5IEKA

Structure of hla-b*40:02 in complex with the endogenous peptide refskepel
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-40 alpha chain
publication title Structure of HLA-B*40:02 in complex with the endogenous peptide REFSKEPEL
rcsb
source organism Homo sapiens
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iekA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5iekA01
2ED8A 4Y89A 3U46A 5FDWA 4LIQL 1W72B 1YEJH 1J0ZA 3C08H 3C8HA 4XP5H 1A7QL 1F2QA 1CT8B 4G6MH 3VMOA 2H2SD 5TE7H 1BFTA 1IRAY 4M9PA 5EZJA 4AEHH 2BVYA 5I1AA 2BSED 1WIOA 3OJDB 4ZFFB 4HDIA 4LLMB 2Y36H 2OYPA 1EJOH 1DP0A 1A2YA 1MRCL 1BM3L 2V2XA 2AJYL 5DMGD 2DYPD 1R5WA 4NZDA 2UZIL 4N1CA 3RWJA 3MNVB 1RFDL 1NCDH 2HJLB 5TJWK 3OGOE 5EU7C 4F9PC 3NGBC 4W81A 3O2WL 3ZE1F 4MNHB 4Y4FD 3VXSA 3HC3H 4PJAF 3WS6A 5E2WH 5E2TH 2WNGA 3OB0H 3IJSA 5ICYA 3FHAA 4Y16A 3T3MF 4MSWA 1H15B 4PIRF 4Z7WF 5D7JC 4I8DA 3D3VA 1HEZB 2FX9H 2XWTB 2VDPL 1YPZE 4M1CC 2CLZB 4G42A 4WI7A 3SBWC 3LSOB 4QTHB 2HFGL 5CJQH 2EE9A 4Y5XB 4WRLA 4YXKL 2B1HL 3LPFA 4EUPG 4JY5H 3O2DH 4NO0B 4QHLA 3OSKA 3JV4A 2F53B 1YJDC 2YA1A 3G9VA 2OZ4L 2JTDA 3HE7A 1A9EB 3MO1A 3BVNB 2DQTL 3AXLB 1QP1A 2VIRB 3NCYP 1T21A 2J8UF 5JQHC 2GJ6D 3RP1A 4JFHE 5B3JE 1KTLB 1XEDA 4LARL 5IVNA 4D9RD 3S3JA 1XIWB 4W4NA 1GPOH 5D93B 3MRIA 5CP3H 1C5DA 2NXZD 4FQXB 1FNSH 1NUGA 5HI4C 5C0RH 1FO0L 2DOCA 4LIQE 5C0AD 1B6DA 1E6OL 2NR6D 4OQTH 2BSTB 4MHHI 1SEBB 1AGEB 4HFWB 5ALCH 2FJGB 5CKGA 1BBJA 1F4AA 3GRWA 2R0LL 1CFVL 3I02A 2YS4A 5C9JA 2X5PA 4RFOH 3KG5A 4EUPA 3ARGB 4MX7B 4HBCL 4Z7UE 4KDTA 5T3XH 3VWKD 4F80A 3CC5B 4NYLB 4EN3C 3TPUB 4PJXE 4MXVE 5L9DL 2HN7B 5D7KE 1ZVSB 3WNMA 1DR9A 4P5KA 1EZVY 1RZ7H 3OKOB 3HC0B 5EOQH 5D2LE 1T80A 5KZCB 3U7WH 2A2QT 1FV1A 4UT6L 1LK2A 5HI5D 2ZUTA 3D18B 1BWMA 4UTBH 3H9SE 2Y9RT 2X1WL 5DDHA 1TTUA 4HKXA 1YEIH 2BFVL 4U1NA 4OZ4B 3JWDL 1ORSA 4GAGH 1RVFL 2W91A 5IESH 3DVFA 3GSUA 3NACH 3LB6C 4M1DH 4LHQB 4QWWD 1AHWB 25C8H 3OTTA 2DTMH 4LP5A 3DMMD 4C83A 1BIIA 5FYLL 2HAZA 4PJ9D 3VJ6B 2H1PL 3GBNL 1AR1D 2G60L 4QLRA 5GS0C 3WXVH 4X6EA 5HHQB 5KN5A 1N2RB 4O5LH 2AJXL 1ZE3C 2N56A 3CPLB 3ALPA 2HH0L 4ONHB 1OB1A 4ALAL 3ZKND 1IC7H 2YBRB 5D9SB 5C07E 1OCWL 4OM0H 1UKQA 2Z93B 3ARDB 3V4VL 3EYOA 3QO0A 1JVKA 1MJJB 3GIZL 2HFTA 3PWPE 5IMLA 1M05A 2XN9B 1E27B 1HQ4B 5IV2B 3ULVF 2OCFD 3MODL 1EK3A 2D9QB 4K94H 1SBBA 5KSUA 5F9DC 4YWGH 4P23D 4R6UA 5C0JB 5D7SH 3STLA 5HYJE 2Y72A 2HVKB 4L3EA 2HWZL 1K9TA 4F8TA 4UINL 5GGQL 4RDQF 4YC2C 4PJ5B 3VG0H 2B5IC 1MJ8H 5E7FA 3TVMA 3OAUL 5GGTL 3PABB 1BREA 3RL1B 4I1NB 1KIUA 1CU4L 2F19L 1U8HA 3IFPB 5I19H 1ZHBA 4OZHE 4JRXA 4PJ7B 4FQHA 5CD5C 4P48A 3QNYA 5F1NB 2OI9B 5SWSE 4K7PL 3EO9L 3X17A 1A0QH 3DETC 5GIRA 4MCZA 4CVZA 1YC8A 3U0TB 2C26A 3UPRB 5CIPB 4TQEH 3W5MA 3SKOA 1JI1A 1UM4L 5I1LA 3IDMB 1YEFH 1FSKC 1MRDH 1U58A 4J1UB 1IZKA 4G80A 3UTTA 4Y4HB 5FYLE 1JF5A 1HK6A 4PJEB 3IDYB 4CN6A 3RDTD 2JJVA 1PSKL 5AWNH 3TF7A 2ICWJ 1G7MA 4MXWH 3V79C 5MEOB 1QFUH 1J0HA 4RGNB 1XF2A 4YDIL 1DUZB 1JF6A 3TJHD 1LWRA 2KL6A 1OLZA 1XZ0A 4KKLD 1G0XA 4MA3B 4TNWF 1FE8L 5HGAB 4HXAH 5DXWA 5E8OA 3NN8B 4PLJC 2GITB 1DFBH 2Q6WA 1JRHI 5IBUG 4X4XB 1NGPH 5CMAB 1T4KB 3O3EB 2MPAL 5MEND 3RL2A 2WUCH 2XI9A 1IGCH 5CBAA 5E03A 3FQUA 4PJ8D 1Q9OA 5D1XB 5E1AA 1LO3H 2ZUSA 2R0KH 2Z8VC 4P46B 2PTVA 4FP8L 4N8CL 1TVHB 4XX1E 4UT7H 4I2XB 1H5BB 2GY7B 3ARRA 4R8WL 2YPLE 5I9QC 4G7VH 1L9MA 4WJ5A 1ZLWH 3F7RA 2W0LA 2VXQL 3U1SH 4PP2A 4YE4L 4DFIA 4XWOC 2HJKB 2KQNA 3P73B 6FABH 5SWZD 4YUEL 1KN2H 4QRQA 2ZJSL 4Y5YC 4UUJA 3RUGA 1J1XH 1FIGH 3Q5YA 4LLDA 1FYHB 5DJDA 4BH8A 5D7IF 1TETH 5FYKL 3CVHA 1JI2A 2IQAA 3PQYD 5IG7A 5J0BA 5C0CD 3L3IA 4R90H 1RK0B 4UQ3B 3NIDE 4Z78B 2ID5A 2JB6A 5LQBL 1DDHA 4JDTH 3VGGA 1KC5H 3R06A 4F2MB 5DLMH 2EIZB 4P2OB 4IMLB 3DX7A 1NLDH 5CIPH 4P4RB 3LD8C 4YXLL 4NQVB 2XPGA 3HPJA 1DSFH 3O6LL 5D8JL 1QBBA 1R3KA 4QF1A 3Q3GA 1G1CA 3O3BB 4KK8D 3RWDA 1IAOA 5T1KB 5MHSD 3EOTH 5FGCB 3OX8B 5FYKU 2BOCA 2ARWA 4PG9A 3GSRA 1P84K 1ZV5A 4BA8A 1CR9L 3MTRA 4TSBL 2X4OB 3HMWH 5FXCH 5GRZA 2Q7YB 3VGEA 1I9JL 2IAND 1HHJA 1JNHB 2R8SL 1K8IA 1S7VB 5IGXL 4GG6F 4YBHA 1P1ZA 5EBGA 4R2GD 2HKFL 4J4PA 2VLKB 2Y25A 3TH2T 4HC1A 1IQWL 1J1OL 3L3HB 2Z9TA 2X4PB 4BQ9A 4HJ0C 1IBGL 3HRZA 3X12B 1RJLB 3BYYA 3TBTB 1MAMH 4OFYA 3QNXA 4UAOC 3P0YH 4UNUA 2VJXA 5FB8A 2ED7A 2NMSA 4NKMB 1WCBA 4ZTOH 4ZXBD 5KS9B 2VLLA 1DQLL 2R4RH 4XP9H 4TSCH 3S34H 3B3IA 4I3GA 3SDXA 3VFUA 1DL7L 4JG1H 2HG5B 3O9WB 1FORL 2CRYA 5DQDH 3U7AA 5INCB 5FYKE 3TA3C 3BEWA 5FM8A 4C58B 3IU3A 2J4WL 3VFPA 2CO6B 4IRJD 3QH3B 5IBLD 1UWXK 3JTTA 4HS8H 2NX5A 3N1MC 1JNJA 2BNRE 3D2UB 1DVFB 4D3CL 4HIHA 2E7CA 3OKDA 1IL1A 4LASH 5DVLA 2A83A 4PG2C 1G6RA 5ANME 3L3KB 4M6OH 3VFWB 3MRQB 4AL8L 2EDJA 3MXWL 4Q6IC 2PNDA 4L8DB 2EICA 1MCEA 2P5WE 5F3BB 4PRPB 3ZDZE 1QRNA 1NMAH 4RMTA 3NIFE 3C6LA 2VUYA 1GZQA 1F5WA 4OFPA 5A2LH 3RY6A 4S1QL 3UZEA 3DTXA 1XGQB 1FVEB 3QI9B 4OLZH 3NABH 1MI5E 5HHPA 2BNUA 5T1LD 3H6JA 1NPUA 3EYFB 3LQMA 4GBXC 4FQLL 4DKDC 5JIIA 3CFBA 4UNVA 4EI5D 4X7EC 2FECL 5H35A 3SJVE 1MHPH 4NQCE 1KTDA 4OD1H 1KUMA 2EDBA 1S7TB 1HNGA 2EKSB 3VE0A 3LEVL 5C1MB 1T83A 2CPCA 5MERB 3EO1B 5EC1A 3RJQB 