3GSUA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-m5t peptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 77
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsuA01
1JGUL 3WFBL 4J8RA 4OLEA 3KPRD 5JDSA 3D1MC 3HC3L 4GXVH 5T1KB 4M00A 3T4YB 4P48A 5KG9A 3FO0H 2JE8A 3RGVD 1BOYA 2XA8L 4XPTH 2J88L 4Y5XC 1NCAH 5I1CL 3NCBB 3BXNA 3QEQA 5CHNB 4Z7WF 1A1OA 4U1GC 1FO0A 1T22A 2JJWA 5E8NA 4PR5B 4DOHE 4KUZH 3QI9B 4TTGA 2YS4A 3QQ3A 3MV8D 4RISL 4NO2B 5F1KC 4HKBA 1A6TA 4XPGL 3TPUB 1L4IA 5JIKA 2YK1L 3HLAB 3QQ4A 3PP3H 3TA3B 2DL2A 4JHZA 4JRYB 1E0OB 3IS0X 3D3VA 1Z3GH 3PWJA 2AEQL 3F5WA 1AGDA 1UADC 5T33L 2CK0L 4MHHI 4OD3H 3GHBL 4GLRH 2YXMA 5GRWA 4DVRH 1X5ZA 1C12A 4BM7A 2AV7A 3KPSD 4ELKA 4F9LA 4BSWB 5E94A 5IB2A 5IQ7H 1CCZA 4RGOL 3O6FC 5I1IH 2VLLB 3TBTB 3IGAB 1KT2A 2X1PA 5J3HD 2B4CL 5KSBA 3QXAB 1FL3B 5C0AA 5IQ9B 5TQ2H 3V52H 2X1OA 1INDL 1NAMB 3HG1B 5E8PB 4JM2C 3ZDXE 1E4KA 4M6NL 1A6VH 5KVDH 1RIHL 4X98B 1WTGT 3G08A 1N6QL 4MCZA 1WQVT 3WNMA 3MRMB 3VXQA 1KCSL 1TVHA 1X4ZA 2FLBT 3NCCB 4K07A 3B6SA 4LSUH 5D1XA 5CMAB 3VXQB 1B6UA 5BRZB 1DVFA 3FRUB 1YECH 1GHFH 1PW3A 4JN1L 5L8LB 1TJHH 1CBVH 1JP5A 3QJFA 3F7QA 3B9DA 3WSQH 3DV4A 5IVNA 3QDGB 2HG5B 3FQXB 2X4SA 2AK1L 4PTTB 2GJ6D 4YWGL 1I9RL 3EYOA 1JK8B 3VXMA 4ZMAT 4QRQA 4YO0A 1U92B 3IFOA 2OSLB 2VXQL 4WGVB 3H6JA 1DQQA 4WFHD 3PNWB 2NY3B 3N85H 1E6JL 1WWBX 3R1GL 2GJ6B 2KUTA 5GISH 5TF1H 4JO2H 3CVHL 1K8IA 4RX4D 3D39B 2I07A 4QNPE 1Q1JH 4E42B 4QRPB 3UJIL 4W4NA 4XXDA 3VFNA 4X80L 3GI8L 3RJQB 4OZFG 1TVDA 1R3LA 4G7VH 3MA9H 1IGTB 3WE6B 1H5BC 2VDRL 3DOSA 3W82A 4ZFGH 3VXUE 2XQYG 4GUPB 3V5HB 3ZT7A 1FO0B 1T22B 1OPGL 1PEZA 2WV3A 2YBRA 2EIEA 3BP6A 4HIXL 3JVGA 1ZAGA 4KTEH 1N5AB 5D6CA 3WJLC 5EDXA 5JW3H 1F90H 3O3AB 4GUPA 3V5HA 4DFHA 4U31A 1J87A 3MJ7A 2XZAL 5DK2B 4IRJA 5BQ7A 1CIDA 1NGWA 3BYYA 2R4RL 1EFXA 1J8HD 1SMOA 4KJWC 4YLQT 4BZ2H 3BKCL 1S7RB 2GHWB 3X3FH 4KAQL 3STLB 1IGCH 3E2HA 4Z5RB 5CKAA 5FOBB 2NX5D 3WHXA 4JFZH 3OGCA 2QTEA 3G5XA 2ARJA 4RAUA 1R24A 4NQDB 4X8JB 2V2TB 3O2VH 4R8WH 3CLFL 5C3LD 4QGTA 2F9BT 4PJFB 2ATPB 1CTOA 1CLZL 4K3EL 1I1YA 1YMHB 2VUOA 4Y0GA 3AS1A 5ITFA 4F7EB 1MFDH 1TMCB 2K1MA 1G7IA 1UXWB 5DEZA 1NGYA 2X9YA 1I3GH 4HV8A 1W8OA 1DQLH 5IB3B 4PLOB 3MROB 4FQ1L 4ODXA 4ZTPL 3B8YA 2YD5A 4HWNA 2QR0B 5INCA 3AROA 1OSPH 3HC4L 3QPXH 4J8RB 4YXLH 3WLWD 3EO9L 5C6TH 3RWFB 2GJZB 4DZBA 2R56L 3DHMA 4QXGH 1JL8A 4TUJB 1JHLL 4YE4H 5HYJA 1MLCB 3QUYD 4H20H 4HK0A 2VN7A 1AKJD 5EOCJ 4HJ0D 5DHVH 4UBDC 3C6LA 3IGAA 3IU4H 1NPUA 3O3EB 2EZ0D 3SY0A 2IFFL 5C09A 1BZ7A 2XWJA 3WS3A 4KMTL 4R96A 4CRPA 1EAPB 1ZGLP 1C1EH 3LQZA 4JFOA 5B3JE 1F6FB 4ALAH 2CKBB 5E6YA 3OJVC 4YPGB 4RMUA 3TN0B 4C58B 3HPJA 4DN3L 2LV4A 2C7UA 1U3HB 2NTFB 1MFDL 2IBZY 1JPFA 5AYUH 3EOBB 2WAHA 5C0JA 1DQJA 2DOCA 4MD5B 4LDOB 4PJDB 3WFDH 1JYWA 4AYFA 3MLUL 1NLBL 5FEBA 1YEGL 3RHWF 3DSNA 1NEUA 4HDIB 5CWSB 5JOFA 5DR5H 5JOEA 1U95B 5FA4B 2JTDA 2YOCA 4L8DA 1KIQA 2B8OT 3QNZB 4WHYG 1KIPB 1AXSB 3LB6D 4HG4K 4DKFH 2R2BA 4JDTH 4F7MA 4UIKH 3VA2C 4WWKD 5KG9B 4R0LC 4ETQA 1ACZA 5C09E 3LS4H 5FCSH 4LLVA 2DIBA 5KSUB 3TN0C 3T0DA 4HCRA 1MCCA 1X4YA 4IDLA 4LLVB 1IGJB 1CQYA 3GEWB 4OF0A 4S1SL 3QZWA 4TVPE 1EEQA 4QOKB 1MWAB 3ULVE 3V4UL 1A1MA 4QXWA 3D69B 3RUGE 1OAYH 4GAYA 4NFBA 3T2NH 1HYSD 3VFPA 4YBQD 3L5WA 5H2BB 3BPLB 4XP6H 5EWIL 3RTQA 2OTUB 2X44D 3UJIH 1H3VA 4ERSL 1IMHC 1JNNL 3VW3L 1XMWA 4M5YL 4M93B 4YDKH 2IPUG 5GISL 5TF1L 3QWRD 1NCDH 4LL9A 3SDXF 1XR8A 4CMHC 4MD4B 3QO1B 1MAML 5DO2D 4LSQH 1Y0LB 4U1SB 3EYQC 1OAKH 5I15H 1BQHG 3VGAC 1I9RH 1AQKL 4OZGF 4AG4L 5GS0C 4I3SH 1OTTC 1LO5A 1KJMA 1MVUB 4AEFA 4DZ8B 4OZ4A 3SHSA 1H3PL 1F11A 4KY1L 3VWJB 2YD1A 4U6YB 2IANA 4LBEB 3H7BB 4KQ3L 2BSRB 5I75B 1DBKH 3U4BL 4NHCL 5GGVH 4M3KB 1KIRB 3K81A 1BF8A 4UV4L 5F9WC 4YDVA 3HS0A 4KJWD 3P9LB 2NR6C 4KH2A 2EC8A 1BVLA 4ZUTB 4MJ5A 4DZ8A 3QXDB 2DM7A 3RJDA 1FFQA 4N5EA 4IMKC 1A6VL 3S96A 5ECJE 4N0UA 5EIIA 2OMBA 5EOQH 1ZHLB 4WI6A 3CU7A 1CDGA 3VFMA 3EOAA 5BVJA 1M7IB 5CKGA 4K23L 5F8QC 3NTCL 2FIKB 5E7FA 2HA1A 1J11A 1MF2L 4IOIA 1AQKH 3OWEA 1FHGA 3B3IA 5F7NC 4NSKB 4JQIL 3H9SE 2NX5E 2NY5C 3O4LA 4CVWA 4G59A 1V3LA 4RWYH 5MP6L 1YUHB 2JJUA 5D7IB 5ID1A 1TJHL 4FQ2H 2XWJB 5J13B 4NQDD 1CFVH 3RGVB 5IKCA 5GGQL 3S5LA 2XY1A 4YWGH 1U8PB 3QZWB 4M3JA 4M1CD 4O51A 4ELMF 1ONQB 3WIHH 1DUYA 4XNMB 3RP1A 5LKNA 5MERA 3TO4D 2J4WH 3LV3B 1HILB 4XCEA 3MYZA 4LVHB 3NTCH 4XMKH 5IV2A 1JNJA 3ARXA 4OZFA 1MCPH 2O61B 2AK4D 1F13A 3U4AA 5L2KE 1NGPH 3AY4C 1KLUA 4JM2F 5E9DE 1DLHB 1I3UA 5F8RC 1CXLA 3ZKMC 2FATL 1I7TA 4NRZA 4XPBL 5DHXB 5HHMA 2Q87A 3LHPH 4R4BB 3LKQA 4UUJA 3HUJA 3QNZA 5IFHL 3LQAC 1IGTA 4X5WA 4RFOH 1MY5A 5C0JB 3GMLB 2ITDB 4Y4KC 3VXTB 3VXOA 3OKEB 1F6AB 5DQ9B 3S36H 4LGSB 1CL7H 3KR3H 1FGVL 4K3EH 2H8PA 1S7SB 3REVB 4YFLI 3HC3H 4GXVL 4F7PB 5C0IB 5E00A 1EHLH 2CLZB 2YD9A 2OP4L 4D0BA 3IFLH 4NGHH 4Z95H 2J4WL 5D2LE 3O0RH 1FZOA 3IFOB 4J2XA 1AGBB 4JHAL 4KROC 5EUOB 3LKNA 3BGMB 3O6LH 3HKFA 3W11D 5DEFB 5DZLA 4KPHL 4C83A 4DJMA 4ZS7H 2P4AB 1NBVL 2GFBA 3LPGA 1J05B 1CFSA 2HVJB 3GGWA 4RGND 4JM4H 3FB5A 3BP4B 3ZYIA 3UTTB 4RBPH 4L5FL 5IHBA 32C2B 1CXHA 5SV4A 