5HGHA

Hla*a2402 complexed with hiv nef138 10mer epitope
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hghA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hghA01
1C7SA 1SEQL 1TZGL 3QYCA 5F88B 3MGTA 4GUPB 1EAJA 4HCRA 5HDQH 5I15L 2P5WA 3FB5A 1CF8L 5B8CA 2E27H 3MQIA 1Q0YL 1UVQB 4XXDB 4K2UH 5J1AB 4W4OA 3WS3B 3RZCC 4XNYH 1IGMH 4CGTA 3MNVB 1DSFH 1KB5B 5MERB 5L0QC 4I48B 5JW3L 1DBML 4HIIA 2MKWA 1CN4A 5IVNA 4YXLH 1DP0A 3JV6A 3FQUA 1EHAA 3ZDXF 4S1QH 1EIBA 1RI8A 4EDWH 4YDKL 1HQRA 1T89A 3BHBA 1OWWA 4MJ6A 5FYJU 3V4UH 1JUFA 4JFXB 4NQTA 5HI3C 4Z7UE 4NCDA 4YJZL 3PABA 3V5DA 3TH4T 3LKNB 3AM8A 4LCUA 2YUWA 5L2KE 3MRFB 3TBWA 3QZWB 4EXKA 1FYTB 1LD9B 1QFPA 1S8DB 3STLB 1IGTA 2E7MA 4NCC2 3UCRA 4P9ML 4S10A 4PB9L 5I8CA 2EXWC 2IALB 5E8EA 5DJDA 4PV8B 3F65A 1AQDB 1N5AB 3LKQB 2J6EL 3DWTA 1D9KB 2X4RB 3G6JB 2DMCA 1G6RA 1YECH 5BXFA 2EEAA 2I9TA 4MA7H 3PABB 3V5DB 1EXUA 1L6XA 1Z0MA 1N0XL 3MRBA 1QRNE 1G6RL 1KYOJ 1JWMB 2QQLL 4TRPH 2ESVB 1KXQE 4U3CA 1IM9B 2IBBA 4YDJB 2IF7A 5K33A 5EULV 5D7SH 4BK4A 1MF2L 4L4JA 3GJFK 2LQRA 3LQAH 2VUOA 2JJSA 1K2DA 5IWLA 2BRQA 5I1CH 1R3LB 3LHPH 3DUUA 4IDLA 3DECA 3T2NH 4NNPH 2WUCH 4JN2B 2F8OA 4X99A 1W72L 3DV6B 4U05A 4GRWH 4BYHA 1OGAA 2B5IC 3DRTA 4LCWA 3H3PH 4RGOH 1PX3A 3X3FH 3DIFA 3OR7A 4M7LT 1AQKL 1MIML 4GRLB 1CTNA 4M9OA 1FNGB 1K3IA 5C3TA 4FQQB 3E6FA 3WL9A 3WN5A 2FNBA 1BD2A 3ROLA 3ZDYE 3ARTA 1XGUB 2G75B 5EIIA 3NH7H 4X9IA 4H26B 3G5VA 1PSKH 1Y6NR 2X4PB 2F8VA 5B38A 3CSYA 4HIXH 4OLVH 1NFIB 3PL6D 1BVLA 1G9NH 3V7AE 3WIHA 5DD5L 4G5ZH 4TSCH 1R5WB 5BRZA 2BNRD 4N1CA 5I18H 3GBML 1I1YA 3O8XD 4LPYA 3WJJC 4K3GA 1FL6B 1DUYB 3KYNA 3U1SH 1NAMA 3IJYB 1NGWA 2MHAB 4PJ9C 2G75A 3T3PF 1MF2H 1WAAE 3OXRB 4GRLC 1FNSH 1FLTX 1CFVH 1Y0LA 2QJDA 5KSUB 4PJEF 3TP4A 4OZHB 1IGML 1X5HA 2DQHH 3Q6FB 3GO1H 3HE7C 3ZE2E 1MAJA 3TPUB 3U4EB 1A7OL 1MFEH 4PRIB 3HZKA 3K8LA 1W72H 3B8SA 3PGFH 5D1QD 4IRSB 1HHJB 1E4WL 4XBEL 4RFNC 2EDNA 4XMPL 3DV6A 2DQTH 4BJLA 4HIEB 3SY0B 3MODH 5EU6D 4MWFB 5C07B 3TIEB 1S7SB 1ADQL 4U1JA 4U0RC 4XNQB 1CT8A 4X7SH 1T89C 5E56A 4NQED 3CFJB 1F4WH 2D03H 4GMSL 1W8NA 1L9MA 4BZ2L 4ZUTA 5DHVA 1A1OA 5IQ7L 2N56A 4JZJA 3P9MA 3VXRA 5FM8A 2R15A 4X6CB 1A7PL 3HC3H 1FSKC 4TSBH 1E4KC 3NVQA 4V1DE 4ZS7H 4KRMB 3MJ7B 5DZNA 5E5MA 5EIVA 2CH8A 2UZYB 3UAJC 4KHXH 1UWXK 5FHBH 1MPAH 4IRJC 4K94H 3MLWL 4PJXF 3P73B 3RVUC 5IBLD 3OB0H 3MLWH 4XTRC 2R0KL 1INEL 2HJLB 2YUZA 2DWDA 3NPSB 3FOMA 2PXYA 1LK3L 2P5WD 2ZOLB 2NZ9C 4R9HA 2DQEH 3RWGA 2DF3A 1XR8A 4LHQB 2CMRH 2H32B 1U95A 4JFEE 4V3DB 1S7TB 3ZKND 1YEKL 1I3GH 1FRGH 5E0QA 3QEQD 4L8CA 3G6JE 4OFIA 3L3JB 4C56E 2F58H 4U1KA 4CNIB 4X7SL 1A7RH 5IFAL 1VGEH 3D6GA 4MAYD 4CMMB 1F4WL 3ARFD 4JPWL 4I2XA 5ICYA 3SPVA 1QFHA 3QUKA 4LIQH 4P57A 1CICD 4LHJB 5FHAL 1KT2A 4X9HA 5EOTB 4NYLA 4NUGH 1RZGA 1BQUA 1QFWL 4NO0B 4QY8A 1NC2A 2HT3C 1RIHL 4NSKA 5T5NG 4R6UA 4WU5A 2APVA 3CCHA 4Y8DC 2QSQA 3A67H 4B53A 2EEDA 1JPST 4ORGB 3RA7H 1G9NL 4XWOD 1C5BL 5DQDL 2NZ9D 5DS8A 5EBMB 2AVGA 1A3QA 4M6OH 3S3PA 1UM4H 4D0DB 3QIBC 4DZ8B 5IVXB 5D5MF 5LKNA 3DUHA 4FHBD 2YWZA 4L1DA 4CAGA 5C92A 1IEHA 3MV7A 1I1FA 5DUBB 4YHML 1WIPA 4R7DB 4M9PA 1JNLH 4XMKL 3T09A 5HGGS 3GZKA 4ORGA 5BS0A 3SKOB 4X4ZA 4PJCE 4OFDA 3TBTB 1MSPA 1NGQL 1N3NA 1WFTA 5C0BE 2APTA 2AERT 4EI5A 1AQDA 1TZGH 3K1DA 5IHZB 1P5VA 1CXFA 1KLGA 1N8ZB 2ZUSA 5FDYA 5D7JA 1KIRA 1UEYA 3MODL 3WD5L 4XC3L 4WENB 1EMTH 1P84K 5JNYB 1N64L 5F7HA 4I18A 4HPOH 1MQKL 4KZDH 5DMIH 2R4RL 1AGCA 3WMSA 2DAVA 5D8JH 5BOZG 1YEIL 5DQJB 3OKKB 3SDXF 4PGDB 1QFWH 5JW3H 4XI5C 3FL7A 3TPUE 4P5TA 2DTML 4C55A 5HPMA 4FTVE 2H2SC 2Q86B 4RISH 2YPLA 2V7HA 4DKEL 3MJ8B 3HRZA 4YDKH 3CD4A 4S1SL 4RISL 4OKVA 5FHBL 3I85A 4LVOC 1U8IB 4I1NB 4ODXB 2VH5H 3DO3A 3EIFA 4DGVL 3AS3A 4MQSB 4BM7A 5BVPH 3HUJA 5J57B 3K4AA 3WS3A 5C2UB 3CVHL 4JFZH 3N1GC 1B4JL 1BJ1H 4GXUM 5T5FL 3QG6B 1CDHA 1OTUD 3A0OA 4ZOCA 2VJXA 2OI9C 5BOPA 1QA9A 3FQUB 4YHNB 3PP3K 1CL7I 2D3VA 3D0LA 5I30L 5KW9L 1Z5LB 4WJ5B 1FRGL 4PY7A 4ODXA 1K4CA 5ETUA 1K8IB 5T1KB 1A21A 5IVZA 1KULA 5CMAA 4I0PC 5MI0C 1HOCB 1IQWH 1RZKL 1F4HA 4U1MA 4Z7WF 2VZ3A 1DVFD 1NFDE 4NZRL 1I1AD 1ZHKA 1TNMA 4M7ZB 1FYTA 1C5DA 4YO0B 4LGPB 3KPPA 4NKIL 4P2RE 4PP2A 1VESA 3SDCA 5FYKH 1PQZB 5INDA 4RMSA 4NFCA 4PRIA 3ARGC 1NSNL 1WBYA 1PG7X 4NIKB 3SDCD 3RWHA 1LE5A 3GNML 5EOQL 3ZE1F 5C0BA 4P3DA 5FYLE 1MVUA 3SN6N 3BAEL 4CL7A 4XB8A 4NBYB 5IVOA 1TETL 1CG9B 2W0FB 2HTKC 4K94C 5DT1L 3C87A 1Q9LA 2WWMC 3M45A 1G1CA 1FVCB 1PW3A 3QXAA 4LHUG 4AQ1B 5EUOA 5EA0H 1G7JA 4NKOA 5KSVB 1CBVH 1QQDB 2RQ8A 3OHXA 3RWHB 3PWLA 3U79A 3RQ3A 3KAAA 2NY5L 3HN3A 4OTXL 1UB5A 5IGXH 1MCOL 3HMWL 4HKXB 5DJCA 4DGYH 4OBRA 2A1WH 1X5XA 5I74B 1D6VL 3GSWB 1CK0L 3UROR 2G5BB 4L3EE 2ENSA 4KRPD 5D7IB 4NRXA 1U58B 3W2DH 5IW6B 1IAMA 2FH6A 3L7FA 5D7KE 4PB0H 4MXQA 4Z78A 1MQKH 4HPOL 1Q0YH 3BP7A 1U8NA 3MRGA 3UTSE 1QQDA 5DWUH 4F9PC 3B9KD 5HTSA 3ECBB 4N0UA 4NQCB 4PREB 4Y19B 5HHVH 5F3HB 3C2SA 5EU6A 5E9DA 4PP2B 3VFOA 1QRNA 5IV2B 1MCRA 5EOCH 1ZEAL 4FFVD 2EXYC 4M7KL 2R2HA 2R4SH 2C1OB 3V4PH 4MJIB 4OGYL 1C1EH 5JPMB 3LEVH 3DYPA 1DBAH 1SM3L 1CFQB 1VADB 4OT1H 4Z7OE 1S7VA 5IEKA 2QSVA 