3QUXA

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
273
structure length
266
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 73
structure length 266
sequence length 273
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3quxA01
2X4PA 4P23B 2ADGB 2VZ1A 4PG2C 3CCHB 1LO0L 2XWJA 1J5OH 3B3IA 2D03H 3RA7L 1CD1A 2HN7A 2OP4H 1YMMA 1T0NA 4MNQA 1ZLWH 1NCDH 2MNUA 2VL4A 1SVZA 2PXYA 1MQKL 1VEMA 3O3UN 2VWEC 4YPGB 3BPNC 2Q7YA 2MCPL 1IAIM 5BRZD 2JELH 4XPBH 4AENB 2BOBA 4NFCA 2CLRB 3LZFL 1WT5C 5F6HJ 1F2QA 3BPLB 1UCBH 3LMJH 4LKCA 1E6OL 3NVQA 1NC2B 5KVGH 5D6DA 5GRVL 4U1NA 3S37X 4XX1G 4GKSA 1XR8A 5JHDD 4ZS7H 4AQ1B 1RZ7L 1KT2B 1A5FL 4JFHE 3FQWB 4U1GC 2EIEA 3QDMD 3GO1L 3FRUA 4JHAL 1WEJH 4JR9L 1M71B 5EBMB 3TJEH 3VGAC 5CGTA 1EO8L 5C9JB 5E7BA 1AFVH 5L8JB 1IC7L 1F6LL 3MRPA 2F53D 3PWNB 3H3PL 4OM1L 3CFKA 2B1HL 5BS0E 3N85L 1T4KB 5EOQH 2OJEB 2FNBA 4UDTB 2P48B 4G42B 1YN7A 3C9NB 3KLDA 3R1GL 3ULUD 4QTHB 3RVTD 1D5BA 4FXKA 2DLFH 4OKVB 1O0VA 2VXQH 3RX8A 5DSCB 4CDHA 1WBZB 1YEIL 4WY7L 4ZPVA 3DMMD 1UGNA 3RVUC 5DQ9B 1RJLB 4RAVB 2HT2C 4WTWA 2NY4D 5FKPA 5TDOB 1TJGH 3QHTC 1PVHA 4KJQD 4R2GB 5CKGA 1N5AB 4IHOA 2K7QA 3TFKD 4XZUB 1PY9A 5IBUG 2PTTA 5J6GA 5FO7B 2VKXA 3HC0A 1Z9LA 3HCVB 3HS0A 1MREH 3GMRA 4Y2DA 4AMKL 1NGXA 4NO0D 1D5ZB 2WZPD 3FJTA 4WO4A 3VXPB 25C8L 3WIIL 5EH1A 5J13B 4L8DB 3P30L 2V2XA 1IC4L 5C0ND 3ARVA 5AD0B 1RY7B 2DTML 4ONGL 1R24A 2FX7L 1U3HB 1I9IL 4OD1H 5GGTH 2FECI 5IHLB 1ORSB 5KVDL 1HKLH 3CMOH 4GW1B 4JFEB 3L1OH 2HJKA 3UAJC 4QRUB 3LV3B 2XFXA 5FUCE 4CMHC 3J8F7 2WV3A 5C0AD 3D25A 4PG9A 2GJ6B 4JFOA 4P2RB 2UYLA 1JGEA 1YEJH 2JIXA 3E3QA 2NY3C 4NRXA 3MLZH 4M1CD 4NO3A 3V7MA 4XVTH 1A9EB 5F93C 3ZDXF 5L7XH 1II4E 1WJ3A 1OD9A 3CSBA 4G6KL 5FGCE 1ZLSL 3QUMA 4NUJB 4D0CA 4LQFH 5TQ0H 4P46A 2XTJC 4XI5D 2R29H 1SEQL 3EGSB 1ED3A 3QH3A 4LQ1A 5JLZA 3QHFH 2HVJB 5IT2H 4S1RL 3F65A 3UYOD 1YC8A 3ROOA 4L3EB 2OS7A 4OD3H 2CGRL 5LCVH 3V6OE 1FSKC 4YAQA 5EU6B 1TJIH 1B3JA 1NBVL 1IAKA 3CFBB 3F7VB 1C08B 4D9QD 5ADOH 4IJ3B 2GHWB 1G7MA 2IWGA 1YYML 4Z5RB 2Z31C 1ORQA 3ILQC 4UT9L 1OD7A 5SWSE 4OTXL 1BEYL 2E8YA 2BSED 1QBLL 3QISA 1YQVH 2ESVE 3QI9A 4ODSL 3L3HA 1MJ7L 2DQDL 4I13B 5FYLE 4L5FH 1N0LA 4IRSB 4QXTB 1UB5B 1H5BC 2X44D 1RJYB 1ZLVH 3X13A 5CP3A 3FONB 4N0CC 1Q9OA 4JRWA 4RGMB 1T7YA 3KJ6H 5I75C 5DFVD 1RK1B 4HK3J 4PLJD 1NJ9A 1L7TL 3T3PF 5CIPH 1NCBL 2R9HC 4RGOL 1N0XL 3WN5C 5DRNA 2O5YL 4ZXBD 2EE2A 1P7KA 2HAZA 3HRPA 1WCQA 3QDAA 1Q1JH 1GZPA 4U0QB 3O8XC 3SGEH 2X1QA 5DRXA 4G8GD 1TCRA 3MMEB 2P5EE 2EZ0C 5FM4A 5I1HL 5CEZH 2BSTB 4HX1B 4X4MA 4N5ED 2YXFA 5CD3A 2BHYA 5KVEH 4OGZA 4BZ2H 3E0GA 4QRRE 3AY4A 1YPZA 5D1XB 4C55A 1R3HB 1T83C 2A0LC 4R0LB 4E41B 5KSBE 1X6LA 1VGEL 5F8RC 4GW4A 4MNHA 5HGHA 4ACPA 4LPVA 1QFUH 3DX8B 1S7XB 1G6VK 2CUHA 5DMGD 1D3CA 1S8DB 5K59F 4YHPA 5F89A 4HJJH 4OLXH 4ZS6D 2R69L 5HDQH 4V1DD 1RV6X 3TGXA 2NXZC 4OZHE 2VIRB 3GMNB 4PRAB 1AGCA 4HWBH 3FT4B 2A6DB 4N8PA 1IAMA 5SX5H 3OMZA 4P2QD 1HSBB 1ND0A 1ZA6A 2VISA 4HCRA 2IMNA 5AG8A 1UCBL 3DNKA 4QRQB 5ISZB 3GMLB 4MQXC 3W2DL 2OJZH 2ZG3A 2J8UB 4U1SB 3LEVH 5SX5K 2FHBA 15C8H 5J56B 3VD7A 6CGTA 2QADB 4X7TB 4Z7WB 3DWTA 4K9EC 4P4RB 4PLKC 4Y7MA 1GXEA 5D5MB 5C0BA 3BYYA 5I76A 4KY1H 4K2UL 2D31B 5F1NA 2X9XA 4HWZB 3DVGB 2DMCA 3O2VL 4JQIL 2JCCE 3KS0H 1JZ5A 2QSTA 5GGRY 5DZOA 1NANH 1KJMA 1MHPL 4OFKA 2B8OT 4LNRB 3VXMD 1MRDH 3VXUA 1AQDA 3V6ZA 1LEIB 1PKOA 4NN6C 3Q1SH 4X9HA 3D39B 1M4KA 1IAOB 4YWGH 1F58H 3TO4B 2DLFL 2D7QA 3OR6B 3KPRE 1WC7A 5E1HB 3VGDA 4RFOH 1EEZB 4TTGA 2R2EA 4GKNB 2ICEA 1A14H 1HZHH 2NTSP 3GSXB 2GITB 3D3VB 2FSEB 4KDVA 1KBGL 2MQ3A 2J88L 1N59B 1DN0B 3FB7B 5GRJH 2VQTA 2B5IB 4PJAA 3O6FC 4Z7VB 5CJQH 1FO0L 3BUYA 3BP5A 3R0MA 1W0WB 3IFNL 2ZSVB 3SKNA 2VLRA 5F9WB 3FQUB 1FZMA 2LU7A 4KDTA 3MCKB 4GRWE 2YPVL 4RMVA 4K7PX 2O61A 2E7HA 2HVKA 2GYSA 5HYJA 4JN1H 3VWJA 2HT3D 2E3VA 3NGBC 4LVNB 4F58L 5DR5H 5GGTL 3RAJH 1FIEA 4U1IA 1HKLL 4G8FB 2AXGB 4LARL 4WENB 3VU2A 3QUYD 5EUOE 4K3JH 5FO9B 1K8DA 2NNAA 1T1XB 2AVGA 2X4NB 4MAYC 5I8KH 2WP3T 2WP3O 3L3JA 1ZHBA 4NWTL 4RBPH 3O3BA 4G6AD 5ICYB 4KVNL 1VB9A 1CU4H 1U8NA 2I26N 1DBAH 4MS8D 5L7XL 3QEQB 2BDNL 2Q8AH 5F6IB 2EEDA 3K4AA 3BKMH 4EN3C 4WHCA 3VFTB 4NQCB 3K4ZA 4Z7WF 1I1AB 1S9VB 4BSWB 2G60L 5SWZE 2OL3L 3R4DA 3RP1A 3KPOA 4D0DA 5IQ9B 3CXDL 5D5MF 5IHZB 1I9RH 3MRRB 4FTVD 1B88A 1RZGB 3RU8H 5SX4I 3VD5A 1C5CL 1YEDB 2DMKA 3KDMA 5DD3H 5ETUA 4HJ0C 3MUGB 2YRZA 4KQ4L 5HHMD 4FABH 2PNDA 1VESA 4JDZB 5ADOL 1K3ZA 3C60B 3CFDB 5EBLA 5I1AB 3SDAC 1A1MA 4I0CC 2BSSA 5ID1A 2W91A 3EO9H 3BDXA 5D1ZA 3RKPA 5LWYH 2ARWA 3I50H 4RRPG 3MYJA 5I73B 1SY6A 1QSVA 3HPLB 3HI6H 4LHUA 3NA9H 4NRZA 2NY0D 4JQVA 2OXHA 3BIKA 1S7WB 3UO1L 4DW2L 5BRZE 3ME0A 3QJFB 4L1HA 3KJ6L 2P43B 4IS6B 3M1BB 5FK9A 5BQ7A 3U9PH 1RIUH 1AJ7L 4MJIB 1S9WA 5C07D 2JK5B 3NFPA 3D85B 4LCYA 4UINH 4HLZH 4ZSOA 3ABZA 2EIDA 3FOLB 1INEH 5J6HA 1MY7A 5JHDE 1KPVB 4F57H 4G8IB 1ZHNA 3QDME 4NBXB 4FFYH 4JPVH 4RIRB 4YPJA 4KK6C 2F5AL 2JB6B 5CSZA 1CVSC 3GMOB 4JB9L 4H88L 3NAAH 4LSUH 3TBSB 1IGTB 2Y72A 2Q86B 2F53E 3V6BR 1TNNA 2EKJA 3GKZA 4OF3A 3V5KB 5IFAL 4TUKL 3TBYA 3SDXA 2J1KA 4HKBB 3TVMD 3HE6A 