5HGHA

Hla*a2402 complexed with hiv nef138 10mer epitope
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hghA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hghA01
4WV1B 4AG4L 3DO7A 4OFVA 4RGMB 2W9EL 4PJCE 3X3FL 3VFSB 5DEGB 5I73C 3ULVL 3LD8B 5JPNB 5DRXB 5EU4A 4UV7L 2VB5A 1OT1A 4IS6B 4H1LB 1CG9B 2DQTH 2XTJC 1HILB 3PGDB 4WHYG 5DD5H 5C2BL 1XIWA 2VZVA 2X44D 2JB6A 4K3HA 4OV6F 3GGWB 4KPHL 2NX5A 1I7RA 4OFYA 2VO5A 4JB9L 1LQVA 4JO3H 5MERB 4M3KB 1YEIH 4KDTA 2C4FU 4R4FL 2AQ1A 4OLZL 3GBNL 1V7ML 1T0PB 2ESVB 4U0RC 5GGVH 4L1DA 1HINH 1WISA 2PO6B 3VG0H 2AW2A 4ZOCA 4D9LL 1N4XL 3WIFB 4Y19D 3S4SG 3PWLA 4GAFB 3FAWA 4DUXA 2O5ZH 3V6BR 1ZE3C 2VDKH 1T2QH 4MDIB 4WI4A 1ZLUK 3SOBL 4OJFL 2VZTA 3CMOH 4KU1A 3PDOA 1LDPH 5D7LB 4HIHA 3FFCA 3ARRA 3V9FA 4JHWH 4FP8H 4MVBA 1BVKA 3ALXA 2QADD 2AJSH 1HHJB 4OI8A 2H2SC 4JM4H 3PHQA 4GKSA 4L8SA 3VI4F 1A6TB 4AM0A 1XF2A 1SEBA 3GKWL 1ZHNA 5IMKA 1QRNE 4MJ5B 5DQ9B 5ADOH 2X4PB 2V2XA 1FN4B 4OIBA 1SMAA 2F5AH 4F7PB 3TP4A 4ELMB 4I3RH 1J0KA 3VXMA 4Q9BA 3BWAB 2VC2H 4PP2A 1OTSC 1A21A 4P4RA 3KYNA 1MCCA 1KJMA 1RZIB 3HPJB 1L6ZA 1FSKB 4GG6F 2WWKO 1XFPA 3PWVB 5E56A 3U4EA 4G7YH 3OF6D 2EKSA 4XWGL 3WNMA 4RX4D 4BELD 4CW1A 4NQSB 2QTEA 4IRJA 5FYLD 3UTZA 2DMCA 5LQBH 2M8XA 3MR9B 4J8RA 1A6ZB 3O4OC 3MV01 1G6RA 5KN5B 1I4FA 5EH1A 1TPXC 4P48A 3WDIA 2GTZA 1CD1B 1KXQE 4Y89A 2NXZD 1IM9D 1S7WB 2OP4H 1OP3K 2P43B 1J5OL 4MB4A 4PJEF 5T1MA 3BN9D 3C5ZB 4NPYB 1LO5A 1MWAA 5CILL 3QPQC 4JFED 4RZCA 3ULUE 2XQYG 2YZ1A 2JJTC 1E6JL 4KK8C 3GSWB 5BVPH 2FX7L 2IH3A 4DEPB 1A14H 4M93C 5DK0A 3VD5A 3EYUH 3WJLA 1XH3B 4XVUD 3VMOA 5JHDD 2IF7A 2EO1A 3FZUC 1U2HA 2I60L 3T0BA 2C3GA 2XYCA 4HHAB 1F4YL 4JM2D 4QRPA 3V5DA 1DP0A 4YE4L 4G6FD 1IQDB 1FG2B 1M7DA 3PHOB 1NCTA 4OGAD 3FTGA 4X6CE 5AZ2H 2FDBP 5ANME 4NKIH 5FO8A 4TSAH 3P9WB 1T80A 2EYSB 1HQ4A 2XWBB 3F62A 3D0LA 3OX8B 4S1RL 4PV9B 2P5WD 3O0RL 2IQAA 2B2XL 2AK1L 3UDWC 4OTXH 5IK3B 4KROB 3VXOB 2AJ3B 4F7EA 1WBYB 5FYKH 4W70A 4NRXA 3HNSL 1RULL 3S35H 5C7XH 4XXCC 2CGRH 3NFPB 3TBSA 4PRAB 3TCXA 1VHPA 4W6WB 2W07A 5MEND 1WCBA 1JI1A 1RK0A 3LHPH 1OGAB 1I7TB 3UMTA 3SDDD 2ZOLA 1I1YB 1XGPB 2ZUXA 3LSOB 1GYAA 5ESQA 3O81A 4FXLA 4M5ZH 4XAWL 4HIEA 4X6BA 2AXFB 4Y4KC 1IGCH 3EDKA 4KRLB 1X7QA 1UM4L 3QDGB 1CLYL 2OTPA 2ZZUT 4U1JB 4WUUA 3DX8A 5C0AA 5F7WC 3BISA 1OF2B 4OCSL 2Y36L 2F19H 1NLDH 3WFZA 2BC4B 2X4OB 3H9YA 3UTPD 3BZEA 1XZ0A 1EH9A 1L8JA 4B7IA 3FO9A 3O6FA 1ZTXH 5F1IB 1AXSB 4P5KA 3BP4A 4U3HA 2FH6A 1C7TA 1OCWH 4PJ7F 3OBAA 1I3UA 2P42B 4UT9H 1CFNA 1KTLA 1V3LA 2DTML 3W5NA 3QFDB 4C56A 4ZOBA 2NQCA 3B9KA 2P8MA 1F02I 3NMEA 2CRYA 5H2BB 3A6BH 5IW1A 1BD2A 3X14B 1Z3GL 5D8JH 1NUGA 1RZKH 4YWGL 4QYOA 4YDIL 4JDVB 1BF2A 4GJTB 1FP5A 1UA6L 2VRAA 5HI4C 2V2WB 1S7UB 2G75A 1TETH 1YJDC 3C60D 4OF6A 3T1FB 3T2PA 4BZ2H 4Y16A 5FHAH 3GRWA 1NFDE 4S0SD 2ICES 5HGAA 2DICA 4M6MH 5IHBA 1WITA 4JY6B 1NAMA 1PQZA 5D2LF 4EQ3A 5KAQF 1ZK9A 1CXIA 4H1LH 5CEZL 1T03H 4MWFA 1VERA 2ERJB 2Y1VA 4IDJL 1NANI 2AJYL 3FQUB 4ENEC 4WFFE 2HMIC 5F7DA 4OD3H 5BQ7A 5IB2B 1IC4L 1YPZF 4YHLH 5E1AA 2VDMH 3TT1L 4UAOB 4TNWK 1F3JA 3AMLA 1IFHL 1QVOB 1C5CL 1OT2A 3BHBA 4TVPD 4O9HH 5A3ID 2HTKC 1DBBL 2QHLA 2OSLA 4FNLH 2WAHA 1DQMH 2VLKA 5E95B 3VFGL 5FM4A 2WINA 4FS0A 4JPIA 1IAIM 4NKOA 5DRWB 2NXYB 1HH6B 1KCUL 1DBAL 1C16B 4D0BB 4KZDL 3Q6GH 2AJVH 2VXSH 3I50H 15C8L 4OUUA 4KKAC 4HBCL 3W2DH 3S5LG 1QR1B 1A7RH 3UYPA 4L8DA 3HZKB 1QBLH 2C4XA 1GPOL 1BQUA 3TCLB 3T2NL 1CWVA 1J7VR 2H8PB 4RWYH 1ZS8A 1G7PA 3K81A 1FL3B 3VWKD 1BM3L 1MIEH 5BOPA 5FKPB 4LCWD 4NZTH 15C8H 2NY0B 3LRSA 2FBJH 1VFMA 5JOFB 5D7JB 1RV6X 3ARBA 4HS8H 1TCMA 1ZLWK 2LFGA 2IG2H 3TWCH 4AEHL 4G8FB 1D5IH 4Q2ZB 3L3KA 2XACC 4LLDA 4LRIA 1I1AD 4HUMB 5IP4A 5K9KA 4LGPB 3NFSL 2G60L 4L3EE 4X7CC 4XWOC 4ZG1A 1A6AA 3VE0A 1ZVHA 4U1GB 5C3LD 3TJHA 2IANB 3N85H 3KLHD 2A6KA 3BKYH 1RI8A 3IDXL 4H1LG 4FN0A 1EHNA 3K4ZA 4RA3A 5I30L 1J8HE 4MJ4A 3B9EA 5DFVD 4P2RB 3S37L 4G6AC 1R3HB 1WBXA 5L9DH 4PD4J 5HVHC 1IKNC 4V1DE 1RFDL 4OM1H 3W11C 3B3IA 3NFSH 4JJHA 2ARJQ 5EB9A 1N0LA 4QNPF 3ALPA 3LY6A 3MLXL 3FT2A 5I1IL 2YOCA 3VFTB 5EIVA 2CKBA 1AHWB 1QBBA 4MGXA 2FLRT 4P46A 4MA8H 2ADGB 4MQ7A 5DJYA 2HKFH 4ZQKB 3T77A 7FABL 5DQJB 3N0PB 1JHTB 3FT3A 3RGVA 4DKEL 3P11L 5I1HL 5EU5B 3PWJA 1B88A 4HUVB 2VUOA 1MI5E 3HNTL 2O61B 1PEZA 3O8XB 2E3VA 2AI0H 3WFHA 3O2VH 3PXHA 4NQVA 4QT5A 2VDLL 1G1YA 4I0PD 3DARA 5E2TH 4PIRF 1Q9KB 3QHTC 4JGUA 4M3JA 4QOKD 2KL6A 5K9QI 3TFKD 3GO1H 4N8CL 4LHUA 3WS6C 4OZHA 1OHQA 3E2HC 4IRSD 3ZYZA 5CSZB 4IOIA 3O6ML 2XQYK 1D7FA 2NW2A 4U1LB 1MRDL 4M1GL 5E1HB 1FNGA 5ISZB 2Y07H 3L5JA 4X6FB 3H0TB 1CFBA 4B0MM 1N64H 3OKKB 5I9QC 5J6HA 2APXA 3NTCL 2QQQA 4OLXH 2WW8A 3WV0A 1GGUA 1NGZA 2ZPKH 4C4KT 5F7KC 3BZFB 1AKJB 1KPUB 2AXGB 4X0KB 2HFEB 4PJGA 3VWJC 3RWCB 4AJ0A 4HH9A 3IXTA 5IMOA 4QY8A 5EBMB 3ZKMD 3B6SA 5EU7C 1MRDH 3EZ8A 5KS9E 3WFEH 4YHKH 5H8DA 3IDYB 4NHUA 1K8IA 5DEFB 5DHYB 3VXNA 4CN1A 1NDMA 1U8HA 1FBIL 4LDLB 4KVNL 5AZEH 3NZHL 4BQ8A 4U1MB 1AO7A 2FB4L 2X4SB 3BPNC 1OTTC 4PY8J 3N9GH 3VGBA 4LSSL 5I18H 3VXRB 3QULB 1F11B 5C0RL 3FO1A 3L5WA 3DYOA 5D1QC 1PFCA 5LCVH 2XN9E 2VDOL 2D31A 4ZAKB 