3IKCB 4TULL 3QIWD 4YNYA 5C6TH 5D2NA 4PP1C 3ELAT 3FO2A 1NGXA 3ULVE 3VFTB 4DKAA 1VACA 4N8VB 4NT6A 3HAEA 4ZO7A 1GGYA 3GB7A 2DM4A 1VENA 5FUOL 1T22B 1F6AA 5D7LB 1UWEH 5D7JD 4C4KT 5AYUH 1BEYH 3Q2CA 2NW2B 1JRHH 4M93B 1FNLA 3CXHJ 1CFQA 3MUHL 4PBVC 3PDDA 3ZKQD 4HX1B 4S1RL 4DGYL 5KJRL 4XPBH 3CH1A 5HHNA 1X44A 2IFFH 1I3RA 1MPAL 3MRNB 2X4NA 3H7BB 5DYOB 1AR1C 4RX4A 4XHQA 1G9EA 3SDDC 1FLRL 1BD2D 4JZNB 4TQEL 2GITA 1Z9SA 3TN0D 1F90L 3QIUC 2VDRL 4JJ5B 4E5XB 4MJID 1HCVA 5E4EC 3C5JA 3T0EB 1RUKH 2DQGL 2BY3A 1QVOB 4YQXL 1NFDF 2DN7A 3DURB 3EJZC 5HGBA 5FO8B 5IW1B 1ZLSH 3EJYC 3VFUA 4Q2ZA 1OCWH 4LSPL 2YK1L 2OQJB 2IMNA 3FOLB 3L5XH 1ES0A 2LVCA 1KIQA 2WUBL 3ZKXC 4P2RD 2YKLH 3BQUD 1P53A 4UT6H 3SCMB 1DN0A 1DQTA 1RZIB 1CD1B 4X8XA 1FV1B 2HT4D 5JUEH 1L7IL 1QBMH 1NUGA 4IHOA 3U46A 4JCLA 2FX8H 1U6AL 4HC1A 1L7IH 4LSDA 2KH2B 5A2KH 2HJFA 1RUQL 4XCFL 3L95B 1FNEA 1U41A 1FDLL 3CPLA 2NW3B 4JE4B 4QHMA 4Y5YA 4L8CB 5TE6H 1A3LL 1YMHB 1OTTD 2CIIB 1PKQA 3QG7L 4HEPG 3IDYB 3LS4H 5GISH 5H8DA 1KC5H 4YC2C 5H37H 4JFYB 2IEPA 5D5ME 1JGLL 4Z7UF 3I75B 4KQ4H 4RFOL 5ICYB 4JZOA 2P5ED 1A9BA 3N1PC 2PCPA 4NUJA 5DGRA 4EKXA 1WBXB 1YNKL 1BQLL 3INUL 1GPOL 2BOBB 5MENA 2AXHA 3QRGL 4HUKB 3QEGH 2OX5A 1X5AA 1HWGB 3IDYC 3VG0L 1JHTB 2E6JA 4LRIA 2FWOB 2DQHL 1CCZA 5KSAD 4WWKC 1LGVA 3BPLB 3O4LE 1CXEA 5J6GB 4NC0B 4CU8A 1CWVA 5JDSB 1NLBL 1ZA3A 5GJSH 4HF5L 3OAYH 4KTEL 3SKNA 1NCDH 2XTLA 3KPRE 1TZIA 4HWBL 4NUJB 4DW2L 1NPUA 1UKQA 3U0TA 4NZTH 5D7IF 3ULVD 5I73C 4R8WH 3QDGE 3VFMA 3UYOD 2H26A 4DW2H 2MJWA 2FBOJ 2X1PA 4NNXA 1I7RB 4JKWA 3SCMC 2BNRB 4NBXB 1CXIA 3AFLA 4FQ2L 1LK2B 3OKNB 3QWRA 3BN9D 3X14A 4QRSA 1ZT4A 5BVJB 1G7IB 3VXMA 4Y5YB 2NW3A 1GCFA 1H3VA 5I17B 4PG9B 5FO9B 3JWDH 1L9NA 1YPZE 2R1XB 1U8LA 2I07A 4RMTA 3EYSL 4DWHA 4IMLA 1WCBB 1U92A 3E8UH 2V9TA 4P59L 1EZVY 2Q7NA 3EYSH 3BSZL 1OOAA 3MFFB 1ORQB 3D1MC 3KYOB 2ENYA 5IB5A 3E2HA 4A2LA 4NKQB 5KN5B 4OI7A 4ZTOH 4IIQC 3HE6A 4NQSB 5D7LE 2ADGA 1U8OA 5BRZD 4NPYB 1CI5A 4M62H 4UTBH 3ZTJH 3FMGH 1KXTB 2YPLE 2CJUH 1NMCC 1QKZH 1TFHA 2VN4A 3C6SB 3L7EA 5AAMA 5SWZD 1MREL 2MPAH 3B2UD 2BVPB 4TSAH 4HHAA 3NCCB 2FGWL 2EXYD 3CX5J 4MS8C 1EFXB 1LMKA 1MHHA 1X4YA 2V9QA 1C16B 3TA3B 3QFJB 3WIFA 4DTGL 5E6IB 5DRNB 1NCDL 5E08H 2CQVA 3TYFA 4PY8I 2XTJC 1FBIH 3VXUB 3WDIA 1X4XA 1P4LA 4P9HC 4BK5A 3NTCH 1H5BA 1PY4A 5KS9B 3MNVA 4LCUB 2DLEA 3T0VA 4UQ2B 3D3VE 2YHGA 4KRLB 2XWJA 1OGAD 1TVHA 3ZE2F 4MVBA 3ZO0A 4PRAB 3KS0H 4L3AA 3MZGB 3DSNA 3TVMB 4LPCA 1MCIA 2JTDA 2WWKO 3MA7B 2C1OA 4HLJA 5JPMA 5D1QC 5FECA 4RZCB 3ARFB 3FB7A 3QXDB 1YYLH 4H5SB 1JNNH 4L4TD 1S9VA 4JJHA 1UJTA 4X7TA 3EYVB 1S5IL 2IPUG 3F7QA 4OLYL 1QZ1A 5I2IA 3I6KB 3OKMA 2HTKD 3BZEB 1XR9A 4RAVA 4FFEX 3H9SB 4NGHH 5I9QC 1PQZA 1HIMH 1A6VH 4G6KL 1RZFL 5CBAB 3EOBB 3PWPD 4ZOBA 3BP6B 4PRHD 4HBCL 4Z7WE 4O51B 1IL1A 3QO1B 3I6LD 2B0SH 3UZQA 4EZMA 5IK3A 3WNMA 1XIWC 3QEHA 4FXGA 4PBWD 1AIFA 4RRPA 3QEUA 1F2XK 5E6ZA 1MCDA 5DD1H 1C12A 1CFSA 4Y2DC 1GC1H 2VRAA 3HI1B 4M3KB 4NN7B 5A2LH 5I6XC 4M5ZH 3KHOA 1SEBA 5KVGH 5CWSA 1G6VK 4XNXH 2NNAA 3X12B 3MBED 4JN2A 2VXVH 1YEDB 5D7IE 4M5ZL 4AEHH 2D7NA 4MZ2A 5J1TC 1GGBL 1ZLWH 3QUXC 4XNXL 2R4SL 3RI5K 5SWZB 4YXKL 5HI4D 1P4BL 3GSRA 1A1NB 5DJXA 1DN2A 4PJ5D 1OW0C 1D5IL 3V5HA 4UIMB 5E2UL 4HG4J 4FQLH 4CMMA 4DN4H 2PXYC 1FNAA 3V52L 3LN4B 3PJSB 5KANI 1I8IB 5DZLA 3UTPD 4MLSA 5GRJL 1T1XA 2FEEI 2I27N 3P9LB 4W70A 4LLYA 5ESQB 1FC2D 4GG8A 4PR5A 4D94A 5K9KB 4X98A 1JYNA 2H45A 2IQAB 4S1DC 4OCMC 1J8HE 4NO5A 4WU7B 2IBZY 3KPOB 4OD1L 4D3CH 2E7HA 1EBPA 3HAEH 4U7MA 3KWWA 1TQCC 4ODBD 3MR9A 5I30H 2DQCL 1K5NB 1M7DA 5FYJL 1QTYT 2A9NL 4HV8A 5B8CC 3VFTA 5KSUA 4Y4HD 4XCNA 4AM0A 4L4VB 4O58L 3WFBH 2VDML 5F9DC 1QLEL 2NY6C 5DWUL 5B3JE 1A4JA 2UWEF 4UV7L 5ISZD 4HZLB 3F6LA 4PJCF 3P40A 2ZCLH 2AJYH 5T1MB 1KUMA 3VXME 3SQBA 1J0YA 2VISB 1H15B 3ET9F 1I3RB 2C4FT 4RRPG 5ITFB 1W0WB 4HWZB 2UUDH 1T03H 2XN9B 1A7QH 4YHZH 3LPGA 1N8ZA 1CICA 3OPZL 4LVEA 4NN5B 5HHMB 2VXUL 1TZIB 5IKCA 1G84A 2CD0A 5CZXD 3VDAA 5IMOA 3BMVA 1YY9C 3MGOA 2RFXA 5GRUL 4OCWL 3HFMH 1KPRB 1DE4A 2ICEA 4NNPL 1F3JB 1U6AH 2F53B 2XN9D 4O2CA 4I3RH 4PGBB 1UH3A 3EFFA 3FN3A 2N1KA 5MP6L 3LMJL 2P8MA 2YWYA 4P5KB 2MTPA 4Y4FA 3H0TA 3VDCA 3QJHB 2I9LB 3SDCC 2HRPL 3P4NB 2H9GB 2Y6SC 3PWPA 4XCEB 4RDQF 2R23A 3QRFM 2ZCKL 4OGAD 1ZAGA 5HHOD 5TDPB 3MV8D 4X4YA 4OLZH 1XMWA 3MLSH 4RWHA 5FIEA 5C0IB 1UA6L 3ARWA 4MJ4A 3ILPB 4FFVC 4I3SL 1IT9H 1J88A 3JV0A 4TTDD 5L9DL 1IVLA 3RTQA 3OPZH 5GJSL 5EO1B 4HXBL 4LRNH 3FB8A 1CDYA 1HNFA 5E2UH 1SJHB 1NCCL 1A0QL 1DJSA 5DFVD 3CK0H 1AD0B 2RFXB 5E2VH 3MLRL 4C54A 4NQDA 1X5LA 3JV4B 3MLVL 3LRSA 3NBNA 4W68A 4NHUB 1BWMA 5H35B 4MA1C 4NQXB 4M00A 3TVMA 2X5PA 3X11B 1U2CA 4L4VE 4Z76A 4WNQB 4IJ3B 2J3SA 1BWWA 2Y7QB 4ZSOA 3OZ9H 3ISWA 4HH9A 4NKDB 4X6CF 3T4AA 4HUMB 1JGLH 4IIQB 5DMKA 1BFSA 4MNGE 4Z7UA 4YHIB 4MQXD 2HT4C 3PGDA 3C6LB 4TQEH 5MHSD 2BNRA 3TF7C 3L5WA 4OKDA 1N59B 2GSGB 3IFLH 3IS1X 4LSTL 4YFLF 3NIFF 5HYJA 5F97E 3FCTB 1QKZL 5HPMB 5C8JA 3VFWB 3I3DA 2AEPL 1CLYH 2VLLA 1ZOXA 1HH6B 2Z91B 1D5ZA 1QEWA 2R0WL 2P1YA 3D9AH 4Q9BA 5GS2H 3TBVB 1MCSA 4PRPB 4I18B 1KN4H 4GW5A 3BXNB 4CBPA 