3QUXA

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
273
structure length
266
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 73
structure length 266
sequence length 273
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3quxA01
4MJ2A 2Z93B 3CK0H 3SDAA 2MHAB 1D9KB 3CVHL 1CD1A 5FYLL 4B7IA 2JJSA 3SDCD 3G5YB 5DHVA 2Z91A 3I02A 3TPUE 1A1MA 4I9WE 3MRBB 3DTXA 5FYLH 4QCIB 4QHUB 1Q9LB 1YEHL 1P4IL 1X5LA 1HIML 3MV9D 5TE6L 3KYKL 3S96A 4FABL 1NUGA 5DD3L 1L0XA 3P77A 5T5NF 3F7YB 4FS0A 1NSNL 4X6DE 4XCEA 4ZD3L 1YEHH 5D2LA 1P4IH 3GGWB 1J0JA 1YDPA 1HIMH 3OKEB 3KYKH 4FABH 5IJKC 5DD3H 1N7ML 1RZKL 1JVKA 1NSNH 2F19L 4ZD3H 3EYQC 3FT3B 3K8LA 4G9DB 4JDZB 3SKMB 3L1OL 1MHHA 5KG9A 4XNYL 1IGJB 3NIGF 3QQ9C 1N7MH 2PTTA 1A7OH 5CKGA 5L9DL 1RZKH 1A22B 1SJXA 5E4IA 3TBWB 2F19H 4JB9L 4XMPL 1A47A 3L1OH 3OQ3B 4XNYH 3NCBB 3MRNA 1D5ZA 2PO6D 4JDTL 3QFJD 4JANB 5DJ2B 5L9DH 3NPSC 4PYHA 4JB9H 3OKOA 2W92A 4XMPH 3T8XB 3VRJA 4JRXB 2EC8A 4LLVB 2VLJE 3TFKC 4MB3A 4JDTH 3D39B 4RQQB 3P0VL 4PTTB 5EZLA 1RUAL 4IRJB 4JRYD 3K46A 4P46D 1VGEL 2EYRA 3SQBA 4BK4A 4LLMA 5HYIA 3U30C 2PYEE 1ITCA 1IC4L 1BZQK 1W72A 3P0VH 4HUXA 3W5NA 1ZEAL 1RUAH 5KOVC 1VGEH 5EBGA 1JZ5A 3WFBL 2E6JA 3IJSB 4PGDA 1IC4H 2D7OA 4M8QB 1GL4B 1FZMB 1ZEAH 3E8UL 1AHWA 2VLMD 3C6SA 3DARA 3WFBH 4JY5L 1W0WB 5I9QC 5I15L 1Z9OA 3IDJB 2V5RA 1WV7T 4JY5H 5HVWA 3PGCB 3ARFA 1PKQB 5I15H 3VFRA 1HYSD 4JY6B 2DOCA 1KBGL 2XWTA 1R0AL 5DK0B 4DN3L 3QNYA 5KVMC 5E5MA 4X5LA 4ZUTA 4P2OD 3B2VL 4QF1A 3QEHB 3WDHA 2HG5B 2AW2A 4MVBA 1FZJA 1WZLA 3MMEA 1KIUA 2EDHA 2ZUQB 3O3BA 1KBGH 4DEPC 4LPUA 4ZDHB 1R0AH 3BWAB 4DN3H 5LVEA 4DKFL 4QTHB 2JTDA 3B2VH 4H8WC 3HI1A 1MOEA 3TH3T 5HBBA 5IEKB 1MVFA 4Y4HA 4X4YB 2WWKO 4U1GB 2X4UB 4DKFH 5D6CA 3WKML 2VXVL 4PJXF 2FJHB 3WFEL 1JF5A 1C16B 2AS5M 1QHPA 2KZ1B 4R97C 3DI3B 3VXNA 3WKMH 5FOBB 1UM5L 3QI9B 1AY1L 4IRSB 3T1FB 4YR6A 1RZJL 4D9LH 5BO1L 1UM5H 3ROOA 3OXRB 1AY1H 3QIBB 3VG0L 3TA3B 2IPKB 1R24B 4OI7A 5EZJB 2FJFB 1RZJH 4XC1L 5BO1H 1AXTL 5HGHB 1KCKA 1HHGA 5AAMA 3UXFA 5DJCA 3VG0H 5L2JB 4RDQF 1ZGLA 3DIFA 2EIZB 4XC1H 1ZHLA 5KS9F 3V6ZB 1AXTH 4MJIA 1H8SA 1CFTA 1OLLA 2V2TB 3G5ZB 1NCUA 4OLUL 2R0KL 1DQML 1RQ5A 3OR7A 4QRPA 3VA6A 4B7LA 3QIWB 1FJ1B 1A3QA 1VGKA 1TZIA 3K8MA 4P3WA 2DYPB 2R0KH 1DQMH 2I9TA 1UKSA 2DM7A 3BJLA 4CAGA 5EOQL 3LRHA 1BOGB 3SDAD 2C7UB 4TUOA 3BEVA 3WIFB 1BFSA 3KPLB 4PG9B 4PV9A 5IK3B 3ARGC 1DBML 3IFOB 5FCUL 5CZXD 5EOQH 5GS1A 1LVEA 2O61A 1AJ7L 3S36L 3QNXB 2FZ3A 1KNOA 3TIDA 5T3XD 1DBMH 4U1HA 5FCUH 3KPQB 2HAZA 1M7IA 1OAKL 1EXUA 1EAPB 3GEWB 1AJ7H 2ICCA 4PJ9D 3S36H 3IT8D 3NFPB 3THML 3ZTNL 1J8HE 2XN9A 1Z0MA 4KJWD 2X4SB 3UEZA 1OAKH 1MVUA 3KPOB 3EGSB 2OBGA 1LO2L 1FAIL 3DVNB 3UAJC 1B6DA 3THMH 3RWJA 3ZTNH 5GS0C 1DQTA 2AQ3A 4YBLB 3NCJL 2JJUA 3I6LE 3VE0A 4WV1A 4ZNCD 2DDQL 4FTVA 3FHQA 3HRZA 1LO2H 2AXHA 4GXUN 1FAIH 4O9HH 4R3SB 3RFZC 4U2YA 5SV4A 4PJAB 3LKOB 3ZKMD 2WY3A 3NCJH 4G7VL 4GKZA 3IDUA 3C8HA 1U8HB 4OI8A 2DL9A 1BVKB 1KGCE 2DDQH 2OJZL 4G7VH 1QFOA 5MHSD 4ZAKC 4OZIB 3DUUA 1BFOA 3MYZA 4NQCE 5JHDA 1KIQA 1M7DB 2HJKA 5INDA 3QO0A 1FNFA 2VO5A 1T2JA 3PQYB 3U36B 4NNXA 5C0CB 3EYQD 3P0YH 5D1ZC 5LXGL 5EU6E 1TFHA 1HH9B 1WZKA 4JPIA 3JTCA 3QQ9D 5T1KA 3VFVA 4Z7WE 2PXYB 2D9CA 4DCQB 1XH3A 3EO0A 3V7AG 5LXGH 5JDSA 5LGHL 1OW0C 1AH1A 1N8ZA 1B88A 1EGJA 1ZVSA 2DLHA 4UTAL 4ENEC 3CCHA 3AFLA 5JW5A 3SO3B 5FO7A 3PNWB 4LHUB 1FVCA 1N3NB 4ZAKA 3V4UL 5LGHH 1DLHA 2V5MA 2YZ8A 5E5RB 2A73B 4EI6B 1RAMA 4KRPB 2JCCF 4G42A 1U9KA 4UTAH 2NY0C 1RU9L 1X44A 3SOBL 4NUJB 1FYTD 1FCCA 1YECL 5BJTB 1YEJL 4JVPA 3V4UH 4I8DA 1XIWB 3BDXA 4XBPB 5H2BA 4P4KC 1DDHB 1T0MB 3QNZB 1ZT1A 4L9LB 1RU9H 3SOBH 32C2B 5BW7C 1YECH 1TJHL 1YEJH 4MVBD 1AO7A 4XTRC 2BNQE 3F6LA 3BO8A 3HAEA 3V0VB 1U3YA 3AY4C 1G7JA 1W0VA 3OAZH 4K94C 1HH6A 3G5XA 4YBHA 3BKCL 4NQEA 1ND0A 4LF3A 1TJHH 1S7SA 4LLYA 1KTRL 2FHBA 1KJMB 5HHXL 3H9HB 5DUMH 1CE1L 1P84K 1JF1B 3PE9A 5JHDE 2VMFA 3BKCH 4B50A 5C08B 5IFJA 3RUGA 2VLLB 2I60L 4O00A 1ZT4B 2Y7QB 4Z78B 1MIML 3B6SB 1QEWA 5HHXH 3H7BB 1CE1H 4HIHA 4HLJA 3ARDB 2VLKB 3FN3A 4WUUA 3SGDI 2JKXA 3MFGB 5IB5A 5MEND 1MIMH 5A16A 3O4OC 2WUBL 4JZNB 4Y7MA 1XEDA 3F12B 4FFZL 1A6PA 3W39A 4DTGL 2OCFD 3IXTA 1GJIA 1ADQL 4JO2L 5T1LA 4G43B 1SYSA 4N0CC 5DF0A 5SWZA 3AY4A 4KK9D 2WUBH 3BZFA 2CRZA 1GGBL 2NLJB 4FFZH 1Z9MA 3B43A 2BVQB 4YHNB 4DTGH 2F54E 5TDOB 4LVOB 1ADQH 1I7UB 4JO2H 4NQVB 2DI8A 2X89D 3LN5B 5DRNB 4EDWL 5DZLA 4WNQB 4CRPA 1RZIA 1GGBH 1H5BB 3RL2B 5FKPA 2OS7A 2YZ1A 4GMSL 3BGMB 3E6FA 3X13A 2YUZA 4K71B 4WW1A 4X6CF 5DJ8B 5L8LB 1P6FA 3X11A 1CDGA 3OXSA 3MNZB 1CGTA 5C07A 4GMSH 5I1JL 4QRPD 5I1EH 1ZHKB 2YWYA 3MBEB 3MR9B 3HNTL 1H3UA 3BPOC 3MROA 2JCCA 3MGAA 3T0XA 2HFEA 4R4NC 4R7DA 4Z7UB 3VFWA 5I1JH 4HZLA 3VFPA 3VXTB 4HWEL 1BFTA 3IU3B 3S5LA 2IQAB 1U8IA 3HNTH 4BQ9A 2RFXA 2DBLL 4XMLH 3H3PL 4AT6A 3QUZA 3KXFA 1JPFA 1HK6A 3EDJA 4HWEH 4NKDA 3VRIB 3MLPA 5JXEC 2GT9B 2J6EL 2R2EB 1UM6L 5CS7A 4JFDE 1I9EA 2DBLH 3H3PH 2D3VA 4O5LL 1HILA 1S7WB 4PV8A 5D70L 2F5BL 3VFNB 4OF6A 4XWOD 2J6EH 5CEXB 1UM6H 5DTFA 4PGCB 5IMLA 4O5LH 1MJ8L 5D70H 4XCYB 1UVQA 2JIXB 2F5BH 1C12A 5L2KE 2X4RA 3S4SB 