5IMMA 3PIQA 5CLTA 1NFIA 1QLRB 4YR6A 1NCBH 3RJQB 2DLFL 1HHIA 2HJLB 5L2KE 3IAQA 3UJIH 5E8EB 3IFLL 3T0EA 3GSVA 4ZPTB 5IVXA 3PWNA 5L0QC 4LSSH 3LKRB 5FM5M 1R5IB 1BVLA 5FYJH 1NUDA 5TDNA 2QQLH 2OR9H 3FAXA 4KQ3H 4LCCC 4ACPA 3DRQA 4Z76A 3N1FC 5DQDH 5HHVL 2GW5A 4RQQB 4RMRA 4UINL 5A2IH 2D7OA 1JRHH 3PWPB 3FQTA 4M7ZC 4IIQB 1A5FL 5DHVB 3UTSE 3VFNB 4ISVA 1VGEL 3QO1A 4Q9QL 1C5DB 1P7QA 1CU4H 5EU3B 4ONFL 4WJ5A 3MTRA 3P0VL 4Y0GA 4NQXA 4X4XA 3HCVB 3K8LA 1KJVA 3E1F1 4EUPA 1A7NL 2MCPL 3REWB 1G7JB 1CL7H 1MVFA 5IVOA 5GSRB 2OI9A 3I84A 4PJHB 5CHNA 2CIKB 4MNHA 4LAQH 3EYSH 3V6OC 1Y0LA 3QCUH 1T21B 1VGEH 3C6LB 4NO0A 1MJUL 2E5EA 5HYEA 3RIFK 2ZP0T 1IBGL 3MRQB 4NP4H 4O4YL 3KPOA 1XR8A 5C0FB 4FXGA 1F5WA 4LGRB 3QH3B 4Y1AA 4OB5L 5C0DB 4TULH 3FB5B 1NCWL 3LQAC 3V6ZB 1K2DB 3ZDYE 3HRZA 4LSPH 1LE5A 2W0KA 3KPNA 2K7QA 4Y5XB 1KFAH 4CADA 4MNGB 2CPCA 2X1PA 5F3BB 2MHAB 1LHZA 3HZYB 1S7SA 5INDA 1NMAL 3MACH 5GPRA 2DQFA 5DHXB 4PRNA 4NN5C 4EDXA 4NN6C 1YC7A 3FOLA 1I8MB 3AM8A 1MCNA 3MODH 4PR5B 1RIHL 5TGBB 4P99A 1S7TB 4NN7C 1OLLA 4X4MA 3N06B 1BHGA 3JTCA 3RUGE 4O5LH 3SGEI 3QEQE 5DSCB 1KLUA 3H6JA 3RQ3A 4GMTH 1W0VA 4L4TA 2BNQA 5DUMH 1U3HB 1DDHA 1R3LA 4PJ5B 5CSGA 5IR1B 5C3TA 2CRIA 3IXAB 1IAIH 5GISH 5GGRB 2V5MA 2DIJA 4TUKH 1SJVA 1CQYA 1YNLH 5ACMA 2A6JB 1A3QA 3CK0H 1ED3A 5DJ0B 3P3YA 4HWZB 5JW4R 3KS0J 2N4IA 1M7XA 3VGFA 4OZFH 4JVUA 1MIML 1A2YB 2BHYA 1KG0A 1N3NA 1F3DJ 3EO0A 1QBAA 2MCG1 5AD0A 3OHXA 1ZLSL 2JJSC 4UQ2B 5JUEH 5J89A 1JZ4A 3ULUD 4H20H 1LNUA 4TOYH 5KVFH 4KMQA 3IJHA 2HYMA 1RVFL 3W0WD 2P45B 3LPFA 3S88H 3MCLL 1ACYH 1WK0A 2XKNB 1ZWIB 3MREA 4B41A 3DSFL 5C0GB 1LVEA 2C1OB 1JGEA 1OSPH 2ZNXA 4RMTA 1PDKA 4HKXA 5LWYL 5I66A 1NBVL 1XF4B 3NBNA 5FGSA 3EYQC 2YC1B 5JZ7D 3T65A 1ZA3B 4MA7H 4E41A 2NNAA 1HNFA 4GMSH 3DX9B 3P4NA 3SO3C 1S9WB 3MCLH 1H5BA 4HIJA 4OT1L 4HXAL 5ELIA 4MHHI 5D1XA 4JPVL 3AUVA 2VDRL 3MOAH 4KKCC 1IARB 1UZ8A 2G5BB 4K3EH 1QTYT 5D6CB 5JLZB 2HKHH 1X5HA 5EBGA 5GXBB 1LE9B 4HJGA 3TN0C 1R6VA 1MF2L 1UQSA 3ETBF 1I3VA 3HMXH 4UI2A 3QDJA 4M48H 3IKCA 1I8KB 4BFIA 4ODSH 3TPUE 4I8DA 4PJCA 1JPSH 2DLGA 4FXKA 4HUUB 5M95B 2CK0L 2Z31A 3K2UH 4EI5C 2CUMA 3VXQB 2HJKA 2VDRH 2VABA 1RAMA 1HOCB 3F58H 5CCKL 4K7PY 4KJQC 5EORH 1NGWB 1FZKA 1TCRA 1VPOH 4GKOA 3QJFA 2MJWA 1EEZA 2CDGA 5IM7A 4J6RH 4OZGE 5I1JL 5L88L 1PKQB 3ARPA 3OQ3B 3IETB 4H0GA 3L9RB 4OZFG 3GM0A 1D5BA 3QUXB 2ZNWA 5KZCD 4XC1L 1F8TH 3MROB 2WIIA 1P9MC 3GJFA 4WO4C 4HPYH 4LLWB 4JN1H 5ITBH 1XGTB 3CCHA 4ZSOA 3JWOC 3EO9H 5JXEC 3CVIL 3MBED 3W82A 1U6AH 5E7BA 4XXDA 5KSUB 2NY5C 2XKSA 5IB5B 4PRBA 4JKLA 5D7SL 2R4RH 2P8LB 5FK9B 1T1YA 5DMKB 2NZ9C 3SGEH 1XMWA 5T3ZL 5HYQA 4A6YA 4Z7OE 2DYPA 3IB4A 4HS3B 4EI5B 4NDMA 5LGKA 3CPLB 4I18C 2YEZB 3GI9H 2P8PA 4H26B 4JQIH 3D0VB 1YMME 5KVDL 4N8VA 5GJSH 4FFWD 3U30B 5EZIL 4XNZB 3D39A 1II4E 1FNAA 1T4KB 3RTQC 4PJ9C 4JCLA 5CP3A 3UYOD 2C4FT 5D71L 5K59F 1HHGB 4Q6IC 5AAMA 4ZUTB 3RHWF 5CD3A 4R26H 2JF1A 4JRYA 4HJJH 4HZAA 4WFFD 3KPRB 5IHLB 5L7XH 1OSZA 2ICWB 4GRMB 4JDZB 4K7PH 5CINH 4ZXBC 3MX0A 5GGRY 3QEHB 1KIRA 1HWGB 1JP5A 3CX5J 4P5MA 1MRCL 5TE4L 1FYHB 1PGRB 4YHML 4HGWA 2F53D 2GSGB 1J10A 1BLNB 4N68A 3FOMB 3UBXA 2GTWB 2CDEB 3WXVL 4FQXA 4MJID 1OAQH 2VYRE 1N6QL 3ZKXB 1U58B 4MXVE 4XP1H 1RURH 4NQTA 3QXWA 1X6LA 4YJZL 2Z8RA 5MEPB 1OARH 4UUJB 4Y19B 3OKDA 4GW4B 2GCYA 1EO8H 2EC9U 5F70A 1BIIB 3NABL 5F3HB 1ES0B 5I6XB 1A4JA 4Z95H 1FV1A 4HUXB 3RWHA 4S0UC 2W60B 1U91B 3ZYJA 2ZCLH 4WNQB 4Z0XA 5C0CE 4U1KB 4B50A 4JFQA 4M7KH 5J13B 4LU5L 5C9JB 1TJIL 1JWSB 4MB5A 5HGHA 2XWTB 4X98B 3DWTA 3U6RB 2XIDA 1TVHA 4X6CA 4NNXB 5ANMA 5EZLA 2RCSH 4NQEE 1BX2A 1GC1C 2DQHL 3L3GB 4Q0XH 5IHUH 4R4BA 1E27B 5EC1A 1MQKH 3LQAL 2AQ2A 1J1OH 5JW4Q 4LSRL 3S9DB 1KBGH 4XHJD 1UM5H 4ZTPL 4NSKB 4ZNEA 4JFFD 1KCRH 4K3GA 2G5RA 4OIIH 3NA9H 4KHTL 2OZ4A 4TUOA 4K8RH 1YN7B 1RJZB 4V1DD 5F6HJ 3V8CA 3SO5A 1NJ9B 3KXFD 4S1DC 4PTTB 5CJ8A 1Q94B 1FC1A 3FB8B 3Q1SH 2UYLA 2DRUA 3SJVE 3PP4H 3VCLA 3HZMB 5I8KH 2DKUA 4ZTPH 1EMTH 3SKNB 3V52L 1RUAL 5FGBA 3NFNB 1OB1A 1GOFA 3O9WA 4TN9A 5D9SB 5CMAB 4WIQA 3SGKC 1GSMA 2PTTB 4Y4FC 2NXZB 3GZKA 1H3VA 3MFGB 4N0FB 4AMKL 5T33L 3PUCA 5SWSB 3OR7B 1RZ8A 1GOHA 4OLWH 1G9MC 4H88H 1DBKH 1CXLA 3B43A 4JFEB 2O93L 1U8PB 1RUAH 1ETZB 3MV9E 3JTTA 1AQDB 3O4LA 4D9RD 4JFPB 4LHQB 5HDBF 3LKNA 4ZUVA 5JHDB 1BQHB 5LGHL 4NQCD 1MLBA 4X7TB 3CFKB 5E99H 1E6OL 4XNMA 3AFLA 3QXVA 5D70L 4F37F 4UIMA 3U9UA 1G7IA 4N0UE 4PB9L 3DO3A 2J1KA 1DEEB 4G5ZH 4QXUL 1TZHA 2DLTA 4LOUC 4XNQB 5EUOE 2P5WB 3D5OF 5FM8A 4KC3B 3VGDA 4RIRB 1L9NA 3RWGA 1PSKL 3H3KA 1NFDA 2FIKB 5DRNA 5JW3L 1BOGA 2BRRH 3VDAA 4LCIH 1CICA 2VWEC 4PYGA 4OZHF 1OAUH 3BZ4B 4Y4FB 3RVVD 2V2TA 4TPRL 3DMMD 2VL5B 4KTDH 1NCUA 5CEXA 4ORGB 4JY5H 5MENB 2HA1A 2GY7B 2DKMA 3HE7C 4LIQL 4GBXD 5FUOL 3SDDB 4X8JB 2VLJA 4LLYA 1IL1A 3O3EA 4N9GB 2IQ9L 3GIVB 2A74B 4CGTA 1P7KA 3VA2C 5JW3H 3QUYD 5HVFB 5SWZE 1PLGL 1NBZB 4PJGF 4TUJA 5EDXA 5F1NA 5E8NA 4YO0B 3ARGC 5EOQH 4BZ1H 4JO1L 3CAFA 3EYFA 2ORBH 5LG1A 2WLZA 3HPLB 5K33A 2IQ9H 5F1OB 1S5IL 2QSCH 2ZG3A 5D2NB 1BF8A 3FT4A 2BVTA 4FQHA 4Z7VB 3ZLQC 1FVDB 2RFXA 3HUJB 1TNNA 3UTSD 1R3IL 3F7YA 4YUEL 