5HGHA

Hla*a2402 complexed with hiv nef138 10mer epitope
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hghA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hghA01
3OHXB 1BOGA 4N0CD 1WWCA 5L6YH 3HR6A 4X99B 1XIWC 1XF3B 3GO1H 4AG4L 5KSAC 5IMKB 5IV2B 2HRLA 2HFFB 1T0PB 2FATL 2HFGH 3CLFL 4R2GD 1T7ZA 1SVZA 3O6FB 4QXUH 1RUAL 2AJZA 2LU4A 5F3BA 4G6JH 1YJDH 5HI5C 4LQ1A 3O6KH 5DK0A 4PJ7E 5DK2B 5SX5H 3DHJA 1AGCA 1CK0L 4HDIA 4TUKH 5HHMA 5EA0L 4JRYB 2JK5A 1IEAB 1BVKB 3QEHB 2H9GB 4Y19D 2XA8H 2PXYA 2IAMA 4PJGE 4APQA 4M03A 4XRCA 1LGVA 5IESL 3QBTB 3VXNB 2ZUQC 4GS7B 4EVNB 5I1EH 4NKOB 2NNAA 1K2DB 3C9NA 5B8CA 1IAKB 5I16A 3RDTD 3BKJL 3GSXA 5BVPL 1IGYB 5D71H 1RIVL 5ADPL 2AXFB 3OPZL 4X4YA 4LVOB 1I1CA 4LARH 3RVVC 4JO3H 5DUPH 5GSRA 5GJSH 2D0GA 1R5VB 1MHCA 3QHFH 2Y7QB 2Q1EA 3VI3F 2X4OA 1H3TA 4IBLT 3S4SB 3KNBA 5D72H 1BAFL 1XGTA 4Z5RA 4ZFOB 4LLDA 3V52H 5FO8A 2FCBA 5IMOA 1I8IB 4Y2OA 2ZKHH 4JHWH 2VR5A 1BFOA 2BVOB 2EDHA 3D9AL 3H42L 1EIBA 4U1GC 4MLIA 4NHCL 3NFNA 5EFIA 5SWZE 2CKNA 5JOFA 1QACA 1MCKA 1CGSH 4QNPE 3MZGB 4QXTA 4XPGL 2R1WA 2YN3A 1RUQH 2VISA 3IRPX 4RAHA 3GSVA 3QDGA 4WU5A 3S34L 4GRWF 1UENA 3VXTA 4U1KA 2IALB 3HE7D 2KKQA 1IQWL 5IK3B 4NGHL 3QNXA 2UVEA 3B9KA 1AD9A 2AV7B 4WU7B 5D93B 3B2UC 4EOWH 4TPRL 3VXRD 4S1RH 4OFIA 1WCBA 3P0VH 2EO9A 2XG4A 5BXFB 1CD1B 2J4WH 3WFBL 5T5NF 3CFEB 4M62L 5A43C 5HDQL 3C8KA 4JFPA 3RVXC 2OTUA 4Q2ZA 1KENL 3ARQA 2ZPKL 1UACH 3EO1A 4HUXA 1RUML 3MACL 4R97C 3QPQC 3IDNA 3EDKA 5HPMB 2D3VA 3D48R 1H3PH 2NY0D 2YD7A 5DJ6A 2PUQT 3B2VL 1RSFA 4PRPB 1DVFD 4GRWH 5J0BA 3DROA 3WE6A 4XVSH 1QLEH 1V7NH 2W0FB 5FCUL 1SYSA 4RRPG 1D5MA 3OKOA 1XGPA 3UYRH 4ESKA 3O0RL 2IADA 4M48L 1I9IH 2A0LC 3HR5A 2NMSA 3I2CH 1UM5H 4BK4A 5HYJB 3BO8B 1J1OH 1X5IA 1E4XI 5D9SB 1MCRA 3SDDC 3VW3H 1X7QB 3Q3GB 1NAMA 3BGAA 1BQLL 1J10A 2KZ1B 4B5EA 4XI5D 3RBSA 2FJHB 1PG7L 2IG2L 3TZVB 3RTQA 4QRTA 2HRPL 2DQJH 4K8RC 2MQ3A 4PJEE 3TVMD 2L4OA 1A0QH 4ZFZB 1RY7B 2DMCA 3EZ8A 4L8SB 2N1KA 1EXUB 1IGJB 3GKZA 4JKWA 4X5WA 3RUGF 3QIWC 4LSVH 4RWYH 4NN7B 1ZHNB 2CJUH 3VCLA 3TF7A 1DBJL 4NQSA 4HG4K 3MLSH 2CUHA 1Z0MA 1A14L 3SKMB 2YXMA 3HN3A 2ZSVA 2DIBA 3BX7C 1EEUA 3VFNB 4I3SH 1B0RA 2X70A 3H9YA 1RUKH 4ERSL 1QSFA 1CXLA 5FYKL 3IRZA 2R2HA 4PRNB 5L8JB 4Y5VB 5C0IA 1BD2E 3BGMA 4K3EH 5E6ZA 4Z8FL 1QO3A 2H6PA 1RZKH 3DO7B 3DURB 4QCIB 4U1MA 2RFXB 1EAJA 1OY3B 3JUZA 1OGTB 3DMMA 5HSFA 5DWUH 5IBUG 4JJHA 3GSNL 4DQOL 1DANU 4DN3L 3OR6A 2FO4B 3RWGA 5F9WB 5C9JB 4OZHE 1F3DH 2ESVA 3S96B 1BOGB 1HKLH 1OT2A 4FG6D 3NTCL 4MNQD 4JM2D 3QO1A 2CPCA 5MI0B 1A6UH 1P7KA 3VFRA 5AAWA 1FNFA 3LQAH 1IILE 5LBSH 2JB5L 3BRFA 1YYMH 4ODUA 3SDAA 1EFXB 5DK0B 4UQ2A 4XBPA 1F4YL 3BQUD 4HDIB 4OZIB 2BXYA 2OR9L 2Y72A 5E6IB 2H2SC 3TH4T 5A3ID 1FVEA 1QYGH 2JK5B 2C4FT 2CK0H 2FO1A 4P9HL 1J11A 4UTBL 1JZ4A 2WBJB 2R39A 4PJIF 3SKNB 2PXYB 2IAMB 3RAJH 4JPVL 3TFKC 3BP6B 3EOYG 3QHTC 4X9HA 1A7NH 3BPLB 2VQTA 4RX4D 4M6AA 1B88A 3ARTA 4J3TA 1NGWA 3ZDXF 1DLHA 3C87A 3UJJH 4BA8A 3C9NB 1KULA 3MV7A 4NCDA 3C5ZC 4JN1H 5FECB 4I2XA 1F8TL 3GSXB 4YBHA 2HT2D 1Q1JH 5E8EB 4NOBA 4X4YB 4GBXD 1GPOL 5GSRB 2X4TA 3B6SA 3CSGA 1MHCB 5KANG 5IQ7H 5T1DH 3V6OA 3MXWL 4JDZA 2YA2A 5SV3A 3ULVF 3MBED 1G9MH 4ZS7H 4KUZH 2XXMB 1K3ZA 3KNBB 1XGTB 4Z5RB 4L4VD 4EBQH 5KJRH 4LLDB 2E9IA 1IMHC 4IDJH 1BWMA 1AO7D 1EZVX 1EEQA 3O41A 1SJEA 4GJTB 3NFNB 4OKDA 4YDJA 5TE7H 3VA2C 3JV6B 3STLA 4G7VL 4AEFA 3MLWL 4QXTB 4KVNL 2R1WB 4M1CC 1I8KA 2VISB 1RZIA 1U8QA 3GSVB 3QDGB 3HZKB 3VXTB 3QI9C 1ZGLA 2XV6B 4JZOA 4ZTPH 3ULVH 2ZCHL 3QNXB 3U30B 3B9KB 1AD9B 1NUNB 3T2QA 1N6QH 1B3JA 3LS5H 2G75A 3ECBA 4R0LC 4CN1A 4WO4C 3C8KB 2OTUB 3GDBA 4IRJC 4Q2ZB 4QRSA 5I30L 3EO1B 1H3XA 3IDNB 1UM4L 3RP1A 5FXCH 4TSCH 3INUH 2X4UA 1NC4D 4NN6B 4NFCA 3DROB 2DN7A 1BJ1J 1HHHA 5EOCJ 1MFBL 4HIEA 1MIMH 5KSBF 3FT2B 4CMHB 1SYSB 1D5MB 4ZAKB 1XGPB 3WLWD 3S36H 3K8MA 1A1NA 1NAKL 2IADB 2R4RL 5IM7B 1K4CA 3HR5B 5JHDE 1FO0H 1IAOA 25C8L 1NCCH 5AZEH 5KVEH 1LE5A 4PJ7A 5F3HA 4Z18A 4R3SA 1SM3L 1HIMH 1NAMB 2ARJB 2DQHL 4R4NC 4RMSA 3DX7A 2D4DA 1CXFA 3OJDA 2NR6C 3RTQB 2QLVB 3LEYH 4PJGA 2VDLH 3PGFL 4LDLB 2VWEC 1NFDF 4Z7UF 2ITDB 1EJ6A 1N0XL 2F53E 1OQXA 3MV8E 5HD8C 5IOPA 4X5WB 5HGHA 5E2TH 5FGBC 2CUMA 4BJLA 1QOKA 4P48A 5H2BA 3GHBH 1MOEA 1YEHH 3HZYA 4FFYH 4NQSB 3QUXA 4PLKC 4OUUA 1YEJL 3T0VA 3PWJA 4I0PC 3QPXL 4FZEL 5ETUB 3F7YA 4LSUL 4L3AA 2M26A 2QQQA 2H1PL 4MJ5A 3HC0A 4TSBL 2ZSVB 3O81A 2D9CA 1MCWM 3NAAH 5I71C 4WFFD 4YBQC 3OKMA 3QO0B 4N0YL 1B0RB 2FB4H 3GSUA 4HC1L 1QSFB 4LLUB 5FHAL 4JDVA 5J13B 2GY7B 5C0IB 5GGRY 5SWZA 5CINL 1QO3B 4F15B 1DN0A 2H6PB 4OB5H 2FX9H 3DPBA 3GBML 3O6MH 4U1MB 1XIWD 4R96A 1QPPA 2E6JA 1CICA 3O6FC 5KSAD 3ULUC 3NCJL 1CDIA 2OP4H 3THML 2F19H 5HVWA 3LKSA 4K7FA 3X12A 1NCWH 3OR6B 1UWGL 1DSFL 3RWGB 3ET9F 5HI5D 2ESVB 1X6LA 2DIJA 2EE6A 1JGUL 4IRSD 5KSUB 3QO1B 3NIFE 1M7IB 1Z3GH 4CMMA 4LRNL 4X98A 1P7KB 1R3LB 1TNMA 4OQ1A 2I07B 1MJ7L 2Q7YA 3RY4A 4J8RA 3VU2A 4HT1H 1HINH 1K5NA 2JF1A 4ZPTA 4F58H 4ODUB 1I9JH 3O4LE 2VL5A 3SDAB 4LVEA 4G8GB 4EN3D 4UQ2B 1SEQL 4YK4B 4XBPB 4LP5A 3U0WH 5LXGL 4M7LH 1CDGA 1OAYL 4LHUA 1P4LA 5J6GB 1NMAH 4MXWH 