2YRPA 3MJ9A 1BLNA 3DIFB 3H7LA 4WO4D 1MWAA 3PGFH 1MRFH 1MHEB 4IOFD 4QCIB 4QXGH 1KBGL 2PXYA 5EC2A 2ATKB 1MNUL 2VH5L 1BQHG 3TFKD 4MJ6B 5IMMB 4ZO9A 4GMTL 1AY1L 3LV3B 3OXRB 3MGOB 3GK8H 3MRFB 3NZ8B 5F1SA 4LEOB 4OKVB 4JJ5A 4PRDB 4ODWB 4JHWL 1XF3A 1X5XA 3ZL4L 2BMKB 1BZ9A 4BH7B 1FFOA 1NGWA 2FGWH 4R4FL 1NGXA 3O41B 1LEKA 3GGWA 3E6FB 4H5SA 5MP6H 4JN2A 2FATL 4KY1H 5BRZD 1YPZA 2OR9H 4GLRI 3CVIH 1A4JA 2B20A 1MIML 1MJUL 1MIEL 1XGYH 5H37H 3S98A 4BELD 1FFNA 3ULUF 2YPKA 3MC0A 5AG9A 5F3HA 4ZO8A 4EOWH 4JCMA 2F74A 3GBML 3NPSB 5BW7A 1QSFB 3AU1B 5C7XL 3SGEH 4N90E 2A6KA 1FBIL 3FQRA 1OSPH 2UVEA 4XMKH 1F02I 1QOKA 2IJ0C 1P53A 2X09A 2K9UA 2NYYC 4U0QB 1SMAA 3IRZA 5BOZG 3GNML 2JJSC 3QIUD 4OCLC 3JTSA 3JV6A 2QBWA 1LO4L 2KUTA 3KAAA 1U92B 1IQDB 3NVQA 1U8IB 4QHKI 4TULL 2ICES 3QNZA 2CRMA 3BDXA 1I1AC 4U6YB 3B6SB 2Z31D 4Y2OA 4PJBE 5IVOA 1YN6B 5DHYA 3RPIB 1FZOA 1CVSC 4Z7UA 4PTUA 1KCRH 1B4JH 1K8DB 2XRAH 3U30B 3MRRB 5J6HB 1MHHA 4MA7H 1LO0H 4O58H 3LN4B 4X8JB 2VZOA 3IDJB 1IKNC 1QEWA 3CFIC 4PJXA 4K7FA 4ZYKA 4PP1C 1QLEH 2DN7A 1MQ8A 2IADB 4LCCA 3T3PF 2P47B 4JKMA 5KVEH 1XCQA 2NY2C 3MPCA 2NY4C 2VN7A 3T0DA 4UNTA 4WWKC 5D2LA 3SKNA 1A6AA 1P4LB 4N5ED 4RZCB 2WINA 5I1HL 3H9SA 3RWGA 5I1GL 3QDJE 3REWA 4L3CB 4UOW0 2XKSA 2FJFB 3TV3H 3BEVA 1AGCB 3S4SB 1CFSB 2LV4A 3C60B 2DBLH 3FOLA 4WDIA 3I2CL 1A21A 3W9EB 4OB5H 5LKNA 3MJ7A 2WBJC 1CZ8H 4PJGF 3HG1B 4J3WA 5EU6E 4GRLA 4XCFL 5ISZB 4NRXA 3ZLQC 2BNQB 3TPKA 4MAUL 4BQ8A 5E2VH 1CGTA 4KK9D 2DMKA 2OQJA 1T3FB 4AENB 3G6JB 2BJML 4MJIE 5GGVY 5C07A 3HZYB 4QYOB 3P30H 1X5LA 3BPOC 3D25A 1A1NA 5FHBH 2A6IB 1T2QL 3G9AB 3GMLA 3WJJC 3CZFB 3WS6C 5FYJD 3PWPA 1CL7H 1FO0A 5DT1L 4NQED 3U83A 4Y16C 4WIQA 5KAQF 5CHNA 1W0WA 3QIBC 1D9KD 3NCFB 2RB8A 4GXUN 2XIDA 4HGWA 1OGAD 3LKNA 5F7YC 5HYJA 4O2FA 1OWWA 3IDGA 3QUXD 5JO5A 1F97A 1HCVA 2V17H 3TO4B 2YHGA 3IAGC 3SOBH 4MQ7B 2ZSWB 1YNTA 4LCUB 2DIJA 2O5XH 1IFHH 2AJVL 3L5XH 1RJZB 5J11B 5TE4L 3T0EE 5ICZA 3OWEA 2BVPB 2QSCL 5CGYC 4IS6A 4OZHA 3BP6A 3MLWH 1HH6B 1CGWA 2B0SL 5SWSA 2CK0L 3FQNB 4KRMB 3QEHB 3G08A 5GISL 4PJHF 2PW1B 1ZVHA 2NY1B 1Q1JH 3QUZD 4AH2A 1O5DT 4PREB 1UACL 1YQVH 4V1DB 3T0XA 2W9LA 2ORBH 3PGDA 1YUHA 1JHLH 1JGEB 3BH8B 4XHJC 4L29B 1BZQK 4BQCA 5TE6L 2J8OA 3QUMH 3PWUA 4C59B 2SEBB 3HUJB 4XX1G 1DBAH 4G8FB 3ULVH 1QR4A 1CICB 1U36A 4NZTL 3T2QA 3QG7L 3RRQA 3IDXL 3MOAH 5JMOC 2EC9T 3ZZ1A 4X4YB 2X89D 1XGRA 2VDOH 4QRRD 2ICWA 5DJCB 2OTWA 1YN7B 2A9ML 2XTJE 5AUMA 4N0CC 4K8RH 3LPWA 5DK0B 2XY1A 4K23H 2CLVB 1UZ6E 3P9LB 1WZKA 4L3AA 3GUTA 4DN4L 2WBKA 1FNFA 3M07A 3TBYB 1KEML 1P4BL 3QQ3B 2FD6H 3MRLA 4GAJH 1KJMA 1S5IL 2XV6B 5FM5M 3MYZA 5E9DE 3O6FD 4ODHH 5IJVA 3AC0A 1CLYH 3H9HA 3SCMA 3QISA 3QEGL 4BFEA 4EI6A 1BJ1J 5E95B 1Z5LB 4U6HB 2QEJA 5C08B 4XP6L 1IM3A 2YPLA 3DXAD 1CD8A 3H8NA 1AIFB 2EXYD 3PV6A 3T04D 5GGTA 2ARJB 1T0PB 2CH8A 3N50A 3BZDA 4JFXA 3ARWA 1FL6B 3EZ8A 4XPBL 4ELMF 4Y5VA 3C8KA 4I9WE 4LFHG 4XNXH 3KPNA 4Y1AD 1S7WA 5JPMB 4GG6B 5TGBA 3K8LA 3CU7A 2WY3A 1VENA 2DJSA 3BP4A 4HKJB 1HHGB 3V2AR 4NO5B 4NM4L 4S1SH 4ZFGH 5I8OH 4CU6A 4KUZH 3E6HB 1PD6A 4BSVB 4U1IA 2EXWC 5JW3H 1PFCA 3TBSA 4JQXA 2Z35B 4HFUH 3A6CL 4H8WH 1D5ZA 1N4XL 3WDIA 4R9HA 5F7MC 5JHDD 3HRPA 4N8VG 2FJHA 1ZK9A 3RIAK 3PP4L 5GGVH 3OAYK 7FABH 2X2YA 4WTXA 1OP3H 2VDLH 3DROA 3QRGH 3OGCB 5KVFH 3GHEH 5HPMB 1ZHKB 2KZWA 4FQ2L 2PR4L 3GKWH 3OKEB 1X4YA 3QFJD 4EN3B 1HKLL 4RFEA 3QUYA 4JFPB 4D9QE 5IW6B 3C5ZA 4DGYH 2FX7L 3L6FB 2HTKD 1ORQA 5IMOA 3V0VA 3MROB 1CBVL 3C6SA 2XZAH 3AAZB 1OARH 1QBLL 3PWNB 4JB9L 3BN3B 1A22B 4U6TA 4N8VA 2QADC 1HE7A 2GT9B 2B1AL 3HR6A 1M7DB 4GS7C 3SDAA 5F7DA 3VFTA 3IXAB 1QO3A 2OTPA 3MLXL 4UT9H 3K0WA 5A2KH 1MFCL 2R2HB 1P69B 4LPWA 3VA6A 4XNYH 5EOCH 2ZPKH 2H32H 4ZS6C 2R69H 1BWWA 2UYLA 3MLVL 5TH2A 5BVPH 2HT4C 4OZGF 4G43B 1TCMA 2AXFA 4NO2B 4RWYH 5HDBF 1ADQH 4JM2A 1ZLWK 5I16B 4L4VB 5GGSY 4IRZL 3C5JA 3N9GH 4ISVB 1CE6B 3LS5H 1S9XB 2AV1B 2V2WB 5J9PB 3O8XA 4KRNA 4R7NB 2BNRA 1KT2A 2I60L 4I77L 5AYQA 3W2DH 4F7MB 5TDOB 1UXSB 5EO9B 3O4OB 1U6AH 2BVEA 2NY3C 3UYRH 1UM6L 4OLYL 4PDCE 3F7VA 3QG6A 1U8QA 1OP5H 4P5TD 5CSZA 3VGBA 1JUFB 2BVUA 2WMPA 1ZWIB 3VRLE 3CH1B 4GUPA 1PDKA 3HB3C 3MV9D 2PW2B 1CLZH 5DUMH 1JFQL 4YC2B 2B5IB 3MREA 2H2PC 2Q3AA 2HT2C 4LNRA 1MI5A 2CGRH 5D1QD 3VRJB 2BCKB 2YZ8A 4LLVB 3G5VA 3KLHC 1G9ML 3RNQA 1F6LL 4KJWD 1SM3L 2A77H 3UO1H 5IM7B 3CFCL 3FFCD 4M7JH 3BHBA 3SJVA 2D7NA 3TCXA 4NQCA 2F58H 1A3LL 4BZYA 2GJ6E 5A2FA 4ZAKC 3TBWB 1INQB 4GQ9L 3IF1B 4TUJB 1Q38A 5HYEA 1O7VA 1M7IA 4XVSL 3C9NA 5C6TL 4NZUL 1ZGLP 15C8H 1G7JA 3D9AH 2W65B 5EOTA 3B2UD 2CLRB 5C0AE 1YNKH 2RIKA 5DJ2B 4ZUUB 4KKCC 3SGDH 2IC2A 3RVVD 1NSNH 1FSKB 3MRKB 5TF0A 3V8CA 3DO7A 3W5NA 1XF5A 1RUML 1TVBB 2VITA 4DVRL 4ODXA 3CLEH 1I9EA 4B0MM 2NCMA 3FTGA 4WFGE 4X6DE 1MCRA 4AM0A 2EH7L 4J4PC 5JORA 2ZUWA 2VABA 3VGFA 4XCYB 3FRPG 4V2CB 4KK6C 3ZDXE 4UBDD 5IB5B 2PO6D 2JK5B 5JXEA 3NH7L 2CXGA 1IMHC 4XNUH 3AY4A 4OGAD 4HF5L 2UUDH 4G6JL 3AFLA 3ILPA 5KJRL 1MAJA 1PZ5B 3W9DA 3PGCA 3RTQB 2OSLA 4AEFA 4NIKB 2R39A 2DQFA 5EZOH 4U05A 3LKOA 5DS8A 4CNIB 1CXEA 5E8NB 3ZKMC 3BGAA 3GIVA 5KVDL 2AQ3A 4I0KA 4XZUB 1H3PL 5I9QB 5FF6B 3LRSB 2KZ1B 3GJFH 1J8HB 