5IFAH 3GSNA 3MLVH 4QRPD 4DGIH 5DZNA 4D8PA 1U93B 3U9PH 4JFZL 4Z18A 5FKAA 2YD2A 2CLRA 3HE7B 5MP6H 3HN3A 1D9KC 3IVKA 1UYWL 5IVXF 1DCLA 5EIQA 3TVMC 4GQPH 4G6JH 4IJ3B 3OKNA 3DUSA 5HI5C 2E7LC 2NY5L 1FVCB 3ZHLA 3G6JA 3C60B 1XGQA 2QSTA 5TDPB 1MNUL 2EDKA 5SV3A 5GGQL 3OL2A 3TV3L 3BJ91 4P3CH 4HIXL 5AG8A 4PJAE 1C12B 1MHPL 4JZNB 2J6EH 4TSBL 1DANU 3MJ9L 4HWEL 1I7ZB 4DGYH 3WBDA 1T1XB 2NPLX 5J9PA 5J11B 1CDUA 1KGCE 4KH2A 3HS0A 3RGHA 1J8HA 3P30H 5J3HC 5E24E 1VESA 5IOPA 1MAML 1J0YA 3HE6D 2YD5A 1KV3A 1LO3H 5HJ3B 5F6IC 1SY6L 4GRLC 4WUUD 1H3PL 4X99A 4P2QE 4WEUD 4RFOL 5BRZB 1DVFA 4BK5A 2XA3A 1QSVA 4N1EA 3SCMA 5I1AA 2DB8A 3W9EB 3ARDD 3WLWD 3GMLB 1T3FB 5DC0A 2FEDC 2FX9H 3WJJC 3RAJH 5ALBH 3QFJE 3HC4H 4C59B 4L29A 3RWIA 3OXSB 1VSCA 3QDHA 2EDDA 4MSWA 1MI5A 2ADIB 4NYLA 1NC4A 5EO0A 2X4TB 1OM3H 1F6AA 3KWWB 4HUWB 2I5YL 1RJLA 3QZWA 4PLOB 3B9KD 1ZHBB 3RJDA 1IGIL 2D7PA 2XOTA 3DV4B 3ARFD 2YD4A 4KMLB 5CFHA 3UC0L 1MFAL 4RRPA 5HGDA 3VH8A 2MKLC 4LCWB 1N5YH 5C07D 1BWWA 1P69B 1MFEL 3OZ9L 5IJVB 3ZE0F 1RZ7L 3BD5A 4NKDB 2DI7A 3EO1B 3RWFB 3QIWA 3FN0L 3MSPA 2YWZA 3GSQA 5DLML 3UROR 1NBYB 5IBTL 4NZUL 2NW3A 3E6FB 4LFHD 3PL6D 4FQ1H 3E3QC 4MMXC 3S36X 5T1LB 3RRQA 2MQ0A 1UADC 1WZ1L 3LN4A 3CFBA 1P6FA 2DWEB 3RBGA 1GC1L 2YR3A 3JV6A 3RBSA 2IH1A 3DROB 1A1MA 5FYLH 3NCYP 3DURB 4ZTOH 1N5AA 4X4YA 3DIFB 3MMEB 1UM6L 3BMWA 5B4MC 3MRNA 1Z5LB 2CMRH 2I26N 3BUYB 2YXFA 4OLUL 2UWEE 3GSOA 2R2BB 5ESAB 3ULVE 1RUKH 1NQBA 5E2WL 1BJ1H 4QXTB 1XF5B 3O3DA 3M07A 2Z0BA 1JV5B 3KPSE 5E5RB 1Z6JT 1X5LA 4PV8A 4HIIA 3PQYE 3MRKB 3R8QA 1HYRC 4M8VA 5L2KA 2EDXA 3TIDA 4MS8D 2WUBH 1KB5L 4KI5D 2GAZA 4GFTB 4LCYA 3T2OA 1Q9OA 1Y6MR 5EOCL 5B8CA 1TXKA 5GGUA 1B3JA 1QKZH 1KCGC 2C1PA 4U3XA 2PN5A 3CC5A 3STBA 4I0PB 4XMPL 4MNQD 2BDNH 4LKCA 2JE8A 4QOKB 5E4EC 2Q86B 5HPMB 4XCCH 2YKLH 5BVJA 2GFBB 1C5BH 1LP9B 2YBRB 1W8NA 3GSUB 3KYMB 3V6FB 4TTGA 5D7IA 3UJTL 3BEWB 5GRUL 2R9HC 3MUGB 4OF0A 1G9ML 1FZMB 1NMCC 5I1EH 4CU8A 3SY0A 4JFOA 4PJCF 2AV7B 2GY5A 3FRUA 3MYZA 5HHXH 4GQ9L 1T89A 2R56H 3PGFL 3MV7A 5IVZB 4CNIB 3QCVH 3LKSA 1DBML 5ICXA 1T1ZA 5HGGS 1L7IH 3U4BL 2F54E 4UILL 3EFFA 2JJTA 1LEKA 3WDJA 5DJ6B 4KJYA 5DJXA 1A8JH 5F9OL 3MNZB 1INQA 3MV8E 2HAZA 1KPRB 2D4FA 3CGTA 4PJEB 5DMYA 1D5ZB 1PZ5B 4PLKD 2B1AL 3WXWH 3IDUA 3D18B 4JY4B 4HJ0D 2QKIA 4FTVB 4YHNB 1QLFA 4PGDA 5JNYB 3MFFB 1OTUD 1AXTL 5I8OL 3T8XA 1GH7A 1ZEAL 5HDLA 1DQQB 1YMMD 3OAUL 4P46D 3MRRB 1HKLL 1KEMH 1A9BB 4Q58C 2VR4A 1F42A 1HKFA 2L7JA 43C9A 1FL6A 5TDOB 4RNRB 1R24B 2JJVA 3SKJL 1NGPL 4AIOA 2HWZH 1N2RA 2YS4A 3MOBH 3W9DA 3N50A 3LIZH 4GKNB 1DLFL 3DXAA 3I9GH 4JG0H 2C5DC 1GGCL 4M43L 3RUGA 4YNYA 3QIBC 2ZJSH 3QEQA 2O5YL 4F58L 4ZUSB 1HXMA 1DQTA 4R0LC 4AL8H 5I17B 1RMFL 1FZOB 3HR6A 3QG6B 3GSXA 1BQHG 1CE6A 1H15A 2ZUQC 4Y4KA 1NL0H 4NO2A 1MHHA 3E8UL 4RCAA 3UTQB 4HF5L 3JTSA 4N5EC 2VXQH 4GW1B 4KK5D 5JXAL 1GIGH 5I15L 2NY2D 5F96H 5CZVL 1N0XL 1DTUA 2HLFC 4PREB 4ZYKB 3TNNA 5GGSB 1F97A 5FUZL 1FL5B 4ORZC 5TQ0L 1W8OA 2ZSVB 4OUOA 5TFSH 5E9DB 3TO4D 2YPKB 5KTEH 2WWMD 4RMVA 4P23A 2AJZA 4QKXB 1GRWA 4AENB 4BZYA 5ALCH 1RD6A 2H3NB 1RUPH 5GS1B 4LSDA 5T1KD 1G7LA 2NLJB 1FFNB 4YLQT 1H8SA 3MPCA 1MEXL 1HCFX 4FQCH 3C8DA 1ND0B 2OL3A 1X4XA 1YN6B 4BQ6A 1SBSL 4OCRH 4TVPH 2BVPB 1PG7W 2X4RB 1GZQA 2Z4QB 1MCDA 4D0CB 4R0LB 1EJOH 2YHGA 3VU2A 1QLEL 1Q8MA 4J4PD 3HZVA 4QRQB 4XNYL 5IKCB 2NCMA 4KJWD 1IGYB 2ZUQB 2XI9A 2XWJA 5I71C 5JW5B 3ECBA 1AD0A 3D9AL 4R8WH 5B38G 5CJQL 3VD9A 3U0PA 4UQ3B 5AG9A 2FX8H 3MRDA 4CVXB 2JELH 3T0ED 3WHXB 1FGNH 5CIPH 3CVHB 5IT2H 1KENH 4M1CD 4LPVA 1UWGH 4PRDA 1EHLL 3H2WA 3R06B 3EGSA 4R2GD 2D7MA 5J12C 5CJ5A 1GCFA 4OQTA 3B5TA 2IBGA 4X6CF 5FV2A 5GIRB 4DWHA 4FQJL 3LEXA 1A0QL 5C09A 1P7QD 2JIXA 1BJ8A 4PJIE 5L2JB 5HHNB 1D6EA 2KDGA 4JFHE 4DZ8B 2B4CL 3C8KB 3QNZA 1QHOA 2CDFA 4YHOH 3SE3A 4TQEL 5DVKA 1YPZB 4PG9A 4YBHA 4KK6C 5DVOA 1L0QA 1R5WB 1P4LB 3AREC 3MLWL 3VFWB 4A2LA 2XRAH 3DTXA 3B4NA 3OG4B 4F7TB 3MXWH 1EVTC 3MRJA 3DVFA 3MRIB 1AGBA 4DW2H 5C2UB 2FCBA 5EN2A 3IDIB 1D6VH 4LARL 1FIEA 1A7PH 3PV6B 4HFWB 4QRRD 4P2OB 2CD0A 4XH2A 3ILQC 4NZRH 3H42L 2X70A 1F4WH 5EBLB 3ILPA 2AKRB 2VDNH 2ESVE 2AAVA 1KIPB 4YHPB 3RZCC 4BUGA 5CEZE 3X11B 1UB6A 4ZFFB 3WEXB 3RWEB 4U1SA 3KYKL 1X5IA 1BAFL 1BBJB 2HG5B 4WVRA 2A6DB 5IG7A 1RZGA 5IBUG 4ERSH 4K07A 1T66D 2AEPH 5GGTH 2HRPH 5J1AA 4MAYC 1M7IB 5KVMC 2LTQB 1WT5A 5D7LE 4MQSB 3KLAA 3THMH 3AAZB 2UUDH 5E08L 4QXGH 5KSAD 4YBLB 2MPAL 1DFBL 3ZL4H 1MCSA 3GFUA 1TJGL 2IAMD 1IKNA 1FGVL 4L3CA 1KJ2B 2R2HA 3C5JB 3QA3B 1EDQA 4AEEA 4PGCA 3AU1B 4O02L 3BGMA 5DWUL 2E6PA 4LSTH 5ICYB 1NFDF 2ARJB 4UDUA 4KV5F 2W0FA 3RVUD 4OM0H 4ELME 2DQGL 5GGSY 4U2YA 3TT3H 3BVNB 3FRPA 3OKEA 5FGRA 4ZFOA 4OCYL 4G7VH 3WHE0 1XCQA 4G6KH 5FGCB 2NTFA 3IU4H 5KZCB 2GSIB 3X13B 4KRPD 3ARUA 3UTTA 1AGEA 2DI9A 3UBXI 3IDNA 3WIIH 3SPVA 5F7MC 1R0AH 2IFFL 5T3XD 3REVB 4Z6AT 5EWIL 1GZPB 1K9TA 3MBEB 3R8BB 2C7UB 4HDIA 4OGZA 3LV3B 2Y06H 2YPLD 2GITA 4JKMA 3IS0X 3SKMB 1I7UB 3QIUD 3I3DA 3WS6A 4KWUA 5C0CA 4S2SB 5ETUB 4Y2DD 4QTIH 4Q6YA 3WFBH 4RISH 1OAXH 3ZMRA 4C83A 5FECB 3CFEB 2ZUWA 3WO4C 5IESH 2HFFA 4EIGB 4AIZB 4UB0H 5DA4A 4NQEA 