5HGHA

Hla*a2402 complexed with hiv nef138 10mer epitope
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hghA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hghA01
4QO1A 3MRKB 2FJGB 4UTAL 1G7IA 1SQ2N 4TN9A 5I74C 3BW9A 4OUUA 4FXKA 4XP1L 4GW4A 3QIBA 3R8BB 5E5MA 4KDTC 4NKMA 3JV4A 3LPFA 4XPHH 1T89A 3B4NA 3K2UH 2QADB 2W59A 5EU3A 5AEAA 3RU8H 1SY6A 4OIIH 5EA0L 5BS0D 2EE3A 3ARDA 5DFVD 3WNKA 4N0CD 2X70A 5F96L 5FYJH 4K23L 4QF1B 3BN9D 1ORQA 1X5ZA 2DYPA 2BVQA 3PHQA 5IHBA 4R0LC 3OAZH 3ARZA 3UTTA 2DQUL 1TJGH 2IBBA 4M48L 3VFOB 2RCSH 4N0CA 1NLBL 3NCJL 5IBLC 3VWKA 4PRPD 1F4WL 1Q94A 5E2VH 2F5AL 4KMTL 4L3EB 1CFTB 2VLRE 3AREB 4YHLL 5JW3H 2IANB 3CU7A 1N5YL 4JVWA 4HW6A 2XN9E 1X5XA 3TF7A 3QXWA 3PHOB 4GG6E 3QEUA 4NRZB 3RWDB 2HWZH 1F58L 2OBGA 3QXAB 1MCLA 1LO0H 2L7JA 2IAMD 32C2A 1RZFH 3N1MC 3QCTL 1XCQA 3JTSB 2VXQH 3O2VL 3WSQH 4JFXA 4K3JL 4GKSA 1YC8A 5DD6B 1ZEAL 2J8OA 2OSLA 1ACZA 3O6FD 3ZKMC 3FB7A 2Z93A 3KYMB 2V17L 1A1MB 3SDDA 5ALBH 1XGYH 2UWEA 4N90D 5IHUL 3H8NA 3ROOA 1XF4A 3L3JA 5EZIH 5TE6L 2RGSA 5C0FA 1NAKL 3FN3A 4XCNA 2V2TA 4JRYE 5IROC 4UOW1 4WO4C 1Z0MA 3GI9H 1Y6KR 4PJ5B 3ZKQD 4HBCL 1CGWA 1G7IB 3O45B 4N0UA 5D72H 5KSVA 2Z8RA 3MRBA 2G75A 3Q2CA 1T66C 2IALB 4MAUH 3MRRB 3VFPA 3KYOB 4OFYD 3B8YA 3W2DH 3V95A 5B39A 1D5ZA 5E2WH 4L4VA 4FQQB 5IBLD 1WF5A 1PZ5A 3NIDF 1WFUA 2YZ1A 3NFSL 4R3SB 4RCAA 2XRAL 3C60B 3RX8A 5T5NG 2AJZA 2ZWLT 3PIQB 2GI7A 3CXHJ 2P24B 4I2XE 3WKNA 1T7VA 1CE6A 3QNXB 2BNRE 4WGWB 1YEHL 4WW2C 4NRXB 3DMMB 2HN7A 3A67L 4G7VL 1L0QA 3ZHLA 1EO8L 3GMLA 4LCUB 2HJLA 3KR3H 1JUFA 4XRCA 3SDAD 5JR1L 1KPUB 3VG0L 2HLAA 2XTJE 3MV9A 4PJ5D 2EYSA 1J1PL 5GGSY 2XKNA 1WQVT 1KJ3L 4AYFA 4XCYB 3MRIA 1RUPH 4LLUB 3BT2H 4OSUL 4Z7WE 3I3DA 2NY5C 4MZ3A 4QYOA 3OB0H 5T1KB 1FPTH 4M1GH 4YDKL 1LILA 2QSVA 3UTTD 1KJMA 5AWNL 4WJ5A 3CC5B 4F15B 2BHYA 3WIIL 1QRNE 4PRPA 4R4ND 5DHVH 3O6FB 1KN2L 4ZXBA 4PJ7A 4XNMA 5EOTA 3U4BL 4WCYH 4XXDB 2DQCH 3UBXI 3U7AA 1ZT7A 4TVPE 4U1LA 1N0XH 1OTTC 1NUDA 4MJ5A 3HPJA 2WY3A 4ZXBD 3MYJB 4KGLA 4KFZC 3GKWH 1IGMH 5DURB 1AFVL 2XY2A 5E8NA 4XBGB 5L2JB 2ICEB 4KTEH 4XXDA 5JW4N 3GO1L 2EYTB 2DICA 1T4KB 1P4LB 3V5DA 1CXHA 1JPTL 5I1IL 1BWWA 3M1BB 3QNZA 3UAJD 3I02A 5C0CE 2OP4L 1D5XB 1XGRB 1S9WA 2F5BH 3NH7L 3ARFA 4JM4L 4OLWL 3WCYA 1YJDH 3SDCC 43C9B 2ZG2A 2ZOKB 3T3MF 4OV5A 3O11B 1I9IH 1JNLH 4Z7UE 2IFFH 1OAQH 3U4EA 2P47B 4MWFA 1AGEA 2YPKB 5EIVA 4P48A 5E00B 1R3LA 4ALAH 1PYWB 3T0BA 3C60D 4JCMA 3BO8A 5F7NC 2CLRA 1U3YA 1ZLVH 5BVPH 2ZCHH 3M17A 4H0GA 4WFED 1T03L 1JWMB 1UACL 4KK9C 3RU8L 4LP5A 4POZC 1IGYB 5T3ZL 3E3QE 3C60A 3RWIB 2C1OA 4U3XA 1KIPA 4BSVA 2X1QA 1A02N 2VL4A 1JE6A 4JRXE 3DI2B 4G42B 3F62A 5FK9A 3QUMA 4P5MA 4YXKL 2IGFL 1IEBA 2GJ6A 3ULVL 4ODSL 2VXTH 3MBEB 2HH0L 1S7SB 2OL3L 3TO2B 1P53A 2ADFH 4DWHA 5J1AB 4P46D 1KIQA 3ARDC 1AKJB 2OZ4H 4ZAKB 1H3WM 3QWRA 1A3QA 1S9YB 3CDFA 4PJ9A 3FFCB 1OAKH 1A3RL 4MQSB 4YEEA 3DURB 2BSED 4HX1B 1RZFL 3WFEL 5GZOD 2VISA 3T0EA 1I3GH 3VFWA 3V4PH 3OL2A 1PSKH 4NQCB 4NO0B 4XI5D 1U8OA 1NC2A 1TPXB 3SDDB 1A3LL 4GRMA 5FYLE 5KZCD 1IM9B 4Q58C 3BJ91 1BF2A 2Z93B 4GMSH 5KS9F 1QSFD 1R3IL 5C8JB 5T1MB 5TDPB 5AG8A 3RIAK 1CVRA 2PETA 4IRJD 3IDGA 3PL6A 4BH8B 1PW3A 5HDOA 4Q97A 1LEGA 1NAKH 4MNGB 3BP7A 1MI5A 4P9HH 3DBXA 3EJYD 4J4PA 2FATL 3S37X 2VLLB 2YD5A 3F7RA 2VLJB 4EUPH 3WUWB 2EIBA 4OQTA 4HK3J 3MODL 4PJCE 2IMMA 2X6MA 1QHPA 4I3RH 4FQPA 3GMMA 4ODUB 2DKSA 3CD4A 4O4YL 1PKQE 1AXIB 4WO4A 1HIMH 2D7TH 1YN6B 2QADD 3WIFB 3S6CA 2M1KA 3EO0B 4LRNL 1QA9B 2Y07H 2K7PA 5ENWB 3VW3L 4EVNB 4NGHH 2DJ4A 5F9WB 3ARGC 4OGZA 5D71L 3RL2B 5DWUL 2A73A 3HC4L 4U7MA 4DVRL 5GS2H 4PGCB 2V2WB 4KUCD 1FNSH 3DV6A 3TO4D 3VFUB 1IQDA 4IRSB 4KI5F 3TLRA 1CFNB 1OLZA 5IBTH 3HUJF 1IGTB 2HT4D 3IDJA 1T66D 1KACB 3PWNA 4ZPTB 1K5NB 5EULV 1WWCA 3CZFB 4WI6A 2ZSWA 4HT1L 1FAIH 1QVOA 5I1GH 1PFCA 5DR5L 4BUHA 4GFTB 3IJSB 5T33L 1E4KA 3RWFB 3MRMA 3O8XA 4H5SB 5SWSE 4ETQA 5HI5C 2NX5D 2FX8H 4J3TA 2NZ9D 4DN4H 3QI9B 1Q38A 5CLTA 5ICZA 3F7YA 4MGXA 4QRTA 4OAWA 3JWOC 4JFPB 5J6HB 4KZDL 2VDNL 4FQJL 4OBSA 3LEYH 3QUYC 1TJHH 1LO2L 4H26B 1LK3H 1ZVSA 1N6QH 5D1QA 1LP9B 2QHRL 3MLZH 3UYRH 2YSSA 5CJXA 3ORJA 3GMQB 1CE1H 1NUGA 4YO0A 3DMMC 4ZFZA 3QR2A 1RZGB 4JFZH 1AFVH 5HDBE 4QXTB 4L8CA 3JUZA 5DUBA 1A4KA 4DUXA 4EN3A 5CBEB 4D9QD 4ZFOB 1F6AB 1G0DA 1KCUH 2V7HA 3LKRA 3UTPD 2YUZA 5DD0L 3VDBA 5AZEL 2JJUA 4KROC 5GGTL 3T4YA 3LIZH 4CADB 3KPMB 2QSQA 5CLWA 1G7QA 1MFDL 2PYEA 3NCEB 5D1QB 5AAMA 1BD2B 1CQYA 3H9SA 3WMSA 4AH2B 2DKMA 1K8IA 1UJ3A 1FNFA 1YMHA 5TQ0H 4QXGL 1FGNH 4PRAA 3IU3B 2OJEA 2HMID 2R0ZL 3CNKA 1A7PL 5GS3A 3V0VA 2FD6L 3S4SA 2R29H 5BO1L 4DOHB 4Y5XB 1OGAA 2B7DT 5HI5D 2VLKB 1QO3A 2OZ4A 1NKRA 4YK4C 2FO1A 1IC1A 4PJAE 3FTGA 4P0DA 1VGEL 1Z9SA 4UINL 1NC4B 5EFIA 5D93C 1Z9MA 3TA3A 3W39B 3U4AA 3OZ9L 3P77B 4JHWH 4YR6A 3BXNB 1L9NA 1KTKE 5HDQH 4NSKA 4ODWB 2IGFH 3KDMB 1AJ7H 4JPKL 4ODSH 3E1F1 2CQVA 4BYHA 5GS1B 5DMYA 2CDFA 1OPGH 2HT2C 3LKPB 4NO3B 5CP3H 3QPQC 3MNVA 3V5HB 5DURD 3BN9C 3ULVD 5KG9A 4M8VA 4M62L 4P5TA 1JFQH 5ACZA 3BIAX 2D0FA 1UWGH 1U8QA 4KPHH 4BZ2L 2X4NA 4XVTL 3RVVC 4HCRL 5BS0A 4OJFL 5KVEH 3MLXL 2XPGB 