2WUBH 2IPKA 4OIIL 5LGHH 5GS2H 1SYVA 4OLXH 3U2SB 1HHHA 3IDUA 3G5YA 4LCWE 3WFEH 4MAYD 3FRPA 1A6ZA 4WCYH 5JXAH 3BQUC 5EFIB 1P4IL 3G5ZA 3QHTC 3WSQH 1LDPH 1R24A 4Y5YB 2MNUA 5DJ8B 1I4FA 3WIHA 4PJBA 4XC1L 4U6VH 1NL0L 4UZGA 1S5HA 2EDDA 2ZUQC 2A1WL 1BQLL 4X0KB 4BKLA 4F15C 2NQCA 4TTDC 1E6JL 1T1XA 4JM4L 3SKMA 4Y8AA 3A6BH 1M7XA 2RFXB 4LF3A 4LLYB 3ULUH 1NGYA 1RZKL 5JQ6L 2ENYA 3C6LC 2GJZB 4QRUB 1INDL 4PD4J 3RY6C 4U7SA 4ELKA 4NKOA 5CSBA 2DF3A 4I18A 3LPGA 4GMSL 3FQXB 4WI3A 4ACPA 2DQJL 2EO9A 5T33L 3QDJA 4LPUA 1S9YB 5FA3B 1I7ZA 1MCBA 2FH8A 2J2ZA 3D0VB 3WFHB 3VFSA 1WUNT 1QLRB 1INEL 4QOKB 4YZFF 2D4FA 3AROA 5EU6A 4LLWB 1YECL 1I9RH 3CGTA 4RMWA 5GRYA 4WW1A 5IK3A 4JZNA 4JFOB 2PXYC 2EZ0C 1MJ7H 1VGKA 5DD5L 2DLGA 3QSKB 1CF8H 4NP4H 3VXUB 4MJIA 4UAOB 2CIKB 3VWJA 3LH2H 3L3DB 2FYYB 3QWRA 2HYMA 1NEZB 1LEIB 4HWBH 4NO0D 5C8JA 4MS8D 2F53D 2FSEA 1SJEA 2ZNWA 1K2DA 1ZANL 4PLKD 2VXSL 4NNXB 5HGHA 3FRUA 3BXNB 2Z91A 4XVUD 2HA1A 4G8GE 3TA3B 3LQZA 1PGRB 3O6KH 5IW1A 3UC0L 4RX4A 1Q9KB 4OTXH 1URLA 4OM1L 1KG0B 4ONGL 4OUUA 4D0BA 4KAQL 1KYOJ 4KVCH 5GGUB 1XIWD 2BRRL 3V6OC 5MENE 1DLHB 3BOVA 1C5BL 4FQXD 5BMFL 3T0EA 1MFBL 2CKNA 4XBPB 4LSQL 4Z95L 4M93C 4HS6B 5DJAB 4KKNA 2CIIB 1T7ZA 3F12A 4FG6D 4X99B 3B9KB 3WNOA 2AV7A 4OAWB 2QSVA 5JR1L 2IEPA 3VGAB 3IT8D 1HNFA 1UENA 4Q6IB 2VZ3A 5ETUA 5HJ3A 4EKXA 3ARGD 1S7RA 4K9EH 4ZO7A 2GUOB 2CRZA 2J6EH 5LG1A 1DEEA 4ZNCD 4NZRL 1P2CB 4M7KL 4UIMB 1BJ8A 5SWZE 2YUXA 4LU5L 2QHRL 3BZ4A 4KWUA 5ILTL 5JNYB 1CI5A 3S35X 4D0DB 5KZCD 1KLUA 4GBXB 1RU9H 3KJ6H 3PQYE 4PJIE 3DSNA 1X5YA 5C0CE 5AZEH 2I07B 2AVGA 3O3DA 3TH3T 3FAWA 3VFNA 4ELMB 4LCCC 2AK4D 3I84A 4RMVA 5FECB 5FOJA 4LSRH 3IJHA 1IARB 1I9IL 4C57C 5L8JB 2X4RA 3ZE0F 3K2UH 2VO5A 3K74B 3B8SA 1PX4A 3MCLL 2ADIA 3G6AA 3I3DA 4QHMB 3CMOL 5E9DA 1QSEB 1MFDL 4PGZA 3WXWL 4XAWH 4P4KA 4RWHA 2FL5A 3WFBH 5L2KE 5MHSE 3RUGF 2ZOLB 4QNPF 3WIFA 5FO8B 3JWNC 4MMZC 1QNZL 2F9BT 4OBRA 1MVUA 5TFSL 4X7FC 4GRLC 4NBYB 4YQXH 1ZT1B 3ARDD 3PDOA 4JGUA 3FB5A 4HT1H 5GSRB 3VFGL 5KG9B 3WD5H 2RCSH 1FG9C 2XN9D 3K1DA 1I3RA 2AQ2A 4U1MA 2XWJB 2LVCA 3GSOA 4BJLA 1CFTB 2NTFB 4GH7B 2ZCKH 3HE6A 3GI8H 4XXDA 2AXGA 4KHXL 4LOUD 5T1MA 3P77B 2CKBB 4WFHD 5E70A 5D5MB 1RHHB 4XPGH 4PJ5D 1PKQE 4WI5A 5IP4A 4CN1A 4NQXA 1HH9A 2DD8L 3S6CA 5FIEA 1UA6H 2YKLH 1PYWA 5DMJB 2LU4A 2Q8AH 5J06A 3OKYA 2G75B 3FO2A 2C4FU 4KHTL 2VSCA 1IM9B 1GHFL 2V9TA 3VXPA 4KI5F 1MSPA 3RAJH 3T0WA 3WKML 1ZLSL 1D6EB 3I6GB 1I1AB 2V5MA 3KNBA 2P42B 4NQUA 1V05A 5E8PB 2WWKT 3VDCA 5FUZL 3GMQB 4HWNA 3ZTJG 1GRWA 3P0VL 3HR5B 1TZGH 1OTUC 4Q0XH 2AJSH 5JZ7D 2DQDL 1X4ZA 3WYRA 5CILL 3V6ZA 4LCIH 1OTSD 3BE1H 2DMCA 3B4NA 4Y4HD 3F6LA 1GGCL 4JFYA 1ED3B 3FN0L 3K81A 3P4MA 5DRWA 5M94B 3CK0H 1QACA 2P24B 1V5JA 3SDXF 4YDKH 2BDNH 4PFEA 4JFEA 4FNLH 4RGND 2YC1B 2NY2B 2NY4B 4OFIA 2Q87A 5I76B 5LWYL 4WWKB 3QAZC 3VFRA 3WN5A 5HD8D 4WY7H 1K6QH 1XFPA 2ZUYA 3VFNB 4G3YH 2VXTL 2IWGA 4LPCA 4I0PA 4NQSA 4KZEL 1RIVL 2GJJA 1A3RH 3BIKA 4L1DA 1C7TA 3L5WA 1UJ3A 5I1AB 5D1XD 5EZJB 1JGUH 3QXUA 5I15H 4P46D 3V4UL 2YD7A 2WBJB 2R4SL 1X5FA 5J6GB 3GI9L 3MCKA 1B2WH 4MXQA 3R0MA 1HXYB 3QWOA 4L8BA 4FZEH 1A2YB 1QYGH 2V2XB 3PWVA 2DQGH 1EHXA 2VZSA 2HFFB 5K9OA 3U0PB 3B83A 3C2AL 2DM2A 3SCMC 1RUKL 4WNQA 3SDDC 2DYPA 2YA2A 1WVZA 5JMRA 4ONFH 3BPOB 3OG4B 4NQDB 1S7XA 3VXSB 4YHZL 3T08A 4Z7NF 3ORJA 3LKPA 5DR5L 5I30H 4ZPVB 4JR9H 4NZJA 5IVXE 4Y16B 3WCYA 4LLAA 3QIBB 5ALBH 4TNWK 4Y4FA 4QXTA 1BBDH 4M43L 3D3VB 3IKCA 2GSGA 3BESR 3NBNA 4Y5VC 4G42B 3ARSA 3RWCA 3SKJL 3SHSA 3WDHA 4P2OD 5DD1L 1UKTA 1YEGL 3JV4B 5BRZE 4M7LH 5ID1A 5K9QI 2NW3B 3IB4A 1T20A 4HWZA 1ACYH 5C2BL 1R3HA 3MO1B 3PE9A 4CKVX 1EMTH 2WZPD 1ZHNB 2K7QA 1Z6JT 3HZMA 4HUXA 5IB4B 2CK2A 4CUCA 3HI6H 4XMLH 5T1KD 3RVUD 3CAFA 3KR3L 2X70A 4JQXC 3S96B 3HMXH 4MB4A 1OP3K 2GJ6A 3O11B 4KMTL 1BFOA 4QRTA 2A0LD 1CQKA 2Q8BL 2IBZX 4LVNC 3WO4C 3RQ3A 1F4HA 2B8OT 1ZA6A 3RZCA 1TZHA 1BBJB 2W0FA 4F33B 3I02B 1WK0A 1CK0H 2VLKD 5C0AA 1KENH 5DQJA 3QQNA 3QFDA 1MFEL 4XGZA 4HLZG 1A7OH 1YPZF 5DD6A 1IAII 1J0KA 3QDAA 3UEZA 5SWQA 4XXCA 4X6DA 3K7UA 3QPXL 3GO1L 4JDZA 3L1OL 3MLRL 3KLAB 4H20H 3C5ZC 5CBEA 3VD5A 1A4KB 4ZPTA 1WEJL 4FFZH 1RURL 4S0SD 4PTTA 4HZAA 1AXTL 4FFVD 5B3JF 3MRJA 4JQIL 4DW2L 2P7TA 1E4XH 1UB6B 4C4KO 3O9WD 4MVBC 3UTZA 1VFUA 1OAQL 1U0QA 4YX2L 2AABL 3U0WH 2XNAA 3SDAC 1T22A 4HK0B 4U1NB 5EO1B 1DCLA 1ORSB 1BHGA 3EBAA 3GSUB 2B4CH 5CINL 3CXHJ 5T5FH 4PY7A 1QBML 1VACB 1F90H 2HLFD 1FQ9C 1FLRL 1U42A 1KPRA 1AGDA 1BIIB 3VRIB 2XA3A 3C5SB 3D2UD 2ZOKB 1DVFD 3QO1B 3LQAL 4UB0L 3UXFA 1J1PH 2R2BA 1U95B 4X98A 4LKXA 2H9GA 4FQIH 4F37F 3GJEB 1R3JA 4LCWA 4JM2C 1L9NA 3DMMA 4M6NH 4M62H 4PJ9A 2D3VA 3MMEA 4MXVF 1TQBC 2WBWB 3BT2L 1OP5K 4IDJL 2DS4A 4DGIH 4Z0XA 4PRPD 5GS1C 3T0BA 1KN4L 4V3EB 1N3NA 5D2LF 1FGNL 1OF2A 4EVNA 1M05B 1FPTL 3ELAT 3MRBB 3QI9D 3VXNB 3OKNA 2AI0H 1ZS8A 4R26H 1I7TA 5KSUB 4HXBL 1FZJA 3H42H 3TT1L 2GCYB 4NQEE 4MQXD 3STLB 4X7DC 1FNEB 1KCLA 1W0VA 3HC4H 4L3EB 4OT1L 2X4SB 4YO0A 1TMCA 1NCWH 3LIZL 1XAUA 4P23A 1F2XK 1U41A 1XH3A 1RK1B 1EXUA 4UU9B 1JZ8A 1KELL 1RUAH 3L7FA 4ODSL 4MNGE 3GRWH 3EO0A 2QHLA 5I6XB 4DOHB 3VDAA 1U8HB 3BGMB 2COQA 3BPCB 