2A83A

Crystal structure of hla-b*2705 complexed with the glucagon receptor (gr) peptide (residues 412-420)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Conformational dimorphism of self-peptides and molecular mimicry in a disease-associated HLA-B27 subtype.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a83A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2a83A01
2P1YA 1Q0XL 1UB6B 4PJ7F 4JFHD 5IBTH 4ZSOA 1BVZA 1BQHB 1SEBA 4I5BA 5F9WC 4PJ8C 2J5LC 3D85B 2X4TB 4KDVA 5CZVH 3BW9A 3O9WC 1HEZB 1UWGH 1D6VH 1JGVH 5FYKL 3W39A 4PJBF 4GXUM 4S1QH 1CZ8L 4Z6AT 3FCTB 1A7BA 4R4FH 5GGVL 4ZD3H 3V4UH 4OQ1A 3SCMC 2ESVD 4PJ7A 5JOFA 4F15B 2LTQC 2NNAB 4WO4B 4HFUL 1U8NA 3MODH 1AGEA 4R7NB 3PWPA 4ZYKB 5BXFB 5DVMA 2OMNA 3NIFE 1X5GA 4GJTB 4MA3B 1X6NA 4U49A 1AO7D 3HG1B 5HJ3A 4ONGH 4HIJA 4LKXA 4NN7C 4PV9B 4PJBA 5D1ZD 3HI1A 4D0CB 2FCBA 1I7RB 3P0VL 4EUPH 3OAZH 4BQBA 4MXWH 1MPAH 4MX7B 2QQLH 4DEPB 4NT6A 4UDTB 1UJTA 5T5NF 1KC5H 5BJTA 1GAFL 3K7UA 4F9LA 4N0CA 3C08L 3MLVL 4U1LB 1EFXA 4NQDA 5I15L 3SKOA 1GJIA 5LQBH 2VH5H 4Z7QF 2VZTA 4F57L 5JXED 3W9EA 2H6PA 5KG9A 4FXKA 4MAUL 5F7FA 4F2MB 4L8DB 4UOJA 2PTTB 3SGEI 5ESQB 1N5AA 1S7QB 3BPLC 1RVFL 4OFKA 5GSRB 1G7HA 1A6WH 1ONQA 4DOHE 3KXFE 4JJHA 1MFCL 3ZMRA 4B7LA 5KSBF 2FB4H 3C5ZB 2V5MA 2MQ3A 3EYOB 1C8PA 1N3NA 4JPIB 3CXDH 4MJIA 5GJTH 3O8XC 3DX9B 2BSSA 3VD9A 4LEOB 4X4ZA 3S35X 2OJZH 5AWNL 4JE4B 1JZ6A 1G9NH 3C8KA 4Z95H 2CRYA 4L29A 1CF8H 4FS0A 3PWUB 4D9QD 3TM6A 3TVMC 5KSBA 4ENEC 2EC8A 3ZL4L 2QKIA 1TZHA 2VN7A 3OG4B 12E8L 4YO0A 4QHNB 2CDEA 1LP9B 3F7VB 3UTOA 5EZJA 5IHUL 4XAKD 3JV0A 1W0VA 5CJOH 3DIFA 4GBXA 5HDBE 2DD8L 5FECA 4TSCL 3E8UH 4FZ8L 4POZD 1X5IA 4N8VA 4DWHA 3GKZA 2APWA 4PS4L 1AFVL 2CSPA 4G8EA 4XVTL 4Y2DD 2VLKE 4HT1L 2VXUL 3NAAH 3RY6C 2BSRA 1EAPA 4KRPD 3MA9H 1W8OA 1XCQB 4HZAA 1VFAB 4G6KH 3UAJD 3W11D 3DVNA 4GAGH 2CUHA 4OM0L 3BH8B 1PD6A 4WEBL 5ALCL 1U8IB 4KI5E 3MZGB 5DRZB 2DQCH 5D7IE 4G8GA 2ITCB 1UC6A 5DUPH 4HH9B 3H0TB 1WIPA 3HLAB 3CFKB 1OP3H 1F4XL 3Q5YA 1OPGL 4NYLB 1DQDL 1TPXC 5JPNA 1XGTB 2EIZA 3ARDD 5E5RB 3PHQB 4W70A 4O58L 1ERNA 2EE2A 1TCRB 2D7QA 4UNUA 4PPTA 5E2VH 2VQ1B 5CD3B 3HPJB 3SDYH 5JR1L 3IXAA 4LIQH 4I18A 5KJRH 1XF5A 1H15A 5DDHB 5EN2B 2V17L 1YC8A 1IL1B 1R3HA 3MRNB 4JFDD 3DSNA 4UB0L 3S4SG 1S5HB 1A7PL 1IEBA 1JZ4A 1IAKA 2PF6A 2GY7B 3JWOC 3EYQD 2ZP0T 1D5IH 3ZKQD 1I4FB 4WNQB 2BNRA 2GJJA 2R2BA 3QUML 4NRZA 3GNMH 3QXVA 4IMKC 3RX7A 3GBML 4EIZC 2IANE 1U8MA 5C09A 1CDGA 1CL7I 1PQZA 2C3VB 1JHLH 4P5MA 1BIHA 3NIGF 5BVPL 1LO4H 5IB5A 4PY8J 5MENA 5DR5H 1RUAH 4YQXH 4Y4FB 4DOHB 5DXWA 1IEAB 5L2KE 2BZDA 2IPKB 3H9HA 1FZOA 3MXWH 5FYJD 1QLEL 3N1MC 4PP1C 3MBEC 4ZUSB 1BZ7B 4S1RH 4CU6A 1MQKL 2B5IC 4HWEL 2XWJA 3QDAA 1WAAE 5HY9B 2NXZD 3O3DB 2NY6C 5IQ7H 3CSGA 1ZT7B 5EZIH 4BQCA 3LB6D 5CGYC 1N0XL 3C60D 2EH8H 4NWUH 2AP2A 4D2NA 2DQGH 3LB6C 1ZTXH 2XI9A 5A40E 3EO1A 3OAYK 4JG1H 3RVTD 4XP4L 3BPNC 3AREC 2EYRB 3TBYB 3INUL 1I75A 3QXTA 2BSTA 4XMKH 3VCLA 1L6ZA 5EULV 4MCYB 1MWAH 4I8DA 3MRFB 5IHZA 3KPRD 1FGNH 4JO4L 4QRQA 1XIWD 4LCUB 2Q8AH 3QIWC 1N5YL 3CGTA 1FL6A 1CI5A 2OLDA 4I48B 5KTEL 4HF5L 3OHXA 4TN9A 4ELKB 2VLKB 3OKEA 4WWKD 5E8NA 5ICXB 3MLPA 2IBZY 2UUDK 3IFOA 5J6GB 3HMXL 3FQTB 4ETQA 1U3HB 4XGZA 1IAOA 3VFSB 4TNVF 4YXLL 1D9KA 1A64A 3H9SB 4LLVA 5FYJU 1GGTA 3WN5C 1PJ9A 2AJXH 2EECA 2BP3A 3HI6L 3OZ9L 5D7IB 4HHAB 3LEVH 5DJXA 1EO8H 1FZKB 3QXAA 5DEGB 5EBWA 5IWLC 4U6XB 3UYOD 5HYQB 2WAHA 4JQIH 4G43B 1K9TA 4NQCE 4EUPB 4BSWB 2DQHL 2DOCA 4LIQE 3L3DA 2XTJB 4M7KH 1A7OH 4RZCA 4P23B 3LQAH 4MA7H 5T1KB 2YD1A 4YGAB 4I0PD 3TBSA 3WHXA 5JW4R 5E8OA 1FQ9C 3NCFB 1TXKA 3N06B 3QNXA 3RVXC 1GL4B 2HFEB 5HTSA 2VDMH 5GZOC 4K71B 2NY1D 5GRVK 3TJEL 1P6AB 4MA8H 3MFFA 1RZ8A 5FUOH 5J12C 4U1HA 1S9KC 4P4KB 4APQB 1QSED 3OKDB 4D9RD 4MS8D 4QXGL 2ESVA 3IB4A 1CICB 1S7WA 1IC4L 1YN6A 2X4PA 3L3HB 4WRLA 2GUOA 3M17B 5DO2C 2XV6B 1S7TA 1NBVH 2R29L 4OB5H 4YR6A 2CKBA 4OZFA 4ACPA 1B4RA 2ILLA 1AO7A 5I73B 3L3GB 1EJ6A 1JNNL 5K9KB 4JKKA 5D1ZA 4HBCL 2FO1A 3ELAT 4JVPA 5INCB 3QIUB 3G5VB 2GJZA 3C2AL 3HE6A 4PRBB 3Q3GB 4NKOA 2PYED 3L5IA 4Q9QL 4XTRC 5AAMA 1D5MA 1T1ZB 3ARRA 1JRHH 5DMGC 2MKLC 3OKKB 1BWWA 3PQYE 3CX2A 5DQDL 1NPUA 4OUUA 3MMEA 1LE5A 3BPOC 3BDXA 3V95A 3VXPB 3FT3A 4IOFC 4O2FB 4MD0B 1V3JA 3MYJA 4G7VL 2OP4H 4X98A 5JXEA 1I8MA 1KTRL 5IGXL 5DLMH 5HI4D 2Z31A 4Y4KB 4OT1L 2NY3B 4R0LC 5IJVA 4UILH 4PP8C 2Q86A 1JZ5A 1ZHLB 4ZSOE 3RGVC 3N50A 4IOIA 3QZWB 3NA4A 4HUUB 3K1DA 2F54E 3REVB 2HRPL 5DA0B 2Y06L 4OZGF 3UYRH 3G5XA 5D1XD 1IQDB 1F4HA 2APVA 1HXYA 1IC1A 1I7UB 4PJ7E 4M5YL 2F58H 1EUUA 3REWB 4G9FA 3MLRH 4NNPL 4IRSD 3VFMB 2X4OA 1ZLWH 4NUJB 4LLUA 1GC1C 3VD5A 2UZIH 1NGQL 4OZGA 4PUBL 1IGFH 2W9DH 3UDWC 4PJBE 4XH2A 2A1WL 4P3CH 1UG9A 4OLXL 5I30L 3D2UD 4PJIB 2VAAA 4NRXA 1Q9LB 5J6HA 4EDWL 4L9LB 1CXKA 4NN6B 4LKCA 4QHMA 2DN7A 2V7HA 4FP8L 4QTHB 1XF3B 1H3VA 2CLVA 2JJSA 3OGCB 1J0YA 4RX4D 3TN0C 1CG9A 4P9MH 5BZDB 5EOCL 1YEEH 2JJWA 4Y2DA 1HKLL 4NQDE 3MSPA 3QDGD 3BKYH 2EZ0D 4WTZG 4AJ0A 1XGYH 5IVZB 4W6YB 1MHHA 5C3LD 5K59F 2ZUWA 3ILPA 3LS5L 