3KXFD 2FYYA 1AXSB 1CFQA 2YPLD 4LKCA 2OP4H 4GLRI 2R2CA 3ECBA 3G5ZB 3Q6GH 1QPPA 1SEBA 3QPXH 4IHOA 5GRWA 1QLRB 4NDMB 2Q87A 1QFWL 4HC1A 5C08E 4HKBB 5I17B 5EOCJ 5EWIH 2MCG1 3TH4T 1A1OB 1SEQH 3UDWC 3QPQC 3FT4B 3ZKMC 4L3AA 1DQJA 3NGBB 3EO0A 3O2VH 4LCYA 4LHQB 3DYOA 3WUWG 3TBYA 3N1FC 1CVSC 1DCLA 3BIKA 3MNZA 4NOBA 1KULA 2YD3A 4NUJA 3L3IB 3RVVC 1RJLA 1JUFA 1NBZA 4PJGA 3PHOB 4P3DB 2P7TA 3O11B 3CLEH 1HCFX 3O4LE 1XZ0A 3ZE2F 1H15A 3RWCA 4PGCB 3PQYA 3QCTH 1T89C 1FFNA 3LH2L 2DAVA 4LCUA 1N2RA 1PG7W 3ARGC 4NZUH 2Y07L 1A5FH 2VDKH 5JLZB 1KNOB 3CFCH 2CRIA 3GSNL 4HW6A 4OV6F 3S4SA 4NZRH 1XMWA 4PJ7A 1JV5B 4P2RE 3NA4A 3VE0B 1V8HA 1BD2A 1I3RB 2FCBA 4XVTL 5LWYL 5TDPA 3MBEB 3HZYB 2X1OA 1S7UA 2AJSH 4TULH 1KPRB 2XTJB 3FB8A 4J1UB 2WP3O 3T3MF 3SKNA 4KI5E 4U1MB 4M43L 4JFDA 4GBXB 1YYLL 4ZO9A 3T0EE 4O58L 1A7NL 4CU8A 4YHIA 5EZIL 1PEZA 2VLJE 2AK4D 4LAQH 4PJ5E 3ZDXF 1E6JL 1T22B 4X7CC 4JRYE 1H5BC 4ZNCD 4HWZA 1D9KD 4JM2D 5F9OL 1FO0B 3PXJA 2ZPKL 3BKYL 1Q1JL 3QG7L 3JVGC 1ZT1A 3EOYG 1ZGLA 4PJBB 1VA9A 1BVKA 3VWJD 5BRZD 4EI5D 3RKDC 5D1ZC 4X80H 1Y18A 1MLCA 4PJ9B 5L8KB 2YKLH 2HYMA 4OZIB 1G0XA 3V6OC 3H2WA 1SYSA 4XMLH 5B4MD 3R8QA 1OGTB 1GGUA 1S5IH 2UWEB 4JREC 5CCKL 1Y6NR 3MXVL 1LEGB 5LQBL 4FZEL 4NO0D 1QFWI 2P5WD 3PGFL 1G0YR 5DGRA 3HTLX 1A3LH 1EBPA 4Y4KD 5C0BD 5AD0A 5MEPA 3LRSA 1FIGH 4MD5A 1ZAGA 1I9RL 3I3DA 3MRIB 3TV3H 4X6DF 3QDJE 4MDIA 2J8HA 2EH8L 3ARWA 5LGHH 2NW3B 1PLGH 1T7WA 3GBNH 4ZTOL 1RZKC 3MA7B 1KPVA 4DGVL 4BSVA 2DOCA 5DD5H 1FPTH 2RIKA 5HGBA 4V2CB 1IQWL 3LKQA 5DRXB 1BGXH 4YBLC 2IH3A 5T1KB 5JHDB 2P5EA 1YMMA 3DXAE 4E9LA 2CDEB 4HV8B 3DRTB 4C4KO 1Z0MA 2VDQL 1S7QA 5T3XH 4GG6E 5FV2A 4ENED 2QTEA 1WISA 4P5TB 4XNZB 2NY6B 4H8WC 3NN8B 5BS0A 4YHYC 2DWDA 4JRXB 3LQZB 2HLAB 2K1MA 4CW1A 5DRWB 12E8L 1QA9B 4POUB 3WMSA 4HK3N 3OXSA 4OLUL 1VACB 4ZOAA 4AEFA 4ZUVB 4R4FL 4YO0A 3OG4B 1HWGB 2O26U 5DQDH 1A7QH 5F1NB 5HYJE 2J8OA 4GAGH 4OLVL 5IMMB 4R2GC 2AEQL 1UKTA 