1ZHBB 4ZQKB 1I7UA 4JRXB 4RNRA 4EUPH 5TQ0L 1LP9B 1PEZA 4QTIH 3MOQA 3MRCA 3G04A 4CVZB 1OW0A 4MDJB 1KB5B 2GTWA 2C3XA 5HDLA 4PJFB 2AS5M 5DUBA 4F3FB 3SKOB 3I50H 4YDJA 2DKUA 4GKNA 1E4WL 2VR4A 3RX5A 1KTRL 4N68A 4WENB 1AGFB 5E5UB 1S9KC 3LHPL 4WHTB 4KJQD 1SJHB 1UEYA 4TVPH 5I18H 3BDYL 5LXGL 5I1IH 5B4MD 2YPVL 2RGSA 4PGDA 1VADA 4XVJL 4JVWA 1CFQB 1M71A 3GKZA 4QRSA 1EJ6A 2P1YA 1MPAL 2QADB 3IDNA 3MLPA 4JZJA 4GS7B 1OAKL 4RISL 5IJKA 1EO8L 5ESVB 1UWEL 3BRDA 2WWKO 4QRRE 1QSFD 4X9HA 5JOFB 1BFVH 5E8OB 5HPOA 5T3ZD 4OZHF 4LQFL 4N1HB 4G8GA 3LN5B 5JW5A 1JNLL 3NCEB 5SV3A 3RL2B 5L6YH 3AY4C 4DAGH 1CXLA 3OXSA 2EC8A 3MFFB 4X6FA 5CBAB 3U4BH 3GMRB 4IOSD 1Q0XH 4ZNEE 5I8KL 3RWHA 2QR0A 3GJFK 1RULL 1CIDA 1EFQA 1NBYA 3QQ4A 1QPXA 1IGIL 5I1CH 3GSWB 4P5MA 4U4BA 1KCUL 1CG9B 1N64L 3WEXA 4YXHL 4PJ8A 3KPQA 2H3NB 1U8JA 4PJCB 3RVWD 4WJ5B 4KJPC 2GK2A 2NY3B 2CDGA 5D70H 5DJ6A 1BEYL 4NJAH 3N85L 4D2NA 1DQDL 4Z76A 1OY3B 1IGJA 2MFNA 4UUJB 4YHMH 5DJDB 3RUGB 5MI0C 4BH8B 3GSNB 5C0IB 2IQAB 5D71L 2J88L 5SWZA 1OTTD 3IGAA 5HGBA 3AVEA 2DJUA 4NRZA 2F5BH 3RWEA 5EWIL 1Z3GL 1FL5A 1PX3A 1F4WL 2OXHA 3HLAA 2YXFA 1DDHB 4WTWA 1FGVL 4Y1AE 3PQYA 1XF4B 4PJIA 4X5XA 2E27L 3R06B 5C0CA 5FV2A 3MV8B 5H94A 2GI7A 4U3HA 5DRXB 2ZKHL 4Y88A 5C0EB 4P57A 4M1GH 1JRHL 1C5CL 3M1BB 4MD0B 3EOAB 3CXDL 3C60D 3HPJB 4ZAKB 3E2HA 3N0PB 5IIEA 1MH5A 1BGXH 3U6RA 2VQTA 5DJYA 3N06B 1OAUL 1R3KB 4K8RD 4QF1B 1JPGA 3Q3GB 3VXQA 3HG1D 4M6MH 3RWDB 4F58H 5HYSB 1IAOB 4ZUVB 1T1ZB 5JHDE 5ACMA 4ZTPH 4PB0H 2BNQD 3A67L 3S37H 4PRAA 4AQOA 2XKUA 4Z7QE 4PS4H 4L8CA 5L2KA 4AMKL 5ITBH 2Y5TA 1K8IB 1YEEH 1MCWW 1AE6L 2DICA 5ERWA 4JN1L 2ZNXA 2O61A 4YHLH 3L3OB 43C9A 5CD3B 2MWCA 2JCCE 4XPTL 5JDSA 4OZFG 4EQ2A 3U36A 3MRGB 1WGOA 4Q9QL 5BV7L 1CD1A 5EO0A 1LEGB 2OL3L 1OD7A 1B90A 4Q97A 1KLGA 4BZ1L 1F3JA 2G9HA 5EBMB 1F6FB 3TNMA 4KXZH 4KZDL 1WCBB 3OHXA 1JTOA 5HDOA 1M6OB 4P59L 4W4OA 3TO4D 4WUKL 2VLLB 2VE6A 7CGTA 1PKQA 4EDXA 1UXWA 4RFNC 3DVNA 3N1GC 4ZXBA 3WUZA 1J11A 1YC7A 3FO0L 4TVSa 3UPCA 2BVQB 2PCPB 3EGSA 1P6AB 4GRMA 4N0FB 1EJOL 4NOFA 1C1EH 1TJHL 4NUJB 2AJUL 3NZHL 2NY1D 4G8EA 2RBLA 3CVHH 3BQUB 4OZFA 4ORZC 5DHXB 4L1HA 4V1DD 5CGMA 4HIHB 2HJFA 4JGJA 2ADGA 3OKDB 1IL1B 3I75A 4HK3J 3DUSA 3BN9D 4J7RA 2ZUQB 4EEEA 5DWUH 5HYQA 3VGDA 1G9NL 1ULVA 3T77B 4F15B 4EDWH 4JPVH 3EYUL 1CICD 3O6ML 3RKDD 1LQSR 2IH1A 2A73A 4S10A 4FQCH 2O5ZH 4NPYB 3UJIH 4RAHA 1QRNB 1XR9A 5EORH 3CX5K 4F8QA 5T5NG 1U93A 1QSVA 3T65B 2APTA 1EAJA 1OQXA 1KNOA 4W6XB 3CFEA 4DUVA 5AD0A 1LO5A 5E5RB 2DQIH 2BNUB 3SPVA 5SX5H 4UDTB 3O2VL 5HHMB 2I9LB 4IMKC 4GSDL 3CFBB 1YY9C 4JM2F 5TQ2L 1GZPA 2XTJC 2ZUUA 3I3EA 5H35B 1JZ6A 3EIFA 4ODTL 2EYTA 1WT5A 4OV5A 3FONB 5FA4B 5ACZB 2NLJB 4EI5A 1H8SA 3BPLC 4NFDA 5FDYA 3VE0B 4HC1H 1QRKA 2JLLA 4KJYB 5CJOH 5CEZH 1XGUA 4X7TB 4E41E 2WK2A 4DKEH 1WICA 3X3FL 4XP1H 1FAIL 1EHLL 4HW6A 2VAAA 4N9OB 1I85A 5C08D 3RHWF 3D0LA 4N9GA 2PXYB 2VXUH 5EC2B 4WGWB 2F8OA 1L8JA 4OFKA 4S0UC 3ZDZF 4K2UH 5D7JD 4P4KC 1HSBB 3NIFF 1W72L 2G2RB 1QVOA 2D7TL 4IEFB 4M1CD 4ESKA 1F4YL 3ARVA 5F9OL 2ZUXA 3TFKA 1K5NA 2RQ8A 3FL7A 3D39D 4PRHD 5IVXA 4YHOH 1BZ9B 4LSPH 2XQBL 3AMLA 1LEKB 1NGXB 5DEGA 1A7RL 3DUHA 2OJZH 1JPFB 1U91A 4U7KA 4Z7VE 1JWUB 4ZFOB 5EOQL 4WUUB 3MRNA 3X14B 3TYGH 3HE6C 5HY9A 2YPKB 1OWRM 1K85A 1SY6L 4UTBL 1KXVC 1YZZA 5BRZA 5GRVL 3BKYL 3TNNB 3KYKH 4K3JL 4YK4C 2GK0B 2R1WA 5C09D 1KEGH 5CJ5A 5HI4D 1HHKA 1G6RH 4J23A 4ZODA 4BQ6A 4PLNC 4DK6A 4M93B 4YFDB 1I3GL 1BQHB 5KSBE 1PW3A 4JY6A 1UT9A 4FXGB 4JFQB 3MJ8A 5J1AA 3S36L 2BY1A 3MNWA 1JWMA 3GSXA 3MZGB 5SX4H 5L8LB 2X1PA 3WS3A 3SY0B 5A1AA 2HT3C 3IFOB 4KRLB 1RZGA 1VSCA 4EN3D 4RQQA 3T2NL 4U1SA 3TO2A 3QRFM 1UEMA 5IBTL 4KVNL 2EH8L 5L2JB 1VFBB 3LEXA 2VISB 3HNVL 2D0FA 1GCFA 2Z92A 3IVKA 4ZYKB 5FKPA 5IMKB 4LCCB 4UV7H 5DMIH 1B88A 3MJ9H 1CGSL 4XCCL 3LB6D 3WN5C 1MWAH 1A6AB 2VWEE 2WINB 4PRIB 4I3SH 1VA9A 2EIDA 3RWGB 1NCBH 2MCPH 4I0PC 2MHAB 3REWB 3BUTA 1HOCB 3SGKA 3HTLX 4N5EA 5GS0D 4N0UB 2KKQA 3MRHA 4OSUH 4WDIB 4L4VD 4DTGL 1F58L 3IFLL 1JV5A 4PJBF 2E9BA 3QEQB 4JHBA 2QQLH 4MXQC 1EZVX 2AK1H 1SMOA 4NRXB 3X3GL 4OF8A 5L88H 1PLGL 3O3AA 3Q6FB 1KPUA 2X10A 4H1LG 1WBXB 2OQJB 5C0NC 4R4BB 5INDB 4E5XB 1ZLVH 3HAEB 5D2NC 5DMGC 4ONOA 3RWIA 4D0CA 4DZBA 4M61A 1RD6A 1HIMH 4M5ZL 3NCMA 1A5FH 2ED9A 1FO0B 2QQNH 3CFKB 4HG4K 4QO1A 1E4JA 1OSZB 1CFNA 1W0WB 4XPHH 4R2GB 1NAKH 4PRNA 1I3VA 4HGWB 4I3RH 4K3EL 3KJ4C 4DQOL 1TLKA 3I6KA 2F53E 3P9MA 3IDGB 1D9KA 3CDGA 4K3HA 4LIQH 5JW4M 4CADA 5I73B 5E6YA 3MUGB 1A7QH 3DETD 1ZT4A 2AEIT 3AUVA 3ZDYE 2R1YB 3VD3A 2F8XC 3QUXA 4MNGA 1R3LA 5ICZB 5CP7A 3AB0C 4H1LA 3QDGB 2O5YL 1H8OA 3ZHDA 3BP6B 1ONQB 1FZMB 5IR1B 1G7PA 1ES0A 5C0GA 2LE9A 1MRCH 1BM3H 1JN6A 2BC4A 2V9QA 3G08B 4JPIB 1T6VN 2AJYH 4IBLT 1XR8A 2UZIH 1YUHB 4I4WA 1RFDH 2VQUA 4RMQA 3UAJC 6FABL 3BKCL 1YMHA 3QUZA 3RZCC 3BPNC 3O2WH 1E28A 1B4RA 4K7PY 1ETZB 3BD3A 1MLCB 4O2CB 3QAZB 2L4OA 4OLUL 4QKXB 3HKFA 4Z7OE 3IAQA 5BO1H 1T7WA 4Q2ZA 3TCLA 1P7KB 3TPUE 2OS7A 4PLJD 4R4NC 4R90L 1P5VA 3DURA 1C08A 1PQZA 2VDPH 5AUMB 1PG7L 4QHKJ 3MV01 3O0RL 3OKMA 4L9LA 2MQCA 1W2KT 3ARBC 3CFJA 2HFGH 4ZUWB 3FB6B 5K93A 4QRRA 4YXKH 2B1HH 3PHOA 5L7XL 