1UWGL 3H8NA 1KT2A 3WSQH 1MJ8H 2VR5A 3ULUE 5IWLC 4AIZB 3MV7B 4FTVD 1UWGH 1DTUA 3WO4C 4KJPC 3ARGD 1T4KB 2R4SL 4K3GA 5D5MF 3ZTJG 1QSFE 4N5EC 4ELMB 4KMTL 3BVNB 4KJQC 5EWIL 2JK5B 4Y4FA 4GW4A 1QA9B 4Q6IC 2FCBA 4OZHB 3WUWB 4LLDB 4HG4J 4LSRH 2P8MB 1KG0B 2R4SH 5KSAA 1KB9K 5SWSB 4JEGB 3RI5F 5EWIH 2J5LC 2OX5A 3G5VA 3L5JA 3DVGA 4G8IB 3FQRB 3GMMA 4BQBA 3WNOA 3V9FA 1S78D 1ZWIB 4ODWB 1LO4L 2C3HA 2DAVA 3JV4B 2SEBA 1Q9WA 4ZUSA 4F7MB 4ZFGL 2C3GA 5K9QI 5L7XL 2XWBA 1XGTB 3UAJD 1PKOA 4X6CA 5IBLD 1EBPA 5GS0D 1LO4H 1IEAA 3TO4C 1HN1A 2EE3A 1JRHI 4ZFGH 5J6GA 2GAZB 5L7XH 1J0ZA 1AD0B 2R0WL 1XGUB 4JM2B 4X4XB 2W0FA 4HSQA 1R3LA 1CGVA 3O6FA 4UQ3A 1M1SA 3BP4B 4I0CC 4XBGB 3QEQA 3V4VL 2R0WH 2VQUA 1OAZL 3LKRB 4V1DB 1OGTA 3P0GB 5BV7C 4ZAKD 4MYWB 5E2WL 1P7HL 3QJHA 1EO8L 5IVZB 3V4VH 5I8CA 3S36X 2M8XA 1OAZH 2Z0BA 1PQZA 3WS6A 3ULVE 3NCYP 3CFCH 1JNNL 4QRQB 1P1ZA 5E2WH 1YPZB 1EO8H 5I2IB 2DLIA 5EIIB 1XF2B 3L7EA 1DSFL 5D1ZD 3RJDA 5F44A 3EOAA 2VL5B 3ARUA 1AO7D 3MRFA 4HIXL 4JAMB 1JNNH 1QSVA 4OAWB 3DX9A 4TUKL 2BMKB 3O3EB 4QT5B 1ZK9A 2F5AH 3G04A 1DSFH 5GGSY 3IDGA 4HIXH 4YDIL 2W1NA 1Q9KB 1WJ3A 3B9KB 5T5NG 3UO1L 4TUKH 3U83A 5A40E 3QG6B 3HE6C 5K9OA 4ZSOE 3PWJB 4OLWL 4S1RL 4YDIH 3RWDB 3UO1H 5A2KH 2BJML 2A6KB 3VGAC 3MJ7B 1G7MB 2W0LA 4N0UB 4UUJA 4WGVB 1P9MA 1K85A 3OKKB 3UTTD 4GG6E 4P4KD 3RWHB 1KJ2L 4B41A 4OLWH 4S1RH 2VDQL 2BJMH 7FABL 3SE9L 3MV8B 2YBRA 5DJYA 4XTRD 4JFPA 3B3IA 5T1LD 2AK4A 1VEOA 1KJ2H 1S9YA 2VDQH 3MRLB 1I7TB 2DWEB 3IJYB 4ZG1A 7FABH 3SE9H 4NPYA 3IFPB 2XICA 2HLAA 1X5YA 3B5TA 5CMAA 4QY8A 1R3IL 5BRZB 2R1XA 4MZ2A 1UH2A 2YEZA 1MSPA 1WIUA 2UY6A 3F7PC 4ZOAA 1I85C 4HKBB 4X98B 4ZPVB 2YD6A 3SE4A 4GAFB 3FB7A 4GRMA 1S5HB 2JB5L 1DBJL 3FFDA 4HUMB 5E6IC 1WCBB 3ZE1F 5C07D 5KSBB 4IS6A 1VCAA 5A2FA 3QDMD 3SKOB 3QBTB 1WC7B 3CH8A 4RWHA 2JB5H 4RX4A 2J4WL 4HGMA 1DBJH 4TQEL 5EB9A 3U7AA 2YD4A 3T0EC 2VB5A 2EDKA 1QVOB 3HI6L 3QR2A 2MNUA 4N0CD 2DMBA 3OKMB 2GK0B 3JTTB 1N64L 2J4WH 5B21A 4NN6C 4TQEH 1NMCB 1CLOH 1BIIA 3QUZD 3NN8A 3D3VA 2A9ML 4NOFA 5JLZB 4KK6D 3RX5A 1XZ0A 4ZPTA 5C6TL 3TN0B 1N64H 3BMVA 4HH9A 3X12B 3UBXG 4KI5D 2A9MH 1JGEA 2OZ4L 4JO1L 3EW3B 5ACLA 1S8DB 4PREB 5C6TH 4HXAL 5E6IA 3LS5H 3FZUC 5F9JB 3RPIB 3GMRA 2HN7A 1AE6L 4AG4L 3RNKB 2HLFD 2OZ4H 4JO1H 3P4NB 4Z7NF 2NY1B 1KPVB 4WFEE 3MRHA 1TTUA 1Z9LA 4HXAH 4F7EB 1I1FB 1BQHA 4R4ND 1AE6H 4FQPA 2XWJA 4AG4H 4G3YL 3EOBA 3QG7L 4U6YB 1FO0H 3MRQB 4AZ8A 4U1NA 4ERSL 2DTML 5JHLL 1MAKA 1CXHA 4N68A 4G3YH 1KJVB 5JXED 3QG7H 4Y4FD 4V2CB 4FA8A 1RJYB 4ERSH 1NGWB 3AB0B 4CJ1A 1T1YA 2DTMH 5JHLH 4JFYA 2NY5L 4NKMB 5KSAD 3SDXA 2YPLB 2QTEA 1KLUA 2BCKB 1QRKA 5E8DL 3GSVA 4JCMA 1OWRM 4HFWB 4OM1L 4JR9L 1MCQA 2FHFA 2NY5H 4WU5B 1T7VA 4GFTB 2DWDA 5D9SB 3QXWA 4HCRH 4I18C 1YEIL 4R7NB 5E8DH 4MS8A 1RJLA 4PGBA 4OM1H 1F6AB 4JR9H 1MEXL 4UI2A 2EDXA 4M3JA 4RDQG 4D0DB 1YEIH 2EEBA 5FGRA 4KJPD 1MEXH 3O6FD 4X5WB 3C6LB 5HSFA 1WQVT 4GT7A 5HGBA 1QLRA 4Y0GA 1EEYB 1KN4L 5KVDL 1SJEA 3VGHA 2EKSA 2KDGA 2MOVA 3JTSB 1OAXL 5HYJA 1UZ6F 3E0GA 5E9DD 4QHUA 1KN4H 1Q9LA 5KVDH 3RVWC 4N0RA 2VWEC 1E6JL 1CIUA 4M1GL 2YHGA 2ZUXA 4PP1D 3D85A 4NDMB 4CJ0A 1OAXH 3EDDA 3D2UA 4N5UA 2GJ6E 2HTLC 3TO4D 5IESL 3OBAA 1KTDA 3GGWA 1E6JH 1JF6A 4RISL 4X7SL 4M1GH 4CW1B 4OM0L 2B5IB 5D72L 5FO9A 3MRGA 4LCCB 4P2QA 3FB8B 2OJEA 2CDGB 3MRCB 4TVPL 5IESH 5T3XL 1A1NB 5C70A 5CJXA 4RISH 4X7SH 3MRRB 3SDXE 1NC2A 5GRVK 5IM7A 5D72H 4BZ1L 5F3BA 1ZA6B 2WQ8A 5AUMA 2E9IA 5TDPA 5IG7A 4HX1A 4TVPH 2CLVA 3DRTB 5T3XH 5IMKA 4MXWL 1TQBC 5B39A 4BZ1H 5I71B 4G9FD 4YHYB 4EDXB 1T22A 1F11A 5D93B 4MXWH 1IZJA 3S97C 2GQHA 4JZJA 2YD1A 3ZTJH 1UFUA 4GW5B 1CGYA 3ET9F 3N0PB 5E2VL 3D39A 4IHOB 1NFDB 2NX5D 5SX5H 1I1AB 2V2XA 5DYOA 1OGAE 3VFUB 4EI5C 2NY2B 1IARB 4POZC 4RMUA 4DGVL 2AK4D 3TGXA 1A7PH 3D0VB 2BZDA 5E2VH 4HKJA 1OF2B 1A64A 3E2HC 5TJWK 3VWKA 4GRWB 4LSVL 4DGVH 3CSBA 1FBIL 4X6DF 5AYQA 2A83A 1ZT7A 5EC2A 1UKQA 5I17B 2PTVA 2XKNB 4OKDA 4GBXC 3QDJA 3ALPA 1T83C 4LSVH 5F9WC 2XXCB 1J1PH 5FO8B 1FBIH 4PJGF 4QRUA 5BS0D 5CLTA 3BKML 5HHOD 3HE7A 4KXZI 4BZ2L 1DZBA 3UDWC 5GGUA 3FQWB 4RMQA 1S9VB 5F7HA 2EDBA 2VZ3A 3WIHA 4YHKL 5GGRY 3BKMH 4YC2C 1EEZB 1U8NB 2CMRL 3GJEB 4HWNA 3MA7A 1KIRA 1T66C 4OIAA 4XPAL 2XTLA 1B4JL 4NZUL 4BZ2H 3P4MA 1N2RB 5CCKL 5JXAL 5MEQA 5F7WC 1UQSB 5DK0A 3JWDC 4YHKH 3H6JA 4WI7A 3O6ML 2CMRH 4JQIL 4XPAH 1B4JH 2RJMA 4NZUH 1K3ZA 4WHTB 4QXTA 5CCKH 2GITB 3P4OB 5J6HA 4KAQL 7CGTA 5JXAH 4K7PX 3BWAA 5I6XB 3FMGH 2AXJA 3O6MH 1EUTA 4JQIH 1X4YA 4KHTH 4KH2A 3DOSA 4OF0A 4UV4L 2QLVB 1X5HA 4KAQH 1YN6B 4JRXE 2F8XC 4MJ6B 5E6ID 4OLXL 3LAFA 3D39E 4WJ5A 4G7YL 1FL3A 3KYMB 5E1HB 2I9LB 3O11B 1C16A 5ACMA 1FPTL 1N5AB 1QOKA 5F1SA 5CEZE 4P23C 3EDEA 1MJJB 4NRXA 3OSKA 1JYXA 1FZKA 2EH8L 1YEFL 4JFQB 4NJ9L 4OLXH 2DQIL 4P5KB 3T0ED 5CGTA 1NFKA 2VABA 3AMKA 3HPJA 1N4XL 1YNTA 3C5ZC 5IW6B 2WW8A 4M6ML 4I13B 1FPTH 2EH8H 1YEFH 1TVHB 4NJ9H 1BZ7B 2DQIH 3AREC 1NUNB 4K8RC 4G8GB 1N4XH 3S3PA 4MNHA 4HMDA 3GB7A 5FA4B 1MFNA 2IANB 3VD3A 5HGHA 4YHLL 5DUBA 1DQJA 4GJTB 1PDKA 4EOWH 4GUPB 5ESAB 1A6TB 3FZUD 5L0QB 1LGVA 3V6ZA 4DN4L 4YHLH 1WEJL 2YUVA 4U1MB 1HEZB 1PKQE 4ZUVA 4M93C 