3T0XA 1P7QD 2GSGB 1TMCA 2OCFD 3RVVD 3TO2A 3O9WA 1P7HL 5T3ZE 5JW4N 1EUTA 4MYWB 5FUCE 5ISZD 3E8UH 3G9VA 5DJ8A 1NGWB 1DLHB 4GW1A 1T20A 3MV7B 4I2XB 5HHVH 1YEFH 3E2HB 3PDGA 5ACLA 3Q5TA 3UAJC 2X4TB 4HBCH 2FBOJ 2IGFH 5A16B 3RPKA 1DUYA 1YEIH 1KT2A 2K1MA 3CJJA 3C8DA 1MREL 3MRLB 1RZFH 4PJEA 1EMTL 4WTWA 5IBLD 4FQ1L 4HUUA 1TITA 4XWGH 2EDJA 5HHPA 3D87B 1ZHLA 2YKLL 3HAEA 5DQDH 2P47B 3FOMA 3SDCC 5D93C 3O41B 1B4JH 4PIRF 3H3PH 4HUMB 2EDBA 1HHIA 3FAWA 4JQXA 3IDYC 1JHLL 5L9DH 4J4PD 2DKSA 2WAHA 4LSQL 1NC2B 5FA4A 4C55A 3B2UD 3STLB 2FH6A 3BMVA 5EWIL 5T1KD 1J0ZA 1CD9B 1RZIB 2BNRD 4I77L 2YOCA 1M6OA 4ORZC 1ZGLB 3QUZC 3EO9L 4M3JA 2J8UE 4QGYA 1T21A 2B2XH 3IU3A 4ODTH 5EZOL 3KYMB 1WITA 3FO2A 1HHKB 1BD2A 3WLBA 1LK2B 3ECBB 4NPYA 3P4MA 2R0KL 4I4WA 4XMKL 4RMQA 5EU6D 4AG4H 4PP2A 3P9MA 4BFEA 2A0LD 3RWCB 2X4UB 4P5TB 4XNZC 3CLFH 5I74B 3I84A 3T4YA 1RUAH 2A38A 4OZHA 2W9LA 3SDDD 1HHHB 3BDYH 1I1FA 2WIIA 3BPOB 3PF2A 1CK0H 1JZ3A 1CGWA 5DD5L 3MMEB 4LOUC 5EA0H 2BMKA 3OL2A 3TYFA 5L2KD 1A1NB 4K8RD 1K4CB 4L8SC 1LE9B 1IAOB 3KPMA 4BFBD 4OM1L 5C0EB 4NN7C 4XNYL 2NX5B 4PBVC 1LE5B 2BOBA 2I26N 5F3HB 1UCTA 4R3SB 4G6FB 4G8FA 5D7IE 1PKOA 4P5KA 3VXMD 3OJDB 3BKJH 5BVPH 3FQXA 3U9UB 1RIVH 3M17A 4U3CA 5DEGA 4D9RD 3MRGA 4QEGA 3AS3A 3SOBL 4M00A 1U3JA 1BHGA 3SDXF 2QQNL 4U0RB 1E6JL 2P8PB 5KVMC 1ZHBA 2YN5A 1T7XA 1JHTA 5HGHB 2ITCA 2DJUA 4OKVA 1BAFH 2XA3A 2H26B 3DUSA 3LZFH 3RY5A 4NQXB 5H2BB 1SHMA 4Y5VC 3GBNL 2Z8VC 3QUXB 4OUUB 3WFEL 1QFUL 3P73A 4Y5YA 1RMFL 3PWJB 3F7YB 3H42H 4NJ9L 4UU9A 4FHBD 5GZNC 4NHCH 2CIIA 3HI1A 4MJ5B 2LV4A 5EU5A 3HNTL 2OYPA 4P2QD 4QRPD 4KI1A 3OKMB 1Y0LB 4XPGH 2LE9A 1XMWA 3S34H 3MRBB 5F9WC 4JDVB 3UPAA 2DM7A 3T3PE 1IQWH 4Y4HA 5MI0C 4OCYL 4LL9A 5IIEB 1DN0B 4TPRH 1JNLL 4KI5C 5DFTA 2OMNA 4L1DA 4RRPA 1FQ9C 3WFBH 4WGVB 3N1PC 1NDGB 3DGGB 1CICB 1N4XH 1JL8A 4M62H 1JYWA 5HDQH 4IEFB 1KENH 1YPZE 4OFYD 3LMJL 4M7LT 1X5AA 1ONQB 2ZPKH 4HX1B 4RNRA 4YFEA 2ZG2A 2F8XC 4G59A 2GJ6D 3MACH 2Q8AL 1T6WA 2HTLC 5E6IC 4L4JA 3W11C 5F9OL 1NLBL 3B2VH 3IETA 3O6LL 2PR4L 5FV1L 2NTSP 2WBJC 2A6DA 1MFCH 4X8XA 4PYGA 2H2SD 4TOYH 4X98B 1JIBA 5CEZD 3OKLA 4NQDD 1PW3A 3I75A 2IF7A 2D7OA 3DI3B 3GGWB 4J8RB 3TFKD 3KPPA 1K5NB 4O2FB 4ZPTB 2VL5B 2APWA 4XNMB 4B7LA 4NQTA 1UKSA 3WMSA 4PFEA 3MLTA 1SJXA 3C5ZD 3ISWA 3CH1A 2DQTL 2HN7A 1RIHL 1CDYA 3CDGB 4TNWK 3VGGA 1BQLH 4ZYKA 1TMCB 4L3ED 5HVHB 4LCCA 3MUHL 1PG7H 2IG2H 2HRPH 4HBQA 3FMGL 1MPAL 5JHDA 1WBZB 1NCDL 1KB9K 3L5WB 2HLAB 5HHOE 2HT3C 4LDOB 1OWWA 1KCRL 3ROLA 5I8KH 1BECA 1YEKL 5ID1A 4S0TD 1PZ5A 5D96B 1DBJH 1DUYB 1KT2B 3GMRA 5DRZB 4BUGA 4MD5A 2NZ9D 3U0TB 1Z9SA 4PJEB 5EO1B 4HUUB 4KKBD 2HTKD 2F53A 3MV8A 3LRSB 2YPKA 5FIEA 5HHPB 3UMTA 1E28B 1ZHLB 1A14H 4M1CD 4YHKL 3HAEB 3Q1SL 4HIHB 3U30C 3B9KC 3FOMB 1FSKB 2C1OB 1BVLA 4C58B 1G7MB 5C0AD 4JANA 1CVRA 4ERSH 1HHIB 1L6XA 1SYVA 5FYKH 1UC6A 4FQCL 3EZJB 1I85C 1VEMA 1DEEB 2W07A 3TC9A 4Z8FH 2PO6A 1DE4A 1A6WL 4WO4D 1M6OB 1RULH 3DSNA 3QISA 5EB9A 4OTXL 1T21B 3IU3B 4X6BA 3DX8A 2BSSB 5IROA 1A9EA 3GSNH 4DQOH 3UDWC 3WIFA 3FO2B 3SCMC 3BH9B 3NIGF 1FDLH 3LVEA 3MRKA 4ZD3L 1BD2B 4XB8A 3WLBB 1OAXL 4NPYB 3NA4A 2A6IA 3P4MB 4CMHC 2FEEI 3B8SA 4ZAKC 3WFCL 1JYXA 2UZIL 1U92B 4OCWL 1JUFA 1OM3L 5FYJD 3NTCH 5AYUL 3OR7A 4I4WB 4C56E 2R0LL 3RFZC 4GMSH 3P9MB 1HQ4B 4TVPD 4ZSOE 2JB5H 3TM6A 5ECJE 2R2BB 3T65B 1I9EA 5DC4B 4OZHB 3GEWB 4FN0A 3RTQC 1OAUL 1I1FB 1F4YH 3R8QA 2BMKB 3MLVH 1JTOA 4P9HH 3HG1D 4WEBH 3CVIL 4UTBH 4D3CL 3TBYA 2EH7L 4NHUE 4H5SB 5E70A 4KTEH 1T04B 1KYOK 3KPMB 2CRIA 3UZEA 2VXSL 3ZKXB 3O4LA 4N0RA 5C0RL 3U2SB 3O2DA 4ZTOL 4M02A 2XT1B 2JJSC 4G8FB 3VFPB 1MCQA 4P5KB 4RAUA 4GMTL 4PJAE 1F8TH 5E8OA 3P30L 1CE1H 1CFNA 5EBLA 4PLKD 3G04A 4JHAL 1J87A 4XPTH 3MRGB 2P5EE 4OJFH 4Z0XA 3LRHA 4YDLB 4UV7L 2P5WB 1MFEL 3MXWH 1W72L 2B5IB 2E7CA 1JHTB 3R4DA 4OKVB 5KS9E 5T33H 3P4OA 1E4KA 1ADQL 3O2VL 3DI2B 2EIBA 1N2RA 5EIQA 4ZUSA 2QEJA 3P73B 2X9YA 1SBSL 1OTTC 4MJIE 1MHPL 5CD3A 1AKJD 3AREA 3N85L 1KNOA 3ARYA 3WKML 3I6LE 1NBQA 2EDKA 1INDL 2CIIB 2XY2A 5K33A 5EU5B 4YDVA 4G7VH 5C71A 3MLWH 3MGTA 5T5NG 4KVNH 5DD6A 4OIAA 3ULUD 1G9NL 2DLIA 3SQOL 5AG8A 2ICWJ 4Y4HB 4L8BB 4YXHL 5DEZA 5L7XL 1DCLA 2ZCHH 3AM8C 4M1GH 4E41E 4JRYD 1P4IL 2OK0L 4Z7OE 3E3QE 3RWEA 1KBGL 2BK8A 3IYLW 4LF3B 3WL9A 2DYPD 1BQSA 3I6KB 2XICA 3O11A 5EOTB 5BRZE 3SDAC 1XGRB 3QCUL 5I30H 2J8UA 4YK4C 1F4HA 4W81A 1RJLB 1JZ5A 1UM4H 4TNVF 4YXLL 5LWYL 4PLJC 2ADIA 3O8XA 1BEYL 3IETB 1KACB 1Z6JT 1EA9C 2A6DB 5E95B 2MQ0A 1VFBB 4JFYA 3R0MA 4UV4L 2FECL 4CL7A 1D5XB 1HOCA 2VDMH 4HXAH 5HHXL 3OKLB 1MFBH 2DLGA 4C57C 5ESVA 3WHE0 4CVZB 5IW6A 4V1DA 5B3NA 3V0WL 3E2HC 5BW7A 25C8H 1A4KA 4RSVA 3K74B 1IKNC 1IAIM 2V5SA 4KHTL 1KSRA 2OQJA 3RNKA 1KUMA 2XZCL 4OD3L 1SM3H 3ORJA 3DIFA 4P99A 2FLBT 4X6DF 2DQHH 4HKBA 4LCCB 2R8SL 4MD0A 5DMJB 1TZHA 2X44D 3NIDE 1MI5E 5JHDB 4DZ8B 4LIQL 3PGFH 4G43B 4X4ZA 3JXAA 1N0XH 2DQGL 4HHAA 5D7IA 1LP9B 4K94C 5F7HA 5ID1B 4PS4L 1TVDA 5J9PA 3GMRB 3MX0A 1MELA 5FYLD 5DYOB 1K4DA 4D9QD 2X6MA 3QPXH 4FZEH 4PD4J 1K8IA 4BYHA 2ZUYA 5JMRA 3MV8B 4LSUH 5IB1A 5IBUB 5HI4C 2H1PH 1XF4A 1IC1A 1F3JB 2DTML 4GXUM 3SKJH 