1CR9H 1ORQA 3KLHC 2KPNA 2NYYC 3AS0A 3RWEA 3QWRD 4DJMA 2Q8BL 1PG7H 1WICA 1MI5E 1QOKA 3DYOA 3GJFB 4UV4L 1MLBA 3RU8H 4GS7B 2NNAB 1S7UB 2ED7A 3BP4B 4FQ2H 2BHYA 3RBSA 5DD3H 1QYGL 5DK2B 3JTSB 3PP4L 4QYOB 3PXHA 4M1DL 3TPKA 4LPUA 4PJIF 1NEZG 4EBQH 4QXUL 4B50A 3KPSA 3TNMA 3HZMB 4NO3B 3N1FC 4JDZA 4EUPA 2VDLH 5EORH 4EOWL 3QO0B 3G5VB 3MROA 3P77B 4IDJL 1EFXD 1A7PH 1NGZA 3C9NA 2IAMB 2R2BB 5BW7C 1HWHB 3A67L 2JB6B 4S1QL 1T04B 4EXPX 4LKCA 4OZ4A 1I8KB 4QRQA 1WBYB 3IDUA 4PRHA 3QQ9D 4A6YL 4YZFE 3TO4C 5GS0C 4H8WH 4CUCA 5I0ZA 1DEEB 4MNQD 1FVCA 3VXNA 2NY0C 4ODSL 4K3JH 1KCSL 5TDNB 2AGJH 1N26A 4P9MH 3QI9D 5T3XL 3O45A 4JFEA 5E8DH 5SWQA 3ZKXB 4L4TA 3VXQA 3S6CA 1BLNA 4MJIE 4B7IA 4QXGH 4QTIL 5FDWB 5FO8A 4N1EA 1F58H 1UQSB 2E3VA 3SGEH 4EUPH 4ZUSA 3W0WB 4OBSA 3IDMA 3GGWA 4E42B 4I0PA 5CSBA 5GRVL 4ODHH 3IGAA 5FHAH 5T33H 3P4OA 3EYFA 2WWMD 4HIIB 2QL1A 2E8ZA 4LHUD 4D9LH 2DQDL 1TQBC 1CE6B 5EU6B 3VXRE 1RHHB 1MWAB 5CEZD 1J0ZA 1MCPL 2VABB 1HINL 3MLUL 3B5HA 3KXFE 2HKFH 4LCYA 1JUFB 1DFBH 1KTLA 1R3KB 4PS4H 5GGRA 1MFCL 3E3QC 5B8CB 1KN4L 1OM3L 5DR5H 4KKLC 5FYLH 4ODSH 1VFBA 4I18C 2PETA 2A0LC 1VSCA 1RMFL 4X5WB 3SJVB 1FAKT 3NCYP 4GRLD 4J3SA 3VFOB 5DI8A 3KS0J 5GRZA 3RDTC 3S3SA 1KTDB 4TNVK 5DLML 1IAIH 1ZT1A 5D6CB 1KB5A 4X5XA 2DD8H 4FMKA 1DQDH 3P9MB 1NANH 2JIXB 2Q86A 4JHWL 5SWQB 4XP9L 2IH3A 3S34H 3S88L 4PJ8C 1HHGB 1N2RB 2WBKA 3LKPB 3ZKNC 3G5XA 2ZJSL 3IKCA 4DQOH 4M3JA 3OWEA 2KZ1B 2ADJA 3CDYA 4JHWH 1RZJC 3JWOL 2NXYC 1OARL 4OI8A 1TDQA 3ZE0F 5ID0B 5ID1A 4P46C 2IG2H 2GJ6B 1SJHA 3BUYB 3O41A 4NQDD 3AY4C 2R29L 4JY6A 5D7SL 2Q6WA 3PQYD 2B1AH 1KBGL 2NYYD 3OJDA 4Y1AA 4KAQH 5IBUB 1UCTA 3GK8L 5I6XB 3S5LB 3NN8B 2UYLB 1G7QB 4JGUA 3HNVL 2K9UA 5CMAB 1CLZH 2CLRA 2J7LA 2D9CA 1MUJA 4OGXL 3WO4B 1GRWA 4BSVB 5CEZE 5IHUL 2Z4QA 1X3DA 1J0HA 5L7XL 1QSEA 4HIHB 3UDWA 1LP9F 4JQVA 3SKOA 4JFHE 2R0LH 4Z5RB 1OAUH 1TZHA 5JPNA 2WQRA 1R3LA 3T04D 5EC1A 1P69B 1NCAH 4QY8B 4DQOL 1R5WA 3RGVC 3OF6A 2FYYB 4LU5H 1HZHH 3LQZB 4Z7NE 3V0WL 3N50A 1IGCL 2KL6A 5MEQA 3BKMH 3QNZB 2EXWD 2NX5E 4PRPA 4DGIH 2YRZA 3BJ91 1PVHA 2FJGB 5D1XB 4QLRA 1IKFH 1AI1L 4JM4H 2B4CC 4O2FA 4KJYA 4OUUB 3TH3T 1ERNA 4HAGA 5DQ9A 5GS0L 1ETZA 3O8XC 3TA3D 5E2VL 1VA9A 2Q1EA 5EUOF 3O8XA 4FQHB 1PKOA 5DFVC 1VB9A 2CLZB 5SX4H 1E4XL 4JFPB 4I3RL 5I75B 3HUJE 4FQIL 1DBAL 1SM3H 4OT1L 2A77L 4TUJB 4XNMA 3GUTA 4YDVA 2NY3C 3DMMB 4ZPVB 2IANA 3LMJH 5I1KH 4MWFA 5C07A 4F15C 2Z8SA 4QYOA 5AZEH 1MHEA 5LGJB 4JRYB 5HYQB 4P23A 2MMXA 1NC2D 5DJ2A 5E2TH 3HI6H 1GZPB 4K55A 2AP2A 2XV6B 4LPWA 2AEQH 1F8TL 1I85A 1A6WH 4GRWF 1FE8L 1SY6A 3QHTC 3BPCA 4CMHC 3QB7C 1J0KA 1XF5A 4MNQE 5K9QI 2ZOKB 4U4BA 1V7MH 1ZLVH 2H26B 1U3HB 3H9ZA 4L8BB 3ESVF 5C9JB 1LHZA 3NCYS 3RUGE 1HXYA 3PV7A 3U82B 3THMH 5E5MB 3MRDB 4PY7B 4QRSB 3MJ9L 5CILH 1MHEB 5GS3A 1TPXC 2F5BL 4WV1A 1N6QL 3CFCL 3OB8A 5I16B 2HFGL 1JI2A 2ZCLL 3T77A 5F8RC 3U7YH 2RCSL 4PLJC 5LWYL 2E9IA 2Z35A 5M7QA 5D2NB 3LIZL 4QRPA 5J56B 1AI1H 4UIKL 5GRYA 2A6IA 3STBA 4YHYC 3H42L 1M71B 3QXTA 1DDHA 5CJXC 3N85H 3ZYJA 2P8LB 3K4DA 1VPOL 3RNKB 4KRPB 8FABB 3H42H 5F6IC 2NY3B 3DMMC 3WYRA 3C8KB 2IGFH 3X14B 1U8OB 1ZT4B 4FZEL 5CIPH 3HCVB 4YPJA 3RVUD 1BZ9B 1IAOB 4H20H 5JIIA 5SWSE 4QHUB 3DGGB 2R1YB 4AENA 2NX5A 1JFMA 4WEBL 3R8BB 2W0LA 5EBLB 3K81A 4BFBD 2I25N 3IU3A 1S3KL 2VE6A 3PHOB 4M03A 4LLQA 4MSWA 1DQML 1T0NA 1UQSA 3QHFL 4Z18A 1LP9A 2OK0L 4F7TA 4UIMA 5LQBL 2BVUA 5FUOH 3GJFA 3QIUA 2W59A 4K3HA 1KJMA 2V7NB 2X4UA 4NYLB 2VL4A 4HIXL 1VFAA 4NQEA 5FM4A 3BGFC 5MHSE 3S35L 2NX5B 4F3FB 1NFIA 1MRFL 2P49B 3CU7A 4XAWH 4PJFE 2JF1A 2CRZA 4TOYH 2GT9A 4I5BB 2BRRL 3G5ZB 4ZO9A 1J1OH 3WHE0 5LGKA 2OZ4A 3HS0A 2Y23A 3VCLB 4RZCA 1XGPB 4OZGF 2YBRA 3LIZH 5F9WC 2GTWA 2UY7A 1FZJB 3HZMA 4NO3A 3U2SB 1TTFA 4ENEC 2UZIL 1JNLL 3FQNB 2R1WB 1ZT1B 1D6EB 1T7YA 3A6BL 1KIPA 4YDIH 4BZ1L 3JXAA 4JPVH 1NBVL 4PJ7A 4ZFOA 3MLZL 1YEKH 2H3NA 4RWYL 2VLKE 3ARFA 3FB7B 4PJGF 5DHXB 2YA0A 1LEIA 1S3KH 1X5JA 1HCFX 2J1KA 2A6JA 4I9WD 3PV6B 4MJ2A 4N90D 1H3PL 3PHQA 3O9WB 3LH2H 5D2LE 2XN9A 5E2TL 4N5EA 3SDYH 4Z0XB 3L9RB 5EWIL 4V1DA 2YUXA 4Y16D 4MNGA 4J3XA 2CKBH 2X1WL 1UCBH 3DVGA 1G9MC 3MCLH 2NXZB 2EDLA 5LGHH 2NXYB 2LU3A 5FKAB 2YXMA 4M48H 3I6GA 3LKSA 2FO4A 3CSGA 3WFDH 1JHKH 4L1HA 3VFNA 1RIUH 4J8RB 3BKCL 3NCEB 1OWRM 1IKNC 2EDQA 4BSWA 1CT8B 4GSDH 3P0YH 3FT4A 5CZKA 2VLRD 2GITB 4HS3A 4UILH 4N9GA 4KU1A 5F44A 1KPUA 4W6XB 1M05B 4HJ0D 1LO5A 3TA3C 1FNSL 1YNTA 3GEWB 3U30C 3WJLA 2QHRH 2VIRA 2V2TA 3RNQA 1T1XB 3RGHA 3VFNB 2AW2A 1JI1A 1NC4B 4HBQA 5SWSD 4CJ1A 2XY1A 1Q9WA 1I7ZB 1HKLH 3MUJA 4LKXB 3BRDA 2H32H 3L3IB 2X41A 4FXLA 3MV9E 3T1FB 1F58L 4E41A 1YECL 2AV7A 3EKCA 2JKXA 1XIWA 5LVEA 4Z0XA 1ZMYA 4XNYL 4M61A 1A6UH 4UU9A 3FB8B 5D71L 2HAZA 2R29H 1CE1H 4JO2L 4WIQA 1NUNB 3S97C 4NRYA 3DV4B 4B41A 3UZEA 1NCUA 1Y6KR 4YIQA 5IB1A 4NQDB 32C2B 3V4PL 4ESKA 4K7FA 3RWCB 4TOYL 5FGRA 1IC4L 1K9TA 1TJHL 3CSPA 4ZPVA 4MS8A 3D39D 4XVTL 4K3DH 1IGJA 1AJ7L 2EO1A 3L3GB 4UDTB 4X7DC 1JPGB 4LQ1A 1INEH 4PRNA 1K85A 4M7LH 3DV4A 1J87A 2JIXD 4H1LB 5IMOB 1N7MH 1J7VR 1ZS8B 1A6VL 3VMOA 3O0RH 4O00A 4MD5A 1A14L 2EH7H 4M7LL 2K1MA 3OKOA 1RIVL 4IHOB 