1QO3A 2QQKH 3HR5B 4M7JL 5ENWA 4NO3B 1CTOA 2DTSA 3FQRB 5AWNL 2Y6SC 2B0SL 3QDJD 4G9DA 1UJ3B 2BY0A 3KDMB 4O51A 1MPAL 4R96B 1HSAB 3QEUB 4KQ4H 1KIUA 1JYVA 4UTBH 4HGKC 2DDQH 3K4DA 2A9ML 1P4BH 3UEZA 3G6JF 2ITDA 5KSBB 3LQMA 2JK5B 5DRZA 4XAKE 4ZFZA 3UO1H 1I8IA 5IROC 1E28B 3SJVA 1GHFL 2H2PD 5D1QA 1IVLA 3OKMA 1CFSB 1QFUH 4JHAH 2F53B 1A6WL 4XPBL 2J4WL 3GIZL 5IEHA 2AJUH 1DUYA 4MJIB 1Q9WB 5E00B 5C92A 4YXLH 1MOEA 2YWYA 3G5XA 4KGLA 4RFNC 3PJSB 2WMPA 1YECH 4HK3N 1OGAE 2IFGA 5E6ZA 4YFLF 4QTHA 1XIWC 4LCCA 1K8DB 5C0IA 4R6UA 2IEPA 3NVQA 5HHMB 3CVHL 4XNUL 3L95A 3MV9A 3QDGE 1I85C 4KDTC 4G80B 4HKBA 4K2UH 1H8NA 5JOPD 1S9XB 4U6VH 1ITCA 4JPKH 4X5WA 4C54A 2R1YB 3SBWA 4EN3A 4EZMA 1EFXD 5KANI 3MZGB 5FAAA 3BDXA 3PHSA 5EG6C 3C8HA 5FOBB 4NUGL 3U7YH 4N0UA 3VRLE 1I9JL 5F7NC 3S97C 2R1XA 4G43B 4DGVH 4BJLA 5EUOA 5I74B 3D39D 4WU7A 1OAYH 5SWQA 2A2QT 4U31A 4JJ5B 3H9SB 3MCG1 4G59A 2XA8H 3QWOB 5FYJE 2IJ0C 4R4ND 2DF3A 4PJBA 5HD8D 1X5XA 4KTEH 5DK2A 3GK8L 4MVBC 2Z35A 1QSEA 3VRIA 4I1NB 3MLZH 4YXKL 1X4YA 4L8SC 1AR2A 2JB6B 3KXFB 3RDTA 2C9AA 4Q7DA 1I7RB 3BH8A 2EE6A 3ULVD 1JWMB 3OSKA 4OI9A 2B5IC 2PXYD 3HC3H 4LHJB 4FQXD 2EIEA 4QRTA 3BE1L 4NM8L 2FD6L 3PQYD 2YSSA 3GMQB 3ULUH 1W72L 4HZLA 3ISWA 3G5ZA 1FPTL 1NCAH 1J12A 2OJZH 4XPGH 2XG5A 5I0ZA 5I1GL 1KPVA 5TE7H 1AFVH 4NC0B 3MV11 2R29H 5FOJA 1AJ7H 4P5TA 1MAKA 3PDOB 4IMLB 2VDQL 4RGND 3A6CL 3FFCB 1WQVT 4R90H 5GQBA 1BVKB 3KPPA 1CDGA 1YYML 3P9MA 4NQCB 1QR4A 3IFNH 3QUZD 2HJFA 4GKSB 2QQNL 3TH2T 4UBDD 1KJ2L 2BFVH 3GMNA 4AM0B 1IGTB 1U8JA 4HWBH 4B5EA 1XF2B 1SEBB 4OD2A 5IMKB 2EZ0C 4MD4A 2V2XB 5D72H 4ZS7L 4MYWB 4OGXL 1HYSC 3CLEH 3PP3H 4QHUA 1EZVY 1BOYA 3T0XA 3WJLC 5JPMA 4PJAA 5DYOB 3MV8D 3BKCH 1KELH 4HQQL 4NWUL 1MCJA 5D7IF 4P4RB 3OKLA 3KYNB 3S34H 1UVQB 5I19H 1KJMB 5I8CA 2FJHB 2JB5H 2BY3A 3U4EB 3QP3A 4GBXB 4PY8I 4CDGC 2EDHA 2DQCL 5E5MA 4CW1B 2XPGA 2BHZA 3O45B 5JQ6H 4XRCB 4IRJB 1ZGLA 3UTZB 4P2CG 4QCIA 1JPTH 3QEGH 4J8RB 4KK9D 5L6YL 3QQ9C 3GI8H 4XVSH 3ZTNH 1K6QH 5T5FH 4IOSD 4YFLI 5GS2D 4MLIA 5FUCC 4ZD3H 1ZOXA 3CFDB 4KHXH 4UNUA 1T0NA 3ES6A 1QYGL 2IANE 4S1SL 3S4SA 2VISB 2XFXA 2FBOJ 3MNVA 2VZ3A 3TN0A 3VMPA 3I2CH 1LO5B 1MWAB 2FGZA 4N90E 1CI5A 5F93C 4RZCB 3ZDYF 2V17H 4L8CB 4HXBH 4O2EB 4E42B 2IH3B 2KH2B 5DK0B 3O4LD 1MY5A 1RPQA 1EAJA 4XC3H 4N1CA 3DV6A 3QNXA 4WFEE 1DANT 4QRPB 1EEQA 4U1IA 4WCYH 1JK8A 1BGXH 1CR9L 1RY7B 4OCMC 4KXZH 1JNNL 2D9QB 4OAWA 3O6FC 4PGEB 3RUGF 5F88B 1RUQL 3WLBA 1AD9A 4MX7A 4AQ1B 3VW3H 3BPCA 2J88H 1KC5H 1I1FB 2A9NH 1G7QB 2QJDA 2WBJD 4NRXB 5EU6A 3EJYD 1I3GL 5D93C 4WO4A 4Y5VA 1VFOA 1DN2A 2X7LB 4TNVF 4PBXA 3TBSB 5JXEA 3MLRL 1DBJL 2EE2A 1IT9L 5JMOC 3PNWA 1B0GB 1RK0B 2BX5A 4WI8A 5HYIA 2CRZA 4YC2C 2ZOLB 2EDFA 3IGAB 2VLJD 1GXEA 5JIHA 4HIEB 2QADC 3HE6B 5ISZE 3RKPA 4U3CA 3GBLA 4WWKA 3WD5H 1OGTA 3R1GL 4Y16C 3L7EA 2XZZA 2DM7A 4WUUB 3Q48A 1K85A 3FMGH 1FO0H 2UWEA 4I18A 2M2DA 4YDLC 1C08B 1LDSA 3D25B 1A1NA 4JO4L 3LOWA 1XZ0B 1FFQA 1H3TA 3KPSA 3RNQA 4FABL 3D3VE 4U6YA 3ZT5A 1ZVSB 4P5KB 3BP4B 4UIKH 4U1NB 2ZCHH 5GZND 5T1DH 1NUNB 2AXHA 5KW9L 4YDJA 4ZOAA 4UTAH 1KTLB 2IALA 3G08B 4WFGD 1H0DB 5CUSL 2VZ1A 5IWLC 3B9KB 2BJMH 2P8MB 1IEBA 3VXRE 4XPTL 3M8OL 2VR5A 1I9RL 4M6AA 4I3SH 5ACZA 2P5EA 2W0PA 3ARFB 3KHOA 2PF6A 4PLNC 5DMJB 1YEFL 1OD9A 3PE9A 4NM4H 3IYLW 1S9VA 1SVCP 5C07B 5IUSA 1CGUA 1FIGH 2IMNA 5IB1A 2H9GA 4ALAL 4KRNA 3C08H 4EBQH 4UOW1 1HWHB 2BOBB 4JHZA 3CSYA 4D3CH 2LAAA 4OLEA 4DK3A 4OSUH 3BN9C 5HVWA 2PYFB 1NAMB 1PQZB 3NZ8A 3MLYH 2F54A 1UT9A 4RDQG 3PWPE 1J0HA 2X42A 4F3FA 1CXKA 4MWFB 1YEKL 3BPLB 35C8L 1KCSH 2HT3D 4LLQA 1BJMA 1E4XI 2R4SL 4U1HA 5BQ7B 1P84K 4EJ1C 5BMFH 3VG9C 5E1AB 5CJOL 3ZDZE 3ARBC 1F3JB 1OAKL 4M5YL 2E7MA 5GSVA 4UT6H 1DN0A 1AC0A 2FEEI 3BHBB 5CEZD 3MNWA 2BVUA 1F90H 1BQSA 2NY3C 2IC2A 1DVFD 1A6VH 2RB8A 4NHCL 4LRIC 35C8H 4PJHE 3O11B 4NKOB 4MXWL 3RU8L 4G3YL 4C57C 3FONA 3TJHC 2UZIL 3CFJB 5CGMA 5EC2A 4GT7A 4OCWL 3F12A 4OUUB 1YYLL 4U6XA 1NC4D 3C6SB 4L8DB 1JI2A 4MJ2A 4LVHB 5FIEA 1YNTB 3DUUA 2K3TA 1X4ZA 2SEBA 3DVIA 2XTJD 5EOTA 4Z7OF 3NIDE 5D1ZA 2Q6WB 5FXCH 1G7PB 4MNGE 4MNQB 3SDCA 5ADPH 1KB5A 1IILE 5BZWA 4IHOA 4N0YL 3LRSB 3GMMA 5MEOA 1CT8A 1UB5A 3CXDH 3ROOA 2W59A 3ARBB 5DJCB 1MCWM 1G9NH 3RGVC 3O3UN 1IQWH 3PDGA 1T20A 1R3KA 2VUYA 2NY3B 1LD9A 3SGKA 4PJXB 1CF8L 3E0GA 3L3KB 4ZUUA 3WSQL 1B0RA 1G6RL 3EOTL 5K9KB 3L3DA 4MJ6B 4CMHC 1WJ3A 4OCNC 3C5SA 2DQDH 1A6AB 2D4DA 1IEAA 4L8BB 3VE0B 3WNPA 2PR4H 2A6KB 4IOFC 4BSWB 3HMWH 5J7CC 1A22B 3FO2A 2OQJB 4Y4HA 2X4UA 2E27H 4YEEA 4DFIA 3MRHA 1WBXB 3Q3GA 1QFWM 3QB7C 1MWAL 4GH7B 1OY3B 3QUKB 5DJAB 1CZ8L 2CLZA 3FFDA 2H2SD 5C1MB 2R8SH 4WGVB 4MXVF 3IDGB 1LO2H 4YK4C 4YXHH 5K9OB 4ETQA 5FEBA 1VKXA 1CBVH 5DD6A 1RZJH 1HIML 4HFUH 5FB8A 2CKBB 4P46B 3OJ2C 4HC1H 3Q2CA 3BEVA 5DJYB 5E2JA 3BT2H 4EIZC 1DEDA 4XP9L 3RGVB 3NAAH 3PWJB 1NEZA 3OPZH 4AIXA 4XNXH 2JTDA 3O2DH 1OTSD 3F7RA 4L4VD 3CDGA 4ODTH 1RIUH 2AJXH 4NQVB 4QT5B 4KY1H 4ZDHA 4CMHB 4E0RB 4P9ML 3SGDI 4RMUA 5HI3C 5JA9A 4X7SL 2R0LL 5KG9A 2QSVA 4PRPA 2X9WA 1FH5L 1QBML 4IOIB 4E9LA 4H5SA 3MO1A 1BBDL 4PJIA 4XBPB 5J4MA 1T83C 4UV4H 1FNGB 4LRNL 3O3BB 2BY1A 