5IT2L 2VDOH 4JANB 4Q6IA 4PRPD 1F13A 2RIKA 1A3LL 4N0YH 4WWID 2UZYB 1BWWA 5HDBE 1SYVB 3GSWB 5FHAH 2NY5H 4XVTH 3M07A 2CXGA 4NO0D 1U8OA 2VQUA 2PO6B 1DE4B 1JI1A 3D69A 4M8VA 3CFCL 4P5TC 4OZGF 5I74C 5HYJD 3MRNA 4X6BB 3DX8B 3ZHLA 3VI3E 3NCJH 4DTGL 4P2OA 1TIUA 1A9EB 4POZD 3WIFB 3THMH 1QPXA 3MRKB 3BPOC 1J0JA 1S7WA 5K9QI 1UWGH 1DSFH 2A6IB 5EO0B 3TZVD 4KKAD 4OF7A 5FKAA 3DXAE 1JUFB 3FB7A 1JGUH 2IQAA 4OLUL 1D9KA 2VKXA 3HE6B 3OR7B 2APFA 3N9GL 4LOUD 4LRNH 4O51A 4MNGE 1YPZA 2YRLA 5I1CH 1MJ7H 4HMCA 5GZOC 3RL2A 4NM4H 1RURL 4TYUA 4K23L 5GHWL 2N7BA 1F90H 1RFDL 3MLXL 4YFLF 1DLFL 3WEXA 5EZJB 5ALCL 3ZLQC 4GRWE 2HFEA 4M6OL 3F7VA 4ELKA 2VYRE 4OFPA 1VB9A 3F6LA 5LXGH 1OAYH 1MCOL 3LEVL 1DEDA 1Z9LA 3TBYB 1JFMA 4A6YB 4U0RC 1I7ZB 4LLWA 2V2XA 4MMZC 3O4LB 3VJ6A 2FHBA 4RGNE 3PDDA 3F5WA 1YECL 1IARB 4HMEA 4QHUA 4NKIL 3I02A 3A67L 4RAUB 2RHEA 3B83A 5EBLB 3G04B 2V2TA 3WNNA 4Z0XB 1H8OA 3VRIA 2AXHA 5EIIA 1MRDL 1MREH 4XTRC 4R8WL 5IQ9A 4KKLC 3HZMB 4EI6A 5HHOA 1FN4B 2YKLH 3P4OB 1ULVA 3I3EA 4WW2B 1YMHB 1ZLUK 5BVJA 1N2RB 3WFDH 4G6ML 2EDRA 4ZUSB 5L8LB 1AQKH 5C8JB 1HCFX 3OZ9H 3AREB 1KNOB 1JNHB 1KIQA 1NUFA 5T3XL 2BY3A 4XAKE 1INEH 1JHLH 4X6FA 4ZFFB 1REIA 4LSQH 4KI5D 3QUKA 5EWIH 5IG7A 3MGTB 5DSCA 3L7FB 2FH8A 5EUOB 5DD6B 1ETZB 5J4MA 2CMRL 4I77H 2P46B 3FRUA 4I8DA 3EO9H 2HTLD 3MROA 5EZOH 5HHMD 3WXWL 5B21A 2OLDA 3RWEB 2MCPL 5GGSY 3RUGE 3V4UL 2PXYD 2IAMD 4APQD 5IHUL 4WFHD 1OP3K 5F1NA 5C6TL 3MOQA 5CEYA 1JHKL 4XMPL 4GQPH 2J8UB 4XMKH 4U1JA 1T66C 4FXKB 4NWTL 3O8XB 1IFHL 2IANE 4PJ8A 5IB5A 3VRJA 4EJ1C 1Q9LA 4JFYB 5B22A 3MZTA 4CGTA 3BZ4A 2HJKB 5TDPB 5DD5H 4C56A 1FJ1A 4K9EL 5ESVB 3G5ZB 1BJ8A 1L8JA 4XBGA 3ZKND 4BQBA 4ZSOA 2YPVL 4JZJA 1LWRA 4KV5F 2AJUL 1T22A 1A4KB 4KTYA 1EDQA 2VXTL 4OM1H 1GCFA 4XNYH 2ICEA 2HT3D 3NFPA 4KY1L 3DIFB 4HKBB 2C4FU 1TZHB 1EX0A 1C08A 3DX6A 3C2AH 4NHUA 5D1QA 4GKSB 1RU9L 1F3DJ 3JTTA 3MGAA 4J6RL 3QDGD 1AGEA 1FSKC 1DDHA 3PL6C 4U7SA 1TLKA 3GHEL 2XACC 1JFQL 4L29B 4HHAB 1E6JH 5D7IB 4JQXC 3B9KD 5E9DE 4PJAA 1I3RA 4IOFD 3J7HA 3F7RA 5J9PB 3OAUL 3CVHB 1QLFA 4M5YL 4E0RA 5I9QB 3VG0H 3WFEH 1QFUH 1RMFH 2P5EA 1K4DB 5DJZA 3TIEA 4NJ9H 4XZUA 3LKPB 2EIZA 3OF6A 3KLAA 3EOBA 5EC2A 4PJIE 3HNTH 5TQ2L 3RY6A 4EXKA 4QHKJ 1AH1A 1JWSA 5KS9A 4Q6IB 5CJ8A 2L0DA 2WWMC 1EBPA 1UZ6F 1BGXL 3ZDXE 1KJMA 3TH2T 1F02I 5IVXF 4MJIA 5EU3A 1TJHL 4LKXA 3N1MC 1U8OB 5JORA 4OCYH 43CAA 2B4CH 4ZAKD 1MAKA 1JNLH 2PW1A 3NPZB 4LLMA 1G7PB 1GC1L 1JGEB 3C6SA 4JGMA 3ZTJH 5F71A 3QYCA 3ULVE 3LMJH 2AGJL 4PRHE 3PP4L 2VN7A 1QHOA 4CU8A 2Z92A 2BVPA 1S7WB 2Q8AH 3S97C 4E41A 5I1IH 4N8PA 2E7MA 5F9OH 3E3QA 2IMNA 5FKAB 1NLBH 3RTQD 3O6LH 2PR4H 2VZ3A 5CP7A 3FB7B 2IQAB 1D9KB 3K8KA 5BS0B 4HLJA 5GRWA 3ZKXC 4O51B 5BRZA 1YPZB 1BFTA 3DBXB 4QWWC 2X4QA 1DZBA 1UJ3A 4JJ5A 3UYOD 1RK1A 2QBWA 3AMLA 2HFEB 3ZDYF 4M8QB 4XHJC 2DQTH 1RIHH 2B5IC 5ADOH 5JXAH 3PP3K 2V2XB 2Z31A 4JGUA 3PWUB 5IWLC 3TNNA 4H25B 2AEPL 1MPAH 1NCDH 4OI9A 3PWVB 3F5WB 1QSFD 4QHUB 3VXUB 1X5XA 2RGSA 1OW0A 5I8EB 4WHCA 1KCRH 2V2TB 3T0EB 1FORH 1XF2B 1G0XA 1HI6A 1YEKH 1NCTA 5K9OA 1OTTD 2PCPA 3VRIB 3AXLA 4UT9H 1MI5A 2D7MA 2IPUK 2V5RA 1BPVA 4U1LA 1H15A 4HUVA 2FIKA 5KSBE 4EI6B 5HHOB 5GJTL 3ARWA 4POUB 4JLRB 5SWQA 4DAGL 4YHKH 3Q1SH 3EJZD 5BVJB 2EYRA 2ESVD 1A1MA 1LO4L 4R7DA 5DQ9A 1NGXB 4TQEL 4FQCH 3RA7L 3UROR 1MCJA 5LJYH 3TYGL 5DSCB 3PUCA 4XGZA 3FZUD 1A6WH 2DIAA 4GRMA 3SDAD 4OIBA 1NFDE 1ODAA 1S7TB 4Z7UE 4OTXH 2P49B 1C12A 3BISA 1S9VB 1U6AL 4KJPC 4ZD3H 3SE3A 5CZXC 1OAXH 2UUDK 4P3CL 2VIRA 3JWOL 3WFCH 3X11B 1T7YA 3ERYA 2UZIH 4OCWH 4L9LB 3DX9B 5F1NB 2GUOA 4HAFA 5CEYB 4UINL 3BRGC 2R0LH 4XVUC 3MV7D 1NCBL 1GH7A 4GAFB 3IKKA 5ITFB 5IB5B 3VRJB 1Q9LB 5D2LF 4AIZA 4LCCC 2VXUL 2H8PB 3DXAA 1OAUH 2OJZH 2BVUA 1J18A 3BZ4B 4QYOA 4C56B 3DYOA 4HMDA 1FJ1B 1F3RB 3OXRA 1OT1A 1N8ZB 4XBGB 4MNGA 4BZ2H 3BHBA 3CVIH 4D3CH 3EJYC 2EH7H 4JZJB 2EDNA 4NSKA 2OBGA 4NNYA 2C3GA 2VXSH 5JDJA 3K7UA 1VFMA 1U93A 4Y5XB 1F4WL 5C0RH 5KAQF 5F7DA 4ZTOH 1K9TA 3NFPB 1T0MB 4ONGL 4GMTH 3DSFL 3P30H 4N8VG 1T5XA 4QY8B 2C5DC 1C08B 5F89A 3DX6B 4JHAH 4NDMB 4NHUB 3WBDA 3JTTB 4OZFH 4EIZC 1AGEB 1X44A 2AABL 2DS4A 4TVSa 4UV7H 2Z93A 1MFEH 4PG2A 5F7EL 32C2B 1Q94B 1BFVL 2P45B 5CJXA 3U9PL 1S7VA 2BVTA 1MUJB 4PJAB 4MNHB 1I3RB 1PLGL 3BIKB 5IJKC 1ADQH 1QLFB 2ARWA 3O2VH 5C3TA 4E0RB 1PKQE 2PO6C 4JM2F 4BH8A 2P5EB 1SBSH 5DJZB 5DD3L 2ICWB 1MHPH 1JCKA 3TIEB 3WKMH 4PBWD 2EIZB 3CX2A 3EW3B 4GQ9L 1KEGL 2YUVA 3EOBB 2EXYC 2HT4D 1FL3A 1INQB 1R24A 1JWSB 5KS9B 4D0DA 2YD2A 4ODVL 4OUOA 1G9NH 3SQOH 1S7SB 1N59A 1JZ6A 3MLRL 1KJMB 1FFQA 3MLUL 5EU3B 2LQRA 4YXHH 2NXYD 5L7XH 3HE6C 4IOIB 5JORB 3UX9B 1CXEA 1JRHL 1B4RA 43CAB 1AC6A 2OK0H 1OLLA 2PW1B 4LLMB 1A2YA 1KBGH 2O5ZL 5JOPE 1CN4A 5JZ7C 1HN1A 3PWNB 3V95A 2NX5D 5GZOD 5DJAA 1XH3A 3KJ6L 2Z92B 3QJFA 4G5ZL 2BVPB 4G6FD 4I48A 1DBML 4KROB 2BSRA 5FGCE 3SE8L 4E41B 1OSPL 1ZSDA 4J7RA 5I75C 1BEYH 5FUZL 3MNZB 3RUGA 3CUPA 3V4VH 1WBYB 4PLNC 1FNLA 5GGQL 2V9QA 4Q7DA 5A2KH 5BO1H 4UV4H 5EBMB 3K3QA 5BRZB 5HHXH 2RB8A 2HLFC 3NH7L 2X4QB 2MMXA 2D0FA 4HIXL 5ICZA 3C5JA 1UJ3B 1P5UA 1YUHB 1RK1B 5F7KC 3CSBA 1LILA 3J8F7 3QUXD 