5T3ZD 5HVGB 5EZJA 1KEML 3G6DL 4H25A 2YKLH 3BGMB 3F7RA 3BQUB 2MFNA 4PJHA 1JNHA 5JW4M 3ULUE 3FT3B 5HYQA 3AFLA 4OZFG 4HT1H 4P49A 5IMLA 4LCUB 3RWJB 1MCOH 1N5YH 1ZHLB 1G1YA 4KAQH 1LEGA 4EDXB 3QIWC 4XXDA 4EUPG 2NYYC 4YEEA 4FQQA 4F2MA 3UTTD 3IVKA 1G1CA 5A40E 1CK0H 2OJZL 1J7VR 1S5HA 3HFMH 5MEPA 4EBQH 1Q9KA 1MIML 1G0DA 1XGRB 1FQ9C 4WDIB 4WHTA 4YHZL 1BREA 4HUMB 3X14A 3VMNA 4KY1L 5CEXA 3HZYA 1BJ1J 4UNTA 3RUGE 2VE6B 4Q0XH 3HLAB 3QHZH 4NNYA 4IIQC 5H94B 4BFEA 1UB6B 5ENWA 1I9EA 2HLFC 3CNKA 3NMEA 4NQED 1NL0H 4GXUN 1GAFH 1MRDL 3ZE2E 1U8MA 5C0AE 2QQQA 3DI3B 3Q1SL 3VXOB 1FL6B 1LK3L 1W8OA 1W72A 3L3KA 1X4YA 2A77H 4RGNC 1FV1A 1A6TB 4X8JA 4YGVB 3ESUF 4A6YB 3OKKB 5DJZA 5HDOA 1DBML 1OAXH 2H32B 1CGUA 4X9GA 5HPMB 1A14L 5D7LB 5GGSA 3TO2A 4WU5B 1L6ZA 5EU5B 5L2KA 2CDFB 4X7CC 4LLUA 2R0LL 4RZCB 1D9KB 4KRPD 4JLRB 5FYLL 3BP6B 4ODVL 1CR9L 1JGLH 2QBWA 5DD6B 4FQJL 3QUMH 3U7YL 1GGCL 4FMFA 4U1HA 4Y4HB 1RZJL 5I6XB 3VFPA 3NPZB 2AAVA 1OCWL 4KKLD 1I4FA 5EUKB 5C09A 4JFXA 2CLVB 2W9EL 2UVEA 3PGCA 3MRFA 4JHWL 3Q0HA 1QFWH 3KPSB 4D9QE 1IT9H 4M43H 3PP4L 1QLEL 4LU5H 5MENA 2MKWA 4K3DH 5IG7A 1NBYB 4OFPA 3IETA 4HV8B 3PL6A 1MUJA 4G8EB 3KWWA 1DSFH 4ZAKD 5L8LB 2DYPB 3NZ8A 4PYGA 2FR4B 3BEVA 4WFED 2W65A 3QXDA 4H1LG 4IMKC 5DVNA 3F7QA 5DD5H 4LLMB 5DDHB 4LGRB 5E08L 5DQJB 3HMXL 1RIVH 1QPPA 2C26A 1CDHA 3IDYC 3HI1B 5D9SB 3FFDA 4FQHA 5E2UL 4TRPH 2CDEA 4FZEH 3MBEC 4NZJA 5LAXB 4M6OH 5E1AA 4G8GE 3MRLB 2DI8A 1TZGH 4KTDH 5HI3D 1SMAA 2EH7L 5JPMA 3RU8L 4TUJA 4RFNB 1AGDB 2IG2H 3LQMA 5EZOH 3IF1A 2GTWA 3MRNB 1QA9A 5DD3L 3HNSH 1OM3H 4YZFE 1ERNA 4ERSL 3FN9A 1YNLL 4HKJB 5E94A 5I71C 5BVJA 4O2CA 1ZVYA 3E8UH 4GBXB 3WBDA 4IMLB 3T65B 1H3PH 3UROR 4F7EB 2A74B 2PYFB 1FNEB 3TP4A 5I30L 1YA5A 4Y8DC 3SDCD 2E9WA 3K2UL 5FGBA 2C4XA 1MCNA 2YUXA 5K9KA 1LGVA 4V1DE 3NA9L 3HMWH 4PJ7E 3ULVF 3TCLA 2HLAA 2EXYD 3UTSA 1WTLA 3ARDD 4NUGL 2YD5A 3L3IB 4MA1B 5D1QB 4P2QE 1DQJB 1GGBH 3E2HB 5FKAB 3LH2L 2VLKA 3RGVB 1I8LC 3TZVA 1MWAA 2XACC 3SE4C 5K9QI 3QG7L 4MQSB 2NY6B 4YBQC 2V17H 3I6KA 3C6LD 4APQD 4TSCL 3BKYH 3MLRH 1UH2A 4XBGA 5J1AB 2FJHB 3U2SB 2UWEA 5TDNB 4FFZL 1GGIH 2I07B 4JZJC 4BQCA 1IAII 1XH3B 2ED7A 3DHJA 3TA3D 1M1SA 3G6AA 2Q87A 4Y16A 3PV7A 3JTTB 5DTFA 4ZTOH 4XBPA 2NY2D 3WHXB 1I75A 1HKFA 4WNQA 5KTEH 3O3DA 5IF0A 3MJ7B 2Z93B 3QDGD 5IR1B 5J11B 3NAAL 4LSUL 3SBWA 1VGKB 5K9JH 3QA3A 3QNXA 4Z7OF 3QQ4B 2E6QA 3M07A 1KPUA 1JFQH 4ZUUA 3DYMA 4O2FA 4MVBD 4HK0B 5AUMB 3HE7B 3DARA 4JZOA 1RIHL 3VXME 3ARED 3PXJA 1KEGL 3A6CL 3ZLQC 3NBNA 2A9NH 3AS1A 1FL5B 3MJ8A 1NC4A 1A1OA 3MOBL 4XVJH 4JPKL 3B6SA 1YY8A 5I1JH 4HT1L 5GRWA 2X2YA 5ESVB 3PV6A 3EFDH 3MCLL 1MCOL 5DYOB 4JQXC 4QXWA 2AKRB 1DBJL 4KAQL 2I5YL 1Q94B 3KPMB 1QEWA 3OGCA 4OZIA 4QHMB 2GSGB 1MRFH 1KJ2B 1AO7B 1KLUA 4IDJL 3DVNB 1QRKA 1SJXA 4K94H 1S3KL 4RMSA 2BC4B 1PJ9A 4HS6A 1YECH 4PY8J 4YHIB 5E9DD 2ZNXA 3GK8L 3ULSA 4AIZB 5I8OH 1BM3H 2AXFB 4OD2B 3VFMB 4CVXA 1OY3B 3CFIC 3TBVA 5T1LB 1JI1A 1IFHH 3HKFA 5L88H 3A0OA 2WQRA 5DJ8B 1D5XB 3RNQB 3SDXE 2ICWI 1M05B 4FQLL 3CPLB 2BNUA 3HUJA 1H15B 4Q0XL 4U05A 3C5ZC 1S9YB 3CH8A 4U2ZA 3GSUA 4P5TA 2NW2A 2BZDA 4D0BA 1IKNC 1GOFA 2N7BA 1A6AA 1NEZB 4XTRC 1NEUA 5ANMA 1GAFL 1OGAB 3B9VA 3BPOB 4MA3A 1EX0A 1Q72H 4U31A 3MRHB 5GGQH 4KV5F 3DYPA 2ITDB 3S7GA 1BQHA 1JPTL 1Q9WB 5TFSL 3MUJA 4MD0A 3C6SA 2BJML 1U8HA 4ELMF 2XKUA 1OAXL 1K4CA 4K7FB 5E2WH 4IOIB 3U9UB 3WSQH 1JNLL 3MQIA 1IC5H 4OGYH 1EHAA 3B8SA 1EFXB 3GMPA 1J05A 2QR0B 3T4AB 3V5HA 2VDKH 2YWYA 4X6BB 4FTVE 3SDDC 5CWSA 3WIFB 4PJIA 4U1MB 4PJCA 3R8QA 43CAB 2LQRA 1VCAA 1AR2A 1K4DB 4XWGL 3P2TA 1CDUA 5HHME 2C1PB 1XGQB 1U8KA 2YPLA 2AGJH 1CXEA 1PQZA 1CCZA 3G5XA 1EEUA 5FOJA 3ERYA 4Z7NF 1EMTL 4B50A 1H0DA 4K3DL 1U91B 1XGYL 4UOW1 2YSSA 4KKCD 4X5WA 2QL1A 3O2DL 3HG1D 1JPGB 3T77A 3MRBB 1DSFL 5FIEA 2OTUA 5LGJB 4NN7C 1FORL 3ARPA 2VH5H 3KG5A 4GG6F 5TQ2H 1FN4A 4Z7QE 3LB6C 4YBLB 1KB9J 3EYQC 2V7HB 3MV11 1RIVL 2IQ9H 4YXKL 5EU4A 5C07E 5F3BA 2X4SB 3ZO0A 2NX5D 2FIKB 2IAND 1S7TA 5I19L 3G08B 4OFVA 3ULUL 1TVHB 1WGOA 4W70A 4QOKA 4F7CB 1NDGB 2HFGL 1TZGL 4Y4FB 1CF8L 3MLUL 1FYTD 3RDTB 5F7EL 3N1QC 1DL7H 3BRDA 1PEZA 1MFEL 2AV7A 1UQSA 3E8UL 4FQCL 5I66B 4ODTL 1XR9B 4JRYB 3N06B 2IEPA 5T3ZE 1JPFB 4KKBD 1FZOA 4MXVE 3O6LH 3BH8A 4PS4H 4PV8B 3WMSA 2B0SL 2LVEA 1SM3H 3VWKD 5LBSH 4GRLD 1DEDA 4DGVH 2P8MA 2XQBH 4L4JA 5IHUL 2OMNA 3FQTA 2YPKA 2X4TB 1P53A 5BV7L 1MJJA 3PWUB 3MV8B 4DKAA 1D5IL 3MRGB 4CVZB 1QSFB 4S1SH 4LPUA 3UTTE 1KJ3H 3S36H 3IDJB 4KK5D 2DJSA 2EXWD 3BPNB 4NCDA 3ALPA 3LKRB 4UT7H 3Q5TA 5IV2B 4NJ9H 1KG0B 2GTZA 1A6WH 3H7LA 5DXWA 4DCQB 4JDTH 5GQBA 2R23B 3KNBB 3QQNA 3SCMA 1CLYH 5E8NB 1S9XB 3RWGA 1HHJB 4WJ5B 3PGDA 3VG9C 2AEPH 5FV2A 3HHRB 3S5LA 5HI4C 3PQYD 1F4AA 2WW8A 3M8OH 2YMXL 1P84K 1B0RA 1DQLL 5IGXH 5JORB 1JF1B 1UKTA 4C54A 1KIQA 2EYSB 5IW6B 2IAMD 3Q6GL 5I74B 4NQEE 3MLSH 3SJVA 2ZUTA 1QSEA 3DETD 1U8LB 4DOHB 2IGFH 4J1UB 1LO5B 2ZUUA 3KR3H 5ACMA 3TIDA 1P6FA 3ARFD 1L0QA 3UXFA 5I1JL 3EFDL 4EDWH 4BQBA 2OI9C 2R4SH 2ERJC 1W72H 1IJ9A 4JO3L 3CVIH 4KJWD 4XP1L 4R8WH 5IBUB 3RIFF 3DUUB 2CRYA 2FL5A 3G5VA 3LN5B 4I3SH 4GAYA 4FQXA 3WLWD 3CLEH 4NQDB 4WWKB 