3SEPA 1JGUL 3T2NH 1P5VA 1FZJB 2DWDA 4U1JB 3BOVA 4XMKH 2NY6D 3I75B 5FOJA 2P5WB 1X6NA 3C5ZD 3CSYB 4PRDB 4ZO7A 4OZIA 1M6OB 5DSCA 2AV1B 3U2SA 4CU6A 1T80A 4OIAA 1ETZB 5E2TH 4FFZL 4MS8C 1A3LH 3MRQB 4N0RA 4QLRA 3OG6B 1NDGB 5FO8B 4RAUB 2CPCA 5C7XL 1EMTL 3BP7B 1ZHNB 1G9MH 3RY6C 5D2NC 3HZYA 4DTGL 3U7YL 1NGYA 2RQ8A 3REWA 1FL3A 3MUZ1 4NM8H 5D96C 1Q9KA 5FA4B 1OWWA 1HHKA 2RB8A 5CSZA 3WFDH 1NFKA 3B9DA 1YYMH 4UUJB 4X6BB 5ERWA 5E24E 5GSRA 5CBAA 4QHUB 3NABH 4U1SB 4LBEB 4W68A 1ZWIB 3MODH 3QHZH 3PGDA 1X5JA 4WTWA 3RUGB 1LDSA 4OF0A 1T21A 2Y06L 1AXTH 3TBTB 4HGWB 3P0VL 2Z31A 2ADJA 3LQAL 3MUGA 5IW6B 3MPCA 4UT7L 4I77H 3QRGL 4KZEL 5DD1H 1KCGC 4BSWB 3KPPB 5JNYB 5ITBL 4HFUH 5E4IA 3OMZA 5HGDB 5IQ7L 1HHIA 1MQKL 2OK0H 1OTUC 4WHTA 2V2XB 3FL7A 4OM0L 4P59L 4C56E 4LSPL 4CMHC 4AJ0A 3LDBB 4FA8A 1LO4L 2UZXB 2VXSH 5J11C 4XC1H 3RDTC 1BX2A 5AD0A 3QDMB 5HHNA 1QFWH 3W82A 1IAMA 2MKLC 4TTDC 5I76A 3D0VB 3GJFK 5A2KH 1RZ7H 4XPTH 1TQCB 5DHXB 3DPBA 2APBA 3BI9X 5LKNA 1KC5H 4LKCA 3T4AA 4B50A 2GY5A 1AGCA 1LK2B 3MFFA 4HUVB 3PQYB 2MHAA 2VL5A 3ARDD 5D9SA 1ZHBA 3F7QA 4U0QB 2ESVD 4PJXA 5HI4C 3GMRB 3ABZA 4MDJB 2XYCA 5DZOA 5INCA 4CDGC 3FO1A 1M4KA 3QIWA 1N6QL 2IJ0C 4F58H 3HE6D 5CZVL 4Q0XL 4YIQA 1DQQB 5LCVL 4KKCD 1DANT 5FGSA 2AXFA 4HPOH 3V5DB 3VWKD 5SWZD 4KY1H 3D85A 3NPZB 4NFDA 3U46A 4GQPH 2PW1A 3V6ZB 3HMXL 3T2OA 1GGUA 4JFFA 1BZ7B 4YBQD 4FTVD 5C2BL 5BW7A 2E27H 3QEQA 4Y1AE 4ELKA 1A2YA 1CFSB 2A6JB 5EU6A 2NXYD 4XP6H 5F1NB 1MCCA 5IJKA 3VXSE 3F5WB 2YMXH 2D9CA 5DHYA 3MOBL 1CR9L 3OKNA 4LPCA 2YEZB 5EU6D 1VFOA 3BJLA 5DLML 4F7MB 4DEPC 1UXWA 2AEPL 1DE4B 1MNUH 4DN3L 2KH2B 2XWBA 3FT2A 3AAZA 1N6VA 3O6FA 1OP3K 4M6NH 4OQ1A 1NL0L 3ZT6A 5E5RB 2ITCA 2P5EB 1FNHA 1A6TB 5BO1H 5C0BB 5FYKH 2CIKB 4PP2B 1MPAL 1QSVA 4LASL 3OKNB 5H35A 5HDBF 1ZHLA 3VXME 3DO7A 3MJ9A 4KTDH 4OF8A 3MUHL 4GUPB 1FIEA 2CR3A 4X8JB 4KHXL 3SKOA 1B0RA 3B3IA 2C7UB 4PGBB 1CGTA 1MEXL 3UTSE 4LHUA 1JUFB 3RZCA 3WFZA 3WYRA 3SKJL 4UV4L 4E42A 4JCLA 1MAMH 5AZ2L 4PJXB 1NGPL 3RZCD 1VACA 1DLFH 2VNCA 2X5PA 3BDXA 3QEHA 1CLZH 1U41A 5D7IA 3PQYA 4DGVH 2AP2A 3O3AA 4PB9H 1OOAA 3G6JF 4ELMA 5K9QI 5DRXB 2BNUA 2BZDA 3IFNL 5E2UL 5EUKB 1DFBH 4Z7OE 4R26H 4RIRA 4NKDB 3NA9L 1OP3H 4RWYH 1R24B 4DVBB 4LIQE 3BQUB 2QV2A 4CKVX 4PJ5A 1K2DB 4ZSOE 1B3JA 4ODXA 3CFCH 2MSPA 1WTLA 5D93B 3CK0H 1EEQA 5GSVB 1KFAL 5DMGC 5C7XH 1OD9A 2LV4A 1A7OH 5IVXF 2DWEA 2R2CA 4Y4HB 3EYOB 2X4RA 4EBQL 2JELL 3U7YH 2A74B 4MVBC 4KWUA 1LD9A 4JQXA 5AYUL 1A8JH 1AH1A 4ZG1A 3TT1L 5HYEA 5I1AA 4MJIB 3HC0B 3NFPA 4MJ4A 3SKNA 4GBXD 1DL7H 5IMMA 5LBSL 5IFJA 2CDEA 2YD9A 1U8KB 4I1NB 5D7SL 5IEHB 3HE6C 4PP8C 3U1SL 5HYJB 35C8L 1XZ0B 1VERA 4NN7B 4TOYH 1AY1L 4HZAA 4JM2F 3E3QC 2Y06H 1OTTD 3ECBA 4QRRD 4OCNC 4I77L 3TN0D 4PJ8C 4R7DB 3VG9C 1RVFL 4ODTH 1I8LC 5DC4B 2Y72A 3TVMA 4AEIL 3PP4L 1GIGL 3MOAL 1HOCB 1KT2B 3BISA 5J13B 1R6VA 4KK8D 3NZHL 4U6XB 4AY0A 3QFJB 1EBAA 2OK0L 1BVZA 1TXKA 1M05B 4KJWC 2CK2A 1JHLH 2XWJA 1NUFA 2BJML 3GUTB 4CN4A 3QXUA 1OQOA 4JGMA 2FIKB 1DBAH 1MLCB 3NIFE 4JO2H 1T6VN 3S4SG 4FFVC 5I1HL 2R4SH 3QDGD 4H88H 2H45A 3OF6D 2P5ED 1C5CH 4FQ1H 5DJCA 1CICA 2P5WA 3EHBD 4XP5L 3T3ME 4XCEB 3INUL 2UUDH 3QDGA 3BYTA 5T1LD 3RVVD 1NFIB 4JHAL 4Y19D 1HXMA 3WFHA 3WLBA 4P4KC 4HUKB 3BPCA 4TUKL 4GBXB 5GIRA 3ZYZA 3DVFA 4P2OB 1UH2A 4LVNC 2ERJB 4MA3B 2GJ6D 3KHOA 1LO3L 1GCFA 4YXHL 1FNGB 5JMOC 1DN0A 3B6SA 2E7MA 4AL8H 3KPSE 2IWGA 3B5GA 2FGWH 1NGWA 4JFYB 5H94B 1F00I 2X89A 3QWRD 3CDGB 1LO5A 4RRPA 4F3FA 1T7XA 3QUYA 3E6FB 2W60B 2MMXA 2CXGA 4P49A 1NCTA 4JFEB 1FFPB 4HS3A 3HNVL 4MYWB 4NWTH 4X6FA 4RFEA 5KTEH 3QUYD 1AHWC 2GCYB 1CDHA 4WUUB 1KG0A 1JV5A 4QHKI 1MJ8L 5LQBH 3HI6H 3G6AA 3DUSB 1HILA 3WFCL 1TCRB 4IOSD 2AEPH 3G5VA 2C4FT 2QJDA 4YDVA 4TTGA 4KQ4L 3Q0HA 3RVUD 3TGXA 1W0VA 5KOMC 4R4BA 3HE7D 4BJLA 5MP6L 3TWCL 3HKFA 3CVIL 4H1LH 3MXVL 3SPVA 2XA8H 2NW2A 1AO7A 2V17H 4GLRH 5CGMA 5ISZE 4XCFH 1FLTX 4L3AA 3PDOA 3H42L 2X4OA 3VJ6B 5FGCB 5ACLA 3ALWA 3ILPA 4LHUG 5DJ6A 4ZFOA 1CL7H 4UNTA 4PJAB 4N8VA 1A4KB 3TJEL 3G9AB 1P6AB 4UT6L 2YBRB 4NPYB 1MCDA 4D0CA 4MMZC 5GZND 4Z7QE 2Y5TB 3RL1A 1GZQA 4LSVH 3G5XA 5CP3A 3B5TA 4UV4H 3UO1H 4FG6C 1ZVSB 3MNZA 4H26A 1FFQA 2AJUL 4I48B 1MAML 3QUZD 5ESAB 4LLDB 4IRSD 4WEUD 5JW4R 4PRHA 4V3DB 2FX7H 1P9MC 4RGOL 1IILE 1QKZL 3GHEL 4KXZH 4RGMC 1MFBL 1FYTE 4G43B 3DYOA 4DGYL 1BGXH 1U8NA 3M07A 5DC0A 3Q6FB 3TO4A 1OGTB 2NNAB 5DK2B 1N7MH 3NCMA 3GMPB 4X4YA 2IF7A 4XH2A 1TVHB 2XRAH 1CU4L 4MD5B 5I66B 2VZOA 1KJ2L 1H0DA 1ZT4B 1FCCA 5CEZE 2Z35A 5T1LA 3CZFA 3NA9H 1B0GA 1S5HA 2CO7B 3KPQB 5L88L 3MUJA 2A6KB 2JB5L 4TNVK 5JORB 3X14A 4NQEA 4QWWD 4NZJA 3QUXB 3PWPA 4P5TD 3ULUL 4LGSB 4JQIH 1T1WB 3P11H 4YHZH 3BP6B 5IWLC 3K74B 4ZQKA 1I8IB 4OF6A 5JIHA 4N9GB 3Q1SL 2HFGH 2E9JA 3V6BR 2A6DB 3N0PB 2NX5A 2ESVB 5DK2A 1PVHA 4G8GD 3BUTA 4YDKH 1S7WA 2GK2A 1L4IA 3MBXL 1Y0LB 1A4JA 2FX9H 5FYLH 2V5TA 4JG1H 1S7XB 3SQOH 5DK0B 3HPLA 4L8BA 2D31B 1RY7B 3CX5J 2HLFD 3SOBH 1DP0A 1IBGL 2A77H 3X11A 3TFKD 1HXYB 4LOUD 1F3JB 1LDPH 2NMSA 5BVJB 2RAMA 4WEBL 1D5IH 3EYVB 1FO0L 1E28A 1A9EB 4Z76B 1MIML 3NZHH 2BRRH 3PF2A 4JDVA 2ID5A 3HRZA 2A83B 5KVMC 4IS6A 