4OCXL 4KHTH 5ID0A 3BKML 1VENA 5E2VL 4Z7WF 4ODBD 4NP4L 2XZCH 5HYSG 4OD3H 1NBYA 3OKKB 5E5MA 4J1UA 2R8SH 3W5NA 4H20L 3OKNB 4UB0L 1WF5A 4OCMC 1H5BA 4XTRD 5F8QC 4JAMA 4MZ3A 4WW2C 4GAYA 4KKLD 1CL7I 4HGWB 4WIQA 2J8HA 5ICYA 1LK3L 1QEWA 2UV3A 1WT5C 4DZBA 3T77A 4ZO6A 5SWZD 3T2NL 4ISVA 1HI6B 4PS4H 2OTWA 4QKXB 3AXLB 3KPRB 4LLYA 2MCG1 2CRYA 4HKJA 1CICD 6FABL 5ENWA 2CDGA 1AD0A 4PJXF 1H15B 4HUVB 2FIKB 1QQDA 2VUYA 5SWQB 5DVKA 5E4EB 4KK5D 4LFHG 5E9DA 2DTMH 4U4BA 3OB0K 1BIIA 1QR1A 5IT2H 1A1MB 2HVKB 3WXVL 5DQ9B 1A3LH 3IU4L 2PF6A 2FWOB 4FOMA 4FXGA 2BFVH 4KWUA 3QDME 1KXQE 5JQHC 4S2SA 3EFFA 3ESUF 2VAAA 3CPLB 4YZFF 3F65A 4GRMB 4PJIA 3O8XC 3CFCH 5H8DA 1GGIL 1A6AA 1T66D 1DQJA 3L6FA 1VKXB 3SDXE 2IPKA 4LSDA 3O3AA 3O2DL 1C12B 5TPWH 2FJFB 4Z77A 3UXFA 1BF8A 2DMBA 2VIRB 5D2NE 3QULB 1MCBA 2YZ1A 4OLUH 3N9GH 1EVUA 4YFDB 4ZO7A 5BW7C 1MH5B 5MERA 4PRHA 4AH2B 1RURH 4K23H 5GHWH 3MLXH 4KH2A 1A3RL 4AIZB 1DLFH 5EZIL 3EAKA 3RU8L 1OOAA 2JTDA 4QYOB 4NRYA 2VB5A 2RJMA 4N9OB 5I1DA 1MCOH 4MNGB 4LBEB 4WENB 4NSKB 1OCWL 2MSPA 1FYTB 3C60C 3OMZA 1EVTC 3FN9A 1YN7A 5I9QC 3PGDA 1OAQL 1YECH 1NKOA 5J56B 5DA0B 3A67H 2D9QB 4F80A 3DARA 4G9FE 3H9SE 4TNWF 3RIFK 5F89B 4EKXA 4FMFA 2CKBH 4P9ML 4Q6IC 1MRDH 2OZ4A 2EDQA 4PTUB 4NT6A 4MQXD 1S7VB 3R0NA 5I1KL 4KDTC 4HFWA 3VFVA 5C0FA 1CFSA 1BD2D 4NCC1 2WWMD 2AAVA 5C0BE 2YD9A 4PYHA 4G6MH 3HHRB 4BH8B 2APBA 4KJWC 3A6BH 1KFAL 3KJ4B 4JY4A 1JGVL 4MHHI 4KJQC 1X4XA 1NJ9A 3RZCC 3WKNA 3QDJE 3BFOA 5KSBA 1R24B 4D0DB 3CFJA 4UNTA 4FQHA 2CMRH 1N59B 4PJBB 5GS1B 4WHYH 4WWKC 1AHWA 2DI7A 2H32H 5FYKE 3KWWA 3EGSA 4ZUTB 3IGAA 3MNWA 3FJTA 3L1OL 5B3JF 1QSEE 3WXWH 1ZVSB 2MCPH 2VR4A 3MRQA 3V4UH 4HK3N 3V2AR 1CXIA 5IHUH 3UTPE 2XXCB 1CFTA 1LEGA 1OTSC 4LVNB 4PRBA 5C6TH 1JHKH 2W59A 1NFDA 1XH3B 4XMPH 4Z7UA 1OPGL 4F2MA 3RGHA 4I48B 2BSRB 2BNQE 1KPVA 1CYGA 2AKRA 4NWTH 4XBEL 3RUGB 5GS2D 4RA0C 2APTA 4J3XA 4XHJD 1HZHH 2HJFA 2JJTC 3L3JA 2ZJSL 4JZNB 2P5WD 1FLRL 2NW2A 4LGRB 3C5JB 4QT5A 4Y1AE 1ZT7A 1OWRM 3L3HA 5DUML 2VUOA 5H37G 1WCQA 2D03L 1HYRC 3MJ6A 2IANB 1VFOA 3W0WE 2YPVH 2AJUH 2RCSL 4JPIA 4LMQE 4M9PA 3T0EC 1AGDA 3MTRA 3TWCL 4AJ0A 5ALBL 4JHZA 4ENEC 1FNEA 4KY1H 2A73A 2JLLA 1NBYB 3ULSA 4DVRL 1NH6A 3D5OF 2JE8A 3NIGE 1NGZA 5E5MB 4J1UB 4MDJA 5AAMA 3WFHA 3MXVL 2XFXA 1FCGA 5JDSA 3S3PA 4ZUUA 5L2JA 2ZUSA 4IHOA 1S7XB 1RU9H 4J6RH 1FAKT 5DQJA 1NMBL 1A6TA 1GGYA 4Y4HD 4C83A 1JFQH 1QEWB 4CN4A 1CIDA 1MCLA 1PAMA 1V3LA 3D0LA 3T77B 3TCLB 4ISVB 3TPKA 3TPUE 2OTWB 3OAUH 4I18A 4LLYB 1CT8A 5F7YC 4EEEA 4M5YH 2D0HA 1MWAL 1FP5A 4HKJB 2A6JA 2GYSA 1F58L 5ENWB 2CLVB 4M4RA 2VDNL 4HIJA 3P9WB 1QQDB 1S8DA 4GFTB 5E9DB 5TQ2H 3MRMA 4ODHL 1BIIB 1QR1B 5D5MF 1RUPH 5D7JA 4O58L 1BGXH 1PKQA 1JNNL 4FXGB 2B20A 3IFNL 2FX8L 1KPUA 3VI4F 4L9LC 4S2SB 1BMGA 1HEZA 1S3KL 5CZXD 5CKAA 3EFFB 3FAXA 4JM4L 2AV1A 2XKNA 5E1HB 2EICA 3LD8C 4RA3A 3K81A 3FCTA 1GC1H 5GGRA 4BZ1L 1A6AB 4XVUD 4P2YA 1DQJB 3L6FB 5CIPH 3TBVB 2AJ3B 3QUMB 2IPKB 3O3AB 2AGJH 4NBZB 3L5JA 3PP4H 1MQKL 5DDHA 4Z77B 1U95A 3HI6L 3BKYL 2Q8BL 3W81A 5IHZA 3L95A 2R29L 3QIBC 3VXRB 3SGDH 1YZZA 5JHDD 4JZJC 1YC7A 4UI2A 2B0SL 1MCPH 2WBWB 1ZHKA 1U91B 5MERB 4Y5XC 4WI4A 4Z78A 1DBKL 2OL3L 4K8RH 1AGBA 2IBGA 2B1HL 2CXKA 1Q9OB 4PRIE 4XPAL 3TCXA 1A5FL 2W91A 1FL5A 1WFOA 4NRYB 5F7MC 4JFDE 5I1DB 3ZT7A 2F53D 1MCFA 3MV8D 3Q2CA 3VH8G 1ZA6B 4Q0XL 4XNUL 2AEPH 3I3DA 3FL7A 4O9HH 2DM4A 5HGDB 3IDUA 2NLJA 1YN7B 3PGDB 3JV4A 2OSLB 3OKYA 4LRIA 3ARDB 4X7EC 3DUUA 4AM0A 2PO6D 3RJQB 5GS0C 3QH3A 4YGVA 5E8NA 2HMIC 15C8L 3KDMA 4NT6B 3ARFC 4HS6A 3TVMB 5FYKU 4HFWB 1QR4A 3JV0A 5GJTH 3VFVB 3SE9L 5C0FB 3BUTA 2EC9T 4DAGH 5TE4H 1NCNA 1TCRA 1KJ2H 3S35X 2X4NA 3DRQB 3BN9D 5E4IA 3MUZ1 4GG6B 4IJ3B 2Z35B 2XTJE 4M43L 3ZYOA 3OG4B 1XR9B 4X6DE 4YPGA 1OD9A 3RA7H 5JHLL 5KSBB 4HJJL 1S5HA 3F6IA 1W0YT 3CFJB 4P23C 1ACZA 4KROC 3B43A 4NKMA 1IAMA 4MCZB 4FQHB 1TDQA 1TCMA 3WN5A 5J89A 4GAJL 1AHWB 3GJFK 3BIAX 4PRDA 2NXZB 3IGAB 2ZP0T 5AD0A 3ARVA 4OIIH 2FECI 4RZCB 3QDMA 4JFOB 4ZDHB 2CO7B 1G6RB 3MRQB 1YYLL 5IP4A 4HKXA 1NBZB 4S1DC 2Y06L 4P3CH 3JWOH 1LEGB 4OCRL 1JZ7A 4Y2DC 1RIUH 2DRUA 4PP1D 4D8PA 3O4LD 4PRBB 2HLFD 5HXMA 2VLJA 3QXAA 1NFDB 4Z7UB 3QIUB 5FKPA 1GL4B 4UINH 1UA6L 4Y89A 3MRIA 5FOBA 1KPVB 3UO1H 4ZOBA 3SDXA 1NCBH 4QOKE 4CKVX 2AKRB 5CS7A 3FQRA 4DW2H 1QA9A 1AY1L 5C08E 5CFHA 3HPJA 5D2NA 2VXUH 5FO7B 4N8VA 4M5ZL 5T3ZD 3DGCR 1Q9WA 3BESR 4D0BA 2NW2B 2JB6A 4CUCA 4G3YH 4MNQB 1ZT7B 4YHNB 1CLCA 2ERJB 4UDUA 3QDAA 1XR8A 1EH9A 4JPIB 2BC4A 4OZGE 1F4WH 2X9WA 4OI8A 3ARED 1FNEB 1CXKA 2A73B 3GIZL 3RHWK 4ONGH 1NGZB 3IFLL 4MDJB 3BQUB 3E6FA 3QSKB 4Y0GA 3DSFH 2XFXB 5JLZA 3K1DA 5JDSB 4DVBA 4ZUUB 5L2JB 2E7HA 5E4EC 4WNQB 3ZTJG 3JWNC 1TJGL 2AABH 5DQJB 3O3EA 5C0GB 2Z0BA 5D1XA 1XCTA 2YMXL 3KVQA 4C83B 5F7EH 1T7VA 3U9PH 5C3LD 2Y07L 3D0LB 4OZ4A 3SKUD 4F7CB 1PLGH 1BX2B 4G9FA 2DQCL 3H9SA 1CT8B 1U58A 3C6LC 2A6JB 2VC2L 3RKPA 3HNSH 3FO9A 2EDFA 3G5VA 5DD3H 5HHNA 4GLRI 1S8DB 2O61A 3LN4A 1UCBL 4BH7A 2HWZH 4GQ9H 1KEGH 1LO5A 1BZ7A 3MBEB 3MRMB 1XGUA 4MXQC 3O8XD 1TTUA 1FIGL 1U0QA 3RVTD 5D7JB 4L4VB 5C0BA 3U48A 1PKQB 3QZWG 3MLRH 2J88H 4FQXA 1AO7B 