3O9WA 3B9KD 5D2NB 4U7MA 5IMOB 4DVBA 1V7NL 3DJ9A 3K0WA 2D4DA 4HJGB 5FXCH 1CLOL 4HXBL 4JHBA 2F58H 3MLPA 5MEQB 3MNWB 4MCYB 1RU9L 3A67L 4NHUA 1E6JH 3GRWA 3SDYH 5DJXB 5F7KC 1IILE 3WFBH 4POYA 2NXYB 2C3WA 2DIBA 1HSAB 1JUFB 1PGRB 2BNQB 2EDQA 1PLGH 1BQLL 5CD5D 1T80A 4AH2A 3GSNB 2ICWA 5GSVA 3LS4H 4J3SA 3WJJC 2DAVA 4WV1C 5GGQL 3FKUS 4U4BA 5ALBL 4GT7A 3U0PB 2H6PB 1QYGL 3QDJA 3RX5A 3O41B 4WFEE 3WL9A 3QFJA 5I18H 2DLHA 4I3GA 1MPAH 4Q9RH 1TETH 4D2NA 5GS2H 4CMHB 3RZWA 1D5MA 5J8OA 2FECL 1WISA 3KYKH 2JJWA 1P9MC 4OFYA 4I5BB 2AABH 1EHLH 4PPTA 2NY3B 2XI9A 1C5BL 3T04D 5J1SC 4CJ1A 2ZCLL 4P4KB 3S96A 2HJFA 5IOPA 1DLFH 5IESH 4P57B 1JBJA 1KN4L 2B1AH 2P47B 2XTJB 4MXWH 3U7AA 1JN6A 4BYHA 2GIYA 1MRCH 3OQ3B 4QRTB 1RPQA 5A2LH 1NCUA 3DURB 4OV5B 3MJ9L 1B0GA 3EYFB 3MODH 3U36B 1DE4B 1U42A 3S4SA 5A2KH 1C16B 1FSKB 4XP5H 2GAZA 5SX4H 3AGVA 5FUOH 3FQNA 5D7JD 5D7KD 3ZDYE 1QRND 3RNKB 3F5WA 4P2OC 1LP9A 3ALWA 5EA0H 2FZ3A 4HBCL 1DQTA 3BZ4B 3T0EC 2FLRT 3EDEA 4K3HA 4NM4L 3MLXL 4ZUSA 1PBYA 4PJDA 3SQOH 1AXTH 5KJRL 1GZQA 2QKIA 2OZ4L 4OF0A 3ZDZF 1FVDB 1MI5A 1OPGL 1SJVA 3TV3H 4M7JL 3ZKND 3T3ME 3H9SD 1FZJB 4DUVA 1MWAH 5I75B 2DM3A 2AJVH 1UYWH 3HZKB 1OB1B 1XCQA 4FA8A 1RAMA 3WN5B 3V4PL 3VH8B 2F5BL 3VFGH 4OCRH 4ZO9A 4X98A 5CZKA 1DL7L 1EXUB 1GVIA 3QDGE 4K7PY 4N90D 4F9LA 3C5SB 2X4OA 5C0GA 4QTIH 1EPFA 3OKDA 1C7SA 4YHYB 3WD5H 2FB4H 3IFOA 2WK2A 3QP3A 1H8NA 1WF5A 4RSVA 3GBML 4YNYA 1YC7A 1RZ8A 5DHVA 1QQDA 4TULH 4LSRH 1X5LA 4BSJA 2Q3AA 1AGEB 1CD1B 3OR7A 4NZTH 2XQBL 4Z8FL 1DVFC 2D7NA 5EN2B 4I2XA 4PP8C 4LSVH 2APXA 1WZKA 4JE4B 3U6RB 3NIFF 4S1SL 3PWLA 4NNXB 4F7PA 4L8SC 1KJ3L 4Z7UE 4UT7L 4HG4K 4HGMA 4NJ9L 4NKIH 1FE8H 5E9DE 5HTSA 4NN5C 4CGTA 4MWFB 3C08L 4JG1H 5J06A 2VQUA 1BZQK 4LVOC 3BZFB 1P1ZA 1PY4A 4M6ML 3B2VH 4M7ZB 4J4PA 3RX7A 4MXQA 3HR5B 5BVPH 1VSCA 3CVHB 3GBNH 1WFTA 4M6NL 3PABB 4X7DC 1T0MB 1IMHC 4FQ1L 4HHAA 1ROWA 3IFLH 4G80A 4M1DH 4XT1C 4X0KB 4ZFFA 1P7HL 4UIKH 4RX4D 3BDBA 5IB4B 4N8VG 1BAFH 4XNQB 2RCSH 1HH6A 3WJLC 3V2AR 1TMCA 1MIEL 3KS0J 3EO0A 4HMDA 5KS9E 1CIUA 4M4RA 1P7QA 4AT6A 5LQBL 4XC1H 1DQDL 1FP5A 1YN7B 4R90L 4EVNB 2YZ1A 2QHRH 3ALXA 1OAQH 3WNKA 1D5BB 2XWBA 4NN6B 4ZFZB 1TVDA 1MJUL 1E28B 5JXEC 5GHWL 3I85A 4OLEA 1BX2B 4XHQA 3QPQC 1LK2B 5HHOD 4HIXH 2UY6A 2I9TB 4YHOL 4PJ9C 3RY4A 3ZHKA 5KSAA 4NM8H 2YN3A 4ZNEE 5B39B 4PB0H 4XH2A 2F58L 1FYHB 4OUUB 4J23A 1CICD 1UZ6F 4LOUC 4W81A 3LN4B 1E6JL 4KROC 4NPYA 3SDYL 2BMKB 4XCFL 1ULVA 1VADB 4TPRH 1OAUH 4WO4B 3BE1H 1WK0A 2Q8BH 3LIZL 4HPYH 4YX2L 2Y6SC 1NDMB 4HQQL 4NJAL 4X6FA 4XNZC 3HG1E 2CKBH 1CI5A 2CRMA 5CJ8A 3TIEA 3W82A 2XFXB 4PRPB 2YZ8A 3FB5A 3QUXD 5EO1A 4EI6B 1G0YR 4PG9B 3BO8B 1MPAL 1VKXA 2Z4QA 1JGVH 1KIRA 4TQEL 4XPHL 2UYLB 5T3ZL 1JGEB 1KIPA 3L5WA 2NX5E 1FNGB 2IANE 4UB0L 1RUKL 2V7NA 4X7SH 1T6WA 4JRXD 4Q97A 2ENYA 3EFFA 1I3VA 4O02L 3Q6FB 1URLA 4CAGA 4JY5H 3VRJB 3D2UA 4ODHH 2BERA 1FG9C 2CO7B 2VXUH 5T1KA 5BJTA 1KLGA 4D0CB 2COQA 2P8LA 1FYTE 5F97E 5KZCB 4CKVX 3KGRA 4MJ6B 2B1AL 4LMQE 1J8KA 5ITBH 1HXMA 4I0PB 1YYLH 4I0KA 4UDUA 3SY0B 4DK6A 3QEUA 5DK2B 4LCCA 1NQBA 2E7BA 2JJTC 1SJHB 3G6JA 3FO1B 1MAJA 3VXQA 4M48H 1JRHL 3BD4A 4HGWA 4L8CB 1IAKB 4FHBD 3CC5B 3BH9B 1BZ7A 1PYWA 3KXFD 3RL2A 1OP3H 1G7MB 3GJFB 2VC2H 5I16A 4PRBB 2YS4A 3TT3H 4G6ML 4HLZG 1NBQA 1XIWC 3SDAB 2QQLH 1ITBB 12E8H 4C58B 2F54D 1AHWC 2OLDA 3QI9B 1JHTB 4ELKA 3S3PA 3WS6A 1FAKT 3SQOL 1JV5A 3O0RH 4XMLH 4UIMA 3RVUD 5C92A 1U0QA 2HT2D 1Q9OB 1U6AH 3KPLA 1TVBA 5FA4B 3QPXH 3Q3GA 1NJ9B 1RMFL 3FCTA 5DEGA 1IGFL 1NBZA 5E8DH 4I48A 3JV4A 5A1AA 2YA1A 3EUUA 1UZ8B 4OCYL 1IGCH 3C09B 3OXSB 4YHKL 1FFPA 2YUVA 4GS7C 2BFVH 4QY8B 5DRXB 3MV7A 4CN6A 3MRKB 5ILTL 5FV1L 3WNPA 1L9MA 1R0AL 1PSKH 4ODUA 4Q2ZA 4HPOH 5EC1A 3PQYE 4EEEA 4WTZA 2VR9A 4PLOB 4G5ZL 2HKHL 5IM7A 4QRPD 2E7LE 1IQWH 1IAIH 1A6UH 4OB5L 3CDCA 2DTSA 2VABA 1YEEH 4NSKA 3UAJD 3DPBA 5D72L 5KAQG 3BW9A 1I7ZB 3DBXA 2MSPA 4OZFB 4TTDD 5ESAA 2AEQL 3X3FH 5HGHB 4Y2DC 1V8HA 4UTAL 3EOBB 2VXTH 5CUSL 2A1WH 3VXRA 5F89B 4NZTL 2VDRL 4HAFA 4P23D 5DS8B 1HQ4B 4EUPB 1F11A 3WCYA 2BVOA 1KB5A 5IFHH 3WUWA 4U6VL 5EIVA 5FF6A 3QIBA 4PJ8B 3WO3B 4UU9B 5FYJD 1AGCB 1CGWA 4PY7B 4X80H 5TE6H 4LIQE 1TZIA 1ZA6B 1NKRA 2VISB 1FPTL 4N0UE 3W9DA 2RAMA 3QWRA 5GGVL 3HRZB 3LRGA 3QIWB 5AYUH 4IRJD 4L4VB 3JSSA 2Z91B 3IFPB 3NABH 2IPKA 5F7DB 5DUBA 1DUZB 1CT8A 5EWIH 1NC2D 4N0RA 4UT6L 3SKMA 2BVQA 1WAAF 3IFLL 5LVEA 2M1KA 4H8WH 4PDCE 2ADJA 2H26B 3PHOA 5JZ7D 2DF3A 2Y5TA 4R7DB 2Z31D 2YD9A 4YC2B 1FNFA 4I2XE 1BD2D 1KJMB 1L0XA 2VDLH 1S5IL 3GSWA 5JMRA 1I8MA 1GSMA 1EDQA 4PJXB 1IEAA 5FM5M 1OAQL 1KJVB 3OKNB 2OR7A 5J0BA 1Z3GH 3KLHD 3ARBA 5E6IA 4RGNB 1N64H 2R2EB 1BMGA 2ICEB 4H5SA 2WBJA 3CZJA 1IGMH 2DKSA 1AGFB 4GW5B 4GRMA 2XWTB 1G9NL 1S7SB 4QXGL 3HA0A 2R0ZH 5KOVC 1SEBA 3JV6B 4PB0L 5F9OL 3OJDA 2VZTA 4K71B 3OAZH 2KH2B 5JW4N 1DANT 1BIIB 2QQKH 1U3ZA 1YEHL 4KJPD 4ESKA 2ZCHH 3ULUC 1R3JA 1JYVA 4TPRL 3HNTH 4RQQB 3PWPB 3BE1L 5IMKB 4HPYL 4R97C 5ID0A 1OOAA 3QYCA 3DMMC 1CFBA 2A6JA 2P7TA 2Y25A 1JZ7A 2CKBL 2E9BA 2YHGA 4KJQC 5D7KE 1QRNE 3IDNB 5E4EB 2VB5A 2NXZD 5K9OB 3T8XB 1FC2D 1J8HA 4KKAD 3C5JA 1SBBA 2Y9RT 1P2CA 2XZCL 