3THML 4C59B 2VLMD 5HHVH 5IB3A 3BP4B 3E2HC 4JREC 4Y5VC 4EQ2A 4LIQH 2X4QA 2MCG1 3B9KA 2DQIH 3QYCA 4H88L 3RJQB 1CZ8H 3NH7H 1G1CA 5ADPH 1A9EA 5CMAB 2PO6D 1I7UA 1C5CL 2F19H 5E4EB 1MCRA 4FFWD 1LE9B 4Y2OA 4AENB 1AQKH 3FFCA 2AXHA 2EH8L 4NN7C 4YE4H 3UTOA 2PYFA 4WFFD 4NP4H 5I19L 1KYOJ 3BH8A 4PRHD 3GIVB 4U1NB 2BCKA 5HY9B 1E6OH 1S7XA 3MV11 2NPLX 4O02L 4PJ8B 3BKML 1QBLH 1OD7A 3OKYA 5DO2D 1UXSB 4GG8B 4R6UA 4ZFGH 5T3XE 4JFYA 1IQWL 5IG7A 5CEZL 3I6LD 1N5YH 2QBWA 4XNZC 3QCUL 5JQ6H 4K3EH 1JZ3A 2C1OB 3KXFD 5A40E 4GH7B 5EWIH 1VACB 3WIHH 4OFIA 4XGZA 2DQFA 3OKKB 2VXQL 4Y19B 1P7HL 4UZGA 3NTCL 5GRZA 3WSQL 1U36A 1HZHL 3QI9D 3F7VA 1VFUA 4NWTL 1CT8B 2WLYA 3PNWB 1M7DB 3DUUA 3MZGB 4ZS7L 4YGVA 3GSNB 1V3KA 25C8H 2DRUA 2HTLC 4X4YB 3ARYA 1U91B 4PR5A 1H3GA 3HG1A 4G8GA 4JFDA 2R0WL 4W6WB 4JFFD 4Z0XA 2Q8AH 3BE1H 4XTRD 5MP6H 5MEOB 3G5YA 4PV8A 1AHWA 1TDQA 4MNQD 5C0RH 1FL6A 1R3JA 1ZLSL 4PJHE 4O58H 2YD3A 5DHVB 1UKQA 4NYLB 4E41D 4LEOB 4CBPA 4PJIF 5C6PB 1R3IH 3OKOB 5JMRA 5C0BD 3KXFB 3DRQA 2I07A 4EOWH 3U0PB 4D9RD 3QQ4B 3ZHKA 1GC1L 4HKJB 4NPYA 5D1XD 4TPRH 3B5HA 1X3DA 3N1PC 3L6FA 2AJXL 2CSPA 3OJVC 1RAMA 2VRAA 5FO7A 4UNUA 4XNMB 4XAKE 3O4LA 4XX1E 1FH5L 3GHEH 4NKIL 4OF7A 1INDL 5GRVL 1U2CA 1X5FA 2PO6C 4LEXL 4M6OL 3MROA 1EO8H 2F8OA 4Y4KB 4PJHB 5JZ7C 2C3XA 5BRZD 5I8KL 2Q1EA 4X6EB 4U6HB 4HMCA 4OF3A 1C16B 2A74A 1OF2A 3VCLA 4NNXB 3RI5F 4KK6D 2M2DA 1J0IA 4WUUA 5K9JH 3D3VB 2WLZA 2FO4B 5L88H 3UC0L 3K4AA 3WL9B 4PGDA 4HS3B 1FPTL 3T09A 3RUGF 3O9WA 3PQYD 2VKXA 1F4XH 4ORGB 3O8XC 2D7MA 5I17B 1VEPA 1ED3B 1I1RA 5KW9H 4PTTB 1F13A 4ZUTA 5JQHC 2BOCA 5DMKA 3X12B 2J5LC 1BPVA 1U8MA 1QFUL 5SWSD 1XGQB 3IF1A 4R90H 4HXBL 4ZUTB 1EHNA 5J1SC 1IKNA 2YD8A 4W6YB 4AENA 4S1SH 3UPRB 3OHXA 2V2XA 3K1KC 5GGRB 2EKSB 5E8PA 4F57L 1U8JB 4LLMA 4YUEL 1FVDB 2FX8L 2IALA 3VFPB 4I5BB 4EN3C 5F21B 3BD5A 3B9KB 4QHNB 3VFNA 1RSFA 3W9DA 4NZTH 2QQKL 2OL3A 1WBZB 4D9QE 1EPFA 1W0WB 4P23B 5I75B 1LO2H 2R2EB 4JFEE 4XMPH 2EDLA 5C71A 2ADJB 3I3EA 1SYSA 1NMAH 4R9HA 5I1IH 1EUUA 2NY0B 2Q87A 1H3PH 4P5TC 5KVDL 4ZTOH 4ZNEE 3HE7C 4JO3H 3SY0B 1UJTA 3QHFL 3ALXA 4OV6F 3HAEG 1MFAH 1LGVA 1OCWL 4JFDD 4Q2ZA 1G9NH 4Z5RB 2DOCA 5BVJA 1INQB 3RGVD 2UWEB 1TVDA 5HHXL 2IFGA 5GGTH 4DK3A 5D7IF 43CAB 4BQBA 3MLSH 4OLYL 3MCKA 1IKNC 3T77A 4Q9BA 1RZJH 2VWEC 2R0LH 2D2OA 3PWLA 2JCCB 4LSQL 3U0WH 2D7PA 2CKNA 5LAXB 2BY0A 3ZE1E 5DJ8B 1P1ZB 3MO1B 4PJEE 1YNLH 3LRHA 5D5ME 1BQLH 3ZKSD 1ZSDB 1T03H 5JIKA 2LU3A 1JZ4A 1A7PH 1T1ZB 1INQA 2DQJL 3QUMH 1OARL 3ECBB 4KJWD 5E1AB 2BC4B 3BGFB 1WAAF 2AV1A 4G9FB 4XNUH 2XI9A 1M6OA 5D6DC 4PRDA 1NLDL 5IT2H 4NO5B 3D39B 2HH0H 3TNMA 5IFJB 1JPST 1QBLL 2FEEL 1MREH 1XGPB 3X14B 4LAQH 1WBZA 1IC5L 4M5ZL 4ZFGL 1NDMB 5HHMD 5JDSA 4CAGA 3S3PA 1XF5B 4YIQB 5JQ6L 4Y19A 1QNZH 1EAPA 3UBXA 3FT3B 3OKKA 1ES0A 5KSBE 4O51B 4BH7B 3U6RB 5EZLA 5DQDH 1T3FB 5EO0A 4UAOB 3WJJC 1CK0L 3BP5A 5E6ID 4HEME 1DDHA 4NJAH 4G6AC 3RIFF 1SY6L 4UBDD 3F65A 1UB6A 5E4EC 1AP2B 3KS0H 1S7UB 5F9OL 2P44B 3IAGC 5FOBB 4NKQB 2VH5L 5CEXA 2Y4SA 4PJGB 3IDNB 4XXCC 4C4KO 3VRLF 3BN3B 1E27A 4F37F 3D3VA 3FZUD 5C08A 2C3VB 5ESVA 1IAIL 4CW1A 3P9LA 1F4YH 4N8VB 4DQOH 3TBVB 4YXLL 5DJ6B 3V6OC 3V0VB 4M6MH 4OD3H 2WNGA 4X6DF 3L1OL 5GRXG 2WBJD 4ESKA 4G8EB 4JAMA 2I60L 1T20A 5CMAA 4XNZB 5J56B 4E42B 2WQ8A 1R5VB 3MRHA 1TMCA 4XPBH 2OI9B 2Q76B 4FQXB 5JDSB 2DLFH 4EEEA 1YYML 4AG4H 4EI5B 5IB3B 3FQXB 1B0RB 1CDYA 5DA4A 3LKRB 1G7PB 2VZ3A 3EOAB 2Y07L 3G6AB 5IB5B 3VW3H 1AO7D 3P9LB 5E9DE 3HAEB 3V79C 3HC4H 3KYAA 1OLLA 4DVRH 2I5YL 3VXRB 3OTTA 3V52L 4G7YH 3S96A 4LEXH 1FRGL 4K71B 3AM8C 2X9WA 5CUSL 2UWEF 3BZFB 5ITBH 4JY6B 2Y6SD 2W9EH 4XI5C 4BQ9A 3IETA 4KJPD 1T0MB 3B6SB 2F54E 5K9JL 1QBMH 1CDBA 1VFAB 1IAII 5CZXD 2H1PH 2R0KL 3EGSA 3HB3C 2P8LA 5I18L 2CRIA 4CL7A 1FG2B 2P5WD 3EYQD 2NX5B 4I4WA 3OPZH 2PR4H 1EH9A 4JFFB 5E6IB 3T2QA 3WHXB 2P1YA 3IU4L 4JN2A 1N6UA 1M7DA 1LMKA 1AGBA 1ITCA 1NAMB 5BV7L 2JCCF 1HNGA 4XZUA 3G6JA 1RD6A 2R9HC 4KJYB 2UV3A 4XZUB 3KGRA 3FO0H 3JBG7 1L0XA 3VFUA 3UYRL 4NQED 3ZDYF 3VFNB 4V1DD 2ADGA 1PEZA 3LV3A 5EZOL 2IAMA 3TYGH 5CD3B 4G9DA 3MFFB 5SWZE 5A16A 2B5IC 3W0WD 4LSSH 1FIGH 4X9GA 2QQKH 1LEIA 1JPSH 3VFGL 5AZEH 4XTRC 4PJFA 5L2KE 2DQHH 1MCIA 1J1XL 2VITB 2C3GA 3W0WA 3O2DH 2ICES 4FMFA 1KCRH 4S0TD 2GJZB 3GKZA 2BHZA 1GJIA 1SVCP 3TJHC 2B1AH 4LFHG 4JPVH 4UTBH 1QLRA 3FZUC 2K3TA 3VXNB 3S96B 2ZUUA 3C08H 4Z5RA 3DNKA 4GRWH 4NQDE 3TFKA 5I71B 4Z95L 3HE7A 5TH2A 1MCNA 4X9FA 5HHQB 3VFRB 3JV6B 3DETC 3JVGA 3KPPA 5C8JA 4YHOL 3TPUA 4ISVA 4QCIA 5E99L 1YMHB 2FBJH 4A2MA 3LPGA 4N9OB 1YECL 1BVKB 1EEYA 3RZCC 4UQ2A 5HGAA 5TJWK 1BD2A 4QTIL 3T8XB 4ZDHA 1RJZA 4XNUL 1E28B 4G8EA 4JAMB 3E6HB 4KTDL 2R1WA 1OP5H 3FT4A 3UPRA 3EFDH 2PW2A 2YPVH 1Z0NA 1TFHA 5HHOA 4PJ9B 2CD0A 5L8LB 4KKBD 3BQUA 5EUOA 2DS4A 1E27B 1A14H 2FEEI 2NTFA 1FFPA 3FFCD 4XNQB 1U8IA 5IB1A 1KUMA 4ZODA 2VN4A 3O9WB 1S7SA 5FUCC 1EZVX 4HUXB 4K94H 3TV3L 4HUNB 3K2MC 4RFNC 4JPWH 1ETZA 1NMCB 2EC9T 2Z8VC 4JDZA 3VD5A 3MBED 4LRIC 4P2RE 3SE9L 1G1YA 2DI8A 4PR5B 4H1LG 3EOYG 2OM5A 1ACYL 2XOTA 1KB5B 1QVOB 2VDLH 1S5IL 4I18B 1HCVA 5EDXA 2VH5H 1G9ML 2HVJB 4XVJL 5CSGA 