3TBVB 3V2AR 4XCNB 4FNLL 1MCOH 4LKXB 5T5NG 3WE6A 1IFHH 2AJZA 2BOBA 3QUZC 3UC0L 4F7EA 2AERT 2VLKB 3WHE0 5FFLA 3QFJD 5DJAA 1PSKL 4CDGC 4HMDA 5A2IH 4TOYL 5DRXB 4Y19B 4K7PH 5F7YC 5HPMA 4QHKI 3FQNA 5GGUA 3O8XA 1I9IL 4MVBA 3SEPA 5DDHA 1H3UA 3QPXL 5DI8B 3QYCA 1VFBB 3OAYK 4BSVA 4EIGB 5HDBF 5DJDB 4U1HA 5F96H 3CD4A 4HKXA 1MHHA 3TF7C 4P23D 4L5FH 3BH9B 2OR9H 2I26N 2AK4A 4NPYA 4PGDB 4HT1L 1SBSL 1TQCC 4GQ9H 2DM4A 4LSPH 5T1DL 1TNNA 2HVKB 3FN0L 3ZHDA 1ZHNB 1F4HA 1I8KA 2CRMA 3LN4A 4ZYKB 5JQ6L 3O3AA 5DTFA 3QNYB 2WUCL 3OR6B 3ULUD 3B43A 4LCWA 3S4SG 5HYSG 3B2UD 1EO8H 3OKLB 4NC2B 4NHUB 4RFEA 5F7MC 1E27B 4P4KA 3KWWB 4JQXA 4RNRB 4NO0B 2NY6D 4WGWB 3SCMA 3FFCA 2D4DA 3ARFD 3LIZL 4PJXA 1Z0MA 2GI7A 1HI6B 2X5PA 1DUZA 1UC6A 5FGBA 1QVOA 1OW0A 4ZNEE 4B0MM 4NQXA 4OCLC 3RZCB 5LBSH 1BFTA 1MWAH 4QEGA 1VFAB 5IESL 5CEYA 5GHWL 4JKKA 2MNUA 1J0ZA 3NCEB 3B9KB 3DMMD 4OTXL 1MF2H 1FNEB 5EZLB 4OLYH 3GJFK 2ESVB 1JNHA 2APWA 4PJIA 3VGBA 1RJZB 4G6JL 5F93C 3BGFC 4XI5D 5BZWA 1ZLVH 2BFVL 3RWDA 3GMOA 4UT6L 5C0AE 3KPRB 1MFBH 1HH9A 3BDYL 5D1ZA 3TZVC 1U8NB 1WICA 2JCCF 3WIHA 1FCGA 5CJOH 3QRFM 4NT6B 4LMQE 4RX4A 2F5BL 4P9MH 3RUGF 4RMVA 1WWAX 3WUWG 4N0CC 2H9GA 5JHDD 1P53A 3P0GB 3EOTH 1N26A 5TPWL 3RNQA 3NCJH 2FB4L 4M6AA 1EZVY 5EUOF 4Y4KA 3DRTB 2WP3T 1TCRB 3NIFE 2AABH 4AMKH 5KN5A 4LNVA 5IVZB 1NGPL 2Q76B 5T3XL 1A1OB 3TPUA 3WXVL 1P7HL 5DRNB 3PGCB 3WNKA 1BEYL 3U1SL 2YA0A 1BFOB 2MCG1 2Y5EA 2WLZA 1N59A 1TFHA 2FX8L 2BMKB 3RIFF 4ZO8A 2DWEA 5IQ9A 2O61A 1Q0YH 1IJ9A 1CFVL 3BIBX 1A0QL 2VC2H 3UJTH 1SYSA 1SJXA 4NQEB 1FAIL 1V7ML 1AKJA 2OL3A 4PGJA 2JB6A 2AQ3A 5DHVA 4WUUD 1VSCA 4GH7B 3IXTB 4N1CA 3QCUH 5T1KA 1CGVA 5IM7B 4ODUA 4Z78B 1JBJA 2FJHA 4ZUSB 3D85D 4P46C 5J4MA 4CW1A 3D3VB 4JM2B 1IC4H 2F74A 5DQDH 5DK0A 4YHLL 2P44B 3L9RB 5EZJB 2BNRA 4YBLC 2BERA 5IF0B 1UWEH 1SEBB 1YN7A 1D6EB 4X7TB 3MA9L 2HT4D 3VXTA 3MLZL 4XHQA 2ZPKL 4K55A 2BDNH 3VXUA 1D5XA 4OLWH 4ZFOL 5J1SC 3P30L 1JRHH 4G42B 1FV1A 2IPKB 4APQB 4QXTA 2HLFC 1WFUA 2OI9C 3CDFA 4L3CB 4PB0H 3BQUD 4D3CH 4JM4L 1AR1C 1L7IH 2CGRH 1P1ZB 4OJFL 2ADGB 1XR9B 4R0LB 5EN2B 5J12B 4RZCB 4X5XA 1JHTB 2V7HA 3FONA 1CT8B 1ZVSB 3O6KH 4LF3B 4C55A 1AD9B 4N90D 1CZ8L 4H1LG 3FZUD 4JM2D 2HT2D 4FFYH 1OAUL 3VWJA 2AGJH 1I1AD 2E8YA 1FVCA 2BVPB 3OQ3B 2FWOA 2GK0A 3O11B 1IGMH 1FGVH 4LLWB 1I9JL 5KZCB 3BESR 4JCLA 5E4EC 1KYOK 5I8OH 5ANMA 5CCKH 4KI5D 5HGBB 3PL6C 1IAII 3SE4C 2QQNL 5BS0E 3SGJA 4G3YH 3HPLB 1EIBA 1MIEH 1IZJA 5DC0A 5F9OL 2O5YL 4KJPC 1T0MA 3RWCA 1NSNL 2EXYC 4F58L 1IBGL 5D1QC 3DVFA 3KPLA 4S0UC 3MRNA 4JFXA 3FOMB 2OTPA 3SO5A 2FX7L 2H26B 3QXDA 5F9JA 2IH3B 4KHTH 4UNVA 1MCJA 2GT9B 2NY3D 3LS4L 1X9QA 5C0EA 3RX8A 3GSQB 1MWAL 4QYOA 4XP9H 1QO3B 3PWLB 2XTLA 1T6WA 5AYQA 3CXHJ 4IHOA 5IMMA 2AJUH 2BNRD 1OAZH 3VFWA 4WFED 3DMMC 2UVEA 1PKOA 1UEMA 3LKSB 4O58H 4DN3H 3D25A 3NMEA 3EJZC 4ERSH 1GAFH 1NBZB 1NGXA 4B41A 5L7XH 2MQ3A 5BS0A 2BC4B 4ORZC 4HUXA 4F7TB 3TZVD 3W9EA 3WSQL 1QNZL 1U3YA 1T3FB 1KB5B 5LXGL 3CSYB 5C07D 4MAYA 2VZTA 3DO3A 2FZ3B 3TNNA 4XCNA 2P7TB 3PDOB 4IRSA 4PB9L 3BDXA 3F7YB 1RZFH 4J4PC 5I1HH 1MHCB 4JY5L 5FUCC 4XH2B 2DBJA 1F02I 3HR5A 1N5YL 3VCLA 1AH1A 3ZTNH 5E6ZA 4DVBB 5C0BB 3DXAB 4IMLA 2FBJH 5K9JH 4ONGH 2VQ1B 3E2HC 1RUPH 3QUKB 4DOHB 5F6IB 2BVPA 2VDQL 5E00B 5I1IL 1LMKA 1TTFA 4PJDF 1CDBA 4LCUB 4E9LA 3GI8H 5IK3B 5EU6B 4BKLB 3S3PA 4XP1H 4ZTPH 3T0XA 4I3RH 5D7LB 4MJ6A 4X99B 5I0ZA 1DQDH 3RIAF 5GRVK 3UTSE 3IVKB 2H1PH 4JRYE 2BNUB 1ZLSL 4NKMB 2QSCL 4M1GL 1DEDA 3SJVD 15C8H 5ERWA 3WNPA 2Z93A 4YC2B 4FXLA 4YX2H 3K80A 5DJ2B 1KCUH 4GKNA 4KMQA 3WLWC 2RAMA 1NFDB 4PJGB 2XZAH 5DJ2A 5EOCH 1G7IB 1UXWA 4KMTH 5CBAA 3NABL 2J8OA 1MCRA 4AENB 2KPNA 3C5JA 1S9KC 3MROA 4K3JH 4ZPTB 2VDKH 4X6DA 1EZVX 2OL3L 3OXRA 3ZDZF 1NL0H 4XXCC 1T1ZB 5IF0A 3RVWD 4AEHH 1CLYH 4M7JH 4PP2B 2AV1A 1MQ8A 1NC2B 4LLMB 3VFPB 4JO1L 5CILH 1NMBH 1OCWH 4TRPH 1SVZA 3QCTL 2J8HA 5BO1L 1K9TA 5FYKH 1RUKH 2AXGA 3QULB 3MFFA 3S9DB 3L3OB 1QLRA 2WQ8A 4PG9B 4CN6A 3CUPB 5DJCA 3OGCB 5B3NA 1XF1A 4C56A 1EH9A 1P69B 3CXDL 4PJFF 5IMKA 3VRJA 2ICWA 3GO1L 3RQ3A 2JB6B 3HR5B 3D0VB 4OIBA 4S11A 1MI5A 3NCMA 3HI5L 1KFAL 4U05A 4B7IA 3QG7H 1TJGH 4N0UE 1R3JA 2DWEB 3K8MA 1F4YH 1YEKH 3EDEA 4QY8B 1S9WA 3LD8C 1YNTB 4L3AA 3UJJH 4MCYA 5SWSA 1RK1B 4RFEB 4R3SA 3DX8A 4MAYB 4U6VH 3PL6D 1ZEAL 2BSTA 3QEUA 5KJRL 5AAWA 5L6YH 3FO1B 1FIEA 3GMRB 4JG1H 3ZDZE 2IWGA 4H25A 4RDQF 5HHVH 1OB1B 1CWVA 4PJ5D 4YDVB 3OAUH 2IADB 3D39A 2BCKB 2EXYD 4KJQC 2JK5A 3HNSL 4M61B 1BQHA 3CVHB 5BJTB 5IVOA 1OGTA 3QIWA 1AHWB 3F8UB 1KPVB 3FHQA 5BS0D 2UV3A 1YEDB 2BXZA 2VXSH 5L0QC 3MRQB 2ADGA 3QEGL 4S1QH 3X3GH 2WINA 4QYOB 5GGRY 1HZHL 5EIVA 4XPTL 5DJYA 3RWDB 1Q72L 3GK8L 2VDLL 1OLZA 1V3KA 4MWFA 1HE7A 4XCFL 3FO0L 4P2YA 3GSRB 5CSZA 3TBSA 4DFIA 1T2QL 4WO4A 1GGBH 4HPOL 3C6LB 3G6JE 1A3LL 2E9BA 4LCYB 1IGFL 3HUJE 1BREA 3MV8B 3MNZA 3C2SA 2PYEA 3ALWA 5SX4I 2V6HA 1QLEH 3KPQB 4G43B 3V6OE 4IIQB 1GH7A 3RWGA 5FYLE 3GSWB 5JIPA 3EW3B 4MAYC 5GS0D 1FN4A 2PW1A 4HX1B 2IANE 3HZKA 1A9BA 4FFWC 5HGAB 5HY9A 1ZA6B 4DEPB 1PY4A 1S8DB 4P0DA 3TT1H 1MIML 3BPLC 4DGVL 4CVUA 4XNXH 1G9ML 4RAVB 2FEEI 3EFFB 3CCHA 1ROWA 