2B1AH 5C3LD 1S9WB 1PEWA 1P4LB 3RZCC 5I2IA 5KSBA 4KH2A 3ZHLA 2R23A 1MFDH 1RJYB 4UQ3B 5T1DH 3UC0H 8FABA 1BOGB 2B1HH 5DWUL 1EAPB 2JB5L 3CX2A 4XPTH 1YDPA 2BC4B 1U92B 2A73B 5KAQG 3BXNA 1A6PA 3MRCA 5JNYA 3IJSB 2FEDC 1AXIB 3CPLB 1MY7A 1YEJH 3VXQB 4CJ1A 2NW2A 4JO3L 4PP1D 3UTZB 4D0DA 5C6WH 3HCVA 4J3SA 1FBIH 5GGRA 3LB6C 2I9TB 2XFXA 3G5YA 3L3KA 3BN9C 1DQMH 4GRLD 3QT2A 4C59B 5CEZE 2ZOKB 5HHNB 3V95A 2IJ0C 5IMKB 4XVJL 2NZ9C 3LV3B 2XXMB 2AW2A 1J1XH 2G5BA 4WGWB 1IC7L 2FHCA 1IAKB 3EYSH 3FCTA 1D5ZB 4XRCA 4Z95H 5KVGH 3DUHA 4Y19B 4Z0XB 3QUZA 4CGTA 2EDQA 2IGFH 4KKAD 3WDJA 3SDAC 3NH7L 4XP5H 4JFYB 2JTDA 1UKQA 2BHUA 1QBBA 2YZ1A 1IFHL 3BMVA 1CE6B 3VXUD 2VDMH 3IRZA 4WO4B 5JXEA 1J05A 3VXTB 2YOCA 4XHQA 3GHEH 4U2YA 4W81A 3WN5A 1I9IH 1JFMA 3MUHL 4UV4H 5I8KL 2Y1VA 4E41D 3T65A 1CBVL 1T3FA 2NCMA 2H2SC 4FQXC 1GZPA 3T0DA 1MVUB 1VB9A 3RUGE 1F4XL 2X4RB 3QEQD 2Y36L 5D2LF 1NUDA 3SCMD 4PJXF 1NMBL 1VERA 4AM0A 1B0RB 1S3KL 2VLKD 3CUPB 5GJTL 1EHLL 3QDGD 4AIXA 5IJVA 1DBAL 1F58L 5IROA 2F58L 1ADQL 3ET9F 1OGAA 1TMCB 1XGTA 5B8CA 5CFHA 3OBAA 1ZXQA 3HNTH 3ULUH 1AD0A 4Y4FB 2FDBP 2DDQL 4X9GA 2BOCA 3DROB 4TUJA 4UAOC 2EEDA 4L4TD 5KSAA 4R6UA 2XKNB 3MGAA 3TJEH 1LEKB 1B3JA 5HHPB 4DCQA 5GGTL 5IB1B 3H9SB 2FR4A 1F3DJ 3KXFB 3PWPE 4U7KA 5IK3A 5IB5B 5CBEA 1WWCA 1Z3GL 1NQBA 4OF3A 5IFHL 2DQCH 4PJ8B 2BNQA 4YUEL 2ICES 3WHXA 5JOFB 3MOBL 3FOLA 2DYPA 3S36L 5C0CE 1FAIH 1YUHA 2EDRA 1R24B 3D48R 5DMGD 4CDHA 3V7MA 1FSKC 4NN7C 3ULSB 3MRGB 3ULVD 1WFUA 3QQ9C 5DD1H 5DURD 4N0CD 4PRBB 1H3TA 2FH8A 5DK2B 1BHGA 5L6YH 4WV1A 1CDYA 4FTVA 4LVHB 5ID0A 4OCRH 3SDYH 2FIRT 2VLMD 1U8IA 3LQAL 4LLQA 2JLLA 3K2UH 1ZGLM 3MLWL 5EUOE 1LVEA 2WV3A 2BVTA 3IAPA 3GNML 3RI5F 3SQOH 1U8NA 3BZEA 5LKNA 2IFFH 4JN2B 4MAYB 2ED8A 2F9BT 2HTKD 3K2MC 2HVKB 2JIXA 1KN2L 2WW8A 1JWMB 1P4IH 3CFEA 4XNUH 4GRWH 4WFHD 3HB3D 1PKQA 1S9YA 1U8JB 3C9NA 4OZFA 5IHZA 3P0VH 5AZ2L 5DJDA 3UTTA 3TO2A 5I9QB 1NC2A 4LCWA 1IGFH 3DGCR 