2DQUH 1BFSA 3TBTB 2WAHA 2ADGA 1U8NB 3H9SE 3GDBA 3CCHA 2NW3A 5I1IH 5C0NC 3CUPB 1WQVT 4ONOA 4XVSL 5LXGH 2VZVA 3P40A 3QCTL 4IBLT 3H3BC 4D0DB 3T2QA 1GOGA 4X5LA 3S88H 1U8JB 4YPGA 3GSRB 1WSST 4N90E 2I24N 2PR4L 1FZKB 3T2OA 1NCTA 5KANI 4AENA 1TXKA 2CLRA 1S7UB 2DKMA 5DO2C 1XMWA 4M1CC 5JA8B 1FLTX 3FB6B 5IEHB 4LP5A 2DDQH 4M7KL 4YHLH 5B4MD 4O9HH 5JO5B 5I71B 4OAWB 4PJXF 1J0HA 5ID1B 1UKSA 1RI8A 1KT2A 3FQWA 4G9FB 5D1ZB 4NWUH 5EU6D 3HC3L 4JO1H 4XI5C 5AZEL 2ATPA 5C0RH 5DUPH 4DUXA 3A6BL 3MYJB 1M71A 4X6CA 5EBMA 2D0FA 4LHUB 5C9JA 2BRRH 1J87A 2EYRB 2ICES 3PWNA 1U6AL 4AEIH 3QPXL 1JZ3A 3S34L 3X3GL 3L95B 5FK9B 3QAZB 4KRMB 1IRAY 2OJEA 4F7MA 3O6FD 4UDTA 4PJGB 1AD0B 4G42A 4MNGB 4XPAL 4XAWH 4RMWA 2NY7H 3C9NA 3NCMA 5INDB 3QZWG 1RZKH 2P44B 4DVRL 2QSQA 3ZMRA 1T89C 2E8ZA 1FFOA 4OKVA 3L6FB 4K94C 1WBZA 1X5KA 4HAGA 3QIUB 1GGTA 3S36X 3V0WH 4YH6A 1RJLA 4MD4B 5DQ9A 3BFOA 4RAVA 5I1EH 2XT1B 5TJWK 3VXSB 1A7NH 1T5XA 5TDOA 1KCLA 1IQWL 1GHFL 2JJSC 2ATKB 1NAKH 1ZXQA 1YEEL 4XZUA 4ZO7A 4ZXBC 3VI3E 1K5NB 3X3FL 5FO7A 4HUXB 4R96B 3HCVA 4Z95H 1A4JB 1U3YA 2A38A 2VXTL 4FP8H 4GJTB 1QR1B 1A7OL 1D5ZA 2AJSH 4G6FD 5FFLA 3CLFL 3VXPA 2ZUSA 5IFHL 5JMOC 1QNZH 5IUSA 4H20H 4L8DA 3VWJC 1AKJD 2ZG1A 5HYEA 3VI4E 2E9JA 4EN3D 4OLUL 5AD0A 1NGPH 3IU4H 4XP4L 4TNWK 5HHOE 1J1XL 1U3HA 1LEGB 4FXGB 4YHMH 1ORSA 3WLBB 4F7TB 4JFEA 4WI9A 4QRUA 1T7WA 4HDIB 3LV3A 3SKJL 5CSBA 1DBBH 3TJHA 4FQ2H 5AYUL 1QFPA 3D9AL 2GJ6A 4P2RA 4HJ0D 4LEOA 3KPNB 3TPUB 3LOWA 4WHTB 5KBNC 4O4YL 1L9NA 2X09A 1A9EA 2YRPA 4G43B 2HH0L 3V8CA 4MA8L 3X14B 3MX0A 4S0TD 3HI5H 4H0HB 5D8JH 5MI0C 2IMMA 2DQCH 3D18B 1RSFA 2EC8A 2MJWA 1CD0A 3P77B 2AJYL 1AGBB 4G9DB 2OR9L 4LK4A 1T21A 4OZGE 5B3JF 2H1PL 1Q8MA 5ENWB 4N8CH 3C5ZB 2BVTA 5T5FL 5JIIA 4P2CG 2HVJA 1QO3B 2VDPL 1OW0A 3X17A 4L3EA 1YUHB 1ZKAA 5HJ3B 1PKQE 3VG0H 4XHJD 5DFWH 1ZTXH 4PJGF 4X8JB 3CFBA 1C08A 2E7CA 5HPOA 3ILPB 4PJEE 4JRXE 3MRJB 1JNNH 2PO6D 3D39D 2VDOL 4Z5RA 2X4QB 1JZ8A 4YUEH 3ZL4H 1LQSR 5L2KB 4JKWA 1DDHB 2RR3A 4J6RL 5FYKD 3N1PC 3MOAH 1JYXA 1AP2B 2IFFH 4JQVC 2O5ZH 1ADQL 5I1DB 3ROLA 4IRSA 4QXTA 4CRPA 1RJYA 1EGJA 32C2B 3D3VD 2VAAB 4M7LL 1LE5A 3FONA 4PGJA 4OM0L 1I4FB 2WMPA 1RK1A 4G7YH 3SDDB 2RB8A 2CIKA 3TH4T 1WCBA 2OCFD 1OSPL 3PGCB 2R4RL 4P9HH 1A1NB 3QXUA 1IEHA 5ERWB 3KXFE 1W0VB 1EZVX 2BXZA 2FBJH 3MMEA 5J3HC 1KV3A 1YEGH 2HP4A 2R8SL 2ZCKH 1P5VA 5C70A 3V79C 2AXHA 2BSTA 2F54E 5KVMC 2MHAB 1T66D 3O3EB 5IVXB 3NZ8B 5D1XA 2WIMA 1B4RA 4EOWH 1R3HA 2PN5A 2NZIA 3TF7C 5C71A 4E41A 3O4LB 4LSTH 5D2LE 3DX8A 4H0IA 3GZKA 1RJZB 1S7XA 1S8DA 2NMSA 4A2MA 4FQHB 1T1YB 3IB4A 1U8IB 1IARB 1KTLB 2X4RB 1JTOA 2YD3A 4HH9B 2DLEA 1BZ9B 3QUYC 1HWHB 5FM8A 2VIRA 3FQRB 3GMNA 4LPWA 4PRAA 4LIQL 1KCSH 3ARGD 3FT4A 2A6DA 3IF1B 2WWKT 1SYVB 1T2QH 2XKSA 2WWKO 5B8CB 1DQML 3DTXB 4G6AC 4QRPE 4QRQA 5ISZA 1RUPL 5DJDB 4JKPH 3GMLA 1CXIA 3EYUL 4MS8C 4YHLL 4O9HL 4U1SA 3Q48A 1T03H 1J0ZA 1A6PA 1H3WM 4NWUL 4JO1L 4X7TA 4Z7WA 5DUPL 5JHLH 3BX7C 4P4RA 4RWYH 1RFDL 5D5MA 1DFBH 2D31A 5EOCH 1AD9B 4EIZC 5FYJE 4HWZA 3DVGA 1OT1A 3UTSB 1KENH 3GHBL 4C56D 4YFDB 4AEIL 4Q9QH 5DD0H 4PRIB 1KB5H 4YEFA 4JO4H 3BPCA 1HIMH 4LNRA 1M6OB 3CXHK 1LEIA 3AC0A 4W4OC 1RZKL 1E4JA 2A9MH 4PBVC 2VXVH 4MJID 2P8PA 3TO4A 4JGUA 3OR6A 5ACLA 4OQTA 1P84J 4GKNA 2NY0C 3V0WL 3N9GH 5ADPH 4AJ0A 5I1EL 4PJFB 3GSXA 2GITA 2FSEA 5CEYB 1N59A 5BOPA 4QGTA 2L4OA 2O5XH 3FB7A 2YWZA 3VG9B 1BD2E 1VA9A 4M9PA 5IVXF 5H35B 4Z95L 1FO0B 4FP8L 4Y4KD 3ZT5A 1HE7A 2IADB 2XRAH 5F21B 3FQUA 1NC4B 1DP0A 3MCKA 4MX7B 1BOYA 4CU6A 5AYQA 4H20L 2FEEL 1BIHA 3PV6B 3IU4L 2EC9T 5I17B 3VGEA 1OWWA 4OZIB 3OKEA 1JCKA 2AK4D 3MBED 4G8FA 2ERJB 2AXGA 3KYNB 1F4HA 5FO9A 3CMGA 2XZQH 3MREB 1T1XA 3QFDB 4XCEB 3PNWB 2MOVA 4Y19D 4CVXB 2ZUQB 4M7LT 5DA4A 5ICYA 1ZS8B 1CFSB 1X5IA 3QUZB 3RZCB 2ZKHH 3QEQA 1KCVH 4AYFA 5D8JL 3VFTA 4LCIH 4NQCA 3N1FC 3UC0L 4ZPTB 4WU7A 1I1AA 1S9VA 3D1MC 4HSQA 2OL3B 1U36A 5DK0B 5JUEH 2J2ZA 5IHZA 4LKXB 3MRRA 4ZFGL 1RZGA 4MA3B 3NZHL 3DRTB 3ARUA 5BZWB 3MUGA 4NKOA 4OCMC 5F1KC 2YD7A 4MD0B 4WV1B 5T1DH 5DA0B 5M94B 2AQ2A 3C60A 3CFDA 5EU7E 1JNNL 1TTFA 2V5RA 4JFDD 3RJDA 3NFNB 4YUEL 5HYIA 4M5ZH 4JM2D 3WFEL 1U8PB 5K59E 4Q6IB 1J05B 2BX5A 3V5HB 3AMLA 3HPLA 2O5ZL 4PJFF 5TE7L 2XG4A 4ONFH 1S7WA 3TBWB 2Y07L 3SE3A 3MC0A 4IS6A 5J89A 2Q6WB 1D9KD 5BS0B 5HXMA 4XMPL 4LLQB 2FIRT 2JK5A 1AIFA 3D85A 3MRMB 4HULB 4WHDA 4Y4HD 2YPLB 3FOLA 4N1CA 1PQZB 3GI9H 3ARTA 2VMFA 4HUUB 4PB9L 3HAEG 1KPVA 1T6VN 2RJMA 3M17B 3ZTNL 3I2CL 5EU6E 4G8IA 5FA3B 2ZCKL 3BOVA 4KRPC 4LSDA 5TF1L 3T77B 4RIRA 4BH8B 3WFHB 2OTUB 2JB6A 3SBWC 5HVHC 4E0RB 3GMOA 1LO4H 4KKLC 3TBSA 2Q86A 4LRNH 3V5KA 1T0PB 4P2OB 3CSGA 3IJSB 4Z0BL 4HKBA 4LSTL 3L5HA 1UACH 5F3BB 4TVPD 4L4TA 4ZTPH 4YDIL 1S9KC 3TYFB 1OGTB 3BGMA 2FGWH 3BQUA 2MKLC 4XPTH 4D3CL 1AQKH 3FT3A 3BJ91 3WE6B 2FHCA 2CUIA 3IRZA 1T5WB 2BXYA 4LCUA 1GC1H 3RWJA 1S7VB 4DEPC 2P5WD 1ZHLA 3WFZA 4LCWD 1LDPL 2YD1A 4GQ9L 5L6YH 1X6NA 5IBTL 4XTRD 2XY1A 1WIOA 4L3CB 4HGKC 1U93A 1FVCB 1M7IB 1XGRA 4OF8A 4WDIA 3ARYA 4RWYL 1N26A 2HKFH 5K93A 5I1CH 4E41E 5HI3C 7FABL 5FGCB 1NMBH 4TOYH 4AEHL 2VSDA 2P8MB 1TIUA 5DHYB 2VE6A 3FQTB 