5DD6B 5E1AA 4ODXA 3C60C 4FFWC 4DN4H 5I75C 5CBAB 3SPVB 5FECB 4H8WL 1WEJH 3H9SA 5M94B 4JFXA 4F58L 2XZZA 3QO1A 2CIKA 1NANH 3NH7L 3LKPA 3ZKXC 3BUYB 4H8WH 5FK9A 2DQTL 3DXAB 1G7HB 3N1FC 4S10A 5L8KB 2NY3C 4F58H 3RX8A 1WFUA 4QHMA 3TZVB 3NH7H 4RSVA 3GHBH 2DQTH 5E00B 3MRKB 3FO1A 4EN3C 1MCPL 3IAQA 4QYOB 2P48B 3NIDE 1KXQE 2WIIB 2VIRB 3IXAB 2XOTA 2H8PB 3JSSA 1YN7B 3WFDL 3FQUA 1MCPH 4E0RB 1WFTA 3STZA 1IM9B 3D85D 1XF3B 2DQCL 2WLYA 3MXWH 5HHMA 3U46B 3D2UD 3EYFB 4P49A 3LB6C 4GOSA 4OZGB 5IROC 4LPCA 4CADA 2BERA 1LMKA 3WFDH 1X6NA 4PJ5B 1LNUB 2CXGA 4CMMA 1HXMB 2MCPL 5HHNB 3VFSA 2DQCH 2P8PA 3D18A 4Z7VB 4DZ8B 4P2QD 5HY9B 1IGML 4NZJA 1QD0A 1T04B 2FX9H 2HT4C 3N9GL 3RWEB 2CLRB 3T4YA 1NC2D 1WGOA 1F3JB 2MCPH 3PDOB 3L3JA 4P0DA 4HS3B 4HWBL 4BFGA 5EO1B 1CTNA 2LV4A 3N9GH 2FATL 1DE4B 4XNQA 3QZWB 1BVKA 3VXRB 1N6VA 4BSWA 3HUJB 1EHAA 4HS6A 4NM4H 3RVWD 4HWBH 4NRZA 4N8CL 5DMIH 4UNTA 2FATH 2ZKHL 3KJ6L 4UIKL 3ULSA 1YJDC 3HZMA 2FH6A 3IB4A 2HTLD 5IROA 2VQ1B 3KYNB 4OF8A 4JREC 4ZFFA 3HHRB 4N8CH 3KJ6H 1CDCA 3J7HA 4UIKH 5ID0B 3PQYA 1RUML 4RNRB 1CDYA 5MI0C 1DEDA 4Z95L 1JYNA 1BMGA 2OP4L 4B5EA 3SJVA 3VWKD 1M6OA 1K2DB 3U1SL 3WDIA 3RVVD 1RUMH 3C5JB 1KIPB 1RZGB 3LDBB 4Z95H 3QDJD 2OP4H 4PRBA 2DJSA 4W4OC 2D7MA 4PJHB 3U1SH 5TF0A 3SDDA 1ZA3B 3H42L 4POYA 4DZBB 1EUUA 5GS0L 4PJ8C 5F8RC 3AMLA 5I66B 2ARJA 5DO2C 4XVUC 1QQDB 1UA6L 5GRZA 5K9JH 1URLA 4NUJA 2PYFB 1RI8A 4L8CB 5GS0H 1BOYA 2JB6B 4DK3A 4BH7A 2ITDA 4POZD 4F33B 1CFSB 1F4YL 3RIAF 2FH8A 3M1BB 4EXKA 1UA6H 1CLZL 5DXWA 4IIQB 1PY4A 4XHJC 4PJAE 1CTOA 1WFNA 3GJFH 4XH2A 1BGXL 1D5MB 1F4YH 1OOAA 4ZYKB 3U6RB 1CLZH 1JGUL 3BIBX 4KKNA 3VFOB 1CU4L 4CVXA 4E41A 4NO5B 5C0FA 5CGMA 5C0GB 1BGXH 4OZIE 4QXGL 2CJUL 1JF1A 3MOAL 4PJEB 3TBVA 4XP9L 4PJ8A 4PRNB 4WHYG 1CFNB 3K2UL 2E9WA 5BQ7A 1CU4H 5ACZA 1G9MC 5J1AB 4NO2A 1KF9B 3B6SA 2UZXB 3TBTB 1MIEL 5TFSL 5IQ9B 1G6VK 4QXGH 2CJUH 3PQYE 5EH1A 3MOAH 1S9WA 1VADA 1T66D 4ZNEE 3K2UH 5C0CE 3L5WA 3V0WL 2XTJD 1MIEH 5TFSH 4JZNA 4ESKA 1PX3A 1FNSL 3F12A 3FAWA 2MFNA 4HDIB 2AABL 3T0AA 3V0WH 3KAAA 1GYAA 1WAAA 1FNSH 1N6QH 4P5MB 4I3RH 1I7ZA 2AABH 2IALA 1S7QA 3LN5A 3PWVB 2QBWA 5SWQA 1S7UB 4U1JB 3CDCA 1UH4A 3BSZL 2BOCA 3U79A 2F74A 2C3VA 3IDNA 2LQRA 3BPCA 3LPFA 3BGMA 3R8BB 3SO5A 3EAKA 4N9GA 4HUKB 4P23D 4PJDB 4OSUL 1JNHB 4K94L 3BSZH 3OR6B 1DQDL 3C5ZD 3DV4B 1ZHKA 3H9SD 3E3QE 1H8NA 3ESUF 5FEBA 4OSUH 5D1XC 1SHMA 3WFCL 4KKLC 4K94H 3ARED 1DQDH 3V5KB 4NFDA 4OZ4A 1HQ4A 4P9MH 4E41E 2NXZC 3WLBB 2E3VA 1XF4A 3WFCH 4TOYL 3NA4A 4U1LA 4OCWL 2QSQA 4ODSL 1K4CB 2V6HA 4LSQL 5EPMB 5C8JA 5ADOL 2X1PA 4PRDA 3K8KA 5C08E 1YC7A 2O26U 4WWKA 3TT3H 4TOYH 5LJYH 1K6QL 2BOBA 2MQ0A 4ODSH 5CIPA 4MSWB 2VLKE 5ADOH 1D5BA 5JOFA 2PYED 1U58A 3REWB 3MYJB 5D7IB 1F4XL 2NNAA 3C60D 4FFWD 1K6QH 5JOPD 2AV7B 4Y4KB 4JFFB 3MUGB 5CZKA 4OZFA 3L3OB 4XB7A 5EUKA 5EU7E 4Z6AT 1F4XH 3RY4A 2AJUH 2EDRA 3UTSD 1R5VB 5JNYA 1U0QA 4LVHB 5GGSB 4WO4C 4YHZL 4ZFZA 3AXLA 1U8LA 2NY3D 2QADB 4JDVB 1UWEL 5KAQF 2DKUA 4FQXA 5C0DA 3UTPE 5FDYA 4IOIB 1DUZA 1LK2A 1NCAL 3HCVA 3T0WA 3JUZA 4YHZH 5CP7B 2DLEA 4GAYA 4LLDA 2QKIA 2A9NL 1UWEH 3BRDA 5ITFA 5FDWA 1NCAH 1TPXB 3HG1A 3CLFL 4LCWA 4Y19B 3S3SA 1YEDA 1ZWIA 2A9NH 4DUXA 3LB6D 3FFCA 1T3FB 5FYJD 3CLFH 5DQJB 5JPNB 3L6FB 4M1DL 4Z7UE 4F7MA 5I0DA 3KHOA 4NUGL 3QP3A 3AVEA 2X9YA 4LBEA 5ICYB 4X6EB 2FSEA 3W0WA 2HVJB 5B8CA 1LEKB 4YE4L 1FG2A 4NUGH 4FQQB 2X9WA 1A7QL 4M6AA 1FE8H 3RQ3A 1CFQA 1CGXA 3SY0A 3LEXA 2LU3A 4GH7B 4YE4H 2AXFA 1JN6A 1YMMB 4S0TD 2W0KA 3JBG7 1WBYB 3ULUF 4GRLB 1A2YB 1RJZA 4HHAA 2F53D 3VI3F 1A7QH 4LPYA 2G2RB 3G6AB 4CVWA 3Q6FB 1TDQA 3DX7B 3OG6B 1NDMB 2XPGA 3RZCB 4DVRL 1CDJA 4BELD 2B0SL 1FVEA 1NGPL 3BQUC 5TH2B 1X7QB 3F58L 5I2IA 3MV7E 3V79C 2FWOB 5F7DB 4X9IA 4YK4C 4R26L 3ZDYF 5CHNB 1A9EA 1S7TB 3RNQB 4DVRH 4PRIB 3BRGC 2VL5A 5I18L 4ELME 2B0SH 2XYCA 1MCNA 5KSUB 1NGPH 1PYWB 3F58H 2NR6C 3B2UC 4OZHE 3SGDH 4R26H 4CN6A 2X5PA 4APQA 1ZXQA 5EU5A 1UXSA 5I18H 2Z31A 5DJ6B 1G6RA 3VFMB 2IPUG 2R39A 4NN7C 3DYOA 5TQ0L 2DM3A 4PJ8D 3IFLL 3EDFA 5C9KA 1I9RL 3GKWL 4XVUD 4RAHA 5D7LB 1EFXD 3I75A 1U2CA 1SY6A 3D0LA 5H35B 5TQ0H 3ULUC 1U8PB 5FM4A 4OI9A 3IFLH 1I9RH 2AKRB 5J11C 2JLLA 2XRAH 3GKWH 1INEL 4IOSD 3W81A 3WN5B 4L3EA 2BVUA 3MRDA 3DHJA 1ITBB 2YRPA 4XHJD 2BNRA 5DEFB 1JPTL 3RY6A 4F15C 1INEH 3PWNA 2BFVL 3HA0A 3RKPA 5K9KB 3M17B 3N1QC 3MJGX 3ULVF 3L95A 1T0NB 2ZUVA 5LAXB 3PWUA 1U8MA 4V1DE 1JPTH 5BV7H 1ES0A 4RGNB 2AEPL 2BFVH 4OF3A 4LEOB 3VH8A 5EULV 5E4EC 2AJSL 5T1MA 2CH8A 2D7NA 4MD5B 3CZJA 5IV2B 1I1CA 2AEPH 1S5HA 1YPZE 4HUVB 1YEEL 5DC4B 3I3EA 3WMSA 2AJSH 3H0TB 1TJGL 1UYWL 4GXVL 3HPLB 5JA8B 3SGKA 3U48A 3MOQA 4MA1C 1P2CB 3OAYH 3L3HB 4PJIB 1JHLL 1YEEH 5F1IA 1A6ZB 4YJZL 3E6HA 1UYWH 2XQYG 4GXVH 4CL7A 3MREA 2Q3ZA 4BZYA 3DV6A 1NAMB 4OQTA 1C7SA 3RWFA 3BGFC 2Z4QB 1E4XH 1RIVL 3S88L 4GG6F 1JHLH 4OB5L 5I74C 2Q7YB 3AS2A 3NMEA 5DDHA 3WCYA 3VA2C 5K59E 1L8JA 1XGPA 2F9BT 1QKZL 1FGVL 2C9AA 3WFZA 3S88H 4M5ZL 2A74A 3ULVC 4JPVL 4OB5H 3QUYB 3QDAA 5E0QA 3MBXL 3LSOB 4N0UE 5DK2B 4S11A 3NZ8B 4Y5XA 2BSED 5FGBC 1CXLA 2J8UF 1QKZH 1FGVH 5GJTL 4M5ZH 3EDKA 3PHOA 4JPVH 5EU6D 3BHBB 1G0YR 