2VQ1B 3HN3A 3BI9X 3UAJC 1CXLA 4ODBD 1NMCC 1QPXA 4P46A 2ESVB 3B5TA 1G9NC 4QNPF 2H9GA 2NY3C 1UACL 3EJZD 2BVOA 4HD9A 5DD6A 1Q9LB 2R1XB 1XGQA 1S7TA 1LO5A 1IGJA 1F00I 2IPUK 4GRMA 1CFTB 3SJVE 2W60B 2YD9A 4G8EA 1MHHA 3IJHA 3WBDA 3F7QA 1ACYL 2AJ3B 2NY1C 5DFVD 1D9KB 4JM2B 1IC1A 1U8MB 1E4XH 3SE3C 5C7XH 4I3RL 4ZFFA 4P4KD 4AK1A 4XTRC 2C1PA 3EDJA 3BPNC 1D6VH 3TN0A 2YMXH 1P1ZA 3U4EB 4L8SC 2C1OA 3DLQR 1OAKH 1OAZH 1JHKH 4QRSA 1JFQL 2OL3H 3BMWA 4DAGH 1GZQA 4HIHB 4JO1L 4QGTA 3VXSB 1EJOL 1HIMH 3T2NH 5IT2L 3DVNA 3I2CH 4IJ3C 3NCBB 1NEUA 5ACZA 4S10A 4CMHB 5HYQA 1I75A 4XNQB 2BNUA 2P49B 1WGOA 3U4AA 2WAHA 2DQUL 5CD5D 1YEIL 3DYPA 5FHAL 3JWDH 2G2RA 1CDIA 2KL6A 5I1AA 3AM8A 3STZA 4ZNEA 2Y7QB 1R3KA 5HBBA 2X44D 5B38B 2HG5B 3QUMB 4PRPD 2CLRA 1A4JB 3F6LA 3D3VA 4Y88A 4NQEA 4I5BA 4MVBA 3GSVA 1F3JA 2MWCA 2IBBA 3KDMB 3AS1A 4ZTPH 3BEVB 3H7BB 1KB9K 2A6KB 2VDPH 4GJTB 5FYKL 4F58L 1WZLA 1CGYA 2IH1B 4S11A 1DN2A 2VQUA 1JHTA 4LLMA 5F1IB 1LD9A 2HRPH 4YHLH 1DQLL 4ZYKB 4MD0A 1EZVY 3MV8A 4OFYD 3MRHB 4Q2ZA 1MH5A 2MMXA 4Z18A 4FXGB 4AH2A 3U1SL 4XCFL 1A6UL 5GRUL 5T3ZH 5KN5B 1G0DA 4LQFH 5C6TL 5HHMA 5CHNA 5E2VH 3U9UA 3RVXC 3G6DH 1XGYH 1MCPH 1PZ5A 3V4UL 4HS6A 3E2HC 4HS8H 3RFZC 2DIBA 5IW3A 1M7DB 4GG8B 4M00A 4Z7WA 4YXLL 1RULH 2VITA 3FZUD 5AYUH 5FO7A 3ILPA 1EXUB 5EU7C 1F4AA 1KJ3L 1BZ9A 3SOBH 1ZANL 1JZ3A 1VDGA 1EEYB 4CRPA 3O3DB 1VCAA 5EZLB 2CLVA 4PJDF 1INEL 3FHQA 2HFTA 4NFDA 2HN7A 4IOIB 2NXZD 4NQCE 1SM3H 1QSEB 3NCFB 3TBTB 1GVIA 2DLFL 1SVZA 3GMRB 1OM3H 4TSCL 2NY2C 3KPLB 2H32A 2Q1EA 1FNLA 4MB4A 3BGMB 2WWMC 2VERN 3MJ9L 4QHNB 5FYKU 4PFEA 1KCUH 1SMOA 2BNRB 4LEXL 4LSVL 1FFOA 3FB7A 3EUUA 3QG6B 3GIZL 3SBWA 1NBYB 2Q3ZA 1OW0C 4RGOL 5EG6C 5E8NA 3PL6C 4X6CE 1QO3B 3RWHA 1P7KB 4N9OB 3L3DB 5DUMH 2ICEA 2ZCLL 1KACB 1JHLH 2JK5B 4XP6H 1BLNA 5IVXF 3QJFA 4GRLB 1V7ML 2J8UA 1UWXK 1NGZB 1Q0XL 1I8LA 4PJIE 1XT5A 1DANU 3OPZL 1T20B 1U93B 3KYNA 3WSQL 3PWUB 5E99L 1J9CT 3U30C 1PY9A 