4B41A 3IJYA 4WI8A 3GMPB 5IW3A 5C92A 5H2BA 2DQTH 3MRLB 4OUOA 2VQ1A 5CZXC 5A16B 2Q76A 4ZNEA 1J8HD 4ZMAT 2OXGA 2H6PA 5HI5C 3TT3H 4WWID 1IGFL 3MLYL 3SDDB 5D1ZA 5D6DA 1QLFA 1KB9K 1UQSA 4JHZA 2IH3B 1FO0H 3O6FA 1J86A 4BUHA 1E6OH 2QL1A 3HZKB 2CJUL 4QWWC 3PV6B 5DTFB 5TF1L 2R0LH 1CFVH 3DMMC 4I5BB 3FN3A 4QHUA 4JFXB 5DHVB 4WU7A 4G7YL 3BDBA 3RIFF 4HBCH 3WHXB 2CDEA 5I1DB 5DSCB 4WW2B 5DRZA 1QPPA 3KPNB 1UZ6F 2XN9E 1TPXC 3KYOA 4Z5RA 4H25A 1K4CB 4JKPL 4R3SA 3NTCL 4WFFE 1G1YA 4W70A 3IYLW 4Y1AA 4HWEL 4FFYL 3I85A 4TSCL 4XNMA 4NT6B 3MRDA 3UTQA 3FN9A 4X9IA 3DVGA 3DLQR 4UT6H 4X8XA 4OCRL 3UMTA 5I17A 4PJ5E 1TJGL 4XC3L 1N0XL 3I6LD 1NJ9A 3EYQC 1T1WA 1BQUA 1OOAA 1EGJL 2BFVH 1WWCA 3CH8A 3V7AE 2VDRL 4QOKD 3JWDH 5E5MB 1RVFH 2A6JA 4PJ7E 1LNUB 3HPLA 1EEQA 1SJVA 3QCUL 5ITFA 4POUB 1JFMA 1H3VA 1I8KA 5JHDA 3CLFL 2EDNA 2NPLX 1KTKE 2FHBA 4GG8B 1T1YB 4IJ3C 5FYLH 1GC1L 2H1PH 3S97C 3GBNH 1AGBB 2G60H 4HJ0D 3V8OA 4DCQB 3KLSA 4Q9RL 2AJXH 1D5BA 2DB8A 2HH0H 4LRIC 3VXUD 1FJ1B 1PY9A 4ALAH 3F7QA 1T0MA 3C5ZB 2JCCA 4UIKL 1OCWH 5E8EA 4DFHA 3V4VH 1G7LB 4PJEE 3GIZH 1X3DA 3CSPA 4BQBA 1MFAL 2DI8A 5FEBA 2VDML 1DBBL 3BO8A 5F70A 2ZUVA 5ESAB 3MODH 4RAVA 4RGNE 3REVB 3V6FA 2MMXA 3TA3D 5F7KC 4JZJC 1ZAGA 1HKFA 3F5WA 4RIRA 3VFTB 1P7QB 5IJKC 3AM8A 2HWZH 1RUPH 4UINH 3S5LG 5GGQH 3LDBB 1FVDA 2E5EA 3QA3A 1C12B 3OAUH 2UYLB 5TH2B 5GGTH 1YDPB 4K3DL 2APBA 3MBEA 3V4PL 2J3SA 1CU4H 1F11B 1LE9B 2F19H 2Z8SA 4D9LL 4DZ8B 3B9KD 1T7YA 4RGMC 5HGDA 3LKSA 2IMNA 3O45B 5F9AC 1J88A 4K7PH 1R5IA 1MRFL 3EO9H 1AD9A 1S7SA 1TQBB 4GW5B 3MYJA 2GSIB 2BNRB 1NEUA 1NFDE 2PTTB 2DQCL 5GS1B 1RZKC 2NNAA 3FO1A 2DL2A 2H8PA 3QXWA 4OD2A 4W6YB 3STZB 2D7PA 4O2EA 1UM4H 3D85B 3F58L 1NFIB 3QG6B 3QXDB 1U8QB 2ZWLT 1AC6A 3VD9A 1IEAB 5HHXL 2X44D 4GBXD 3ARFC 4P3CL 3S5LA 3TJEL 3WJLC 2W92A 3KPSB 5J1SC 1PSKH 2OR9L 5EZLA 1DLFL 1AKJB 5I8EA 3L95A 4LNRB 4NO3A 4YDIH 5GSVA 4U3CA 4ODUA 1FE8H 2JKXA 3FB7A 3ZE2E 4XMKL 1GGIL 3ETBF 4KKBC 3BHBB 5ICXB 2MPAH 4YEEA 2C3WA 5EUKA 2DWDA 2NXYC 5CUSL 3E2HC 1QSED 2OL3A 3MA9L 4PR5B 4FXLA 5I8CA 4FP8H 5FGCE 1VPOL 4E41A 1NCTA 4N8CH 2X7LA 1M1SA 2VDKL 3K4AA 5IEHA 1HDMA 3QCTL 3QZWB 5EOTB 1Q9WA 2UZYB 3BW9A 2VXQH 3VRLF 3EHBC 1XF5B 4HX1A 2HFEA 4ODXB 4XP4L 2P5EB 2FRGP 3ULSB 2VLKE 4X80L 5IHZB 1WBZB 1F45A 3P4OA 4YUEH 2ZJSH 1WF5A 1AP2A 5JORB 2VABB 1IGTB 4LSTL 5FYKH 1PAMA 1WC7A 1KIPB 3QULB 4XCNA 2KBGA 4Z7VA 3G6DL 5D6CA 3IKKA 1ND0B 5LQBH 1G9EA 2NYYD 3MGTA 1MAKA 3PJSA 5KS9E 1B0GA 4LSVL 4F7TA 4CBPA 2PO6A 1KJ2B 1BD2B 1WSST 2YWYA 4IM8A 4H88L 4W4OC 5AAMA 3VI4E 1CIUA 1EEYA 5DS8B 1IM9D 5CWSB 2XXCB 3I9GL 1VEPA 4XCEA 2BHZA 3GIVB 4YXLH 3MR9B 5I0DA 4X5WA 2FO4A 1EEZB 3X13B 1I1AD 5KSBA 4PV8A 3O6LH 4JKWA 1WWWX 4ZXBC 2C3VA 5D8JH 1GYAA 4GXVL 4YIQB 2A74A 2IPKB 3PWJA 4L4TB 2E9IA 5EU5A 4Z77A 3DPBA 3SE8L 2EE6A 1UC6A 1MREL 3KPLA 1U8MB 4X6DF 1CR9H 4P3DA 5E2VL 4TSBH 5ENWA 2G5RA 3MJ6A 1RJYB 1XCTA 3OKLB 2X6MA 3QQ9D 1I9JH 5MI0B 1U8OB 2R8SH 1VEOA 3GB7B 2MOVA 5IGXH 2J5LB 4BYHA 2D7MA 4YFLF 3IXTA 3TN0C 1JE6A 2YK1L 1HHIA 4HUWA 5T3ZL 2CSPA 2HKFH 4NC1C 3ZMRA 2NY2D 3V5KB 2NY4D 4PRPE 1IQWH 5TDPA 4WWKD 3NPZB 1J1OH 1CD0A 1T1XB 4MNQB 1P5UA 3DXAB 4KFZC 5SX5K 4JFFD 3T1FA 4CVXA 1NCAH 5ID0A 4U3XA 1NGYB 2R23B 4L5FL 4YHYC 4LDLB 3MV11 1NC2A 4LPVA 5CJ8A 4OGXL 4ELKB 1FL3A 4NKOB 1Q72L 4YR6B 1W72A 2OTUB 1UGNA 4FQ1L 2WBJD 4PGEB 3LEYL 1S78C 3FB8B 1DL7H 3L5XL 1FORH 4X6BB 3OJDA 4DEPC 1TCRA 5HBBA 2EDFA 3V5DA 2BY0A 3DV6B 2Y6SC 1WT5C 4LLMA 4KDVA 3ZHLA 3U9UB 5J12B 3ARUA 4DVBB 1SY6A 1JYNA 4JEGB 4NQDD 3ROLA 3VXSD 4D3CH 4IRSA 3MNVA 2V7HB 2VKWA 4RA0C 4JZNB 1MLBB 1ZKAA 3MRMA 4Y16D 5JOEA 3QIBD 4JO1L 4AL8H 1JGDB 4Y2DC 2XKNB 2VLME 3D3VD 2EE3A 5LJYH 3IS0X 4XWGH 1OHQA 2DMBA 3RVXD 5FKAB 5DC0A 1H15A 2ADFL 4XH2B 3TFKC 3BH9B 3QR2A 1VGEL 5FM4A 4YDVB 1HEZA 4U2ZA 2XWTA 3B9EA 1QKZL 5ESQB 4K8RL 1BAFL 2CLZA 4RFNB 4S1QH 2AP2A 4P49A 3JWOL 5HGHB 2Z91B 2EYSB 5DI8A 3WLBB 5CGYD 1OLLA 3LQZB 2F53A 4MS8A 4HKBB 1A6WL 1QSFE 5T3ZE 4FQLH 3BVNA 3AXLA 2VIRA 3WIHH 4JRYB 2YSSA 4ZUSA 3RI5F 2R56L 4FXKB 1KTLA 4IHOB 1Z0MA 1YEDA 3FFDB 3OBAA 4FQQA 4XHJD 3HI1A 4AIOA 3LEVH 2VR9A 2W38A 4FQXA 3U9PL 5EG6C 1NGQL 1YEKL 2OK0L 3MZTA 4JO2L 1RQ5A 2BSTA 1KBGH 1RAMA 1AGEA 4HFWA 3VW3H 1MNUH 2VH5H 4NKIL 4Z8FL 3Q6GL 1MCNA 4GMTH 1AY1H 3KDMB 1REIA 1RZJL 3SE4C 3ARGA 4N0CD 1AFVL 2QLVB 1T04A 3CC5A 4RCAA 2DAVA 3GMNA 4M5YL 4JHWH 3TPUA 3ZL4H 3BYTA 5E4EC 2HN7A 1ZVSA 4A6YB 5D7LB 4E0RB 4YNYB 2FATH 4HAGA 4S1SL 4Z6AT 3DHMA 3OKOA 3HC0A 1MIMH 1MJUH 3WFCH 1MIEH 4F7PB 3LKQB 1HWGB 2DLFL 3JUYA 4GRWB 3D18A 3BPLB 1CXFA 4UDUA 3ILQC 5C7XH 5JPNB 3ESVF 2X4RB 1R5VB 1FBIH 4KMQA 3M8OH 3Q0HA 3ZYOA 1FN4B 1OPGL 2CMRH 3FT3B 3G6AB 5D1QB 5I66A 3ME0A 35C8L 5MEQB 4J3XA 1GH7A 4N5EC 1L7IL 3X11B 3GNMH 1AHWA 2XT1B 3HG1E 4HS3A 1LO4H 4P4KB 3VCLB 2FL5B 3VJ6A 3RU8L 5ISZE 3GMMB 1I1FB 1JWSB 1ZLVK 5HHQA 2BNQE 1N2RA 1MVUB 3UYOD 3EDKA 3IAPA 4TULH 3CPLA 3VGHA 2EE2A 3V7AG 4ONHA 1A7PL 3FB5B 1S8DB 3G6JE 2YBRA 4PJIF 5D9SA 2FIRT 1TXKA 1GAFL 2PYEE 4RBPH 1SBSL 1I3RB 2Z93A 1U8NA 3ARDA 4BSWA 4OCYL 4U1MB 3GSOB 3E0GA 1MJJA 5DUPL 1CQYA 5DQ9A 1VEMA 2RJMA 2EXWD 2Z0BA 4JFZL 1HQ4A 3ZO0A 5T1MB 