4P3WA 1KPUB 3MLUH 3WYRA 1FZOB 1OB1B 5L6YL 3EIFA 1JRHH 3GO1L 2XKNB 3QDJA 2R9HC 2O5ZH 3FCTB 4LCYB 5E1AA 5B39G 5FYJH 2CGRL 3S5LG 3IFOA 3UBXG 4M93B 4QXUL 4G6JL 1A7BA 1IGIL 1GVIA 1Q0XH 3O6KL 4G5ZH 1YY9C 3EDJA 3CXDL 3ARUA 1OSPH 1QSEA 1YQVH 5HYSA 5IW3A 1ZWIA 3DTXA 4TUKL 5IHZB 2GAZA 3L95B 5DRWA 5FUZH 1ZLUH 4G7YL 5I17A 3ARSA 2ENSA 2X4RA 1ZHKB 4L8DA 5I66A 4PGEB 5IBTH 4KKNA 3P0YL 1W8NA 2GKIA 4IMKC 4HIXH 3GSNA 5FGCB 2BNQA 3GNML 1AGBB 3EHBC 3HI5L 3REWA 3X3GH 3ARBA 4UT6L 3ZT5A 4KRMB 2IQ9L 4PDCE 1FC1A 1U8NA 3KLHC 5C7XL 5E2VH 1KEML 4TULL 3CZFA 3AU1A 4S0SD 4MD4A 4P3DA 2C9AA 5CJXC 5MEQB 5DJ0A 3OGOE 4Y1AA 4JFZL 3L3IA 4H20H 2XZAL 2XWJB 4UB0H 4IMLB 1OP3H 3W0WA 2NLJB 3TT1H 4HG4J 4FFWC 1CR9L 2LAAA 2VXQL 3O4OB 3KJ4C 4KMLB 3DUUB 4R4FL 4AM0B 1LK3H 2Y6SD 5F88A 1W0VA 1LMKA 3V7AG 3QG6A 1ZK9A 3T2NH 3ZYJA 4KJWD 5FGSA 2QQLH 4YHYC 3QH3B 4YGVB 3W5MA 1UZ8A 4QHMA 5E8NB 6FABH 3QXDA 4U1HA 5JIIA 3KDMB 1AP2A 1RUQL 4HS6B 4P2OD 5HYQB 1T1XA 1A02N 5EU7C 5GS1C 5AG9A 5KN5A 4MZ2A 1CL7H 4PGBA 5AUMA 1T89A 3RNQA 4HS8L 3TPUA 4LLQB 2ED9A 3WXVH 3UTSE 3P0VL 1D9KD 5BS0D 3SY0A 2J4WL 2K3TA 2DQUL 4EI5B 3BDBA 5TDNB 4YPGB 4WUUE 1WAAF 3KAAA 1GGBL 5CCKL 2H2PC 4OFKA 4NKMB 1NCAH 3WN5B 1H3PL 3MRHB 4PRDB 3W9EA 5BQ7B 1R3HA 3QDMB 4HS3A 3QT2A 4N0CC 5KTEL 4HKXB 3MODL 4AIOA 4KTDH 3QXAB 1U8HB 3UYRL 5FKPB 4FQLL 3F58H 5SX4H 3MRIB 3QEQE 1IZJA 5DRNA 5FOBB 1FG9C 4Z95L 4AIXA 1J1OL 1UT9A 4YHPA 3FQRB 5ICXA 5A2LH 2BZDA 1QA9B 4PJDF 3PHQA 4I0KA 4B0MM 5M7QA 1KN2L 3FQNA 2YXFA 3HPJB 5D2NB 4ETQB 5EZIH 4N8VB 4ENED 5KAQG 1UZ6E 1Q9WB 2PTVA 3S3JA 3RU8H 1A7QL 5CJOL 5IVXE 4D0BB 2JB6B 4IRSB 4M4PA 1I1YB 3BP4A 1KCKA 5HHOD 2AJXL 3U4EA 5E08L 1G7JA 4HJGA 4UDUB 1R3IL 1OCWH 2HA1A 4PRIA 4RWYL 3RDTC 2CJUL 3V6BR 1I8LC 5EH1A 5CBEA 1F97A 3U46A 1OAQH 1FG2B 3HS0B 3MLSL 4JFDA 4JRXE 5GRYA 4JO4L 3ZO0A 5JLZB 4DVBB 2MOVA 5TF0A 4HWUA 5H35A 2ZOKA 3MRPB 4YIQA 4XC3L 3Q5YA 1ZLWK 2VN4A 1HILB 1T2QL 3O3EB 1QKZL 5HDLA 1XCTB 4MJ6A 4P9MH 3MOBH 5ISZB 1WQVT 1CGVA 1KLUB 1RUKL 3FT4A 5I1KH 1AXTL 1CE6A 5JUEH 5EULV 4G9FB 1KXVC 1TVBA 2G5BB 3H9SB 4PJ9B 4B41A 1U58B 3EYOA 4PJCF 1MIEH 5E0QA 4MQ7A 5HHNB 3ZDYE 1KFAH 2LU7A 3V5KA 1BVZA 4YAQA 2O61B 5F1OB 4BH7B 4WFGE 1LO5B 1BZ7B 3LKQB 5F21B 4DEPB 2OXGA 4QRQB 4I1NB 3PP3H 3HE7C 5C0BB 1PEWA 5EPMA 2FL5A 1X5FA 4X9FA 4FQXB 5I76A 1MLCB 3DVNA 4MAUL 2BCKA 4FQQA 4QTIL 3L3DA 1HKLL 1FHGA 4C56D 3L1OH 1UQSB 4X6DA 1CU4L 5DVMA 3ULVC 1FZKB 1IQDA 3LQAL 5E1AB 1J1PL 1HYSD 4HAGA 5JW3H 3IJHA 3IFOB 5F1SA 4P5MB 2CLZB 3VFWB 1YYML 2BNRB 3BPCB 2NY0C 5TQ0H 1SY6L 2P7TB 4NO2A 3VXSE 5HYSB 5DMKA 2X10A 5LAXA 2GAZB 1I3GL 5DRWB 4OCSL 4FA8A 5J57B 1QYGL 3V7AE 5JA8B 3NFSH 5D1QD 3MUGA 1C5CL 1UWEL 2X4RB 4L8DB 4YXKL 1O0VA 3V0VA 2ZJSH 5I66B 1FZJA 5J1SC 4WY7L 3Q6GL 4YHLL 3T8XA 3GSNB 2EDLA 2BNQB 3REWB 4GRLB 4QOKA 5DUMH 2D03H 1U8NB 3ARDC 1L0QA 5C08A 1U3HA 1Q1JL 1K85A 2RCSH 3TWCH 2P5ED 4XI5C 5ALBH 1LEIA 1MCEA 1MJ8L 2YHGA 3N1FC 5SWSE 1L9MA 3SE4C 3QWOA 3EO0B 1N7ML 4MD4B 4DVRH 4PGDA 3OF6D 4X7CC 4RMRA 4Y1AB 3MXVH 3TVMC 5BZWA 3L3IB 2UUDH 3KHOA 3QCTL 2YRZA 2P43B 4KUZL 3WV0A 5L2KB 3W0WB 2HMID 4EBQL 4K2UL 4IDJL 5HVFB 3HFML 4OZGA 3BSZL 4OZIF 1NMBH 4MJID 4OD2A 3I6LD 1W0VB 3RVUD 4U6YB 1EEZB 3RX8A 5D2LE 5TE7L 5KG9B 5CILH 1MWAH 2AP2A 3E6HA 3QXDB 4U1HB 4K7PL 5DXWA 5F6IC 2VDNH 3GRWH 2OS7A 1KTLA 1T1XB 4NC1E 3QEUA 4ZTPL 3F62A 3RNQB 4E41D 3HPLB 4ODHH 3TPUB 1YY8A 3HKFA 2ATPB 3VWKA 3D85A 4O58H 5JNYB 1O7SA 3LS5L 1JNNH 3IFNH 2FX8H 5BRZD 2C3VA 1UB5A 1I9RH 4V3EB 1S3KH 2Y4SA 3QIUC 4QRRB 1TXKA 1KTDA 4JM4H 4MSWA 2L7UA 1EGJL 4NZRH 2VDQL 4NUGL 1YMME 4BZ1H 2GT9A 2ICCA 3INUL 3W9EB 1R3HB 5F7WC 4HS3B 2QKIA 1MQKH 3T1WA 2UY7A 3BKYH 2Q8BH 2NY4B 1CBVL 2R29H 3VH8A 3ZE2F 5IMMA 2ERJC 3S36L 3CFKB 4MS8A 4BSWA 2OXHA 3BZDA 2B0SH 3ARRA 1FO0L 5DRNB 1H8NA 1WICA 4JKLA 2VE6B 4HIIA 4ZQKB 4YHPB 2QSVA 1DBKH 5ICXB 2KDGA 4JGJA 4HH9A 3PHQB 4OQTL 5HGAA 3S37L 5CD5C 3FQNB 4RIRA 2ZCKL 2B1HH 3BQUC 4RMUA 5E2UL 4F7TA 2ADFL 2CQVA 3KPRD 3LDBB 3UJTL 1MI5D 1UB6A 3H9HB 2VZVA 2C3WA 4G80A 2FHCA 3GKWL 2FRGP 4HPOL 3LKRA 4ODWA 3BP4B 1XAUA 5FB8A 1G7JB 4Q0XH 1ZAGA 3JWDL 4WHYG 1F11A 4N5EA 2A1WH 2GJZA 2HT2C 4JFQB 3U46B 1BQUA 1GGUA 4FFYL 3TEUA 5DO2C 2Y9RT 3CMOH 1A1OA 5I1HH 2YD6A 2EYSA 3BVNA 1ZEAL 4XXDB 2GFBA 4D0CB 5H35B 4YIQB 4P49A 3MBEC 3GB7A 1MVFA 3BOVA 2WQRA 5FK9A 3FOLA 3OGCA 15C8H 1X5ZA 2EXWC 3LB6C 5DFWH 5TGBA 1D5BB 2FB4L 4YGAB 1CE6B 4U6VH 1TVBB 4NQEE 3PGCA 3EYOB 1U9KA 3RGVA 2X1OA 3NCYS 4MQ7B 1ZA3B 2XPGB 3EOAB 1MVUA 4Z7WE 4LP4A 3O6ML 3BPNB 4L4TE 3VFOA 1IL1B 3SO3C 1QSZA 4M93C 2C4XA 5JHLH 4HJJH 2DD8L 2BSTA 2DL9A 4KU1A 4XP1H 4F9PC 3VFSA 4G6KL 2F19L 1DUZA 5EPMB 2VDKH 1E0OB 5I76B 3DXAD 2NZIA 3DVNB 2BCKB 4FQQB 3UTSA 5E24E 1YY9D 3L3DB 2XTJB 5EO9A 1FPTH 4XNQA 4X6DB 2NQCA 4WUUA 3DVIA 1A3QA 1YYLH 1IQDB 2Y06H 3QUYA 2QR0A 4OCRH 4QHNA 3UTTE 3K4AA 4YH6A 1FYTD 4BK5A 4Y16A 1OLZA 5GGSA 4PJXE 2W0LA 1MNUL 4MB4A 3LV3A 4ETYA 2VOTA 5DMKB 1WLHA 5GGTH 5LAXB 1RZGA 5DD0H 1VDGA 3KLHD 3OAZK 4HUKB 4HEPG 2CO6B 1HH6B 3OB0H 1G7LA 4Y4KA 3MUGB 5BZDA 4M5ZH 3V0VB 1KCUL 3WLWC 1W2KT 3DYPA 1MY7A 2IWGA 3QEQA 5CMAB 1VACB 