2DL9A 5DJZA 5CEZL 4URTB 5J8OA 4F7PA 2PYEA 1HNGA 3VU2A 2YXFA 3N85H 4LRIA 5CS7A 4LLUB 3MMEA 3WFCH 3LS4H 4WHCA 5FKAB 1C8PA 2Z92A 4XVUC 1BJ1H 3BQUA 3L6FB 1T6WA 3OKEA 4JY5L 4Z7UA 3MCKB 4JFFD 4MXVE 4M7KH 2XZAH 3QIBB 1QEWB 3NAAH 5HPMA 5ITFB 3RBGA 5LG1A 4FQIL 2WLYA 1S9VA 1KIPB 1IJ9A 5IWLC 1OP5H 4X5XB 1MWAB 5K93A 2Q7YB 5L2KA 2XG5A 4E0RB 5IQ9B 1NH6A 2FGWL 2BX5A 3O3AB 1UZ8A 2X7LB 3C5ZA 5I0DA 3HI6L 1J12A 3DMMB 4UIMB 3CFKB 2Q86B 3OKDB 5TQ2L 4MNGE 3QDGB 4U6XA 5KG9B 4P4RB 4BH8B 4NWUL 4HWNA 1QP1A 1P2CA 4FXKA 1U8OA 1H8OA 1DLFL 5JMOC 4LLYB 5I16B 1DTUA 1YMHA 1ZLSL 4ETQB 5MEOA 4EXKA 3ZTNH 1F4YH 3TVMD 5HDQL 4EN3A 4G7VL 3CSGA 5EIIB 4OIAA 4YBQC 1RZFH 3PWJA 2MFNA 4TRPL 1UXWA 4X4XA 3KPOA 5IBUB 4JO4H 1F4WH 1U8QB 2EE3A 3C6SB 4MCYA 1IKNC 3GIVA 1RK1A 3CFJB 4ODXB 4ZUTB 4Y16D 4KV5F 3DV4A 2R1WA 1JGLH 1NCAL 4PB9L 4BH7B 4Z7QF 2MQ3A 3QFJB 4HKJA 3S96B 4NNPL 4N9GA 1QR1B 5FDWA 4X7FC 3N9GH 2ZUWA 5INDA 3A67L 3NTCH 3DX6A 2W0FA 5MHSD 5TQ0H 3T0BA 5MP6L 1T0MB 5C07A 3UTOA 1L0QA 1M7XA 3QFDA 4HS3B 3MRBA 1NCDH 2AERT 4I0PA 5ADOL 4RBPK 4MJ2A 1JZ2A 2P43B 3VRIB 5I8OH 2NY5H 5EBGA 5SX5H 2P8LA 4AEHL 4LPVA 4JGMA 4LIQH 4NKMB 2ZCKL 3PWVA 4UNTA 4M61A 2F54A 4GUPB 3JBG7 4DFHA 4K9EC 2QQLL 3CMOH 3GSXB 1U8PB 4J3XA 2DKSA 5ANME 1HQ4A 3RDTC 3NCCB 5IKCB 1NGPH 4ORZC 1KIUA 2H1PH 5C09B 1UA6H 5BCAA 1B0GB 4MSWB 3C09C 4QWWC 1LQSR 2CK2A 2QSVA 5D7JA 1JPGA 2YZ8A 2DRUA 4J6RL 4L9LC 4PJAE 4C56A 2NXYD 3HRZB 2BXYA 4RRPA 1MQ8A 3HMXA 3KPRE 4KKBC 4PJHF 3RWEA 3N1PC 4AENA 1EH9A 1I7RB 4WTZA 4WW2B 1C16B 3MBXL 4JZOA 3IDYB 4GXUM 5IHUH 1NC4A 3RKPA 1WIOA 3FAWA 5E8DH 4RFEB 4D2NA 1MCHA 4BZYA 3QXDA 3IDJA 2F53E 1MLBB 4IRSB 4NO2A 5DLML 5L88L 3GJFK 2VTFA 2D7OA 4QRRB 4G8FB 1RIUH 1D5IL 1BZQK 4ALAH 3MRMB 3ARBC 4LVOB 4AT6B 2WM0A 3HLAB 2YC1B 4UT6L 3BKMH 3SDXF 3VXOB 2AI0H 2DQFB 1LEIB 5CEYA 3RTQC 3LEYL 4G6MH 3CC5B 4P2CG 4Z7VB 3VFMA 3QO1A 3C60A 4RIRB 2HJFB 3Q0HA 5FO8B 1CFSA 5DS8B 4XP9H 4GS7B 3GGWA 