3U4AA 1VFMA 5HDQL 5IV2A 4L3ED 5A3IC 3LS4L 4WU5B 3GBLA 5C0JA 3UP1A 2V7NB 4NQXB 2UWEA 1BVLB 2HVKA 1MEXL 4LEXL 4Q58C 4OLVL 3GZKA 1HCFX 3BKJL 2A9NL 4PUBL 4PJ5A 5IWLA 4JRXD 2R69L 2YD9A 5I1GH 3FO2B 4TTGA 3PABA 3VXPB 4RWYL 4FQJH 3VXTB 1QFPA 3FCTB 3IFPA 2F5AL 4PJ7A 4W68A 1D5MB 3TESA 1YJDL 4APQC 2ERJC 3U0TA 2Z8WC 3U48A 4XCFH 4V1DE 4HPYL 3S88L 2BOBB 2WLZA 1NKOA 4MAUH 1HSAB 4KMLB 5E6IB 1HYSD 2ICEA 1SEQL 1J7VR 4JFYB 3IDMA 3P4MB 3HUJE 3EFDL 2JJUA 2QADD 2V5SA 2BJMH 3IETB 4KDWA 2ZCLL 4JFEB 4J1UA 1JPTL 1T2QH 4Y4HA 4PJEA 3WN5B 3UTSB 2BSRB 3A0OA 4PV9B 5DT1H 2R1XB 3UROR 4H8WC 4IOIB 3RY4A 2GFBB 5HHNB 4ZS6D 3LQAC 4I0PB 4NQSB 5F9JB 2VLJE 1EO7A 2HT4D 4KKAD 4JG0L 5HGAA 5GRJL 3K1KC 1BJ1H 1F00I 1NC4B 1FYTA 1AO7B 1JMXA 4X4XA 3O3EA 1G7HB 2NW2B 3TYFB 3QWQB 1G0DA 4XBGA 1KCVL 2AJVH 1Z9OA 2XICA 5C9KA 5D1XA 5TE4H 4MDIB 4P46A 2QSCH 4P2RA 3TEUA 1JTTA 4X4ME 4JE4B 2B0SH 1QR1B 5EU7E 2CK0H 2NY3D 3B9AA 5CZVL 1H5BA 5I1EL 5C08E 5D96C 5D2NB 5GISH 4WNQB 3UZQA 1DZBA 5D1ZC 5D6DC 4LHJB 1NFDA 2R2EB 5L8KB 2HMIC 5EOCJ 4E42B 1S7XB 4XPAL 1UACH 1GXEA 2HJKA 3LKPB 3HB3D 2IQ9H 2PYFB 2FWOB 1OD9A 3P73A 5F6HI 4JREB 2H2PD 1PEWA 4HUNB 4QXTB 3KPMA 4TN9A 4KH2A 4AG4L 3IKCB 1DBKL 1DJSA 4NZTH 3KLHD 1GOHA 4PYGA 3QG7H 3DRQB 4GG6E 3IDXH 5GS0L 3RWCB 3MV8D 4A2LA 1RK0A 4UQ3A 4G9FB 2VXVL 4IIQC 3H3KA 2LFGA 1Y18B 4JCLA 4XNUL 3ZT5A 5KSAC 1RIHL 1NGZB 2A9MH 3WMSA 2X4QA 4ZAKD 1J87A 2EIZA 4P2OA 4F57L 5EZIL 1UZ8B 2FHCA 3HZMB 4DN4H 3T2PA 1AXSB 4NQVA 5T5NF 1KEMH 1P4BH 4HUVB 1L0QA 3BZEB 4KKCD 1S5IH 2X1QA 1BFOB 3V0AC 3O3BA 5T1KA 1PVHA 4F9LC 3OX8A 5IB2B 3QEGH 1UVQB 4H0GA 5IVXF 5LGJB 1DQQA 3EJJX 1I8MA 2V9RA 3RZCB 3BPNB 1TZHB 2YD3A 2W0FB 2X4OA 4TNVF 4XP6H 1LDPL 2Q7YA 4J4PD 1GL4B 2EDEA 5DQJB 1JNHA 1S7VA 5JA9A 1MUJB 1GGBL 4KK6D 5HXMA 1YA5A 5IQ9B 1JPST 3NFSL 4ODBD 4JZOB 4OFYD 1X9QA 4XPBH 3L3HA 3ZTJH 4H26B 2X4PA 1WQVT 3ARBB 2KH2B 3X12A 1FC1A 1RJLA 2DQUL 3TBTA 1FDLL 3BP7A 1EUTA 1DQML 3FKUS 3ZKMD 2W0KA 4NM4H 3LOWA 5KS9A 5KOMC 2JE8A 2XQYK 1WWBX 2HG5A 4NHUE 3O9WA 2YD8A 1EAPA 4JVPA 3AM8C 3F6IA 1BX2A 5INCA 3A6CH 5ADPL 2I9TA 3HFML 2W9DL 1N4XH 2QKIB 3BQUD 3QH3A 1Q94A 5HHOB 4KQ3L 2AK4B 4NKDB 2OP4H 3MBEC 4PP8C 5FV1L 4X98B 3ES6B 3PP4H 2H9GB 1R3JB 4LCWB 2RR3A 4JO4L 1DVFA 4MLSA 3E3QE 3MMEB 4TTDD 1IC4L 1ZTXL 4WHDA 3L3KA 2LVEA 3VFWA 3QXTA 4Z0XB 4FQ2H 3U4EA 2PR4H 2DKSA 3RX8A 1N5YL 4B53A 1QRND 1HKLH 1TPXB 1IAIL 1N3NB 2I24N 3KPPA 3C6LD 2BX5A 4L8DA 3JBG7 4C56B 4DN3L 5KW9H 2FX7H 4PRPA 2PKDA 3V52L 1AC0A 3VXMB 5SV4A 4PGBB 1G7QB 3ERYA 5HHMD 1QBLH 1FVEA 3QI9A 4JB9H 4KK5C 4HCRL 2KDGA 4YO0B 4P2QB 1NANH 2B1AH 3EYFA 3C09C 4HV8A 3L7FB 4KVCL 3MLXH 3EO0B 4MJ4A 2Q86B 3QPQC 1MFCH 1MFNA 1RY7B 4IJ3B 3WNPA 3S3SA 1PZUB 3MLVH 1S7TA 2EKSA 3MRCB 3WUWB 3G04B 2PXYD 2DQEL 5E99L 5GGRY 1H3XA 5BV7C 3EJYC 1HYRC 1CLOH 1KCSL 2EZ0D 4LBEB 3SE3A 3PNWB 1ZT7B 3IFNL 1X5GA 4IRZH 4EJ1C 1MHEA 2NY7L 5KVGH 3T4AA 2YUVA 2C4FT 4GKNB 4BK4A 1KFAL 5J13B 1UWGL 2I60H 2IAMC 3FQTB 4I77H 4MJ6A 5IMMA 1N59B 4NN7C 3QIWC 1T5WB 4NN6C 3ULUC 3FJTA 3LV3A 1I1YB 3OXRA 1FG2A 3MRFA 2HTLD 3NZ8A 1YY8B 3OAYH 4PRDA 1UM6H 4ODWA 4OLYH 4R96B 2BMKA 1NDGA 1TDQA 4WUUD 4BH7A 5HSFA 1RU9L 3HCVB 3O41A 5AZEL 3E6FA 4M8QB 4HLZH 1DUYB 4P9MH 4OLEA 1JFQH 5K9KA 3OR6B 3PIQB 3B9VA 1QSFA 4U1HA 3AU1A 1G9MH 4YLQT 4X6FB 3RHWK 4G8IB 1SM3H 4PPTA 4RGMB 3RWHB 2QR0B 3CFCH 1QA9B 3QQ4B 4L8SB 2ZCHL 4AZ8A 1K4DB 3WFZA 4P5MB 5TDNA 1A3LH 4YGVB 3KPQB 1J8HE 3H9YA 5GZNC 2V2TB 5B38B 1U92A 3EAKA 1A1OB 4GQ9H 3KPOB 1IEBB 3QHZH 1IQDA 1RIUL 3EOBB 4PBVC 1RZFL 1X7QB 3OJMB 4XVSH 1IILE 4HJGA 5C6TH 2HRPL 4NZUH 1U8IA 5F88A 3KGRA 2CDGB 5DJ6B 3S4SG 4U6YA 3WLWC 1ZEAL 4HT1L 3K4ZA 3B6SA 3RGVA 3ARFB 4Z76B 1ZOXA 4DVRH 3TH4T 3DX6A 3DARA 3OKKA 5T1DL 3GI8L 3MRRA 1IGYB 5HGBB 3T4YA 5J6HA 4NRZB 4X8JA 1JL8A 4ERSL 2Z8RA 4PJIB 5GZOC 4XI5D 4QGTA 2IADA 4PRID 4WI9A 5CFHA 3B2VH 3H9SD 3OQ3B 4FABL 3PHQB 3I3BA 3PHSA 4HF5H 2NXYB 1P4LA 1OGTB 2VDNL 1T2JA 5KJRH 3E2HB 3SGJC 1AI1L 3ZKXC 2IALA 1MH5B 1X6LA 3QDMB 2FJFA 1W8OA 2VWEC 4EXPX 1JPGB 1AGCA 3I6LE 1X6NA 3MLTB 3QEQD 4JLRB 3S4SA 3K4DA 5KVDH 3OV6A 4MD5B 4K9EC 4K55A 4WTZG 1H3PH 4QOKE 5JW4N 3W9EA 1JHKL 4RGOL 2GKIA 4UI2A 2D31B 3P11L 3HG1A 4OIIH 4HGKC 4L8CB 5L2KB 1HILB 3FQWA 5ISZA 5HYFA 5J56B 2R0ZL 1A7NL 2BNQA 5ERWB 1WTLA 1X4XA 2EECA 1P4IH 1T3FA 5I1JL 4AENA 4IRSC 3G6JA 5LCVL 3W0WB 4W6WB 4XC1H 3VXUE 2PYEA 3GM8A 3HZYA 3U36B 4ZOBA 1NL0H 3BIBX 3HI5L 2A1WH 3QXAB 2A6IA 2R9HD 1BQLH 5L0QC 2ARJQ 4TUKL 1E6JH 1RZIB 4HK3N 4WEMB 3TNMB 4MJ5A 5DD0L 4G3YL 5TPWL 5EU3B 3RA7L 4WI2A 1FH5L 1RZKH 3L7EA 5JQ6H 1J0IA 3RBSA 3SDCA 1INDH 4WTZA 1C16A 2OBGA 5IEKB 2FO1A 1DQJA 5F7UA 4N8PA 3TO4A 3BUYB 4GQPH 4GMSH 3R8QA 1FFPB 3FT2B 3QDGD 4MS8C 8FABA 2DQJH 4MQ7A 4LCUA 4LSSL 2C4XA 5T33H 2PN5A 4GKSA 4Z7QF 4PLKC 5CEYB 1WFUA 4GRMB 5DFWH 1OTUD 3UTOA 2ITCB 4ZFZA 4RAUB 3B43A 4G8EB 5C71A 1HH6A 5JLZB 4LGSB 2C1PB 5HHVL 1INEH 2JCCF 2IPUG 3FQNA 2HJFB 2ADGB 2CKBL 5D93C 3DUSB 2ADJB 3TN0B 1YECH 3LMJL 5BS0B 4BZ2H 3T0AA 5ADOH 1JIBA 1UCBL 4PREA 4V1DA 4XBEL 1EBAA 1NMCC 1JHTB 4PGCB 4O51B 4EIZC 3BH8A 3H7BB 4GW1B 3D6GA 4L29A 5KTEL 3PDGA 2FIKB 5DD5H 1VHPA 2SEBA 