1Y0LA 3MBXH 3MV8E 2ED8A 1H0DA 1WBZA 2W9DL 5D1XD 5GJTH 4KKLD 2Q6WA 4BKLB 2NY6C 4NBXB 1OCWL 5DMYA 2CDEA 1P7QD 2GTWB 5FHBL 1G1CA 4ZFOB 4L3AA 2YD5A 4I2XB 1IKFL 4WHYH 4U6YA 5LWYL 2W9DH 2NXZD 1HHJB 1G7IA 4RMWA 5BRZE 1JGDB 1Z5LA 4NM8L 4UOW0 4D9RE 1OCWH 4CN4A 3RU8L 1JNLL 5FHBH 5T5FL 1MI5D 1IKFH 4JKMA 5LWYH 1TNMA 3VG9B 4Y8AA 1LHZA 4NM8H 1NGWA 2ICEA 2H3NA 5ENWB 3RU8H 4JKKA 1PSKL 5A2JH 3HG1D 5JIHA 4LCWD 3HZVA 5KSBE 2BVEA 1CL7I 2V7HB 1GH7A 4ELKB 1DQQA 5DJZA 4BUGA 2FR4A 3VXUA 1T20B 1AFVL 2I24N 1PSKH 3FFCD 3EKCA 3OJDA 35C8L 4TNVF 3QJFA 3HC0B 4WDIB 1S7VB 3UMTA 4PGJA 3VXOB 1LE9B 5AZEL 5GSRB 3QRGL 1ZHNA 1AFVH 5C0EA 1JZ3A 5BMFL 4PJCF 4WO4D 35C8H 2GCYA 1N0XL 3F7QA 1MCSA 1VACA 3RTQB 2IQ9L 2NXYD 1NC4B 3ARVA 5AZEH 5CZVL 3P9LB 3QRGH 2PNDA 1U3HA 2KH2B 3CPLB 3MCG1 4FQJL 2ADJA 5EBWA 1OAYL 4X5WA 2IC2A 1N0XH 1U8JA 4WFHD 2IQ9H 3FTGA 5F1NA 2BRQA 5CZVH 1BFVH 4PJBA 3RPKA 5EU4A 1TCRA 4FG6C 4X7TB 4FQJH 1KPRA 1OAYH 3WFHB 1WWCA 4BA8A 1QO3B 1MWAA 2X1QA 5GGRB 1ZS8B 3O9WA 5D2NB 1MH5B 5JMRA 3SKNA 4ODHL 1U3ZA 5D6DC 2E7BA 5A1AA 2WNGA 4MQSB 1RK1A 3U7WL 5IOPA 5HYSA 1MY7A 2P47B 4U1KA 1ZVHA 2BNUB 2BP3A 2IGFL 4CW1A 4ODHH 1AP2A 4HH8A 2QR0B 3T65A 4A6YB 3U7WH 3MRCA 5ESVA 4X99B 5DRXA 2AVGA 4JHZA 2YPLE 2Z31D 2IGFH 4NCDA 4CMHC 1KYOK 3VMNA 4OKVB 5GRXG 5INCB 2OTWB 4D8PA 1LP9A 5E6ZA 3MRMB 4HWZB 5AYUL 5CJQL 2YXMA 4XCFL 4R8WL 2N7AA 4JJ5B 3GMPA 4QRRD 3U2SA 2B7DT 3MLTB 1I3RA 4WU7A 4Y5YC 5AYUH 5CJQH 4XCFH 4R8WH 3MV9B 4FXKA 4FFVC 3BQUD 5IMOA 5ISZB 4WW2F 2R2HB 4IHOA 1I8MA 1UJ3A 5DMKA 1MRFL 3QWOA 4J4PC 4PR5B 3LEVL 2EIBA 5LKNA 1XR9A 5IVNA 1NEZA 3B2UD 2YK1L 4MAYC 1MRFH 2ATPB 4RFNC 2NYYC 2ZWLT 4R96B 3RHWK 5HYQA 3E1F1 4NYLA 3BJ91 2YK1H 1T0PB 5EUOB 1VEPA 3IDYB 4CBPA 4OGAC 3FT2A 3HLAA 3O2DA 3FO9B 4X4MA 2X10A 3FQTB 4BUHA 1F4HA 1DJSA 1FDLL 4L29B 3RIFK 4GLRI 4ZTOL 1QSFD 2B20A 4M7LT 2H6PB 3UPRB 2B1AL 3GJEA 1QFWH 4JRYB 4L8BB 4P46B 1L0QA 1FDLH 5F6IC 4ZTOH 1OP3K 1E4KC 2OK0H 3HR5B 4PJFB 4WW2C 3TBSB 2NY4B 5C9JA 5C92A 2B1AH 1S7RA 5F21B 3K4ZA 4KROC 2BSSA 3RHWF 3OAUL 5B22A 3D25A 3OL2A 2VAJA 4H25B 1L4IA 4WUKL 2YUWA 4LVNB 4N1HB 1QSEA 4RZCA 2H26B 2IJ0C 4RFEA 2IG2L 1YN6A 3OAUH 2M1KA 3V5HA 2ITCB 2VR9A 2R1WB 3QUMB 4WUKH 2AEWA 1NFDE 4P5TA 3RIFF 2VERN 3SQOL 3C08L 4D0BB 1MFEL 1NFIA 3MUY1 2OI9B 2IG2H 2EDQA 4XCCH 3GKZA 3UROR 2BC4A 3KPSA 2FEDD 3SQOH 3C08H 1MFEH 1B0RA 4GRWE 1DVFA 1YNKL 2V7NB 3DURB 2B8OT 1FO0B 1XR8A 1BVLA 4OZFG 1TNNA 4M1CC 2EH7L 2LTQB 1YNKH 4LNRB 2H32B 3QXVA 2IANA 1FAKT 2DS4A 3DWTA 1M71B 2HRPL 5DS8A 5EOTB 5DSCB 1PD6A 3PABA 5FF6B 1TVBA 4J3SA 4LGRB 4S0UC 2EH7H 4HT1L 3TCXA 1TETL 3JWDL 5HDLA 3OHXA 3VXUD 2HRPH 2ATKA 2VZ1A 1NBYA 1AQKL 5D1QB 2AJYL 1K5NA 3VWJA 2YSSB 1G7LB 1ORSB 3DETC 3DLQR 4HT1H 4NCC1 5HI4C 4D3CL 3KWWB 4ZXBB 1TETH 2NY6D 3JWDH 3GMOA 5I76B 1AQKH 1TZHB 1YY8A 2AJYH 3BDBA 2VRAA 1A14L 3WHXB 3INUL 1S5IL 1A6AB 3TVMA 4D3CH 1T6VN 1IMHC 2LU7A 5DRWB 2P7TA 1QSEE 4OLEA 1A14H 4XNUL 2DM2A 1S5IH 5E8PB 5EN2A 4C59B 3LKSB 2L7UA 5AD0B 4O2CA 4QYOA 4XNUH 5F71A 1MCJA 3PWLB 4P4RB 4XNMA 4NQTA 1EZVX 3IXAA 3LZFH 3CVHA 5EO0B 4MNGB 4GQ9L 3TBYB 4K8RL 1AGFB 1VKXA 3QXDB 3TP4A 2EDWA 4GSDL 2WBJB 3ECBB 2X44D 4ORGA 4F8TA 5IIEB 4HKZA 4GQ9H 2X40A 4K8RH 4DVBA 4TNWF 4G8GE 1EZVY 4GQPH 5IKCA 3IGAB 4PJ7B 4LIQE 3CSYB 2C3WA 3UJTL 4Y2DB 2V5TA 2IANE 3VRLE 3SDAB 1CD1B 4I0KA 4JFOA 4UNUA 3GSXA 5C1MB 1F3JA 1ODAA 5DEZA 3UJTH 5CD5C 5DHVB 4F57L 2Z91B 3I02B 4FG6D 3AUVA 1C5DA 4HS3A 4L4TA 1A1MB 4IRJC 2ICWA 5LCVL 5E6YA 1T1XA 5FGSA 2DN7A 2I25N 1AKJA 2P24A 4F57H 4UU9A 3S96B 2D9QB 3LKNA 2YD3A 5LCVH 3WNLA 3MFFA 2VITA 3P77B 5KAQG 4MJ5A 3JZ7A 4XCEB 5D2LB 2VQ1A 4LHJB 3KYNA 3D5OF 2OL3L 1YDPB 4LQ1A 5KANI 3NIDF 4S2SA 3DXAE 3DBXA 4NQDD 2O5ZH 2V17L 1G7PA 1VFAA 4ODVL 5I1IL 5F7NC 1CF8L 1VENA 4FNLL 2YWZA 1B2WL 2PTTB 1RZGA 1HSBA 1RUKL 2V17H 5J7CC 1I1RA 4TSCL 4ODVH 3ARBA 2WP3O 5I1IH 3MRNB 1CF8H 1D5ZB 4FNLH 5FYLE 1B2WH 3KLHC 5IJVA 4X9GA 5JIKA 1RUKH 4MHHI 1ZA3A 3MX0A 1T89A 3UX9B 4PB0L 5DRZA 4TSCH 3VRJB 3G6JA 4FFVD 4OZGE 5I8EA 4U6VL 2ZUQC 5FYJH 3IETB 1OAUL 4PJ5E 3VH8G 5DURB 5EZLB 2Y07L 1AIFB 1XT5A 4MAUL 4Z7VE 5I8OL 2EYRB 5DVNA 4M6OL 4F33A 4U6VH 5C0AD 1CFSA 1OAUH 4LLMB 3O6LL 4U1GC 3OGCA 2XKSA 5K33A 4MAYD 1OQXA 1W72B 4HUXB 2Y07H 3RGVA 4MAUH 1CD0A 5I8OH 4M6OH 43C9A 3O6LH 4PGDB 1YJDL 3VXRE 3HUJE 3U0TA 2GY5A 5D7KE 4PP8C 1X5JA 3QI9C 4HC1L 4P2RA 4OGAD 4MWFA 1AHWB 5C0GA 3FO2A 3C6SB 4IRSC 1YJDH 4YPGA 3I6GA 3X3FL 4OCMC 4HC1H 3QIBC 3V6FA 3TA3C 1FFOB 1FL6A 5IQ9A 4HMCA 2HTKC 3ARFB 2P4AB 3VFRB 3KPSD 3X3FH 4KWUA 3QNYB 3U30B 4M7ZC 5E5MB 1KCVL 2X2YA 4ZUTB 1DVFD 4W6WB 1CLYL 4QF1B 5KJRL 3CFEA 2EICA 1FZJB 2CGRL 3MMEB 3I84A 2E9BA 1TQCB 3O3BB 4HDIA 4RMRA 1FH5L 4MD0A 3GSQA 1IQWL 1ZLVH 3IKKA 3TYGL 2YA1A 3U9PL 1CLYH 4PJHE 3MJ6A 5KJRH 4PTUA 4XAKD 3FQXA 3HI1B 4PLJC 4JN1L 1R5WA 2VDOL 2APWA 5C2UB 3QIWC 2CGRH 4Y4HB 4MLIA 1FH5H 2JF1A 1IQWH 2GJ6D 3ZYJA 5D6CB 3U9PH 5I9QB 4PJAF 5C0BA 4JN1H 2VDOH 4OD2B 3T09A 2WAHA 3V6OE 4DKDC 1QBLL 25C8L 4YH6A 1S9XA 1DL7L 3VWJD 2VE6B 4LAQH 3BYYA 1ERNA 3VXNB 2LVEA 2YR3A 3STLA 2R29L 1GZPA 5MENB 5KZCB 5J13B 4OZIF 25C8H 5CSBA 1DL7H 