1HEZA 2R4SL 4MJIB 4NYLA 3U83A 4NBYB 5AEAA 4G43A 3OGOE 4F8TA 1WTLA 2AXFA 4UBDC 1JPSH 3KYAA 5EU6D 5GGUA 4U1SA 1I8KB 1AHWA 1I1CA 3Q3GB 4OF7A 1NUNB 5KOVC 4KGJA 4R7DA 1CGSL 5F6IC 3HAEG 4Z77B 4LSRL 1KEMH 3FO0L 1KCSH 5D1QA 2NY4B 4Y2DA 4YNYB 1QNZL 4GKZA 3GKZA 3VGFA 4F37K 5I1GL 4PGDB 3ILQC 3TA3C 5IBTH 4N0UE 2EYTA 1FGNL 3DTXB 3QDMA 1O0VA 4YHKL 4Y5VA 5ADPH 4YX2H 1CXFA 2ICWJ 3S98A 4WHYH 5F7EL 1BFVH 3QXWA 2YSSB 3UEZA 5D5MB 5GGQH 1JNNH 2QV2A 4G8GA 3MRJB 4YGVB 3WE6B 5DT1L 3QHFH 5DMIH 3SDCA 3ALXA 5HHVL 1MAMH 1XCTA 3BSZH 3HRPA 1V7NL 3PQYD 4OCSH 4YGAB 5K59F 5HI4D 2OZ4A 1MIML 5C0RH 3CXDH 5INCB 1ZS8A 3EZJB 2C4FU 1ZMYA 2HT2C 1DJSA 3FFCB 3K7UA 1LP9A 5HDBF 3MODH 4OCYL 4HJJL 1J5OH 2ZSVA 4JDVA 3JXAA 4FS0A 25C8L 1BD2D 3NIDE 4WI7A 1XR8A 1FORH 4Q0XH 5JOPE 5T5NF 5HGGS 3O45B 3IDGA 3IFLH 4JO2L 2FJGB 3ZDZF 4MA3B 4UTAL 4D9QD 5FECA 2X41A 2X1WL 3VWJC 4JFDD 2OI9B 2QADB 2CIIA 2B4CC 3FQWA 1JRHL 4YJZL 4H1LH 1LK2A 1MCSA 2E9WA 1KJVA 4N0YL 3VFOA 2PW2A 4QRPB 3U82B 1K4DB 5F1SA 3ZLQC 1VGEL 4HPYH 1HCVA 1WEJH 3GSNB 4KK5C 3ARZA 4NJAL 3VMNA 4ZXBB 5HVFB 2EDTA 1GGCL 3EBAA 3D85A 4KK8D 1UCTA 3BZ4B 4U1NA 3U6RB 1ZK9A 5ITBH 4LCCA 1P4BL 2XKUA 1JZ5A 1HHGB 5F9WB 1U8LA 3QH3B 3MGOA 3JV6A 5A43C 2HJKA 3HC4L 5DJYA 3LKRA 2NY0D 2FO4A 1DSFL 1S9XA 3ARRA 3RBSA 5CJOH 4YWGL 3FO2A 4HZAA 3MV7E 3CVIH 2ZG2A 5KVEH 1CICC 1WWWX 5DQ9A 4HQQH 3WS6A 4KZDL 4HJ0D 4M5ZH 4WGVB 1DVFC 5F7FA 3VD4A 1EEZA 4JVWA 3X3FH 4NKIL 4JQVC 3H9HA 5E08L 3F7RA 1JGEA 3OKOB 1B6DA 2GUOA 1EFXA 1IGTA 4RGND 3L5HA 3F7VA 3ARFA 4TNWF 1XGRB 1G9MH 3OR7A 3VGBA 3VFRB 4F2MA 1P84K 1P7QA 2MCPH 2VXTL 1TFHA 3HUJA 4LSDA 3MUGB 5GQBA 3DGGB 4JY4A 2OR9H 1FDLL 2JB6A 4FFVC 4M5YH 5C0DB 1NDGA 5H35B 5SWZE 2P5ED 1YMMD 3WXWL 4JKPL 3E6FB 5E2WL 1IC5H 3V6ZA 1JNJA 3C6LB 4PRIE 3GMPA 4MXQA 5C8JB 3VG0H 3OZ9H 5BS0D 3BKCL 4M6OH 4KKCD 3VGGA 1BQHG 2C26A 3V0VA 4EUPB 2DIJA 3J8F7 1X5GA 2FBJL 5MERB 3L7EB 4NQSB 1NFIA 2Y5TB 4R7NA 1KV3A 1I85A 