3ULSB 2P43B 2WWMD 2N7BA 4Y4FB 1T1YB 2ZZUT 5EU4A 4M5ZL 3X14B 4M8QB 4PJ9B 5MEOB 1IEBB 3ZMRA 4R97B 5CIPA 5JLZB 1J8HB 4Z7VF 3JWOC 4U1MB 1RZGA 2MOVA 4M43H 4YDLC 1VCAA 3W39B 4X7EC 1Q9OB 4WTWA 1JCKA 4ZXBD 1M7DB 2P5EB 4Z8FL 1KIPA 3QIWD 2FEDD 4MNQD 2I60L 2KZWA 5F7EH 4ZFZB 4XVJH 5IIEB 1JGVL 3QIBD 3L5XL 3O4LE 1DVFB 2ZSVA 1GOHA 2DQCL 5TQ2L 3V52L 5I71C 3U2SB 2APFA 3LIZH 2A74A 2V9TA 4GG6B 3QI9C 5FKPB 3BPNC 3WFBH 2E3VA 5DMKA 5C08B 2LTQB 4PRDA 3BW9A 3MRPB 4OCSL 1RJYB 3DARA 4PJHB 3PXHA 4MJIB 1EEZB 3ARDC 4Z0XA 1AD0B 4M02A 4UU9B 4M1CC 5JW4N 4PRIB 5C86A 5HDQL 3OSKA 3TCLB 3OR7A 2HFFA 3U4BH 3UYPA 3BP4A 4ODHL 2VE6A 4HUWA 1H0DB 4ONOA 3ARUA 3FQWA 3QO0B 2DD8H 1IGYA 3DV6B 3LEXB 3SDDA 5FYLL 4XPAH 5HYJB 5CEYB 3V6FB 1K8IB 3SDDB 5E56A 1FL5B 4KXZH 5JORA 1KXVC 1LO3H 1C5DA 2C1PB 2QHRL 3TO4A 3F5WB 1EJOH 1NUNB 1JWSB 3L3OA 5D2NE 5EO1A 1ED3B 3QWQB 3P11H 4XCYB 3FTGA 3PF2A 1EGJL 2FSEB 1XAUA 1G7PA 5HYQB 4XT1C 3B9KD 1PKQB 3DMMB 3FRPA 2RBLA 1MJ8H 4NWTL 5HDQH 5JHDE 1HSBA 4K94H 4ALAL 4PS4L 1MFCL 1JPTH 4LAQL 5HI4D 3MNZB 3DX6B 1QSZA 1EX0A 1YN6A 4LPUA 3CFDA 3A67H 5CSZB 3TBSB 1HHIB 4JFEE 4WUKH 5IEHA 1AFVH 4Z7WA 3QCUL 1CDJA 1KNOA 2VL4A 3IDIA 5IIEA 1OTSD 1PLGL 3IJSB 1ADQH 1P4LA 1K5NB 4JG1L 1A7PH 1I3VA 5E4IA 4BSVB 5HHNA 1BIIA 3VXRE 4OTXH 2VDMH 1W0VB 5EU4B 3GRWA 2YKLL 3HB3C 5JXEA 2Y07H 1G7JB 4EDXB 2XN9B 4WUUE 1QHPA 3WXWH 1UWXK 1MJ7L 4LPTA 3GMRA 4MDJA 4X4YB 2WBWB 1MPAH 5IT2H 1MFEH 4HK3J 1XR8B 2NZ9C 4JJ5A 2IAMD 1YMME 2QQLL 5GJTH 5MHSE 1FIGH 5AG9A 2YA2A 3VGGA 1U8KA 3VXUD 4U6XB 4YFEA 2OQJA 2YEZA 4OT1L 1HI6A 3S4SA 3UTTA 4Y19D 4I18B 5IW6B 2AEPL 3LDBC 4GRLC 4YX2L 1XGTB 1RU9L 4JDZB 3T0BA 1KULA 4Q2ZA 1X4XA 4QT5B 1HWGB 1RJCA 2QHLA 3ME0A 1XF2B 2IQ9H 3O81A 4P23C 4TSCH 2R0WL 4PJAF 3HE6C 3QZWG 3VGFA 4FA8A 3P73B 4LVOB 1CXKA 4WO4B 4X6EB 2VZ3A 1J8HA 3VXSE 1T3FA 2PNDA 2ZG1A 2VIRA 1RUQH 4FFWD 1AC6A 4FQJH 1S7SA 5HHOB 1FYTB 3IU4L 4R4FH 1CFQA 1ZXQA 3ULSA 2Z92B 4KI5E 3B8SA 4HKXB 1HQ4A 5F9DC 2WWMC 3UDWA 5DQDL 1QTYT 2LE9A 5FF6A 1RU9H 2D0GA 4XMKL 4AH2A 2ITDA 3CVHA 4OLUL 3RIAK 1AXTL 4OGYL 2V5MA 4MQSB 5HPMB 4P5TB 1U95A 5DSCA 4E41D 1TQBC 4YQXH 3NPSC 4N90E 1DBKL 4HDIA 4MB4A 2DQIH 4G9DB 1U8LB 4XCCH 4KKAC 4PJBF 2MHAA 3FOMA 4UDUA 3FT3B 1KPUA 1RZ7L 2RR3A 2VH5L 3NCFB 5T1DH 2HJLB 2J5LC 2J6EH 3QIUD 3UYRL 3NIGF 4HXAH 4WVRA 4NZTL 1NCCH 4Y2DA 4ZUUB 1CICD 3CDGA 1DN0A 1ZTXH 5GRZA 1I1RA 3A6CH 3VXSD 1IGFH 4BQBA 3BP7A 5L8KB 1CFSB 4JFFB 3VRLE 1KN4H 4L9DA 2KDGA 3WFCH 1AI1L 2DS4A 3JVGC 1P7QD 4JPVH 1KTRL 1NC2A 3SKOA 3WO3B 2Z9TA 4JHWL 4UAOC 5DZNA 4WHDA 4E0RB 4OUUB 4CU7A 4JANB 3B3IB 5F1IA 3PWJB 1PQZA 3RWFA 1OSPL 4I0PB 1VEOA 1EAJA 3PABB 1G9NC 5GGRB 2Z8RA 3WMSA 1YJDL 1ZLUK 4ZSOE 5I2IA 2X41A 4H26A 4O2CB 3NIDF 1M1SA 1GC1H 3SE3C 1UM4H 3P40A 1DQML 5D5MA 3QBTB 1PFCA 2DTSA 3F7PC 4X5XB 4ELMA 3DUSA 4G6JH 1MIEL 5IB1B 4HZLB 3UAJC 2CMRL 1SJHA 2HP4A 4M5YH 3P0VL 5DC4B 5E99H 1T7ZA 4R3SB 4F7TA 2CR3A 2WWKT 3FQUA 5B8CC 3HZMB 4NNPH 1KENH 4JKLA 4KHTL 1NCWH 1WBXB 4I0PD 4X83A 3SE8L 4QWWD 1RVFH 2A2QT 4UINL 5JDSB 3DWTA 2X4UB 4Y89A 1HQRB 1BAFL 2Y25A 4P46D 3GMNA 5F7FA 3TJHD 2BOCB 2AAVA 3HUJF 4L8BB 1MCNA 1DQMH 1FLTX 4GKZB 3MRFA 2R1WA 4NQED 4CVZA 1QYGH 5BCAA 1OTSC 5D7JD 5KVMC 2BJML 2QSQA 5AZEL 1Z9SA 3P0VH 1X6NA 1YY9D 3T0AA 3IETB 3I6KA 4PV8B 5C0DB 2YN5A 3W5NA 3RU8H 4G9DA 1D5BA 4TSBL 1YNKL 4PUBH 1HNGA 1RQ5A 3ARGB 1KPUB 2QQQA 5MENA 1YJDC 1CF8H 2V5SA 2YUZA 5ESVB 3O3BB 2FEEL 3TWCH 1U8LA 4ZTOL 4OZFH 3PV7A 1W2KT 3PWPB 2IH1B 4MXVF 4Y4HA 5FO8B 3VDAA 1NC4B 5DD6A 2Z93B 3QRGH 1MJJA 2H2SC 2W9EL 2HT2C 3ORJA 4NKOB 5IW1A 3ZKNC 3QDGE 4GRLD 4KRNA 1UZ6F 2HTLC 1IFHL 2EXWC 2W60B 1MRFH 3S34L 4LVNC 2V5YA 1Z5LA 2E7CA 5HHOD 1MNUL 1A64A 5TDPA 3C6SA 4WU5B 1ZKAA 4KI5C 3K7UA 5C0CA 2V2XA 4BA8A 4DKDC 2MFNA 4KAQH 1RUPL 1JV5B 5EBLA 4E0RA 5INDA 3QFJA 3I02B 1BBDL 4FABH 3ZTJG 3F58L 2P24B 1Q0XL 4ODVH 1YYML 3NIFF 2FJGB 1BD2E 1MSPA 1IGCL 2VDML 4GMTH 3O2DL 4POZD 2IQAB 3RVVD 4OGYH 5GSVB 4OQTH 3KPRE 1BJ1H 4Y5YA 4EDWH 1MLBB 3P4OB 1J86A 3GMQB 4KTDL 4HLJA 3IDGA 4PJ7A 3VWKA 2Z31B 4L4VA 2IQ9L 1WITA 1UJ3A 1NDGB 4HQQL 2NY6B 4PRPD 4JJ5B 4GAYB 3BEVB 2NXYB 4OGZA 4IDJH 4MA7H 4MXVE 2YPLE 4HBCL 3X13B 2D03H 4M4RA 3OHXB 1A2YA 3NCYP 3RWEB 1UKSA 2IGFL 4DVRL 4TRPL 1OPGH 2VYRE 5C0CE 3ZHKA 3K0WA 3HR6A 5HYSA 2VH5H 5T3XE 3L3GB 1U8JA 1HXMA 4HUVB 1OVZA 3BAEH 5FF6B 1YNLH 4PJAB 1MI5E 1DQQB 4X6EA 3SE4A 5CAYB 5CJQL 4ZPVA 1R0AL 2R9HC 2Z91A 1WBYB 3IJHB 5DUPH 4FTVD 1BD2A 5HHOA 5JW4M 2VLJB 5EWIH 1IT9H 2VIRB 4P4RB 3CFEA 1XR9A 5EA0H 4G9FE 2F53D 3DMMA 2EDLA 4JCMA 3ARZA 3BZDA 2J88H 4J4PD 4L4VE 5EZIH 5I17B 3AXLA 5I1CH 1SY6L 1U58A 1S7WA 5FB8A 2VLKD 2Y36H 5ANMB 4K94C 5DK3A 1F4WL 3MX0A 4PJEA 4CN4A 2IGFH 5JO5A 1P5UA 4FOMA 5IW3A 1LEIA 1HK6A 1OARH 4HC1L 3UAJD 5EO1B 4LAJH 4LASH 3OV6A 3RVUD 2WBJA 3OXSB 4JRXD 4L8SC 3UZQA 4XP5L 4F15C 3Q5YA 1HEZA 4KK6D 1JF1B 3EO9H 1JGVH 1S9YA 3BRFA 4KFZC 5I74B 3SDCB 2B0SH 1KJVA 4LRNL 4OF3A 3BZEB 5CLWA 3QHZL 4C59B 5IG7A 3OKKB 2NY4B 5IQ7L 4LU5L 2ID5A 1CFTB 1QYGL 2EIDA 4M7LT 3JWDL 4G9FA 1T1XB 4JFQA 3V6OA 2AJYH 5ELIA 3VFSB 2H2PC 1UM6L 3LRSA 2R2HB 5I75C 1K5NA 1I8MA 