3TBSA 5EBGA 2Y1VA 2YXMA 2ZSWB 5B8CB 1LNUA 4ZSOB 4DTGH 4JANB 1P4BL 3LCYA 5BJTA 4JQXC 2Q6WB 4Y2DB 3PWPD 1WICA 2ZUYA 2CGRL 3VRIA 4JANA 4KHTL 1K4DB 5DVNA 4DQOL 1I7TB 4NO3A 3UJTL 1EHXA 1MCHA 3Q5OA 4NO5A 5I9QC 3ZTJG 2EDOA 1GSMA 2WM0A 1EJOL 5IVZB 2D0HA 3JV0A 5GGQH 3BSZL 2JJVA 4PG2A 3D2UD 3RL2A 2AEQH 1U6AH 5HYJE 4NO2B 4YR6B 5JXEC 4JY6A 4V3EB 3LQAH 3OGCB 2DLFL 3E8UH 1WLHA 1TTFA 4UAOC 4LEOA 4TSBL 3O4OC 1C5BL 4X99B 4F7MA 2DQTH 4UT9H 4G6JL 1MRFL 4ZNCD 4XP9L 2NY2C 2BVOA 3PWLB 4JFDB 1GGBH 4APQB 5KSAC 4RMSA 1XR8A 3OKMA 5D6CB 2VLJA 3V7AE 5E08L 4NRYA 2LABA 3S8WA 3DLQR 4Q2ZB 1OQXA 4JLRA 1B6UA 1LO4H 2DDQL 3ROLB 5IM7A 1IC7H 3DX7B 5KS9E 4M43H 4XPTL 2FJFB 5JW3L 2H1PL 2AKRB 3C6LD 5JXEA 1I8MB 5ADOL 4ZOAA 4A6YB 5CWSA 1FBIH 3JV6A 3VXOB 4I5BA 5TH2B 4GG6F 4Z76A 1INEH 4ZFZB 1PAMA 4FQHA 4KVCH 4X6FB 5M95B 3U48A 3RTQA 2C3WA 1QSEE 4Y1AB 4J8RA 1S78C 4OIIL 4MXWH 1QQDB 1GAFH 4MXQA 4JHAH 5D70L 4OZHE 4YFDB 2WIMA 2HT3D 1FO0A 2PCPB 3U36A 4IHOA 4R97C 4ZAKA 4KJQC 3DGGA 5C0JB 3LPWA 1JN6B 5IMKA 4X9BA 3ILQD 2BVPA 3PWUA 2XTLA 5D1XC 4K71C 2WP3T 1WC7A 5DEFA 2E27L 2D7OA 1LE9A 2MOVA 2F5AH 1NC2D 1WT5C 3ARUA 3RTQB 2KL6A 1TZHA 3TZVA 4JZJA 4Z77A 5IJVB 5IK3A 4AL8L 1QSFA 1RJYB 4HBCH 4P9HC 2B8OT 3BP6A 1MCWM 4LSTL 4KRNA 4QRPD 2AABH 2CR6A 4FRWA 1HXMB 2KBGA 5CEYA 3VMOA 4DKAA 1MF2L 3C5ZC 3H7BB 4O2CB 2O5ZH 1WWBX 3CUPA 5FM8A 1T21B 2NYYD 3VXUA 5I2IA 4LASH 3KPOA 5CHNB 4N8CH 3HG1D 3TJHA 3B3IB 1IT9L 3VFSA 4KUCF 4GUPA 3L5XH 4X6BA 4MNQA 5ERWB 4PPTA 5TFSH 5DUML 1IC4H 5SX5H 1OTSD 2JF1A 5JOEA 5KSBB 1Q9KB 2W0LA 2LFGA 4ZUVB 1T0MA 3T0WA 5GGVY 3TWCH 1A5FL 5C0BA 3RIFK 5DEGB 3N06B 4ZUVA 5ELIA 3AS2A 1EFXB 3WUWG 1BQHB 3J8F7 5D72L 5EG6C 2E8ZA 4RAUA 5C9JB 1T2JA 3B43A 1KTRL 4N0CC 1OAXL 4NO2A 3P4MA 2HVKB 2XQBL 3AROA 4LCWD 1DQJA 4L4TD 1F3DH 3BUYA 1IVLA 1G7PA 3EOAA 2BXYA 3MTRA 4LLVB 5CIPH 2HFFA 1BLNB 1CDIA 1DFBL 4LMQI 5DMIL 2ZOLB 4R26L 3DUUB 3JVGC 4PJEB 3KPRD 5CGYD 1ORQB 2PF6A 3W9DB 5IF0A 3EYQC 4R0LA 4RZCB 5CEZD 2HMIC 3CVHL 5FV1L 1MFBH 5BRZA 3R4DA 5D4QA 4G7VH 2CLZA 3VFWB 1E4JA 3K7UA 4XGZB 4GAYA 1HYSC 4WUUD 4M02A 5GS1A 5T1KA 3G5VB 4GRWE 3REVB 2YRLA 2VDLL 1HILB 3D0LA 5INDA 1F42A 5C09D 4PJFF 3KJ4C 3MRIB 4XNXL 3I3BA 3MNWB 4QRQB 3GJFH 3H3PL 5C0JA 2EYSB 5D1QD 1U3HB 1ADQL 4NC0B 4D3CH 3EFFA 4H25B 3MLVH 5EFIB 1H5BB 2AQ3A 1JHTB 1RI8A 5IFHL 2ARWA 4JQIL 2R15A 4WWID 3GHBL 3K46A 1CE6B 2DKUA 3TH2T 1GZPB 3RUGE 4Z9KB 3G04A 3MNWA 4QRQA 1I1FB 1WCBB 3GJEA 4FQIH 5C0AA 3S4SB 3D0LB 5INDB 2R1WB 3VXQB 1NFDB 3L95A 5DO2C 4NZUH 5FIEA 1KLGB 3DX8A 2DQTL 5GGTA 4M7LT 3MRGA 4G6JH 4AH2A 5IROA 5IV2B 2ZCHL 1DR9A 2WBJA 2NTSP 4MSWB 1J86A 2FWOA 4HWUA 1BBJA 4HJ0C 1DSFH 1KGCE 5T3ZH 3GM8A 3QO1A 5DI8A 3O11A 5MEND 1NEZA 4OM1L 4OZGE 3DUSA 4WEBH 4XBPA 2L7UA 2VLRD 2C1PA 4JPIB 2MCPH 3GSNL 5B3JF 1FSKB 1G7HB 3LOWA 4EKXA 4UIKL 1IC7L 2XN9D 5A2LH 4KV5E 4DOHE 3M1BA 2W1NA 3LS4L 3LKQA 3RVWD 3QPXH 4GRLB 3AM8A 5CKGA 3MV7E 1EFXA 1M05A 5IESL 3QH3B 2PXYB 1RIHL 4GLRI 1G7JB 2FH8A 3FB7B 2WUBH 1Q8MA 4MAYC 3X3FL 1YEJH 2DJSA 1G7MA 3DHJA 4P2QA 5DQJB 1KT2A 3G5YB 4PV8B 3MRMB 1C08A 2F19L 3AS3A 5ALCH 4I9WE 1HH6B 2XTJC 1EAJA 2XQYK 4P2QD 3QEUB 2KZ1B 3V4VL 4G9DB 1I9JH 2J88L 1A6ZB 1X7QA 4Z7VE 3RY5A 1HWHB 2R39A 4YXKH 4IOFC 1S7VB 4MQ7A 2QR0B 4GXVL 5I2IB 1T5WB 5D7JC 4L4JA 4LHQB 1Q94B 2AERT 3P3YA 4JRYD 1VFBA 4NIKB 3KXFE 4WJ5B 1KJMB 3HAEH 3ES6B 5I74B 1TZIB 5TF1H 1KB5A 4I18A 5D2LE 3QBTB 5JORA 2SEBB 2IBZX 1Y6MR 1MJ7H 2DLHA 4QYOB 4XMLH 3NCFB 4FN0A 1L7IL 1P6FA 4PGCA 1YQVL 1JVKA 4XAWL 1G9EA 5E6IA 1MJ8H 5JDJA 1O7VA 5LQBL 1C5DA 1C1EH 2JE8A 1JZ2A 4OCSH 2H3NB 3WIHL 5FCSH 3Q6FA 4HUXA 4HHAB 2R2BA 3ARSA 4CVWA 1PQZB 3LKSA 3SDDD 2HN7B 2G60H 3CVIH 4LP4A 4NJ9H 3BKCH 3KLAB 4HFWA 4V2BA 1GGTA 4Y16C 4HGKC 2HKHL 5A43C 2F53E 4XPAH 1A7BA 2IEPA 4GMSL 1I7RB 2P45B 3AREC 4L5FH 5KN5A 1BJMA 4UDUA 1C8PA 4E41E 3L3GA 4PRBA 3SKMA 1NCNA 1IC4L 2BNQA 2XTJD 2R0WH 5C0EA 2QQNL 4D0CB 1RJZB 3VWJC 2EICA 5AYQA 1VGKA 3ZKND 1UCTA 2MPAL 3S7GA 3ILQC 3ULVF 5LGHH 3FQXA 1BFVL 4A6YA 3SKNB 2QQQA 1GGIH 5IR1A 4K2UL 2GITA 5T5FH 5MERA 4CJ0A 4AT6B 2FX7L 3RZWA 4RMQA 3L3IA 4HH9B 1EHAA 1A47A 1QKZH 5TDOA 4MCYB 3JWDC 1OAXH 1EGJA 4I3RL 4XAKD 2UY6A 4AIXA 3L7FA 1YPZF 4DGYH 3N50A 1OTSC 1ZWIA 2WK2A 3C9NB 4J7RA 4TVPD 3WXVH 4X8JA 2O5XL 5F9AC 1JRHI 3K1DA 4ZYKB 3KYKL 1MCQA 4F37K 1ITBB 4QOKA 5IIEA 3C6LC 1ZHLB 5DD5H 1S7RB 1KJVA 2VDNH 5KVGH 4ZO9A 2E5EA 4A6YH 4LPYA 1BIIA 5IVXB 1LP9A 1LQVA 1A1OA 3WE6B 3SDYH 5J1AA 4HUWA 3SHSA 2VJXA 1LEIB 1GXEA 4MNHA 3JV5A 2NLJA 2ESVA 1UB6B 5HPMA 3VFMA 3MV8E 5MEOA 4P2OD 4U2ZA 5CD3A 4NQCE 2AGJL 2RJMA 4PJDA 5D7LB 2J8UA 2JK5B 1IE5A 1MFDH 1JGLL 2DYPD 2BSTA 4LDLB 1ES0B 2I9TB 2Z92B 5EO9B 4WW2B 2FX9L 3E2HA 5IFHH 1RUAL 4WNQA 3WD5L 5J4MA 1PYWA 4PY7B 2HKFH 3MA9H 3DRTA 1O7SA 1BAFH 3GHBH 1K3ZA 3QEQD 3OJDA 4LHUB 2IADB 3WJJA 1U9KA 5JW4M 3WFHB 1YDPA 2DL2A 1IGTA 2ICCA 5I66A 5D8JH 2BSTB 5BCAA 4WFEE 4ZTPH 4NC1C 5DJXB 5F7YC 1HYSD 3PUCA 3LKNA 1QZ1A 5EBWB 4G43A 2NY7H 4KGJA 2Y9RT 3FFDA 4IRZL 1NEUA 2X7LA 5GGVL 3EJYC 3VGAB 4L3EE 1WWAX 1ZSDA 5L8KB 1CLYL 1PJ9A 4FFYH 2XXCB 4QT5A 4UBDC 1NQBA 4MD0A 1V3JA 4NN5B 