4YLQT 1LDPL 4H0HB 5GS1A 2Z8VC 3O6LL 2ARWA 1F00I 3MRGB 3ARGC 5TE4L 2N1KA 4DZ8A 1EVUA 4BUHA 4L8CA 5DJ6A 1U3JA 3AB0C 4JM2B 1T0MA 1ZLSH 5F9JB 2HFFB 4OLYH 3BIKA 5EBMB 4BQ8A 4Z7QE 2PXYC 1KIRB 2Z9TA 3DMMC 3EO0B 2DLIA 2VXVH 2X89A 4NQTA 4OFYA 4ZOBA 1ZGLM 5GRZA 1R3JA 1JUFA 3FT2B 3LAFA 4OLUL 3D0LA 4ZAKB 3GSXA 4KTYA 4MJIE 4JM4L 2DM3A 3JTSA 3SDDB 1HHIA 4TQEL 1R0AL 1YDPB 5GXBB 4TUOB 5HHVH 2Z4QA 5T1LB 1NCWL 3CFJB 4KJQC 1A9BB 1BX2A 1KN4H 1BOGB 4JFDA 5KSBE 2D03L 3EHBD 4NHUA 1XR9B 2AEIT 1WBXB 3PP4L 3RWCB 2EEBA 1ULVA 5C0JB 5T5FL 3E6HA 2FHBA 3BYYA 2X40A 3ARYA 3CCHA 2H45A 2B4CC 3DV6B 4JG0L 5B4MC 3CUPA 4MAYC 4M7JH 3EDDA 4K7PX 2R1YB 4KQ3H 4Y1AA 2GHWB 1T03L 5DYOB 1MWAB 3EOTL 3FZUC 1JI2A 1P6FA 4TULH 2ZPKH 4WV1A 5TF0A 4ZSOB 4LK4A 3BHBA 1SEBB 4I5BB 2EDTA 1JZ7A 1QACA 3SKMB 5EU6D 1H9VA 4MMXC 4WFFE 1DR9A 1J8KA 2V2TA 1CGSL 3BW9B 3W39B 4O4YL 4FQXC 4KTDH 1Z9MA 4QXTA 5GRYA 4OGXL 3QCVL 3ZDZF 4PJ7B 5JOFB 1K6QH 4G8GE 3C60A 4YHML 1U8NB 3UXFA 1AGEB 3PWPB 5C0AD 1KJMA 5HVHB 4JHZA 2FX9H 5D7LE 5ENWA 1KCUL 1FRGL 5HJ3B 3UJTL 1U36A 2APFA 5AZ2H 5C0GA 4HIJB 4LKXB 4PJBB 3HI1B 2HFGL 1TIUA 3IDXH 5DVLA 3BKML 4EIGB 2WY3A 4PV8A 3KPRA 3PG2A 2X42A 3LKQA 3FONA 1K3IA 1XIWA 4NT6B 2PR4L 1MFBL 5GGRA 2OK0H 1TTFA 3U48A 3SQOH 2MKWA 3MNVA 5BJTB 2FBJH 5CFHA 3PF2A 4CBPA 4ODWA 5ADOH 2VO5A 1EFXB 1OAQL 4WWKA 4NQDB 3IAPA 4GMTL 3SKOB 1WFOA 5IB1A 4J8RA 1BAFH 1A5FH 1OTTC 2H6PB 1JCKA 3IU4H 4LLAA 1RU9L 1YQ2A 4XB7A 4FXKB 3W9EB 5E2WL 1N5AB 4FG6D 3BO8A 5JDSA 2RJMA 3EKCA 1G7HB 2CKBH 4OZFH 4KHXH 2ADFH 1ONQB 4JY5H 3GSRA 1GGYA 1I1RA 1OARL 3THMH 4QF1A 3MOAH 1JIBA 2VITA 1N3NB 4MJIB 2X41A 4I0PA 2BSSB 5FYKD 4JJ5A 3VWKD 2VAJA 1T2JA 3C8KB 4M00A 4GH7B 3OB0H 3RIAK 4L29B 4DN3H 3VWKC 2YD7A 5KSBB 3S3PA 1QSEA 3QUZC 2P8PA 4MS8A 3V4VH 1SJEA 2QKIB 1TZHB 1QOKA 4YO0B 5EOQH 4YIQA 2CDEB 1UWXH 5EZJB 4LSPL 1CLYL 3WNPA 3IFNL 4O9HL 1W0VB 3WBDA 4RISL 2IALB 1P53A 5TQ0H 1LEIA 3DIFB 4GBXB 4KK9C 2GSGA 4HCRA 1RMFH 3D3VD 5FECB 5A2IH 2DQTH 4N8VB 4IOSD 1KCSL 2B7DT 2VLJD 3QULA 4G8EB 3DETD 1KJ2A 4FZEL 2PYEA 4OFPA 2BSRB 1EAPB 4S11A 1A3RL 2QV2A 3P9LA 3VXRA 1WUNT 5F72S 5K33A 5D7SH 1WIUA 5DMIH 3DVNB 1F4WL 1S3KL 1FSKC 1LWRA 1FHGA 5DS8A 5DEZA 5LGHL 2H9GA 1EK3A 3KS0J 1OAUH 1WWWX 3EAKA 4G8GB 4LRNH 4N1EA 3VGAB 4Q9RH 4MDJA 1A0QH 1AJ7H 1VGEH 3H2WA 4KHTH 4WJ5A 2DDQL 1FCGA 3VFRA 5JPNB 2EIZB 5C0RH 3UJIH 3CDCA 3MJ7A 1I8KA 4CL7A 3EJYC 1K2DA 2PW1A 4QXUL 5HDLA 2VMFA 3RL2A 2C3WA 3IXAB 2QL1A 4I18B 1XF5B 1UENA 1H15B 5C07E 5C0FA 1R3HB 5D1XA 3Q6FA 3RWIA 4M1DH 4HUNB 1IEBB 4JO2L 4NBXB 1IAKB 4Y4HC 3BAEL 1DBBL 2HT4C 4HGKC 2BNRB 3QAZC 4IRSA 4WEMB 3HZVA 5KW9L 2R2BB 4NRZB 2EDDA 4JR9H 4WU5A 2N7BA 1DZBA 1AO7E 1U8MB 4JHAL 3C09C 3KLDA 5C09B 5H35A 4M7LT 1N6QH 4TOYL 3D2UA 5KSUA 1PQZB 4ERSH 1T66C 2C1OA 4P5MB 4V1DD 5IB5B 1KUMA 2CJUH 5MENB 5I6XB 2R15A 3VFOA 3RWDA 3H9HB 3HNSL 1FZOB 2CLRA 5K93A 2DKMA 1BGXH 1JZ8A 3C9NA 3PGFL 5E24E 4KK6C 2XWJB 5GGSY 3QDGA 1IGCL 3IJSA 4AEIL 4YEFA 1AY1H 1A6ZA 3GMOA 4JDZA 2EDWA 5F8QC 4XP6H 4H5SA 4LLMA 3V0WH 4ESKA 1K4CA 3VRJA 4JPWL 1WITA 3LS4H 4Y8DC 1HNFA 4S1SH 3LCYA 2IG2H 1N7MH 3EO1B 4F7MA 4OSUH 1ZANH 3GJFK 5KVDH 2VZOA 4JGMA 2BSTB 3VCLB 3ALXA 2LU7A 3MRBA 5FO7A 4K7PL 4BYHA 4HJJH 5IHZB 4K3JH 3VFGL 3IJYA 4QRQB 4R90H 4JGUA 3RKDD 1D5ZA 1FL6B 4ZODA 2VN4A 4UIKH 3OHXB 5FYJH 2A38A 4G9FE 3OKEB 1IGML 5E8NB 1EV2E 4M93C 4D9QE 3IFOB 1IGIL 3L3OA 4ETQB 5D71H 4OZGE 4XGZB 4X7EC 3A67L 1IAOB 3U0TA 4Y16C 4XPBH 1D9KB 2YN3A 2AAVA 4FQQA 4LLVB 1UM6H 5EBGA 1C5CH 3V0AC 3RBGA 1AXTH 4DGVL 2DLEA 1V05A 3DARA 5DJXB 2X1QA 3IDNA 3QXAB 5EBWB 4FTVD 1NAML 4LCCA 5H94A 1NUNB 3L3DB 4AMKH 4RZCB 3GEWB 4JRYA 5DHYA 1FNHA 4L4VD 4WUKL 3TBSB 3TYFA 3WHXB 5E8OB 3ARTA 5C2UB 3QNXB 5EU6A 7FABH 1O5DT 1XT5A 2IAMD 5DHVA 3RFZC 2HN7A 5F6HI 3UBXI 4WFED 5C86A 1WT5C 3TBWA 4KJPC 3MFFB 1RZ8B 3JV6A 3F12A 4FOMA 4U1HB 3EYUH 4WHCA 3KPOA 1BVKA 2PO6C 3JVGC 2ESVB 4RGOL 1FJ1A 1S7WB 1YN6B 2X4PB 3MLZH 2GUOB 5BQ7A 2NY2D 2EDRA 1S7TB 3VDBA 4YR6B 2CKBB 4OZFB 4LLQA 2ICWI 1T80A 4BFIA 1EXUA 5CBAA 3DVGA 1AO7B 4FFWC 3R4DA 3QCTL 5D1ZB 1BQHG 4R6UA 2GJZB 3HE6B 4NKOB 3HB3D 1D5MB 4JFDE 3C6LC 4LU5L 4Y5YC 4OLWH 3ALPA 2EDKA 2Y36L 4OUUB 1L7IL 4M8QA 3MMEB 4EN3D 4ODTH 1LE5B 3RNQA 1FZMA 1ZLVK 4M61A 1PYWA 3FT3B 1WEJL 5HHXH 3MYJB 1YY9D 4X9HA 4X98B 1I8MB 4Y1AE 2DM7A 3BD5A 2C3XA 4IDLA 3WLBA 1YYMH 1A6VL 4HC1A 2YXFA 2Z31B 1RIHL 4I1NB 5IJVB 4I3RH 5F9AC 2Q86B 3QR2A 3JV5A 4IOIB 4OQTA 4U1SA 4ZFZA 5T33H 5TDOA 2BHUA 1LNUA 4HCRH 1G7LA 4FFZL 2IF7A 4NJAL 1GIGL 1MQ8A 2EDXA 3U4EA 2QR0A 3RHWF 4RMQA 2YEZA 5HGGS 1KJ2H 2EDQA 2ID5A 3G5XB 4P0DA 4YHKH 2GTWA 2DKUA 4HBQA 1RZKL 1HXYB 5IMKA 3VGHA 5SX4H 5FV1L 4HUVA 3NMEA 5L9DH 1NDGA 1CYGA 4KTEL 5ITBL 3HE7A 4G9FB 4ZTPH 2ZUQC 4NC1E 4G6JH 2X4OB 4FFYL 4JB9H 4R2GC 5EC1A 4LSTH 3TJHC 2AJ3A 1ODAA 4OZGB 3S98A 1P4BH 1Z5LA 4N9GA 1DANT 2EIBA 4XH2B 4K94L 1NDMA 1KJVA 4NUGL 3ZDZE 2NTSP 3VGDA 4XP5L 2VAAB 4NRXB 3CDGA 3KPRE 1QRKA 4C4KO 5J6HB 1E0OB 1U2CA 5BW7C 1DVFD 4TTDD 1IBGH 1I1AD 3K8MA 4LKCB 4QHMB 2V7HB 3D3VA 4C59B 5CEZL 2CLVB 5HGAA 2VLRD 