2NY2B 3D69A 5J6HB 1E4WH 5LGJA 3VMNA 4L9LA 1NGZB 2NY4C 2DQUL 4YK4B 5K93A 1O0VA 1OGAD 1XT5A 5GJTH 3QPQD 2AK4D 1V5JA 4PJGB 1UJTA 3TO4B 3VD3A 5JR1H 2EIDA 5DEGA 4KK8D 2AQ3A 3IXTB 1D5MB 4HCRH 1RHFA 4JKPH 5DRXA 5IMOB 5DJDA 1B9ZA 1A3RH 4QY8B 3TA3A 2RJMA 1SBBA 4DKFL 1VDGA 2DKSA 3B6SB 1IAKA 1HILA 3P4MB 3PGDA 5T1KB 3ZT6A 5KVEL 3GBML 3QDGD 7CGTA 5GS0C 1OAZL 4M7LT 3BQUC 1S7VA 3FZUD 4JPWL 3UX9B 4NHUB 1K8IB 3VXNB 3B83A 5DXWA 1F58L 4DAGL 1PKQE 4F7MA 3CFCL 4YDVA 2W38A 2VOTA 1J1XL 2MOVA 3PP3K 2JKXA 4PP1C 1NC2D 2OI9C 5EBWA 2E9JA 2D31B 4CU7A 5IMMB 2E7LA 1JHLH 1NFIB 2C3VA 4YR6B 4LIQE 2J8OA 4JPWH 4KTYA 2A1WL 1Y6NR 3BYTA 4ODVL 1FE8L 3O3AA 1HHIB 3SE8H 3UXFA 4KAQL 1UWEH 4RAVA 4X80H 4N8PA 4XP4H 2WUCH 3T0EB 4MDIA 1KTDB 4UOJA 3KLHC 5ID1B 3LRHA 3EOAB 1BVLB 4WI5A 2DIAA 4M9OA 4R2GB 3GRWL 5D7LA 5F6HI 1PJ9A 5TDNB 4ZO7A 1A6UL 3MA7A 1NDGB 1KJ3L 1NAML 3QQ3B 2A1WH 1HHJA 5HSFA 2BMKA 4Y4KD 5EUOF 1G1CA 4GRLA 4ISVB 2CR6A 1A6TA 1P7QB 4NC2B 3T0AA 4NBYB 4M4PA 5M94B 1QFWI 4MJ5A 5DQ9A 3AM8C 2X4PA 1FN4A 4NQXB 1ZHKB 1OW0A 4X4XB 3NN8A 4PJBF 1U95A 1KJVB 2H1PL 4LPWA 1QD0A 5FCSH 1CXEA 1NAMH 4X5LA 5BV7B 3BGFC 2I25N 4U2ZA 1CK0L 4LEXH 1SJEB 4HD9A 3BWAA 1QEWA 3DPBA 4MNHB 5CHNB 3KPRE 1Y0LB 3HKFA 4NO0B 4FZ8H 5HHPA 4G42A 4XBEL 2EXYC 3HPJA 4HS6A 3KPOB 3T09A 1XR8B 1LO4H 3OV6A 3TO2B 4YIQA 2BVQA 2OK0H 4Z77B 4Y5YB 4K71C 2F8OA 4NQSA 4YH6A 4QRRB 3S36L 4IRSC 1JF1A 1A6ZA 3SDYH 3GMOB 1YY9C 1FORH 1LE5B 4NGHH 5KN5A 5HI4D 3LEVH 4CADB 1CD1A 4M61B 4PG2C 5INDB 4XVTH 1O5DT 1FYTA 2DQFB 4PRNB 4EDXB 4Y19E 3FOLB 1CD0A 1FRGH 4NPYA 1SEQL 1GVIA 2ITCA 1LK3L 5CD5C 3KPQA 4QHLB 1LK2A 3ZKMC 5HGBA 5FA3B 3BGFB 2UVFA 3S7GA 1W0VB 1EPFA 4ENED 2HMID 4L4TB 3K1KC 4XGZB 1MREL 5KSAB 1R3LB 5D7JD 2DLEA 4HHAA 1NKOA 2D0HA 2J5LC 3IKKA 4EXKA 1P2CA 1IQDA 1FG2A 2ED8A 2IAMB 4XCFH 5C09D 4CKVX 2HTKD 4GG6A 4TNWF 2JIXD 1X5JA 5DUPL 3OX8A 1CS6A 2WSKA 3CMGA 1ED3B 1MCHA 3MLSH 5DMIL 3IDMB 5IK3A 5E5UB 4DN4H 3LZFL 2QR0A 4PJAF 3TGXA 4APQA 2IAND 4P4KA 4XP5H 1Y18A 1KG0B 4HT1H 4KKAD 2C26A 1KCLA 5AD0B 3OHXB 3O6LH 1J05B 1NCDL 4LFHG 4P2RD 4PRAA 1N8ZA 1ZAGA 4LCUB 3V7AG 3SE9L 4KRPB 4PBVC 5IB4B 3IJHB 3HTLX 2Z31C 4U49A 3WNNA 2VZUA 2IMMA 4FQQB 1OVZA 4JGJA 4WFED 5EIIB 2FGWH 1J18A 3MREB 5FYLE 4PJ8C 2EEBA 1JGEB 2X41A 3QIUB 4G9FA 1OF2A 3U2SA 3SE9H 3X17A 3P9LA 3LDBC 2BC4A 2CKBH 3T65B 4NFCA 1JHKH 1HHHA 1VEPA 4E41B 2NNAB 4H8WC 5F1IA 1AXSA 1H5BB 4HIJB 1INDH 4HW6A 5IGXL 5D1XB 1JGVH 4JFEE 4XWOD 4OBRA 4K94H 3QUMB 5DJZB 3U0WH 5ITFA 3RWJB 2PYED 3QDJB 5TPWL 4BFIB 1E4JA 4C58B 4PJCB 5JHDE 1JTTA 4G6AD 2VIRA 2R0KL 3X14A 1U8NA 4ZO8A 2APWA 2VABB 3W11D 2W9DL 3BW9B 2V2WA 4OGYH 1CGXA 2OX5A 1JL8A 3FO0L 1TCRB 2P5WE 3QJFB 3T1FA 2FJFA 1B4JH 5JMRA 3IJYB 2R69L 4HK3J 3LDBB 4K3JH 5JORA 2J8UB 3OKOB 4LF3A 4L9DA 5DS8A 2VN4A 5H37H 4MAUH 3UTTD 4F9LC 4CN6A 4KUCD 1WEJH 4P0DA 1A6PA 2E7CA 5MENE 1TFHA 4U7SA 3QIBA 4ZSOB 4FQIL 5IB2A 2VXTH 4HK0B 4OD1L 4XXDB 2EH8H 4PJ7A 3VXRD 2IBBA 4PRBB 2UWEF 1QVOA 5D5MA 4JKWA 5ICZA 2VJXA 2GJ6D 4XCYA 4FFVC 1K4CA 4UDTA 4JZOA 3P0YH 4DOHE 4N5EA 5HYQB 3HFML 4XI5C 3L5XH 5GRVL 4A6YB 1CLOH 2VZOA 3DGCR 4JVWA 2R0ZL 1WVZA 2Z92B 5DRWA 3UTPE 1EFXB 4ONGH 1HH6A 1YEGL 4PLJC 4D0BA 4Z8FL 1OPGL 4JFYB 4LSQL 2P8PB 1DUZA 5C0EA 5GS0L 4QGYA 3TYGH 3EFDH 1DQLL 5D2NE 5T3ZD 4J12A 4N8VB 3BO8A 3VWJD 1QR1A 1FVEB 3D39B 3ULUC 4Z7VE 3HZKA 3HUJE 3P2TA 3EW3B 3KYOA 3HI6H 3T08A 4QHMB 5CD3B 2VZSA 5AEAA 1U2CA 4JRYB 4YFEA 1EHXA 5BV7L 1C8PA 1BJ1J 3S3PA 4PJDB 1FL3A 1AE6L 4NJ9H 5E2VH 5FKPA 3CFIC 2BNRA 1K3IA 5DMGC 2NTSP 2YUZA 1KIRB 1OTTD 2X10A 2Z9TA 5JOFA 1GGIL 4P5MB 4NT6A 1KEGL 3U79A 4S10A 4K9EH 5D1QD 4MA3A 4OLVL 1N6VA 5BV7H 5TF1L 1J1PL 4HKJB 4A2MA 1IMHC 5ECJE 3BKJL 4OZFA 4FQXB 4LKXA 2DQIL 5BCAA 4Z7QE 1GAFH 4XPAH 1U9KA 2DQJL 2DBLH 5IQ9B 2YXMA 3HAEH 3WKNA 5H37G 3QRFM 1EAPB 4I0CC 4OI7A 1RJYB 2R0WL 3OKDB 3H7BA 2GCYB 4KI1A 2X4NB 2J8HA 5HHQA 1JFQH 2X5PA 2EKJA 1L9MA 1A4JB 1FV1B 1NMBL 1TTGA 4JO2H 2VXUL 3I02A 4U7MA 3D85A 4Z0XB 4RGNB 3WIHL 5BRZE 4LVOC 3EJZC 4Y8DC 5FGBC 4JFQB 3O9WC 2EO9A 4L5FH 1ROWA 3U48A 1U42A 3QUZB 4F15B 1JPFB 2YK1L 1AHWA 1TVHB 3DLQR 2ADGA 3OWEA 12E8L 1A3LH 4ZQKA 5EZLB 5DD1L 5E8DH 1BX2B 3ERYA 5KJRL 1ACZA 2ARWA 1NSNL 4HUVA 3UZQA 2M26A 5EC1B 1JF6A 1U8QA 4LP5A 4PJ5D 3V0VB 3SQOH 2EH7H 2QSQA 4O2FA 3W39A 1RJCA 3RY4A 5FDYA 3HMXA 4TSCL 3RIFF 3LS5H 1QSED 5JIPA 4P9HH 2Q76A 1FCGA 4MXQA 2GEEA 1AQKL 1WUNT 4LCWE 1HEZB 1EXUB 3CDYA 1MFDL 2VAAB 2V7HA 4F9PA 1YEJL 1WLHA 2UYLB 4YX2L 3VCLB 1KT2B 5ISZA 4X6FA 3OKKA 1AY1H 3BAEL 3VFMB 3VXPA 1BEYL 1OB1B 4DQOL 3MGTA 3O9WB 3B9DA 1KPUA 1NAKH 1CFQA 1CICC 4X0KA 4MDJB 3VDCA 2AEQH 3GHEH 4JQVC 1BQLL 1H3UA 3K1DA 1CGYA 4JRXD 4KUZL 2X6MA 3D3VA 4W6XB 5T3XH 2APFA 5HHOD 4URTB 3FQNB 5EO9A 1CGWA 2KKQA 2A77L 1TQBB 2Q7YA 4Z0BH 5BO1L 4I13B 1L7TL 4RFEA 2RQ8A 3TJEH 4H25B 5FYKU 4OLYH 3JZ7A 3O4LB 1UCBH 4ZO9A 4ZUVB 3BESR 4OV5B 5E2UH 3ARTA 3QULA 1MLBB 4Y2OA 5KVGL 1UACH 3SE4A 5I1CH 1F4XH 2PCPA 3RWDA 4UIMB 3U9UB 1G7IB 4JFXA 4I77H 4K23L 4FZEH 1AC6A 3NCEB 4PY7A 1HHKB 1TZHB 4XB8A 3BDBA 3QUMH 4IEFB 4LNVA 3LEYH 3LS4H 5AUMA 1P5UA 4BSVA 3MRBB 4NNPL 5DRNB 