4JHWL 4NT6B 1A6AB 2WZPD 1GZQB 3T0AA 1H3PL 3T0XA 3SDAC 3PDDA 3MA7A 5DTFB 4M7KH 2EEBA 2EDFA 3B9VA 5ADPL 4TUOA 4G6FB 5HVHC 3IVKB 4MJ5B 1H5BC 4TNWK 4H0HB 3QPXL 1E0OB 3FT4B 1JZ6A 1ORSA 4DUVA 3LRGA 1NCUA 5CILL 3ARQA 5F3BB 4UV7L 4OFPA 1FQ9C 1NBVL 5TDOB 4FNLL 3RI5K 4JHBA 5EN2B 3F12A 4U1GC 3IFOA 4UINH 5B38A 3MXWL 3L3HB 1RZIB 4CADA 3BEVB 5D9SB 2Z31B 1AE6H 5E2TL 3HRZB 4FFZH 2NZIA 1IQWH 4LLUA 3QDHA 1FFOA 3FHQA 3ZTNL 5JXED 4YO0B 3VI3E 3QT2A 1IKFH 3BQUD 4JN1H 3RWCB 3O3EB 4CU8A 1I1AB 1L9MA 2X2YA 3DURA 1HXYA 4PJGA 3SE4A 3S88H 5KN5B 1NANI 4CNIA 3A6OA 4JO1H 1HZHH 2R1XA 1AP2A 3GB7B 4Q9CA 5ANME 5FF6A 5SWQB 4XB8A 1MLBB 3GEWB 2GJZA 4Z7VB 4MXQD 4PTTA 4XAWH 1RFDL 1OAYH 4WEMB 5D7JA 3CU1A 4O00A 25C8L 1A4JB 1XMWA 3QDMD 3MBEA 4PGDB 1MH5A 5EZLB 3W81A 4MAYB 4PV9A 2E7CA 4ELMB 4O51A 3U30B 2QTEA 5FK9B 1N59B 1YN7A 4NQVA 3MBEC 1JGVL 4ZQKB 1F3DJ 2ATPA 3CSGA 4KUZH 5EORL 3TZVD 1DBJH 2XTJB 1F45A 3KJ6L 4BSJA 5DRWB 2X9YA 3WFBH 3LMJL 2R8SH 2FYYB 4OGYL 1NAML 1MELA 4NZRL 5BV7B 1CG9B 1CN4A 3NCBB 1HINL 3NVQA 4M5YH 1CDJA 1X7QB 2P8MA 1QUNA 1YEGL 3WFDL 1CI5A 2WUCH 2MPAH 4MX7A 3D39D 3TVMD 1QA9A 3O6LL 3NABL 4P3CH 2AJXH 3NIFF 1HHKB 3KDMA 1C12B 2H26B 1P1ZA 4U33A 4PDCE 1QRNB 1U8HB 1A0QL 4X80H 3P0YH 4HDIA 5DD1L 3ARFD 5DHVA 5FUZL 3WUWA 3MNZB 4OLEA 1SVZA 1XGTA 5IHLB 1G6RH 2ENSA 2YUVA 4RMWA 3FCTB 4O5LH 5DHYB 5IEKA 3SY0A 2EDWA 4NNYA 1CTOA 2B1HH 4OZIB 4DKEL 2F54D 4XBPB 1MFCH 5LCVH 2YA1A 5IMMB 1ZT7B 3RIAF 1D9KA 3FONB 3OB0K 4HUUA 3KLDA 3C6LA 5I0ZA 1HHHB 2X70B 1JWSA 4DZ8A 5J3HC 5FFLA 5E2VL 3MNVB 2GTWB 4JJ5A 4PRNA 5HYSG 5K9KA 1B4JH 1MCPH 5T3XH 4GKOA 4DK6A 5C2UB 1NGQH 2Q7YA 1NFDA 3L95B 5EIIB 4JY4B 3MOBH 2I9LA 4YBQC 2MHAB 2X89D 4GG6A 4WTZA 4IRSC 4CW1B 4L8CB 4L1DA 1LO0L 1Z6JT 3MA9L 7CGTA 1YPZA 2W92A 4GG8A 1TNNA 1X5HA 3O2VH 1I8LA 3FN9A 3VFTB 4RBPH 1Z9LA 5BQ7B 5JW5A 4HMEA 4ZTPL 1R3KB 3FO0L 1D5MA 5DMGD 4BFBD 3CXDL 1L6ZA 5F7HA 4OCLC 4XXCA 3GMOA 1G9NL 2QHLA 2WWMD 3IDIA 7FABL 1YA5A 4FFYL 1CLYH 4M1DH 4GMTL 1HHIB 3MOQA 1MIEL 8FABB 4NWUH 4P4RB 3BIKA 4YHPA 3OXSA 4GXUN 1JYXA 1FAKT 4M7KL 2O26U 3WNMA 1K5NA 2J3SA 3KLHD 3PXJA 1OGAD 4X4ZA 1RULH 3CFBB 1UZ8B 3MACH 1Q0XL 3GBMH 5ILTH 3SGDI 1UEYA 3QG6A 1CFNA 3O2WL 1E4WH 5C0DB 4JY4A 5B3NA 1B6DA 3ARFB 3QUZA 2IANE 2X1WL 4POUB 3JSSA 3X17A 5MENA 2BDNH 1M7IB 1NBVH 5C0FB 4PP2A 2B0SL 3ROOB 3PDGA 4G59A 5J12B 4HK0B 4YBLC 1D6VL 1J9CT 1EJ6A 4H0IA 1MREL 3MSPA 4KKAD 3FONA 2BNRA 3D69A 2EYTA 1R3JB 3RAJL 3GZKA 3AMKA 3VI4F 5HVGB 1HQRB 1X5AA 1NBQA 4LCIH 1FV1A 2FEDD 3RPKA 3TVMB 3WNPA 32C2B 3IJSA 1U91A 4MNQB 5DQDL 2H2SD 4L4TA 1KJ3H 4N0FB 3PHOA 3D9AH 1VB9A 3BT2L 2WWMC 5JW4Q 3IFPA 1WGOA 4ZXBB 4PB9L 4HPYL 1J05A 3H6JA 2MQ0A 4MNGA 1XF3B 3KPNA 4JRWA 1T0PB 3RKDC 4Z8FL 4O2CA 4H1LB 1J5OH 3GSOA 1DQLL 5D7SH 1V05A 3IRZA 5HDLA 1UJ3C 3O3DB 3HCVB 4KC3B 1KN2H 1RMFL 2ATKA 2GK0B 4WHDA 2IPTH 1AXSA 4QHNA 3VDCA 4UB0L 1RJYA 1N0XL 1N2RB 4MS8D 3ZMRA 2XNAA 3SCMC 3CLFL 1KV3A 1FE8L 3GMPA 4I0KA 5GGRY 3LKPA 4YXLH 1AD0B 2FSEA 3C6SA 3SCMA 1A7OL 1S5IH 1YN6A 1EEUA 2WWKT 2AI0L 4F80A 1ZANL 2OR8A 4YPJA 1XGUB 3DVGB 4LCYA 1QPPA 2VAAB 4ONFH 1YEEL 5I76B 4XPFH 5EUOF 3BW9B 1QLFA 3VA6A 2P8PA 5CJXC 3DO3A 3C5JA 5HYJD 5EBMA 2WUCL 3I2CL 1W72H 4LSRL 4AG4L 2Z8WC 2XZCL 5ICXB 1YC7A 2Z4QB 4R3SA 3FTGB 2OP4H 5I73C 4J3WA 5A2FA 1NBYB 2Z31D 4NN6C 4QRSB 4QNPE 4XPHL 3ZDYE 2YBRA 3K2UL 2AEQL 4Q9RH 4K7PX 3V4UL 2EDXA 4XNYH 1N5AA 1RURL 4MJ6A 4Y4HD 4D0BB 5CSBA 4N0UB 3NAAL 3DSNA 3MJ8A 3AMLA 4TUKH 5DFVC 2PO6A 2CLRB 4MD4B 4TVPL 4JR9H 2AJ3A 5BVPL 2UUDK 3HI5H 5C3LD 1CGVA 3GI8L 3O3EA 4L29B 3GGWA 1XH3A 4G6KH 4S1RL 1MAJA 2DQGL 5L6YH 2YUWA 4X6CB 1NGZA 1TQBB 3AY4C 1DLHA 3AFLA 2XKSA 3B9AA 4D0DB 2J8HA 3GMQA 1A7RL 4L3CA 2IPKA 3UTQA 4AM0A 1NGYB 2P43B 1RV6X 1M7XA 1NBZB 3SKUD 2HP4A 4X99A 1B4JL 1MCPL 5T3XL 2AK1L 5F3BA 3C09B 2B4CH 3MCG1 3HI6L 2FL5A 2OLDA 1NGWB 3MRQA 1MJJA 4OCXL 1CFQA 4YHNA 1KTDB 5EC1A 3WFCH 5IHUH 3HS0A 1RZKC 2XKUA 4BFIA 3HE6A 4G8GB 1QRKA 3AVEA 3T0EE 1I3GL 3VXMD 4CMHB 1XCTB 3BGMA 5C9KA 4ELKB 3GMNB 2GFBA 4P2OA 1GAFL 3MREA 3TC9A 1J1XH 4EDXA 4FXLA 2PW1B 2BFVH 3UTSD 3DUHA 4FTVA 1J8KA 1CT8A 4HIEA 1T2QL 1MRDL 3LH2H 4ERSL 1JNJA 4BKLB 3ZSTA 3V5HA 1T5XA 3I6KB 4MS8A 4QRPE 4MAUL 3TESA 1MI5E 4GAJH 1OSPL 4OLUL 3QFDB 1II4E 4GW4B 5C0ND 4KTYA 4PJ8D 1I7ZB 2P7TB 5I6XC 3ZT7A 5I8OH 2AABL 4PJCA 3MRKA 1KCLA 1NH6A 3EO0A 4P2CG 3STZA 4MJIE 2EE6A 1UKSA 3WS6C 4RDQF 4RGOH 3QO0A 1CICC 5F6HJ 3S97C 1MF2H 4LAJH 1S78D 1LE5A 3O2WH 12E8H 1WBYB 3IKCB 3BRFA 1W2KT 1KEGH 3MXVH 1FL5A 3P73A 1UENA 4BFEA 1YMME 3VG0H 2FCBA 4X6DA 4HWBA 3MGAA 4GW5B 3QZWB 1E6JL 5F9DC 3WN5A 2FDBP 5DWUH 5DVLA 2VIRB 1ZLVK 1SJXA 1EUTA 2AQ2A 3IDMA 1D6VH 5EZJB 3MZTA 4UT6H 4W4OA 2GTZB 3ZKNC 1QP1A 2FH6A 1SJEB 3RHWK 3BZ4A 5H2BA 3TCXA 1AGDA 3GSVA 5AWNH 4LCWE 1VEMA 2X4QB 3QP3A 1LWRA 1RHHA 4WI8A 5JOFB 3ULUE 5ITFB 3U83A 1MHHB 4ISVB 4QCIB 2FR4B 1J10A 5IIEB 4HT1H 3TBTA 3JUYA 4R2GB 3DVIA 4FFWC 2JJSC 4PTUA 5DR5H 2EDNA 4ZS6D 5D7LE 3F6IA 3LN4B 1BGXL 3CFJA 1HKFA 4QRRE 4Z8FH 1DBKH 3BAEH 2DI7A 4AZ8A 4PP1D 4WI4A 2DIJA 2LVEA 4M3JA 3BHBB 3QIUD 2PTTB 4LK4A 4JQVC 2E3VA 4U1MA 4Y5XC 4HZLB 