2Q7YA 1CG9B 4XXCC 2VLJA 4Y2DB 1UJ3C 4KRPB 1NCDH 3ZDXF 1MHHB 1X4ZA 3ILPB 1FFNA 2BK8A 5GS1B 5F7EH 5FM8A 4DZ8B 1FIEA 4WCYH 1AGCA 1FL5A 4L8CB 1A7QH 4OJFH 5DJ6B 1LO5A 2P44B 1T0MB 1I1FA 5CCKL 3A6BL 2CH8A 3BIKB 2ICEA 1F58L 3RI5K 2ICES 1KXQE 1MCEA 4OBRA 1R3JB 5DVNA 1JUFB 5F7DA 2WLZA 3V2AR 1P7QD 3D0LB 3DGGA 3GSXB 3NH7L 3S8WA 3JTCA 3SEPA 1CIUA 1MRFL 1HH9A 3JTSB 3H42H 1HHIB 1PSKL 1F8TH 5TPWL 2Z4QB 1CDIA 4X8XA 2J88L 2ZG2A 4CADA 1BX2B 2OXGA 3T0VA 4JFDB 4B7IA 4P59H 5FGBA 1QSEE 3BESR 1PKOA 2YZ1A 4NHUB 4D9RE 1FH5H 3CVIH 5J11C 3E6HB 3CU1A 5HHMD 5IBLC 3CCHB 3BDYL 2WLYA 2P24A 4PLKC 3CUPB 1I1CA 4FFEX 1OTUC 5DZLA 5AAWA 3MRLA 1F2QA 3EUUA 2XXCB 3L7EA 4YBQD 4JZNA 3F62A 1PKQA 1BREA 4WV1B 4I3SL 4V1DA 4Q9CA 3AGVA 2PYEE 3BHBB 2O61A 3G6DL 5I0ZA 3VXRE 1NGXA 5L88H 3BWAA 4U0RB 2V2TB 1G9ML 2YSSA 3I3DA 4N1CA 4K9EC 3GMPA 3GI9L 1BJ1J 3GRWL 4QXTB 1AXSA 2NY4D 5JQ6L 4W4OA 2FHCA 2NXZB 3WSQL 4U6YA 1PBYA 2BHYA 2RB8A 1MFEL 3RBSA 2VL5A 2I25N 3NZ8A 3ULVC 3C60B 2O5XH 3NCYP 4HLZG 5HHOD 1KJMB 5ENWB 4ZFFA 5C0GB 3NA9H 2A77H 4PJ5D 5L0QB 4R7DA 4UMGA 3VI3F 5E8PA 1X5HA 3LPFA 3WXVH 4XC1H 4PGZA 2XQYG 3U7AA 4R97B 3VFTA 2DMCA 4PV8B 3KPRB 1NGPL 4XAWL 3T0ED 3WNNA 3LKQB 3QQ3A 3FONB 3CLFH 1XIWB 1QFWL 4X7SL 3I50L 4KK5D 4QT5A 5GGRB 4S1DC 2AVGA 4BELD 4ODSL 3VD3A 2ZNWA 4JRXD 3MNVB 3FN0H 5D7KE 5FGRA 3VXSD 3I6GA 4XVJL 4KQ4L 4NOBA 4WU7A 4ODWB 5DHVH 2VDKL 4LRIA 4GG6F 4WWKB 2A6JA 1IKNA 1WZ1H 4AM0A 4O02L 1HYSC 5IB1B 4B0MM 3L6FA 4J8RB 1T21A 2BERA 1OAKL 1A2YA 2YPVH 2WANA 4NO3A 4GKOA 1F5WA 4OCSH 4RDQF 2AJUH 3QUMA 3QO1A 2G2RA 2NY7H 4TRPL 4CJ0A 5C6PB 3BO8B 5JDSB 4XI5D 1ITBB 1RIUL 4EI5C 4GG6A 4XI5C 5CKAA 1BM3L 3GSRB 4Y19D 1RURL 1OAZH 1ORSA 1IGJA 1CXLA 3BUTA 2D4FA 5JXAL 4FTVA 4UTBH 3BEVA 4KPHL 1VENA 5EO1A 4QF1B 4JPKH 2VITB 5I76A 1FVDA 1M71A 1IKFL 3QDGE 1MFAL 4L4VA 4I0PB 5JHDD 4JJ5B 2Y6SC 2HWZH 1MIMH 4Z77A 1OAXH 2XN9E 1LO0L 3V6FA 2NY1B 5I75B 2IAMA 2WWKT 5LKNA 4LPXA 3KR3L 3TGXA 1DN0A 1QSEB 2P8PB 3BD4A 1SJEB 1ED3A 4M62H 4YIQB 1BLNA 2W0LA 2DM4A 4HC1H 2FGZA 2IBBA 3U0PA 4V3DB 2R0WL 5GRUL 4EUPG 1LEIB 4OQTH 3QDJD 2XY2A 5ETUA 4HLJA 2GSGB 2FJFA 2AK1H 5BV7L 4XBPA 1Q0XH 1S7XA 3QULB 2J2ZA 1KJ2B 4EBQL 2PYEB 4M5ZL 1Q9WA 4IMLA 2E8ZA 3C5SA 3LRHA 3P9LB 3VXRB 3RDTD 1BEYH 4NC2B 4HKXA 1UZ8A 5FYKH 1JGLL 3GBNL 2HVJA 2IWGA 1CZ8H 3HMXA 1J86A 3IAQA 2DWEA 3O41A 5GGVH 3VMNA 2DL9A 5C7XL 2ITDA 1JK8A 5IROA 5DS8B 1IFHL 1QFWM 2H9GB 4DFIA 4HFUH 3ZE0F 2EDLA 1UM5L 3BPCA 2HG5A 2AABL 1AGFA 2EYSA 4HAFA 1G0DA 4MDJB 1BIIA 1X9QA 4LLWA 4WJ5B 3O6FC 3VFRB 4JRYE 3FRUA 4AYFA 5I1AA 1XEDA 3MJ7B 1ZLUK 1I8KB 3TC9A 3P0VH 4LGRB 3N85L 2X09A 1K2DB 2PW1B 4HGMA 5EU6E 3RL2B 3I75A 1PY9A 3LPGA 4E41D 2A6IA 5MEOA 1CWVA 5C0FB 5D1XB 3Q6FB 1GAFH 3RWIB 1L0XA 3JWDC 1WBYA 3C08H 3MLVH 3LMJL 3TF7C 1AI1L 5DC0A 3DLQR 5I15H 3K81A 3O3AA 1T89C 4XXDA 4F57H 3SQBA 3SOBL 2B39A 2XWTA 4IRSB 2WINA 2W91A 3HZVB 4B41A 4MAUH 4Z7NF 3TPUA 1JN6A 4WU5B 2R4RL 5INDA 5IFJA 1VKXA 3TYGL 3IDMA 5H35B 3D2UB 1EJOL 1CDCA 4WI5A 3NN8A 5KSUB 1XMWA 4UV4L 2C1OB 1MFCH 5HYEA 2WK2A 5SX5H 1MCRA 3VFOB 1CLOL 1DVFA 3ARZA 3B9KC 4P5TD 3U36A 3HAEA 3RWDB 1FVCA 2SEBA 2CLRB 4IRJC 2B1AL 1ZWIB 3BYTA 2YRPA 3C9NB 4S0UC 3QDGB 3OQ3B 2CPCA 5AWNH 1Y6MR 1T5XA 3IJSB 3OF6D 4MXQD 3I85A 1ZGLA 3ETBF 5SV3A 4BH7B 1A6ZB 5SWZD 3GMOB 4JDZB 2HMID 2OI9C 4H5SB 4LLMB 3RAJL 1K4CB 3PWJA 3VRJB 3ZL4H 3GIZL 4F7MB 5LXGL 12E8H 1F3DH 4BFEA 1ZAGA 4XC3L 5IHUH 1Q38A 5GS2D 3MRBB 4RGMC 5FO7B 2DQFA 1WBZA 3K4ZA 5C0CD 1YMMA 2DD8H 4TSCH 3IJYB 4FZ8H 1DQTA 1P7QA 4M4RA 1D5ZB 5HSFA 1B9ZA 2EDEA 2R9HD 4PS4H 1AFVH 4XVTH 1N2RA 2DI9A 3GKWL 2DQEL 4HT1H 2VXUH 1OGTA 5EU7C 2R69L 3ARBC 1MEXL 2VLMD 3DYOA 3L3OB 2YC1A 4NKDA 4XNQA 1X5XA 2OTPA 3U0TB 2C4FU 4KRMB 4OM0H 4PJ8A 3BRFA 5FM4A 4WEBH 2JK5A 5ALCH 4FQQB 3T77A 4P46A 4MA1B 5HHMA 4JDVA 1R3IL 5IJKC 3EJZC 3T2PA 1MRDL 4YNYA 4OM1L 1F6AA 1F4XH 2EIEA 4X9IA 3IDNB 3D3VE 4LCCB 1OPGH 5H94B 5C3TA 1DQDH 2V9RA 4NPYA 1MNUL 4IS6A 2Y4SA 2WBKA 2FGWL 4JRYB 4BQ9A 3SBWC 4I2XE 1B0WA 1AC0A 3TYFB 1Z9LA 1WC7A 4HWNA 3BRGC 5JR1H 4IJ3B 5EU6B 4U1IA 2V17H 2C3HA 4YDLB 2O5ZL 5DHVB 2HN7B 2FSEA 4UB0H 5DMJB 1TVBA 3TBWB 5TH2A 1A7PH 3F12B 3JV6B 5IEKA 2F8VA 4GKSA 3KPOB 1BVKB 5D2LE 1WZMA 3MOBH 2XG4A 1WVZA 1OLLA 5F7LB 1E28A 1FJ1B 2NR6C 3QUMH 3WCYA 4LVOB 1KT2A 5BQ7B 3ZDXE 3GBMH 5HHOA 3E2HC 4LLQB 4BFIB 1EXUB 5MI0B 4Z7VF 5CBAB 3DVGB 1PG7W 4KUZL 1K8IA 1JGDA 4PJ5A 9CGTA 5EB9A 5EG6C 1VFBA 5BVPH 2A9ML 3W5NA 2EKJA 4ZS6C 1ZVSA 1N59A 3MLYL 3LN4A 5FKPA 3T0EA 5CJXC 1QLEH 1RZJL 4UNVA 2P7TA 1X7QA 3PUCA 1RJLA 2IPUG 4JRXA 1MQKH 4HWEH 3DI3B 4M8QB 4O51A 1CDYA 1AH1A 3RNQB 3KG5A 3FHQA 4YHZL 1FZMB 4M61B 1PYWB 2PTVA 1N0XH 4F80A 5CP3A 3HR6A 4R4NC 1B3JA 1W0WA 1N6UA 2OX5A 2ZOLA 2D7NA 3BP7A 3WLBB 4XP4H 2E8YA 4WHDA 3KAAA 3INUH 1PKQE 3WO4C 4WDIA 4X4MA 3B8SA 4JFOA 4V1DE 2MCPL 4ZFZB 4U1SB 5TDOB 3AVEA 3KNBA 1A4KA 1LNUB 1G7LB 4Y19A 1YEJL 4JO4H 4WHYH 3U4EB 1U58A 2QR0B 1BD2D 5GSVA 2YEZB 4YHYC 1N5YH 3CVHL 3E3QA 4S2SA 2GTWB 4FQ1L 1G6RL 1KOAA 5KTEH 4HF5H 3HZKA 5LBSL 5IMKB 1UCBL 3ZTNL 4HUVB 1NDGB 1J1OL 