3P0GB 3P9LB 4XB8A 4PGZA 2EO9A 3HLAA 5EFIB 1ZANH 1I9JH 5H94A 1Z9SA 3DIFB 4JO4L 4AY0A 1DVFB 3QNZB 1VFUA 1BOGB 1OTUC 5FCUH 3L7FB 3R8BB 4DAGH 3VXOA 4BQ8A 1FL6A 2GTZB 4L8SB 4OIAA 1GIGL 4OSUL 1XF4B 1NFIB 3P0VH 3QG6A 4YDKH 5IP4A 1A6TA 4PGDB 3U4EB 4XNUL 3W39B 4ODXB 4OT1L 4NN5B 3OKKA 4ZUTB 3SCMB 3BXNB 1B9ZA 2HFFB 5GISL 4KZEH 2J8UE 4XNYH 5DJ6B 2H32A 4OCSL 5HPMA 4N8VB 5D7LA 2EXYC 3U0WH 4WU5A 2XN9D 3PGDB 3H42H 5DMYA 5IJVB 1MCIA 3S5LB 2CDFA 2YK1H 5F7LB 1INDH 2JLLA 2ESVB 4RZCA 1B0RB 4WUUD 5C0FB 1HOCB 3BP6A 5DD6A 1A3RL 2JKXA 3T1FB 4APQC 3C6LC 1ADQA 3BP4A 3VRLE 1NCCL 4PGBB 4WUKL 4LGPB 5CLTA 4NQXB 2CJUH 4OCXH 2C3XA 2ZOKA 5EUKA 1A4KB 3GHEL 3S6CA 3TA3C 2E7MA 1OAKH 2APTA 5FO8B 2QQNH 4KRNA 1YNKL 2NY2C 2V5MA 3KPSA 1CWVA 2YBRB 3W0WD 4O58H 4RWHA 1CGSH 3D39E 1RK0B 2UZIL 2P5EB 4PGCB 4V3DB 4GQPH 4HV8A 1TENA 2ED9A 4MVBC 3PIQB 3O4OC 3MGAA 5FYKE 3RY5A 5GGRA 1OLZA 1K6QH 3AREC 2FH8A 2DYPA 1EHNA 5DJ0A 5ELIA 5F72S 5MP6H 4QRRB 4DVBB 5TPWH 3D3VE 4J3WA 1CFQB 4PJ9B 4LLMA 2F74B 3AVEA 5DDHA 5KSBB 4Z7VE 5DQJA 1ZLUK 1A8JH 1EGJH 5HY9B 5A16B 1QLFB 5F6HI 3PGFH 1TQCC 1SVCP 5D71H 2PYED 1I3RB 5LAXA 1UFUA 3EOTL 3HZMA 3VFNB 5JW5B 4OZHB 5B22A 4WEUD 1F3RB 1AGDA 4JFQB 1CQYA 3MRNA 1WIUA 4XNZB 2F9BT 3KJ4C 2CXGA 4FFWD 4HKJA 4UV4L 2AV1A 2EYTB 4GBXA 1ETZA 4ZMAT 4IMLA 3T65A 2IPTH 5F9DC 4F7EA 2A74A 5I15H 3DXAD 1ES0A 1S7RB 1IVLA 2HWZH 5F70A 4AZ8A 2H45A 3MXVH 5LGHL 5TH2B 4PIRF 4I18C 1YEKH 4NKMB 3GM0A 2J4WH 3H2WA 5FYJL 2HJFB 4LSQL 1GGUA 4HFUH 3WKML 3L3IA 2KUTA 5D1QA 1DQJA 1FNHA 5FKAA 2B2XL 3E2HA 4XBEH 3RGVA 3FT2A 1JN6B 4ELMA 1IQDA 5HGGS 3UZVB 3JWDH 3GI9L 5J1AA 2FJHA 1XCTB 3CDFA 5TDNA 2FD6H 2I07A 2NY1B 3BDYH 4X7FC 1XH3A 5I1GL 1KC5H 2WUBL 2EDOA 3KPRB 1DTUA 3JTTA 2DQJH 5IW1B 4J3XA 3WHXA 4QHUA 5E0QA 2EECA 3F5WB 3U4AA 3MJ7A 5IR1A 3PP3H 4WFGD 5C0CD 1HYRC 3QQ4A 4KMTH 4F37K 5DJYA 4O51A 4PRHD 4HK0A 4PJDB 5AUMA 3HE7A 1AHWB 3THMH 1GZQB 1A6VH 3SKOA 1TNMA 4QXUH 5SV4A 4KPHL 4LDLB 3PDOB 4CNIB 1FL5A 1T04A 5KSBF 2C1OA 4KKCC 1UM5H 5JQ6L 4GRWB 1R3KB 4MJIE 1XCQB 2EDRA 2HJLA 4EQ3A 1NCAH 1OARH 1MCPL 5ESVA 4L3AA 4W4NA 3S37L 4DTGL 5DYOA 2YUWA 3K80A 1A2YA 4EI5A 4OJFH 2AKRA 2MMXA 3KPMA 1BBDH 5C9KA 1RUML 1MCBA 4GS7B 3OPZL 4QHMA 1NGQL 2GSGA 2H2PC 4OZHF 5GPRA 1BJ8A 1AO7A 5LKNA 4GG6A 3DVNA 5EUOB 4OQTH 5FYKH 5DGRA 4TNVK 2X4OB 5C0GB 1ZMYA 1YY9D 2BC4A 3O9WC 5IWLA 3WNLA 4YHIA 4G7VH 2AI0L 4Y1AD 4HMEA 4BK5A 3IXTB 4HWEH 4AIZA 4OD2A 4ODBD 4UOW0 5T1LA 3Q5OA 4GAGL 5DHVB 5DJ8A 1D5XA 3RNQA 2Y06H 5L0QC 2NZ9D 1UXSB 1J1PH 4XNXH 1H15A 1UH3A 4S0SD 5SWZB 3KPTA 4GAJH 1S9YA 1ZANL 3WV0A 1CDYA 4BZYA 2AK4E 3MRDB 1NEZA 3PWLB 1CZ8H 1OGAA 2J3SA 4F7PB 1HYSD 5IB3A 1Y0LB 2AQ3A 3LQAH 4XP9L 4XP6L 3MRHA 2ITDA 4DAGL 4KKBC 1HWGB 1Q9WA 2CH8A 3VD4A 3MV8D 1HHIB 1WZ1H 1UC6A 4Y19E 1QSFD 4Y5YB 4CW1B 3P0VL 1N6UA 3VWKC 1WITA 2WUCL 1DANU 2B4CH 4GRLC 4K7FA 3SGDI 2WWMC 1FGVH 4IOIA 3U9UA 4I3RL 1UM4L 3VFRA 2DLGA 1MCDA 3D69B 3MLYL 3D48R 3H42L 3TN0A 1EFXA 2QR0A 5CEZD 1INDL 4K9EL 2ZOLB 2DBLL 5D7SL 3UYRH 3V4VH 1X5HA 4DKFH 4S1DD 4ZO6A 3TT1L 4X6BA 4KK5C 2XTLA 3WIFA 2EXWC 1X4ZA 4U1MA 4KUCD 4PJBA 1J12A 3FZUC 5JW3L 4QKXB 2FH6A 1VENA 3T0ED 3H9HB 4MCZB 3BYTA 1K4DA 1P7QB 1OAKL 1I3GL 1CFVH 1UWGL 1KLFA 1XGQA 1OHQA 1FIGL 3H7BA 4O58L 5JHDB 4JFDE 4ZOBA 4GRWF 1UM6L 2ZUYA 4OLWH 2H9GB 4U6TA 3QDMB 1C12B 3MRBA 2IAMC 1RVFH 1B2WH 5MP6L 5KAQF 1KXTB 1BFVH 5EUOF 2F53B 5E8OB 3MSPA 4YQXL 2V7HA 3ARFC 4NQDD 5E99H 8CGTA 1P6AB 3CFEB 5D96C 2X4SA 4WEBH 2FIKA 3LRSB 3GUTB 3G08A 5D71L 3PHSA 4R26L 4KJWC 1TVHA 2R56L 4LP4A 1G6RL 4Y4FA 1QACA 4GUPB 5TE4H 3WLWC 5IMMB 3KPSE 3DLQR 3B9KC 3RDTA 3AB0B 1FAIL 3TYGL 1V05A 4F9LC 1NUNB 3OJMB 3L9RB 2NY4B 1E4WH 1N6QH 3FB5B 3RTQD 1ACZA 3K1KC 5I66A 3SKUD 1MHEB 1MFCL 1VKXB 3ES6A 1XR9A 4JRYA 1QKZH 4UTBH 4TVPE 3L5WB 5IB2A 2OK0H 2I27N 2HWZL 2V7NB 3BAEL 1TPXC 4NO0B 2NY5L 2NPLX 5CD5C 1YEKL 2J4WL 2GJZA 3RUGB 1NCWH 3UTQB 4HWNA 2LAAA 3B5TA 2X4TA 4LRIA 2P5WE 4G3YL 3QXVA 1JYNA 3PWUA 3OWEA 2E27H 4LCWE 5BV7B 4CVZA 4M1GL 2PKDA 5GGSY 2VXSH 4M62L 1F4WH 1OTTD 1RZKC 3IDJA 5IV2A 4YFEA 3G6JB 1KG0A 3QXAB 4NCC2 5JTWA 2X1XR 4UILH 3BDYL 4J7RA 1BQUA 1WT5A 3FFCD 1GPOH 2KPNA 2R23A 4P5KB 2E9IA 1MFAL 3KNBA 4J4PC 4MXQC 5E8NA 1S9XA 1HHJA 1E27B 4WJ5A 2VRAA 2FJGB 5F7MC 5CCKH 2DQHL 1MCCA 5JORA 1JF1A 2EYSA 5IW6A 4FN0A 3QZWB 3Q3GB 2NTFB 4HXAH 4KV5E 1U8LA 2W0KA 3MZTA 2D7PA 1MEXL 2E6PA 1LO5A 2P49B 4YDLC 1UM5L 5IKCB 1HI6B 5CBAB 1EERB 1YEFL 5D7JC 1TITA 1EVTC 4KROD 3I02A 3UTPD 3SEPA 3BKJH 4J12A 3ULUF 3OG6B 2XN9E 4Q2ZB 4A6YH 1PG7H 5FYKL 2B39A 3VRIA 1ZT4B 5HI5C 5EORL 1RZFH 1SMOA 2H32H 4WUUE 1EZVY 5KSAC 1MHCA 4WWKA 35C8H 3ZKNC 4HWEL 1IGIL 5D2NA 5IMOA 3OF6A 1SHMA 4HJGA 2ZUVA 4P59H 1HXYB 5EIQA 3MNWA 4JO2H 4MCYA 5J12B 1Z2KA 5JDSB 1BGXL 4ZXBB 5H8DA 2DM7A 3VXRB 5C6WH 1AXIB 2DQGL 3BT2L 2HG5B 3W0WE 2FLBT 2GI7A 1HSAA 1JUFA 3MA9L 2EH8H 2JF1A 2BNQA 4C59B 2LTQC 1CZ8L 3GSNA 3RUGF 3IDXL 1YMMD 4MNQD 4KK9D 3GIVA 5ICZB 2PXYD 3U0PA 3KPQB 3NIGE 4MDIB 3WHE0 2F19H 2G9HA 3O41A 4NZDA 2MCG1 4MHHG 4HUNB 3ZE2F 3MXWH 3E1F1 1NFDE 2V9QA 3G6JF 4MAUL 2X10A 2IPKB 5CZXD 1G7QB 3H8NA 1N7ML 4HUKB 3SKMB 4I5BA 