2VC2L 3ZKSD 4WEMB 5DK3A 3TVMD 5E2JA 3O4LA 4KJYA 3ZHKA 3N85L 3ROOB 4OV6F 2R29H 3HR6A 1X3DA 3A67L 4M1CD 1G9ML 3PWPA 1UACL 2VC2H 4U3XA 4LRIA 1HHGB 2LFGA 1K4CA 1YUHA 2WIMA 5DJCB 5BXFA 4FQ2L 3A67H 1G9MH 1ZGLB 3DIFB 4Y89A 5J3HD 1ZHLB 2UWEA 2FL5A 4MJIB 3X3GL 1OGAD 1CFTB 4YBLC 3OF6A 1RPQA 1LEIA 4WGWB 4MJ4A 4FQ2H 4R97B 4DGYL 3DETD 3WE6A 5B38A 3X3GH 3OR7B 4ONFL 4QRPB 3GSNL 2RCSL 5FYKE 1NCTA 3ISWA 1HHIA 1GHFH 2XV6B 2IH1A 2OXHA 4DGYH 4U1IA 1VGKB 3C8DA 1TZIB 4LP5A 1NGZA 3T04D 2I9TB 3QISA 4ONFH 3ARYA 2KPNA 2RCSH 4M02A 4NT6A 5AWNL 4RRPA 4P59L 5GGSA 3O6KL 3QCVL 4TUOB 3BEVB 2RGSA 4PV9B 4NSKA 4NO0A 5F1OB 4IOIA 5AWNH 5HVFB 5E5UB 5GS1B 4P59H 3WXWL 1AD9A 2O61B 3O6KH 4XZUA 3KPPA 2UV3A 5CP7A 2FGWL 1KNOB 4LSTL 4YDVA 4N8VA 3CNKA 2ZG3A 4PJDE 4U1HB 4OLZL 4J3UA 1M7IB 1EXUB 1SEQL 3WXWH 4Y19A 2FGWH 4LSTH 2XN9B 1OWWA 4OZFH 2PXYC 2FNBA 4OLZH 1I8KA 1T3FA 5HI5C 5I1HL 5C0JA 5JQHC 1MVUB 3Q2CA 1GGUA 1SEQH 3VFGL 3O45A 3RWJB 1OARL 2FGZA 5FUZL 3FRUA 1JTPA 5ICYA 5B3NA 3SO3C 3EYVA 4OCNC 4E5XB 3VE0B 4JRXD 2HVJA 4FTVB 3HRZB 4JO3L 3VFGH 4KRPC 1OARH 3CFKB 2X1WL 5FUZH 5CD5D 2PETA 4GKZB 4LSDA 3SN6N 4ZOEA 4AEEA 1GSMA 3HC3L 3ARBD 5CKAA 1XIWC 5IT2L 4JO3H 5GJSL 1PG7X 1HKLH 5D7IE 4L9LC 3E3QC 3FB5A 4HUWA 3HC3H 3TIEA 4MQ7A 3DUUB 3TH4T 1GGIL 5IT2H 5JHDB 1DBKL 1KIQB 2HJKB 3C9NA 5INDB 3LQMA 2ILLA 1GRWA 2VXQH 2UY7A 3CLEL 3RKDC 5J12B 1GGIH 4O51A 2OMBA 3PL6C 4Z5RA 1RY7B 3BFOA 4ALAL 4NNXB 4HEPG 1NAKL 3QQ4A 4BH8A 1IGIL 2J1KA 4JPIB 2W9EL 5T1KB 3VFVB 4ALAH 4Y1AA 3ARDC 1NAKH 5D7JA 1XH3B 4Z7UF 3EO0B 1IGIH 8FABA 5JDSB 1N8ZB 3G08A 4W68A 1KB5L 2H2SD 3DROA 3KLHD 1K4DA 1ZVSB 2W9EH 3WS3A 5KVEL 3LN4A 4Y19E 3CCHB 5JW5B 5FO7B 2QL1A 1FVCB 4ZAKB 1DLHB 5KW9L 4MLSA 5EU7C 1KB5H 3P9MA 5HPOA 5TE7L 1NGYA 5KVEH 4WCYH 3S37H 5MERA 3SE3A 3A6BL 4UT7H 4DJMA 3QCUL 3NCCB 5E70A 5H2BB 2FIKA 1I8IB 5KW9H 3PL6A 3UPCA 5TE7H 2X7LA 1ZT1B 1G6RL 1H5BC 3A6BH 3QCUH 5GHWL 1AO7B 1XGYL 5DEFA 3BO8B 4R9HA 1G7JB 1W0VB 4K71C 4MCYA 1HH6B 3G5XB 4JRWA 1G6RH 4NQEB 3AM8A 5IVXF 4J12A 1JHTA 1ZMYA 1ND0B 1YMME 4LF3B 4KTDL 1OVZA 1S7SB 5GHWH 4LLYB 1XGYH 1SY6L 3QI9D 1A3RL 4LMQI 1F5WA 1HDMA 3MBEC 3AAZA 3HS0A 3GM8A 1CYGA 4IRSD 1TENA 1ADQA 1ZLUK 5C0BD 5IFJB 1WZMA 3RUGB 4KTDH 4D9QE 4ZO9A 1WISA 1SY6H 1A3RH 2KKQA 2VDML 3TA3D 3U9UA 4OZHF 4HIHB 4XP5H 4WUUB 4HUVA 4QWWC 4YHIA 5F88A 4HBQA 1NUFA 5IB5B 3PV7A 2VDMH 1A3LL 1H3PL 4PRIE 1DANU 5A16B 1X5IA 1E4JA 3LHPL 2W9LA 3I2CL 4PJIA 4ONHA 3WUZA 3LV3A 3W39B 4YDLB 4W70A 3MRJA 3IXTB 1MHEA 4OUUA 5T1LB 4EUPG 1SYSB 5SWZB 1HHKA 1H3PH 2Z4QA 3BZFB 3LHPH 3I2CH 4OCXH 4PLJD 5EFIA 4Z0BL 3QIWD 3ULUL 4UIMA 3AU1A 1RZ8A 2XNAA 1QTYT 3GSWA 2HWZL 3SKUD 4JM2F 1RZIB 4OFVA 4LCYA 1IAIL 5FKPB 1F6FB 5D7LE 4Z0BH 5E8OA 3U0PA 3OF6D 1JHKL 3E6FB 3LEYL 3X13B 1NL0L 3ULUH 5AG8A 4WW1B 2HWZH 4HLZG 3DYMA 3RBGA 1IAIH 3OXSB 3UP1A 5C07B 3QDMB 1JV5A 2J6EA 2Z8SA 4IM8A 3LEYH 3MROB 4G80A 2JCCB 5I1LA 4UV7L 2HFEB 4R7DB 1FNLA 4HZLB 3VFPB 2Y23A 3S5LB 1HE7A 5DHYB 1C5BL 2VN7A 1OD9A 1U8IB 1YPZF 2RFXB 4RGNE 4AT6B 1QZ1A 2HKHL 3QUZB 5FB8A 3KXFB 3K4AA 1UH3A 1JPFB 1I1YB 4UDUA 4J1UA 4NKDB 4MNQA 4ZOBA 1UADC 1C5BH 4YHPA 4JZOA 2HKHH 1HILB 5IVXA 5ABDE 4PV8B 4BFEA 5DTFB 5IMLB 2BX5A 2J88L 4JM2C 3QDGD 5K59F 3DSFL 4PD4K 4PJIE 1WLHA 5EZOL 1C12B 2X4RB 1X5XA 5C0IA 5DJ0A 2FECI 1KT2B 3EOYG 2J88H 4NNPL 3DSFH 5BVPL 5EZOH 3ULVL 3RTQA 3P40A 3ILQC 4OFDA 3GMLB 4NNPH 5BVPH 3ULVH 4S0SD 5JW3L 4Y4FB 4GW4B 3NA9L 1CD9B 2EE9A 2BSTA 4GKNA 3HC4H 4LDLB 4N0YL 5C0CD 5KSAB 5JW3H 3G5VB 3DVGB 4X7TA 3BP7B 2QSCL 1CDUA 1GGYA 3GMMB 4J8RB 3NA9H 2F15A 1JWUB 4BQ8A 3I6KB 3L3KA 2PXYD 2SEBB 4N0YH 5D2NA 1Q9WB 2AJ3A 1FYHB 5DA4A 4ZUSB 3RDTA 1SEBA 1MUJA 5DI8A 2QSCH 2XWBB 2Q3AA 5JPMA 3LOWA 3B9KC 4X6CB 4I2XE 4KK8C 5ETUB 1IEAB 2K3TA 3VGBA 2G5BA 5IR1A 5KSBF 4Y16A 4ZUUA 5J6GB 2BNUA 3DUSA 4F37F 4M4RA 3GBNH 4R6UA 3MSPA 5HHVL 4RMTA 5CD3B 2W0FB 4J7RA 4Y1AD 1R3LB 1HHHA 3O6FB 4UQ3B 5D7JD 5HYFA 3UYOD 5HHPA 1V8HA 1XIWD 3GNML 3QEQB 1IC5L 5HHVH 3SDCA 5ERWA 1AGCA 1OGTB 4WRLA 2J5LB 1JP5A 3GSOA 4LNVA 3QJHB 3GNMH 1QRNA 5KVFL 5I8CB 5E9DB 4U0QB 4UDTA 1IC5H 2GEEA 2VDNL 1PQZB 1J0HA 4FQCL 1AC0A 4YHOL 4BFIA 5JA9A 1P1ZB 3MUZ1 3PL6D 3O8XA 2A6DA 1T7WA 5KVFH 4ZO7A 3ZSTA 2VDNH 3TPKA 1X9QA 4C56D 3BZ4A 4FQCH 2FLBT 2PUQT 1G84A 3EOAB 5CFHA 3MRFB 2R23A 4ZMAT 1NCBL 2JJVA 3DX9B 3SKJL 1EEQA 1IGYA 1K8IA 3ARDD 2VLKD 3G04B 1BX2A 2CLZA 5GZNC 1KJ2A 2ATPA 3IDGB 4KV5E 1NCBH 3SGJA 4L8SA 3IFNL 3SKJH 5BV7B 2D31A 5EUOA 2Y9RT 4QHNA 3HZKA 3NFNA 5D2NE 5K9OB 2PO6A 3N06B 1T1WA 3QFJA 4Z9KB 3IFNH 5IW3A 4YFEA 4G9FB 2WK2A 1NMCC 3GSUA 4UUJB 3OKLA 1BVZA 4QNPF 3QQ3A 4OFIA 3QUXC 3QIUA 4OQ1A 3UTQA 1BJ1J 1L6ZA 2Y25A 3TN0C 3RX7A 3UTPD 2N56A 3CGTA 2YBRB 4N90E 3UPRA 5DJYB 5ICZB 4L8BA 4JRYA 4JFPB 1YQVL 2IFFL 2Y36L 3B3IB 5CILL 2AK4B 2FX7L 3O41A 1S9YB 4L3CA 1VFBA 4PJFA 5HPMA 4NPYB 2CO6B 1UWXK 2CUHA 2HLAB 5D71H 1JZ6A 3MC0A 1D5XA 5CMAB 1YQVH 2IFFH 4QY8B 2Y36H 4Z7OF 2R1XB 3MBED 5CILH 2FX7H 1CZ8H 2NY1C 2YEZB 4M9PA 3HKFA 3SGEI 2C1PA 2Q86A 4WTXA 1KCRL 3FB7B 3MV9E 1EJOL 4URTB 3CD4A 3FFDB 5HHOB 5ISZE 2ADFL 4HS8H 1RIUL 4IS6B 3RJQB 2VZTA 4NN5B 5DZOA 1KCRH 