1P1ZA 4XPFH 3TFKC 4V1DE 1B4JH 1A7NL 3BN3B 2QKIA 5K9KA 4Y2DD 2Q8AL 5CEZH 1JNNH 3VW3H 3DETD 3OR6A 1TENA 1L8JA 5KOVC 5EZJA 4G42A 3SQOL 1RPQA 2EE3A 2ATPA 2HT3D 1FC1A 1CIUA 1I85A 2B0SL 2R2HA 4X9FA 5EFIA 5I19L 3CFEB 3MLXH 1ZLWH 4XP5H 1KFAH 5ITBL 5I73C 3L5IA 3S88L 1TETL 2DLFH 2JB5H 3G9AB 3NCJL 5H8DA 1X44A 2UZXB 3RVXD 4D9LH 2X4SB 4RRPA 1MHEB 3C9NA 5DVOA 5E6IA 1ZT1B 3MNVB 4OLZH 4WI4A 5TE6L 4OZFB 3SDXE 3K1KC 4BSJA 3QA3B 4MXQA 4OLXH 5E7BA 2VR9A 1T66D 3GM8A 2HTLD 5EC2A 5LVEA 4FQQA 7CGTA 4HH8A 1S7XB 4K7PL 1ONQA 1JTPA 2O5ZH 2ZKHL 3NPZB 5TGBA 4OZGE 4GKSA 3NH7H 5HI5C 3K8LA 5DEGB 4XPBH 1EGJH 3IJYA 3ZLQC 1NL0L 5MEPB 2JJTC 1YQ2A 3TYGL 4GAJL 1FRGL 1N5AA 5C7XL 4M7KL 4QRUB 3CGTA 4WFFE 4QRSA 5FB8B 1I7UA 5I16B 5GGTH 1SJVA 1VGEL 3ARBB 1FVEB 5D2LA 3RNQB 1T21B 3PL6A 2XYCA 5KSBB 5E8DH 1BBDH 4WV1C 4FABL 1S5HB 3WFHA 5EBLB 3EGSB 1XGUA 2F19L 3MV9B 3P2TA 4LHUA 1XCQA 1G0XA 5DTFB 5GGSY 2QL1A 5JHLL 1BZ9B 5KSBF 5IP4A 5J6GB 3V4PL 1OWWA 2DICA 2WINB 3LZFL 5E2JA 3EJJX 4KK5D 3TYGH 3LRHA 1BD2D 4GS7C 1CFNB 3FOLB 2FD6H 5GGQH 2PXYA 4FP8L 3TGXA 3IFNL 4NPYB 1U42A 1HEZB 4YHOH 1N6UA 3PGFL 5KSVB 4ODWA 2ZUSA 1GGIH 5F7WC 3JV6A 5I8KH 3TEUA 2NLJA 5C0CD 5D93B 4PJIB 2DLIA 2W0FA 1MRDL 1UZ8B 4BH7B 3OKNA 4MAYD 4Z6AT 4XWGH 2YD6A 1T1WB 2K3TA 4NKDB 4LPWA 2XTJC 3SBWA 1AXIB 2Z31A 3I6GB 1X7QB 4HUUB 4Y1AB 3L7EB 2PYEB 4WHTA 1S7XA 2FJFB 5ESVA 5IEKA 2AJZB 2BOBB 1KC5H 4BUHA 3O9WC 4NDMA 1FH5H 1LK2A 5EO9A 3VE0B 2CDEA 2WMPA 4LLDA 4H5SB 1GRWA 2ATKA 1WZ1H 5D7IE 3O8XC 4MVBC 5DHYA 4YHML 3KNBA 2Y36L 2VLJA 5MHSD 5J11C 4YHYB 2IMNA 3MO1A 2VITA 4FQXA 3GRWH 4XMPH 1LHZA 3P4NA 4PJGE 4X9IA 2CGRL 2BVQA 1EHXA 3QIWC 4UOJA 4CVZB 2YN3A 1A7QH 5E8EA 4V1DD 3ROOA 3QNXA 4XBPA 3RPIA 3VMOA 3T0WA 3LEVL 4JFDD 4LP4A 3HC0A 1QRND 4NUGL 3R8QA 3VI3F 5AUMB 1A2YB 3RWEA 3TH2T 5DRZA 3W9DB 5LCVL 5E9DB 4AENA 4E41A 4WWKB 2AXJA 5IB4A 3C5ZB 4EIZC 3DIFB 4L3EB 4JB9H 1CICB 4QXGL 1DVFC 3SKMB 3ZYZA 3W0WB 3LY6A 4HKJA 3MJ9H 4EEEA 5I1LA 2DI8A 3TBVA 4GRMB 4F7MB 2Y6SD 4JZOA 1XGPA 4N9GB 4WI2A 3VH8G 4YXKH 1H3GA 4O2FB 1QPPA 2H2PD 4HIIB 4LEXH 3H9HA 5FA4A 3TFKD 4MS8A 4I4WA 1JF1A 3O45A 1PQZB 4NHCH 5GGVL 3LV3A 1ZE3C 4GXUM 4LIQE 5F1OB 5DYOB 3VFRA 1HHHB 3VRJB 3DETC 3O4OC 5ILTL 3UTZB 3VXMD 2CLVA 5DFWH 4F80A 4OCWL 3MLXL 5JXEC 4GBXC 5J1AB 5SWZA 3ARBC 2M8XA 3FJTA 3MSPA 4JKPH 4MD0A 1N64H 3PDGA 1X5GA 1FYTD 3QHTC 1FDLH 4U1KB 4KUZL 1ORQA 2CQVA 4IS6A 1Z3GL 1VERA 4PIRF 4J3OC 5DJXB 1K3ZA 2A9NH 1EK3A 4LLMA 1KLGB 4MAUH 1ADQL 3IFPB 4ZQKA 4HT1H 4TUJA 4ODHH 2O5ZL 2ZKHH 3FN0H 3QUMA 1EO8L 1GIGH 2P7TA 5FCUL 1LDSA 3GSNB 3MGTB 4JQXC 4OZIB 1D5ZA 1U2HA 4D0DB 4UDTA 2HFEA 4Y16D 3HZYA 4JY5H 3K4ZA 4OKVB 1UQSA 2R1XA 3PWVA 4OFKA 4N0YL 1DEEA 1E28A 1I7ZB 4YFDB 4PB9H 3NFSL 3EYSL 3GNMH 1C5CH 3H42H 4UT7L 1RIHH 5CEZE 5GRUL 4HV8B 2JB5L 2UY6A 2XPGB 2PYFB 3HB3D 4X9BA 1WBZA 1QFHA 4G7VL 1KJ2L 4FFZH 2BNRE 1LP9E 1INEH 1ZHKB 3W5MA 2W92A 3B2VL 4WU7A 1YMMA 1EJOL 3CDCA 3ROLA 2E6QA 4OZ4B 3VG9B 3KYOB 5E1HB 4S1DC 2NZ9D 5GXBB 3GBNH 1CR9H 2IANB 4LBEA 1NDGA 5C0BD 2UYLA 4ODSH 4D2NA 3QXUA 1N8ZB 1J12A 1XEDA 2B5IC 2Z31D 4L29B 1P84K 5KVEH 1FORH 1BM3H 1FNSL 3E6HA 1YMMD 5C2BH 3R0MA 3QHFL 3HMWL 4PGEA 2LQRA 2GQHA 4IRSC 4QRRB 3ZE2F 4BFBD 2NY4C 3EO0A 1PZ5B 4WFFD 2F8XC 2CK0H 1J8HE 1NMCC 4Z7VE 4TPRL 2X05A 3RA7H 3MV7B 2YR3A 4F15B 4L29A 4FQPA 1BBJA 3W9EB 1OAQL 4PY7A 4NP4L 3CLFH 1FG2B 3GBNL 5HGBA 1VACB 3KPOA 3VDCA 2CRYA 2NLJB 3O9WA 2B4CC 1ZT7A 3KPSA 1F3JA 4KROB 4DCQB 2DLTA 3RVTD 1QR1B 3MRGB 2N7AA 4EXPX 4PBVC 1BIHA 4FQ1H 1YYLL 1FFRA 1J9CT 4TULL 5C08E 2AJSH 4ZS6D 4HZAA 2BVQB 3AM8C 4RIRB 3UBXA 4ETQB 4QT5A 2HH0H 4LGPB 4B50A 4PJCB 5MENE 2CJUL 1V5JA 4N68A 1NCBH 5D1QA 4Q9RH 4MJID 1Y0LA 4L9LB 5F3BB 4Z7VA 2FGZA 2XZQH 1TMCA 3EOYG 5I1KL 4Q2ZB 4PJDA 5T1LA 1H3WM 1OTUC 5DK0B 1S5IL 2ZUYA 1L0XA 2DQFB 2VZOA 3MLWH 1DL7L 5CMAA 5D1XD 5KJRH 1WSST 3OZ9H 3WN5B 1OF2A 1DVFD 5I6XB 1KEGL 2Y23A 5D9SA 2OM5A 3M1BA 4QKXB 2OK0L 3Q5OA 4MNGE 2E6PA 3MRLB 3MRCB 1PKQE 1EAPA 1C08A 3GJFA 5J0BA 5DJ8B 4HF5L 4P46A 2VKWA 1RULL 4OZHB 2ZUXA 3ZE1F 2PO6C 1HQ4B 1LO0L 2R1YB 4LSPL 1QLEL 1MHEA 3QFJE 2NXZC 3WS3B 3O3EA 1A3LH 2V7HB 2N56A 5D6DA 3MCG1 4EUPG 3A6CL 3ARBD 4NZDA 5IB1A 1T2QH 3HE7C 2LFGA 4G8GD 5JW4R 4BJLA 5CCKL 1T0NB 3KYNA 5I8OL 5TDNA 4Z7OF 2F53A 3AREB 2DKUA 1CT8A 3F58H 3L3HA 4PJ7E 2Z4QB 4JR9H 4JQVA 1A7BA 2E9JA 4RWHA 5ESAA 3MOAH 2H3NB 3EYUH 4K9EC 4YHZL 1JZ7A 4XP4H 3BP5B 4OB5L 5K93A 4LVNB 1IARB 3QUMB 4FTVE 1RSFA 2BJMH 4WDIA 2YPKA 1IE5A 2EH8L 5K59E 1PKQA 3V0WL 4QOKD 1OSZB 1Q9LB 2DQGL 5LAXA 1VGKA 1QLFA 2FO4A 1QACA 1CE6A 1WAAF 1ZGLM 3HTLX 1KTDA 4XX1G 3STLA 3CNKA 1KV3A 3WHE1 1GHFL 1XT5A 5IFJA 2FH8A 2WW8A 2IPUK 1Q9OA 3WHXB 3FQTA 1MCQA 1LDPL 4X7FC 2A1WH 1CVRA 1K4CA 3CDGB 3C60A 3RHWK 3T08A 3DBXB 3PHOA 4PRNA 2Z35A 2FJHB 2HLAB 3PQYB 2EEBA 2BHUA 1WCBB 4U2ZA 3RZCD 3C2AH 1OAYL 4MZ3A 5INCB 4EI5C 3UBXI 4WW2F 3JV4B 1J0IA 4X6DE 5GS0L 1JVKA 3O45B 3VXSB 2A77H 2XFXB 5CSGA 2YKLH 2VAAA 2X7LB 5DMKB 4PJXB 1ZHBA 2DQDH 3G08B 1KEMH 1V8HA 2Z31C 4TVPH 1XCTB 3B5TA 3BZ4A 4OKDA 3S8WA 3ZKND 3LN5A 4ZFZA 4PJHF 5LBSL 3CLEH 1IVLA 4H88H 4YXKL 1INDH 5C0FB 