4ZQKA 4OBSA 2EZ0D 3HE6C 3Q1SH 1ZT4A 1ZLUK 4O2CB 3QXVA 3R1GL 4X98A 4HBQA 3PGCB 1NGWB 5FYKD 4K71C 2E8ZA 3KGRA 4MNQE 2CSPA 4Y89A 2I07B 4IS6A 5DEFA 2D3VA 3FN0H 5I76B 4I8DA 4NHUB 1IM3B 5T1MA 4LEOA 3MA9H 1JRHI 5AZEH 2J1KA 4PBVC 4OCXL 4UOJA 4GSDL 3MREA 1DQDH 4NO5A 4FFZH 43CAA 1JPST 5HHXH 4R3SB 1KEGH 4HMDA 2E6JA 3TM6A 3BP7B 4HMEA 5I73B 2ZUUA 1EUTA 1FFPB 1GGIH 1JTOA 5IESL 4JAMB 1W0VA 4MQXC 5E4EB 1YYML 32C2B 1NFDA 5ISZE 3EYOB 5D8JL 2H26A 1QFWM 1GHFH 3X14B 3OGCA 1CYGA 4RQQA 3PUCA 3QEGL 4HCRH 2AKRA 1RZIA 3ARSA 3KPNA 1DFBH 5DC0A 1IQDB 2DKMA 2Y6SC 1RUPH 1CK0L 1VFUA 4LOUC 5I8CA 4PJCA 2H2PC 2X4PB 2VO5A 5IQ7H 4ISVB 5KSVB 3TCLB 2VAAB 3RVWC 1SJHB 3B2VL 3WIHH 5F8RC 2GJJA 4F7EB 5CMAA 4I3SL 5K9QG 1UXSB 2K7QA 4JFQB 4KDVA 3UYOD 3HFML 1SYVA 2R56L 3BO8A 4XWGH 2Z8WC 3TNNA 1UZ6F 3QUZD 2R4RH 4G6AC 4DZ8A 5GIRB 2AVGA 3LMJH 1T1XA 2NMSA 2W65B 1QSFB 4MQ7A 4EOWH 1AC6A 4UT9H 5JXED 3FFDA 1NUGA 4LU5L 2X40A 1G7QA 2Z4QA 3BRFA 3RJQB 3RWGA 1R3LA 5B39G 3UDWA 4LCIH 1WK0A 2J6EL 3HI5L 3IXTA 4WW1A 4XBPA 3IETA 4R26L 5KS9B 3NZ8A 2O5YL 3O9WC 4N68A 4OTXL 1UJ3C 4IIQB 3DARA 2G60H 2V9TA 3HC3H 5L9DH 4HZLA 3L3HA 2HJLA 3BE1L 1UWGH 5EO1A 1OGAD 4K23H 4JVUA 2D7MA 3P9MA 5C0JA 5CEXA 1C12B 1MAJA 4QRQB 1T89A 5K9JL 5EU5A 1J0ZA 1JNLL 3SO3C 2ICWI 4HGMA 2APXA 5E1HB 5KSAD 4WWKB 3ARGA 2XNAA 5IVZA 5DMGC 4LPCA 1UYWH 3VFVB 5EU6B 3VXNA 3EJJX 1HKFA 5ACMA 5TH2B 4Z78B 1N64H 3OX8B 4XPFL 3ECBB 1AXTH 5CP3A 2WQRA 3WV0A 4HG4J 3QEUA 2BNQD 4IHOB 1BFTA 3MLZL 2ITCA 5IVOA 1KCVH 2DYPD 2XT1B 3A0OA 3G5XB 4NCC1 3RP1A 4YXHL 4K94H 5C1MB 2YN3A 1RJZB 3VW3H 4JDTH 4HKZB 1LO0L 4G6FB 1KELL 1A9BA 1BF2A 1RK0B 5JIIA 3WDHA 3W0WE 5J11B 1UG9A 1KSRA 4PV9A 3GI8L 2XWBA 2GJ6B 1R3IH 3L1OH 1ZHLA 3RY6C 4UU9B 4QXUH 3BIKB 4FTVD 1OOAA 5ICZB 5DEZA 1H5BA 5ACLA 1A6TA 3VRJA 3CXHJ 5K9OA 4PJGB 4YC2C 4MDJA 3JVGA 5I66A 5MENE 1ND0A 4HAFA 1FCGA 4UDUB 2R0ZL 5D1ZA 3SE9L 3PQYB 4PRNA 3CXHK 4RGMB 3B2UD 5J1AB 4LCUB 1N2RB 