1EJOH 2QHRL 4UINL 1U3JA 2OI9A 3CMOL 4UOJA 1IEHA 3AB0C 2Z8VC 2ADFH 1I8LC 43CAB 1RIUH 3ILPA 4X6BA 5DJDB 1FLTX 1P53A 4I0PA 1GC1C 2QHRH 4JFEA 5HDOA 4UINH 4LEXL 4P2OA 1BIIB 3CMOH 4XCNA 3WNPA 4KPHL 1X5ZA 1F4AA 3D3VB 1L7IL 4Q2ZA 5DGRA 2JIXD 1XZ0B 3BH9A 1D5IL 5EUOE 4ZPTB 4MNQD 1OTTC 4LEXH 3TF7C 4HH9B 3CC5A 3WV0A 1VHPA 1W8OA 1L7IH 2ED7A 1JGEB 3ESVF 1QFHA 2K9UA 2ZG2A 1D5IH 3MV7D 3B83A 5E6IB 4MDIA 2AJZA 3GMRB 2HN7B 3T2PA 2XG5A 1BM3H 4YDKL 2PCPA 3L9RA 4JRYE 3C6LC 3V7AE 4KKAC 1D6VL 4F9LC 2GHWB 2EIDA 1TCMA 1BQHB 5HJ3A 2G5RA 2XWJB 4PJFE 4YDKH 5SWSD 5IB2B 3EOBB 1S9KC 2VZSA 1DLFL 3DMMC 1BD2D 1CE6A 4NN6B 4U1NB 1D6VH 1NFDF 3DYPA 3R0NA 4LLQA 3WJJA 1HKFA 5CEYB 4F7TB 2NTSP 3K7UA 1DLFH 1LDPL 3QEGL 2VLME 1T1YB 3CXHK 1FN4A 4JFYB 1LDSA 5DEGA 1KLUB 1R5IA 4GRWF 2N1KA 4JFHE 1LDPH 3EJYC 2E7LA 3GSVB 2HFFA 2B5IC 4EUPH 6FABL 2GY7B 4JM2D 4LCCC 1MJUL 2WBKA 2DWDB 3RDTD 1UG9A 3VW3L 3QA3A 3OB0K 1RJLB 4PGBB 3X14A 6FABH 2YA0A 2EZ0C 4M62L 1MJUH 3IAGC 2AXGA 4Y16D 1J9CT 2IADA 1B9ZA 4OLVL 2DQHL 3VW3H 1WT5C 1PFCA 3IGAA 3WDJA 1MHPL 3UCRA 4M62H 3JVGA 5I71C 3ILQD 3GMQA 4HGWA 4YHYC 4HLZH 1T21B 2YPKA 5D93C 4OLVH 5HGBB 5L88L 1QLRB 1CQKA 4U49A 1SJEB 1MHPH 3PXJA 4BQ6A 2EKSB 4XP9H 4LHUG 1I1AC 2PW2A 3CJJA 2BVYA 5DVOA 1EAJA 3DI2B 2NY2C 3CVHH 5L88H 5HYJB 5FUOL 4X5XA 1QRND 1IRAY 3S3JA 1U92B 3JXAA 1V3KA 2GSIA 3MLXL 3KNBA 3D85B 4PJ9A 3FRPA 5FUOH 3B9KD 3O8XD 5MP6L 3D2UB 1FG9C 4TVSa 1KTDB 5EIQA 2IFGA 5IB1A 5CJ5A 3MLXH 2F8OA 1BEYL 5TE6H 5CINL 5FO9B 2D0HA 4U1SA 5MP6H 3MRGB 4P2QB 1OP3H 1INQA 6CGTA 2OJEB 1P7KA 4HKXA 4U6HB 4MX7A 4LP4A 1BEYH 1NC2B 5CINH 5IM7B 2XQBL 4F80A 4JQXC 5F3BB 2E7LE 5AUMB 5IG7B 5TDPB 4HX1B 4Q58C 1FFNA 2CLVB 5IMKB 2Q76A 3BKJL 1OQOA 4KY1L 4MNGE 2XQBH 5B39B 4QOKA 4IMLA 1T22B 2E8YA 1F11B 1EEUA 2N4IA 3BKJH 4JZJB 2YRLA 4KY1H 2YD9A 2R2BA 5BRZD 1OY3B 3IKCA 3IETA 3QIUD 3MODL 4D9RD 3P9WB 4X9FA 1QYGL 5ESQA 5I6XC 5MEOA 4H26A 2V2XB 4PJ7E 5DYOB 4YEFA 1AIFA 4DUWA 5IJKA 5LGJA 1NCDL 2YMXL 5DJXA 1TTFA 4HKJB 1PY9A 4RBPK 1QYGH 3LKQB 3PDGA 3VWKB 1PBYA 2EIEA 1NCDH 2YMXH 3BZDA 2A83B 1ZT7B 3PGDA 5EC2B 4HJ0C 5F7LB 1U91A 1H3WM 3QDJB 5T3XE 2ZOLA 5DGQA 3B9DA 1XMWA 2NZ9D 1TQBB 2Y06L 4QRUB 2CK0L 4H0HB 2X05A 1V05A 2APTA 3HE7B 5D2LE 5GGUB 3TFKA 3GIZL 2X1OA 3QUXD 1AGBA 3E8UH 1X5FA 1FFOA 2RR3A 3TN0D 1Z3GL 3CFDA 5GRJL 2CK0H 3KPRD 4F3FA 1FYTA 3MA7B 1KIRB 2A0LC 5HI3C 3P4MB 3AS3A 4QKXB 3GIZH 4I1NB 4I0PD 4PY7A 5MEQB 5EOCJ 4JFED 1Z3GH 5GRJH 4P9HC 4OZGF 1LO5A 3M8OL 4QXTB 3EFDL 5J6HB 3UZEA 2NY1D 1V3MA 5BCAA 3MCKA 2ESVA 4Z7VF 3VDBA 2MCG1 2EDEA 5F9WB 1U36A 3M8OH 4S1DD 3EFDH 4M7LL 2IH3A 2OM5A 4RMSA 4WJ5B 1FL3B 4OD2A 4FN0A 3S4SG 4M7LH 2VE6A 4NRXB 1EVUA 1FZKB 1IE5A 3HZYA 1AGEA 2VXVH 3TZVC 2VABB 5I0ZA 3HPJB 1MCOL 1YNTB 1HCVA 2XTJB 3WFEH 3N50A 5MENA 5JZ7C 3TM6A 2DBJA 5GS3A 4YGVA 1WICA 4G6ML 5CP3A 3MGTB 5KTEL 1UXWA 2EDNA 2FD6L 1NBZA 1MCOH 1MQ8A 3QDHA 4XP4L 4MNHB 1IM3A 3WUWG 4IEFB 1OTTD 3SCMC 4UT6L 3GB7B 4G6MH 1UB6A 4RCAA 5KTEH 5DUBB 1DQJB 2FD6H 3ZKQD 1MELA 2IBZX 2X89A 5HGAA 4EQ2A 4UT6H 3ZZ1A 4PB9L 5E2TL 3UJIL 4ZUVB 3C6LD 3BD4A 4KKAD 2IBZY 4PJGB 4ODXB 5E1AB 3QXAA 4RWYL 3K1DA 3CH1A 4X6FB 5ADPL 3H3KA 5DC0A 3KJ4B 4PB9H 3H9SB 2YN3A 5E2TH 4JPWL 2P5WD 3DMMD 4AQ1B 3UJIH 1N26A 4JFXB 4XRCA 3QO1B 4OLUH 4XNXL 5HDBE 4RWYH 2CIKB 4KK5C 3LKPB 4X0KA 5ADPH 5FK9B 2HMIC 3PGFL 3UBXA 1EIBA 4FP8L 4JPWH 3SCMA 3DHMA 4XNXH 4QHMB 5GIRB 1QG3A 3FN0L 3NIGE 2WZPD 3VI4F 4PY8I 5IHLB 1J18A 3FO1B 4FP8H 2APVA 1S7XA 4TVPD 3FN0H 3DGGA 1JTOA 4YDJA 3FQUB 1ZLWH 5MENE 3STZB 5HHMB 2YOCA 3C60B 4HWBA 4J3VA 5I75B 2EZ0D 4PJEF 4CADB 3VXMA 3MV11 4PJXA 1NDGA 3BYTA 4CMMB 3V7MA 3O3DA 4JG1L 3VFSB 2P8PB 3D18B 4XGZA 3ZKXB 1CT8A 2X09A 4M00A 3WLWD 4JKWA 4E5XA 3T4YB 1R3JA 2NY3B 3JV5A 3RA7L 1L9MA 1L0YA 1WVZA 5FGCB 3ARGA 5EG6C 3CFKA 2EXWC 3L3JB 2I5YL 2GTZA 1I1AD 5DVLA 1ZTXL 4NGHL 3V6OC 4MJIE 3VD9A 1AI1L 1HQRA 4XNQB 2NY2D 4BSWB 3RA7H 2YD2A 4HS6B 4Z7QE 4E9LA 4QOKD 5EC1B 2I5YH 1JMXA 2EEAA 1ZTXH 4NRZB 4NGHH 2GUOA 1DUYA 2H1PL 4IJ3B 4ZS6C 1AI1H 5ANMA 4QRPE 4ZS7L 3ULSB 3HZMB 4G6KL 4LARL 5KS9A 2OJZH 2H1PH 4ZFFB 1NKOA 1UC6A 4ZS7H 1VFMA 4PJDF 4G6KH 3ZDXE 4LARH 4WIQA 4NWTL 3SJVB 3DVFA 1M6OB 3P4LA 1NBVL 4ZTPL 3GJFA 4NWTH 4MB4A 4PRBB 2ZJSL 1XGRA 1A4KA 2NW3A 3SDDB 1NBVH 4YHML 2CSPA 2F53B 1K8DA 2XN9E 1T7YA 3C09B 1DN0A 3TFKD 2ZJSH 3RL1A 2ARJB 3VXSA 3ROLA 5AG9A 4YHMH 1X6LA 3GRWL 5CUSL 1RIHL 4BH7B 2ITDB 3FONB 1G7QA 1I8IA 1MCFA 5D7IF 3FT4B 4FTVE 2BY0A 1W8NA 4K7FB 4YNYA 4NKQB 5D1ZA 3GRWH 1E28A 5CUSH 1RIHH 2ID5A 4LFHD 4KC3B 4XH2B 1MY5A 4IRZL 4HJ0D 2ESVD 3BT2L 4CVXB 1OW0A 4E41B 3NOIA 4Q9QL 4R90L 4H0IA 3UZVB 5C0FB 2CXKA 4PRPD 4IRZH 2DM4A 3TBVB 4PJ8B 5D7SL 4WI4A 2WV3A 5BQ7B 5ACZB 4NO2B 4R90H 4B0MM 1SM3L 4XBEL 1YA5A 5GGVL 1EFXB 4M48L 2VUYA 5F7FA 1S9WB 1KTLA 1VADB 5D7SH 1VERA 2A0LD 3UTTA 5HI3D 1MPAL 3L5WB 2I60H 4P4KA 4JY4A 1CBVL 4XBEH 3ELAT 5GGVH 4KQ4L 4M48H 1L6XA 2BDNL 4QEGA 4YGAB 2G60L 5JIPA 4UAOB 5BW7A 1CGWA 1MPAH 1CBVH 1ZKAA 2J2ZA 3IDIA 4KQ4H 4HUNB 2BDNH 3DPBA 2G60H 4RA0C 5DJAA 1I7ZB 4Y4KC 2IALB 1S7QB 2F8VA 5SWQB 2EYTA 4XI5C 2OSLA 2CIIA 2W60A 2BOCB 2F74B 2C3VB 