3DROB 2NY4D 3IRZA 5DJYB 2VDRH 2APXA 3FO2A 1NEZG 2ENYA 1KTLB 3MA7A 3NAAL 4HULB 5C1MB 4GMSL 3DRTA 1Z9LA 2EEAA 1RIVL 3BKML 3DURB 2VWEE 3FCTB 1G9NL 4OLZL 5DD3H 1C5DB 2C1PA 2Q3ZA 3OL2A 4L4TD 4WO4D 1EFQA 4QRQB 4CBPA 4K94L 1FL6B 1T5XB 2C1OB 3EAKA 4KDWA 5DURD 4CU6A 4NQCE 4ZOEA 4M7ZB 4OFDA 3PNWA 1FNGB 1AE6L 1U93A 2VDQH 4X7SL 3PP3K 1KXTB 3OKDA 4BZ2L 4TSAH 1T1YA 4JO3L 3DI2B 1CFBA 2W9EH 2A6KA 3O6FD 1UM4L 4KUCD 3W2DH 3MBEC 5I16A 4DUXA 32C2A 3FFDB 4GJTB 4DTGH 5FIEA 1HH6A 1OGAE 3O6ML 1RIVH 4RA0C 3H9ZA 3JWNC 3U7WL 2D9QB 3T0ED 4XNYL 1NDMB 3INUH 4HGWB 4TULH 5I1AB 3IJYB 3BQUA 3VFNB 4NNXB 4DQOH 1RFDH 4PJEF 2F54E 1U3JA 3E1F1 1QEWB 4QRRA 1NAMA 2P5WE 3QXAA 4X80H 2P48B 1I1FB 3JV5A 1FPTL 1N8ZA 3MFFB 1KBGL 4DN4L 1IC7L 4ZOBA 3LRGA 4XB8A 25C8L 5CZKA 3RKDC 2CUHA 3C09C 2SEBB 3RWJB 4C56B 5ITBH 1DBML 5DZOA 4FRWA 4GRWE 2R15A 1KCLA 4GFTB 4YHOL 4U1MA 4F33A 1YPZA 3U7WH 1EGJA 1QLFB 1MCPL 2HRLA 4TUOB 1LQVA 3BWAA 4GSDH 4PRHB 3DHJA 1ADQA 2KZ1B 3LKQB 3Q3GA 3QIBA 5CINL 1YEJH 2JCCE 4AT6B 4HS8H 5GS2D 2XKUA 2DD8L 2H3NA 2I24N 2C4FU 1H3TA 2XG4A 2P8LA 2C3VB 5I73B 3ULUF 1IL1A 1E4WH 2ADJA 2HLAA 2VLRA 5E9DD 25C8H 4D3CL 1YQVH 3DYPA 1X5FA 2MJWA 4RISH 2ICCA 2VLKA 1MLBA 2CO7B 3T2PA 2P8PA 3SDDD 4G8FB 1FL3A 2CJUH 3FO9B 3TIEA 3OAZH 4YHZH 4PJ8B 2E5EA 4ODBD 3RBGA 3GSRA 4YXHL 1D5IH 3GKZA 3BGFB 2VOTA 1I4FA 1B0GB 1LILA 5DJZB 1RHHB 3IFNH 4P4KC 1S78C 1J05A 2EDXA 1PYWA 1ZVYA 4HFWA 4L8BA 3IRPX 3K2MC 2DBLL 3QXTA 2NCMA 2BK8A 2FX9H 1I1CA 5EUOA 3QQNA 2FIKA 4DVBA 1RV6X 2VDLH 5FO9A 3DYMA 4M4PA 3AU1B 1SY6H 4N0UB 1DBJH 1LEKB 2H41A 4M6ML 4YGAB 3OAYH 3QEGH 3TA3A 2WNGA 4DGIH 2VLRE 5F3HB 3L95B 5CHNA 3G6AA 3SE9L 4HS6B 2D7TL 2BNQB 2QLVB 4HLZH 1WIOA 2NY7L 4NGHL 1KJ3L 4N5EC 1QFWI 2CRIA 4ZAKB 4L3EA 3DO7B 3MOBH 2V7NB 4LKCA 5IV2B 4ETYA 4G6ML 1W0WA 5MEOA 1T66C 3VI3E 4N0FA 3WV0A 1DBJL 1NBZA 1NGXB 3FB7B 5GRXG 2A38A 4QF1A 1KJVB 2CD0A 3CXHK 3TO2B 4PGBB 5JHDA 1BLNB 4OB5H 5DQJB 5JOPD 1WT5C 4S1RL 2A6IA 3VGDA 1AGFB 2AXGB 5FUZL 4NKIH 4K7FB 1DUYB 5CUSH 3SKNA 3WN5C 2X70A 5GS0H 1FG2A 3U0WL 1MJ8L 2OCFD 4J23A 2HFTA 4F9PA 1UCTA 2GSGB 2RIKA 5D72H 1LEIB 1JI1A 2R39A 2XTJB 3QQ9C 5HPOA 4ONFL 4HAGA 3R06A 3V4VL 4JQVC 3UPRA 3L3IB 2BHYA 3T1WA 3C08L 4HIJB 4M6NH 3VXRA 3FQUB 2VLME 1OQOA 4L9LA 1VPOH 2LAAA 2G75A 1KB9J 1BOGA 4M9OA 3CFBB 3U4EA 4Z7UA 1QHOA 1ZMYA 5EBGA 5F7HA 4HFUH 3JTSB 5D7KD 5T1KD 4QHUB 4JFHE 1RIUH 3BMVA 4HD9A 2EIZA 3C87A 4P2OD 1ULVA 2AKRB 2RFXB 4RMRA 4IHOB 3LB6C 4UTBL 2FGWH 1JZ3A 4Y4FC 5IK3A 4I5BB 4H25B 4AIOA 2FHBA 3X3FL 4RZCA 5KSUA 4Y19E 4WFEE 4Z7NF 5E5MB 1D9KB 3KAAA 3EFDH 4AQ1B 3DO7A 1REIA 1NGZB 3GSXA 1ZLSH 4JVUA 4LOUD 4TSBH 1U6AL 1X5JA 4EBQL 1YZZA 4KK9C 4PPTA 3MLTA 4NCC2 5HHXL 4YHPB 4NOBA 4PY8I 3EGSA 4Q74A 1TPXC 4I2XA 3IDYC 3HPLA 3LHPL 5EOCL 2VERN 5I66B 4OCYH 2A77L 2E27L 5D70H 5DD1L 4GG6E 4M7LL 1CGSH 3O8XD 4MVBD 2PR4H 4YBQC 3S36X 1IM9B 5HHPA 5AAMA 5I76A 4RSVA 3OGOE 5FK9B 3QDME 1XIWC 1W0YT 3T0EA 4Q6IA 5EUKA 3RIFK 2GSGA 4G6KH 2IPTH 4K3DH 1KB5H 1ORQB 5K9QI 1X3DA 3GKWL 1JPTL 3RY6C 1IKNA 4ODUB 3IDYB 1Y6KR 2X4OA 3MLSH 4JFDB 4OV5A 2EDEA 1IGJA 3RZWA 1P4IL 5IFAH 4I9WE 3SDDC 4AM0A 1EXUA 4Z77A 4LF3A 4P2CG 2V2XB 3BN9C 3AFLA 1SYSB 2CLVB 1BIIB 4MHHG 3LEYL 5CGTA 1KJ2B 1WBXA 1M71B 3H2WA 1I4FB 4KPHH 3U7YH 2Y07L 1CFQB 2PYFA 5IVXF 4Y1AA 2ENSA 4WW1A 5D7IF 3JV0A 1JZ8A 2ESVE 4P4KD 5MEQA 1M4KA 2WIIA 3L95A 1FVDA 2BDNL 4CJ0A 3H8NA 5ISZA 4Q7DA 5JA9A 4LCWD 4O2FA 5IHZB 4V3DB 3HZYB 1T5WB 1NUDA 3VXUB 3GHEL 2BVTA 2ADJB 5I74C 2ZCHH 4EDWL 4Y1AD 1YEFH 3GBLA 3ARTA 5CS7A 3J8F7 1KB5L 3BWAB 1XGTA 4JR9L 5EU6A 4UILH 3KPSE 5D5MF 1F8TL 5I18H 1KCVH 1P9MC 2J8UF 3STZB 2EE9A 1FBIH 1HWHB 5DT1L 4HCRH 5FO9B 4JPVL 3EDJA 4NP4H 2Q7YB 2W0PA 5DJZA 5BXFB 4KJYA 3OG4B 4W81A 5EU3B 4P9HL 1HHKA 4X6FA 5I71B 1AGFA 2CKNA 5I1GL 1RJZA 4LHUD 1QRNA 4NQVB 5D5ME 2YSSA 4JDVB 2H32B 4OI8A 5EU6D 3UO1H 1IGYB 1ZK9A 2NX5A 5CZVL 3O3DA 3BH8A 1A6ZA 4XRCB 2X4TA 5DHYB 4X9GA 1R5VA 4NQDE 3N06B 4V3EB 2YUXA 5IJKA 4CGTA 1RY7B 1OP5K 5JOPE 2QV2A 4PLJC 3WJLA 5JPMB 5C07B 3WLBB 4R7DB 5GRYA 4X6CF 5F7UA 4NN5B 5JNYB 4KK8C 3FFDA 3WXWL 4Y4KB 4HS8L 1LP9A 2AI0L 3U36B 3O2DA 4JHAH 4Q9RL 5IEHB 3GI9L 3W0WA 1N64L 3TT1L 4MNGA 2EDJA 5TDOA 2VLRD 5E9DA 3QQ9D 5JUEL 3V7AE 2A6DB 2HJKB 5HHME 4QHMA 4S1DD 4X7CC 4ODWB 3QWOA 1I8IB 5I2IB 3L9RA 1A5FL 1QFOA 5DVKA 3T8XB 4PJFA 3EUUA 3ZHLA 4QHMB 5FYKE 4U1HB 2BXYA 4RAUB 3ALXA 4M8QA 1JZ5A 1JWMA 4P2OC 2AI0H 3DVNA 4YHNB 4J3VA 2X9XA 4HQQH 2AS5M 4YNYA 4A6YL 1ZANH 4JKMA 1RZIA 3BIKA 5I19H 1L7IL 2DAVA 3O41A 4LLAA 1B0RB 4MNQE 3VFTA 2FGWL 3MJ9A 3O2WL 2R23B 4LAQH 1VKXB 1UZ8A 2MSPA 4OFPA 4U6XA 1OP3H 4FTVA 2CLRB 1CBVL 3BPOB 1OM3L 3QH3A 3QDHA 5HYIA 3AVEA 4MDJB 5EBMB 3VJ6B 3QNYA 3W0WD 1J0KA 4IMKA 3DYOA 5E8OA 3RVTC 3PHSA 4DK3A 5KAQG 1OAZL 2FR4B 3AMKA 4D8PA 3QUZD 1U93B 1WC7B 5J1TC 1K8DA 3LKPA 4GOSA 5E94B 1HDMA 4KJYB 1KYOJ 2D31A 5JZ7D 4UT9H 1RZ8B 5C0RL 5DJ0A 5K9OA 4G6KL 4K3DL 3UYOD 1B0WA 3U6RA 5JIIA 3BGMA 3V6ZA 5I1DB 3HI6H 5SV3A 2DMKA 5EU3A 3MRRB 3KPRA 3HN3A 1RURH 1ES0B 3ARYA 1OQXA 4NO2A 1KN4L 5HYFA 5HDOA 4KTYA 4YHIA 3VD4A 1UYWL 1U9KA 1B3JA 3S5LG 1JYNA 4OLYL 