2F8VA 4QOKB 4RWHA 4YZFE 2JKXA 1E4WL 3O4OC 4KK9C 1NEZB 4LRIC 3DETD 4M61B 3MCLH 5D1ZB 5HTSA 4ZXBA 5C08B 1U3HB 4M6NL 3ZHKA 3FFCE 4EQ3A 5K9JL 1N6VA 5IJVB 1LEIB 4G42A 1OHQA 2O26U 1F2XK 3TO4A 3ARXA 2IGFL 5IVXA 3G5XA 4WW1A 4LHUG 4PGDB 4ALAL 1JPFA 2Q3ZA 3IFLH 4XP4H 3DUHA 2DM2A 1RZFL 5CWSA 1JV5A 4YPJA 1QFWL 5HVGB 5C70A 1CD8A 4QLRA 2X7LA 1TJGH 1OARL 2EDYA 2YMXH 1JVKA 3BE1L 3QZWA 4XAKD 1P53A 2Y07H 5AWNH 4EI5C 5ELIA 4U1IA 4JRXA 3RIFF 3T0DA 1WC7B 3A6CH 1V7MH 3LIZL 5FHBL 1WK0A 3HRZA 4W4OA 5KANI 3GMOB 4WV1A 1B6UA 1K8DA 2VC2H 3KYNA 1CLZL 4LNRA 4U3HA 1KTLB 4FP8H 4AEEA 3JVGC 5B39A 1KF9B 3WN5C 4LPWA 3SGKC 3S5LA 3UBXA 1UCBH 2H2PD 1GZQB 4U49A 1S7RA 4ODTL 3I50L 4BQCA 1FIGH 1YY8B 1QP1A 1WFTA 3VWKB 3D85B 5IF0A 5GRXG 1V3KA 5I15L 3TP4A 1KB5L 5T3XE 1P9MC 1UB5B 2C3VB 4DCQB 3VGFA 5JPMB 4IS6A 1AKJB 1KTDB 5HHQA 3L3KA 3SBWA 4OLXL 2IAND 2GT9B 3DV6B 5EOQL 2CGRH 4J12A 5KOVC 5D2NC 2QKIB 1IGIH 5I18L 2FD6H 3BDYL 3CXDH 2NY6B 4IRSC 2P48B 2IFGA 4Q74A 5C6PB 3VH8B 4G7YH 2APXA 5IMMB 4PJFB 4A2LA 4BSWB 2DYPB 3C08L 4YHZL 2N4IA 3PABB 4M1DL 5D70L 5JTWA 4HIIB 4DK3A 4HZLB 3IB4A 4M3KB 3P0YH 4EN3C 4HH9B 3LHPL 4YR6A 3GNMH 3HI5H 3VXSA 2X1XR 4UT6H 4F7TB 2IQ9H 4FQIH 4PR5A 1UB6B 5F9DC 3F12A 2P8LB 3NCCB 4WI7A 3UTOA 4G80B 4K94H 5C7XH 1JMZA 4ODWB 1KB9J 1KEMH 4TULH 2R0WL 2WINA 5B3JE 5FB8B 4O2EA 3DOSA 1NQBA 3S88L 4JKMA 2W92A 1QLRA 43C9B 5E9DD 4UUJB 3NPSB 4JFZH 2XZAH 2P4AB 4PJ9C 3LZFL 1JF1A 4XCFL 5J12B 4UAOB 4GO6B 4LVHB 2VZOA 4HWZA 1CR9H 1T83A 1ZVHA 2VXQH 5SWSA 1A1OB 3FQUB 2EYSB 1TQBB 1PY9A 4R4FH 2GFBB 5MEPA 1D6EB 3HMXH 3PV6A 2OR7A 2CIKB 2K7PA 3WS3A 5IBLC 3GB7B 4DEPC 2WK2A 3C8HA 4AENA 4E42A 5FK9B 3N1QC 5GIRA 3FOLB 4PUBH 3VA6A 3ZL4L 2J2ZA 5HY9A 4FQXC 1LD9B 1ZLVK 2AJVL 4NBXB 3RGVB 4HS8H 4WEMB 4ONOA 2BSED 2EZ0D 2W65B 4J4PC 3LKNA 5D2LA 1MVUB 1FZMA 1GZPA 2DQUH 2LFGA 1U8IA 1W72A 1N4XL 1EEYB 3ULVD 1SEBA 2FSEA 5HPOA 4GKZB 5F6HJ 2XWBA 1GGBH 1UM6H 2GY5A 1DN2A 5CCKH 1DUZB 4I5BB 1CI5A 1ADQA 1QBBA 3UTSB 2F5BL 1CTOA 3PDOA 4BELD 1MFCL 3BI9X 3MRJA 4TOYL 5EN2B 3ZTNL 4WUUB 5DA4A 4U6XA 4MX7A 3EYUL 5KTEH 3MODH 3QUYB 4NO0B 3ROOA 1KELL 4QHNB 1H0DA 1TPXB 4GRLC 5CKGA 4MAYB 4Y16B 5GGSB 1YMMA 1JBJA 4FQLH 1XZ0A 3LV3B 4X9IA 3ZSTA 5C0CE 4Z95H 1YNKL 4U2YA 1RZGB 5F7FA 2Z91A 1JK8B 3ARDD 2PETA 4PLOB 3CVHL 1KN2H 3QQ4B 1A9BB 5F9JA 1G7LB 4Y4KB 1KYOJ 4J3VA 1G0YR 4JM2A 4IIQB 5T1LA 5I1JL 1A7QH 5CJOH 3VI4E 1YA5A 3QEQB 5MENE 1O5DT 1JGLL 1Y6MR 2AJXH 4JVPA 2BX5A 5I0DA 4YDIH 5E08H 4O00A 1ZTXL 2R1YA 4PY7A 1UH2A 4ZXBB 1R3IH 1E4XL 4N1CA 4RISL 5I8KL 3WD5L 2FGWL 4G42B 3TO4B 1BJMA 1BM3L 1YN6A 4X5XA 3G5XB 2OR8A 4WW1B 5IVXB 1JPFB 2HKHL 4X6EA 2UWEB 2YUXA 5I2IB 1JV5B 1YNTA 4JO4H 3WO3B 3FB5B 1JPSL 2H45A 1JGDA 1T5WA 2Q7NA 3C09B 1T89C 4RX4A 4XC3H 5CGTA 2X7LB 1T2QH 3VGDA 2I9TA 1T3FB 1QKZH 2M1KA 3KR3L 1U8MA 3QZWB 2NXZD 4H26A 4P2RE 1ITBB 1T4KA 3SGEI 1H3WM 1AXTH 4U1IB 3GZKA 1HSBA 1QFPA 3UTZA 1A64A 1L7TL 4O4YL 2AEQL 3HRZB 4LNRB 5B39B 3AS0A 5AZ2L 3RWFA 3MJ7A 2FEDC 2ZG3A 3QIUD 3UBXB 1MCSA 1H9VA 1RULL 2ADJA 3L7EB 3PQYE 5FDWA 4QRPE 3CLEL 5DI8A 1ND0A 1ZT1B 1B2WH 2EC9U 2O5YL 4K7PY 4NQEA 1BFSA 1GJIA 1FDLL 5IF0B 3V8OA 3IDIA 2Q6WA 1GGCL 3T2OA 4MAUH 1NKRA 2UY6A 4QTIH 1OP5K 4Z7WA 4KK8D 4L4TA 1MFAL 5HHQB 1JTPA 3MNVA 1CU4H 4LPVA 4GMSL 1SVCP 3L3KB 1F4AA 4LU5L 4TSAL 1J1PH 4QTHA 5CSZA 1PVHA 3CIQA 4KRNA 5INCA 2AJZB 5F3BB 1EHLL 3LDBC 3SQBA 1SY6H 3DV4A 3NCMA 5CD5D 4H1LH 1AGCB 1ZGLP 1A4JA 5HHMB 2C1PA 1I3GH 3MLVL 4OCSH 3QQ9D 3G5YA 5IMLA 4WEBL 4LCWE 3IDMA 4APQB 3UTTA 4KTEL 1C5CH 1UWEH 2HVJA 4NQDE 4XRCB 4YXKH 1KTKE 1JYNA 1KCSH 3ME0A 1JN6A 4WY7H 4PJXA 1BIHA 3Q6GH 4YHLH 2YWYA 4YR6B 2NNAB 2DQEL 3VXSB 1KGCE 2DB8A 5B8CB 4NFDA 5I16B 4PR5B 5ESAA 3F12B 1CE1L 4JCLA 1SJHA 1VGKA 3U0PA 4XPTL 3HLAA 5DO2D 3GJFH 1MJ8H 4OJFL 4O2EB 1N7MH 1IM9A 1QLRB 4OV5A 2X4OB 4NO5A 3S7GA 3QCTH 3U36A 1U41A 5D7JD 1JF1B 2EXWD 3LB6D 4K2UH 5T33L 3LPFA 3VFTA 3HFMH 4YX2H 5FO8B 3BSZH 3FFCA 3FN3A 4HWZB 4X6CF 5IMOB 5SWSB 5FV2A 1BFOB 3RHWF 3CSYA 4YQXL 5MEPB 3T4AA 4LSTL 1NLDL 3LOWA 2WV3A 1UGNA 2CLRA 3PV6B 2DTSA 2I25N 5EFIB 2W60A 3QAZC 2NZ9C 3WS3B 4Q9BA 4QXGL 4KKBC 4AENB 5JOFB 2HTKC 5A1AA 4E42B 5GIRB 5DLML 4K7PH 3VD5A 1M05A 4FQ2L 1GOGA 1KG0A 5HY9B 3A6OA 2DAVA 4WU5B 2WP3T 1L0YA 3V4PL 1I8MA 4U1KB 2YC1A 5EIVA 1RZJL 4M1GL 3LKNB 5D2LB 3OV6A 1WCBB 4BUHA 2CKBA 4K71C 1FZMB 1FFNA 1GZPB 5DURB 5JOPD 4HW6A 3RIAK 1W72B 5SV4A 4JFPB 2EEAA 2F5AL 2OM5A 1T2XA 2XWBB 4PPTA 4U1NA 3GBLA 4HUXB 1EGJH 4OGYL 2VDQH 4NUGH 3WNOA 1JWUA 4I13B 5DJ6B 4CNIA 5LG1A 3MRJB 2X42A 1XGYL 2GTZA 2VDML 2F54E 4HXAL 3WE6B 4U6XB 1KV3A 4QF1A 1MCHA 2ICWI 4XCYA 1CBVH 1J0KA 4LKCA 1H0DB 5C07E 3OKOB 4CN6A 3GI9H 1YMMB 3X14A 5D1ZC 1U3HC 1CFVL 1XZ0B 3X13A 2H32A 4L3CA 4KK9D 1S7QA 2Z91B 3X17A 3VWJA 4OQTH 3S37H 1YDPA 3VFMA 4PB0H 2ZCKH 5F9JB 5A2IH 5E2UH 1RJZA 2ADFH 4Z7NF 5C9KA 2Y5TA 3UJTH 5IKCA 1PD6A 4QRTB 5T1LB 2VABA 3MOAL 3GKWH 4HPOH 4Z76A 1U3YA 3K0WA 1XF1A 4XC1L 2VZTA 1B90A 4CVXA 5FAAA 4NZJA 4LPYA 9CGTA 5GS0L 1FLTX 2R1YB 5J6HA 3MQIA 4PY7B 4NNXA 5FDYA 3JWDH 5M94B 3ZKMC 5IHLB 4Z7VF 3VCLB 1YN6B 4EI5D 4X6EB 3KPTA 1QBML 1ZEAH 