1BOGB 5IQ7L 5KVGH 5F9WC 4LQFL 4LPTA 1KNOA 5D96B 3LQZB 1KCKA 3RA7L 4JLRA 2V2TB 4QOKE 1OWWA 3PWPA 4PJIF 5CEXB 1S5HB 4IIQA 1LP9E 5FA4A 1N7ML 4H8WL 2B1HH 4YPGB 4JR9L 2VLJB 4LLYB 1IL1B 3O3EB 1ORQA 3HNVH 5EU3A 1P7KB 3QPXH 5M7QA 1ZV5A 1IE5A 3EYQD 3JWNC 5BZDA 4PUBH 4N0CA 2QEJA 4TUJB 1MJ7L 4PS4H 4TRPH 5F1NB 2CIIB 5E8NB 3SGJA 3RA7H 3VRJB 4YQXH 2O5XL 4NWTL 4S1QL 4IRZH 4QHKJ 5GSRA 4PJHA 2CIKA 5IEKB 4A6YL 1MCOL 4KKCD 1I3RB 1T21A 1CXFA 3C6LA 1SJXA 1HE7A 1DQDL 4XHJC 3QH3A 3MRCA 2R15A 4FQHB 3FB5A 2ICCA 5DD3H 3V6ZA 2HT2C 2Z93A 4EI5D 4P59L 5DZOA 3F7YB 3BGAA 1JZ2A 1MCOH 4FTVE 3AMKA 2C3WA 4KJQD 2CJUH 2DWDA 1I9EA 3GSNB 3WKMH 5IVNA 3WN5B 3SCMC 5L8JB 3B2VH 5F3BA 3U36B 2MHAA 3IFOB 2JJUA 1JTOA 4D8PB 1DZBA 4QEGA 5FKAB 1EGJH 2CLRB 4P3WA 3IVKB 2L4OA 3EYOA 4PR5A 3OKNB 3V4PH 5TGBA 4M7LL 4XHQA 1A7OH 1BZ9A 1S7TA 3UPCA 3G6JB 4PRHA 5F7UA 3KPRD 4K7FB 1SM3H 4JFDA 4NQDD 5EU6D 1KUMA 3T0VA 1HCVA 4KDWA 4MD0B 5F7EH 1AI1H 3V5KB 4NC1E 4DTGL 4EVNB 1UZ6E 1U3HA 2OCFD 4FQLH 4XPHH 3IXAA 1Q1JL 1UH2A 3KJ6L 3NPSC 4AG4H 4FQ2L 1I85A 2W9EH 2NZ9D 2EDBA 5IOPB 3GUTB 3X3FH 4PB0L 3ULVH 1Z9OA 3AS0A 4UV7H 3W81A 3X3GL 2FSEA 5JW4N 5JOEA 4X99B 3QIWC 5C2BH 4XP6L 1DVFB 5E0QA 3ARSA 4KPHH 3SCMB 5E9DE 1JZ5A 1Q1JH 1GGBL 4JB9H 1EJ6A 3SDAA 1FFRA 3MUY1 4R4FH 3RTQD 4PJ9D 5CBAB 4OLZH 3GBNH 1V7MH 3CIQA 3MLUL 4L29B 3RWIB 3SKOB 2D7QA 4MSWB 4D9LH 1NC4B 1N4XH 2EDTA 6FABL 1ZWIA 5I73B 1F6AB 5ERWB 5BJTA 4ZXBD 1T7ZA 5C0GA 1RJLB 1MH5A 2XTJB 2H45A 1QRKA 4PFEA 1J87A 2EDJA 2P5ED 4RAUA 3SOBH 1NGXA 2RHEA 2CLVA 4OJFH 4Q9CA 3QAZC 5HGDB 2AP2A 1IC5L 2OZ4L 1T6VN 3TZVC 3VH8B 1UKSA 3DX9A 5L8KB 1S9WA 4EDWL 5BXFA 1YEHL 3G5VB 5F1KC 3P4OB 4BH7A 3G6AB 4U0RB 1LEGA 1NH6A 1RZJC 5D6CA 3QIWB 2YPVL 2RAMA 1ZGLP 5B8CC 3O6KL 2BNUA 3FN3A 3GKWH 4HMDA 1I8KA 4HUUA 2V7NA 3LN4B 1P84J 2HH0L 1WIPA 3MJ7A 2IH1B 5E94B 1TVBB 4U4BA 2Q87A 4DVRL 3H9HB 5JHLL 4ODBD 3KR3L 1YPZE 1A7QL 1PKQA 3MRNB 4F2MB 5MI0C 4UOW0 3GSOB 3L9RA 1T89C 3SKUD 4GAJL 5GS2H 4XWGH 5SWSD 3QAZB 3QUXA 3U46A 4W6YB 5FO9A 3MROA 5GHWL 4DVRH 5ESVA 1XGTA 3NCJL 3TIDB 3W0WE 3S35X 1R3JA 4LCYB 1ZT7B 1Q9OB 1MCRA 3ZT7A 3M17A 5B8CB 4ONOA 3G6DL 5IB5A 5GGUB 1J5OH 4L4VB 2C1PB 3ET9F 5HDQL 5FK9A 4S1DD 3CC5B 5CILH 5DMKA 4OFPA 2YD6A 4MQXC 1E6JH 3VRLF 4M03A 2FX7H 3U1SL 5BVJB 2DLHA 1K5NA 5C0BA 5A2FA 5D7IB 3O4OB 4M62L 3RIAF 2QL1A 1JE6A 2A0LD 3DX7A 1TPXB 3ARDC 2I60H 4YGVB 2R23B 5LXGL 5IW3A 5EPMA 1F4YH 3T4YA 2BXZA 4YE4H 4Y4FD 5DTFA 4QRUB 5MI0B 3FRUB 1YUHA 1HHGA 3MV7B 3LKSB 4ZUTA 4S1RH 5ICXB 2MQ3A 1T1ZB 5I1KL 3O0RH 2IPKB 2B2XH 2AK1H 2MQCA 2AK4B 1C1EL 2J6EA 1LEKB 1BIHA 1HH9A 4JDZA 4WEBL 5C08A 5DJXB 2ZKHL 2FL5B 3MBXL 4M93B 3HNSH 1RULH 4XCEA 3IFPA 4ODHL 4X4ZA 2DMKA 2GSGA 2WV3A 3OR6B 3VXSD 2W92A 2FZ3A 1C1EH 2QKIB 1QLFB 2CDEA 4PGDB 4XAWH 4Z7NF 4LOUD 4PGBB 1G7MA 5C6TL 3HB3C 1JZ8A 1NKRA 3GSNL 1NC2B 4KVCL 5I8EB 1P1ZA 4P23C 3IT8D 1UM4H 1CLYH 2ZCKL 2I9TA 1UH4A 4Y19A 3GNML 1I9IL 2E9BA 3RVTC 43C9B 1F3RB 2IADA 2Y36H 4OCSH 2VERN 5D5MF 4DVBB 3W9DB 4M4RA 1FZJA 3DXAB 5F3HA 4ZPVB 2Q8BL 2EECA 4HUXA 1AGDA 3RUGB 1WFTA 4YNYB 2QHRL 1U91A 3T0DA 5HYSB 1QNZL 5A40E 3HE7D 2PUQT 4U1KA 3GSXB 3V4VL 4DKAA 5IFHL 4M1DL 1DL7L 3DOSA 1YNKL 2XWTA 4X98A 2DTMH 1VFAA 4Y4KB 1VFBB 4NO2B 3U6RA 1CFVL 4X7EC 3R4DA 3ARGD 4NKMA 3L3GA 2ED9A 1Z3GH 4YWGH 5DDHB 1E27A 4J3TA 1JYNA 4YDIH 2EDLA 3DHMA 2GQHA 2KQMA 4PJFB 1UA6H 1KSRA 1JGUL 1U41A 2AGJL 3BH9B 3V8OA 3FKUS 4WY7L 4DK6A 2EXWD 4KMTL 1TQCC 4I9WD 3TH4T 1YN7A 1VGKA 4XTRC 5KSBE 3UPRB 5IWLA 1G9EA 3FB8A 3OF6A 4ZOEA 5BRZD 5B3JF 2W65B 4WFHD 2DOCA 4RX4A 1MFBL 5EA0L 4P2YA 5IF0B 2NYYC 5CEZH 1GZQB 3H3PL 3SE3C 3SKNA 4IDJH 2F53E 2AJYH 1V7NL 4H0IA 3NFNA 1D9KD 1IC4H 1IM3A 3HZVB 3TVMD 1EX0A 3TT1H 4MJIE 3ZKQD 5CJBA 4N9OB 4HUKB 5D9SA 5HI5D 1IFHH 1C5CH 1FNSL 1DBBH 1IM9A 3NACL 4LASL 5FM5O 2NY1C 3VFGH 3MRDB 3OR7A 2NR6D 1U8PA 3DETC 3BIKB 5HHME 1KCUH 2OTUB 1DBAH 3BX7C 4PRDB 4X83A 3VGAC 1JNHA 3EGSB 4KZDH 4JREC 5DJ2A 4JFPA 5J3HD 3BP6B 4HBCH 5JHDA 1BQHA 4I3GA 1TQCB 2V5SA 1U8KB 3CFKA 1GPOH 2X9XA 4JM2A 1HXYA 1U92A 3JXAA 3T2NH 1QZ1A 5C09B 3RNKA 2NY7L 1DEEA 2JIXB 3UAJD 1D6EB 5H94B 2Q8AL 4XNQA 5I1LA 2P5WA 3QNZB 2CDFB 5F7FA 1BM3H 1JRHI 3QWRD 2FEDD 1T1WA 3QXTA 5T1LD 5J8OA 3U7AA 1WT5C 3S37X 3O2WL 5IBLC 1E4KC 2GJJA 3PGCA 2H6PA 3U83A 1I75A 4JFFE 4FFYL 4AEHH 3KPTA 1RIVL 5FCUL 5F21B 3WFCL 4KGJA 4ORGA 3MRJB 5MENA 1AGBB 1LO0L 4LLVA 3SDDA 1CL7I 3KXFE 5EN2B 4O2CB 2R2CA 3NCMA 2G60H 5A43C 3AY4A 4JREB 2GK0B 2YD7A 3ARVA 4XH2B 1NBZA 2X70B 3IDXH 3ILPB 3RVWC 4HKZA 5I30H 3HC0A 1RK1B 4YO0A 3ALWA 3FB6B 3S37H 1N59A 1JPGA 4DN3L 3OKYA 1SYVA 1GGTA 3MXVL 2BY2A 4HEPG 1UB6B 4JANB 1K3ZA 4WTZA 1FYTD 1J0IA 1RFDH 1PG7L 3P4LA 4GS7C 3HPLA 3FJTA 5B38A 2YD3A 3BRGC 4HLZH 5IG7B 3MJ6A 4X7DC 2VH5L 8FABB 1WICA 3MLXH 4XMKL 5D2NA 1G7HB 4KDVA 1QSFD 3LPWA 4AEIL 5J1AB 3EOYG 1B4RA 5I1IH 2BSRA 4XPFL 4Z7VA 1FDLL 4QF1A 2UVEA 4LVNC 7FABH 3KLAB 2BOCA 4EOWL 2PYEB 4D9RE 4DKEH 3P11H 5I1HH 1E4XL 4EI6A 1GOGA 3IJSA 1F3DH 3HNTH 4NQCE 2CUHA 3LB6C 5HVHB 4L3CB 2R2HB 4RRPG 3V0AC 2F58L 4U6HA 3EBAA 5B4MD 1XF1A 2VDLH 3IRZA 3K80A 4J4PC 1U3JA 3UJJL 4QLRA 