3JUZA 2ICWJ 3ULVL 2V5RA 1PZUB 2Q86A 3D87B 4K9EH 1D6VH 4X6CB 2A9MH 5CILL 1T21A 4HXBL 3C60C 2YMXL 3QPQC 3BXNB 1EHAA 3BD5A 2NNAB 4PUBL 3QJHA 3BQUB 4I13B 3N1MC 5TGBB 5CBEA 1XZ0B 4ZPVB 3UZVB 1A9BB 2F74B 5ISZB 3B2UC 2GY7B 3GSNH 4R90L 4K7PX 5CD3B 3KG5A 2EE2A 4U33A 5TDNB 1OAKL 4C83B 4G43A 3DJ9A 1I3RB 5MERB 2ARWA 5C07A 4FQLH 1YPZF 3WLBA 1RZJH 3G04A 2WANA 5BOPA 3IETA 2A6JA 1G9NH 2NXZD 5HI3C 2AABL 3X13A 2Q8BH 3RGVA 1YNLL 1G7JA 3D3VD 5KTEH 5EUKB 2FIRT 5IROA 2X4TB 5ADPH 1KUMA 1C12B 1NCWL 2Q7YA 4U1IA 4RGMB 4PJ5B 1Q9LA 3MBXH 5C71A 4YEFA 3H0TA 2VLLA 3TBTA 1F58L 3HE7A 3VWKB 1QSEE 4JDVA 4MA1C 5E6ID 2A9ML 1N4XL 5FKPA 2JIXB 2ZUUA 4JY4A 5H37G 1SY6A 2FLRT 5GZND 5A40E 1GJIA 1N0XH 5DMJB 3KJ4B 3STZA 1ZWIA 4GG6F 3MRHB 4F8TA 1HXYB 2GY5A 1H8OA 4I2XB 4X5WB 3Q0HA 4P2QA 1Z0NA 5JXAH 4Y5XA 3TP4A 3MBXL 4Y16A 3HS0B 4M62L 3KHOA 5GSRB 4L8CA 4KRMB 4WIQA 3TBYA 1TZHB 4I3GA 3SDCC 3T4YA 1A6ZB 1KCKA 3PHQA 1VADB 4G8IA 3MZTA 5AYUL 2HWZH 3GGWB 1YEEH 4IRZL 2NY0D 2MTPA 1GPOL 1AO7B 4XMPL 5KVFH 1J88A 1JN6A 2ZUWA 2DQJH 4NRXB 4EI5D 1CS6A 4NM8L 4OGXL 3NZ8A 3JTCA 4OZHA 3M1BB 3KLDA 2IMMA 2HTKD 2XZCH 4YK4B 2EYTB 4X6BA 3NA4A 4U7KA 5GS2H 5GRJH 1INEL 2Y06H 1G9EA 3UCRA 3VD7A 4EJ1C 1MCWW 3MJGX 3ARGA 1FE8H 3ARSA 2WUBH 4HK3N 4AEIL 2C26A 3G5YA 3O6FA 3VD9A 5ENWB 1PBYA 2YRZA 1CG9B 1EVTC 4YXLL 4BQ9A 3ULUH 3EDKA 3NBNA 3MRJA 5ADOL 1LO4H 3QFDB 4FN0A 4UMGA 4UB0L 3U30B 1EO5A 3S96B 5I8KL 1EPFA 6FABH 1VFMA 1T0NA 3KYNB 4WO4C 3MGOB 3T4AB 2ZOKA 3QR2A 5C6TL 3C5SA 5HYEA 2HLFD 3M17A 5HDLA 1K2DB 2X1XR 3T65B 4KXZI 1OW0C 5C0CB 4EZMA 1QBML 4GO6B 3ZKQD 3BJLA 4BFIA 5EUOE 3FKUS 1WZLA 2XWBB 3AMLA 4W6YB 2ORBL 4XTRC 1WWWX 1ZOXA 2GT9A 3WKML 3QG6A 3P4OA 3FZUC 1ZEAH 2NXZB 4MD4A 3T0EB 4HZLA 2E7BA 4Z18A 4G80B 3CFBA 2VZSA 4IMLB 4M5ZH 3DUSB 2PTUA 1A02N 4D0DA 1MQKL 1NBQA 3ABZA 1TZIA 3U9UA 3QUXA 3GUTA 3MACL 1H9VA 1G9MH 2NTSP 4U1GB 1JYVA 2C3GA 4L8SB 1T2JA 1AGCA 3QHZH 5IROC 2J3SA 3RNKB 3IKKA 5J11B 1DQJB 3H3KA 5KSAB 3QFJB 2IQAA 1BJ8A 3OF6A 1P4BH 1JNLH 3L5JA 2VABB 4HH9B 5ANME 3MREA 3D2UB 5D96C 3WFEL 3QRGL 3O3UN 2J2ZA 2Y4SA 3QPQD 1U36A 4OM0L 1I85C 3PWNA 2R4SH 1X5IA 1Y18A 3MRDB 2OL3H 3VFOA 3DX9B 1CD0A 1D6VL 4W4OA 2UWEE 5HYJD 5F96L 1JN6B 4V2CB 3NABH 4B7LA 3QUMH 1ZA3B 4QOKA 2B20A 3B2VH 3IT8D 3LS5L 2VLMD 1N7MH 2Q6WB 1B0GA 3GFUA 2BVEA 2EO1A 1YEDA 3NVQA 4QTHA 1P7QB 1J1OH 4LKCB 3OKOB 4M1DH 4UDUB 2GSIA 5AZEH 3LOWA 1K6QL 5L2JB 2R0KH 1Z9MA 3MLPA 5E24E 4JFYB 4JQIH 3MNWB 3N1FC 1B6DA 4GS7B 5J06A 1WAAE 1LWRA 2UUDK 3HAEA 5FGBC 5H37H 1KELL 1JZ6A 4G8GA 2XNAA 1GVIA 1TCMA 5DMYA 2BY3A 5ERWB 4R6UA 4O2EA 3KJ6L 5C2UB 1GZQB 3KPLB 1OTTD 2H45A 3ARVA 4JZOB 4N9GA 2N1KA 5DJXA 3IVKA 5J6HB 1UT9A 4R8WL 1EO7A 2E7LA 1F97A 3C5ZA 3H0TB 4N0CA 3GMPB 4MD5A 4P3WA 3TWCL 1MAMH 2QQKH 2D03L 4U4BA 3VMNA 3GKWH 1A9EA 4XCYA 3MODL 4UI2A 1MCIA 4XAKD 3HFMH 2VDOH 4CVXA 4PV9A 2VITB 5FUOH 3UXFA 5FECB 4OD2B 5EU5A 3SDCD 2P5WD 3QULA 4NBZB 1NAKL 4M6OH 4JFED 4I4WB 1A9EB 3ARDB 1W0WB 3I50L 4WHYH 4XBGB 1MCFA 1XH3B 1WAAA 3G04B 2DDQH 3GJFH 3W2DL 5J89A 1FO0L 1WT5A 1FC2D 2EDFA 3S7GA 3RTQD 4FP8H 4EBQH 3VG0L 1CLZH 5ADPL 1SJHB 3O6MH 4EUPB 2FJFA 5IEKB 3UTPE 5IB4B 4FZ8L 4NOFA 1LD9B 2D7NA 1D5ZB 3ARPA 3PABA 3U1SH 3UTSA 2QQKL 1QG3A 4EDXA 4PREA 4WTZA 1G1YA 4CMMA 4H0GA 1FL6A 2C1OA 1QA9A 4JY4B 1KLGA 2EYSB 1VEPA 4OI7A 1DN2A 2HWZL 2Z0BA 4NKMA 3BKCH 4P23A 2W0FB 4OM1L 4B53A 3I6LD 5ACZB 2I9TB 3G6JF 4NZRL 2IBGA 4FQ2L 3ZO0A 4HS3B 4JFFA 5DR5L 2O5XL 2NYYD 2MQ0A 4FQXB 4LLUA 3FRPG 3SBWC 4OFYD 4PJBB 4JPWL 4Q0XH 1CDCA 3WFDL 8CGTA 1VDGA 4BZ1H 3FCTA 1H8SA 5C0FA 1EV2E 5DFVC 3UMTA 2ESVA 4XGZA 3QFDA 3RY6A 5E2VL 3S37H 5E8OB 1JFQL 2YPVH 4YEEA 4WEBH 1NGWB 3CK0L 1L7TL 2ZNXA 4LEOB 1I9IH 4GBXB 4Z7UE 2ATKB 4XTRD 5HD8C 2VUYA 1PSKH 3L3KB 1JRHL 4J3XA 4EVNB 4L3ED 2PW1B 3C5ZD 4C56E 3KDMA 5D6CB 2VXSL 1N59B 3GI9H 3RY5A 1P2CB 5E5UB 1J0YA 3UYRH 5LJYH 2NNAA 2A6KB 4LCWB 5DWUL 5CJXA 5F9AC 4KV5E 1IKFL 3QP3A 1ZGLB 1Z9OA 4MSWA 5IJVA 1AO7D 1G7MA 2DQIL 1T4KA 4PGCB 3DRQA 3E6FB 1GYAA 3O6LL 1CZ8H 2IBZX 4J6RH 3VFVB 4N1HB 5FOBA 2VO5A 3BH9A 5DURB 5HHNB 1LP9F 2J6EL 4NC1E 3BW9B 3MRPA 5KVFL 4P9HH 3M17B 1KPVA 3CVIL 5EFIB 2OYPA 1AGEB 1B2WL 4W6WB 2X4PA 3PGDB 4GXUN 1A4KA 3IDNA 3F7RA 5AEAA 3S4SB 2R2EB 1XF2A 1EUTA 3QQ3B 3CC5A 4GRLB 3VE0A 2ICWI 4WI5A 3DUHA 3W0WE 4L9LC 2RHEA 5TFSH 1IM9D 1NC4D 2JKXA 3VJ6A 1XGYL 1CN4A 2IEPA 3MLYH 4G7YH 4X0KB 3GJEA 3RZCA 4UV4H 1HN1A 4EQ2A 1SEBA 1YN7B 3TN0A 5F1NA 3VWKD 4MAUL 3FTGB 5LXGH 3CFCH 3VFTB 5A1AA 4N0YH 1R3LB 4JB9L 2I60H 1P84J 5F7EL 2VDKL 4P59H 3C09B 5EU7C 4NN7B 4MQ7B 4L4TE 4P99A 8FABA 2YSSB 2EDQA 5E6IB 5C0GA 1IM3B 3V6FA 1CLYL 2L7UA 2FWOB 2GK0B 3O11A 2B39A 4M7JL 4PJXF 5T33H 3BZEA 3CSBA 1MOEA 2ED7A 1Z6JT 4JHBA 3MQIA 5FA3A 4XGZB 1UB5A 1MH5B 2YK1H 3WKNA 3MRIB 2V9QA 3SGJC 15C8L 4HX1A 1Y6MR 3CDYA 3MRCA 1YN6B 1P4LB 3U30C 4YO0B 4ONHB 5DD3L 4Y16B 3TV3L 2ZWLT 1K4DA 3ARFC 2YPKB 3PG2A 4HPYL 2A6DA 2QQLH 5GJTL 3KPMA 1CGTA 4PJEB 1AY1H 2HRPL 3KJ4C 4F37K 1CE6B 4YK4C 4ZXBC 1UJ3C 2XA3A 1J10A 1S9VB 3CMOH 4U2YA 2VJXA 3KPMB 4H8WC 2FYYA 2VNCA 2FEDC 2WIIB 3I6LE 4ODSL 2GTZA 2H1PL 2B1HL 4P2QD 1DBMH 