4S10A 2VZ1A 1CGUA 1JK8A 1F8TH 3MMEB 1CBVL 1FVEB 1UKTA 3SDAA 1CWVA 4WI3A 3UZEA 5FDWA 3RVXD 2UYLB 2DI9A 1IAKB 4G8IB 5T3ZE 1WZMA 2CGRH 3EO1A 3SDCD 5ICZB 3QJFB 4AIOA 3DMMD 1BJ8A 3PWJB 1DUZB 5J89A 5KSAA 2N1KA 2CKBH 3LEXA 5FO8A 5IVOA 4OLWH 1XEDA 5D7JD 3SKMB 1J8HB 2F54B 2VIRA 3EBAA 4PRID 1WT5A 2WINB 3QIWD 3QXVA 4X4MA 1JNLL 2P5EE 3ZYJA 1JIBA 1N64H 4LIQL 2F8XC 5DJZA 5F7DA 2GT9B 3PP3H 2WQRA 3MGTA 5DJ2B 4JFOB 4ZXBC 1WAAA 1XGUA 1MRFH 3BESR 2BVQB 3PHQB 2D3VA 4M7JH 3VDAA 3HUJE 2R0ZH 4KK5D 4YH6A 2ORBH 5E9DB 1VSCA 3FO9B 3QUKB 1CF8L 2X4SA 3KG5A 3BMVA 3P4NB 1RURH 4POZD 1KGCD 2YPLE 3S36X 1NJ9B 1A9BB 4I0PD 4ODWA 1DJSA 3MRLA 3CFIC 4G8FB 4G5ZH 4QY8B 2X9XA 1A6TA 3A6BL 5DJZB 2A1WH 3AS1A 1PKOA 4P9ML 3SE8L 2HJKB 3O41A 2NY6B 1RUQH 4LLDA 2IH3A 5D2NB 1JNHA 3QCUH 3IFPB 2FHFA 2WIIB 3HZVA 5HDQL 4U1HB 1SYVB 3RL1B 1A3RH 2DQIL 3DBXB 1E4XL 3DHMA 5FA3A 4BZYA 5D96B 3WJLA 4ORZC 3EUUA 1AQDB 3WFEH 4UDTA 3EYUL 1CFTA 3AREA 1WZLA 3QDJE 2JJTA 4LHUD 3ILPB 1EGJL 1CFQB 3IYLW 2HFEA 1T83A 3SJVA 4G8IA 4NN6B 2X1PA 4JFHE 4PJ7B 4EI6A 5FDWB 1HQ4B 4XVTH 4ZS7H 2DYPB 1YEJL 2W65A 3DVNB 3MLXH 5BS0E 4MDIB 4L8SC 1S9VB 2KKQA 5GS2D 2IPKB 5SWSB 3NPSB 5GZNC 2IBZY 1KB9J 1D9KD 5DVMA 1JWUA 2X4RB 2BOBB 4D9LL 4PGZA 5DEZA 4LVHB 2LU7A 5CEZH 2MQ3A 2OMNA 5DUBB 4FXKB 3QIUA 3VH8A 1EMTH 1N0LA 3H0TA 4K3EL 1VPOH 5DVOA 5ITFA 3LN9A 4DVBA 2E6QA 1T2QH 2R1YB 3S37H 1XF1A 4ERSH 3RY4A 5AUMA 4F9PA 3UMTA 4YHPB 3BIKB 5BMFL 5GZOC 3AB0B 4KRPC 5TGBB 3QDMA 1G0XA 3RDTB 5L9DH 4G9FE 1YQVH 4HIJA 3FQWA 2ERJC 3IDXL 1FYTD 5I30L 2HLFC 1TQCC 4PRIA 3IS0X 2IG2L 1FNGA 1DQMH 1UA6H 5SX5K 2EXWC 4MA3A 1P7QB 4L4VB 3TBWA 1IAOA 2AJSH 2YD7A 3FN0L 1UQSB 1AXTL 4PS4H 3BO8B 4UT7H 12E8L 1AIFB 2ICWJ 1WVZA 2VXUL 3MRFA 1FDLL 2BRQA 3BVNA 1WBXB 5JXAH 3STZB 4XPAL 4ZPVA 1GOFA 4K8RC 4LQFH 3M45A 4LCWB 2DMBA 3K8KA 1QLFB 3RP1A 1E6JH 1ZOXA 4FMKA 1S9KC 3QDGB 3FRUB 3D39A 4J4PD 2K9UA 1MQKH 1Y18A 2Y25A 2MWCA 4JHZA 4FABL 3V9FA 1J0JA 4RWHA 4LPUA 2CRMA 4CGTA 3C8DA 3QWQB 1XIWC 3VE0A 4I2XA 2XWJB 4GJTB 4HXBH 2NR6D 1AXSB 4WO4B 1SBSH 1HSBA 1TETL 4W4OC 5E8NB 3FHAA 3O81A 4GKZB 4RGNC 2JCCA 4DEPB 3V6OA 1KC5L 1JTPA 1K8DA 4UDTB 1TVBA 4C54A 2DIAA 1AQDA 6FABH 1ZXQA 1DBKL 3QXAA 3DXAE 2O5XH 4NRZA 4JFZL 2VLLA 2GUOA 5IBUB 3KYKH 2CMRH 4OD2A 2GJJA 4NZTL 1CBVH 3PJSA 4JGJA 1W72A 2A9NL 4UIMB 1XZ0A 4K7PL 4EXKA 3LIZL 2IPUK 2HG5A 4Y5VA 4O2EA 1F4XL 5DJYB 4HUMB 4HWBH 3PWVA 5FCUL 4MQXC 4PJBE 3T04D 1HSBB 4GAFB 4PRPE 2NY4B 1REIA 4D0DA 4C83B 3QHFH 3UTTE 4PREB 3RNQA 4PJ7E 1KBGL 3S98A 2E6PA 4QXGH 1NCAH 4YNYA 1NC2B 2B4CC 1U8OB 1T0NB 2FIRT 2DTSA 2VLKE 3VI3F 4FQIL 2I27N 4M1CC 3QQ9D 4PYGA 1N4XH 3QIBB 4MXVF 1CD9B 1QHOA 1CFBA 1MNUL 1UC6A 3NA4A 3MJ8B 2FJGA 1NL0H 4WFFE 1UH4A 3NN8A 3OKEB 3QUXC 4DGIH 4NKDA 5I16A 1CF8H 2ATPB 3SDXB 5I17A 4LGRB 4KRPD 4ZMAT 4DJMA 3O6FC 1QSFB 2BNUB 1I75A 3JWDL 2W9LA 4Z77B 5IJVA 5KVDH 3ZDZE 1IAOB 5CFHA 4WW1A 3I6LE 4JO3L 5EU4B 3RVTC 4BZ1L 5CP7B 1K6QL 4ONGH 2X41A 1OF2B 3CLEH 3VCLB 2EDHA 4Z7UA 4U6VL 1FJ1B 3CVHA 2EE9A 4Y4HC 3S5LG 4LDEB 1KULA 4FZEH 1MCOH 3SO5A 1V7MH 4EUPG 1OB1B 3ZLQC 4K3GA 1BJ1J 1LEKB 3BRDA 1RIUH 1MVUA 3ME0A 1M71B 4LLYB 1YNLL 3WBDA 1CK0H 5FKAA 1PG7H 3ARXA 3HNSL 1CLZL 4TUJA 1SY6H 1F6AA 2YN3A 2ZOKA 3L6FB 4JRXA 2DQJH 5CCKL 3V4VH 4WU7B 3DO7B 1NCCL 1A1MA 5CILH 1S7QA 4OLZH 2BOBA 2QL1A 2VDQL 4JREB 1JWUB 1KLUB 3TA3D 3D25A 5K9KB 1A6UH 1Q1JH 1DBBL 3P30L 1I3UA 4O2EB 5T1DL 3HLAA 5EN2A 1T1YB 1ZVHA 3GSOB 3OR7B 5C1MB 2XG4A 3IDYB 1YNTA 5EBLA 5C07A 5LJYH 4QXWA 1CIUA 5TF1L 3GRWA 1QR1A 1MJUL 1HQ4A 1SM3L 4Z78B 1MJ7L 3DI3B 4X7SL 1U2HA 1JTOA 4Y5YA 2OR7A 5TE7L 4U6YB 4ZD3H 2YWZA 4XBEL 4F2MB 4NHCL 1EFQA 3I9GL 4APQA 2KQNA 4MMXC 2AV7A 1YEIL 3HPJB 1MFNA 1A6WH 5FHAH 3EOTH 3S88L 4QHLA 1PKQB 2H9GB 1XGTB 4PD4J 5HGGS 1YUHB 4GKNA 4NJ9L 4UQ3A 4KV5F 4KZEH 1Q9OA 2XZZA 3C5ZA 3ARDB 4U05A 3GIZH 4U3HA 1DBML 4YHML 4HFUL 1I9RH 3FB8B 2HRPH 4P4KB 5ABDE 5IVZA 5DVKA 2DTML 4GBXC 2OQJA 3STLB 1JGVH 1CD0A 2J2ZA 5K59F 5I1EH 2VXUH 1ZE3C 1FDLH 4F33B 3CFBA 1WUNT 4LVNB 2HLAB 4HS8H 1RPQA 1M71A 3NIGF 3WIFA 4AEIH 4UI2A 1G9NC 3BZEB 4LVHC 4ZFFB 2Q7NA 4XC1L 4Y2DA 3SDDC 3JZ7A 4D2NA 1NCBH 3GMLB 4LCUA 4PJ8A 2R8SL 1OB1A 4JY5H 4WNQB 5D1ZC 5FM5O 3VA2C 1WZ1H 2APFA 1W8OA 4NM4H 3QRFM 4Q6IA 3SO3B 4UTAH 4POYA 5AG9A 5I1HH 5IHZA 1MQ8A 1H3TA 4PG9A 2DBJA 4QHKJ 3AB0C 3FQWB 4KRPB 4N1EA 2D0GA 4FQ1L 3IU3A 3U0TB 4Z78A 1D5MB 5DD5L 2G5BA 4PB0L 4PD4K 5HGDA 2ZUQB 2PNDA 4NBYB 3VXTB 2LAAA 4G7YL 1T1YA 3OR7A 1X5YA 4Q0XH 4Z18A 5T1MA 5TDPA 3UTZB 1MLBA 5F96H 1IAKA 2EYRB 3T4YB 1TLKA 1TTGA 2R1XB 4WWKA 3M8OL 4ENED 1VA9A 2YZ8A 4RA3A 1FZOA 4XPGL 4EDWL 1WV7T 3RTQD 2VDOL 2XICA 5IFAH 2GAZA 4JRXD 3EO9L 1UCBL 1Q72L 3SBWC 4DFHA 4YHLH 2Q7YB 3X13A 4K7PH 3E3QA 1H8OA 3MYZA 5SWSA 5DS8B 1CDCA 4MB4A 2PR4L 3IS1X 4OTXH 2CUMA 4WWKB 1F58H 2PO6B 2X1XR 3H3BC 1OAUL 2W38A 4JPVL 2XZQH 4D94A 5HPOA 5B38B 4OT1L 3HZYB 3L5WB 3WN5C 4PJIB 5E1HB 5EOCJ 2DQEH 2H41A 1IJ9A 1BOGA 1NBYA 4YPGB 1ORSB 4RGMB 4JB9L 5F3HB 3P9MA 2C9AA 3V7MA 1I8IA 5HYQB 3SDXA 3VXUD 1ADQA 2J5LB 2VYRE 4QTIH 1KCRL 5HHME 3HNTL 5ACZB 1PG7W 5AZ2H 4QRUB 2E7LA 5IVNA 3L3DB 4OV5B 