3IDNB 3BPCB 3L5HA 1MFBL 4N9GB 3U7YL 4PLKC 4EDWH 1ROWA 1TIUA 2PW1A 4X8JA 2QADC 4RAUA 3K4DA 3TZVD 3ZE0F 1FLRL 3R06A 3QDMA 4PBWD 4X80L 5JZ7D 5DMJB 1MFBH 1AO7E 1TLKA 5GGTL 2RB8A 5D96B 2VSDA 3U4AA 2M2DA 1FLRH 4OZ4B 1HQ4B 4U6XA 1V7ML 1TPXC 4NQEE 4N0CA 4X80H 1JTTA 2XZAL 2GSGA 5DHYA 1CGUA 3S8WA 5GGTH 3SCMD 1XF4B 4P48A 4U1LB 5I16A 1ZLSL 5C8JB 3BH8A 5GRYA 1I1YA 1P84J 2QHLA 1V7MH 4PRDB 1IAOA 1ACYL 1UZ8A 4G8FA 2XZAH 3RUGE 4PJ5D 4U0RB 1LE5A 4WWKB 5I30L 1LO0L 2OR9L 2BOBB 1N59A 5DWUL 1ZLSH 5CIPB 4WUUE 1D5BB 2IEPA 3BIKA 3UTOA 5JOFB 1ACYH 1U58B 1OSZA 2NNAB 4U3HA 4C54A 1LO0H 2OR9H 4L4VA 4NC0B 5DWUH 3VXMD 2X4OA 1NH6A 4OZFB 5EUKB 4AQOA 5SWZE 3VXRD 3LMJL 1LD9A 4KK5D 5D7KD 1UB5A 5DD0L 5JNYB 3KG5A 2HMID 4X83A 4GRLC 2HJFA 5E8NA 2NXZB 3FRPG 4ZFZB 1A7RL 3AXLB 1P4LA 1BZ9A 1U8LB 2OTUA 1A1OA 3LMJH 5EU3A 4FQXB 5C0DB 5DD0H 1DUZB 1LK2B 1IL1A 3GMLA 2DKSA 3HCVB 4RGOL 2JELL 4K55A 3RZCC 1MI5B 5JXEA 4LSPL 3AC0A 1A7RH 1B6UA 4GAYB 3C2SA 1QR1A 3LY6A 2QKIB 4PG2C 1IGCL 3B9VA 5ITFB 5TE4L 1T2XA 5FDWB 4UMGA 4R0LC 3HG1B 3VMPA 4KMTH 2VZOA 4RGOH 5C07E 4LCWB 3QDME 3BP7A 4LSPH 4J8RA 1JWUA 1YEDB 4HWUA 1IGCH 3I6KA 5TE4H 2JCCE 2WWMC 4XVJL 3FFCB 5I19L 3GBLA 5TDNA 3IS1X 4OFKA 4CU8A 1ORQA 2BVPA 3BRFA 5ETUA 4LBEB 1A21A 4WI2A 4XVJH 5I19H 5I1CL 3MGOA 1JPGB 2FSEB 3D48R 1FL5A 3KXFE 3W0WB 5IWLA 5B8CB 1Q94A 4F7PA 4Q9RL 4EQ3A 2NXYB 3EO9L 1FG2B 3UPAA 1J88A 4G59A 4N5EA 5CD3A 1J10A 1HZHL 2JJWA 3QAZB 1CFBA 5I1CH 4KI5E 5DFTA 1CFQB 3SY0B 4Q6IA 4AM0A 3LEXB 1GVIA 4Q9RH 1FORL 2AXFB 4LSUL 3EO9H 1JN6B 3DX8A 4HUUA 4MZ3A 1NGQL 3WN5C 5JO5A 3TNNA 4R0LA 1RJZB 4HHAB 1HZHH 3C8KA 4JLRA 3WNNA 4TULL 4O58L 3KLSA 2ZCKL 3AS1A 1FORH 4LSUH 3QCTL 3VXSD 5E9DA 4XXCC 3PV6A 1LK3L 1JMZA 2XPGB 4TULH 1FVEB 2V5YA 5I1DA 3RWIA 4O58H 2ZCKH 3TO4A 1ACZA 1LK3H 4LOUC 4YFLI 5MEPA 4M6NL 1A9EB 4K7PL 5KBNC 5I73B 1BP3B 1RV6X 3PP3H 2AEIT 2UUDH 3MLYL 3O2WL 1KELL 3U0WL 3G9VA 1B0WA 1G1YA 5IQ7L 3L3GB 4M6NH 4APQB 2X4QA 5EU5B 3FB6A 2DTSA 1UXSB 2Z31B 4K7PH 3Q5YA 1G6RB 3ZKNC 1KB9J 2BK8A 4IOFC 3O2WH 4OT1L 3S35L 4CDHA 1KELH 5D5MA 5FYKD 4ENED 1P69B 3U0WH 4LFHG 5DHXB 5IQ7H 1S3KL 1Q38A 1PVHA 1ZV5A 3GZKA 2NY0D 3I75B 4MCZA 4OT1H 1N5YL 4G9FA 3D0LB 4X6CE 1S3KH 3B5HA 5IW1A 3ARTA 1SQ2N 2Z8RA 2ZSVA 4L3EB 2NX5A 3MRDB 4O2EA 4YK4B 4AIOA 4V3DB 2QSVA 3BPLC 5ICZA 2BNRB 2VZUA 5JW4Q 1IQDA 4G8EA 3PWNB 3G6DL 3L95B 3QEQE 3AROA 2AQ2A 4TUJA 1VPOL 3PWUB 4RA3A 1U8MB 4JM4L 1ES0B 3G6DH 4WENB 3VH8B 4MQTB 5E9DE 1OAQL 2WINA 5T1MB 1VPOH 3HE6A 3DECA 1R3IH 3NZHL 4JM4H 4LU5L 1U8OA 5F93C 5BS0A 1FGNL 4P57A 3QEUA 3CZFA 3MTRA 1OAQH 4KV5F 5HHOA 1J7VR 4MXQC 4HV8A 3NZHH 4LU5H 2R1YA 2AJVL 1FGNH 3VG9C 5DA0B 2BSRA 5F1IB 3V6BR 3AGVA 3E6HB 3OX8A 43CAA 3EZ8A 2UZYB 5DJDA 3BI9X 3BP5A 3MREB 4A2LA 3DV6B 4X9HA 2FECL 3RWFB 4G6FB 4LPXA 4FZEL 2AJVH 2CRIA 2CKBL 4XXDA 1GOHA 4K3HA 2E8ZA 2YS4A 5D5ME 5DDHB 1QPPA 3HI6H 3CFJA 2VAAA 4YBQC 5F1KC 4JFFD 1XGPB 1P5VA 5L8JB 4FZEH 4XI5D 2A74B 4FXGA 2CKBH 5HHQA 1JWSA 1ED3A 1I85A 2VOTA 4G9FE 1IC7L 3RP1A 3T77A 3PG2A 4QHKI 2IBGA 4Y5XB 4PLKD 5CBEA 4XPGL 2QADD 4HJGA 3PHOB 2XIDA 4L4VD 5F3HB 1Y0LB 3HNSL 3Q6GL 1H0DB 1WBZB 4PGEA 5C09A 3CFBA 2AK4E 1UCTA 2Q6WB 2CDEB 3T0EA 2P5EA 1QLFA 2CDFA 3HNSH 3Q6GH 2KQNA 1MCDA 4WI6A 5IB2A 4UB0L 1G7IB 4XNZC 2X4NA 1Z5LB 3WJLC 1LWRA 4P3DA 4GXUM 1JI2A 3Q5OA 5CEYA 4F7TA 3QZWG 3L3IA 2IMMA 2CQVA 4JO4L 3MRPA 5TF1L 1ZVYA 2AERT 1MCIA 2ICEB 2H3NB 4I4WA 1IKNC 4OBRA 1OT2A 3IVKA 5E56A 5HHOE 3JWOC 4QGTA 3HZVB 3LD8B 1SBBA 4JO4H 1B0GA 1DQQB 4N0FA 1GC1L 5DJZB 1QNZL 4EEEA 2B2XL 2GJJA 2FR4B 5TF1H 3VXUB 4NNYA 4KDWA 3OJDB 3QJFB 5FM5O 3ZO0A 5B4MC 1Q9OA 1GC1H 1QNZH 2B2XH 2NY6B 1F90L 4LRNL 1ZHNB 1Q1JL 3FOMA 5C0EB 2ZNXA 3C5SA 5EIVA 4GRLD 3D3VE 4RGMB 2GCYB 2C1OA 3MRIA 2E27L 1VACB 4JJHA 1FC1A 2NCMA 1HCFX 4LRNH 1F90H 5GRWA 4DAGL 5C0NC 1Q1JH 4D9QD 4N5ED 4OCYL 1U3HB 2KQMA 4KJQD 2V5SA 4Z0XB 2ADJB 5EBWB 1KV3A 3RZCD 1Z0NA 1T21A 3WHE1 2E27H 1U8JB 3FTGB 5F1NB 4DAGH 4J2XA 4PJBB 5EU4B 1TCRB 4OCYH 1KPRB 4PRID 5SX4H 4OBSA 5HTSA 1MWAB 4ZQKB 2BHZA 4AH2A 3NPZB 3NAAL 2WWMD 2FHCA 3O9WB 5EBMA 3EJJX 1U92A 4YXKL 4BM7A 4I18A 3SKNB 2A1WL 1H3TA 5C3TA 2J8UB 1SJVA 3NAAH 1RK1B 5IOPB 5IEHA 2OQJA 5HYSB 1TJIL 2V2WA 3Q3GA 4U1KB 4YXKH 1T5XA 4LKCA 3IDYC 2A1WH 4UT9L 1AP2B 4I48A 3GFUA 4WHDA 1Y18B 5D7LD 3T65B 4EZMA 1UCBL 2APBA 5ESVB 1DFBL 5DRXB 3VU2A 1TJIH 4U6HA 3T2NL 2W38A 4OM0H 3BWUC 4UT9H 4CDGC 5ELIA 4D8PB 1LP9B 2E7CA 3EYOA 4HPOL 3KPNA 5T1DL 3WBDA 5ECJE 1DFBH 1F4WL 4P46C 3T2NH 3GMPB 3EYSL 1JYVA 3U2SB 3KR3L 4OLYL 2FB4L 1I3RB 4WU7B 4C4KT 5I1AA 1WIOA 4HPOH 2NY4C 5T1DH 1ULVA 4Z76A 1MCWW 4FXKB 1F4WH 3EYSH 2FIRT 2XA8L 4JQVC 5IMOB 5E8EA 4NQXA 3KR3H 4OLYH 5F96L 1I8MB 2FB4H 3NIFE 1UJ3B 5DMKB 2B4CC 2PR4L 1HWHB 5GXBB 4H1LA 1NGXA 1YNLL 3QWOB 4KGLA 1ZAGA 4LVNC 3QUKA 1NBQA 1M4KA 1MLCB 3A6CL 4NQDB 1XR9B 2XA8H 3K80A 3CUPA 1NEZB 5F96H 2VISA 4W6YB 2PR4H 3LKQA 3P73A 1YNLH 2FEEL 3QHFL 3L7FB 3ZKND 3A6CH 5HYQB 4HEME 4NYLB 5TGBA 2XFXA 5HYJE 4TTGA 4PRAA 3SBWC 4PBVC 3HE6D 3WEXB 3FT2B 3HLAB 3QHFH 4GRWH 4OCLC 4I77L 5FOJA 4M61A 2APFA 1H8OA 3BN3B 5GGQL 4Z8FL 4K3EL 2LTQC 3ARZA 4I77H 