5E6ZA 2P48B 3HE7B 1QQDA 1YNKL 3HMXH 5F9OL 5EC1B 4YXLH 4MQXD 3S5LA 5T5NG 3B2UC 2AJ3B 3MRHA 1Z5LB 1JNLL 3RL1A 4N9GB 1NDMB 1KJVB 3ZDYF 2P8MA 3BIAX 1KFAL 3TO4D 3HI6H 1RUML 1W8NA 2E6PA 3BX7C 3OZ9H 3CDGB 5E6ID 4MJ6A 3KPSD 5JO5A 3QDJA 4Y0GA 2DQHH 3D3VB 1OM3L 5HGAB 2Q7YB 1BVLA 4WFGD 1L4IA 3SDCC 2VLJB 3BDBA 3VXUE 1HILA 2VE6A 1BZ9A 2DRUA 3RDTA 3TJEH 3BKCH 1FFNB 3WFZA 1CL7L 5D7JD 1AGCB 1G7MA 2APTA 1FL5B 1CU4L 2X5PA 4QXGH 4XHJC 3EGSA 2FWOA 4HGWA 3SJVD 1LO5B 3FT4A 1IC4H 2HTLC 1JI1A 1I1FB 2G60L 4GG6E 1TDQA 2ICEB 2R29H 4FTVE 5E2JA 3G04A 4K8RL 5F7DB 4N8VG 1JNNH 2C1PA 2HTKD 4HBCH 2HT3D 3DGGB 3ILQC 3V8CA 2H1PL 4F7EA 2HLFC 4L4VE 3C2AH 1HH9B 3HAEH 1KXTB 5DJ0A 3O81A 4Q9QH 1CGXA 4XP9L 4ZXBD 5I1JL 4CADB 2OS7A 4E41A 3RZWA 1SBSL 5DQDH 3AY4C 3KPLA 3MROA 3S35H 3OJMB 2E7LE 5ERWA 4RSVA 4Q6IC 4Y5XC 5I71B 1RZ7L 4G7VH 4AIOA 4NZJA 5D93B 1J8HD 2P24B 3STBA 1T1XA 4ZO7A 5FM5M 2H8PA 1R5WA 5IGXH 1MJUL 4BM7A 3MRLB 5E2UL 4OT1H 5SV4A 4QHUA 3R8QA 1LGVA 3ZHKA 4HIEA 4X5WA 4ZO9A 3L7EB 3MUZ1 4JZNB 1QSFD 4MD5A 1PKQB 2VC2L 5CEZD 4V1DB 1KULA 2FD6L 2O61B 5HYIA 1H8NA 2HRPH 3MPCA 4NJ9L 1NGXB 2Y06H 4JEGB 4P5TA 2IMNA 2W1NA 3BWAB 2YSSB 3HN3A 1HNGA 3GMPB 4P2OD 1BJMA 1ORQA 3U9PL 1AXSB 3QRGL 4M5YH 2Z8RA 4U6YB 4JKWA 1HINL 3OF6A 5FFLA 4NNPH 4MXQA 2VL5B 3NZ8B 1HK6A 4OZHF 5SWZA 5M95B 1S7UA 1NGQH 4XPHL 4PUBH 3MRKA 2A1WH 4ZFFB 4OLXH 2VR4A 1XFPA 5I30H 2RR3A 4R7DB 3TNNA 5E8PB 3O45A 3CPLA 3ZE0E 4EDWH 4F8TA 3VFTB 3ESUF 3MUGA 4L3AA 4OZHA 2KQNA 5C0CA 4FFVC 4FP8H 3QQ3B 4U2YA 2ZG3A 5CLWA 5I16A 4QT5B 2V5RA 5EOCH 2F5BL 2DKSA 5F96L 5CUSL 1HKLH 3S37X 3U4BL 3I6GB 3ULUD 4WU7B 4H25A 4M7LL 1SYSA 5TDNA 2A6JB 4JREC 3LS5H 2HJLA 1A22B 3MJ8A 1LDPH 4AM0B 2XZCL 3L6FB 4ZUWA 4Z5RA 3O6LH 1T21B 5J56B 1A2YB 5TE4H 4NO3B 3SE9L 3QUMB 3QO1B 1KJ3L 2G2RB 4KGJA 4K7FA 3RRQA 4OGZA 3Q6GH 3T0WA 4N5UA 4GG6B 2UVEA 3R1GL 4Z7NE 1ORSB 1IGJB 1D7FA 4FTVB 4OLUH 5KANI 3BEVB 5TE6L 2X2YA 5E03A 1J1XL 5IESH 25C8L 4JM4H 5I76B 4TQEH 1R0AH 1FVDB 1M71B 2WBJD 4L4VB 3WFEL 1NCWH 4HXBL 4Z77B 3CH8A 4YK4C 3V6FB 4RMUA 2D03H 2IAMB 2BSED 5F6HJ 3IU3A 3ERYA 1S9WA 2FDBP 5E8DL 3PP4H 1HIML 4GRWF 5JOEA 4H1LG 1DN0B 3PV6A 2ZG1A 5T5FH 5CP3H 3X17A 4F3FA 5E9DD 4YH6A 4C54A 4MVBD 4M6NL 1ED3B 1BLNB 4JG0H 4XT1C 3GIVA 5CINL 1TJIH 1YMME 3U0PB 1T03H 3PIQA 2ICWJ 3DX8A 1YEDA 5KVMC 5K9OA 3EOTH 5ETUB 4G8IA 2FJFB 2E7MA 4XBPB 4LGSB 1S7XB 5AZEL 4BJLA 4UIMA 3U7YL 4HH8A 4R0LA 2NLJA 2BC4B 1Q9WB 5F8RC 5E1AA 4IMLB 3C5SB 1CGSH 4HKXB 1UZ8B 5FYLL 4O4YH 2GFBA 2HVJB 3QEQD 1JYVA 4OGXH 3QCVH 2WP3O 2DWEB 3O41B 1H3XA 2ITDB 1JK8B 5HHME 2KZ1B 3G6JA 5LGJA 4RMRA 2YRLA 4GRLC 2EC9T 2QSQA 4YHMH 1V7ML 2HLAA 4DKFL 3BPCB 2HG5B 1AGFB 2NZ9C 2EYSB 1KCUH 1FRGH 1UADC 3UJTH 1NCTA 1BIIB 4LLWB 3RTQC 3V4PL 3KYOA 1NAMA 4OCMC 2HFGH 2QADD 3FRUB 4LOUC 5I1AB 1MLCA 1P5UA 1OT2A 3MTRA 3BKMH 5C0BD 1BF2A 3I75B 1BD2A 2NXYD 2PR4H 1MFBH 5GQBA 3GSUA 2A6IB 5MEOB 3FFDA 3L1OL 3KLHD 5T3XL 2CRMA 1CS6A 4M4PA 1WBYB 1MCWW 1CXHA 1OAQH 5ANMA 4GMTH 1JGEA 3O11A 3O3AB 4XXDB 3B2VL 2XWTB 2WINB 1RU9H 3KJ6L 1BBJA 1KG0A 1NMAL 4X7CC 3TPUB 1JN6B 3O2WL 5E2WH 5INDB 2VOTA 4PREA 5IFJB 4GKZA 3PJSA 1FG2A 1VKXB 4PJ5E 3IDMB 3KPQA 1J88A 1ADQL 3NN8B 3W0WE 3TO4A 5E6IA 5DUBA 4HD9A 2AEWA 3OGOE 4J6RL 4JHWL 5DWUL 1OARH 3DYMA 3T0EE 1DVFB 3U36B 1R24A 4F15C 4OCRL 3HAEB 1UXWA 4J7RA 1FVCB 2SEBB 4WO4C 3P77A 4Z7VE 4ZNEE 4U4BA 1LQSR 1F45A 2OQJA 1N26A 2GCYA 1W0YT 2E27L 3LD8B 1FC2D 2D0FA 1T5XB 5L8KB 2Y1VA 4F37K 1ZGLB 3JUYA 5IKCA 1IRAY 1S9VA 5MHSD 3PWJB 5D7JA 1H3WM 3BUYA 3D87B 4DEPC 2QEJA 2K7PA 2MPAL 4X4ME 4YHPA 3SJVA 4EKXA 1MOEA 4BH8A 4XVSL 5DURD 4BK5A 4LSPH 1CLYH 3IFNH 4O9HH 1VDGA 3GM0A 4Y19E 5C70A 4RISH 2MSPA 2DQFB 3ZYOA 5DJAA 1WBZB 1YMMB 4BZ1L 3ZKND 3E3QE 1P7QB 2R0ZL 1YEHL 1KCSH 1JBJA 1L9NA 1N2RB 1A8JH 4NM8L 4FZEH 1OGTB 5L8JB 3H8NA 2CIKA 1L0YA 1A3RH 4ZXBA 1IGYA 4RRPA 1FE8L 5DC9B 3RY5A 4XZUA 1WIOA 2YC1B 2F8OA 4NKDB 4XNQB 4F33A 1EFQA 1F4WH 1G1YA 1S3KH 4PJ8B 1U95A 5IW3A 4M03A 1IJ9A 2JK5B 5LGHH 3C5ZC 1I8LC 3HNVL 1HOCA 3LKPA 1I85A 3T77B 4P46B 5HHMB 4JDVB 3H7LA 1J8HA 3GK8L 4LHUD 4YNYB 3QDJE 1F6AB 1I8IA 3QQNA 5GS2H 2DDQH 1GXEA 2Q3ZA 4M9OA 3VA6A 1DQLL 4NPYB 2A2QT 1QSFA 2AV1A 4DN4L 3DHMA 3ZDYE 4QXUH 4MB5A 1WC7B 2CD0A 1PW3A 5HDOA 5KOVC 4U1IB 2FSEB 1MAML 1TVBB 4P2OA 5TH2B 2WNGA 3S37L 1P2CA 4GKSB 4JO2H 2NY4B 3BAEH 1DBBH 3CDFA 5ECJE 4G59A 3EOBA 1E28B 2NMSA 2W0PA 3WNOA 5KW9H 1KT2B 2MWCA 5HHOB 2FX7L 3WJJA 2ED7A 2YOCA 1F90L 1K8IB 1HZHL 1JGDB 5DZNA 4OZ4A 4TOYH 4PJ5B 3BN3B 2BHZA 1KLUA 1T1YB 3U0WL 1VFBB 4AQOA 2NY5L 3UTPD 3LIZL 1IM9D 3TCXA 1ZVSB 4HG4J 1N59B 1NH6A 3LN4B 5FKPB 3HNSH 3T0EB 4E41E 4JFYA 3ZHDA 1U8KA 4JY4A 4JFED 3S7GA 1NCAL 4N5EC 2P7TB 4A2LA 2MFNA 1X7QB 4HIIA 2R2HA 1RJLB 4KV5F 4JRXB 3PGFH 3VXSB 4O51B 3ZHLA 3UPRA 1PG7L 1IGCH 4AEIH 1PZ5A 4OF7A 2P42B 4UINL 2RGSA 2BY1A 4AL8L 1BJ8A 5BOPA 1W0WB 3QUYD 2ZOLB 3ARVA 3BP7B 3CFIC 4JPWH 5FDYA 3G9AB 2AJSL 1MJ7L 3UO1L 4WDIB 4MQ7A 4JFOB 4WY7L 4JKPH 4Y89A 4K7PH 3KNBB 1A4KB 5HI3D 4G80A 4Y19B 4RGND 3VFGH 4GRWH 3FRPA 4NCC1 1U58B 5HI3C 5DF0A 3EDKA 