2JIXD 1AGFA 1C1EL 3KPPA 4M7LH 1CXEA 1CF8L 4AMKH 2DI9A 3MJGX 5KZCB 4JFEA 2CXGA 3V6OA 2L7JA 3UTSE 4PJ7B 5TPWH 4OM0L 4F7MA 3UTTD 5A3IC 3VFTB 1BD2B 1NC2D 5C08B 4LCWD 5TDPB 3SGDH 1MFBH 3JZ7A 5E00B 4DZBB 1RURL 4P46D 5DJ6A 2EDFA 1U95B 5C0AE 3FB8B 2VIRB 5H2BB 4OT1H 1EVUA 1EBAA 1TJIH 3GK8H 3LOWA 4O4YH 3PWLA 5FYJU 4OQTA 1TQCC 3RIFK 2GHWB 2BP3A 4YIQA 4U1JA 1J10A 3MOAL 1D6EA 5KBNC 2IMMA 4PLKC 4HIJA 3OG6B 3EDEA 4KTEL 4QF1A 5E94A 5JW5A 4OGXH 1GGBL 3O4LB 3ULVH 3ARDB 2XQBL 1MHPL 1FL6A 4ZMAT 1ZT1B 5EBMA 4H20L 1ERNA 5DFWH 1RI8A 1BIIB 1AQKH 4I77L 3TN0D 4PREA 1F6AB 4V3DB 1HHHA 3C5SB 1L0YA 4X7TB 2O5ZL 1P5UA 1K4CA 3U7AA 1BPVA 4YLQT 2B2XL 1GJIA 1TETH 5I1LB 2CMRL 3ZSSA 4P2RB 4M03A 1YEGH 3DNKA 1XR9B 3I9GH 1V3MA 2OP4L 4DVBB 3Q6GL 2MOVA 1FVEA 3RY4A 3QPXL 1K3ZA 2VLLA 1EDQA 3WNNA 4JY6B 3CK0H 4XB7A 2X4TB 4OD3H 4FHBD 2VSCA 1FAKT 2GSIA 5EWIL 1FL5B 1TCRA 1SEQL 3VXRA 3T0EB 1O7VA 4PY7A 3RZCA 5AD0B 4NQVA 3VDAA 4HUWA 2BSSB 2EC8A 4RGNB 4TSAH 2VLJB 2QL1A 3O2VL 4PJ5B 5KW9H 3D3VD 4MD5B 4NQED 5E4IA 4LLVB 1JWSA 4MVBD 5HD8C 3WKNA 4N90E 1EO7A 1C5CH 4U1KB 1V3LA 4UTBH 2CXKA 3IDIA 3BZFA 3CLEL 3MV8D 3LKQB 4OFIA 3PJSB 2PR4H 1T2QH 3MRRA 3QCTL 4GRWE 5HHMD 3WS3A 2X4NA 3RVTC 2X1PA 2Z31C 4NZUL 1F2QA 4JJ5B 1A5FL 2CDFA 2VDKL 3OJ2C 4X99B 3CFCL 3HS0A 4KKLC 3BRDA 4H0IA 4U05A 5BS0B 4NZRL 4WIQA 5SWSE 3L95B 2DWDB 1IL1A 1U2CA 4CW1B 3THMH 2PO6B 2MHAA 5JW4M 3V5HA 1T21A 2AJSL 3HZMB 4TULL 5C0ND 5LBSH 3D1MC 4X8JA 1QOKA 4WVRA 1YNTA 1FE8H 2ZCHH 2LQRA 2E6QA 1NGXB 5I2IB 3SDAA 1S5HB 3JTSB 3Q2CA 3QDJB 1MREH 4NC1E 3KLHC 1U58A 3I6KA 8FABB 3FKUS 2ENSA 2RJMA 5DJ8B 1FH5H 4LAQL 5DZLA 2D2OA 3CVHA 4EIZC 3MRFB 1DEEA 5JNYB 4FQXA 4PJEE 1S7RB 2UUDH 1OP3H 4GG6B 1MCOH 3NCJH 1A7RH 1K85A 5EU3B 3W9EA 1KJ2A 4X80L 2QBWA 4ODUB 4PLNC 5GGRB 1I1RA 3IS0X 2V7HA 3UZVB 1NBVH 2YKLL 1TQBC 5J0BA 2VN4A 3EO1A 4PG2A 1MFNA 3EFFA 4XMLL 1UADC 1S5IL 4DN3H 4QHUB 5HYJB 3ZE1F 4Y5YC 1LO2H 15C8H 2I9LA 5C92A 