3MX0A 3HUJA 4CJ1A 4YHYB 5DFVC 4G8FA 1ZLUH 2QTEA 4UV4H 1UG9A 1J10A 5DJCA 2E7BA 2WWMC 1YN7A 2EDTA 4G9DA 3Q1SL 5BZDB 1ZANH 2BZDA 1F3DJ 2VLJA 5DK0A 2HLAB 2VXSH 1GZPB 4HLJA 2CLVA 4DEPB 4PJAB 3RY5A 5IQ7L 3UC0H 3TBYA 3MLZL 4OM1H 1NCNA 3QQ3A 4ONGH 4KAQH 4H0IA 2BRRH 1HXMA 3SDDD 4Z7WB 5D72L 3BZFB 4MZ2A 3TZVB 4HULB 1C5BH 4J6RL 5BMFH 2YOCA 5KANI 1MFBH 1MCQA 4LSQH 4M9OA 4HJJL 4Z95H 3D0LB 5EBLB 4NFCA 4X4MA 1I7RB 3FOMB 3F7YA 1Z5LA 3AS0A 1MCOL 1WAAE 2LQRA 4U6HA 5E2UL 5EBWB 5JR1H 1KENL 4Y2DB 1C8PA 4RBPK 2IFFL 2X4TB 3S8WA 4KGJA 3L3JB 1UADC 1X44A 2NY5C 2J8UB 1F4XL 1Y6MR 1K5NB 4J8RA 5DK2B 4WHCA 5IVXB 1IKFL 4NZRH 5K59E 1CXIA 4LU5H 1TJIH 1U91B 4ZSOB 5JPMA 5I0ZA 4GG6A 5F7EL 5AYUL 2ZG2A 2EDOA 1CFBA 4HKJA 5D5ME 4OZFH 4NO5A 5E94B 1DQTA 2DI9A 5B22A 3E6HA 4BSVA 3UJTL 1D5IL 5HYIA 3GHBL 5LBSL 1NDMB 4PYHA 1IAIM 2Z35A 1I9IH 1VKXB 2WIIA 4U1LB 1II4E 5IWLC 3MJ8B 4HIIB 1IVLA 1TZIB 3MNWB 3GSXB 3MCLH 4HG4J 3CMOH 4FFWC 4X9FA 5EPMB 5EU4B 1KJVB 1MFDH 1DE4B 3WXWH 3RVTC 3RIFK 3OGCA 2MKLC 2EDKA 5HPMA 3NIGE 1BZ7B 1QNZH 1ZHKA 3C5ZD 4JQVA 4HIXL 3QB7C 5TFSH 1CD9B 4Z7VF 4EN3A 3LEXB 3WFDL 5DJZB 5FO7B 4JFDB 3G5XA 1KCKA 4MVBD 1RI8A 3MROA 1MCFA 4NRYB 3AAZA 3CFDB 5DO2C 3PWNA 4KHXH 1P7QD 1EHAA 3OMZA 3P4NB 2VYRE 5KSBF 2YUWA 2VZVA 1IAMA 4CU8A 1AD0B 3JV0A 2GYSA 4WI4A 3WL9A 1M7DA 4XMPL 2WW8A 1H0DB 3QDHA 4FMKA 3IXAA 3D48R 2DD8H 5J7CC 2R2HA 1JYWA 1BOYA 4NHUA 3QUMB 5EH1A 4JM2D 3MNZB 5J8OA 3H3PL 2VC2L 3QT2A 1JV5B 4KHTH 1GHFH 3NAAL 1J5OL 2GQHA 2DBJA 1H3TA 2XFXB 3ESUF 2BNRD 3FT4A 5FUOL 3WKMH 3QEUB 2H45A 4P9HL 1ZLSH 5D1XC 4F7EB 5I16A 1MHCB 1X5KA 4LHUG 4ISVA 4P46C 1CE6A 1MVFA 2AV1A 2V2WA 5FUZH 3O3AB 4R7NA 1KPUB 3P0VH 3D85D 3E3QA 1RZ8A 4RMUA 3DYPA 3PUCA 3JXAA 4NQDE 4F7MA 2DQDH 5TDOA 1UXSA 3HS0B 5EO9A 4DZBB 1GGUA 5CILH 3F65A 3O81A 2OZ4A 3HNTL 3DX8B 3LAFA 3F62A 4MJ2A 1EBPA 4EZMA 1GGCH 3FN0H 3KPSD 1G7IA 1AKJD 1EV2E 5K9QG 5FGBA 4XHQA 2ITDA 1IC5L 1ZWIA 3EFFB 3CH1A 5LWYH 4NKQB 4OJFL 3PL6B 2PW2A 3WE6A 2B4CC 3T1WA 4M00A 3BKML 1ZSDB 3PXHA 2VXTH 3LRHA 1GC1C 5DFTA 1YEHL 4CADB 2NZIA 2BCKA 4KZEH 1RIVH 4LLVA 4NQCD 2P44B 4YHIA 1LHZA 4S1DD 3UBXB 4TUOB 4LHUA 1I75A 2FEDD 2W60B 4MNGB 3BISA 5IM7A 1R3LB 5CJXA 5CP7B 4H1LB 4XVTL 3DNKA 5H8DA 3S37X 3V4UH 2R4SH 2JELL 3GI9H 4APQB 5K9JH 2ERJB 1G7PB 3WNKA 5F1IA 5HGGS 1ES0B 5C0GB 3TBWA 1INQA 3IF1A 3HE7C 4TUJA 1N26A 5F71A 4P3WA 4HIEB 4DUWA 3C2AH 3RVUC 4MD4B 4I4WB 2P5ED 1F6AA 1RUKH 1SYSB 2CLRA 3JV5A 4ZUUA 4QXUL 1YMHB 1IT9L 5JUEL 4GO6B 4YHZH 2EYRB 4CDGC 4G6AC 3TCLB 4B7IA 4ZOEA 43CAA 2A6DB 3GM0A 4NBZB 3JUZA 4M43H 4XCYA 2FB4L 4GKZB 1OAXL 2WIMA 3ZSTA 3ZDYF 3SKJH 3MUY1 1BD2D 2JK5A 5DJ0B 1Y6NR 5DD1H 5GJSL 1KB5L 5F1OB 1YEGH 4KDTC 3IJYB 1CE1L 3E8UL 4LKCB 1QD0A 3RTQA 5C2BH 2XQYG 1BGXL 1V3JA 3HA0A 4LRNL 1LE5B 5EA0H 1VFAB 4CNIA 5D7IB 4KJPD 5E8NA 2H6PB 4L4TD 3O9WC 4XZUA 5D96B 4UILL 3KR3H 5D1ZB 5FF6A 3LRSA 2DJ4A 3MACL 3U7YL 1QHPA 2MCG1 3GSQA 4KMTH 4HCRA 4HUUA 2HKHL 2VDQL 3W81A 1T03L 4Z7OF 2Q8BH 3O4LB 4S2SB 2EDLA 2HLFC 4NUGL 5EFIA 2X1OA 3NGBB 5DJ8A 4GAFB 5E8DL 2YN5A 1F8TL 1MFEH 4TOYL 4HMEA 1OT1A 1FCGA 4MNQD 2JJWA 3ZT6A 1ZHLB 2OR8A 3M17B 2H32B 4IIQB 4X0KA 2X42A 5KSAB 3VD4A 3KYOB 5D7JB 2P8PB 2VLRB 1T5XB 3QPXH 3GO1H 4H1LH 3L1OH 3MLRH 4KRPC 2C3GA 5LAXB 1WEJH 2RFXA 4LLYA 1RURH 1BVZA 4N0YL 4N1EA 2P4AB 2XZQL 4YHNB 3EKCA 3SDYL 3WNNA 3CDCA 4WI6A 2GJZA 3MRDB 1AXTH 4QRUA 3UTQB 3D39B 4PRHB 3NFNB 4ZOCA 2NY0C 2GHWB 4JQIH 4DW2H 1T89A 1XGPB 5C2UB 2Q7NA 2E3VA 4NBXB 4LVEA 2AGJL 3FQXA 1JMZA 4OIAA 4BUGA 4YX2H 4DUXA 2AABH 1NEZG 1R3IL 1U8PB 4DOHE 3ZT7A 5DEFA 1S9YA 5C0BB 5FA3A 3ROOA 4YGAB 3HPLB 2IGFL 1LQVA 1LP9E 2XACC 3ZKSD 4OQ1A 1QBMH 3DGGB 5BQ7B 3D0VA 3WFHA 1PKOA 1Z0NA 3GSNL 4NGHL 1QLRA 3AREA 4U6XB 5F7NC 1FLRH 1I8KB 2JB5H 5C09B 3LQAH 4UB0H 4FFEX 4PJFE 1XGTB 4XRCA 3TVMC 5C6PB 2JF1A 2ZSVB 4CW1A 2G5BB 1WBYA 3SE3C 4OKDA 4CRPA 2BVOB 2ICCA 2AEQL 2AKRA 2CXKA 4MJID 5KSVA 1LO2L 1ZGLB 3BT2H 4IDJH 2JCCB 3QWRD 3W11C 1V7MH 4CMHC 3VXUA 2UWEF 1KN4H 3V7MA 5I2IB 1HN1A 2ESVE 2CIKA 1FGNH 3JVGA 3L3DA 5EN2A 3V5HB 1WCQA 3BI9X 1FPTH 1NEZA 4RAVB 1FFRA 3V6FB 1UYWL 3KYNB 4KJQC 5JOPE 2H26B 4HXBH 2GEEA 5E1HB 4WV1A 4MCYB 4PJ7F 3MLUL 4NNXA 3BXNA 1H3GA 3CUPB 4OT1H 3P9WB 3TA3A 3DBXA 4JRYD 4O9HL 5JW4R 3QA3B 1Q9KA 3TF7C 1EFXB 4PRBB 1KG0A 4ODSH 5GGUA 3SGEI 5C70A 3MBEB 4CGTA 4XPFL 1JF1B 5MEPB 1MELA 4ZUTB 4ZDHB 1DLHA 4XP1L 1DBJL 5TQ0H 1YYLL 1J0YA 4XBPA 4FZ8L 1AD9B 1S7SB 4HS6A 2B2XL 4PG2A 2P43B 4PJCE 3CCHA 3B9KA 4X99A 1ZA3B 1T7XA 4OAWA 4F7CA 2NNAB 4PD4K 4U1KB 3MV7B 1F3RB 1TFHA 4PJEF 4AQ1B 5ABDE 4Q6IA 4OD2B 4X7CC 1E4WH 2GUOA 3LHPH 1CGUA 5CJBA 3RVWC 2YEZA 5LXGH 1C7SA 5IB3B 1P2CA 2AJZB 3RGVC 2YPVH 4UIMA 4XVJH 1MCLA 5ANMA 1YY9D 1KCGC 3DRTA 5D7LD 3VH8B 2XTJD 1N6QL 1MPAH 5JNYA 2YD1A 4AIZB 4D0DA 1OAKH 3C09B 4R7DB 3GJFB 1KIQA 3U30C 3PWLB 5DVMA 4RISH 1EO8H 2P5WA 2I07A 4NO3B 1UWEH 2EEAA 3MV8E 1U8LA 3C8DA 3RI5K 1IGML 3BMWA 3STBA 1HQRB 1QQDB 3CSGA 1KEGL 4LQFH 5DVOA 2F54B 4G5ZL 1UM5L 5FECA 3SKUD 1GOFA 4DGVH 5EUKB 5E9DD 2ZP0T 3OPZL 2YMXH 1NFDF 4E9LA 5I8KH 4P4KD 1RULH 2JIXB 1WISA 1FHGA 1IGIH 4E41B 4NWUL 1KCUH 1X5JA 1N64H 4NNYA 4YXHH 2IAMB 