1F4XH 2YZ1A 4YE4L 3DBXA 1OAUL 3RNQB 3WLBA 2IFGA 4YAQA 4MVBC 3EFFB 1F4YH 2BMKA 2Z31A 4HMDA 5ITFA 4KKNA 1OD9A 2ARJQ 4D9RE 4YFDB 5E8DL 4WFEE 3OGCA 3SE4C 2B8OT 1AP2B 2FL5B 4OCRL 2O5ZH 3QT2A 5DRXA 4G5ZL 2FX7L 4RIRA 3R1GL 3IDJB 4U6HA 5I19H 1MI5A 2R2EB 4JO2H 5JW4N 1D5MA 1UCBL 2OTUA 5LGHL 3QUYA 4NZUL 1R3JB 2X4TA 3RWEB 2HMID 3D3VA 1JJUA 3LCYA 2XZCL 1HDMB 4KUCF 3RZCA 5DMGC 3CAFA 4KJPC 2XZZA 4OF0A 3V6ZA 2EYTA 1KBGH 4MXWL 5F3BB 1MI5D 4HKZA 1ZSDB 2EYRA 3W0WD 1A7OH 1MFEL 2DQDH 1J8HA 3RDTB 1I8MA 1HSBA 4NHCL 4G42A 4FQJL 4LEXH 4XWGL 3QA3A 3FRPA 5C07D 4FQLL 3ZLQC 1TCRA 5KOVC 3R0MA 5B39B 5ENWA 1TMCB 4Z0BH 4UILL 1IGYA 4PRBA 3UMTA 1ZLVK 1IGIL 4EQ3A 5HYJE 2YD4A 5EN2A 5C0RL 2XTJD 3HI1A 5C0NC 4M7JL 2VYRE 5F3BA 1IFHH 2DBLH 4HKZB 4NJAL 3S98A 1X7QA 1QA9B 1I7RA 4PTUA 4WTXA 5HHQB 1QSVA 2NY5C 3MRNA 2NY5H 5JR1L 5CP3A 3VWKB 5JLZB 2HFFB 3RPIB 5GGQH 3FFCB 4JQIH 4XCCH 5I1GH 4WW1B 4GKNA 1WK0A 3HUJF 2RBLA 2E7LA 1A6UL 4XVSL 3QPXH 3ZSSA 3P30H 3RVXD 5F6HI 1AHWB 2WW8A 5IB5B 5BJTB 5IF0B 3MV8A 4HJ0C 1IARB 3X11A 1B2WH 5AD0A 3RUGF 5EOQH 4AIXA 2E9BA 2E7BA 3B2VH 3QXDA 1NLDL 2RB8A 5HI4C 3RDTA 4HF5H 4KTEH 5HYIA 2ATPA 2WBJC 3SGDI 5HHOE 3TT3L 3IDGB 2CK0L 2IQ9L 3P11H 3O6LH 3RL1B 3OR7B 5C70A 4MCZA 1OPGH 4ZNEE 1BZQK 4ZXBC 4BKLA 1BVZA 1RZKC 3B9VA 3NZHH 1YDPA 4HPYH 1HSAB 3ARDA 3NH7L 4GW4B 3VW3L 3WE6B 1EAPA 4CN4A 5B3NA 5HGBB 1AR1D 2NY7H 5CILL 3OR6A 3C08L 1NH6A 3AS1A 5IIEB 4NN5C 5MEND 1PKQE 4B7LA 2H2PC 3BRGC 3LDBB 1ZVSA 4M5YH 2XOTA 1F2QA 3MNWB 1GXEA 4G9FE 3V6FB 2XKNB 4AEEA 1KPRA 4Y2OA 2UZIH 3FHAA 3CFBA 5MEPB 5IFHL 5EZJA 3D2UD 3DYMA 5KAQG 3TF7A 1IT9L 4Q6IC 4RA3A 1MNUH 4FZEH 2A0LD 2VC2L 5JA8B 3WUWB 4R4BB 3UYRH 2YOCA 1IGFH 5CSZA 4Y7MA 3OAZH 4QHLB 5LJYH 2CRYA 5DT1H 1KSRA 4ZD3H 4KUZL 3O4LD 3T8XA 1WZ1H 1UACL 3IDXH 1QSFA 3CLFH 5ID0A 4YHLL 1T7XA 3U6RB 3QO0A 5KVDH 4GKOA 1WEJH 4LSQL 4CN6A 3FQWB 2X42A 4U49A 2AV1A 5DJYB 1CBVL 1KCRL 5TFSH 2AEWA 3G6JF 3IXTB 4G8FA 3U9PH 3BN3B 2VDQL 4S0TD 4LFHD 3EDJA 3HB3D 4OD2B 1Z3GH 2H3NB 5TFSL 2VXSL 1DBBL 4D0CB 1JYXA 3VW3H 1EEYA 3Q5YA 2YD2A 4BELD 3JV6B 1QACA 4HQQH 5L2KA 5IROA 3F5WA 4ZAKD 4KDWA 5SWZA 4R26H 5IM7B 1BGXH 4GXVL 3UX9B 2VH5L 5F9OH 4DZBA 1I8LC 4LOUD 1GIGH 1XF3B 5DHVB 3MO1B 5F9OL 2DLFH 2D7QA 1UJ3B 1JFQH 2X6MA 3QI9C 2FO4B 3NFNB 4WY7L 4OB5H 2GQHA 2CJUL 4M8QB 3B6SB 3MOAH 2YK1H 4QO1A 4HFUH 1JGDA 4Y5VC 4QT5A 3ULUE 1EPFA 4R2GD 3TNNB 4GLRH 4ZS6D 3GBNH 3WO4C 3ZHDA 4K9EH 3N0PB 4UT6L 1G0XA 4POYA 4PJ5E 3OF6D 1U8LB 4TVPH 3GGWB 1HN1A 4E42A 1PG7L 2GAZA 4RIRB 5JOFB 1FO0B 4Q6IB 4UBDC 1WEJL 3KYAA 3QBTB 3NACH 3BH8B 1D5XB 1JPTH 1TLKA 3MLRH 3DTXB 5L8JB 1RUAH 3MRPB 5GIRB 3WFHB 2W38A 5BCAA 1HDMA 2QADC 4JR9H 2FD6L 4LDLB 3WS6A 2HVKB 3RKDD 3AU1A 2FH8A 4K7PL 3OXSB 3W9EA 3GMNA 5ACZA 3HNTL 5BZWB 3DI3B 5FGCE 2DMBA 1KC5L 3N06B 4LCIH 3T2PA 5LG1A 5JIHA 1S9WA 2OL3L 3ARDD 1HYRC 2AQ2A 4S0SD 3VG9B 2VQ1B 3PWNB 4GAYA 1QFUL 1A9BB 1EFQA 4FP8L 3AREA 1XR9B 1A7NH 4RAVB 1FNGA 2R0KH 4CKVX 3RKPA 3BPOB 9CGTA 1AO7D 3SGKC 3SQOH 3VRJB 5CZXC 1IZKA 3K2UL 3MMEA 4F7PB 2XWJB 4YQXH 1RUPH 5CINH 2X4PA 1CYGA 4TUKH 4WVRA 2AS5M 5EU5B 2B4CL 1OAQH 4WU5B 4G80A 4LSPH 1FN4A 4PJIE 4HS8L 1L7TH 4NM8H 4MYWB 1IGFL 3MGAA 4KY1H 1GOGA 1I9RL 3FFCA 1ED3A 4Y4FB 5IVXE 2UUDK 1P9MC 1XGYL 3NIGF 1E6OL 4JY6B 1BREA 3RVWC 5B4MC 2DL2A 5FV2A 4KVCL 2NY0D 1P1ZB 3RWIB 3BH8A 4X6CA 2YD9A 1B6DA 1FYTE 3KPNA 25C8H 2XNAA 4NC2B 5I76A 2PW2A 1TQBB 2ADFH 3FQRB 5JW5B 5GS0D 1YEGH 4HS6B 4MAYA 4HULB 4WNQA 4MJ6B 5K93A 4DKEH 5E4EB 2BXZA 3DOSA 1A7QL 4YHZL 5KVFH 3LS4L 3K0WA 4G6ML 5GISL 1U3HC 4YXKH 5ABDE 5IUSA 3DGGA 1IE5A 2R1XA 4WDIB 3Q5OA 1TJHH 4GG6B 1WCBA 1IAII 4NQVA 3EO0B 4O2EA 5CEYB 2A73B 5H37G 1T5WA 1KACB 2HTLD 3H9HB 3OKDB 1DVFC 4PD4J 2FJFA 5HSFA 3D2UA 4HWEL 2PYEA 3DVNB 5HHPB 4GG8B 1LK2A 1T1ZA 1MCPH 2W0KA 3O45B 3NA9H 1EDQA 2VSCA 1NFKA 2YRPA 1T2QH 1B0WA 4X5LA 2Q87A 1I8MB 1RY7B 4HFUL 4HHAB 3U7AA 2FLRT 4PB9H 5GHWL 3IT8D 2IAMD 4JVPA 4YDLB 4LDEB 3V9FA 5HYJD 4LIQE 5FYLD 1RJCA 3NFSH 4P23B 5DFTA 4PGEA 3SE8H 1A6ZB 4AYFA 1K8DA 4NZTL 3L3OA 2L7JA 3P4MA 4PRDB 3TN0B 1QO3B 4ZG1A 2GTWB 3QDGA 2ZOKA 4G59A 3VA6A 2VDRH 3RGVB 3QIBB 3WDJA 5HVWA 1QPXA 1YEIH 5HHME 5EZJB 5EUKB 4U3HA 5L2JB 3OKLB 3R4DA 4G6JL 1XIWD 3GI8H 5L0QB 5IVXF 2YPVL 1U8PA 1YYLL 3U0PB 1JWSB 3KLSA 3WJLC 4OF3A 5ISZE 3ARQA 1ZLSL 1YMMB 3QNXA 1CL7H 3S4SA 3E8UL 5GS1A 4AT6B 2P47B 5GS1C 5HVGB 4PJBE 4PJCA 4F7EB 4XVTH 5GGSB 5JOEA 4XAKD 3B9KC 5EUOB 2Y07L 5EUKA 4NM4H 5TE4L 3GSNL 3C9NB 5ESAA 3JWDC 1DUZB 4U6XA 5C0RH 5J13B 5J7CC 4PJFA 3PIQA 5A2IH 4JANA 4PJBA 5TE4H 5EOTA 4IRSC 5ICXB 4IRSA 1RUPL 4V2CB 3DNKA 3QQ3A 1Q9OB 1HINH 3I84A 4LPVA 4C83A 5GS1B 3BISA 3IDIB 4IOFD 2AK4D 5IMKB 3QR2A 1X5GA 2M1KA 3BMWA 4QWWC 2EICA 4AG4H 4QOKD 5DS8B 2PR4H 5SX5H 1Q9LB 3RZWA 4G7YL 5GJTH 4LMQE 5C0EA 5L7XH 1DUZA 4U6XB 5IFJB 5I1EL 1MWAH 3NA4A 2C1PB 3O6MH 3PWLB 3OAUH 4FMFA 2OYPA 4E0RB 3KYMB 2VTFA 1P2CA 3I3BA 4PJIB 3D18A 3AAZA 2G60L 5JMOC 4G7VH 1GGIL 4V3EB 1KLFA 2F5AL 1Q94A 2QQLH 3MCG1 4ZDHB 1BIIB 1IBGH 4CJ0A 2JK5A 2E5EA 4UINH 1JWUA 4WHYG 4K7PY 2F5AH 4U6VL 1A1OB 1NUDA 4UB0L 3TJHC 4IJ3C 5FUCC 5TDOB 4KDTA 