1J05B 1I7RB 4P2QE 4EI5A 5IB3A 1A4JA 5C0AB 5GGQH 3PP4L 5DC9B 1EBAA 4K3EH 5C9JB 4RFNB 9CGTA 1S7RB 3E2HA 2BSSB 4WI8A 2P49B 5D1QC 3PP4H 4KKBC 3D25B 3ARPA 2X70B 4GBXA 4ZXBC 3SBWA 1QSEB 4RZCB 4L1HA 4NCC2 1T83A 3L3DA 1G0XA 4YZFE 1AXSA 4RFEB 4JGMA 3V5HB 1JPSL 1F2XK 1V3JA 4FQIL 4K7PY 3S35X 3LQZA 4KUCF 4P5TB 4MD4A 3IS0X 4Q6YA 3UDWA 4MXQD 1D6EA 5DQ9A 4UV4H 2ZPKL 1NFIB 1EH9A 4PRHA 1FC2D 3EFFA 5C09D 1I9JL 3D69A 1JPSH 2DD8L 3OB0H 4DKAA 4FQIH 2BC4B 4QRTB 2P5ED 1FFPA 2VLRD 3KPSB 4G7YH 5F6IB 1YEGL 4OCRL 4GG8A 1YEKL 2ZPKH 1B0RB 1DVFB 4J3XA 4WW2B 1I9JH 2DD8H 3TPUA 1IT9L 5D2LF 3S9DB 3MGTA 5B3JE 5IHZA 4FFYL 1XR8B 4NWUL 5D8JL 1BVLB 1IZKA 4F2MA 1YEGH 3QDJE 4M6MH 1DEEA 1IBGL 1YEKH 4OCRH 1MREL 2ADGA 4HIJA 4LIQL 2DJ4A 1QLEL 1IT9H 2GFBA 5DS8B 2WBJC 5J0BA 2QV2A 3PABB 2IAMC 4NWUH 5D8JH 1TVBB 4LLWA 1QHOA 1FIEA 1ONQA 2E9JA 1IBGH 2X4TA 1MREH 4X6DA 5DLML 5A2LH 2FO4A 1NC4D 3K81A 3OHXB 1UZ6E 4LIQH 1QLEH 1FCGA 4Y2DC 5GSVA 2ATKB 1NBYB 1IAMA 3K74B 4P9HL 4HK3J 1K5NB 3VWJB 4P23A 2J7LA 5DLMH 3ZDZE 4PJGA 2JJSC 3JWNC 1P6AB 3GMOB 4K2UL 4X6FA 3C5ZA 4NRYA 5CP3H 1L9NA 1U2HA 4P9HH 4GW1A 1YY8B 3BOVA 5EOCL 3BXNA 3TVMB 2OXGA 5C3LD 4YIQA 3AREA 4K2UH 5LGKA 1H3VA 2P7TB 5EOCH 3LRSB 4PS4L 3VJ6A 1FP5A 4LHQB 2NY7L 5EN2B 5GIRA 3R1GL 4M7JL 5T3ZD 2VLJA 2IAMA 1I4FA 3CSGA 4Z77A 4O2CB 4PS4H 1CXKA 5E94B 2P1YA 4N90D 4XNMB 2NY7H 3R1GH 4M7JH 1TZGL 2P44B 3CVHB 5FA3A 2DQFA 5BZDA 1A02N 3U4BL 1VKXB 2PYEA 3K1KC 5B4MD 1B90A 2XTJE 4KDVA 3CDFA 3C60A 3BW9A 2IPTL 3ZKMC 1TZGH 4ORGB 5M7QA 1KPUA 4NO3A 4HKZB 3U4BH 4DVBB 1QSZA 5IKCB 1X5AA 4DGIL 2YRZA 3UTSA 3NBNA 5C0ND 4B53A 4PFEA 2IPTH 1R3HA 2ERJB 1NANI 4JFZL 3UC0L 4RBPH 1H3GA 4U7SA 2H9GA 2HJLA 4JFOB 4L8DA 3GSXB 4U33A 4DGIH 5ISZD 1FNAA 1HOCA 2OL3A 4JFZH 1IGMH 3UC0H 1C5DB 4L4TB 5FXCH 4EN3A 5HDBF 1FSKB 2ICWB 1U95A 3BZEA 3QFDA 1T1XB 3U4EA 1A7OL 3IJHA 1G9NC 5EC1A 1AKJB 2P24B 4YWGL 4MDJA 4PJGE 3ERYA 1VDGA 4C58B 3MO1A 4QO1A 4UU9B 4EVNB 3LKNB 3MFFB 2VITB 3H9SE 4MJ5B 5DFVC 1U93A 4YWGH 3TCLA 4G6JL 4LCUA 2ADIA 2ZKHH 4S2SB 2VYRE 1AHWC 4UNVA 3DBXB 3UBXI 3V5DA 2XT1B 1G7PB 2EO1A 1VFAB 4KRNA 2FRGP 4FMFA 4MQXC 4GS7B 4G6JH 3RY5A 4HK0A 4DOHB 1HSBB 5IBUB 3ARFC 4CNIA 3ARBB 2QQKL 4R2GB 3VFTA 3FCTA 3F8UB 4WTZG 5IJVB 5HHME 2F53A 2NY4D 5DRZB 4YO0A 5A43C 3G6JB 1WZ1L 4MVBC 5JOPE 2QQKH 4LVEA 5I8EB 1TQCC 2C5DC 3CAFA 2C26A 3GI8L 3H42H 1MAML 1AQDA 2OMNA 3ALWA 1FNGA 4HC1A 3UTSE 1WZ1H 4EI5D 3FONA 1RUQL 1ZHBB 4XX1G 4Z7QF 1JK8A 4Y4HC 5DVMA 1UKTA 2A6JA 3OGCB 1RHFA 5DMGC 3FT4A 2LABA 4X9BA 2KL6A 3GI8H 4K7FA 1MAMH 5FGCE 3RGVB 4JFHD 2WSKA 1CG9B 1RUQH 1HI6A 3T4AA 43C9B 1IEBB 2YA2A 4L9DA 5IGXL 3MJ8A 3U0TB 4GBXD 3K0WA 5C71A 2Y1VA 4P2RB 3ZDXF 4MWFB 4W4OA 3MV01 5J13C 5H8DA 3FO2B 2NQCA 5IGXH 1ZSDB 3F5WA 3EJZC 4YPGB 1JGUH 2VUOA 3I6GB 3GO1L 3V6FB 5FYJE 4U05A 1WIPA 4Z7WF 1FL6B 2E6PA 4KK9C 4QGYA 4PRHD 2W65A 1EFXA 5K9QG 5ILTL 2W07A 1H9VA 3GO1H 3SJVE 3TWCL 3ME0A 3CFEB 5ILTH 2FYYA 5FYKL 4JCLA 3EZJB 4I9WD 5F8QC 5D1QD 3TV3L 1UENA 3GSQB 4MD0B 4D9LL 4KKBD 4S1SL 1F6LL 3TWCH 4PTUB 3EYUL 3FQXB 4ZXBD 3IF1A 1R5WB 5FYKH 1GXEA 2F53E 3TV3H 4FRWA 4WI9A 1J8HA 4S1SH 2ZNWA 5C0BB 1BBDL 3EYUH 3GJFK 4WFGE 4GKSA 5CSGA 1D3CA 1S9XB 3QPXL 4F7CA 5C6WH 1BBDH 5GS2D 3STLB 2ARJQ 1GZPB 5EBLA 5GS1C 4M7ZB 3NGBB 3QPXH 3O4LB 4KJYB 1O7SA 4K8RD 5JUEL 2AK1L 5ICXA 4ODUA 4XWOC 3PWPB 3PHQA 1YYLL 5BZWA 3GSNA 1PJ9A 3VD7A 1T2QL 2WBJD 1YUHB 2VLJD 2DIBA 5BXFB 5JUEH 2IAMD 2AK1H 4NQCA 1WBXA 3H9ZA 2BXYA 1YYLH 3OGOE 2UWEB 3BP6A 2FL5B 2O5YL 3IDMA 1T2QH 4OCWH 5ID1B 4Y2DD 1F3DJ 4LSQH 1LEIB 1B4RA 4WV1C 3WE6B 5B38B 2O5YH 3UYRL 1MHCA 5EU6A 1HHIB 4KUCD 4JVUA 2IH1B 2NW2B 4Z7WA 3V2AR 4U1IB 5D1XA 1NGZB 1WAAE 3BEWB 4WI5A 3TESA 3UYRH 4EIZC 2XG4A 1P7QA 4NT6B 2DLFL 1JUFB 2WWKT 5BVJA 1S78C 4NSKB 4NO0B 1HYRC 4KRMB 5H37G 1BECA 3GI9L 2DLFH 1DBAL 5JORA 1AD9B 2QQQA 4EN3D 4XZUB 1MI5A 5D4QA 3KPPB 4CN1A 5E08L 5J12C 4O9HL 5IBLC 4YDVB 4N8VB 1M05A 3GIVA 3GMNA 2I27N 5KSVA 3GI9H 1DBAH 1MCCA 2VN4A 5E08H 3KS0J 5F7UA 5H94A 1E27A 3ZYZA 3ZHDA 3QDGB 3QHTC 2BNQA 3G9AB 1I8KB 2NTFA 3RUGF 5C0JB 3V0AC 1BJMA 1T03L 3O45B 4C57C 2EYSA 3FRUB 5HVHC 3EYVB 2Y72A 3TNMB 1JPGA 2HT4D 4WO4A 4M1DH 4UQ2A 4EIGB 2NPLX 1T03H 4O2FB 4H1LG 1JZ7A 3P0YL 2Y5TA 5DURD 4ZO6A 5E03A 4MA7L 3ARQA 1A8JH 3CDGA 5FIEA 2DI9A 4U3CA 4J23A 1A7BA 3VXQB 2VZVA 2EDJA 3F7RA 2EDOA 1CIDA 1RVFL 3ARWA 3FB5B 1U6AL 3OMZA 4HUWB 4MA7H 1U8KA 4MQ7B 5FV2A 3TIEB 4WWID 3VCLB 4W81A 3C9NB 5DFVD 2NMSA 1F2QA 1RK0A 3F7VA 1KB5A 1RVFH 3AS0A 1U6AH 2MWCA 1VESA 3CX5K 5C6PB 2Q8AL 1KJ3L 3MUHL 4O51B 4Z5RB 3V95A 2X4PA 2HRLA 4BSJA 3QQ4B 2F54A 4BH8B 4KTEL 4MQXD 5C86A 4JHWL 4RAVB 5SV3A 2Q8AH 1KJ3H 3DVIA 1MI5E 4Y1AB 5D7JB 3ARFD 4KTEH 8FABB 3L3GA 1RUPL 4JHWH 3G08B 3HG1E 1D7FA 4YXLL 3DROB 4LGPB 1K4DB 3WS3B 2EC9U 4LCWE 1FHGA 3LN4B 3K3QA 4H88L 4HIEA 1RUPH 4YDLC 3FFCE 3P9MB 4QRRA 3QWQB 2D7TL 4YXLH 5DO2D 5DUML 1A0QL 1RHHA 1NGYB 3T3ME 1U8QA 4ZUWA 4H88H 2FBOJ 1T1ZA 4KI5F 5MERB 5IB4A 4EXPX 1X5GA 3ORJA 2FIKB 5J9PA 2ZP0T 3PL6B 4Y4HD 2D7TH 1PZ5A 3BQUA 1A0QH 3W0WE 2X7LB 5DMGD 4CVUA 2QSTA 4C56B 3NTCL 2HVKB 5FM8A 4R4BA 2I26N 4BSVA 4JFDA 4MCYB