4LPYA 1F13A 2KL6A 5JA9A 4OCWH 3DI2B 2PYEE 4LASH 1A0QH 2V2WB 4P4KA 4K7PL 4DKFL 4B5EA 1S78D 2I60H 2BHZA 4V1DB 4PJ7B 1MJ8L 5MI0B 5T1MB 1D6VL 5GS1C 3WO4C 2DRUA 1JNJA 1B90A 4P57A 4HKZB 4P2QB 4GXVL 1A3QA 4MGXA 1G9MH 3NH7L 1UJ3C 4P9HC 2YUZA 1ONQB 1CG9B 3RWIB 3DURA 4OV5A 1KPRA 3BVNB 6FABH 3U36A 3DXAE 1DE4A 1AE6L 4P3CL 4OLWL 3ARBB 4HUWB 4FG6C 3EDJA 1C16A 2Y23A 4WI8A 4NHCH 5E8PB 1FDLL 4N9OB 5ITFB 5K33A 3RNKA 4P3DB 4GRMB 2QSCL 3I6LD 4LAQL 3BZ4A 1Z6JT 3WXVH 2G5RA 5EZIL 4O5LL 2WBKA 3F6LA 3U7WL 4U0RC 4XC3L 4FZ8L 3SPVB 1MCJA 1FVDA 3VXMB 4L29B 1UWEH 4L8BB 3ARXA 5AZ2L 1H5BA 1PZ5B 1FZJA 2Z35B 4F33A 1WFOA 4N0CA 2CDGB 3PF2A 2J8HA 3HZKA 1OB1A 3FB8B 4Y2DD 3WN5A 2A6JB 2P7TB 5TE4L 3DRQB 4HK3N 2LAGB 4ONHB 4WO4D 1DZBA 3QULB 4R4FH 3EJYD 3O8XA 1EXUA 1TQBB 2R0WL 4QO1A 1NPUA 2Q3ZA 4HC1A 1NKOA 3QCVH 4WFGE 5C0CE 1E4WL 3C5SA 3NFSL 3WNOA 3EOAB 4IRZL 1CICC 3QBTB 3O2WH 4PRHE 4YZFF 4U49A 3WIHL 3G5ZB 1MFBL 1A7QL 4DKDC 1HEZB 1RULH 2DQFB 2NW3B 1EVUA 3I9GH 1T83A 3T2PA 4ZUWB 3UP1A 2J5LB 1AGEA 1JK8A 2JIXD 4WTZG 3ZTJG 4AG4L 2XYCA 1NCWL 5EN2A 2FRGP 2VLJA 3FO2B 3TNNA 3B43A 3U6RA 4LSPL 2VDMH 3QUXC 4QRSB 1KCKA 4PJ7F 3SO5A 2VXSL 1F4WL 4NNXA 3LPFA 4P46D 3MACL 5DT1L 5E2VL 3T2NH 2DKUA 2M2DA 3O6ML 1ZLWK 4AL8H 2JJUA 4LHQB 4Y1AE 4MWFA 1KJ2H 3QRGH 5FHAH 3DV4B 3GKWH 1GPOL 1G7JA 3BZFA 3PWJA 1XGPB 4LLVB 3HR5A 3IAPA 3NCJH 3CVHA 1BJMA 5DRWB 3PABA 4HS3A 5T5NG 2ATPB 4PR5B 1T0MA 3UJJL 4JZNA 4X6CB 4BK4A 4PUBL 3U0TA 2Y36L 4X0KA 3P4MB 2EC9U 2J6EL 4DGIL 2P24B 2EDYA 4FTVB 5HYSB 5IB4A 1KACB 5EOCJ 2BRQA 4J8RB 4XNQA 3CXHJ 1R3IL 4DGYH 2WBWB 3QI9D 5I2IB 4LDOB 1PDKA 2K3TA 4HFWB 4F7MB 4XWOC 3MV8E 1QSFE 1KCGC 3K81A 4URTB 3QEHB 5HHMB 2NR6D 1P4LB 3IRPX 3KYOB 1IGYB 2DBJA 4EVNA 3BKCH 1JHLH 2D7OA 4KWUA 5DZLA 1J9CT 4ZDHB 1FFOB 1MELA 4ZFZA 1AXSB 2EDKA 1E28A 5E6IC 2OYPA 3WFCH 4A6YL 1BX2A 2RGSA 1EJOL 5CEZE 1BECA 3AS3A 1LK2A 2WBJC 5DVLA 1RZFL 3GIZH 2I9TA 3REVB 1U9KA 5F7YC 1EH9A 1T5XB 5CINH 1F3DH 5IW3A 1F90H 5B39A 3ZKXC 4JO2L 3T0EE 1IM9A 4OUUA 1U8QA 3LN4A 1X5YA 3EIFA 3IJHB 4KZDH 3MV9A 2BMKA 3HB3C 1N4XH 1F4YH 4PBWD 1VADA 1RURL 1A7RH 5DEFB 1NDMA 1LVEA 3MNVB 4WI6A 1NAMA 1F8TL 4GO6B 4HW6A 4WFFD 2ZZUT 4OGXH 3CFCL 2YC1B 3X11B 5JXAH 3MUZ1 4JKMA 3O81A 2F19L 1RUAL 3QJHB 5T33H 4S0UC 5GSRB 4PRPA 4TTDC 3MA7B 4EI6A 3V0AC 3BO8A 3MXWL 4CUCA 4D9LL 3ZE1E 4UV7L 4NQDE 3TVMB 4TVPL 4P23C 4LEOB 4MAYA 1LMKA 3DROB 5DO2D 1FNGA 2OX5A 4YE4H 5IFJA 1HNGA 4X5XB 3Q6FA 3BEWA 2AJUH 2F15A 2Z8VC 4LASL 1A0QL 3VRJA 1JZ2A 4NCC1 1LO3L 1ZT7B 1T21B 4X6CF 3N1GC 4MJ6A 4XCYA 5EIIB 5C0BD 1FBIH 1CL7I 1U92B 5FDWB 2BNQE 4I0PA 4IRJC 3SY0A 5DK2A 3BPLC 1FH5L 3INUL 3SE9L 4DJMA 1SJHA 3FO1A 4ODWB 3MCG1 4L8CA 4S10A 3U4BH 4RRPA 3VXUD 3MUHL 3CC5A 3BH9A 1WAAA 1AI1L 5JZ7C 5E8EB 3GJFA 4PRBA 2ORBL 3VJ6B 3AU1B 4X7EC 4OLZH 4OLYL 3SDAA 5C7XH 4H26A 4BZ1H 1JHKH 4YBHA 1ZGLB 3HC4H 4ZOEA 3BISA 1JHTA 4GMSH 4QYOA 4WHYH 4F3FB 4MA7H 5JOFB 3ROLB 3MLWL 1LE5B 4NQEB 1KXVC 5CGYD 5FA4A 1UWEL 2YRLA 1A3LL 2FO4B 3HAEB 2CIKB 2MPAH 4MYWB 4Z7QF 2ED8A 2HT4D 1EBAA 1EIBA 1CXHA 3KLHC 5E2TL 1C1EH 1WCBB 4ZFOL 3R06B 1J1OL 1UZ8A 3FFCE 3OZ9L 1ZLVK 2VLRD 3OXSA 2Q20A 3U83A 4XXCC 4QY8A 3AM8A 5DJAB 1NMCC 5C1MB 4R4FL 4TSAL 3MRKA 1XT5A 4JG0H 1QP1A 3TEUA 5HYJD 3N0PB 4X6DE 3CU1A 4G6JH 3VWJD 4ZUVB 1EK3A 1A7PL 1NGYB 1SBSL 3LHPH 4NKQB 4KRPB 3O2WL 4KJPC 4Q74A 5KN5B 3K7UA 3QWQB 4NT6A 1B4JH 4LVHB 3FQXB 3BESR 3F58H 4R4ND 1EFQA 1I7ZA 4OZFA 3G04B 1J5OL 3EOBA 2D03L 3P4NB 1E4KC 3OB0H 4KUZH 4MXVF 4ZD3H 2OP4L 5DS8A 1HQ4A 1RUQH 4EUPA 1NCDL 1MHHB 3UTPE 4WI5A 4M5YH 5HHNB 4PJ8A 2A73B 4UU9A 4PY7A 3D6GA 4KKAC 2JELL 4XPBL 3K8LA 1U3HC 3OB0K 1VERA 2APFA 4ZAKB 4F9PA 3Q2CA 3AXLB 1J0JA 3LMJL 5GZND 1KJ2L 5EU7C 3TJHC 5FHAL 5KVGL 3HRZA 3I75B 3QIWA 3EYSH 4L4VA 1ZSDB 5IQ7H 1HQRA 1VFBB 4ZS7L 2Z91A 3IFPA 5F7DA 1DUZA 4ALAH 3QDHA 5TF0A 1WEJL 3U1SH 3TJEL 5AEAA 4LPTA 3H9ZA 4AEEA 2H26A 3RPKA 1AFVL 4R7DA 3ARZA 5D1ZD 1YMME 2BNRA 4MNQE 4X8XA 3RGHA 2FYYA 2AJXH 2IFGA 5DRZB 2VQ1B 3LS5H 4LHUD 1KCUH 4M6AA 3BPCB 5EOQL 2CR3A 3O6KH 5B4MC 3GSNH 1OP5H 5DURB 4CJ0A 1I7UB 1U3JA 4OIIH 4PJXA 4DZBA 2BSRB 4DFHA 5F8QC 3BKCL 1KJVA 3OKNA 1JPSH 1O5DT 2C3GA 4LLWB 5KW9H 5ESQB 2F8XC 2P8PB 4JFPB 2VXQL 1VFMA 2V5TA 3SDCB 2HMID 1CGTA 2CLZA 3GIZL 2V5YA 3LAFA 4HF5H 1AGFA 4GW5A 2ENSA 1S7SA 2XWTA 1TJGL 4XPGH 2W60A 3MBXH 5J3HD 1MCSA 3JV6A 1JWMB 3ARDB 3BGFB 4IRSC 2AJ3B 3SGDH 5DC9B 2DL2A 4YFLF 4RGMC 4NO2B 1MREL 1BIIA 1MVFA 3NACH 1R5VB 3GSOB 3C6LB 3B5GA 4GSDH 4RQQA 3PWPA 1NLDH 4CVWA 5IMKA 2DQTH 3HE6D 3TA3B 4QHNB 2OBGA 2NY2B 4R3SB 4OD1L 2DWEA 3OKEB 3IDNA 3CMOL 4BSVB 5D7IB 5HDLA 3L1OL 3I6LE 4WI3A 5K9OA 3T8XA 3FRPG 3BWUC 3OKOB 5GGUB 5D1XC 3O4OB 3LKNB 1YEJL 3C8HA 4R0LC 3AREB 3MLZL 3TBTA 2NY5C 4M93C 4XVTL 3DGGB 1I1FB 2UY7A 2AJUL 1WICA 3CUPA 1OLLA 4WU7B 4LQFL 4RBPK 4WCYH 5TQ0L 1K2DB 2R29L 1VACA 3U30B 4QF1B 1U58B 4JVPA 1FBIL 1U8JA 1H3XA 3GSRA 3KLAA 3DVIA 3QHFL 5IT2L 4HD9A 1FZKA 5J57B 4KU1A 3JWDC 4Z7UB 3CIQA 1S7UA 4NKOB 4OD3L 4JREB 4ZOCA 5LCVL 5E9DB 1INQA 1TJIL 1Y6MR 3RWDB 2DWDB 1TJHH 3FB6A 4JY6B 5IEHA 5JO5A 4OAWA 5DF0A 2V9RA 3QUKB 4HIJB 3GNMH 3GI8H 4FQIH 