2PYFA 5E95B 1S7XA 4G6AC 1MJ8L 4NQCE 1Z9MA 1UC6A 4Q6YA 3RIFK 1K4CB 4PJ9A 4Z7NF 4R3SB 1X5FA 4QTHB 5CP3H 5IG7B 1U8KB 4HUVA 3MJ8A 5IQ9B 2E9WA 4YHOH 1T1WB 2NQCA 3BH9A 1S7VB 1MCOH 1A6TA 3KLDA 3CX5K 2PR4L 4MX7A 4X4ME 4X4MA 4MA3B 2YMXL 5IR1A 1QSFB 3ARRA 3MRBB 4KI1A 5C09D 5KG9B 5T1LD 1PEZA 1PSKL 1U95B 4O5LL 1RU9L 4L29B 4UV7H 1OP3H 4OF5A 4RX4D 1A4JB 2IQAA 3REWA 3BKYH 3VRJA 4OD2A 4OQ1A 5DD5H 3P4OB 4XX1E 1P6AB 15C8L 4WTZA 2VLLB 3RWFB 3VXOA 4E0RA 3BH9B 4CVWA 5C0JB 3PNWA 2GY7B 4G9DA 1U8QA 5LWYH 4XP6H 1OCWL 4HV8B 4RAUB 5KSAC 5C08D 2D0FA 3D25A 4LLDA 4UNTA 4IM8A 2QSCH 1JV5B 4JFDB 3MLXL 2FZ3B 1IKFL 4N9GB 4OV5A 1JL8A 4JG1H 3G04B 1ZGLM 5DMKB 5F7MC 3MV7B 3GMRB 5TPWH 2DDQL 2LU7A 4OFVA 1PFCA 2V2WB 4APQA 3GMLB 1RUQH 1FP5A 3SDAB 3FQRA 5AUMA 3NN8A 2F54A 1N3NB 5CJBA 4J3OC 3V79C 1MCJA 3K74B 3E0GA 2BSRA 5BRZE 5KJRH 3MLYL 1I1YB 4ZOEA 1XGTB 3Q3GA 2ZG2A 5CLTA 3DJ9A 1MUJB 1CDGA 4OCYH 3UYPA 1BGXL 2VWEE 3FO0H 5ID1B 1KCUL 4NWTL 4X6EA 2F54B 1EEQA 2Z8VC 1J5OL 4Y2DB 3L95A 4P99A 2XTJE 4MQ7B 2HG5A 5HI3D 4UNVA 3CVHA 1FYHB 2VITA 4PRHB 2AJSH 5CSGA 3PNWB 3HLAA 4OLUL 5ANMB 4HXBH 1AFVH 5D5MB 4WWKA 4JHAL 1CS6A 3B43A 5H2BB 4OLXL 2BVOA 4EDXA 1JV5A 1WWCA 1E28A 4U1HB 3DI2B 2H6PB 4OCWH 5HGHA 1A5FH 4Y2DA 1X5KA 3WKML 5INCA 3KPMA 3QIBA 1RD6A 2AAVA 5FGBC 3IVKB 4Y16A 4PLKD 1XAUA 4F3FA 5EBWB 3WJJA 3TJEH 3CX2A 4KVNL 1LDSA 1OP5H 4FXKB 3ARBB 3LZFL 3WFCH 5J0BA 4WEMB 3I02B 3T2QA 5DJ2B 3O2DH 1W2KT 3C60A 3O11B 4Q0XL 1WIOA 2D7PA 1S5IH 4OLYH 3FO9B 2ATPB 4HH9B 1JYWA 1AY1L 4MD4A 4ZS6C 1AGEA 3FO2B 2ITDA 1LQVA 2OCFD 2VZSA 3V4VL 1B3JA 4JKMA 4WW2C 4XP4H 4KPHH 4YHKL 4ALAL 1S7TA 5DQ9B 2FBJH 2ZUWA 4GQ9L 5C0DA 2J4WH 1RULL 4XAKE 2EYTB 3VXMB 3PDOA 5BQ7B 3FT3A 3FOLA 4Y4KD 2B4CH 4IRJD 3G08B 2LAGB 2MCG1 1F3RB 4PJAE 1LNUB 2EC9U 5GZND 1FIGL 2C4FU 2V6HA 2A9MH 3MRQA 3GMPB 4O9HH 3KR3L 2I26N 5E9DD 3ME0A 4LAJH 1IZJA 2DQEL 4LQFH 1WV7T 4R4ND 5FKAA 3EFDL 2W9DH 2CXGA 1S78C 3EYQC 4POZC 2VDMH 3ZTJG 3O2WL 2ZWLT 5T3XH 4RNRB 2M2DA 4PV9A 4LARL 5C09A 2DYPA 4P2CG 4GAFB 5FAAA 8CGTA 4QWWD 2G5BA 1FJ1A 5D1QA 3TFKA 5KANG 2G2RA 4MB5A 1MEXH 1FL6A 3BEVB 3HE7D 5CBEA 4NNYB 3MCLL 4J4PD 3E6FB 3WL9B 1NAMB 3IJYA 3F12A 2AJ3A 4PRHE 5D1ZD 1D3CA 1INDL 1J10A 1J18A 3F6IA 4N0UE 4PJ9D 1AHWA 4LCWE 4PRPE 1MFDH 1MH5A 4W4NA 2FWOA 3DO7B 5DK2A 5F89A 4OZ4B 4QRQB 5C86A 4YX2H 4KMLB 3CPLB 1B0GB 3RIAK 3A6CH 4PJHB 5AZEL 3BQUC 4AH2B 2SEBB 3BWAB 5D1ZB 1D5BB 2GTZB 1PD6A 2HA1A 3FAWA 5E08L 1CK0H 4YH6A 2FJHB 5F8QC 1A14H 2EH7L 4LVHC 4F57H 4KZEH 4UU9B 3FT2B 5FK9A 2OZ4L 3GRWL 4HUUA 2CLVB 4LKCB 3ARGB 3RVTD 4NHUE 3FN9A 1BX2B 1WLHA 4I0PD 2GHWB 5I1LA 1JNHB 1KELH 1GGBH 1G6RB 4FFZL 2VZVA 2XQBH 3UTSD 3NFNA 3ULUF 1MIEL 4AH2A 1YJDC 3ZDYF 4HDIA 4Y16C 1EZVX 4G9FD 2NY6B 2ADIB 1HZHL 3PG2A 1T7WA 2FIRT 2NY3D 3H8NA 4CVXB 3LEVL 1FC1A 4MCZB 3T65A 3HUJB 5B22A 4O4YH 4Y4KB 1RFDH 1OW0A 1SVZA 3ARXA 4ONGH 1BFOB 3HFML 1CE1L 3WNOA 1J8KA 3OMZA 3VH8G 1NCWL 3F12B 1E4JA 4JFFE 3EYFB 1P9MA 4U7SA 5A2JH 1FVDA 5F7NC 3RL2B 5HHNB 1PG7W 2BOCB 5D93C 1KPVB 1MHHB 2HTLC 1RZFH 5JORB 4MMZC 4J4PA 1BJ1J 3IYLW 3L3KB 4J4PC 5DZOA 1QP1A 4P3CL 1UKTA 1KB9J 3S3JA 4HC1L 3FAXA 4JZNA 2GEEA 4G8EB 3SEPA 3QAZB 2ZUTA 3MBXH 1U3HD 3CJJA 3MX0A 1F8TH 5F1NA 2WQ8A 3BYTA 1H3TA 1KTRL 1VFBB 3HC4H 1SHMA 2W9EL 2EKSB 1ZLWK 3FZUC 1U3HA 3VGEA 1R3JA 2X4TB 3SE3A 1OAYH 1R24B 1SEQH 4PR5B 4JFFD 4J3VA 4YGAB 1YEEL 4PJDF 5CCKH 3LEXA 3QDMD 5SV3A 2JIXA 3OAUL 4YBHA 2DIJA 4XHJC 5FCUH 4AMKH 1UADC 3TV3L 3D69B 1FFPA 3SDDB 5BMFH 1KV3A 3QDGD 4KGJA 2GSIB 1ZXQA 5DUML 5CD5D 2RCSH 2G60H 4LU5L 2XA8L 5EU6E 5LBSL 4CVXA 4IS6A 3B2UC 5DJZB 1NCCH 3O3BA 4LSRL 4GJTB 4KWUA 1CL7L 1EO5A 3B3IB 1VDGA 3NMEA 3AC0A 4KI5D 5HYSA 3PQYA 1RJZB 3BPCB 1WBXA 2IJ0C 2AJZA 5GRUH 4DN4L 4YWGL 1B2WL 4OZGE 1EERB 5TQ2L 1DANU 2NXZD 4JPIB 4BH7B 4JFDE 2XNAB 4YWGH 2ATKA 2JCCA 1D9KD 1UB5B 2W91A 1R5IA 4NP4H 3WXWL 4XGZA 4EI5C 4KHTL 4GAJL 4NRXB 1OM3H 5D7JC 1R3IL 4X7TB 4H1LA 1BFVH 4ONFL 5CWSB 4JO4H 1F00I 2HT2C 1AGCB 4BQ8A 1DDHB 2ZCKH 3ECBA 1QSEB 4HIHA 5D2LF 2ORBL 5IF0A 5TDPA 2WP3O 2J6EH 1FVEA 5DK0A 4MAYC 4KMQA 2I24N 4OZFG 1XCQB 3HCVA 5ACZB 1HHIB 1ACZA 3DLQR 2ZSWB 5I8KH 4O51A 4WI6A 2JCCF 5EPMB 3GM0A 4JFFB 2ICWA 2JJTC 3WFEL 3H9SE 2GSIA 3U7YL 4WWKD 4R4FH 3OBAA 3S96A 4ODUB 5AEAA 4UDTA 2HKHL 1CLOH 4BKLB 1IGTB 2NY4B 3TVMD 4HEME 4X6DE 3TN0A 4QRRE 5E8EB 5C08B 4S2SB 3AU1B 4HGKC 4PYGA 3AB0B 2ZCHL 3LQAL 4K8RH 2BSSA 4N5ED 4Y5XB 5C0BD 4MD0A 1QYGH 5L2JA 4XPTL 4JFQB 4TVSa 4KRNA 4IOIA 4KJQD 4P5TC 1G7LB 3MNZB 1U8HB 1Y18A 3GSXB 1GAFL 1DQLL 5DRNA 3VD7A 3OZ9L 1ADQH 3GJEB 5J3HC 2X44D 4NZDA 3S4SB 5C9KA 1N5YL 1IILE 4D0BA 4JO4L 5HGHB 2E6QA 35C8H 4IRSD 4Z95L 1F3DJ 3QWOA 5KS9E 3CDFA 2FATH 4UQ2A 4XCFH 3U9PL 1FNFA 4M48L 5LQBH 1MHCB 2Y1VA 5E2WH 3JV4A 1I9JH 4Y5XA 3KPPB 4ODHL 3X13B 3L3DB 3CLEH 4TUJA 2GFBA 3GSVB 5HD8D 1NAMH 1FCCA 5LXGH 3SE9H 1A22B 3GBMH 3VU2A 1NDMA 1C16A 3FCTA 4LDOB 4PJAF 4PJXB 5H94A 2VR9A 2NR6D 5DVOA 4LGRB 4OZGB 4XZUB 4FTVA 1AH1A 3MV9D 4XRCA 3MR9B 5I73B 1KPUB 3TO2A 2NZIA 3VRIB 4NKMB 1VCAA 1N7ML 3ARBC 5DUBA 1VKXA 1INQB 5C7XH 2JJWA 4PTTA 1DL7H 1I1AC 5A16A 1ONQB 5FYLL 