5IEHA 4X0KA 2IPUG 3QG7L 4EDWL 2I9TB 1BJ1H 2HP4A 1A6VL 2Z8SA 4BFGA 4JFXA 3SKJL 2VDOL 4R7NA 4H26B 5F96L 2X70B 1T4KB 4UTAH 4NYLA 1CLOL 1IGCL 1JPGA 3QDMD 1RHFA 4JREB 4X7SL 2NY5L 1HSBB 2R2HB 2NCMA 4RFEA 4XVTL 3UTZB 1IAII 2IH1A 3DNKA 3BGMB 1UG9A 4JB9H 4RAVA 1EHXA 2NTFA 3RWFB 3KS0H 4HK0A 3MJ7B 2PYEE 2ADJB 5FDWB 1DQQA 1LP9F 1RK0A 3DMMB 5DI8B 2DD8H 4OCNC 2X4SA 4NQEB 5DJCA 1UYWH 4G6KH 3QFJE 3IDIB 4HPYH 3CFDA 3R8BB 4Z7WB 1IGML 4IDLA 3MNVB 4P59L 3VFRB 4GS7C 5I1CL 4QTHB 1Q38A 4NM4L 1J05A 5CSZB 2MQCA 3RKDD 1F90L 3EOTL 1NL0L 1OTUD 2AK4E 1J12A 5INCB 4Q9CA 1C7SA 1MNUH 2PN5A 3DV4B 1ED3A 4JR9L 4LVOC 3TN0A 2C1PB 4WI2A 1FVEB 5IMLB 1ZOXA 1TJIL 3AY4A 1WTGT 3IDMB 4XXCA 4O5LL 3UTTB 3KYOA 5ILTL 3NPSC 2VL4A 5D1XD 5F1IA 1KCUH 4N5EC 1JN6B 5CIPA 4PJXB 2WMPA 4U6TA 5J12C 3WNKA 1WAAE 2FDBP 4UAOC 4F3FA 4LVHC 2E8ZA 4FABL 5C0CA 1E4WH 4KXZH 4G9FD 1UWXK 4PJ9D 3H9SD 3TLRA 1TQBC 5JPNA 1SJHB 1HXMA 1FRGH 1VGKB 4M6NH 3U0PB 5K9JH 3I3BA 4AEIL 3QWRA 3B6SB 2YR3A 4ALAH 3D18A 4JDZB 3S36X 4OV5B 5MENA 2VH5L 2VSDA 4NO5B 3K2UH 1QFWH 5DR5H 4RFNB 3U36B 5C0BD 1CFBA 4BSVA 2DJ4A 3RGVC 1J9CT 1OARH 4FQXD 3WFDL 2I27N 1AQKL 3BE1H 2ED7A 4LPUA 1CDHA 3CSYB 3KPLA 3T4AB 3OZ9L 3QIWA 1IEHA 5CAYB 2CLRB 1SJEB 4PJDE 4HH8A 1INEL 5LGJA 3QDJD 1XFPA 4KPHL 4YDJB 2QHRH 3LIZH 5FHBH 3ARZA 3RWIA 5C09E 4M7KL 4D9QE 1CLZH 1M05B 4E5XA 1I8KB 1KG0B 1Z5LA 1N64H 1U8QB 3P40A 5FYKD 1UJTA 1AR2A 2VDPL 3FTGA 4P2RA 2YC1B 4JZOB 2IBZX 1QSED 5BV7L 5D8JL 3I50H 3WJLC 3H0TA 1WUNT 4XMLL 3KPQA 3UTPD 3DO3A 4XH2A 5I15H 3IT8D 2G75B 3PV7A 1KB5H 4BZYA 4MAYC 4Y16C 2QQKL 3OX8A 4N5UA 3ILQD 4U1NB 1RZ7L 2FLRT 4QRSB 4A6YH 2BVQA 3NABL 2BNQD 3P0GB 3PQYA 4GRLD 4WW2F 3ARBD 4QRPA 3T0AA 1KJ2A 4V1DE 2V2WA 1EO8L 4OLXH 4POZC 2J6EL 1JWUB 1ZLWH 5EOQH 1JMXA 2UYLA 2E6PA 4LSPH 3TH3T 5IW1A 3IS0X 3TZVC 4KKAC 3RL1A 4IIQC 5I18H 1S78D 5JXEA 4HIEB 2NXYB 4QF1B 5EUOF 4XCYB 4LKCB 4Y1AD 3CC5A 4LASL 4PJCE 1S9XA 1Y6NR 3CDFA 5CZKA 4ODXA 4LFHD 3X14B 1QUNA 3W0WD 3C08H 4YHZH 1U2CA 4ZXBC 4M1DH 1NGPL 5D70H 2H32B 4L3CB 5IVNA 5EUKA 1S7QB 5B38G 3TO4C 3VWJB 4PJ7B 5CLTA 3LHPH 3ZHDA 3VFMB 3DX7B 2EDTA 1RJZB 4UT7L 5DHVH 2Y5TB 3ALWA 3MCKA 4EIGB 4HULB 4LCWA 3FN0L 3C09C 1LVEA 4Z76B 3C2AL 4PJGB 2DWEA 4NQDA 2R0WH 1OF2A 1ORSA 2L7JA 2W0KA 3GMQA 3S88H 5J6HB 2ZUQB 3W2DL 5IOPB 35C8L 5DJXA 3W82A 4F37K 4OGAD 5D7LE 1E27A 4XCFH 4M7JL 3C5ZA 4S0UC 3HZYB 4LPCA 5IEKA 3VG0L 2F9BT 1KLGA 4GOSA 2CUIA 4QRRD 3C5SA 1NDMA 1WFNA 3IDGA 3HC0B 1I1AA 2FEDD 5EDXA 1FVDA 1X5LA 4JFXB 3U4BL 3ZL4H 5TF1L 3H7BA 4KUCF 1WBXA 3GSUB 4ZO8A 1PGRB 5TJWK 1JPGB 2X2YA 2AJVH 1C1EL 4RFEB 4NNPH 4EUPG 5E03A 2IH1B 4H0HB 2NY4D 5SWZB 4RAVB 4XVJL 4FMKA 2B4CL 4U1GB 4MWFA 1BZQK 4HV8A 2X1PA 3EYQC 4R96B 1DQQB 1RK0B 4U31A 5F97E 1IZKA 4L8CA 2X4SB 5DJCB 2BHZA 4POYA 1NMCB 2FZ3A 2X09A 3LKSB 3QI9A 4K7FB 3X12B 1OP9A 3ES6A 1VSCA 5I1IL 1G7QA 4JFHD 3CFDB 1V8HA 2EYTA 4QHKI 2F5BH 2PXYC 2IAMC 5EZLA 4APQC 1FL6A 2PYFA 2PKDA 3ZTNH 3BPLC 4CMMB 1R3JA 3X3FH 3VXQA 4R0LA 3EYUH 2Q7YB 3PE9A 3ELAT 1KELH 1J05B 3OSKA 3LSOA 4IRJA 1I1RA 1UVQA 5B8CC 4PRID 1Q9KA 4R97B 1I75A 4OLYL 2WY3A 1ED3B 4JFDD 1YNKH 3TN0B 2A77H 4LHUB 2F54A 2OTPA 1VADA 1P4LB 3CVHH 5ADOL 3OWEA 2D2OA 3KYOB 1WV7T 3O2WL 5DJ2A 1MJJA 5C07A 5JXAL 4RGOL 3O9WB 3TO2B 4Q9QL 3ZKNC 5I1JH 1PEZA 4RBPK 5DJ8B 4F3FB 4GW1B 1JGLH 1T20B 2COQA 3EDFA 1ZTXH 4MJ2A 5JPNB 1F6LL 2BY0A 1E4XH 4RISH 1HXMB 2HG5A 3WD5H 1FORL 2FGWH 5IB2A 4CAGA 1BM3H 4UT9L 2HKHH 4UIMA 5MENB 1RVFL 4X4ME 2G60L 1JPSH 3QWQB 2BHUA 4WUKL 4YC2B 4U7MA 1HXYA 1CFQA 1DQMH 2ENYA 3ZE2E 1JE6A 5IGXL 1ERNA 3WHXA 1MCWW 3KR3H 4IOFC 4Z0BL 1VERA 2XTJD 5FGBA 1FAIL 4ODSL 2DQFA 5LGJB 5FA4B 1L7TH 4O4YH 3KYKL 1EJOL 2AEQH 3RWIB 3BAEL 4I0PA 2BY2A 4NC1C 4E5XB 3WIHL 5AZ2H 2HYMA 1CF8L 5DS8A 3FTGB 4P2RB 3EJJX 4MA1B 3UEZA 5I1GH 5JO5A 3CLEH 4NN6C 3MRDA 4O02L 2O5YH 3H0TB 3MO1A 4YDKL 4W68A 5D6CA 5E5UB 3KPQB 2BDNH 5FGRA 3OHXA 1J1XL 1MCIA 1P1ZA 1GGCH 4X99A 2M8XA 4DK6A 1TZIA 1TNNA 1I7RA 2PYEA 2XZZA 1MFAH 5IMKA 5IV2A 2HFFA 4D94A 3PQYB 4QOKD 1MCCA 4LU5H 4R26H 4PP2B 2V2WB 4YLQT 4TSAH 3O6FA 3I85A 5D1ZD 5C0JA 4LK4A 4GUPA 5BMFL 1CLYH 8CGTA 5C08D 1U3HD 2UYLB 3T4YB 3QFJA 3MLPA 3BWAA 5IW1B 1EHLH 1MQ8A 3RL1B 2OJZL 2I5YL 1WZKA 2FEEL 2WIIB 3CC5B 3QEHA 2H9GA 3LRGA 3TYFB 4ODXB 4BZ2L 4KZEL 4D2NA 2PTTA 4S1QH 5DJDA 5FM5M 2AK4A 2ZWLT 5EUKB 3ABZA 1DR9A 4ZOEA 1K2DA 5F70A 5C0NC 3TF7C 2BOBB 2DQEH 3TT3H 1U8KA 1IGYA 3ZKMD 3MCKB 2WLYA 3FQXB 4LCWB 2Q20A 2VTFA 5IFHH 3M17B 3I6GA 5DEGB 1OF2B 2Y7QA 1A21A 1LO0L 1ZKAA 3O3UN 1OAZL 1WAAA 5FA3A 3QXWA 1V3JA 1ZHBB 5B4MC 4DGYL 5MHSE 2ITCB 1TENA 3DUSB 3VWKD 5J13C 1OGAE 4S11A 3D85D 1CGXA 4HXBH 3JV5A 4XP5H 5IB4A 1KIUA 5I1LA 1KLGB 4F15C 4Y5YB 3JSSA 3HC4L 4YQXH 4UU9B 3C5SB 4LSTH 1NLDH 3CXHK 4DKEL 1PG7X 5TE6L 1NDMB 5F7LB 3P2TA 4F57H 2B8OT 5HYFA 3MREA 3OAZH 1FFOA 3DMMC 3HI1B 3DWTA 4QXGH 1I1AB 1FVDB 3NZ8A 5DLMH 3H7BB 1J7VR 4FQ2H 4MVBA 1WBXB 2IALA 3EJZC 5IK3A 2NYYC 1QHPA 3V4PH 3Q0HA 3SDCA 4WU7A 1RZJH 2NY6D 4AMKL 4PJDA 3WUWG 1CD1A 1OL0A 2EDEA 4CW1A 3ARGA 4MS8D 5HDOA 5C09A 4HV8B 1WGOA 3CDYA 4UQ3A 3FZUC 5JQ6L 5L0QB 2F5AH 3AROA 4RNRB 