2PF6A 4EKXA 4G9FA 4OLZL 3WS3B 3E3QE 3VW3H 2L7UA 3SOBH 1YQVL 3STBA 1UVQA 1CTOA 4MA7L 4L5FL 5FCSH 3ZDYF 4I18B 5IJKC 3PWVB 2EYRA 4E5XB 1FNLA 3ZZ1A 1R5WB 5KANG 5L2KD 2KKQA 3L5XH 3L95A 4XHJC 1U8OB 1A6ZB 5KS9B 5GS0D 1WUNT 2D4FA 5DMIH 2VZSA 8FABB 1AIFB 4WGWB 1GYAA 4PJGA 1AD0A 5M95B 2PO6C 4MNGA 5MERB 3BSZH 1Q1JL 3T3MF 5INDA 1UH4A 2R1YA 1MAMH 1R3LB 5C09D 5EPMB 1V7MH 3OG4B 3L6FA 1HDMB 3FMGH 3U79A 5CEZL 3QIUA 4TVSa 4S1QH 3CVHH 4Y89A 5MEND 4MD4A 3BMVA 4J3UA 3TNMB 5KVEL 4BZ2L 3VXSA 5D7IF 2E5EA 3QXWA 4J2XA 1LWRA 3PL6D 4LFHD 2ATKA 1HILB 1X4XA 1K5NA 5GS2D 4KVCH 3V8OA 2R0KH 4HUXA 1QFUL 4R96A 5IB5A 4L4TB 4XCNB 4FFVC 5BMFH 1A4JA 1QR1A 4KUZL 5F9WC 4ZD3L 1F3JA 3VGFA 4HJJL 4OLXL 1JZ6A 3T0XA 1RUQL 2KQMA 1JGUH 5GRUH 4CU8A 1LE9B 5HDQL 4KI1A 4X9IA 2KDGA 5CJXC 5CZVH 1YMHB 1T66C 4HWBL 3T0VA 3MOQA 1D6EA 1DLHB 5C08A 1YNTB 4FXGA 5DQDH 2CRIA 4JFFB 4JN2B 1CDGA 3WLBA 4HIIA 4JQXA 4F7TA 4HDIA 3FOMA 2B4CC 3JVGC 4X4ME 4Z7UF 1IL1B 3LEVL 1L8JA 1JTPA 2F8VA 4NOBA 15C8L 3ARSA 4TUOB 5HGDB 4ZYKB 1U93B 4ZODA 3VA6A 4KJYB 1WZLA 1YPZE 3KPNA 4G59A 3TPUA 2NX5B 4ORGB 4ALAL 5JOPD 2IANB 2N4IA 2HA1A 5F6IC 1PG7X 4G43A 1CIDA 3U1SL 1CE6B 3KPPB 3ARGC 3LKPB 3D18A 1FYTB 3P77A 1AGBA 4G9DA 3NTCH 4WFFE 3C5ZA 3O6KL 3MPCA 1QO3A 1IKNA 3UTSD 4FXLA 3V9FA 1YUHA 4RISH 2CMRH 5HJ3A 5KS9F 2VLKD 4NNPH 3TZVD 4YWGL 1F58L 3QG6B 1IZJA 3QSKB 1MCWW 2W0FB 1HH9B 3ILPA 2AEWA 3MRJA 4RFOL 1PEWA 4D8PB 3VWKB 2X4QA 3OAYH 1HZHL 3RVWD 4GRLB 3MBXL 1DDHA 3HPJA 4Y16D 5GRJL 1AP2A 1EA9C 4MQ7B 5C0BE 5I1DA 5CJQL 3BP4B 32C2A 3OAYK 2VAAA 2EEBA 3BD5A 1F4XH 3SDDA 5JQHC 2ZOKB 1CFNB 3T0DA 1CXKA 2DQTL 2P1YA 4X9BA 4PLNC 4M02A 3VXUE 4JN1L 1A1NA 5ERWA 3LEXA 1W0VA 2VUYA 2PCPB 1NC4D 5DR5L 3RAJL 4CVUA 3RWCA 1HK6A 3ZKQD 4K3JL 2DQIH 4UUJB 5I0DA 3PQYB 3GJFH 1CFTA 2MHAA 2L7JA 4NGHH 4NP4H 5GGRB 1OQXA 3W9EB 5I8KL 3O3EA 3ZKMC 1IC1A 5IVXA 3RI5K 4Y4KC 1VPOH 5DJ0B 1HHHB 3U48A 1FNSH 3GMQB 5DWUH 1CU4L 5A3ID 1DBAL 4D9RD 4PJAE 3O4LA 2Q8AL 3BKML 4LGSB 5CP3H 2KQNA 1RJZA 3GM8A 1T1YA 3S98A 4KHXH 2N56A 2VLRE 4PJ5A 1U8IA 1F00I 3S9DB 2GT9B 1NMAH 1KTLA 2X4RA 4JFYB 4OBRA 4HH9A 1BZ9A 1I9RL 3HZMB 1ACYH 1KFAH 4UI2A 1YZZA 3FQRA 4TSBH 2EKSB 5HYJE 5EO9A 1UA6H 2JB5H 2PW1B 5DHXB 3KYMB 1QOKA 1SYVA 3SGJC 5B8CA 4P5TD 3DTXA 2AERT 1BVLB 4N0UB 1Z5LA 3B9KB 3MLVH 5D70H 5DJ2B 3O11B 5DJDA 2AV1B 4FABL 1ETZB 4XMKH 2ARJA 3I6GA 2W0LA 1F02I 1OTUD 5C2UB 5JPNB 5GIRA 4KMQA 3GI8L 3EO9L 3S97C 1HCFX 1ES0B 1N2RA 3PXHA 4LEXH 5LWYL 1P4IH 3UJTH 4JM4H 3I50L 4MDJA 5IROA 4WW2C 3SOBL 1YJDH 5T3XH 4OZFH 2FO1A 4EXPX 1L0YA 3KHQA 3HI6L 1TPXB 2WLZA 4Y5XC 1AD9A 4RA0C 5EC2B 4EUPH 2IPUK 2Z92A 4PRIA 1X5ZA 5CMAB 3U9PL 1RIUL 5DMIL 3FT2B 4UAOC 4YK4C 4AEFA 5E5RB 4HKXB 1M6OA 4ELMB 4IM8A 4UINL 3P11H 1IQDB 3I3EA 1INEL 4HCRH 3UJIH 4JM2C 2ILLA 1MAML 1UT9A 5DD1H 5J7CC 5DMJB 1QFOA 4F57L 2VDQH 1V7ML 2WINB 2DM4A 5GJTH 2YPLD 4FFYL 4JPVL 3MLTA 2CSPA 4BELD 4QHUB 2EICA 1IKFH 1FVEB 4PJFA 3LD8B 3CDGB 5CEYA 1D9KC 5DJYB 4O51B 1ZEAH 5B3JE 5FGSA 2XXCB 3SKOB 4Y4HC 5I6XC 5H35A 1FO0A 1L7IH 2YKLL 3V4UH 2IADA 3NIDE 1T04B 4M00A 5HHPB 2C1OB 1BWWA 4MX7A 2HJLB 4I4WA 2H3NB 4LPCA 4ZSOE 1N5YL 1A2YB 1KUMA 4EI5B 4P9MH 4LLDB 3VFVB 5I17A 5D7JB 4QOKD 2D7TH 2OI9A 5GGTA 4GG6B 3KYNA 2CR6A 1ZHKB 1CK0L 3MREA 3QFDA 1CLZH 3HFML 3PNWA 4LHJB 4FMKA 4XCEA 2EDFA 3B4NA 4EBQL 1Q0YH 1CXLA 3OJVC 4ZO8A 1ZS8A 1CFSA 3QUZA 3BMWA 4LVEA 3RZCA 3H9SB 3RQ3A 3L7EA 3ZT6A 1NCNA 3UZQA 5KSVB 3RIAF 3HZVB 2W9DH 4ZPTA 2NLJB 1NGZA 3QHZL 4HIEB 5H2BA 2H2SD 2OL3A 1DBKH 1AY1H 4PJHE 5DK0A 5GXBB 4LKXA 5B38B 5A2FA 1NL0L 5CLWA 5C6TH 5IB3B 4XGZB 1ZGLM 1I85A 3DRTA 2LTQB 4PREB 1T7XA 3GEWB 2N1KA 4YDJA 5BZWA 4Y5VC 3MO1B 2A77L 3WJJA 4NNPL 4WV1A 3W5NA 1MCEA 3B83A 4N9GB 2CUMA 2M26A 3VFRB 3NFNA 3TN0B 1U8PA 4Q6IA 1U95A 3ELAT 3SCMD 2BVYA 1P9MA 5IVZB 1JGLL 1FC1A 4XCCH 3QUML 3BZEA 3RA7H 4R7NB 1J88A 2FJFB 3TBWA 4PJBB 3E2HC 1H8SA 5GZOC 1I8KB 2KZ1B 4XNMB 5F3HB 2Q6WA 3RGVC 3RBGA 5BS0A 4KTEH 4C4KT 3WO4B 4C4KO 1MQKH 2W92A 4LLQA 4XPFH 3LPWA 3MRMA 5A43C 2MCPH 5BCAA 1QFWL 3SJVD 3ZE0E 1MFNA 1IT9L 1QSED 4TNWF 4M43L 2R2HB 4HUUA 3H7BB 4LU5L 3VE0B 1KF9B 3LZFH 4WW1B 1HINH 4M9OA 1CL7H 3C2AH 3M17A 5FA3A 1TZHB 1E6OH 1E0OB 5C8JB 2WLYA 4BH8A 2ZSWB 3WFHA 1XZ0A 2HTKC 4NGHL 4NP4L 3MFFA 5J11C 4E0RA 2FWOB 1RZ7H 4KQ3H 1A5FH 1VPOL 4WVRA 2BCKB 3GO1H 5L2KE 2H2PD 4P2OA 5DWUL 5DD5L 1SY6H 5IBLC 4JR9H 3IJSA 4FQXD 1TDQA 3VGGA 1EO8H 3O9WD 4MJ5A 4M4PA 1FRGH 4TRPL 3TYFA 1OGTA 1VFAB 3H3PH 4EIGB 1QVOB 3FAXA 3BRFA 4OM1H 4FZEL 2HFEB 3WDHA 2B1HH 4M6OL 5C09E 3N85H 3WE6A 1ACYL 4CMMB 4KTDL 1T5WA 1S7VA 2A83B 3W5MA 2JB5L 4GLRI 2IG2L 4V2CB 5EZOL 5HYFA 3HNSL 3R1GH 4GKZA 1OM3L 5MENE 1ZT1A 2G75B 3ESVF 4F80A 1YEIH 1H3PL 3ES6B 4WY7H 4BH7B 4L3CA 3QDJD 1RZIB 1FVCA 4OF5A 1CICB 2H8PB 1M7IA 5IB2B 4WI2A 1FLRH 3QFJD 3UJTL 3OTTA 5MEOB 4MB5A 2GJZB 2WWMD 3S35H 3HMWL 5DHYA 3P9LA 4OFYD 5I9QC 4AMKH 4GH7B 5LGKA 5EFIA 4OZGB 2A2QT 1GGBL 4FFWC 4M8QA 3DIFA 2YEZB 1DVFA 25C8H 1ZVSB 3EAKA 3QNZA 3WIIH 1H3GA 3P30H 4DUWA 1IC4H 1BOGA 2XKNA 2R15A 2V17L 4PJBF 3BKYL 3MLRL 2DTMH 3L7FA 2XZZA 2WANA 4ORZC 4ONGH 4HCRL 3UJIL 2FX7H 1I9IH 