1EUTA 1BWMA 3K2MC 1FVCA 4UDUB 3C60A 4N8CH 4EOWH 1IAII 4UT7L 5TDPA 4MA1C 4IM8A 3L6FA 3MLTA 4I2XE 3C09C 1JNLL 2OBGA 3O6MH 1QHPA 3BDYL 3CZFB 3OKEB 1C12A 3K46A 4ZFOB 5DR5L 4M1GH 1MJ8L 1XCQB 2APBA 2NTFB 2Y5EA 5F9AC 4M1CC 3MQIA 5DJ8B 1TNMA 3UTTB 3NTCH 2XZCL 1T1XA 2FWOB 1AGEB 1ULVA 5DA0B 4QRSB 3IDNB 1IGML 2LU4A 3CH8A 4M8QA 3FB7B 5CS7A 3NH7L 2EIBA 3TYFB 5IFJB 4FTVD 3INUL 1QOKA 1XGYL 5KSVA 4PJHF 4ZUWB 1CN4A 3JWDC 2DIBA 4RSVA 5C6PB 2GJ6B 2E9WA 5C0CB 3E2HB 1JFMA 2VLLA 3UP1A 4RWHA 4C83B 1D5XA 3MRLA 4NZDA 3T04D 1QG3A 3WMSA 1FBIH 1T83A 4KVNH 3NZHH 3QCTL 5I9QB 2FB4H 1M4KA 1CE1L 4V3DB 3HG1D 3HI5L 1Q0YL 3V0WL 4HLZG 1QO3B 5C0RH 1WZKA 5ENWB 1M05B 1WZLA 3OXSA 4I5BB 3NIDF 2VDOH 3VWJB 3NGBC 5I75C 5CIPA 1ZT4A 3KWWA 1FAIL 4G9DB 5I1DA 1ZHBA 3UTOA 2DLFH 5TQ2L 2P7TB 3IFLH 3BQUA 5EZJB 5FDWA 2YMXL 3BMVA 4QRPE 1P53A 3VWKA 3SBWC 4EN3C 4NJAL 3QNYA 4GW5B 4D9QD 2A73A 2ITDB 4G8GA 3BPNB 3V4UL 1MFCL 5IJVA 5HHVH 4Z7UB 4ZFZB 4NCC2 4NKDA 4UINH 2OL3L 5E9DD 3QHZL 5D1QB 3RWFA 3OKMB 1A5FH 4WDIA 3NIGE 2VLRA 2ZSWB 4Q9QH 1MY7A 3QI9C 3CX2A 2JCCA 5IEHB 1I1AA 3E6FA 4ONFH 4FFZL 4P57A 3P0VH 4C4KO 1YJDL 1MVUB 5BS0A 1A7NH 2MCPH 5L0QB 2ICEA 25C8L 3FL7A 5HYJD 4LCCB 3RDTC 3BUTA 3NGBB 5I2IA 2Q1EA 1MCBA 1MJUH 4PD4K 2IGFL 2D03L 1IBGH 3MMEA 4M7ZB 4O4YH 3O41B 4HKBB 4WUUE 3G04B 2R39A 4N5ED 2R2BA 4OQTL 4OB5H 4X5WB 5TH2B 3A67L 3HLAB 1XF5A 1NCWH 5K9JL 2IPTL 2HLFD 2MTPA 4N0UB 5GS3A 4X9IA 3MRKA 3L3HA 3WIHA 3WHE1 2FATL 2WY3A 4PRID 1NMAH 1FNLA 1PBYA 3RPIB 5SWQB 3G9AB 1MHEA 2J2ZA 3RX7A 4P5TC 4OQTH 5HYSG 1CLZL 4YDKL 4Y88A 3IS1X 4JZJA 4PJBB 1RIHH 4CU6A 1CGSL 4I0PA 5DK2B 5A2KH 1QSEB 3VRIB 1SMOA 2XXCB 4BUHA 3GB7B 4Z78A 5D7KE 2YBRA 1FFPA 4IRSA 5C07E 4YAQB 3HA0A 3BEWA 4Y2DC 3MUGA 1XGUB 1CQKA 1K4DB 2IBZY 1PY9A 2HFGL 1BECA 1YA5A 4PG2A 2J7LA 5EUKA 1PKOA 2FECL 4NN5B 4NN6B 2DD8L 4QRTB 2V5RA 2F8VA 1RUML 4HZLB 3V7AE 4NN7B 3KNBA 1S8DB 4YHZL 4JRXB 4P2OD 1S9YB 1KN4L 1MIMH 2AS5M 4NRYA 3OAZH 5HHOB 3TLRA 4LLAA 43CAB 4CUCA 3F6LA 1ZLSH 1JTPA 1YMHA 1AIFA 1FNEA 2WP3T 2HP4A 3BPOC 3D85D 4ODXB 3D18A 1RVFH 3OGCA 4PYHA 3EHBD 4RMWA 4YHNA 1Q0XL 3KPPB 3TNMA 1CVSC 3MFFA 3P9MB 2VDPL 3LKQB 3ROLA 1DQQA 2VXVL 5FHBL 3DSFH 3QQ4B 3HI1A 3GMNB 3SDXA 1U8JB 2NY6C 3MA9L 5LWYH 4MD4B 1NBVH 2OMBA 3ARED 1AGFA 1ODAA 2PKDA 1NFKA 4GKNA 4HAFA 1LMKA 1P5VA 3BSZL 4KI5E 1VADB 3BYYA 5JPMB 4OT1H 1FZOA 4HXAH 4PJAB 3QG6A 1JGLL 4JPVH 5CEYA 4LPXA 4MNQE 4ZFOL 1YDPB 1NLBL 5HPOA 5J56B 2ADFL 1A9EA 1MF2H 3ILQD 4K55A 5I8CB 3QG7L 3UTQA 2MNUA 4PJ8A 4R7NA 5GRWA 3QDMD 2EIZA 3MRGB 2XPGB 4LBEB 1Z9MA 5FO7A 3RZCD 3BXNA 2A83A 1TZGL 2CK0H 3VFPB 3WFDL 4PJXE 4ZYKA 5DT1L 1FL5A 5CCKH 3SO3B 2YZ8A 4LDEB 1CTNA 4Y5VC 5DZLA 4CVZA 2I9LB 4OF8A 4R7DB 4MAYD 4GAGL 3VFUA 3S4SB 5I1JH 5L88H 2H3NA 5GS1A 2NY6B 4LNRB 3TN0B 4O58L 1FFNA 1A02N 5E6IC 1YN6A 4XC1H 1HZHL 2BVPA 2X4RA 2Z4QA 1KYOK 4K7PX 1YC8A 2YN5A 3TH3T 4WWKC 3D48R 3CVIH 4G8EB 4QRQA 3ORJA 5IKCA 3ULVC 2DQEL 1QRNA 1Q72L 1X5GA 5D7SH 5A16B 2VE6B 3C2AL 2WP3O 2MKWA 3KAAA 4OAWB 4UQ3A 4KZEL 3UCRA 1TJHL 4KKLD 4UU9A 5T3ZH 1AD9B 4MX7B 3BKML 4F9LA 3JWDL 2Y5TB 5DHVH 4NQDB 4UMGA 5EU6B 1BFSA 4WO4B 5EO1A 1R5VB 1WTGT 2XNAB 3U7WL 1ADQA 5KVDH 4POYA 5EZIH 5DFWH 4GUPB 4TTDC 5D71H 3RVXC 3QBTB 1X44A 3KG5A 3K3QA 3D2UA 5L2JA 4LL9A 1UEYA 3C8KA 1FAKT 4WWKB 1OGTB 4WUKL 3G9VA 3MCKB 1NGYA 3QRGL 5ILTL 2LV4A 1SHMA 2UWEB 4I18B 1ZSDA 1R5WA 2X1XR 3GHBL 1MRCH 2AABL 5TE4H 1A1NB 5E4IA 4YHMH 4F7TA 3RNQB 5HHMD 4OCXL 4JG1L 1EK3A 4U6YB 3RTQB 4OZIB 2VQ1A 4PJ9B 2Y6SD 2PW2A 3WXVH 4Q6IB 5J1SC 1N6QH 3W0WA 4ZFGL 1QPXA 4YDJB 3VXUD 1T5WB 3VFOA 2LU7A 1NCCL 2AV1B 4ZXBB 5EBLA 4CMMA 4Z7WE 1TTFA 1NGQL 4GG8B 1IEBB 4O00A 3NABH 3VFVA 3CSBA 4J7RA 1KIPA 4YHPA 4OF7A 2P5EB 3SEPA 5ACZB 4RGOL 1WAAE 1T0MA 5IIEA 2P44B 4MLSA 3RWEA 1X5FA 2HG5A 3K4AA 2A6DA 4GKZB 5DD0L 3H9SD 1YQVL 2ZG1A 3L1OL 5IB1B 1B6UA 2H9GB 1M71A 2XQBL 4HWBA 3T0EE 1AXIB 3P77A 4X5XA 2EYTA 4PRHD 4LU5H 5F8QC 1TJIH 1NGQH 1M7IA 2AEIT 3CSYB 5DO2C 2JLLA 5AYUL 3TEUA 4G6ML 4D0DB 4JM2F 3AAZA 4R97C 2DQHH 1XIWD 2YD9A 5D1ZC 2F54B 4MCYA 2NX5D 4XMLL 3JSSA 4XX1G 1UXWA 4FG6C 1XF3A 4OFYD 3SDCC 5LAXB 3LQAH 3C5JA 4AEFA 3MGAA 1FNFA 4LSRH 3PWUB 3QA3A 1TTUA 4U1HB 5GRJL 4GXVL 5ICYA 2RR3A 2ZUUA 5GSVB 4KHTH 2ARJA 4Q9RL 3MYJA 1HI6A 4F57L 3CSGA 4X6DB 4LSVL 3U0TA 3IRPX 2X09A 3Q6FA 3GM8A 2Q7NA 1WFUA 2GSIA 2ZUTA 5EFIB 3V79C 3FONB 5F7YC 2WBJC 3V52H 5EC2B 2UY6A 2VLME 3RY5A 3P73A 3F12B 3C87A 2D7TL 32C2B 3REVA 3FFCD 4Y4HC 1GZPA 4MB3A 5IMLB 4MVBD 4HX1B 4QRRE 1INEL 1IC7L 3DUUB 2SEBB 5DUBA 5EOTB 5T33H 3SKMA 4AMKH 4AH2A 1OL0A 4HV8B 1JMZA 2X4QA 1RU9L 2EDQA 5ETUA 2HVJB 4CL7A 5FECA 3LRGA 1UXSA 1KB5B 3CFEA 5BZWB 1RZFL 4IHOB 1IGJA 3GMMB 4DZBA 4IDLA 5MEOB 1UB5B 1BFVL 4Z7VF 4JGMA 3F5WA 3HR5A 3DHJA 5LGHH 3VXMD 5HXMA 1E6OH 2D0GA 5D70H 3SQBA 4YBQC 4JQVA 4PB9H 4LEOA 1N6UA 1WFNA 5IHZB 4QXUH 1B0RB 1FJ1B 1UJ3A 4BSJA 4R96A 1HSAA 1QFOA 1A47A 3RZWA 1IEAB 2CRMA 3S96B 3TBTA 5ID0A 4M6NL 1S3KL 3WUZA 2ATPB 5TE6L 1PSKH 3FO2B 4IRJD 1RZKC 2X4UB 4PTUA 5KSBA 2JK5A 1TZIB 1S9KC 1DSFL 3LH2L 2OR8A 4TPRH 3QHFL 4JRWA 2CLZB 5I76B 1FLRL 1I8LC 4Z7QF 2F53A 