5D6DA 5GSVB 3SKJL 4G7YL 4S2SB 3QIBD 1EUTA 3DJ9A 3HZKB 2B20A 2WBJA 4BSVA 1IGMH 1G1CA 3GRWA 3QEGL 1QQDB 5SWZE 2ERJB 1IGIH 1EVTC 3KXFD 5ACZA 4RFEB 2EDNA 3A67H 1VERA 4NC0B 4Y4FC 3S5LB 3EIFA 2D2OA 2FYYA 3MRHB 2AQ3A 3RL1B 5E9DA 5IF0A 2P8MB 3EFDL 4DGVH 4BUGA 4MJ6B 4OZHE 5C0CE 4PB0L 5JO5B 1B4JL 1YA5A 1MRCL 1IILE 4M43L 1NAMH 1XZ0A 4HJ0C 4W6WB 3QDJB 4RFOL 1QR1A 3KJ4B 4WEUD 5FIEA 1BVLB 1IZJA 2HKFL 4WUKH 3ARFD 1QYGL 1HILB 2VE6B 2VLME 1BZ9B 2OTWA 1V3KA 4U3CA 3GI8L 2IC2A 3RDTB 1QBAA 4AT6A 2E9JA 3QEQA 1G7MB 2FRGP 2IFFL 5GGUA 5DHXB 4HS8L 4KK8C 1GGCL 5M7QA 3EGSB 2FWOB 4HGWB 4RGOH 3FT4B 3CZFA 2OJEA 1T7WA 4TNWK 4RIRA 2O5YL 5IHBA 1H3GA 4RMTA 4PG2A 1I3RA 3G04B 1KCVL 4J23A 4HX1A 2C1PB 4WI4A 3QCTH 4NFDA 3EDFA 4PGDA 3K8KA 4F7EB 1U3HC 4FHBD 3VXTA 1EPFA 3VWJD 3CH1A 2VYRE 5I17A 1YEKL 5EZLA 2A0LD 5DJ0B 5EU3A 2G75A 5C0BA 3SGJC 4KI5D 4LU5H 3D1MC 4PLJD 4XX1G 2AERT 4MHHG 4E41B 4W4NA 2Y36H 4KI5C 2EEDA 5CD5D 1L7IH 3RZCD 3P4OA 3KPLB 3M1BA 1C1EL 3MROB 1PEWA 3I84A 5JDJA 5CD5C 5TJWK 1WEJH 4R3SA 5ERWB 4GXVL 2XTJC 4XPTL 1VEMA 4P23C 5SX4I 1ZKAA 4JFQA 1T1XB 2H8PB 1R5WB 1A6VH 4D3CL 1YNLL 1RIHH 4GRWE 3CX5J 1F13A 4K71C 4QHUB 4APQD 1TMCA 4HIEB 4MD5B 1VB9A 3E1F1 1H5BA 1OT1A 4P4KC 5F7WC 3VDAA 4J4PC 4FFZH 4NJAH 1GIGH 3O2DL 3PL6D 4NP4L 4P5TB 1CICC 3IETB 2FZ3A 4N8CL 1TENA 1RZKH 2IAND 5TFSL 1ORQB 1ZVHA 4QRSA 2CDFA 4KTEH 5ITBH 3GUTA 4NQVA 2XPGA 5LG1A 1PVHA 2D9QB 5D2NA 4ALAL 2FR4A 2I26N 3AROA 3QIUC 5SWZB 4FFYH 1S7UB 5L2KD 1DCLA 1BFOB 1CDHA 5C0ND 1INDL 2W38A 3MRKB 4K94H 3BZ4A 2ENSA 4NUGH 2VSDA 5C0NC 4XP5H 4K8RD 4GG8A 3TNNB 4QOKD 1G9NC 3O45B 1Q9OA 3CPLB 2DYPD 3RVVD 5JLZA 3MUGB 4OZHB 5C0CB 3HR5A 4KDWA 4PBVC 1CFVL 5CEZH 5I16B 1X5AA 2NY3D 4JGJA 3MUY1 1L9MA 4CAGA 4U1KA 1J12A 4M6OL 4H25B 4Y4KC 1SYSB 5TDNB 4Z7OF 1JE6A 2HJLB 3MJ8B 1MAKA 1JMZA 4ZUWB 4Z5RB 3MZTA 3HRZA 4I0KA 2N4IA 1D3CA 1R5VA 3PWNA 4LCIL 5KSAD 2LVEA 4HMDA 5CCKH 1G0YR 5GJSL 3A6BH 4K7FB 3LH2L 4G6FD 5JZ7C 5J12B 5FO8A 1F58H 3WNMA 5BVJA 1P84J 4LHUA 2J7LA 4QWWC 5ISZD 5D4QA 3A0OA 2C7UA 2B0SL 3NH7H 4WFGE 1MRFH 5HI5D 1PSKH 3T4YA 5TPWH 1NBQA 2J88H 4HQQL 1QRND 3VRIA 3SE4C 1HWHB 3IU3B 1UH3A 4WWID 5E94A 1S9WB 4L9LC 1J1PL 4PJFA 1JYNA 4NQCD 1IZKA 3PV6B 4NN6C 3SJVE 3M45A 4F3FB 4ZPVA 3BDYH 3DROA 2X1WL 4G6AD 3GIVB 1FORL 4KKCD 3PIQB 3DX8B 1TZIA 1YEDB 3H3BC 5K9OB 4OCNC 1NAKL 4G8IB 3SE3C 1LD9A 2X10A 4GRWB 4WFHD 1AKJD 2DLTA 4P9HC 4I3SH 4C56D 5J0BA 1IM9A 4UIMB 3D48R 2JE8A 4R0LB 1J0JA 2NLJB 4JM2C 3OJ2C 3S96A 5E1AB 5HGHA 1G9MH 1HHHA 4JFEA 5F93C 1TZGL 3GI9H 1KIQA 3RIFF 2VDNL 3GRWH 2GFBB 4QRTA 2EXWC 5JQ6H 3SDXE 3WSQH 1OAYL 3CNKA 1KB5L 3ZSTA 4OD2A 4ZAKC 1MFEH 3G6JB 1FBIL 5LGJB 1WF5A 1J8HE 3SGDH 2HLAB 1AR1C 3SDDC 2H26A 3QUYA 5DQJA 1U91A 5ADPL 1XH3A 1RUQL 3LQMA 3PQYD 2DTML 3C87A 5I9QB 3KYOB 3GSOA 1NAMB 5CEZE 3TJHA 1MLCB 2BRRL 5AYUL 1NGPH 4XAWH 2N7AA 4YXKL 1BD2B 1P9MC 1QFWH 4X7SH 4L4JA 3I50H 3GSUB 3QPQC 4PD4J 1U6AL 3FFDB 4ODSH 3L3JA 4A6YL 3QIBA 2AKRA 4XVJH 3BJLA 4KQ4H 5I1CL 2DLHA 1U8OA 3PNWA 2VDKH 4GQPH 5J1SC 5ANMB 1JGEB 3O11B 1P7HL 2VDRL 4O02H 4YXHL 3KXFA 4XXCA 2W59A 4DCQA 1OAKH 4DJMA 2F54D 1JVKA 1BBJB 1KG0B 3CK0L 4JKLA 32C2A 4N8PA 1U8LA 4PREB 2YD3A 4TRPH 4GKZB 1FG2B 2D7MA 2C4XA 3KPQB 2VXQL 4PGBA 2R8SL 1RIUH 3TO4B 5E6IB 3SDAD 1BM3H 5DUBB 2OTUA 4YZFE 1RURH 3DX6A 4I9WD 2DQUL 1RUPL 2GY5A 5JXAH 3WFHA 1K4DA 1R24B 2PN5A 4KPHH 4WHTA 1UXWB 2YMXL 3P77B 2DQIL 5EUKA 3WLWC 1IKFH 1UYWL 2R0LL 3MQIA 4LPUA 1MFAH 2OQJB 3ARFA 2GCYB 5FYLD 1XGUA 3Q5TA 4XNMA 4RA3A 1LO0H 3VA2C 3S3SA 4PTTA 3GMLA 5IKCB 1OB1A 1OLZA 3KR3H 1Y6NR 1S9VB 5D7JB 5LAXA 5KVGL 4KV5E 3BUYB 3LQAC 1TJHL 1X5ZA 2MHAA 5T3ZL 4YHPB 2AJVL 3SJVB 5ID0A 3MV11 1OQOA 2DLFL 4BH8B 3HKFA 2W9EL 4HS6A 4MJ4A 2LVCA 3FQNA 4N0CC 4F9LC 1FPTL 5IW6A 2R0WH 5GRUH 6FABL 5DJAB 4Z78A 3EDEA 5BV7H 1IAII 3EFFA 3JBG7 1FO0L 2H2PC 5AG9A 3MV9E 3FQUA 3VWJA 5I1DA 4ZO6A 3CVHA 4EBQH 3HFML 1G6RA 4M5ZH 2CIKB 4ZXBB 2DM2A 1IGYB 4RMSA 1FFQA 1JPTL 2H32A 4XZUB 1J5OL 1JGLH 3GBNH 4F33B 1WTLA 3RZCA 2VZ3A 1HSBA 5C7XH 5E9DE 1KV3A 4H8WL 3TZVD 1U95B 3G5YA 1IFHH 3LKPB 1HOCB 3P0YL 3BP6A 3HNTL 3I3BA 4KXZI 1UM5H 5AYQA 1J8HB 2AABH 2WQRA 2YN5A 4U7MA 1DSFL 1I8IB 4PTUA 3TP4A 4OCWL 4AEEA 3SE8L 1VFMA 4GLRI 1QSFB 2Q3AA 2AV1B 4W81A 3N85H 3QUXD 2ZSWA 4YUEL 3MV7E 3PL6A 4PDCE 4LVEA 5C9KA 1S78C 1ACYL 1RUKL 4P2OB 2IANA 1MCWM 1WGOA 3LMJH 1P2CB 3SO3B 4C57C 1AI1H 5JA8B 5CJQL 3F5WA 3HC4L 4GBXC 4NOFA 4QLRA 3IJHA 5MERA 4HG4K 1TETL 3SOBH 4C58B 3EOBB 4GSDL 5EUOF 1I9EA 2R4RH 2F19L 5L2KA 4WFFD 1F11A 3TYGH 4XHQA 2R23A 1NANH 5IMMA 1BQLL 4OZ4B 1J0KA 1EJOH 1QLRA 3F7YA 4Z0BL 5LCVL 4TUKL 4UV4H 5BZWA 2XQYK 1KLUB 4QOKA 1WAAA 2F53A 5C0BE 2DYPA 2XA8L 1QFHA 4U1GC 1CLOH 3MLSL 4L4TD 1XGPA 1SBBA 4IDJL 5EUOA 4JFYB 1AIFA 2M26A 1U8KB 4JY4B 2B1AH 2YUVA 4P48A 4HIIB 2R2HB 1SY6L 1E4XI 3VGAC 1E27A 4LASL 5D7LD 5IHLB 4LSRL 3EYVA 3O2VL 3UPRB 4P5KA 4KKAC 5CZXD 1PZ5B 2GIYA 3OR7A 1MCDA 4AQ1B 4IIQA 1CVSC 2XYCA 3RAJH 1A14L 4EQ3A 1B2WL 3GIZH 1UGNA 4CMMA 1CIDA 5LXGH 4I18C 1CN4A 5KSAA 4XC3H 4PJXF 3TNMA 4UT6L 4MLSA 4PJAF 