1PKQB 3FZUD 1GGIL 4L8SA 3ZSSA 3V6OA 5KVDH 3OX8B 1GRWA 1XF4A 1A64A 1NFIA 2DLTA 2VDQL 1P5UA 2X5PA 3U4EA 4PGDA 3W39A 3DX9A 5JOPE 4ODXA 5GJTL 4ZUTA 4PJEB 3BXNA 1NGWB 4JRXB 2HFFA 4ZTOL 1OWRM 3UEZA 1NEZG 5DJ6A 4YGAB 5KTEL 4N8VA 2NY1D 5E70A 4QHLB 5FOBB 4OFIA 5IJVA 1KTKE 5K9JL 5SWSA 2CXKA 4U1GB 1S7QB 2ESVA 5INCB 3F7YB 1JFQL 5C0FA 3PE9A 1HOCA 4Z0XB 1EEYB 4G6KH 3T1FA 1ZLSH 3LN9A 1JP5A 3ARWA 1PX3A 2X6MA 3VGAB 4PGBA 1L7IL 4UNUA 3UTSE 5FECB 1UADC 4NQXA 3V4UL 2A9NL 3VI3F 1A4KA 1SEQH 2X89A 2VLKE 3TH3T 4XVJL 5FO8A 3BD3A 1MI5D 3T4YB 4X4YB 2PW2A 4S1RH 1C7TA 2IQAA 1CDIA 2YBRA 3I02B 2UWEE 1RK0A 2CGRH 2P5EA 4PGCA 2G5BB 1MRFL 1NBVH 2EDNA 3VI4F 3QWOB 1KTRL 4K94L 2F54B 3PIQA 3VRIB 5JXEA 1MHCB 1YECL 1YYMH 2D0HA 2C5DC 4N0YH 4K3GA 3WDJA 1Q0YL 5I8OL 1BM3L 1R5IB 4QRRA 4UT9H 1CFQA 4PJ9A 1BEYH 1IFHL 3OGOE 5L88L 1QBLH 5BXFA 3P73B 4ODSH 2F74A 5GS0H 5KSBA 3W11D 4ETYA 1MJ7H 3TC9A 5D2LB 1AR1D 2GCYB 5HY9A 3HMXA 1X44A 5A16A 1MH5A 1QLFA 4QEGA 2W9DL 1J0IA 4QNPE 1LHZA 3BHBB 5TGBA 1I3RA 4IEFB 1NCBH 1DBKL 4RGOH 1Q9LB 1N0XH 5JW5A 3VFNA 4Z77A 2O5YH 1K8IB 4OZHA 1PZUB 2GK0A 1YY9C 1HHKB 3VMOA 4POZD 3RDTC 4S2SB 1Q72L 3OKLB 4I8DA 1M7XA 3GIVB 1JI2A 4JFQA 4OZGF 3NN8A 3F12B 4U6XA 3BGAA 3IKKA 4U1JB 4OZIE 2G9HB 4OZ4B 4QRPB 2EYTA 3U46A 5I1HH 2NZ9C 3I3DA 2UV3A 5E2WL 5T5NF 2EEAA 4D9RE 3WSQL 1IC5L 4OGYL 1IEBB 3DSNA 1S7RA 4DN4H 5TH2A 1EAPB 4PJEF 4J4PD 4MXQD 2VSCA 1VGEH 5A2IH 4NKMA 2VDKL 1G7LB 1HYSC 3EKCA 4XCCL 2H41A 4LRIC 2MTPA 5B21A 2JCCA 5HHQB 3HUJE 1IM3B 1ODAA 5DC4B 5L8KB 4KTEL 2R69H 2Y4SA 4XPFL 2YXMA 3F8UB 5ANME 5KSUB 4WHYG 1KPRB 2AGJL 4IRJB 1XCTA 1WVZA 2QEJA 1P7QD 1HINL 1XAUA 3RHWK 1CL7L 2JJTA 3C2AL 4BFBD 3HTLX 4O2EB 3O3AB 3KPRA 4B7LA 3RJQB 3W2DH 3QO0A 4S1DC 5IW1A 4KGLA 3K1DA 5TDPB 1FJ1B 3ZT7A 4KQ3L 2VH5L 1G7HB 5TQ2L 1JWSB 2Z31B 2RIKA 1XIWA 1YDPB 1SY6L 2R1WB 1BD2B 3CX5J 5I74C 1AHWA 5HI5D 1J0YA 2IQ9L 5JNYA 4K2UH 5KSAD 3O2VH 4JQIH 4PJCE 4PJIE 4YIQA 3RWHB 1FRGL 1H5BB 3PDOA 4F33B 4CNIA 1MHPH 5D2LF 1R3KA 1I7TA 4KI5D 3WDIA 3SGKC 3BN9D 2YPLE 5HD8D 4BA8A 2RFXB 1DEEB 3O8XB 1BBJA 2BY2A 1NMCB 5EUOA 1NSNH 5J9PB 4WWKC 2YD6A 5D2NC 4HH8A 1MLCB 3IXTA 4UBDD 3O6LL 1KBGH 2J88H 4PS4L 1FLRL 1ZWIB 1SM3L 4H0GA 2EE9A 1GCFA 3IT8D 4M3KB 5LBSL 1FO0H 1BVZA 1JK8B 3S35L 1UXSA 4DGVL 2NXYC 3IFNH 4JCMA 4N5UA 1HHGB 5SWZA 4F15C 1J0KA 2VLJB 3TNNB 4QOKE 1PW3A 3D2UD 5F88B 3RTQC 2YPVH 3MRDA 5T1KD 1Y0LA 3S36L 3C8DA 2NXZB 2V5SA 1I1YB 4F58H 1A6WL 1HHIA 5C86A 4JDTL 4Y5YA 5HDBE 4CW1A 4LARH 1G7JB 3PWJB 4OCNC 1E4XI 1CLYL 1IE5A 1U2HA 4HS3B 3D69A 1JE6A 2AEPL 3QEGH 4NWTH 4JZNB 4KVNH 3M8OL 4FG6D 4P4KC 2ZOLA 3MRQB 5IGXL 3U0TB 3UBXG 2BDNH 3QO1A 4M8VA 5DMKB 1M7DB 1OTTC 1CGYA 5L9DH 3MLSL 5EOTB 1I8IA 5KOMC 5BRZA 3UTZB 1ZA3A 2G60H 2OL3H 2BP3A 3CXDH 2IGFL 3H9HA 3MGTA 5CAYB 4MCZA 1UEYA 4X99B 3KR3L 3VFUB 4CADB 3MRCB 1I1CA 4EDWL 5I8CB 1C5CH 2R4SL 1W72L 3GMMA 5JHDA 3CVIL 2ZUWA 2H9GA 3D0LB 4R8WL 3NCYP 2HRPH 4KQ4H 3QDMA 1T7ZA 3TLRA 4I3SL 3O2DA 2RHEA 3CK0H 1C12A 3VFSB 1XF2B 3CLEL 3MV7D 2JE8A 3BWAB 4N0YL 1I1RA 4L9LC 3SN6N 4YO0B 4P5MB 4ZQKA 2F53A 5E8OA 1DUYB 4PP2B 5GS0L 1IM9B 3O6FB 3CFEA 1U8QB 1LNUB 4CL7A 2ZP0T 3LRSA 3MV9B 3GUTA 4E42A 3UO1H 3SJVE 4DW2H 3WFBL 1QSEE 3MGOB 2V2TB 1EO7A 5CBEB 5IEKB 1AJ7H 3D0VB 1G6RB 1PLGL 4BFIB 3VXRD 1MF2H 2VZUA 4GUPA 5IMMA 3LS4L 1NAMB 5I1KH 3DMMA 5J4MA 3NGBB 3L9RA 3QIBD 2ZUXA 1F97A 3QB7C 2BVEA 5I18L 3TFKA 4YHYC 1MHEA 1Z9OA 4Q9RL 1TETL 5C0IB 1CDJA 3Q5YA 2F5AH 3VH8G 1X5FA 4MAYB 4JB9H 3QWRD 4H88H 1X7QB 3KYKL 5IFJB 3CSPA 4DN4L 1SYSB 2AABL 1EHLL 4OQ1A 4NO0A 5IFAH 4TUKH 3BEWB 3IDMB 4G6FB 4M93B 1UJTA 4NO5B 3E6FB 4NHUE 4KK9C 1AKJB 3MNZB 4QWWD 1KEMH 3RUGA 3UTQA 4EN3B 1DLFL 3G6DH 5IESL 2PXYC 1CD8A 4UQ3B 4U6HB 4XCYB 1BVKA 4MXWL 1RD6A 2FCBA 1MRCL 3VCLB 3JV5A 5C0AA 3MRIB 5CZXC 3QXAA 3MODL 4OUOA 5D6DC 5EU3A 3QDJE 2FGZA 1UWXH 5DEZA 4XWOD 4M7ZC 4P5KA 1YN6B 3QFJE 4XP5L 3DX6B 2EO1A 1XEDA 1S78C 4RMRA 5FUOL 4NYLA 2ARJQ 2VLLB 4OI9A 4NIKB 1E27A 4H26B 1MIMH 2FJGA 5EA0L 4FQPA 3ARBD 1UWXK 5E6ID 4YHZH 4PP1D 3MR9B 4QYOB 3IGAB 1OP3K 2WBJD 3OAUH 1AXTL 2ICCA 5DK3A 4YXLH 3QZWA 4NFBA 2NTFA 3TV3L 3P3YA 4K8RD 2P46B 1MWAL 2AJVL 5IKCA 1UYWL 1HI6A 5CBAA 3UPRB 1X5GA 4TYUA 3G9AB 1P69B 3VFGL 4IOSD 4OCRL 1AH1A 5E95B 2PO6B 3HB3D 1LK3H 5HGAB 4PYHA 3EJZC 4RMUA 2HTLD 1JYWA 1T89A 1NSNL 1O7SA 4M3JA 3EDDA 1ZT4A 4QTIL 1DBMH 1RHHB 3ORJA 2IBZX 3WD5L 2FB4L 2GFBB 1LP9E 4NT6B 4B41A 3RKDC 4U2YA 1GJIA 4MSWB 5E5MB 2YA2A 1HXYA 2R0LH 3F7PC 1J8HD 2JJSA 5FYLH 5SWQB 4TULL 4PJDE 4LSRL 4N0FB 4ODVH 1CR9H 5JDSA 4FQJH 3QQ3B 4ZXBA 3U7YH 1GGCH 1LO2H 5KVFH 2F8OA 1MI5E 1RZJH 3BIBX 4WO4C 2HG5A 1OCWH 2VLMD 3EJYC 3RRQA 4LSVL 3OBAA 1UCTA 4G8GA 5B39G 3QNYA 2W9EH 3DX7B 1C5DA 5IB1A 5HVWA 1FL3B 4JHWH 4N5EA 3PP4H 1QLEH 2ADIB 4KC3B 5ICZA 4NKIL 1FE8L 1DCLA 3KPQA 4MDIA 4JG1L 1NFKA 4V2BA 3JWOH 2AEIT 3B2VL 4Z76B 1HQRB 5BVPL 3E3QC 4BM7A 4NKDB 3LKSA 3GBNL 3LKQB 1G7QA 4U6YB 3QEGL 2FDBP 5E6YA 4F37F 5CILH 2HFTA 1MCLA 2XPGA 2ZG2A 4M1DL 4WEMB 2J8UF 3RWFB 4Z6AT 5E08H 2V2WA 4DFIA 2LU3A 3HMXH 4UIKL 4DQOH 5JIPA 3GRWH 4V1DA 4P46C 4PJ7A 3VDCA 5L9DL 2D9CA 5T1MA 1BAFL 2BNRB