2HWZH 1CL7H 3EJYD 3O3EB 1X4XA 1CD1A 1FNSH 4NHCH 3B3IB 2PYED 4KJPD 3EOBB 5J3HD 3QUZB 3QHTC 1M7IA 3BJLA 1A3LL 4QRUA 1T0NA 4HK3J 2EIBA 3BPCA 3I02A 1FIGL 1MEXH 3BQUD 4MCZB 4Y1AA 3O8XC 1LE5B 1GIGH 3HNVH 3WFHB 3TV3L 5LGHL 1I4FA 1PLGL 5D7SH 5TF1H 3GBNL 3F62A 5L2KD 3MZTA 3OKKA 5JUEH 5DD5L 1FPTL 1OF2B 4YAQA 4X6BB 3MV9E 3B9VA 4XMKH 3SKOA 1BGXL 2PXYC 1YEFH 5HI3D 3C5ZD 3QNZA 1FYTE 1JVKA 3SY0B 4NO3A 1YNLH 5T3XL 1T04B 4N0FB 3UZQA 1Z2KA 5ID1A 5B8CB 1I8MB 5ERWA 4GT7A 3X3GH 3PP3K 1WTGT 3U36B 2VUYA 1UCBH 4YFLF 2RGSA 4IRZH 4YFDB 5F72S 5EN2A 5I6XC 5KSAB 4HFWA 4TTDC 1A7QL 5DQDL 4EN3D 4GAGL 3MOQA 4BSWB 3B5HA 4DCQB 4WEMB 2YD5A 4KUCF 2B1AL 4XHJC 4ZAKC 2FR4B 2ED7A 1MFDL 2OTWA 5T1DL 2P8MB 3UC0L 4QGYA 3UBXG 1CDBA 3BDBA 5D7LE 5GS1B 2B1HL 1EX0A 2DMKA 1ZVSB 4TUOB 3SO5A 1YN6A 1YJDC 3BKJH 4FQHB 4XPTL 3RUGB 5EC1A 1WFNA 4C4KT 3O3BB 3GSWB 3BWAA 1PFCA 2P48B 1YEJL 2AQ1A 1W0WA 1CFBA 2X89A 3GBMH 4FTVB 4LNRA 4M1GH 1OAUH 5IR1A 1FBIL 1FQ9C 3QXTA 5HYSG 3HAEA 1KCRH 1BAFH 5HY9A 4K8RC 4CJ0A 1F11A 3L9RA 1HOCB 3TPUA 3SE3A 4NRYA 3QI9C 1DQML 3DX9B 5C07D 2KUTA 3BJ91 3UBXI 4YK4B 4E42A 1L0XA 3BZEB 1U8NB 4DWHA 1I1AB 3K74B 4I0PD 4ORGB 3T0VA 4L8SA 2FWOB 4Z7NF 4P57A 1J1XL 1I7TB 2JIXB 4JGJA 5EC2B 3QWRA 3P4NA 4MQTB 5CJBA 3EYSL 4Z95L 4NWTH 5KVGL 2IGFL 2F54D 4XP5L 1KCLA 5C0CB 3K4ZA 1X4YA 1UVQB 2YPVH 1WZMA 5F3HB 4FG6C 1XAUA 2VDML 1R3HA 2VN7A 3REWA 3GHEL 1I9IL 4YHNA 4UV4L 5E8PA 5DRZA 2R2EA 4UDTB 1LO5B 3B6SB 5D7JD 1MCLA 3OQ3B 2CH8A 3BT2H 1MHHB 3IJHB 4C56D 2HVJB 4AYFA 5CKGA 1P5VA 5DMKA 1CG9B 1RV6X 5EUOB 2PTTB 2Z91B 1BVZA 1U3HB 2APFA 2R39A 1YN7B 5GXBB 5EFIA 1NC4D 3QXAB 3HNTL 3ULUL 1L7TH 2CLZB 1W72A 3D18B 5BOZG 3H42H 1YJDH 1CLYH 3P4OA 4WFGD 4NOFA 3TJEL 2IADA 3E2HA 3MBEC 4PJBE 4U49A 1WQVT 2A83B 4WFED 1QRNA 2ZSWB 2DLTA 5IIEB 2VLRB 3MYZA 5F9AC 1DBMH 2XTJC 3SN6N 1BQLH 2DQCL 5GPRA 3WO3B 2OQJB 1IMHC 2WWKO 3C60D 3GMOA 4GBXC 4OZIE 1FAIL 1YPZF 4YDKH 5CJQH 5I1AB 4PYHA