4MQ7B 1CGVA 5B3JE 4M8VA 4LSUL 1MCHA 4WTXA 4FABL 3P3YA 1YECL 4G80B 5ISZA 3FN3A 3TV3L 3AU1A 1BWMA 2XICA 3MA7A 3GKWH 2DQEH 3BEWA 1EHAA 5I8KL 2WBJB 2R69H 4PJXA 5JHLL 4PJAA 4BSVB 1MEXH 3QQ9C 1QRNA 1PDKA 5ACZB 5MHSE 5I6XC 1T6VN 2YA0A 3CFEA 2FYYB 4NQCA 5E9DB 2GITA 3K46A 5IF0B 1R3IH 3LRGA 4QGYA 3PXJA 3WEXA 1MRDH 4OM1H 5E08L 2P4AB 3OAZK 4PLNC 3QNYA 1XZ0B 3P9WB 3T0XA 1T20A 1QR1B 2X4SA 2A73A 1MNUH 1XF4A 2X70A 1NSNL 2W65A 1AKJA 4TPRL 4C56A 4KJWC 3DX7A 3GMRA 1NC4D 3SGEH 2QSVA 4Z95L 3R8BB 3O0RL 2OTWB 1CXEA 4XVUC 2ZOKA 3TESA 1XCTA 2O5ZH 4Y8AA 2ATKA 3GJEA 4NN5C 4AT6B 5FA3A 3UMTA 3QEQB 3X3GL 8FABA 5FCSH 2NW2A 5GGUB 3EYSL 4MB3A 3P4MA 3CZFB 2D7OA 2OJEB 4Z7OE 4RIRB 3P4LA 1EA9C 1C16A 5I19L 1I3RB 4KUZH 3PQYA 4WHYG 5DGQA 4HX1B 4PGDB 1D9KD 5DQ9A 2A9MH 5DFVD 2QADB 1I7ZA 1J10A 3VXTB 3CH1B 2Y5TA 2YZ8A 5JIPA 5I17B 2OZ4L 4KKNA 5ICZA 4G6ML 5EZLB 5I1HL 3MLYH 3C09B 3DTXA 2G75B 5EU3B 5C0BB 4DKAA 1BOYA 1YNTB 2E6QA 1WWBX 2BVYA 2QSTA 4YX2L 3IS0X 2NXYB 1RZJH 4CN6A 3B9VA 3X14A 3CX5K 3P4OB 4PP2A 3M1BB 2EYTA 5IFHL 4YHZH 3Q1SL 4QCIA 4R3SB 5MEPA 2XT1B 2P49B 4F7TA 2BOBA 3CDYA 2R2CA 1AP2A 2F54A 2NYYD 4JFQB 1GPOL 1ZHKA 2YR3A 4X6CE 5C07D 1GCFA 4HEPG 4ZNCD 1LHZA 1TMCB 2FECI 2MCPH 3UTPE 3PHOA 1OOAA 1H5BB 5BV7B 3SDAA 1Z9OA 1YJDL 5EZOL 2E3VA 1JGUL 1YEJH 1CFNA 3FOMA 4JFEE 2FZ3B 3ROLA 3CVHH 4ODBD 4FRWA 4FQ1H 3W9DA 1G6RH 3FN9A 4P2QD 1CD8A 5LBSH 1OQXA 3P0GB 1UCBH 4QRSB 3BQUD 3ZTNH 4P9HL 2CDFB 1J1OH 2H32H 1LMKA 3GUTB 1YNKH 4NQVB 2XPGB 3HE6D 4LARL 5D1ZC 1YEFL 5D2NB 3IAGC 2FR4B 5F9OH 3KWWA 3ZLQC 1OP3K 4M93B 1JNLH 2Z8SA 2DJSA 3BZ4B 1KFAH 4GG8B 5DURB 1RUMH 5J9PA 1Q9OB 4RGNE 4I13B 3HAEG 5C0DA 5JLZB 2Q8BL 3HR5B 1IT9L 3MV01 1OM3H 5JXEC 4J3VA 3P4NA 2Z31D 5CS7A 3DURA 3KYKL 2G5BA 4D0BA 4U1KB 3BXNA 1MVFA 1P84K 2K1MA 3WUWB 3HI5L 3P9MA 4JRWA 3SBWA 2ED8A 1CL7H 4L3ED 2V5TA 4YBHA 3HRZB 1AR2A 1CU4H 2W9LA 1R5VB 3PWNB 5TQ2L 3T08A 3TZVA 3TFKA 3NABL 5F44A 1ZA6A 5E5MA 2G60H 1NL0L 5FO8B 5BVJB 4G9FD 3WO3B 4LHUB 1ADQA 2IMMA 4K8RH 2CRIA 4CW1A 2FNBA 4XP1L 1FGVL 2C7UB 2H1PH 3RA7L 4E42A 4OF3A 1HXMA 1PX4A 4R9HA 2JJTA 3QUXA 3T4YB 1A7RL 4KMQA 3MR9A 3BKJL 4XP9H 5DGRA 5I1JH 3CZJA 1MVUA 1SBSH 4OKDA 3VRIB 1HI6A 5CHNA 4AIZA 1E4WL 5E94B 5TDPA 3F8UB 4PJFB 3BWUC 2NQCA 1RZ7H 1CK0L 4POZC 4ZPVB 3DROB 5E99L 1Q9KA 2H2SD 3LEVL 4X9BA 4AG4L 4Y2DC 1MJUH 4JQIL 3D69A 5E2UH 3BRDA 1TZIB 4KRPC 2BRQA 1FNFA 5DD3L 1A7OL 3QEUA 5GS1C 4Z76A 1BFTA 2VC2H 1HKFA 3UAJC 3W11C 1A4JA 2FD6H 1IM9B 3UX9B 4EQ2A 1A47A 2VDML 4NJ9H 4L4TA 2IPTL 5GGVY 3ZKXB 3ARQA 3S96B 5HGHB 1HHHB 4PRPE 2IPUK 2X89D 2YD2A 4JFEB 4OFYD 4XCFL 5C2BL 1KIQB 5D7LA 3U9PH 3WFBL 4QRTB 3QRGH 2J1KA 1N0LA 4CVXA 1HINH 4O00A 4OD2B 5T1MA 1ZHBA 3ARDC 5FUCE 2P47B 2H26B 3QUYB 4PD4K 4XPHH 5DQJB 5AUMA 2YD6A 3ULVE 4Z9KB 2BVUA 1U91B 4G3YL 1XH3B 4RCAA 1F6LL 4G5ZL 4R2GB 3GSOB 2A83A 1Y6KR 2YUXA 4YHOL 4U6VL 3CFCL 1OW0A 1EZVX 4RGNB 3BN9D 3EYQC 3SPVA 3S36L 2DBJA 3QHFL 4CVZA 4Y1AD 4QKXB 3L3JB 4OFVA 2F5BH 3QIBB 4O5LL 2AKRB 5F96H 5CUSH 4NGHL 3B43A 3U4BH 2EDJA 1U8OB 4UOW0 3PNWB 4M7LH 3VG9B 1JNJA 1JYWA 2XZCH 1TVDA 3KXFB 4NZRH 3SDCA 4WV1C 4DCQB 1RHHA 3N9GL 32C2B 4OFDA 3SE9H 2FLRT 2JB6A 4AENA 1KJ3H 1U8LB 1MELA 3T2NL 1B0RA 3S88L 2PUQT 5C08E 4U0RC 4XCYA 3WUZA 5ILTL 4QOKE 2F53E 4PGBB 2HJKA 4J1UA 2OTUB 5DJCA 3R1GH 3DX6B 2NXZC 5EUOE 3WFHB 1EEQA 1K4DB 1RD6A 5TE6H 4XPGL 1J1XH 4WHTB 3WS3A 25C8H 3C60C 5EUKB 4KWUA 4KRNA 4G9DA 3VXQA 3RJDA 3HUJF 1YPZF 1FAKT 3FB8A 3ARFB 3OTTA 3WFEH 3RVTC 1NC4A 1XGUB 4HXBH 4XNMB 2BVPA 4YC2C 5L0QC 2EE9A 4CGTA 3RVWD 4PTTB 3GMLB 3ZTJH 3VW3L 2UZIL 1OB1B 1HIMH 5BMFL 5LAXB 4P3CL 2AK4E 3V79C 5GS0L 1XIWC 2MHAB 2QQNL 4M6NH 5CJ8A 3HUJA 1YPZA 5ID0B 5E8EA 4PGJA 4WI6A 5CINH 4HS6B 2XXMB 3DXAA 5GRVL 3FQNB 5ISZE 5IW6B 5CSBA 4WWKC 4KRLB 4Z78B 2HT2D 2HFTA 1SVCP 3EFFB 4RFNC 5AZEH 1BBDL 1QLFA 3FQUB 3VWJB 5I1DB 4PJXE 3U7YH 3CVHB 4TVSa 4YGVA 4PJAE 1DE4A 3MLTA 1G6RB 3DNKA 1QRNE 2YKLL 2H32B 1R3KA 5FYLH 5EO9A 1OVZA 1ZLWK 3RZCB 3H3PL 1GRWA 1HSBB 2BVQA 1CQYA 4R26L 3G5YB 5TE7L 5J3HD 4JZJA 3BP6B 1V7MH 3QP3A 1ES0A 4KMTL 4DKFH 1ZSDA 1T2XA 4K23L 1JNHA 4I0PC 4RMWA 4RAVA 4M7ZB 5C07A 3P30L 4UZGA 4PTUB 5I75C 4WFHE 2NY1C 3V4PH 4C56E 4ZOEA 2LE9A 4PY7A 1FIGL 3WNLA 2ZSWB 4GW1A 3A6OA 3ME0A 4K3HA 3PL6B 4MS8C 1MSPA 1AXIB 1YN7A 4LMQI 1MFNA 3NCYS 1VESA 4U3HA 1IVLA 1JYXA 4URTB 5T3XH 3VRLF 4KKLD 3MJ6A 5JPMA 3CLEL 4P2QA 4DKDC 4XBGA 2IANB 1IC7L 3BQUA 3F5WB 2NY0D 1JF5A 3IJHB 5MERB 4KDTA 1X4XA 3B2VH 1P1ZA 3KJ6H 5T3ZD 5L2JA 1CE1L 1NMAH 4LQFL 3O2WH 5L2KB 3VXRD 3QDME 3RQ3A 4M3KB 1Z0MA 1F11B 3VFNA 3T1FA 2R23B 1CFBA 5IMMB 1FFPA 2AQ2A 1QLRB 2CMRL 1ADQH 3F7YB 3MCLL 4XWOD 5BZWB 3WL9A 4QOKB 1G7IA 2F53B 4J6RH 5A2FA 2DYPB 2PCPA 5DWUH 1QFUH 1IC5L 5I1IL 1XGPB 4OCRH 3QI9D 3V6ZA 5EUOB 3TPKA 1T7YA 1AIFB 1H3UA 4QYOA 4MQSB 3HCVA 3J8F7 1NCBL 1E27B 4F8QA 4DVRL 2E27H 3EYVB 2W0KA 3MRQA 4P5KB 5HI4C 3QHZL 5I18L 1H3TA 5EBLA 3HA0A 3OR7B 4IIQB 1C5DA 2DICA 3NTCL 1UKQA 4L3EA 1OD7A 4CDGC 4LP5A 4HXAL 4BZYA 2RFXA 4CMMB 3U2SA 2MPAH 1G7PA 2DJUA 5CMAA 3U79A 5KSAB 1QSZA 