3IFLL 1MCFA 3C08L 4DGVL 2NY4C 2EH7H 3VGFA 3QJHA 4GMTH 4M3KB 5IMLB 4HLZH 3TN0B 5E2WL 5B4MC 4XT1C 2SEBA 4LSVL 4NWUL 5JA8B 3GSXB 2AJUH 2VSDA 5C86A 1ODAA 3AXLA 1L6XA 5D1QC 4R4FH 1PG7L 3HNSH 3MRFB 1YEHH 4Z7WB 4OD2B 1AIFA 1ZK9A 1VCAA 4XBGA 5L2JA 4I13B 1PKQA 2Z92A 3MJGX 3SE9H 1P9MA 5JR1H 5FGRA 4IMKA 3EGSB 1ZS8A 1DUZA 1OGAB 4ZUSB 3NACH 2YD4A 2I24N 3I6GA 4S2SA 4XVJH 4PRIB 2AW2A 1KTDA 3L5WA 4U1LB 5EC1B 2V7NB 4EXPX 5LVEA 5JUEL 3V0WH 5SWQA 5A2JH 3W5MA 3VGDA 2JB5H 2BNRB 4LCCB 4ZO8A 3VE0B 1O5DT 5AUMB 4GRLA 3JTCA 1DL7L 3KPSB 4ZD3L 5TE7H 3SJVD 3WV0A 3TNNB 2PYEB 5IVXA 1BIIB 1ZGLM 2W9DH 1U42A 1IM9D 35C8H 2EO1A 1KJVB 3UZVB 3HAEA 1CFVH 2PUQT 4YWGH 4GRLD 1U6AL 2V7HB 3UJJH 4FQCL 2VDPH 5MI0C 4L8DA 3O9WD 2NX5E 4IOIB 5DJ0A 3LB6C 1UVQB 2VDKH 4HS6B 1GPOH 3N85H 4WY7L 1XH3B 3U9UA 2HFTA 1IGML 4P2YA 3SDCA 3LMJH 5B38G 5F1OB 2HTKC 4N8VG 8FABA 4LCCA 3DMMA 3NZ8B 4OGYH 4TRPL 3T0DA 2YC1B 3T65B 2AJYH 1YEDB 1ZAGA 1BMGA 1URLA 4YZFF 2AJZB 1RIVL 1UWXH 3QG7L 3RY6A 1F2QA 1D5IL 1DN0B 4OCWL 3UTPE 4DUWA 4X6DB 2C3VA 1ZS8B 1PZ5B 4Y5YC 2E9WA 2F5BL 3VRJB 3VXRE 1JWMA 2GSIB 1I3RA 1MIMH 5HHMB 3C5SB 5E8OB 1T22A 1NCBL 3L3GB 4JY5L 1U8LA 5F9JB 3ZTJH 2VR5A 4GBXA 5DMJB 4IJ3B 5F7KC 1MCSA 5DJAB 1BZQK 4HXAH 1DQDL 1W72L 3H9SE 2P7TA 1BQUA 1C5BH 2N7BA 3LD8B 3C8KA 5EBWA 1INEL 2LVCA 4XCEA 1RZJC 4BUGA 1A7NH 2I9LB 2J4WH 1U95B 2FZ3B 3TN0A 5CJOL 3WS6A 1WFOA 2CUIA 1Z2KA 4KAQL 1N26A 3MFGB 2CLVB 1GL4B 1HH9A 2X4UA 3GJFB 3GSUA 4K7FA 2EH8H 3HHRB 2XZAL 5EOCH 5K9QG 2AXJA 3ULVH 2R69H 1D9KB 3QFJA 2ATKB 2GK0A 2YA2A 4TVPH 4EUPB 2APTA 3O3DA 2OL3H 3MGTB 4XHQA 1U58A 5DD6A 3MREB 4P3DB 2ADFL 4EI5C 2BY1A 1JMXA 4I0CC 4Z7UF 1UCBH 1MWAA 1KOAA 4R7DA 1CICD 2ARJA 2X10A 5I1JL 5B3JE 4YHNB 3EDEA 5K9OA 2D7QA 2ARJB 5J0BA 1OAUH 2A0LC 4HDIB 4KQ4H 1A7RH 5FO9B 1I4FB 4Q6YA 4OZ4B 3K8LA 5DQJA 3EOBB 2WSKA 4NO0D 1KLUA 2DD8H 1WCQA 3MRLB 4S11A 1C12A 2H26A 4XCCH 1IM9A 4NKOA 4TSAH 4GRMB 1D7FA 3L9RB 4XCYA 2B2XH 3MJ7B 3MRCB 2UZIH 2ZCLH 4OZIE 5MENB 5JO5A 2AXGB 4OLXL 4N1CA 4HCRA 1T7YA 1CG9A 2VE6B 4KQ3H 4FQLL 4OLVL 1JNNH 1BZ9B 1P69B 4LPTA 3WKML 1KCVL 2VUOA 4YC2C 1GOGA 5DI8B 1P7KA 1UZ8A 1KELH 2GEEA 2BNQD 2V9QA 3MV9E 2ZNWA 3D3VD 4CVUA 1Q0XH 3BPOC 3QPQD 3WLWD 1FVCB 4MJID 1KPVA 4GAJL 2G5BB 1YN7B 2XV6B 1T22B 2GTZA 3I50L 4FQQA 1HK6A 1I3RB 2FNBA 4C4KT 1R3HB 3QUMB 4P5MB 1A1NA 4N8CL 2BMKA 4GAGH 5D7IB 1IT9H 3WN5B 2VB5A 4D8PA 5JOPD 5KJRH 1IGYA 3G04B 3VGGA 5HD8C 1GZPA 2CRZA 5JIPA 5DUMH 3KLAA 1U92A 1V7NH 5TGBA 3RAJH 4HZLA 1PQZA 5KAQG 4HF5L 5DXWA 2HRLA 4MWFB 5J3HD 3QA3A 4K9EL 1H3UA 3QIUB 4XNXH 3W5NA 4Z7VF 2HFGL 5E5UB 3V0WL 1T0NA 1FAIL 3D9AL 1EO7A 4FP8L 3RVWC 2YRZA 3ARBC 4J3XA 5DYOA 4OI8A 5TPWH 2PN5A 2Z91A 3L7EA 2CLZB 1WSST 4NOBA 5I1CL 5GJTH 1YNKH 2HG5B 3NFNB 4HWEH 2F53B 3DX7A 3BZ4B 3OQ3B 1Q9OB 1QFUH 5H2BB 4CN6A 3R1GH 3T3PF 4EQ3A 1YUHA 3VI4E 4KZDH 4FQJH 2HFFB 1BFOB 2EDRA 2A77L 4UB0H 4LLVA 4ETYA 6CGTA 4UU9B 5C07D 1I3VA 1DEDA 4FS0A 3BZDA 1FE8H 4U49A 1IL1A 3CCHA 4HKZA 4M61A 1FO0H 1ZLWK 3V5KA 4YUEH 5F1NA 2UVEA 5HTSA 5IB2B 4QXUL 2DMCA 3VWJA 1SEQL 1ZANH 4P3DA 4JM2B 4LU5L 2FB4L 5JLZA 4Z7WA 2OTUB 4R8WL 4S1DC 3DIFB 2AJYL 4BQCA 5ESQB 4PRPB 1IZJA 1RIVH 4OM1H 1IFHH 1NBZA 2AK4E 4V1DA 4D3CL 1JFMA 1ZGLP 5TQ2L 2XIDA 3QCVL 3GJFA 1ONQA 3GSUB 4LF3A 1QRNA 3O3UN 1G7HA 5BZWB 1TZGH 3OJ2C 4LCCC 1MFAL 3PABA 4HG4J 1I8KA 4URTB 4HUVA 2XKNB 3QG6B 5EU6E 3DXAB 3RRQA 1FNEB 1RUML 1YEKL 4LKCB 4YE4L 3QA3B 5B8CC 1BBJB 1FZMB 1QR4A 5DJDB 4Y2DC 4NP4L 4X7CC 5I19H 4FTVB 1BOYA 2AJ3B 2H2PC 5B8CA 4UOW0 5EO9A 3EDKA 4HWNA 3V0AC 1UQSA 4M7JL 1XCTA 3BGMB 1CLOL 1JGEB 3FOLA 2ORBL 3PIQA 4YJZL 4G6KL 3JWOL 3LHPL 3HE6B 1PG7X 4D8PB 4X9HA 4JDZB 4HD9A 2DB8A 4LRIA 3EKCA 3V6FA 2NY0D 3IAPA 3VD4A 5IK3B 4BELD 1J8HA 4IRJB 3Q3GA 5CJBA 4PV9B 2R69L 5IW1A 1T04B 1OWRM 4HQQL 3KYOA 3BEWB 3DX9A 3O4OB 4FQ2L 3SE8H 4LAQL 5HXMA 5I16B 2B39A 3OKEA 4HKBB 1IAIM 1J88A 5FF6B 5HD8D 1FO0B 3LEVL 2BY3A 4HCRH 5HHOB 1MOEA 2OJZL 1V5JA 4FQXC 4HIIB 4Y19E 1MUJB 1MCEA 4ONOA 1UB5A 3ARRA 3PGDB 3Q6GL 2WMPA 3X13B 2DQDL 3FMGL 4NJAL 3LD8C 2K1MA 4ZAKD 4QHUA 2OTWA 3MV8B 1N2RA 4N5EC 3L9RA 5F7EH 1CTNA 4XWOD 4AT6A 5C0RL 2GJ6E 4HUUB 1QFWM 1F4HA 4XVSH 2ZOLA 3KPSD 3SJVB 1XGYL 4X98B 2V7NA 1FZKA 3LH2L 5JIIA 4OCYH 2UZIL 4OKDA 3LAFA 3PV7A 1K3IA 1S7TB 3HFML 2OS7A 4OLXH 4OLUH 2HVKA 1YEFL 4KQ3L 4FQLH 1D5BB 4TPRL 5T5NF 1EX0A 2Z4QA 5CGYC 3OBAA 4GRWB 1GGIL 2LU4A 5JHLH 3S37L 5K33A 1A6VL 4NHUA 4U1JA 3MA7B 2V6HA 1JL8A 4A2LA 3GSXA 1Z9OA 1LE5B 4G8FA 4M7ZB 5BMFH 4NT6A 5BS0B 2XWTA 4NUGL 1P4IL 2WBJC 3KPRE 3JWNC 2MJWA 5ISZA 1KEGL 4RQQA 1HDMB 1AD9B 3ERYA 1AD0A 2FSEB 4GAGL 5I1LB 4U1KA 1QEWB 3LZFH 4YBHA 3OX8B 5KJRL 3QDJB 2VTFA 5E9DA 4MQXD 4LDOB 5C0GB 3LV3B 3S5LB 1T1WA 3RGVB 3GK8H 3O6KH 1IM3B 4HMDA 4LPWA 5GJSL 5C0DA 3A67H 3O3BB 2EZ0D 5DJ2A 2RBLA 4MB3A 3SDYL 3MRJA 2B5IB 4HF5H 3DROA 4U0RC 4BKLA 4BA8A 3WLWC 1YDPB 4LSPH 2Y6SC 4OZFH 3CIQA 1BFVH 3C5ZB 2FECL 4KDVA 2O93L 1YY9D 4X5WA 4TNVF 3BVNB 4LVEA 5D1XA 3FQRA 1NCWH 4Z0BH 2BP3A 1H0DB 4YC2B 5JHDA 2HVJA 4K3DL 1GVIA 4NQVB 4YPGA 3TBSB 1HEZB 3ARGA 5GXBB 4M9PA 1TZHB 3TZVB 1MRCL 5ID0A 1EEZA 1JGLH 