2DOCA 3QI9B 4G8GE 4OGYH 4NZDA 3QUZA 4HF5H 1G7QB 2EYTB 3KXFE 1VPOL 3V4VL 5EZLB 1FL6B 2PYFB 5BO1L 1XGYH 4NWUH 1R3JB 3VXQB 2ZCLL 4R0LB 2B1AH 3I75B 2VLME 4IRJB 1F42A 3KPPB 1UVQB 4N5ED 2R56L 5DRXA 4DFIA 3HZVA 4U0QB 1CFVH 3NMEA 3WDIA 4TTDC 1X7QA 3MLTB 4YBLB 3CH1B 1C7TA 1EV2E 2F54B 5GPRA 2HN7B 1JPST 1VADB 3V6OC 2AJYH 4ZYKB 5C07B 4PJCA 3EKCA 5DJ2B 1MJJB 3MV11 4RFNC 3MOAH 2P24A 3MJ9L 1J0IA 4XC1H 4ZUWA 5GS0H 4LSSL 4HJ0D 1EXUA 2V17L 2GJJA 3RGVD 2XRAH 3S8WA 3ROLB 4FTVE 3FO0H 5IB2B 1PZ5B 4HCRL 4J2XA 4UIMB 4MD5B 3ZE0F 4H8WC 3ZZ1A 3OKDA 1QBMH 3GJEA 3SKMA 1JJUA 2F53B 3FB6A 4FRWA 2YPKB 3AAZA 1HXYB 2VLKE 5DHXB 3VFNA 3TBTA 3QG7H 3WHXB 4EDWH 5D7LA 4AY0A 1A6VH 1BVLB 3UTSD 1G1YA 1ZVYA 2XYCA 4H1LG 4PRNA 5F96H 2D7NA 1U8PA 1CLOH 1IGCH 4X7SH 2BFVL 4WUUD 3FQWA 3TESA 4HK3J 4HKZA 3SJVE 3QUYD 3U82B 3CU7A 2JJWA 4QCIA 4MAYD 4Y16D 3IVKA 2HT4C 1OGTA 5DS8B 5I71B 2YZ8A 3MRDB 4JG1L 4YWGL 3MO1B 1T1WA 5D6CB 5TPWL 2XZQL 1LDSA 1E6OL 5C9JA 2NXYC 3UP1A 1MSPA 1IAIH 3S96A 4Y4KD 4ZUVA 4HEME 1FVCA 1MWAA 1P1ZB 4N1EA 5IFJA 1TZIB 3GRWA 1I7RB 2PYEB 1IGMH 1YNLL 3QEQD 4P59H 1F2QA 4AT6A 3H3KA 3MCG1 2G9HA 3SHSA 3VWJC 3D6GA 4ZXBD 5C0JB 4GUPB 1EFXA 2NX5E 1ORQA 3EOTH 3QFJB 1NL0H 4GAGH 3BWAB 3TO4D 4OZIA 1P6AB 5E6IA 4ZNEE 4JR9H 2WWKO 1ZLVH 2WBJA 3SKNA 3GSOA 2VKWA 3BP6A 1GRWA 1MRCH 1TJIH 2CH8A 2PTTB 4X9BA 4O5LH 5ILTH 5DJDB 5HDBF 2AK4B 5DT1L 5C1MB 1ZMYA 5FECA 4FABH 3QUXC 2EIEA 4JRXD 1U8KB 5E8EA 1MHEA 1L7IL 5E8OB 4K9EC 2E27L 1CFNB 2DM3A 3I6GB 1EZVY 3MLYL 3VGBA 4AEIH 1KLFA 2CKBL 1DP0A 5EBWA 1DQDH 1P84K 3JBG7 2OL3A 2VH5H 5FA3B 1VEOA 4RFOL 4XCEA 3MV01 3AC0A 5IB4B 2Q87A 5I1LB 2E9BA 3CU1A 3A6BL 5CD3B 4WFGD 3QJHA 3NCEB 3JV6A 4JPKH 1R0AL 1CICC 3MREB 1FFOB 4X4MA 4KPHH 1VEPA 4YDVB 4LPTA 3NZ8B 3EYQD 4M7KH 1CD0A 1NMCC 3HZKA 4XNXL 4KK5C 1VGEL 5CHNA 2VDPH 4IOSD 4UBDD 3SDCB 2M2DA 1A7PL 5BV7H 4PJDB 2CR3A 5D8JH 1QRNE 3BMWA 5BOPA 4CW1B 3ARGB 4YE4L 4XMLH 3IDYB 5C09B 2B7DT 4NBYB 3WL9B 4UQ3B 1I85A 5GISH 1FE8H 2QQKH 3O11B 1Q8MA 1JTTA 4WEUD 1RZ7H 5E2WL 4WI6A 3NABH 1MFNA 3VXSD 5B38A 5D4QA 3QUZB 2EE3A 1IC7L 3TN0C 1EO8H 2J6EH 2ADIB 4XXCC 3AY4C 5D7KE 3UDWA 3SCMA 5HVHC 1GC1C 5CJBA 1MY5A 1HZHL 3O9WC 4K3JL 1HOCB 3FT2A 1WSST 4ZAKA 1V5JA 4LASH 5IM7A 1NSNL 1YEEL 5IW6B 4WDIA 4V1DB 4PJBF 3DYMA 2ED8A 2EE2A 4C4KO 2WNGA 5DRXB 3HZVB 1BP3B 3MYJA 1NGPH 2KUTA 4J3OC 1QNZL 5SWSD 4XNZB 2ARJA 2OQJB 3RNKB 5D96C 2DQDL 5E7BA 1L6ZA 4UT7H 1Z9OA 5F44A 4PJCB 4MD0B 5CJQL 2ZG1A 4YC2C 5CGYD 3FN0H 2YK1H 2ITDA 2P24B 2DWDA 4ZUWB 1OP5H 3RVWD 2I24N 4KZDL 4GH7B 3IDXL 1K6QH 2X4PA 2JJUA 2LTQB 5GGTA 1F6AA 2BNUA 3VRLF 4GXVL 3W2DH 3TJHA 35C8H 4EUPA 5IUSA 5A2JH 2JJSA 2AEIT 4M7JH 4URTB 5DURD 1RPQA 1IVLA 5ETUA 3OKDB 3GJEB 1UXWA 1K8IB 3FB6B 4OF3A 3NACL 3AAZB 5IB1B 5DZLA 4MA1C 1XF4B 3TBTB 4MQXC 1YEDA 4FFVD 3QO0A 3NA9L 5D7LB 3U4BH 1OGAA 4LLUA 5TF1H 1RUPL 4WFEE 1KJ3L 1U8PB 4JPWH 4OBRA 3B3IA 4DKAA 3WDHA 1XGQA 4PJHF 1ZANL 1C1EH 3FQWB 1Q72L 4HKZB 1X3DA 5HYEA 4XVJH 3IVKB 1Z0NA 3B5GA 1C16A 1MEXL 1YMMD 1CGUA 4R90H 3D69B 5KVFL 1BBDL 2EIDA 3BJ91 3P77A 3IDJA 3MRNB 1HDMA 2QV2A 4P2OB 1T1WB 4LMQI 5JXEC 3UJIL 5DGRA 4ZFGL 4KK6D 4ZUVB 1FVCB 1MWAB 1ZXQA 4MA8L 4NCC2 5KSUA 3AM8A 1FNGA 4X6CE 5T1LD 3UC0L 5IFJB 1M7IA 3RIAF 1R3LA 2GSIA 2QHLA 2I07A 1R5IA 1MCPL 4KHXH 1TZGL 5CEXA 4AT6B 3BDXA 2G9HB 4R9HA 3RL2B 3TV3H 3QNYA 2DF3A 4K8RL 1ORQB 4G8GA 2ORBL 4P4KA 2N56A 3JWOC 3WEXB 4OLYH 3IFPA 5C0ND 4Z6AT 3KXFA 3F7VB 4ELKB 5J6GA 4Z7QF 4YHMH 2GSGA 3GSOB 4YDLC 4RGMB 1BOYA 5C6WH 4O2CA 3G6JF 3NCYP 3O2WH 2P5WE 5JIPA 4LLWB 5M95B 4OGZA 4RGOH 4Q9QH 3KPSE 5A40E 2ZUUA 3VJ6B 1X4ZA 4O9HL 2MTPA 5B4MD 3S3SA 3E2HA 1F5WA 4Y5YC 3I02B 4MB3A 1MHEB 5DHYA 5CP3H 3BJLA 1IKNA 2VERN 4NO3A 4I9WE 5A16A 1J0YA 1I1AC 4HWNA 3MRLA 3IKCA 5EC1A 1L0XA 5EBWB 2GIYA 5EIIB 4QXWA 1UKQA 5J3HD 1NFKA 1RVFH 4WCYH 5IQ9B 2OL3B 3DMMD 2G60H 4XCEB 4WUKH 4NQED 2BXZA 4MXVF 4HQQL 4XPHH 4CU6A 4Y4HC 5TE4L 1KJ2L 4TRPH 5IGXH 3QUMH 2NYYD 1NGQL 4FTVA 5TH2A 1PQZA 4Z0BH 2IBZY 4QO1A 5FFLA 4L4TD 1MAML 1NC2A 4N90E 1FAIH 1KIQB 3CX5K 3QJHB 4ODSH 3RX7A 1JF6A 4X6FB 5K9KA 1L4IA 4FS0A 5FM8A 3KYKH 1EJOH 2NY2D 2O5XL 3BEWA 3QUKB 5L0QC 2E7LE 3BAEH 4Z7NE 4U33A 2VLKA 5IG7B 5DZNA 4JFFE 2I60L 3U6RA 3WIHH 5CHNB 2V5YA 1CF8H 3FRUB 2XQYK 3KYMA 4NQCE 1HHKA 3MROB 3N1GC 5IVOA 4OIIL 4O02H 3HMXA 1LK2A 4P46A 4YDKH 4G6AD 3SJVA 4J3UA 3UTTD 1OAKL 4Z7VE 1J1XH 1FH5L 4OCLC 3QCVL 1RIUL 1EHNA 4XT1C 5HJ3A 4DUWA 4PBXA 5CEZL 3CSPA 3HUJF 5I8CA 3TA3A 4U1JB 3GK8L 5B38B 4NIKB 3RWCA 4YBLC 4P5TA 2NY1B 4LSRH 3UO1L 3QHZL 5BMFH 4GG6F 4DW2L 4PJ8B 1T80A 4TTDD 3H9ZA 3SCMB 2AQ2A 5C2BL 3WNMA 2LU3A 3MMEA 2I5YH 1IM9D 1CDCA 1A47A 4G3YL 4WDIB 1LE9A 4KZEH 5C0EA 4ZSOB 2OZ4H 3MYJB 2NX5A 3OJ2C 3KS0J 1T22B 3AFLA 3FFCD 2BERA 4GKNA 2ICEB 4JCMA 1LP9E 3UZQA 2HKFH 4ZNEA 3U9UA 3MR9A 4PY8I 5JW4R 4J3SA 5D1QB 3DJ9A 2DWDB 3VMNA 1LO0H 4X7TA 1DDHB 2P8PA 2X4PB 1F6FB 4NC0B 4U1SA 4FFEX 3KLSA 1OAZH 1F6AB 2BNUB 4I3GA 1D6VL 2H26A 1IRAY 1WWBX 4NQXA 4EUPB 4DGYH 3AMKA 3WHE1 3WUWA 1HWHB 4ELMF 2JELH 3HNSL 4RMTA 5IR1A 3HC4H 1UXWB 1G6RH 4DKEH 1LQVA 3DVFA 3SPVA 4XZUB 4N68A 5TE6H 5DFVC