4XVSH 5D1XC 3VJ6A 5D7KD 3TNMB 3LVEA 4M1CD 4G6FB 3CSPA 4FQCL 2VRAA 1ZHNA 4I9WE 3ZKMD 1HN1A 4BZ1H 5ISZB 1N64L 1ND0A 3QG7L 5CBEA 2R0ZH 2CR6A 3AU1B 3O2DA 5E7FA 4IRSC 3PGCA 1YEHH 4NQEA 1DBML 5C0EA 3MA7B 4OCYL 2OR9L 4NM8H 5FYLE 3BEWB 2VXSL 4PJXB 3H3KA 2GKIA 3DYPA 4PJAB 3C8DA 1FE8H 1QRNB 5DD6A 3O3EA 1F3JA 1GSMA 2I27N 5FO9A 1UVQA 4L8SA 3NCBB 1AHWA 3CMOL 3CFEB 1FFRA 4NKMA 4OLZL 4NQCB 3L5WA 3KYMA 3HNVH 2ATPA 4DQOL 2GITB 2F74A 2ADFL 4AZ8A 2A6KA 1GOGA 3WEXB 4OF0A 3RKPA 1INEL 1LDSA 3UBXA 2EZ0C 2XN9D 3QNYB 1NFIA 2W92A 4IBLT 1T20B 2X4SB 2CK0L 2HKHL 1DQLH 2A73B 1OTSD 3QPXL 5HGDA 4DN4H 1XF4B 2X70B 1WTGT 2W65B 1AKJB 3H7BA 4C56B 5T3XE 1JP5A 4GKNA 3DX7B 1RULL 2ZNXA 4EDXA 3GMRB 3G08A 3L5XL 3OR6A 4D8PA 4BA8A 2ZOKB 4D9LL 2IFGA 1XCTB 2BX5A 2YD4A 4NO0D 2ATKB 1MAMH 1JFQL 3GJEB 3GZKA 5FA3B 3S37H 2ED9A 2Y9RT 4EJ1C 8FABB 5L7XL 2VDLL 3ESVF 2L4OA 1RY7B 5IB2A 3P4MB 1OWWA 5BO1L 3D39D 1X5LA 1NGYA 1UQSA 5T1DL 3GSNL 5F1NA 2FX7H 3IDIA 4PBXA 1F90H 3IDGA 1RHFA 3PQYB 1HZHH 2D4DA 2GK0A 2YPLD 2F15A 1T4KA 5DQ9B 3U0WH 2YK1L 2NY5H 3LIZH 4DGIL 2Q1EA 1DBAL 3EHBC 2Y5TB 4GS7B 5FUZL 5ICZB 4KGLA 3DTXB 5I0DA 1OD9A 1NCAH 3OB0K 3U30B 3X14B 3SGKA 4PP2B 1V3MA 1M1SA 1NLDL 2VISA 1PG7H 2EYTB 3TA3D 4LCCC 4QCIB 5DD1L 4JRYD 4OV5A 5MEPB 3TLRA 4F7TB 4UINH 3BMWA 1T7VA 1UWXK 2BOBB 4AL8H 1KN2L 1BFVL 4UV7H 2UY6A 5D96B 1AP2B 2F54B 3KPTA 5DMKA 3IKKA 1FYHB 1ZHKB 2AJSH 1C7TA 1MJ7H 4IJ3C 4U1JA 1I9IL 4P99A 4JQVA 3UO1H 3V8OA 5DEFA 1NFKA 3MREA 4WY7H 2WWMD 3PHOB 3NCMA 4MX7A 5CWSA 3SDAB 1LO2L 4L4TE 5E1HB 4D0DA 3BP5A 5JMRA 1CFNB 3FOMB 5HHPA 4N1HB 3T0DA 5B8CA 3ROLB 4G7YH 3SKJH 5F7KC 4LVOC 4U1NA 3MV8D 3W9DB 4BQ6A 5MI0C 1ZS8A 4K3GA 3QEGH 4YDKL 1S7RA 1QR4A 4DUXA 2HP4A 1KB5A 1HDMA 4ZG1A 1Z3GL 2VUYA 5GGTL 1Q1JL 5C6WH 3EFDH 5J9PB 2AXHA 4DW2L 4PJ9D 1KBGL 1B4JH 1MRCH 4M43H 2JKXA 5C0DB 3EDJA 4RFOH 5KG9B 4LCWD 4Z7UF 1MCOL 2J6EL 2R39A 2HKFH 3P4NB 1A7NL 1KELL 1YEIL 3DURB 1QYGH 2G5BB 2XWBA 4A6YA 3JWOL 4D0BB 4FG6C 3BXNB 3PWUA 5F1KC 3GI8H 4X83A 5I1EL 3P9MB 5D9SA 2XNAA 1J0IA 4Z7UA 2IFFH 3TEUA 1SVZA 5FHBL 1S5IL 4CVWA 4HS8H 3TZVB 1GGCH 3WFDL 1ZA6B 2AXFA 5E5MB 3W2DL 3VG0L 2VSCA 2O5YH 3HE7D 3QCUL 2VUOA 1KIPA 3GB7A 2BFVL 1JF1A 4CW1B 3G5ZA 4QHKJ 2E9BA 4E42B 1HXMB 1YEKH 4JO3L 3GSWA 3QUXB 3R06A 2E5EA 3MR9B 4RRPG 1YEGL 4HWBL 2AXJA 3HZYA 4I3GA 1AD0A 1MVUB 5B39A 2ZJSL 4OI9A 3MYZA 1HI6B 3WDJA 3U1SL 4AIZB 5TDPB 1C1EH 3VFPA 3D5OF 3CC5A 4MDIA 1UM6L 4FXGA 1RSFA 2LU4A 4X6BA 1OP5H 5HYJD 3HUJE 1YPZE 4GXVH 3T04D 4XPTH 2B2XL 3IVKA 3DXAE 1Q9KB 2NX5D 5K9QG 3NFPA 3NBNA 3DETC 2ZUXA 4P2CG 3WIFA 4D3CH 1MF2L 1CFQA 1AC6A 1CGWA 1YNLH 3PP3H 3D69B 5FOBA 3B6SA 1JMXA 4NNXA 5GHWL 1A3QA 1LO3L 3QEUB 4Z76B 1P4IL 3E0GA 2COQA 5I74B 5I1KL 1A4JB 1I3GL 1FO0A 3O2DH 4AEHL 1NC2D 4NP4H 1F3DJ 4YJZL 1IL1A 4L4TB 3VH8A 5A2JH 4N8CH 3QI9A 3UJJL 1BQUA 3RVUD 1NUFA 5FYKU 5I1GL 3NCJL 5TFSH 2YHGA 5D7LB 2X7LA 2G9HA 2OBGA 4CVXB 4YHYB 1K3ZA 5T1MB 4ALAH 1ZHBB 3OKLA 3JTTA 5IVXE 4JN1L 1P7KA 1NLBL 5AUMB 3U82B 1INDH 4X5XA 1J87A 2GSIA 4XCNA 1QP1A 2FEDD 1FYTD 4JPVL 5FAAA 5FGBC 1DLHA 2A83B 1WWCA 3C8HA 4PJCF 3EJJX 2OMBA 4HZLA 1OF2A 4WI2A 3RWJA 1CFVH 3SPVB 1A6UL 3ARWA 4O2EA 5I71C 4CVZB 4P2QE 3VDCA 5D93C 5E7BA 4M6OH 3QQ4A 3QDHA 4PJCA 4LSDA 1F6FB 3SDCB 4DZBA 1RHHB 4Q0XL 1J0ZA 2JB6B 4GT7A 3VRLE 4AENB 2O26U 4LCIH 1JV5A 5A43C 1B0RB 5GJSH 4XCYB 1TNNA 5IVNA 3LH2H 3LKRA 1KIUA 2HJKB 4J1UB 1F4YL 1L7TL 2GEEA 3FAWA 3FRPG 5D8JL 5DJCB 3HMWL 4W4OC 1Z9SA 2XN9A 4GAYA 3QG6A 2B0SH 3WS3B 3KLAA 5GZND 4G9DB 3VXQB 3FB8B 1SY6A 1NC4B 4OIIL 5IB3A 5BS0A 2BVPB 4HQQH 1S9XA 4LPCA 2C4FT 4L3EE 4NO0A 2LQRA 1NMCB 3HPLA 4UBDD 3H9SA 4RNRA 1J1PH 3CSBA 2A74A 1H0DA 3RUGF 1T5WA 4X6EA 4JFFD 3FQRA 3O6KL 4M48L 3RKDC 1SJHA 3HUJB 1YPZB 4ISVA 5E8EB 3D39A 2X4UA 3PABA 1M6OA 3VXUD 3DXAB 1FORH 4MD4A 3X3FL 4KKBD 4LRIC 1NAKH 1FV1A 3SGDI 4NQEE 1IKNC 1RI8A 2YPLA 4FXLA 3RUGA 1QLFB 4OD1L 2IH3A 4YGVB 3ZSSA 1DE4B 3MLTB 4HK3J 3KPMA 3CFDA 3MCKA 3DVFA 4DUWA 5F7EL 2GTZA 4EI6A 4FQHA 1TZGH 3UZEA 1R3KB 2VDNH 5EO9B 3AC0A 1GC1L 4KROD 3HZMA 2BVQB 1OAYH 1KB5H 3TA3A 1LK2A 3ULSA 1CLZL 1FBIH 4HKZA 4Z8FL 3I6KA 4JZJB 1KENL 1ES0B 4P2RD 4E0RA 4LP4A 1M7DA 1ZSDB 1T2QH 3LOWA 4BFGA 1JNHB 1X5KA 4OIBA 2XKSA 5ADPH 2PYFA 1RUQH 2W0FA 4M1GL 4RAVB 5C07B 3LSOA 2DTMH 4YPJA 2IAMC 1REIA 2X05A 2BRRH 4PY7B 1ZMYA 3LKSA 5DI8A 4GW1B 2D31A 4U0QB 5AYUH 5HD8D 3DBXA 4YXKH 1YN7B 3ORJA 4LVNC 1U6AH 3K4AA 4A6YH 3MV8A 5EC2A 5JTWA 5JPMB 4JY6A 4P2QB 2I07A 2NY2C 4XBGB 5I1CH 4Q97A 3BQUB 2MCG1 2EE6A 2XTLA 3CU7A 1YUHA 1FP5A 2VDRH 2J4WL 4ZFOL 4YXHH 2OCFD 3WS6A 1P1ZB 5GS0D 3CK0H 5L2JB 1S7VA 1CGYA 1JWSA 3HB3C 3VFNB 4DKEL 3QEHA 4MLIA 3T1FB 1JPST 5D1QD 5IP4A 2VXQH 2IBZX 1FFPB 2R8SH 5CP7A 3T1WA 3WL9B 4JQXC 3N1FC 4UOW1 1G7IB 5IMOA 4PJ9A 2DQUH 1RUPH 2PCPB 4EN3C 4NZTL 3JXAA 3P40A 1MUJA 5IROC 2OZ4A 3V6ZB 2YMXH 2P45B 4U6HA 4LCWA 2FJHA 4QYOB 2DQIH 1YY9C 3HCVB 1UYWH 2R0LH 4JFPA 2FATL 3MLXL 3T3MF 3ZE2F 4WGWB 1DUYA 1Z0NA 2YXMA 4QRPD 3MRQB 4DGYL 2ADJA 5EBLB 3WDHA 2B4CL 1UACL 1C5DB 5IUSA 1UT9A 1ZT1A 4L3EB 5KVGH 1NMBL 