1HH6A 1OM3L 3TCLA 1C08B 3O4LD 4F57H 3VRLE 5I1CH 3BAEL 3PWUB 4J23A 4DAGH 2YKLH 4X0KB 5FECA 2UYLA 1F8TL 1FVEA 2LE9A 5C0IA 2KQMA 4FOMA 3A6CH 5I71C 1DVFB 4WCYL 5ESAA 4P57B 5T1KD 2BK8A 4A6YL 5BQ7A 3LKQB 4PJCF 4NCC2 4L3CB 3T3PE 3EDJA 1DLHB 3G5ZB 3VH8B 4JPIA 4QXUH 3TH3T 1PZUB 4IRZH 5CS7A 5H37G 4YDIH 5BW7C 3ZSSA 5HGHA 1MHHA 2FR4A 2AKRA 5L2KA 2NW2B 3QIUC 1I9EA 3ARBA 3TIDA 1FYTB 5TQ2H 2OI9A 2VO5A 1VESA 4EI5D 2K7QA 1RUAH 4R7NA 4YFLF 3DOSA 2RFXB 4XP4L 3RX7A 3ZE0F 1RQ5A 2NXZD 2R2HB 3ARBD 4JLRB 1BQLL 1YJDL 2NY1C 1G6RB 1T1XB 1U8PB 4K8RL 4OZHB 1RZ8B 5IB4A 1X4YA 4F7EB 1JV5B 1FFNA 2CIIA 4I3SH 1KTLB 4FZ8H 1GYAA 2Q86B 3EHBC 2XFXA 3H9HB 3MXWH 3CDGA 1JTTA 3A6BH 5ICYA 1IC5H 3NN8B 1UACH 4M5ZH 2VLRA 5ISZD 4I18C 1CYGA 3X3GL 1XF2A 1S9XB 1QFHA 3RGVA 3REVA 5EC2A 5HJ3A 4BZ1H 1Z3GH 4KKBC 2D9QB 4PUBH 2DL9A 2FHCA 3WS3B 3NCYS 5KVFL 5L7XL 1EGJH 2ZCKH 1AC0A 2DF3A 4RQQB 5EUOE 1V7ML 4HC1A 3E2HB 4HIHA 4Z7OF 3KHQA 4QHLB 4Y5VB 4MZ2A 2DM3A 3GMNA 4UILH 3S36H 4YFEA 2X40A 3MLTB 3SE3C 3EJZD 1K4CB 1RK1A 4XC3H 2F53D 1DQJB 5DJCB 4D9LH 4N90E 3HZMB 1YY8A 3VFMB 5HPMB 2NLJB 2VZVA 4YHYC 3TYFB 4QGYA 5KSAB 1BQHA 1IARB 5JTWA 2ZZUT 1Q1JL 3P30H 4PJIA 5FYKE 5T1DH 4EBQH 2JELH 4GKZA 3HLAB 1A1OB 1NAMH 4XPBL 1JCKA 3D25B 3H9ZA 1ND0B 3WO3B 1JK8B 4K8RD 4L4VE 5L9DL 1NCDH 2H6PB 2BSSB 4FXGB 4NO0A 2X44D 1DANU 3KLSA 1AR1D 3L5JA 4JFQB 4HV8A 1UA6L 3E6HA 3DYMA 1YEIH 3HMXA 2I5YH 4IDLA 5FHAL 1ZGLA 3EOTL 5HYJA 2DLIA 3SGEH 3RA7L 1MY7A 1XIWA 1FZOB 3QQ3B 2VDRH 4O4YH 3WNOA 4LPXA 4EI5A 2W0KA 1QYGH 1I1YB 5DRWA 2AJVH 5JXAL 3LZFL 1DBMH 4XP9H 4YHMH 1GRWA 4EZMA 1EZVY 5CP7A 1H3VA 2V9RA 2Z9TA 3IGAA 1GGBL 4LLQB 4AQOA 3W11D 4QRSA 2DTMH 1MHCB 4E5XA 1Z5LB 2GSGA 4NQUA 1CLCA 4PRBB 3MV8D 5I18H 3FAWA 2G5RA 3BPNB 1FN4B 3RWIA 1I7RA 2R4SL 5J6GA 5ID1B 3BDYH 4Y7MA 4WI7A 1LVEA 3KWWA 1B88A 2W0FB 4XP5H 3IDNA 3LS5L 2N56A 2VAAA 4RSVA 4ORGA 1A0QH 1MWAL 1IGFL 3QEQE 4LPVA 4Y1AA 4U1IB 3QSKB 2YA0A 4X9IA 1MRCH 5J9PB 4LSUH 1YPZB 2J6EA 3NBNA 5FUZH 2JJWA 2XN9A 2L4OA 3FOMA 1I1AD 4NQDB 2DAVA 4P5KB 4LSSL 5D2NE 5GRJL 1I85C 1LO3H 2A9NH 4YXHH 4KJYA 1C7SA 1TJHL 3FT3A 2GTWA 3PWVB 2VMFA 2ICWA 5D5MF 3OSKA 5BRZB 4H1LA 2EC8A 5IM7B 1A7QH 3D2UB 1VFMA 5ESQA 1ZLUK 3DIFA 2YPLB 2VDOH 5IFAL 1IEAA 1FG2A 4Y4KC 1QSEB 5C0CD 7FABH 1Q72H 3PGCB 4RFOH 1MHEA 2X4PB 1VKXB 1WFTA 3BD4A 5B39G 1G9MC 5SWZB 1KPRB 1F3RB 2FJHA 4MNHB 3ISWA 3TZVC 5C9JA 2JIXD 3IAQA 4RISH 4PJXE 4N1HB 1TCMA 4N0UE 2HJKA 2WWKO 3WE6A 2R29L 3AS0A 1YECH 5KS9B 1U8HA 4LKXA 5D7IE 1M7IA 4ODBD 2ZUXA 3NIGE 3MRPB 5IMOB 3QUZB 1DVFC 3O6MH 2A9MH 4WU7A 4JFFE 2XXMB 3H2WA 1K6QH 1HKLL 3CLEL 1IGIL 2M26A 4MNQE 5HYSB 4JFDE 1PGRB 3L7FB 2EDKA 4L29A 5IOPB 5BXFA 3DRTB 3QB7C 3KJ4B 1MCOL 3OXSB 4LCIL 4PJ5E 1CD8A 5FEBA 4JDTH 1I1CA 2MTPA 3PGFL 2QSCL 2A6IB 2ZP0T 1KB5H 1L7TL 2P24A 2X1OA 4DW2H 1N5AB 2NY0C 3IFLH 3J7HA 3GNMH 3RWEA 2HT2D 3WDIA 1EDQA 3L3OB 3NCYP 2XT1B 4OLZL 4OJFH 5KVEL 1DQLH 2XQYG 3VXPA 2AS5M 4U3CA 5IWLA 1RU9L 2G75B 4Y4FB 4Q9QL 2B0SH 4XNQA 3D0VA 3GSRB 2BSRA 1JP5A 1MHPL 1P4BH 3DGGB 5HHNB 4R4FL 4P99A 1BREA 3SDAB 4DCQB 5DMKB 4KH2A 5BRZE 4CNIB 4RAVB 1FN4A 2GHWB 4ZYKA 1F02I 3T08A 5GHWL 1I1AA 4WI9A 4YDJA 4BH7A 4FQHB 5F93C 3OXRB 1KCSL 3CFKA 3BGFC 4GW1A 3CJJA 1UM5L 1KN4H 2ADIB 3VD7A 1CVSC 5KBNC 3OG4B 1BM3H 1G7LA 3OR6A 1XGPA 3MBXH 5KSAD 1RHHB 3MROB 1BLNA 5SV4A 1RZKL 3IRPX 3ZKMD 5IP4A 2WP3O 5FYLL 2F15A 1JRHL 4ODVL 3GIZL 4MA8L 3KPNB 5C0CA 3UZQA 3DSFH 1J05B 2MFNA 1UWEL 2IPTL 3ESVF 4XNYL 4ONHA 5B21A 4UDUB 5D6CA 5I1EL 1PBYA 3X11B 2WV3A 3N85L 2Y7QA 4WY7H 2VZUA 2PXYD 4JR9L 2BVOB 5DEGA 4G3YL 4WENB 5F1SA 4YHYB 3BKJL 1XR9B 4PJFB 4YLQT 4XX1G 1ZHNA 5HYFA 2CXKA 3QG7H 5E8EA 3HI1A 4P2RB 1EVTC 2X4SB 3VFSB 4OCWH 3ZDZF 2VXSL 3CH1A 3ULUC 3JV4B 1WISA 2H32A 4K07A 2GT9A 4JZNB 4RNRA 2LQRA 3WDHA 5HYIA 3HR6A 1RIHH 4OCRL 4ZPVB 4LSUL 5EU7E 4OB5H 3UDWA 4MXVE 4XVUD 3MRGB 2NXYB 4EDWH 2F54A 2I9TA 4X6CE 1KNOA 4X5XA 2GFBB 5D5MA 3GI8H 3BH9A 4YAQA 5FYLD 3TEUA 5GRUL 3EZ8A 3GRWL 2PYEE 4OGXH 1Q9LA 4WHYH 2EIZA 5GGUA 5IG7B 1JN6A 2AEIT 2JB6B 4QTHA 5IMKB 1MAKA 4OTXL 4LSTH 4PRHB 5EWIL 1BEYH 2IBGA 2P5WE 3TA3B 3U36B 5E95B 3MMEA 3W39A 2VZTA 4MA1C 1NLBH 3NCJH 1H5BA 2EEDA 5M94B 4XP6L 4U1NA 1UZ6E 3W9EA 1OGAE 2FO4A 3ETBF 1DTUA 5FHBL 2G9HB 4F7EA 3LB6D 3JXAA 4OCXH 1C1EL 4PJAA 4GS7C 4WVRA 3KLHC 3RFZC 4IM8A 5DLMH 1UT9A 3C9NA 3QCTH 4Y4KA 3BEVA 1F90L 1IMHC 4BK5A 1T7WA 1RZIA 5E6IC 2Q3AA 5I15L 1I85A 2CJUH 3KPSA 3W0WE 1ZEAH 1HHHA 1TMCB 3C6LB 5C6TL 3ARWA 5MEQA 3HNTH 2FLRT 5JPMB 1MRDH 5HVWA 2A83A 1JZ5A 1HHJA 1CDGA 1TNMA 2ILLA 4PLKC 2BHUA 3QXDA 4EOWL 1MEXH 2G9HA 4NNYB 3MV9D 2BNQE 5C08B 1VHPA 4JO4L 3D3VE 3MX0A 4HKJA 3P4MB 2F8VA 4TSCH 3QQ4A 1ZA6A 4PJEF 2DBLL 1FC1A 5LGHL 4JDTL 2JJTC 2O61B 4H25A 3QUYB 5I8OL 3TH4T 5IQ9B 2D31A 2B20A 1DLFL 1LP9F 3OAUH 5E8DL 4OI7A 2X7LB 2C4XA 1I7ZA 3D18A 1X6LA 3CVHH 3MRNB 1RUKH 5DUPL 2F58H 1BD2E 2VITA 3BP5B 1LHZA 5EO0B 5E9DD 1T3FA 2P4AB 5JPNA 2VAJA 1WEJH 3BDBA 3FB5B 3MRDA 5I8KH 1K4DA 2QKIB 3FO9A 1MHPH 1YY9C 1IZKA 1QBBA 5DGRA 3CUPB 4QGTA 1RK0A 3ES6A 1IGJA 2H2PD 2DQFB 5KW9L 3VGAC 4LLWB 3DV4A 3DV6B 2GW5A 5LXGH 3OKDA