4LIQH 2VITA 4L9LC 5FUOH 3VXSB 5EZOL 3ZE1E 2EZ0D 4RGMC 5JIKA 3V5HB 4ETQB 4MJIA 1VKXB 1FO0A 5DD6B 5E00A 4AZ8A 1B2WL 1PLGH 1YEEL 2P47B 2BSSA 3LD8C 4JAMA 3PJSA 2ZG2A 1CCZA 3JVGC 1HYSD 3TA3C 2X40A 1X3DA 5T3XE 3ZDXE 1NEZB 4JO1H 4KJPC 3LMJL 5T5NG 5EZOH 2YPLE 1MHCB 4XCNB 3J8F7 4G80A 4ZDHB 4BH8A 1S5IH 1F6FB 2GHWB 2V9QA 1BVZA 4U6TA 3JWOL 2R1YA 2PO6C 5KG9B 5C0BD 4PRPB 5FOBA 1S7QA 4OFKA 1R3IH 4H5SB 4G43A 5HTSA 3VD7A 4YUEH 5IW6B 3OAZK 3ARGB 2DQTL 1CGTA 1LWRA 3UPAA 4JFZH 3D69B 2GT9B 2WWKT 4ZMAT 4L3EA 5LGJB 3OGOE 4L9LB 4GRWB 2HT4C 4JO3L 3QDJE 1UYWH 3JWOH 1YEIL 3QWOA 1KN2L 3MGOB 2RBLA 4JFFA 2ATKA 2NY5H 1YEDB 5IV2B 1L6XA 5GGVL 5DJDB 1HINL 5C08D 1JN6B 2OTWB 1MNUH 3TA3B 5GGQH 3VG0L 1IAKB 3TV3H 4V1DA 4HIXH 1QFHA 2OYPA 5SX5H 1MHPH 3KXFA 1S7VB 2ZUVA 5DK3A 5C0AD 4TSBH 3MJ9H 2O5ZL 4HWEH 2VDKL 2JCCF 1JWMA 1T2QL 2XT1B 2YA2A 1OW0C 1EVUA 2BSTB 4OKVB 5CBEA 4F7MB 4YDVB 1KN2H 4CRPA 5DC4B 3CMOL 2W91A 1U8OB 1YY8A 3O6FD 1D9KB 1MAMH 1CD9B 1LDPL 4GLRH 3TVMB 2J8UE 4HUNB 2ZUSA 2KBGA 3GMQA 2EYRB 3QXDB 5EBWB 4NNYA 4JHWL 1GL4B 1SY6H 4WTXA 4FP8L 1YQ2A 2C3VB 4G8IB 1HSBB 4NOFA 3AS3A 1UGNA 1H3PH 2AJSL 4RFOH 5H35B 5F89B 3O3AB 4ZSOE 3MRMA 3MJ8B 1FSKC 4JM4L 4RAVB 4C56D 3TBWB 1BD2D 5ADOL 4IMLA 1XCTB 3GSRA 2F5AL 2FYYB 5D7KD 3QYCA 5JOPE 3EDDA 3MA7B 3DVNA 2GIYA 4I3RL 4NQCA 2BMKB 2AEWA 5F6IB 2I5YH 2VC2L 4GRLB 1IGIH 1IGTA 2DL2A 4Y16D 3C5ZC 3DUHA 3D39E 3DBXA 4G7YL 2B39A 3UC0H 1MFAH 3NN8B 1Z0MA 3S3SA 1U95B 1JYXA 2MFNA 3PDDA 1BP3B 4DEPC 1MFEH 3OZ9H 4I2XA 4JRYE 2ZOKB 4K3DL 2HVKA 5LQBL 1RZ7H 5DYOA 1LP9F 1QEWB 1JPST 2YRZA 4PJDE 5DURD 5KS9A 1Q38A 5HHPB 4G42B 1UVQA 3DMMA 3FN0H 4HS6B 5B3NA 5DLMH 5IBTH 2FJHA 5DVNA 4NZUH 4YHYC 4YIQB 4GBXA 2BVQB 4NOBA 1X5ZA 2OP4L 2VLKD 3DX6A 2KPNA 5B39B 3O45A 4XRCA 1WZ1H 3QUYA 4KROC 4K3DH 1JF1B 3QXUA 5FV1L 1XGRB 3L3OB 2XN9A 3TZVA 1QFPA 3U82B 4APQC 4ZS6C 5BVPL 2DN7A 1GC1H 1AGCB 1A14L 1FNHA 4P4KC 4LMQE 1LQSR 3EYUL 4ODUA 3ZSTA 3FN9A 3CFDA 1ONQA 1CFTA 5F9JB 1FYTB 1UM6H 2VISA 1HQRB 5CP7B 2PNDA 3ZE2F 4OLUH 4HC1A 4QWWC 4YZFE 3STZB 5E2WH 2ITCB 5AZ2L 1Q9LA 4XT1C 4NKIL 4TSAL 1S7XA 3KPQB 1MCEA 1QSFB 4L8CA 4O2EA 4E42A 1V3KA 1LK2B 3O2DA 4OTXL 5HGBB 1MQ8A 4RGNE 4D94A 3MRFA 3UTSA 1I1RA 2R1WA 5FYKL 4MZ3A 3SDXF 1KB5H 1CDCA 3ARBD 4PBWD 1PYWA 5C7XL 3S35L 5MHSD 3I6KA 3FQXB 5EOCH 2HTLC 2CGRL 1P2CB 4FQPA 4GG6B 4F8TA 4YHYB 1S78C 2NY3D 1F45A 3VFRA 1W0WB 2A38A 1NCNA 4PGEA 3DJ9A 3LHPL 4XMPH 2YA1A 5F88A 3BOVA 5JO5A 4QHKI 5CZXC 1T5XB 2QR0B 1JGDB 1I1FA 4GAYA 4M5ZL 1G7QA 3TJHD 4APQB 2AXJA 1UZ6F 3OTTA 3MUJA 4P4KB 5C0JA 3UJTH 1Y18B 5GRUH 1IGCL 2X7LA 4ZNEE 1G9MH 5A2JH 4DUWA 1N8ZB 4XBGB 4LQ1A 2Z91A 2F19L 1NLDL 2MMXA 2YN3A 1DQJA 3L3JA 1B0GA 4F80A 3JV4A 4GQ9H 4HCRA 4QHNB 3PGFH 4LP4A 3IGAA 1DBMH 3SN6N 3U4BH 4J3VA 4YHIB 1WC7A 1KTRL 3OJDA 1ZTXL 1EUUA 4HG4K 1LEIB 3HE6A 3QT2A 4UILH 1ZVYA 1P6AB 5E4EB 4BKLB 1D3CA 1DLHA 1OCWL 1U8LB 2GKIA 5F9OH 4G9FB 4UT9L 3U2SB 4DKDC 3P9LB 1KLGA 4OKDA 3RGVD 3ARDA 1C08A 1NMCB 2B1AH 3T3ME 3D25A 3IDJA 1HHHB 4MD5A 3A6BL 5D8JL 1RZKL 2ERJC 4XZUA 1ZVSA 3HG1B 4TVSa 2EEDA 4U1NA 2ADJA 1AXTH 1SQ2N 5I8OH 1ZEAH 3OAUH 4UAOC 3DRTA 4J1UA 1TETL 3G08A 4IOFD 1HKLH 3RI5K 5ITFB 1H0DA 3O4LE 4LHUD 4BZ2L 3IU3B 4ONHB 3SKJH 1NGPH 5FHAL 5JDSA 2VIRB 3I85A 1AR1C 1DLFH 1F00I 1U8NB 3LN5B 4M6ML 3ARFA 2BVOB 1GGCH 1Z9SA 4M43H 2V9TA 1SJHA 2NXYC 1T22A 2O5YH 4F58H 2YRLA 1RMFH 1T03L 1IAOA 3QQNA 5C07A 1U8MA 1CIUA 4M02A 4OD3L 2FJFB 1B0WA 4YHLL 4GRWH 1DJSA 2VDML 2BOBA 1ZA6B 3E8UH 4HF5H 1J88A 2VR9A 4POZD 2PYFA 4KV5E 4O9HL 1T2XA 5JORB 4LF3B 4FNLL 5DS8B 5JXAH 5I15H 1DQML 3PL6A 5CZVH 1N0XH 4ESKA 1T7VA 1AH1A 1T6WA 3VJ6A 5FUZH 5TQ0H 3QIBB 4NBXB 5D6DA 2NY0C 1AO7D 2VLJE 3B2UC 4Y8AA 5HYJB 3Q6GL 3ZKNC 1J11A 2LU3A 5I16B 2AJVL 1UH3A 5D7JC 4PJ7B 5HI3D 2VXSL 3I50L 3W2DL 5D5MB 5ICZB 3B9VA 4XCYB 1A7RL 5JA8B 3MOQA 3ULSA 1K4CB 4UDTB 1QACA 2AERT 1QBLL 4JZOB 1MEXH 3GMPA 3ULUF 4LAJH 4WHTB 1FFOA 1SBSH 4R3SA 5F8RC 1ORSB 3O11A 4RWYL 2CKNA 4U1GC 3CFJA 2LABA 2NY4D 1MIEL 4N1HB 5C0EB 1DUZB 1QLEH 3L7FA 4NZTL 4XNYH 2FBJL 3BO8B 1NEZG 2XKUA 4N5UA 4MS8A 3C6SA 3TPUA 4PRIB 4HS8L 3D9AH 3I3BA 2IG2L 2ID5A 5CJQH 1L0YA 1YNTA 4WFGE 3ZHDA 3TWCL 3OXRA 3KYOB 3L3IA 1BFOA 2WZPD 5CSBA 3BP7B 1D5IL 2P24B 5D2LB 2Q6WA 5GS0D 1JJUA 3BQUD 3QXAB 4MNQA 3BP5A 3I75A 1EHLH 2BNRB 2OS7A 4G8GD 1ZLVH 1AHWC 1WBZA 3N85L 4OZGA 3BKYL 4NT6B 5DJCA 3KPLA 4PP1D 3A0OA 3TC9A 4MA3B 4FQJH 2CO6B 3X12A 3G6JE 2VLRD 2X89A 2H32B 2VMFA 5I71B 4PJXA 5L9DL 1A0QH 3O8XC 4NO0D 5IB3B 4OZFB 4LKXB 4OM1L 4ELKA 2VLMD 4NO5B 2B4CH 4MJ6A 4NFDA 4L8BA 2J3SA 4TQEH 2GI7A 4Y1AD 5EULV 5BS0D 4BSWA 4MXQC 2Y4SA 3H7BB 2OXGA 4WENB 3ZYOA 2OQJA 4P3DA 5HY9A 5J12B 5HHQB 3MLWH 4MA8L 4LLMA 2HKFL 5KOVC 4NUJB 3KGRA 4F9PC 5CWSB 3MUZ1 3QUKA 5DJAA 2BHUA 1W72B 3GMRA 3I02B 3D85B 1KXTB 1JCKA 3IDGA 4LLUA 4RAHA 2VQUA 2PW1A 1DE4A 2AI0L 3NCCB 3O2VL 4LARH 5K9OA 1PX4A 4HGMA 4MMZC 5E2TL 1YMMA 3H42H 4LPUA 3GO1L 3WUWA 4X6EA 5SX5K 4N0RA 1E4KA 4L4TD 3W5MA 3AREB 2BNQD 2X1WL 5C0NC 1U8QB 3IDYC 3IAGC 3KYKH 4E5XA 1BAFH 2EXYD 4O2FB 3W39B 2Y07L 2XTJE 1N64L 2XY2A 4OLXL 4GXUM 4E0RA 2ZPKL 2A6IA