1URLA 3U36A 4GFTB 3DVGB 1UXWA 5FB8B 3T0EE 4DN3H 4HUUB 1JIBA 4UUJA 5DVMA 1KN2L 4WFHE 4S2SA 2DKSA 3CVIH 5I71C 5IHZA 4MXQD 43C9B 2ZPKH 4FQ1H 4EJ1C 4QHMB 5C8JB 5IMMA 3NCBB 4F33B 3STZA 1YQ2A 4KI5E 1I3GL 2HLAA 4PJDB 1PAMA 1CQYA 4HDIB 2R9HC 5F9WB 1DUYA 3RY4A 1UB6B 4HKXA 5IROC 1J12A 3LZFH 4PJIA 2FRGP 3VXTA 1MIMH 3AB0C 2A73A 1R5VA 2QHLA 1IMHC 1IRAY 1CF8H 3CC5B 3F58H 2ID5A 5DFWH 5FGSA 5JXAH 4Z78B 3O6KL 4MXQC 2CKBL 4JFOB 2X9YA 5F1IB 4GKSB 4XCYA 4I0CC 2ICEB 5EIIB 1F3JA 1MRCL 2K3TA 1S7UA 3NZ8A 2CR6A 3EGSA 4WUUE 4QRPD 5C0AB 4UT9L 4XVUD 5J89A 4H8WC 4PGCA 2AXFA 5HI5D 4DCQB 2ED8A 2BK8A 4P5KA 3CMOL 3EHBC 5DXWA 3WHXA 1OAXL 1MAMH 1IGJB 1OLLA 4LL9A 3RY6A 4OIIL 3D85B 2WBJD 5E99H 1ZVSB 4KHXL 2WNGA 5MI0B 4GXVH 1FIGH 3L3OB 3W39A 1U91B 1X6NA 5FA4B 4G43A 1FZJA 2AV7B 1YNKH 2X4UB 3RX8A 3PWPB 4F8TA 1D5XA 4EUPB 3DTXA 5KG9A 5HD8C 3CFBB 5MEPA 3MROB 4MQXC 3QEGL 4YHNA 1G0YR 1WSST 1YN6A 3GFUA 3PWVA 2GT9B 3DVIA 5IHLB 5F9AC 4PV8A 5E7BA 4XMPH 4RDQG 1IQDB 3LN5A 5IVZB 1RAMA 2EIZB 3S7GA 4PJ5A 4UOW1 5IESH 4C83B 3MUZ1 4WFHD 1MHPL 1CXKA 1M7DB 1SVCP 2KUTA 4ZTPH 3UAJD 3D25B 1XF1A 4KKBD 2AABL 1CZ8L 1C5DB 4JFDA 3MFFA 4YO0A 3K4ZA 1XZ0B 3S35X 3O6KH 4R0LA 1LO0H 3PQYB 3ETBF 5K9KA 2FECL 5GGVH 5C08E 3I9GL 4DVBB 4YXLL 3D85D 2BNRE 4PJAA 3MYZA 2NW2A 4P46D 4BH8B 5I1CL 3KNBA 1NLDH 4XWOC 3UJJH 4Q9RL 5K9JL 2IANE 5FDWA 1WIUA 3L9RA 5DHYA 1BQHA 1PZ5A 3TYFB 2MQCA 4L4VA 1XCTA 1XGRA 5BVPL 1V3LA 3BZ4B 1BHGA 1OY3B 3MO1A 1U3JA 4IRJA 3RWDA 5C7XL 4GT7A 3ZDXE 1LEGA 4EN3D 3LKSB 3M8OL 4ZFGL 1UZ6E 3NOIA 1KB9K 3KXFA 2ZUQC 3G5YB 3O4OC 3U6RA 4JRXA 3RWGB 5F21B 2HMIC 4RQQA 3ILQD 2PTUA 4KKLD 4AK1A 4EN3A 1X5YA 1AXSB 1LEKB 1WFOA 5DK3A 4WI8A 2WAHA 3MACH 4N0FA 3L3KA 4D2NA 5JTWA 3UZVB 3U4BL 3FT4B 3V0WH 4BFGA 3DX8A 3KPQB 3ES6A 3MJ9H 1WC7A 5T1DH 3TBYB 3JWOH 2XT1B 1JWUB 4U31A 3L7FB 1A6TB 1ZLUK 2EDEA 1ZGLP 4R2GC 3ULVL 4WFFE 1LQSR 3GRWA 4WUUB 1ZA6A 2FEDD 5D70L 4ODUA 3HZYB 4GMTL 1E6JH 1H3XA 4MVBD 2D4DA 3TCXA 3V6OE 5D70H 4PLOB 2DTMH 2WANA 4DK3A 3H9SA 4K71B 3K80A 5C0IA 2PNDA 3V0VB 5HDOA 5TQ0H 1HHJA 4QHNA 4PFEA 1JHKL 1EGJL 4KAQL 3U9UB 1YYML 5I1KL 5IEKB 4N8CL 3W81A 4GRMA 2XWBB 5EIQA 4M8VA 4EQ2A 1OSPL 4QOKE 2FHFA 3RHWF 5J4MA 3HZYA 2FHBA 4XBGA 5L2KD 5DJ0B 2CK0H 3SKNB 4RFNB 1HXMA 2IAND 2PUQT 4HMCA 2DICA 3SKJH 1GVIA 4HFWB 1T21A 4PPTA 4GMSH 1J8HD 1KEML 1F4XL 2EE9A 1EHLL 4D3CL 5FGBA 4W4OC 2VAAB 3HR5B 1OAYL 2OZ4H 4WO4B 3QG7H 1J0IA 1KJ2L 3RX5A 4M1GL 2Z93A 5F70A 1F97A 5CJQL 2DD8L 3UP1A 3QUYD 1OVZA 4L3CB 2A6KA 3D87B 3NPSC 3LKQA 2Y06H 3PQYE 1EEUA 4IEFB 3WD5H 1S5HB 3C08H 2ZNXA 4NJ9H 2AK1H 4OZGA 4XZUA 2F53D 4PUBH 1ZTXL 3TBYA 4UDUB 4PJCB 2CLRB 4K71C 2AK1L 1CFVL 5D8JL 3GMRA 1JWMA 2AABH 4P4KD 5EB9A 4NBZB 43CAB 5HHMD 3U36B 2H32A 4JKPH 2W92A 3D0LB 2PXYD 3AM8C 4HLZG 3SDAA 3EO1A 1QBBA 1NCWH 4R2GB 4CVZB 1W0VB 2IPTL 2GK0B 2WK2A 4WHTB 3Q0HA 4N8CH 3C8HA 4OF6A 5DRWB 1KTLB 1R3KA 3L5XL 5EBGA 3GK8H 1ZHLA 1HSBB 1KGCD 2DM3A 1CDJA 3DRTB 3NIDE 2D03L 1AQKH 4JZJC 1QHPA 4GW5B 5LGJA 3U48A 3MZTA 2FJFB 4X5WA 1UACH 2NY4D 3QUZA 3MBEC 1OQOA 1UKSA 2A2QT 4LVOB 4U1LB 1OLZA 3CFDA 3RBGA 4X83A 1K2DB 1IC7H 5JHLL 4ZS7L 4YEFA 4OGAC 3B9EA 4PTUB 1A3RH 4OF8A 3MACL 4MNQA 1U8JB 2Q76A 3TEUA 2OXGA 1U8HA 1Y18B 3AAZB 4XCCL 5F96L 3N1QC 4L4TE 4QGTA 4WI3A 1NBYB 2D4FA 3JTTA 1JPSL 1P4LB 4NOBA 4UIKH 1WFNA 1KCKA 1FAIH 1RVFL 3MRLB 4AIZB 2C5DC 3IVKA 3P77A 3C5ZD 5DJYA 2WZPD 5DEZA 4GBXA 3L3HB 1YN6B 4NWUL 4OQTA 3TC9A 5HHPA 3PXJA 4KUCD 3REVA 3WN5C 1FO0H 5BS0B 5M95B 3EO1B 3QUZD 4R3SA 1EGJH 4YPGB 1BX2A 4QF1A 5BQ7A 4UTAH 1ZA3B 3H0TB 5D7JB 1KFAH 4FQJH 4LEXL 4XWGH 1OL0A 3NTCL 4KROB 5J1SC 3SDYL 2I5YL 4HK3J 3BP7B 3MRGB 3HMXA 5I2IB 4NP4L 4X6DA 4XB7A 2ESVD 1OD7A 3TESA 3VXNB 3OXRA 2AEQL 1WTLA 1UWEL 4N0YH 1M7IB 1C12B 1JRHL 4P2OA 1KG0B 1QLFB 3O3DA 4LK4A 1YDPB 3Q6GH 2PYED 2YSSA 3CH8A 4K3EH 4ODTL 2OTWA 3VXPA 1I75A 3B9KB 1DANT 4XMLL 3A6OA 5CJQH 1OAKH 5E00A 3U4AA 3QNZA 5DJ6A 4HQQL 3OR6B 5IK3B 4ELKB 2DQJH 1G7QA 3CC5A 1NL0L 3LVEA 4HT1H 1SYVB 2JB5H 1L0QA 1LO4H 4YFLI 3MXWL 4F7TB 2X70A 1CLCA 1SBBA 1DCLA 4JFOA 3X17A 1JZ7A 1B4JH 3IFNH 2C3GA 1VPOH 2D7MA 1UM5L 4F7CB 4CN1A 4HJJL 4OM0L 3MJ7A 1AXSA 1KNOA 3PIQB 4KROC 1LEKA 2DQFA 1VFOA 4N0FB 5ICXA 3WEXB 4P23D 3GKWL 5L6YL 3QAZC 2APBA 2J8HA 4F58L 5J12C 1TNNA 1MCLA 5DMIL 2UVEA 4ZTPL 3WN5B 5BZDB 3ULUD 5JQ6H 1IQWL 4IS6B 2Y5TB 3O3BB 4R97C 4DUVA 3VRLE 1JMZA 5FM5O 1QBML 1Q72L 5F72S 1Z3GL 1F6AB 5D7LA 5JOPE 1MJ7L 2AXGB 4JPIA 1DVFB 3BKCH 3G6DL 4J8RA 3GDBA 2P43B 4MZ3A 1SYSB 1FLRH 2OSLA 1G7MA 4LF3B 4MNHB 3SJVD 2ICES 4X80H 4JFZL 2VXQL 3EDFA 3R0NA 3TBSB 4L29A 2P8PA 3ZTNH 3ROOA 3S36L 4LASL 3C8KA 1S9YB 2WIIB 3MCKA 3T08A 5C0GB 3VE0A 4BH8A 4M1CD 2OP4L 4RGMC 2CMRL 1WISA 1OF2A 4PJEA 1MNUL 4GBXC 3TBTA 1QD0A 1SYSA 1VFUA 4L9LA 4QTHA 5IG7A 4Y5XC 1BQHB 1PZ5B 4TNWF 1UM6L 4TVPD 1OTTC 4LLUB 3HZVB 4BQ9A 1T6WA 2ICWB 3TGXA 2CKBA 4OCLC 5JXEA 3W5NA 4G8IB 2HFEA 2HLFD 4XXCC 2EECA 1J0JA 4C58B 4BSVA 3G6AB 2QEJA 3CFEB 4KVCH 4PRID 2R23B 3LB6D 4AY0A 2VXVL 4TNVF 2B2XL 2XZAL 3ZDZF 3VD4A 5JXAL 1UZ8B 5BS0E 4WUKH 3RX7A 4P49A 2GK0A 3CUPB 3N9GL 5IB1B 5C0ND 1CQKA 1CGSL 