2PUQT 2COQA 3E8UH 5HSFA 1AGEA 3QWRA 3OX8A 4U0QB 4X4ME 3ARED 3NOIA 2D7OA 3T77A 1NCNA 2Z4QA 5FYJL 4OCXL 5KW9H 2VL5A 3KXFE 4LQFH 3BDYH 1U8NA 2BNRB 1A6PA 1TDQA 4NWTH 4Z77B 2FBJL 5K9JL 4ZAKC 3SGDI 4P2RB 3OXSA 1HKLL 3ARDD 4K3JL 2EDRA 4UT7H 2MWCA 5HVHC 3ZTJH 3SKJL 3QO0A 5B3JF 3MLRH 4X6FB 3WIHL 2M26A 4B5EA 1MELA 3EFFA 3I3DA 3VH8B 3DX8B 4KK8D 4J4PA 2NYYC 5FO7A 1IM9A 3NA9H 1QVOB 4MQ7A 5HHPB 5T5FL 1YYMH 3CZFB 3WN5A 4K7PY 3PGFH 5LWYH 5DXWA 4JZJA 5KOMC 3KDMB 3R4DA 5L6YL 1BAFH 1BFOA 3WYRA 4XCCL 4ZOAA 1SBSH 2APVA 2F54D 4GQ9L 1PG7W 4L8SA 3RWHA 4GBXA 4Z7VB 1NFDE 4YZFF 5EO0A 2XZQL 3U9UB 1WZKA 3AXLB 5JXAL 3GSOA 1BJMA 5JQ6H 1FFNA 3LAFA 5HD8D 3SKJH 5FGCB 2R2CA 4TSAL 1I8KB 5HXMA 1XF3B 2IAND 4H20L 5HHMD 2P5EA 3DECA 1YDPB 2GITB 4AQOA 3IAQA 3VG0H 1WIUA 5LGKA 1J8KA 4XNQB 4MA3A 4PTTA 2HKFL 3WD5L 1DANT 1I9EA 4NBXB 2AJ3B 3MBEB 5F89A 1ORSA 1CK0L 3QDGD 1OAXL 4JFEA 4O00A 1BGXH 4ISVA 1MREH 5BJTA 5ID0A 3JTSA 4XPHH 5EIQA 1HDMB 3ULVF 5FCUH 3CK0H 3JBG7 4TSCL 2PCPB 1A1NB 5JPNA 3H3BC 3KS0H 4Q58C 4MNHA 1O0VA 5JNYA 1MJJB 2GAZB 2VISB 3T09A 3BQUC 3MRJB 4XVTH 1N4XH 3SDAC 1E4XI 4PP8C 2MPAL 5EB9A 1P2CA 2VDPL 3AGVA 4HKZA 4U1KA 3MLUH 2HFGL 5JZ7C 1T20B 2D2OA 4FZ8H 3E6HB 4NQCA 4YIQB 1QBLL 2W65B 3BSZH 1C5BL 4NNPL 4RMTA 2FB4H 5ILTH 5GRVL 2AXHA 1RVFL 4NBYB 4UINH 5I9QC 1BD2B 2R29H 3ZDYE 4XP6L 3U0TA 2IAMB 3O0RL 3UTTE 2DQGH 3RKPA 2P5ED 4UNTA 5FUCE 4BQ6A 3VWKC 1DFBH 1YEHL 2IFGA 2FECL 3HG1D 4KHXH 4OZHE 3VXME 2XI9A 5L8JB 3SCMC 4QNPF 1T04A 3SOBH 4R7NA 1I8LC 3PP4H 1A8JH 3G6DH 4LLUB 5DD5L 5TDPB 2NXYD 3KVQA 5DA4A 3KPSB 4N0FB 1TZHA 3C60D 1DANU 1PY9A 3AS0A 4XWOC 5DJDA 1OT1A 4HWZB 3HRZA 2APBA 1OLLA 2F54A 3B83A 3UEZA 1ZLWK 4QY8A 3BEVA 2IFFH 3PWUA 1KG0A 2R1XB 4L1HA 4ESKA 3HUJB 5FM8A 3MLVH 4G6FD 5I8EB 3LD8B 1LEGB 5D5MB 1OWRM 3D48R 2NY3C 3C2AL 2CDGB 1C5CL 3TPUE 3PP4L 4OUOA 1MHPH 1PD6A 4TNWK 3ARDA 4MXQD 4RFNC 4IJ3C 4X8XA 1UM5L 5A43C 3G5YB 1M6OA 3O6FB 1FZMB 4NUJA 1WVZA 3QNXB 4K8RC 4XBPB 1U8PA 3EJZD 1JF6A 3WXVH 4LCUA 2OTWB 1MY7A 2BOCA 5EC1A 4LLYB 1BX2A 2CDEB 3QUKA 4S2SB 1RHHA 3LPWA 5CEZD 4NDMB 4AMKL 1Y18B 1XGQB 3TIEB 5H94B 4EI5B 4NIKB 3MO1B 3TV3H 1DR9A 4MB3A 3RWCB 2VB5A 5B38B 4OSUH 1G84A 4OCXH 1PX4A 4PJ8A 1LGVA 2HJLA 3BP7B 1Q9WA 1R3HA 3H9HB 3RDTA 2C3VA 2FO1A 5C7XH 5L0QB 1HHHA 5FHAH 1GXEA 4HHAB 5I0DA 1XZ0A 5I1KH 1XGPB 4WI9A 5F21B 3FL7A 4P49A 2UWEF 1JMZA 4HKJB 4AT6A 3L3DA 1IC4L 3CFKA 4PBWD 3IF1B 1GGUA 4HIIA 4UV7H 3RFZC 1RZKL 4PJHE 1F90L 4BYHA 5MI0C 1JGUH 1FVCB 3MRHA 2R4SL 3HAEB 4NRZB 4OLXL 5F7LB 1RZFL 4F3FA 3ZYJA 3P4MA 4MJIE 4PS4H 2VZVA 3NZHH 2JF1A 5IBUG 4QHNB 3GSVB 2BX5A 1WV7T 4MNQB 4FQXD 2J8UE 4JRXB 4TUKL 4ISVB 3E2HB 3VFWB 5HYJE 4EN3D 1MJ7H 4P2OB 1YPZB 3T65A 4QCIA 1QOKA 2G5RA 4NQCB 4OSUL 4L1DA 5J6GA 4K2UL 5E95B 3TJHC 4Y88A 5T3ZL 3PDOA 5CEZL 4O5LL 2IALB 2GUOA 4WW2A 1WZ1L 1RHFA 1BECA 1KCUL 2FDBP 3E0GA 3HAEH 1J1XL 5E2TL 4NQEE 2DL9A 3RDTD 4S0SD 4HKZB 4ZD3L 4PYGA 3SDXB 3RTQB 2G9HB 2WWKO 3P77A 4NKDA 2QSTA 1ZHLA 3VFMB 4Y5VA 4M9PA 1HSAA 5B8CB 3L7EA 1FH5L 5TE6H 1CD9B 4G6AD 5F97E 4ZFGL 4JFEB 1T03H 3BPNB 1WUNT 2Y5TA 1Q72H 3H3PL 3QCVL 1Q0XH 4GW1B 1DQTA 1NGYB 3GHEH 1PLGH 4QF1B 2J8UA 1JHLH 4XVSH 1UKTA 4YE4L 4PRHA 5KVGL 4K3GA 3OKNB 3UTPD 4GMTL 2OI9A 1OAXH 4XZUB 4LQFL 1M7XA 3RI5F 1KCVL 3IKCB 1K2DA 5IUSA 4Q97A 3H7BA 3NN8A 1YEHH 12E8H 3GSUB 1FYTA 3K1DA 1JHTA 3V6ZB 2HG5A 3FQXA 3QDGA 1T04B 3KGRA 3K46A 3SCMD 2Q76A 1A7RH 4QTIH 4HSQA 3UDWC 1EMTL 4HUMB 5CWSA 4KQ4L 2NXYC 3FQNB 5GGUB 1LEKA 1LE5B 3V7AG 2DQUH 3EYUL 4KRLB 1ZSDA 5AD0B 1AXTH 2C4XA 1MIMH 4LRIC 1T20A 2XRAH 3IB4A 4MCZB 2JJTA 2ITCB 3L7FB 5E4EB 1MVFA 1A47A 2AJUL 4HC1A 4F58H 3MMEB 2WSKA 4FS0A 5D8JH 3JV4A 2XA8H 4ONHA 3IAPA 3EO1B 1V7NL 5SWSE 4YH6A 3NACH 3OMZA 3FQTB 5E99L 4N8VG 4BQ8A 1S9YB 4DKAA 4OCWH 3TNMB 1DP0A 4Q0XL 4PJ8D 2FL5A 3ISWA 4YNYB 1FYTE 1T89A 2ZCHL 4I2XE 3WD5H 2GJJA 4HAFA 3WNLA 1CL7L 3S37L 3ZYOA 2B4CH 3EYSH 3GNML 1XCQB 5HHQA 3SGEH 2Z8WC 4E5XB 4TTDC 5EN2A 4NKIL 1UWGL 4P5MB 1FV1B 4P2QB 1KF9B 4FQCH 5KSAD 3ZE2E 1FZJB 4ENEC 1CYGA 1W72B 1B90A 3DXAE 4FQHB 4J12A 4J1UA 1GCFA 1S7WB 4LSTH 4JJHA 4MQTB 5TH2B 3HFML 4XBEH 4U6HA 5E5RB 1HXYA 4NYLA 1IC5H 1ZWIB 1MCEA 4LSSH 2ZUQC 3BYTA 4O4YH 5JIHA 3U7AA 1JGEB 4NKQB 1U8QB 5ETUB 5JORB 2QHRH 1LO3L 4JKPL 4LVHC 1NQBA 4PP1C 3TH3T 2E8ZA 4R7DA 4PD4J 4XP1L 4ORGA 3BKMH 4R9HA 5HBBA 2CMRH 3HMWH 2R0KL 4JE4B 3WDIA 5I1DA 4PRHD 1WEJH 3JTTA 5DJ0B 3TJHA 5ESQA 5D71H 4ZUSA 3L3GA 4HUVA 3ECBA 3BD4A 1IGIH 2ZJSL 3NZHL 3GMOB 4JHWH 2YMXH 4POYA 2WK2A 4JFDA 3LH2L 4JRYD 4UU9A 5FGRA 5CIPB 1IAIL 5D9SB 4OCRH 5DJAB 3IDGB 1C08B 3GJFB 3PGCA 4KK6C 3BPCA 5FK9A 3VRLF 3QI9D 3VU2A 4JO1H 4MZ2A 4UQ3B 1NJ9A 2GTZB 5CP3A 1BVZA 5C0BE 2X89D 3DVGA 2QR0A 3INUL 3WUZA 5KW9L 4TPRH 1E27A 4P4KB 4KKNA 1A3RL 2X4NA 1ZLUH 1HHGB 1P5VA 1BQLH 3RDTC 1MRFL 3S34H 4WU5A 3MV8A 3DVNB 5C2BL 5C8JA 4O9HH 3VGEA 2ZCLL 4MA8H 1JV5A 3IKCA 3FN9A 1MPAL 1IAOA 5KTEL 4NQDA 4X8JA 2RGSA 4F33B 3E3QC 3OJMB 4P2OA 4P9HC 2A9NL 2VSCA 2NY0B 5MEQB 4XVUD 4AEEA 3NA9L 2HJFA 4U49A 4NWUL 1D5MB 3I2CL 2DMBA 1F3JB 4Q9BA 4BFEA 1YEKL 1DQDL 5J8OA 3B9KC 4N8PA 4KI5F 1DUZB 3EJYC 