4NN7B 3QIWB 4DKAA 2ZOLA 3CU1A 1WAAA 5C0DB 4D9RE 4TYUA 4KQ4L 4EIGB 4HX1B 1ZT1A 1KPVB 2DWEA 5GHWH 1NAML 5GGSB 5GSRA 3N85H 1HI6A 1KYOK 3P4OB 5KG9A 3HE6D 1DQDH 3BJ91 2X4UA 2M2DA 4OCWL 2XWJA 5IF0B 5D71H 3DUUB 1CFTA 2NTFA 4OCSL 3ZE2F 2X9WA 2R2CA 3GSVB 3MGAA 4KI5C 4HZLB 2CKBA 3KXFB 3IU4L 5D6CB 1Z3GH 1CL7I 5EWIH 5IVZB 1F4WH 5JTWA 1FGVH 3MGTB 4O4YL 2A38A 4AT6B 2E27H 4CMMA 5D5MA 2BSSA 1RHHA 1AQKL 4HH9B 2ZKHH 3SQOL 2IMMA 2QV2A 1EEYB 1EA9C 5IHLB 1JRHH 4XCEB 1C5CH 3SDCC 2GTZB 2HT3D 3OG6B 3CXDH 4X9GA 2JJSA 2OM5A 2FO4B 2G75A 2HVJA 4PV8B 4Y19B 3TO4C 4YFEA 2FZ3A 1OAUH 2A74B 1KJ3L 4X83A 3B5HA 2EEDA 2C1OA 4TPRL 5CCKL 5J11C 3I6GA 4OGYL 1A6VL 1A9BA 3VFOA 3KPRB 3A67H 5FHAL 3GMQA 4ZFOL 4P3DB 1EH9A 1NLBL 2MSPA 5E6ID 3W39B 1XCTB 4OBSA 4AMKH 3W82A 1U3HA 2CUIA 2N7BA 2VN4A 2APVA 1AE6H 1YMMB 2NY1C 4JN1H 4CN4A 1ZLUK 4JFED 1BOGB 1R0AL 4XTRC 4XPTH 1ED3A 1JGVL 4RMRA 5KS9F 1QRNE 3BP5B 3UTSD 4Q9QH 5BV7H 2YC1A 4PJGB 4I0PD 3VI4F 2OL3H 5I76A 4WWKA 5F96L 3BRFA 1NC2B 1MCDA 4BZ1H 1NC4D 5BZWA 4KZDH 1JCKA 3MXVL 1AO7D 5HHME 3ZKXB 3MA7B 4P59H 4WUKH 1GGTA 1I1RA 1UCTA 2AXHA 4YDLC 3R1GL 4FHBD 3LD8B 4MXQD 2AJ3B 5T3XD 2K3TA 2WBJA 1TCRB 3FO0H 4LVHC 4OI9A 5J6GA 4ZS7L 3NCJH 4GAYB 3V5DB 5JHLL 1HXYA 2FR4A 5C0ND 3V0WL 1LD9A 1TJHH 2P8LB 5HI3C 2B7DT 1OM3L 2AJUH 3NZHH 2HFFA 1V7NL 3U0PA 3ROLB 1RHFA 3H0TB 4IRSB 5GRWA 4YHKL 3VI3E 1X5IA 3P4LA 4QHNA 3MRMB 1OAYL 3BD5A 5EULV 1S7UA 5L0QB 1G9NH 1T83C 5IOPA 4NQDA 3UBXI 3WJJA 2EDHA 4ZPVA 3EYUH 3O6MH 5BO1L 5DRNB 4Q74A 4HGMA 4X7SL 4MWFB 3QIBA 1Q9LB 5DGQA 2APFA 4G9FD 1AH1A 1FNAA 4FMFA 4AK1A 4PJHB 4WUUE 4YPGB 3ZTNL 1JPSL 3H2WA 5DI8B 2HP4A 3QUKB 4QEGA 3KWWB 3O2VH 1N6VA 3CIQA 3V6OE 5BJTB 1MQKL 2NW3A 4QRPB 3QJFB 1UH2A 1FFQA 3DV4B 5I1KL 4GSDH 1RUQL 3D69B 2L0DA 3BAEL 5TQ2H 1U2CA 5DD3L 1ZHNA 4HKZB 2YSSB 4ODTH 4ZUSB 1FRGH 4NOBA 5IB4A 5HVGB 4HQQL 4Q9BA 1YEDB 3TT3L 4FQQB 3DI2B 2WP3O 5GRUL 4NHCL 3VFVB 3HI1B 3S96A 3UAJD 3O11A 5BW7C 32C2B 3RZCD 3X3FH 1EHLH 1FAIH 1NMCB 4C54A 4LDEB 2GAZB 5HVHC 2Y7QA 3OR7B 3J7HA 4R4ND 2AEPL 4F33A 2IBGA 4M4RA 4C4KT 1W72H 4WFGD 2D7TH 5B8CA 1F4YH 1JTPA 5F9OH 2FBOJ 3ARBD 4JQVC 1T04B 2QQKL 3GMNB 1H8NA 4KV5E 4OI7A 4N0CA 2XQBH 4OLWL 3KLAA 1GOGA 3INUL 1A4KA 1A7RH 4OD3L 1X5ZA 5GS3A 5CZXD 1NCCL 2I27N 1G6VK 4KTDL 4PRIE 1VESA 1UB6A 1FZKB 4KPHH 1SY6H 1G84A 5IFAL 1B0RB 4UDUB 2P46B 4DKFL 3BKYH 4FN0A 4K07A 4K3JH 2N7AA 2VZTA 2FBJL 3DI3B 2BK8A 4HK0A 4N0UE 4K7PX 5EO1A 4HD9A 5HHOD 5I66B 1I3GH 1VACA 3LRGA 4TNVK 1E4KA 1BIHA 3QEQE 4LCWD 3S36H 2VL5B 4HS3B 3VRIA 3C5SA 2ZOKA 3QO1A 1LILA 1U95A 2HRLA 4JPKL 3TBVB 3GJEA 4NC0B 4FTVB 4JO3L 4JPWL 2FX8L 4TRPL 1AJ7L 1HINH 1HZHL 4UQ2A 3T2NH 4Z0BL 2DIBA 4C56D 1NBVL 3E3QC 5IBTH 4BSWB 1U8NB 4KVNH 2EH8H 5DQ9B 5IKCA 3VXMD 3WHE1 2IG2H 4B7LA 3HNVH 3O4OC 2IANE 3ARPA 5A2IH 1JNNL 2ATPB 3MRBA 3VXNA 3OB8A 2C3HA 3CJJA 4P2QD 5DYOB 5IFJB 3EYQD 4ETQB 4G6FB 4JANA 5E00B 2K1MA 5FGBC 1EDQA 2E9JA 2GCYA 3CSBA 3KYMB 3OZ9L 1FNEA 1N7ML 2UWEB 4GLRH 1CGSH 4JDVB 3IDIB 1RUPL 2X4SA 4XCCH 5GJTL 3DOSA 4MQTB 3LVEA 1VERA 4U1JA 4OZIE 3ECBB 1L7TH 1RK1A 4YAQB 4J2XA 4UU9A 3S35L 5J57B 4AEIL 1NUNB 1OAZL 1B9ZA 2YRZA 4LCYB 3BGMA 3QDGE 3BPCA 4ZQKA 1EVUA 3PP3H 1WZ1L 3ARYA 1BVKA 1LP9A 5CJXC 4DTGH 1DN0B 1F58H 3IFLH 3G6JF 1UJTA 4MDJA 1KB5A 2XYCA 1NUDA 4PJFA 4BSJA 4LLQB 1QFWH 4F3FA 4I48A 4YHPA 2R0WL 3X3GH 1BJMA 2IBBA 3VXOB 1PLGH 2ICEB 4WFED 2PTUA 3MFGB 1AGFA 2VRAA 4XNQB 3SGDI 3CD4A 4WHTA 4YEFA 1SJHA 4OZGB 2LTQC 4YBQC 3PV7A 2P8MB 3CXHK 1QSZA 3VFMA 1CFQA 1S9VB 4M5ZH 2ESVA 12E8L 3LZFL 1IAKB 4ORGB 3VXRB 5DC4B 1DBML 4G8GD 5ESVA 4ENEC 3JWDC 4Y4KA 4KI1A 5DJXB 4K3EH 5JOFA 1FYTB 4DQOH 1JGLL 2NY5H 4IDLA 3LN5A 4JFFB 2IPTL 5F21B 3U46B 5FDWB 1GIGL 4XBGB 4WEBL 3MFFA 3GMRA 5DURB 1D5XA 3ARTA 5IHUH 3RTQC 5E24E 1A6TA 1DTUA 2O5YH 4P2RB 4M48L 3GSWA 1CG9A 2H3NA 1B3JA 4HDIB 2Q20A 3HUJF 4PJCA 2W9EL 4NJ9L 1E0OB 1NFDB 4NM8L 3ARFD 5F9WC 1R5WB 1CDHA 3QCVL 4Y7MA 4GT7A 5HYSG 3RWJB 1RJCA 3BKCH 2ZZUT 1UH4A 3KPMB 1AQDA 4OLUH 3BX7C 3GSNA 3KS0J 4KU1A 5C0IA 2AQ1A 2QSQA 4QY8A 5ICYB 3IJSB 4KKBD 4MSWB 2FGZA 1YYML 4HUMB 1XF4A 2NXYD 4PGJA 1PG7H 2X4QB 3O0RH 2D7OA 3AS3A 3HNSL 3JSSA 4TSAL 3MV8A 2R29L 1CVRA 2UY7A 5DRXA 4O02H 5C0EA 5F1KC 3QDMD 2XG5A 5L7XH 2CR3A 3M1BA 4QHLB 4MD0A 3EOAA 2XXMB 5D4QA 4ZAKA 1T89C 3SEPA 3HE7B 4U1GC 1T21B 3EHBD 5HYSA 4ZUVA 5L2KD 1T1ZA 3EYSL 1IGFH 3MLYH 3NA9L 3VMPA 1DQQB 4OF5A 4BK5A 2I5YL 1I8MB 3MRIB 3AREC 1C5DB 1CTOA 1BF2A 1FLTX 2XZCL 3W0WD 1XF1A 2CJUH 2PF6A 3L3OA 3CDYA 5FYJL 2W07A 5TF1H 5CD3A 1J0JA 1S9WA 1CDIA 1LGVA 1A14L 4YH6A 5C9JB 4G7YH 5E08L 3MRGA 4GW4A 1NCAL 1B6UA 3SO3C 4EUPB 1LEGA 3BP7B 4EBQL 1MCPL 4X4ZA 2FLBT 4JKPH 5EBMA 3JVGC 1CDJA 3NTCH 3QUYC 2P45B 2Z4QA 2YD6A 1M6OA 4HWEH 2E7LE 2E7HA 4P5KB 3VWKA 3BWAA 2YD5A 4FFYH 2AAVA 2BY2A 4WV1C 4OCRH 4ETYA 1FV1B 1EAPB 1TJGH 1LK2B 1BX2B 4XC3H 4S1RL 1N0XH 2I9TB 2BVQA 5FYJU 2PCPA 1EGJH 1S3KL 4N0FA 5DDHB 1LK3L 1Q94B 4HKXB 2VDRH 2E7MA 3QCUH 3UJJL 1TNNA 2CR6A 4NUJA 3TN0D 2DQHL 2NY6C 2VMFA 3BQUA 5BS0D 5IFHL 3CLFH 1F13A 1J8KA 1CDYA 4AEEA 1GC1H 4C83B 1MCCA 1YNLL 4MGXA 4LSUL 3B9KC 4Z7UF 4Q9RH 3U4EB 4X6EB 3T77A 5KN5B 1KJ2L