4N5UA 2YD8A 1FORL 3OAYK 1UXSA 4QEGA 1CGVA 3JWDL 4F7EA 4KK6D 1AD9A 1VACB 4N8VA 3UPCA 5HY9B 3TT3H 4XP5H 3UO1L 1EO8H 4FNLH 4UQ3B 5J1AA 5MEOA 1CIUA 4D9LL 2YD1A 1A6AB 3V5KA 2B5IB 1TZHB 4OCXL 2CDGA 5JPNB 5L88L 3CU1A 4KJPD 4QCIB 3O81A 3RVVC 1WBZB 3TLRA 3L3JA 3BZFB 1II4E 3E6HA 1FH5L 5CJ8A 1JK8B 2XWBA 1R5IB 1AD9B 2MOVA 1RZJL 2AJUH 2V5YA 3GBLA 2GJZB 4LRIC 1HXMB 3HZVA 1RK1B 3NFSL 5IT2L 4PIRF 4Y5VB 5E8NB 2DMKA 1JTOA 5E70A 4M5YL 1YC7A 3VWJC 4K7PX 5GGSY 1BZ7A 4UT7H 4X7EC 4CU7A 4JKPL 1D9KC 3IU4L 5BV7L 1QVOA 4J1UB 1VEMA 1AHWC 5GS0H 4U1IA 3TO4A 4OI9A 4OGYH 4CW1A 5T1KA 1MELA 1IM9D 2VABA 5ALCL 4J23A 5DSCA 1OHQA 5C09E 3QQ3B 4P46B 4RA0C 2BNUB 4FG6D 3WV0A 1YYMH 3UJJL 4JRYD 2A74B 3TCLB 3F7YB 4NQVB 3H3PL 5DQDH 4FNLL 3W82A 3ARVA 4KK8D 4Z0BL 5I71B 2XACC 4V1DB 4L8BA 4IBLT 4C4KO 5ENWB 1IGYB 4PRBB 2OI9B 2R2CA 4I8DA 2AXJA 4G6KH 4G8GB 1MY7A 5CD3A 3S36H 1NBZA 5KTEL 2GI7A 1A4KA 2DQUH 5JW5A 5D6CA 1T1ZB 2FX8L 3BUTA 3MC0A 4NPYA 1DBKL 2NY2C 3SBWA 1ZSDA 1AC6A 3VXUD 4WRLA 4OLEA 4ONHB 4GG6A 2X1OA 1CLZL 3HTLX 1N0LA 4MX7B 5C07E 4O2EB 5CEYA 4XT1C 5GZNC 5DR5L 1A9EB 2DQCH 4XXDA 2HFFA 3QFJA 5K9OA 3CIQA 5F1KC 2HWZH 4G8GA 5HJ3A 3VFSB 5DQJA 2JK5B 3HNSH 2LU4A 2XFXA 1I8LA 4QXTA 1A6PA 3QEQB 4ZO6A 4YR6B 3DXAB 5ADPH 1LO5B 4AEHL 1J5OH 3V7MA 2BDNH 3VWJB 5DD1L 1NCAL 3QIWB 4WI2A 4WWID 4Y19A 5F3HA 2YPVH 2P4AB 2DBJA 5EG6C 3K2MC 2OMBA 4JGJA 4JB9H 4DFHA 1KNOB 3UBXA 1CTOA 3BHBB 7FABL 2XYCA 1AE6H 2CXKA 3LN5B 4L3EA 2VLKA 3VFVB 4C57C 3CXDL 1U58A 2XRAH 3ZHLA 1JN6A 2F19L 4ODVL 3PGCA 4DVRH 2BVQA 2XRAL 5IP4A 1TJIL 3QHFH 1JGUL 3EHBD 4M61B 2Z4QB 4N0YL 1KJ2A 5BV7C 3BZEA 1HIML 4M02A 3ULVC 1S7WB 1HHHB 2NLJB 3WO3B 3UTPE 3BDYH 1BM3L 1EO7A 3CDGB 1NGYA 3LD8C 2DTSA 3ARSA 4K7FB 3I2CL 1BD2E 1WITA 4GAJH 2NY7L 1UB6A 3TZVB 2DKUA 4BFIA 4JQIL 5IIEA 1JPGA 2YMXH 2O5XH 1MWAL 3SGDH 1BQLH 3INUH 3QFDB 5GXBB 3QWQB 1RJYB 5KBNC 1U93B 1HYSD 4Q7DA 1T83A 2FX9L 2OTWB 4XPFH 3VWJA 4JDVB 3FQXB 4BH7A 2HG5B 3MOBH 3EGSB 1YA5A 1CLYL 1G7HA 2HJKB 4P2QA 1JTPA 3SKUD 2X4NB 3H7BA 3ERYA 5CP7A 5F89B 3GKWH 5L9DH 2DB8A 5GGVY 3P73A 4F58H 3DX8B 2V5MA 3ES6B 4R8WL 3V8CA 3SCMA 4EIGB 2HFEB 1B90A 3V52H 1U36A 5HXMA 4E41D 2VLME 4F37K 3FRUA 5I1IL 4KMTH 1F02I 5C9JA 4K8RD 1BBJA 3V0AC 3TIDA 2OL3A 4Q97A 3DURA 5ESQA 1KPVA 5I1JH 4HPYL 5DD3L 1UH4A 5D7KD 2HRPH 3B9DA 2N4IA 4R4NC 1YEFL 3CZFB 4P59H 5JHDD 5HBBA 3QXVA 1FGVH 2GCYA 3E2HC 5LCVH 1MEXL 5F1NB 3QCUL 1HH9A 1QFUH 4MS8D 3GI9L 2PYFB 3QDMA 5CUSH 1QRKA 5ILTH 2AJXL 2F74A 2FB4L 2OJZH 4Y4KA 1JF1B 4Y4KC 3FRPG 4M62L 4UTBL 3K2UH 4HIJA 3TN0C 4DVBA 4G8FB 1IM3A 4N5EC 2OP4H 1Q9KB 1TVBA 5INCB 2EYSA 4NGHL 3DMMD 3WLWD 3C6LC 1X7QB 5TGBB 4KKCC 3FB6B 5EU4B 3JBG7 3VD9A 4JAMA 5L2KB 3F5WB 2P45B 3BIKB 5DJCB 4FXKA 5FKPB 4KGLA 3I02A 4NC1C 4HKJA 4PLJD 1CFTB 2EDKA 4ZUTB 3BZ4A 3KPRD 4FQXC 1GGUA 1CGTA 2BOBA 2YC1B 3SO3B 3UPRA 5F93C 2M8XA 1NEZA 1CICC 3FFCE 2EIBA 2IMMA 2QADD 3WUWG 1FG2B 2BJML 5ALBL 1QSFE 3UDWC 4GW1A 1H3PH 1G7PB 2HT2D 1CD8A 5DSCB 3JUYA 2DIAA 2F53E 3C5SB 4ZFOL 5C0FA 1KF9B 1IC5H 1AO7E 3D39B 4X8JA 2OL3H 1LVEA 1RUMH 5EDXA 1XGTA 3GI9H 3U0TB 5CBEB 2P44B 1H3GA 3GSOA 3UJIH 4BUHA 5JIKA 4KJYB 2KZWA 4OCXH 1UYWL 3ZTNL 1Z0NA 2Z31D 3QFJD 1RJZA 2COQA 5KSBF 2R9HD 3UTTB 1XCQA 3C6LD 3QZWG 4P0DA 3GMNB 4OSUH 1WGOA 4DUWA 1RULH 5EZIH 4ETYA 2SEBA 1BAFH 5KW9H 3T0WA 3GHEH 2XZQL 4ZPTA 3M17B 3OB0K 3ARED 3D0VB 1FL5A 4Y1AE 4K9EL 4CADB 4IOFC 4Y89A 3VDBA 1JNJA 4KTDH 1T7VA 1LO2L 3ARBD 4RBPK 4AL8L 5HYJB 3RTQC 2YPKA 3BPOC 3MV9A 2HYMA 3MREA 1VEOA 4WGWB 4WHDA 3HI5L 2NY6D 1T6VN 3MRFA 1YMHA 2CIIA 3QZWA 1PKQB 1K6QL 3O2DA 3QP3A 1FG2A 5FYKD 3VI4F 4WUKL 5FYKL 4GOSA 3REVB 2ZJSH 4Q0XH 4OZHE 3VGGA 3VFUB 5KVFL 3MRKA 3BD4A 4U1SB 5FECB 5CJOL 2ED9A 3BDXA 1N6VA 4L3EB 3GJEA 3VFVA 2MFNA 3PP4H 5HHMA 3HG1A 3NCFB 4JM2F 2E9JA 5CJOH 4QRPB 1XF5B 2IPUK 1M05A 3I9GH 2LE9A 1EO8L 4QNPE 4LVNC 3OKDA 5F1SA 2CK2A 3P2TA 4M8QA 1INDH 5CFHA 3LS5L 1M7XA 1GPOH 2JE8A 5F7WC 3MV7D 3BW9B 4S11A 4DAGH 5GPRA 1EHXA 3DUUB 3RPIA 2CDEA 3VWKC 3X3FL 5IB2A 4AEFA 2YD3A 5JZ7C 5DRWA 4LHUB 2ICWI 4EI6A 1WVZA 2A74A 3TCLA 4DK6A 1QFWI 3VFMB 2BP3A 2VMFA 2HWZL 4MMXC 2LVEA 3ZL4L 3H9HA 3WFBL 4JPKL 2P5EB 1EJOH 1RJYA 4U6YB 4QRRA 1BFOA 2XQYG 2X4OB 3U4EA 1UGNA 3HZKB 4OJFL 5FF6A 3LEXB 4J2XA 2F5BH 5AZ2H 4IRZL 4OJFH 3BKYL 1H8NA 3MGTB 1IL1B 2YA1A 2ADFL 2GFBB 3GSVA 4P2QB 3KPLB 5JQHC 1MHPH 3MRIB 7FABH 5IB3B 1S7SA 1MCFA 1W72A 1NGPH 3HS0B 2R4RH 1G6RH 3BX7C 1A1NA 4M6ML 1FORH 1U8MA 1NJ9A 1WQVT 4P48A 3QEUB 1DZBA 4LSRH 1ZHNB 3QUMA 2DLTA 3LPFA 4WEUD 4L3ED 2CLZA 4MD5B 4XP5L 4OFPA 4NQEB 3UO1H 3BWUC 4JREC 4EVNB 4MDIA 2DM2A 5IBTL 4YXHL 1JPFB 4ZAKB 2Y36L 3IJSB 3ULSA 2R2BA 3KPLA 2BNQB 3M1BB 2AXFB 1BM3H 3V6BR 3MUGA 3ZKSD 2VQTA 4PJ7B 5D4QA 5I8EB 1U9KA 4JFHD 1FJ1B 4DGVH 2FLBT 1AKJD 3CXHK 4ZNEA 4JRXD 3MNWA 5IBLC 1CGUA 4P3CH 1ORSA 1ZHNA 3QUMB 3LV3B 5FYJD 2GTZA 2Z8WC 3O3AB 4N8PA 4GXUN 5A3ID 2P7TB 1E27A 2H1PL 5C0EB 5IFJA 1F5WA 2W9DL 2O5YH 3HA0A 2G5RA 1M7IA 3GMOA 2QR0B 2VLJA 5F6IB 3CLEL 3KPSE 2QQKL 1WAAF 4XPFL 2H1PH 1AO7A 4R7NA 4GKSA 3QDJA 5KSAB 2Y06L 2E7CA 5KSBB 1BF2A 3NABH 1FPTH 3HAEG 5I1HH 5I8KL 