3KPTA 5FDYA 5HI4C 2PTTB 5DWUH 1WZMA 2QADB 3O8XB 4OV5B 3RX7A 3KWWA 4RNRA 2R0WH 4M6MH 1WC7A 1FNFA 2OJEA 4Z0XB 1LVEA 4FG6D 4G8EA 4YHLH 4PRPB 1CXIA 5BZDA 3IDUA 3SDXA 1FLRH 2W0KA 3HC4H 1RK0A 4LEOA 5CIPH 2ARJQ 4U1JB 2FD6L 2BSSB 5GSVA 3PWPE 1UEYA 3H9SA 1S7UA 4OZGA 2GUOB 2W07A 1LE5A 3KLHC 1GGIL 4LGRB 3QDMB 2LTQC 5J9PB 4Y5YB 3BRGC 1B0RA 3ET9F 3O3DB 2EC9T 1XF4B 4G6MH 3BIKB 1GGTA 3MTRA 4P5TC 1FJ1B 3FT2B 3EZJB 4WW2B 1QRNB 4NQVA 4RFNB 5KS9B 1KTDB 2XT1B 2YUVA 4YHNA 1GL4B 4MNQA 1KGCD 2JK5B 9CGTA 3M8OL 3BKYH 4YDIL 1G7HA 1J1PL 1JI2A 5AWNH 2G2RA 2XACC 5B4MD 3VFGL 3ROLB 4KI1A 3GMNB 3REVA 3TVMD 1VENA 3U79A 3RA7L 5L2KB 4M61A 5EZOL 4YC2C 1T1ZA 1NC4A 1P4IH 4Q9QL 4UOW1 1M05B 2ZSWB 1SEQH 3QI9A 2MMXA 1VACA 3JWDH 4D0CB 1ZLVK 4MX7B 2XWTB 4WV1B 1NFDA 5SX4H 3G6AB 5E0QA 1JHKH 3HE6D 4TTDD 3WJJA 4OIIH 3WDJA 2AQ2A 4G8GB 1MCBA 5CBAB 1SYVA 4YAQB 3MV01 2VAAB 3L3DB 2KKQA 5DRWB 1NLDL 1UVQA 4IIQA 1RUAH 1FP5A 2P5EE 5BW7A 5L2JA 4FQIL 1KLUB 5ICZA 3X3GL 2YPLB 2XTJD 5MENB 2DTML 5HTSA 3DGGA 1R3JB 3RPKA 5LCVH 1OP5H 5INDB 3T2QA 1F11B 3EBAA 2P47B 4PG9A 1JPSL 1R5VB 1R5IB 5DUBA 5J1AA 2XQBL 3PJSB 3O9WD 3BHBA 1U8HB 3UTQB 2UUDH 5E1AA 3S88H 5C0AB 1F4WH 4OD1H 2R0LL 1FGNL 4PGZA 3UTZA 5F7KC 4PV9B 4J3TA 4QHNA 2CKBL 2AJVL 1DN0B 3L5XH 4K7FA 4F57H 4MXWL 3TIDA 3MFGB 3PDDA 4GG8A 3VWJD 1HQRA 3WL9B 1YUHA 4X4XA 5D7IA 2AP2A 4KC3B 2VLJE 4NNYB 3AC0A 4U7SA 3BT2L 5D2NA 1KEGH 3M45A 1SJEA 4PJGA 2AEQH 4XNXL 4AZ8A 1MQKH 1AQDB 3WO4C 5C07E 1DLHA 2P8LB 3Q5TA 4WI3A 1RAMA 4XC1L 1A4JA 4U3HA 5HDBE 2BHZA 4OGAD 4E41B 3WEXA 1A1MB 2R0LH 4OD1L 3MR9B 3MGTA 3GSNA 1JZ2A 1A7OL 4H88L 1VGEH 1FDLL 1QFPA 3TT3H 5E08L 4QRPD 4PD4K 1WTLA 4EI6A 5FV2A 4ZNCD 3IFPA 4ZQKB 4EI5A 4N8VA 1J1OL 5C0NC 5DRZB 3W9DA 2R69L 2BNUA 2XIDA 2GKIA 3HC0B 5F89B 2CDFA 4R2GD 4HUNB 5F9OH 4HIXH 2FATH 2BFVH 2V5TA 4OFIA 1IBGH 1OY3B 1YYLH 5BRZE 3IDJB 4WNQB 4JGUA 4NO3B 4XH2A 2DIJA 5FHAL 2VMFA 4LLDB 2CO6B 2VDNH 1MHCA 1PG7L 1G7HB 4LCWE 5I1JL 4C4KT 4XVUC 4N0RA 4PP2A 1E4KC 5GGVY 3I2CH 4UT9L 3U0TB 3HE6A 1RURL 4AL8H 1GZPA 5KS9A 4ZUUA 4ZODA 3OXRB 4WTZG 2GEEA 3MRBA 3FFCE 2RB8A 3OKMA 1I8LA 5I66A 2CRZA 3EYFB 3EJYD 5FDWA 5DMGD 1PG7X 4QWWC 3ESUF 4UTBH 4Y2DB 4LARH 5J6HA 3Q6FA 1BVLB 4PRPA 1G9MC 3V8OA 4JAMB 4KKCC 2YD8A 1HOCA 1LDPH 3FT3A 1LO2L 4Z7QF 3ULVH 1QSFD 1FRGH 3CVHH 2GAZA 2WZPD 2K9UA 3IDXH 5B21A 4AH2B 3QG6B 1YMMB 4Y16C 1ORSB 5B38G 1U3HD 3FB7A 4MDIA 1LO5B 5D7LA 3CH1A 2GTWA 4YUEH 5ID0B 3QEQE 3GSQA 2W9DL 3D25B 1U8IA 3UP1A 1L0QA 4DGYH 3BPOC 5I1JH 4WFHE 5IMMB 4OLVH 3D18A 2YPLD 4KTEL 2DJSA 5FYKL 3C5SB 3K74B 5I6XC 3FT4A 5C8JB 3F12B 3SGDH 3QEHB 3LKOA 1JGDA 1DSFH 4PG2C 4D9QD 3BX7C 2HN7B 4YDJB 3KLSA 3BHBB 2IF7A 4WUKL 2YRPA 1KPRB 2P1YA 4XNUL 4M93C 1UACH 1NANI 3RL1B 5F71A 5JUEH 1IQDB 3P73A 1N3NA 2AXFB 3VXRB 4H0IA 3LEVH 5CSBA 2V2TA 5FM5O 3UPRB 1A5FH 3I6GA 3VFUB 1B2WH 4CJ1A 4QHLB 3NGBB 2HMIC 2OJEB 3LMJH 1WGOA 3K3QA 4PJIF 4OZIF 4MD0B 1QQDB 5KSBE 3HE7B 4XPGH 4YQXL 2RQ8A 3MV9E 3DI3B 4GKSB 3U46A 5FO7B 2PCPA 3WUWA 3V4PH 3C9NB 4DW2L 1F5WA 1CQKA 4Z7OE 3DGCR 4FQQB 4XVTL 1FIGL 2E9WA 4URTB 1PJ9A 3JTTB 1NMBL 1OCWL 4HUKB 4PLKC 4NQUA 2EDKA 4PJ5E 1A6AB 1XF3A 4BSWA 4GW5B 4WJ5A 2I27N 3RVVC 3TBWB 5HGHA 3D6GA 5LQBL 4NQEA 1HINH 1T80A 4PRAA 4LPCA 1W72H 2VDPH 1IEHA 1N6QH 3U2SA 2B5IB 1A4JB 5BO1H 4L4JA 1OD9A 3OJ2C 5A16B 4NO5B 4WWKA 5KVDL 3VWJC 2UWEA 4GRWB 3MC0A 1A6TB 1KNOB 4LIQH 4NZJA 4JO4L 1FVEA 3MLZH 2QADC 4ELME 4QOKE 4M43L 1D5IL 5FYKU 1NJ9B 1CI5A 3I3BA 5DS8A 2H9GB 1U8OB 1JYXA 1FE8L 2FCBA 5F7DB 5ICYA 4PRHE 4S10A 4Z8FH 4HPYH 1L6ZA 3HI6L 3OKKA 4KHXL 3DVIA 3ZT6A 3MUJA 1OTUD 2ZOLA 3ZE1E 4LFHG 1CFTA 2EDTA 2SEBA 3RWJA 5D1ZB 5IM7A 4PJDE 3U9PH 1I75A 5GS1C 2R9HD 4CW1B 4K71B 1Q94B 1HYRC 3TO4B 2X09A 1ZGLA 5HGAA 4NCDA 2VXQH 2YPLA 1AE6H 4GLRI 2NQCA 1U0QA 4RQQB 2AJYL 5AWNL 1IZKA 4NQXB 4RAVA 5C09D 1ZVSA 1RJYA 4PJHA 1LNUA 4APQD 3MRMA 4I18C 1U58B 4LPXA 5C9KA 1VFAA 1N3NB 1BM3L 3TCLA 4KZEH 2YBRB 3BP6B 5TE4L 1EEYA 1SM3H 4D0CA 4LDEB 4WDIB 1KN2H 3VD5A 5LGHL 3WJJC 3BVNB 3VDBA 1R24B 3KPQA 4XNYH 1IQWL 3ZL4H 4FQXC 4NHUA 3OF6D 5ESAB 3KYAA 2X1WL 4EN3C 5DMGC 1T7XA 3BKJL 4ZSOB 1JWSA 1F45A 3QIWB 4E42A 4YHKH 5HGDB 3BO8A 1QRKA 4KQ3H 3RGHA 1U91A 1UCBH 2E7MA 4JFPB 5E2TH 1CD1A 4OQTA 2ERJB 1R3KA 1BWWA 3O4OB 4XZUA 3WCYA 1AHWA 1S5HA 3WFHB 2UVFA 1G7LA 2HFFB 5I30L 4BFGA 1AJ7H 1U3HC 3F65A 1HOCB 4PGCA 2IPTL 1I1FA 4NNXA 1OB1A 2OI9B 5T3XH 4GMSH 4Z76A 1LD9A 2OR7A 2BMKA 2ZG2A 1E6JH 3N85L 4FMKA 3MRLA 1G6RA 4QHLA 4PB0L 2E27H 5D70L 1ZV5A 2D4FA 4GAGH 1S8DA 3NFPB 2ZSVB 4QRPA 1GZPB 4RQQA 1CF8L 2A83A 4F2MB 2F8VA 1XF5B 5IHUL 1UFUA 3OPZL 5CBEB 1EA9C 1UB6A 2GFBB 5IVXB 3QXVA 1IAKA 3MCKA 4H1LA 3R8BB 2VSDA 4FQHA 3LN9A 2HN7A 4PJBA 3KR3L 1WBYA 3IJHA 3T8XA 3MCLL 4MMXC 5GGSB 4LCYA 1HZHH 4YXHH 2W1NA 1BVKB 1CXFA 4EXKA 1RD6A 3GBMH 5LGJB 1RUKL 1AIFA 5HI5D 1N5YH 2I9TA 5IB2B 4AK1A 2PETA 2BP3A 1IEBA 5HHQB 1EBAA 3J7HA 3O2DH 4M8VA 4OCRL 4GAGL 2CPCA 2EZ0C 3D5OF 5BMFH 3DRQB 2HJKA 3E6FA 3UTSB 5D1ZD 3BP5A 4MSWB 3BWUC 3HCVB 2ZUTA 1WLHA 2DKSA 1A0QH 2VC2L 4N1EA 4UQ2B 3ARFB 3GIVA 1QA9B 5MP6H 4PLKD 4RWYL 5D2LB 4YR6B 5DJ6B 1AR2A 4W