2G9HB 4XVJH 3QDJD 3BIKA 3ARZA 4LCWB 5T3ZL 2X1QA 1ZE3C 1T5WB 3HR6A 5E6YA 1HQ4A 3BGMB 5DJ0A 1N0XH 2FDBP 3AROA 4L8SC 2P8LA 3RNKA 5EZOL 4UB0H 2VDNL 1LDPH 2ZUVA 2L7UA 4QHKI 3EYOB 4R90L 2ERJB 4JO1H 3BVNB 4K23H 1UJ3A 1A1MA 1MJ8H 3T0EA 4YHLH 3ULUL 4J7RA 1X4ZA 4UZGA 4BQBA 3NPZB 1JGDB 1J05B 4BFEA 3BDYL 4W81A 2FR4A 4GW1B 1MFNA 2P5EE 1BVKB 2V17H 4Z77A 1Q9WB 5BO1H 5E8PA 1EEZA 4PJ5B 1QNZH 3IFPB 5JXEC 5HHXH 1KB5L 4HMEA 5GGRB 3MRJA 3NCJH 4D0BB 5IB4B 4JKLA 1M6OB 1YY8A 1QNZL 2V2XA 3QDGB 3MRMB 4JEGB 1PGRB 4Q9CA 5CUSL 2IADB 3BN9C 1ZLUH 2Z8RA 2FGZA 3OJ2C 3HC3L 3P4LA 3X13A 1QLEH 5DI8B 1FCGA 4KKCD 3WKNA 1A3RL 4PLKC 3MRCB 4IDJH 2XXCB 3GIVB 3K3QA 5I1DA 5CAYB 5FOBA 3BGAA 1I1AA 4JG0L 4F37F 3VG0H 4Y2DD 3KNBB 3U83A 4MQTB 3DRQB 1ZHLB 1JK8A 3EAKA 4ZXBD 3QXWA 3RTQB 3U2SA 1UVQA 4HKBA 2WM0A 4XNQA 5K9QG 3BKML 2Q8BH 1BOGB 3WFZA 1LE9B 1YEJL 2F74B 1AXIB 1DLHB 2XG4A 1KYOK 4H0GA 2PCPB 4UMGA 1E4KA 4U1LA 2BNQD 1YC8A 2BFVL 4M7KH 3RI5F 5GZOC 1P7QD 3GO1L 3MMEB 4JFEB 5F7DA 5I66B 2VL5B 5AG9A 2R8SL 3VXQB 1T4KB 3OX8B 3CSBA 3WLBB 1JTTA 4P2QE 2EE6A 6FABH 2DQTL 5HDBE 2ARJB 2A83A 3VFPA 3VXSE 1ODAA 2VQ1A 5JIPA 1ZWIB 2BSRB 4QXWA 2XWTB 5D1XA 3IFOA 3RHWK 4HK0B 3V5HB 3EO9H 3ZT6A 1LO0L 3WSQL 3S8WA 5IQ7H 3PHSA 1FE8H 2V2WA 4K9EC 3UTQA 4FTVD 5B21A 5JHDB 2GK2A 1MJJB 1R3HB 4NNXB 1XR8B 4KJQC 2ATKB 2JCCB 4OLZL 2VISA 5E2WL 1O7SA 5GSRB 4D8PB 4PGCB 2KQMA 3HKFA 5DUPH 4PJBB 1JBJA 1MCHA 4Q2ZB 5DVLA 3BE1L 4H88L 2AJSL 2NY2D 5EUOE 5I0DA 4XNUL 3W39B 2WWKT 1I4FB 3VXSD 1U91A 3WCYA 1I9IH 4Y4HB 1YEJH 1YNTB 1CR9L 3CFEA 1NEUA 4YHMH 1MCNA 5CGTA 1AC0A 4HWUA 4F57L 1BOYA 1KTDA 5IMLA 5F7EH 3WKMH 4YR6A 4PGJA 1JHLH 1R6VA 4YZFF 4Z8FH 1WZLA 5DLMH 2P24B 1H9VA 1NBVH 2AQ1A 3PGFL 3JTCA 1N2RA 3LKPA 5L6YH 2Z35B 1H8SA 1OT2A 4RGNE 4M4RA 5DJ6B 3UBXB 3I50H 1G7LA 2Y6SD 5D93B 2XIDA 4HWZA 4KKAD 4FQPA 4UBDD 1V7NL 3DIFB 1B88A 2B1HL 2DQIH 4GMTH 4CRPA 5A2FA 1A6ZA 3C60B 3O11A 1F11A 5E1AA 1NJ9B 1BFVL 3ZYOA 2H8PB 4ZUWA 4JR9L 2QLVB 5EN2B 1KCRH 5KS9A 1O7VA 4G8GE 3MGOB 5EZLA 4PJAB 1S7XB 3P9WB 1KTKE 5IHBA 2AK4B 2ORBH 4D9QD 1HKFA 5C0JA 3LS5H 4U3XA 4H88H 5HHQA 4QRPE 3E3QA 5TF0A 4QT5B 1TETH 4G6AD 1DFBL 5K9JH 3KPSD 1U8KA 5JDSA 5ACMA 4WV1B 1WWBX 2DQJL 2R0WH 3O4OB 2ZUQB 3AVEA 3AUVA 3V4UL 1RK1A 2XZQH 4F9LA 2GYSA 2CUIA 5JNYA 1WTGT 4MXVF 3QEQE 1M1SA 1KXVC 3O0RL 4XCEA 2J8UB 4XP1H 3IAGC 2BCKB 4LVHB 3QCVL 4OZHA 2C3VB 5H35A 3LKRA 3VXSB 4FABH 4ZXBA 5DMYA 3OKKA 4KFZC 3MOAL 3CFIC 3UJTH 3CFDB 4NFBA 2ARWA 4MJIA 1RZ7L 3O3EA 1FFOA 4I48A 5ESVA 2R0LL 3PDOB 2AXGA 3OGCB 2ZP0T 1AGFB 2ZUYA 3HRZB 3W9DA 2Q3ZA 2G9HA 5MEQB 3S37L 5T1DL 3VFRB 2DL9A 3O4LA 4PYHA 4OIAA 4LPXA 1EMTL 5IWLC 4U33A 3QPXL 2PTVA 1FZOA 4QRTA 2OI9A 3BIAX 3W0WA 4Z95H 1NFDB 3IDNA 5HVFB 2GJJA 4KI5F 4NNYA 1KIPB 2NMSA 3V6FA 1SEBB 5DO2C 2P42B 3NGBB 4GO6B 5DUPL 2WUCL 3HLAB 1MAML 4YDVB 2IH1A 1T66C 3O4LB 5D5MA 5GRWA 5CEXB 1EVUA 3ZYZA 2X4QA 3ZDZE 4I3GA 4PY8J 3PUCA 4NQEE 4RBPH 4MAUL 5HDLA 1XGPA 4RGOL 4G8GD 1SYVA 5BXFB 2HVJA 1W0YT 3KXFD 2H2PD 2MKLC 2XPGB 4HUNB 2BVQB 4N1HB 4O9HL 1ZA6B 2XKNA 1REIA 5L88H 1F6LL 4XCYB 5J8OA 3PDGA 4X6DB 4KKAC 4EVNA 5JHDE 3HR5A 4X6EB 1TVHB 4DOHB 4F7CA 4WGVB 2DYPD 2QTEA 3MLZH 1HHHA 4PBXA 2LTQC 2XICA 1YJDL 1T0MB 3GIVA 5IESL 2BY0A 4GRWE 4MA7L 2R39A 3B9KA 4PJHE 2DWEB 4PRPD 5EU7E 4H5SA 1D5ZB 2E27L 1XH3B 3QIUD 1JN6B 1OGAB 4I2XE 2DM7A 3HPLB 4P3WA 4CNIA 4JAMB 2XPGA 3LY6A 3KPSB 1VERA 4M43H 4U1MB 2FO1A 4ELMA 4JM4L 1UFUA 2MCPL 1RUKL 4C56A 2QBWA 4D9RD 4P57B 1JZ2A 2YD6A 1MCEA 5EO9B 5IOPB 5BJTA 4MA8H 4N8VG 1CLOL 1T2XA 3H3BC 1PJ9A 2VC2H 4L9DA 5IJKC 3OTTA 2AJVL 1I7ZA 1LWRA 1ZV5A 1RURL 4P23C 5IEHB 4KK9C 2FIKA 3MTRA 1KENL 3BP4A 3GNMH 1ACYL 4XBEH 1T66D 2ADJB 3QNYA 4YBLB 5FV1L 4YDLC 3B5TA 5MP6H 5AAWA 3OQ3B 4RGNC 4RAUA 2OR9H 1KENH 4MA3A 4PJGE 2EC8A 3RUGA 2I5YH 3A6CL 1WT5A 1A6WL 2IQ9H 5D72L 5FXCH 1PEWA 1XCTB 1XGRB 4R0LB 3TJHD 5E8NA 1BP3B 4F9LC 3REWB 2NTSP 1FHGA 3QCTH 4ETQB 2AK4E 4U1NB 4JRXB 5A1AA 4K3JL 3PWUA 1OB1A 3R8QA 5GGTH 1QBAA 4G9DB 3L6FB 2BOCA 3TJHA 3KYKL 3E3QE 5DJ8A 4L9LB 4OCRH 5TH2B 4JFDD 5DJAA 4AMKL 1T3FA 5T1LB 4KQ4L 4RFOH 4POZD 3GSWA 4XC3H 3SDXE 5DHYB 1DVFA 1A8JH 1NBYA 4HT1L 4PRNB 3HPLA 1UZ6F 4HIEA 3SGJA 2MCPH 3O3UN 2O5ZL 5T3ZD 3HAEB 3R06A 4JO3L 4C56B 5A3IC 4YAQB 4LLYB 3AREC 3CDCA 3CK0L 1E4WH 4X4YB 3T2NL 4FQHA 3MV9B 2YPKB 4JANB 1JMXA 4P5TB 2RJMA 4Z7OF 1Y6MR 1IAIM 2R2HB 4RMWA 1KJ3H 5E8OB 2P24A 3OGOE 3DPBA 4S1SH 1ADQA 1QSFD 3RZCD 5HDBF 5IEHA 4JPVL 2FIKB 3BI9X 1MLCB 4ZYKB 3ULVF 2X05A 4FZ8H 4GRMB 4FFYL 4HWBH 4MGXA 3GSNA 1P84J 3DVFA 1IGIH 1QSEE 5J6GA 2V9RA 3HI6L 1NGXB 2BVOB 4BQCA 1FL3B 5I75C 1TCMA 3QQ4B 2DJUA 1QFOA 1A2YA 3QUYB 2WINA 3PWPE 4ZQKB 4PJ8D 4HFWA 4G8IA 5JXED 4QRUB 1NMBH 3O8XB 5A43C 2AJ3B 4OZIB 3BKJH 3C2AL 1VFMA 3S5LG 5DRZA 4ZNCD 4NO2B 3UTTE 5JR1H 2V5TA 2GKIA 2OTPA 3CCHB 3P0VH 4NJAH 3DO7A 2Z93B 1UZ8A 2CUHA 2AKRB 2A83B 2A9NH 5DURB 1AXTL 3V7AG 3C5SA 5J6HA 5GS2D 2GJ6A 3T3ME 3MOQA 2J88H 2BSED 4JO3H 3KDMA 3VI4E 3QQNA 4ISVB 4Z7VF 4YDIL 4BZ1H 5F7EL 3LKRB 4ZXBB 3VXSA 3FO1B 2DS4A 1WUNT 1KJ3L 1ND0A 3LHPL 3IB4A 2BZDA 2ZG1A 5FF6B 2EDRA 3VWKA 2P8MB 4PG2A