4K7PY 2IQ9L 1TJHH 4X99A 2A9NL 3MLUL 3U2SB 4R96A 3B9AA 5T3ZH 1G7PB 2AJVH 4PRHD 2ENYA 2DLFH 3VJ6B 2W9EH 1LQVA 1ZHNB 1FPTH 3BFOA 4MZ2A 4A2MA 1HYRC 6FABH 3EBAA 5EWIL 1ND0B 4F58L 1ZV5A 2Z91A 5CBEB 4LLUB 1FO0H 2I60L 2V9QA 3PGCB 3R0MA 4NQEB 4DK6A 5C0EB 4MQTB 3ROOA 3HFMH 3WUWG 1E4JA 1NCUA 1JPTH 1K85A 1FNSL 4YFEA 2WMPA 2X1OA 4MNHA 5DD6B 1J5OH 1VA9A 4OCSL 1MCPL 3O3EB 1F3JB 5FO9B 2VDPL 4YDIL 1UVQB 1T7ZA 4KY1H 4L8SB 1AHWB 4NKMB 2CLZA 4H8WH 1DVFC 3L5WB 3KYMB 4TTDC 1I1AC 5D2LF 5HYJA 1SHMA 2ATPB 3PDOA 3P0YH 4Q74A 3HNTH 2F74B 3IDYB 3R0NA 2A6KB 5HPMA 4I2XA 4LHUG 2MMXA 2NX5A 5HDQL 4OGAD 1ITCA 1JTPA 1DSFH 3LD8C 3UBXB 3K4DA 4RWYL 5FHAL 1NFIB 4OCWH 5DT1L 1MCNA 3SE8H 3T2OA 5HGDB 4GO6B 2JF1A 1XGRA 5D2LA 3H7BB 4YUEH 4GKNB 1NANI 5HYSA 1NC2A 4EDXB 3G08B 1F42A 3OR6B 5EU5A 5CSZA 4D8PB 4J3UA 1ACYH 5J7CC 1YMMD 4PJGF 1RUKH 4Z7UE 5CJQH 3HC4H 4NQXA 1CFSA 3V5HA 4CVUA 4ZMAT 4MZ3A 2LAAA 4M62L 2V5SA 4KH2A 5EOCJ 1TETH 3B3IA 5IB2B 3A6CL 4GSDH 1MJJA 1RJZA 3VXNA 1NGYB 2F19H 1UQSB 4FA8A 5F1NB 3IDIB 1MHPL 1ZEAL 5DJDA 3IDGB 4PJGA 1BQLH 2GK0B 4PJ8D 4Z0BH 3PDDA 3NFSL 5LCVH 5DMYA 1FYTA 4TUKH 4QRRD 1KCLA 1T4KB 3O9WD 4LVHB 2XA8H 3SKMA 4P46D 4MSWA 5HPOA 2BNQD 3MLSH 1EHLL 2W07A 3IDUA 1JTTA 4IDJH 1BEYL 4P46C 3SCMD 1T3FA 2K3TA 3TH3T 4Y1AB 2CRZA 1SY6H 3B9EA 5HVGB 4LASH 2VZUA 2K9UA 4LSRH 1B90A 4GAJL 1WZKA 3O2VH 2VISB 1D5BA 3T0AA 2ADIA 4YAQA 4OV5B 2Y25A 5T3ZE 4YBQC 1IAIL 5HVWA 1A14H 5DMKB 1B2WH 2Y5EA 3QHTC 2Y23A 2R2EA 4OTXL 4U1JB 4U05A 3RWHA 3D9AL 3S3JA 2X1PA 1GZQA 1G7QA 4UT6H 4WUUA 5DEFB 3MREB 3GHEL 3BZFA 4LSUH 2WBWB 5CWSB 2NY4C 4FABH 1YECH 3NACL 4D0DB 3UZQA 3BP5B 1CBVL 4WI8A 5HHPB 3TV3H 3NIDF 4BSJA 5B8CB 3BGFB 3FO9A 1AQDA 3DO3A 4CMHB 4U1NB 4HIHA 4QNPF 1U92A 2VKWA 5EO0A 5I8KH 2EDOA 4KZDL 3T09A 5JHLH 1ZS8B 1HHKA 5DJYA 1OSZA 3W0WD 1S7RB 3RHWK 2FX8L 3MX0A 3WJLA 5IG7A 1KB5B 1CD1A 3DUUA 1HDMB 4AK1A 3MGTA 4P57A 4XNZB 4POYA 3T0EC 4JFFA 1EHNA 4KK5C 1HCFX 4ELMF 3VXUA 5E08H 3DUHA 3O8XD 4DVBA 5JA9A 1NSNH 4TPRH 4C4KT 1U8PA 4LQ1A 3TVMD 2XWBB 4PJCE 4A6YB 3O0RH 4ENED 3MGOA 4KUCD 1FNAA 1KB9J 4ELMA 5J13B 2UV3A 3Q2CA 3VGBA 3DUSA 5GGQL 1KPVA 1IM3A 5D9SB 2XNAB 5K9JL 3C5JA 1A3LL 3X3GH 3BISA 5TGBA 4Y7MA 4Z7UB 2AGJL 3EYSH 4J12A 3FQWA 2AXFB 3E3QC 4HSQA 4X7TA 3IS1X 2IALA 4P2RA 4MMZC 1E4XL 4ORZC 5SX5K 5I19H 1KIPB 4Z18A 3GB7B 2Y72A 1JF1B 2ERJC 3G5ZB 1ZA3A 1IAIM 5FKAA 1BZQK 1PAMA 1LVEA 1QO3A 5J89A 2OZ4H 3MLWL 2DIJA 3GSWB 4G6MH 4WW2F 5I1HH 1GOFA 3R06B 5BS0E 2E7LA 2ZCHL 1VACA 5KN5A 4YX2H 3HZYB 3P73A 1AD0B 3OB8A 5B39B 3B5GA 3H9SE 3VE0A 2I24N 3X11A 3VFPB 5IFHH 2PW2A 3PWLA 1S8DA 1AGBA 3CC5B 3Q1SH 4MDIB 2NY0B 4FXGB 4X6BB 1FG9C 3KJ4C 1KPRA 3D39E 1I9JL 2VL4A 4WW2A 4TSBL 3IVKB 2JTDA 3AM8C 3NFPB 1GPOH 1U8JA 5D70L 4Y5VA 4L5FL 3WIFB 2DIBA 2XTJE 1CFQB 2JJUA 5FOBB 3B6SB 1NCCL 2YPLE 4NNXB 4LNRA 5D1QA 3RDTC 3RUGE 2UY7A 4AIXA 4KAQL 5EFIA 2YWYA 1YJDH 5F7NC 5EZOH 2F9BT 1JGUH 1FO0B 3I9GL 3TIDA 3VH8B 5I8EA 1DL7L 3RNKA 3QI9B 1IEHA 4HAGA 1WK0A 5DK2A 1NGWA 2JIXD 3NPSB 1L6XA 3NPZB 5F88A 2X7LB 2G9HB 3MOBL 4EXPX 4P9HH 4QRPA 4LARH 5IFAL 1YEFH 3FMGL 4J2XA 4TVPL 1MCCA 3OKLB 2ZCKL 4WW1A 1R3LA 5A16A 1T6WA 3WD5L 3JTTB 5F1OB 1P7KB 4QY8A 4X5XB 4XPFL 4U1MA 2GSIB 1AQKL 4HUMB 3DHJA 3RX5A 2ZKHL 4XCNB 1II4E 3FFCD 3OBAA 4PRHA 1JPFA 5DD0L 3CXHJ 1Z6JT 1GVIA 1DLHB 4PP1D 3MBED 2DAVA 1OGAD 1UXSA 4HZLB 1OF2B 4JKMA 2Q8BH 1IT9H 3RWJB 3ARUA 4O2EB 4PG9A 2NY6D 2VTFA 3MV8E 4U7KA 1TQCB 1TFHA 3OKYA 5CGYD 2V2WA 3KYKH 4JANA 2J12B 1KF9B 1RVFH 3QZWG 2AV7A 4XB8A 4ONFL 5GRWA 4LF3A 3F7PC 1RIVL 3QQ4B 4YDJA 1UH2A 4K3DL 4H88L 3LN5A 4PJCB 3MRCA 3HI5H 3ARED 1Z2KA 4DZBB 4ZUVA 1TVHA 1F97A 3WMSA 2FL5A 2I5YL 3DRQA 4NO5A 5TQ2H 3V6OC 4C83A 3NABH 1JV5B 4P5TC 4U6TA 2R1XA 4UT9L 3LKRB 1NL0H 4LAJH 3QIWD 2BOCA 2Z35A 3MJGX 2O93L 2XN9B 4LCWE 2DS4A 4GAYB 4XP1H 1FGVH 2VDQL 3QG6B 4GW4A 4MXQC 5EIVA 3RA7H 3KLAB 4OI7A 3S34L 2HMIC 1A7RH 5DRNA 5IR1A 3VGEA 3BKJH 3OSKA 4ZFGL 4NWTL 5IB3B 5BS0B 2MJWA 1S9XB 3OKNA 4HIXL 3LDBB 3AS2A 4NO0B 5KVEL 2FECL 1E4WH 3EOAA 3HPLB 4RNRB 4H1LA 4PJIE 2A74B 1H0DB 5CEYA 2GT9A 3T3ME 1CR9L 1T5WB 4X6EB 3OXSA 3ZE2E 3FQRB 1CK0H 2ADGA 2I9LA 2GYSA 1SJHB 5E99H 1X5YA 4MJ2A 5J1TC 2R9HC 4ISVB 4FN0A 3D39B 2X4UB 3PABB 4JFZL 4AG4H 1M6OB 1M7IA 1DP0A 4MD4B 3ZT6A 4OCLC 1EEYA 2P5ED 3IT8D 1FV1B 2ZCLL 5DD3H 4WGVB 3VU2A 3RVXD 2CIIA 5MEQA 2YPLB 5GZOD 4QRRA 1AE6L 3RUGB 3O9WA 2IH3B 2BNQA 1SM3L 2IPTH 3KPMB 3CFDB 3MCKB 5IK3A 3BKCL 4F9PC 3OX8A 3SCMA 4XCFH 2GTZB 4EI6B 4FQHB 3V52L 5C2BH 1FL3A 5BOZG 3BGAA 3WFBH 5DO2D 3HZMB 2WV3A 5HYJE 4O58H 3TA3B 1LK2B 3ULSB 5DHYB 4HKZB 2NX5E 3I6KB 1QA9A 5E6YA 2V9TA 1VGKA 4G42A 2D9CA 4E0RB 1M7DB 4G3YH 2N56A 2PYFB 2W0FB 3LSOB 4JLRA 4XTRD 5J06A 3AAZA 4G5ZH 4BK4A 5I1LA 1NEUA 5DMGD 4YHOH 4U6VH 4G8FA 3CFCH 3LKSB 5AEAA 5DI8B 2D31B 2Q20A 3AS3A 1A9EA 2R1WA 3DBXB 3S36H 3MC0A 3OAYH 3QHFH 4IOFD 3V0VA 3HC3L 3DI2B 5F97E 3MV8B 4O5LH 5EC2B 4JY6B 3ZTJG 2I07B 4NGHH 3S35L 2XKNA 4JVWA 2CGRL 1YUHB 1UWEL 3W0WA 1UM4L 4UT7L 1VCAA 3N9GH 1MH5A 1S7VB 2J8OA 2VIRA 3RGVD 3T2NH 1JWSB 3B5TA 1QBLL 4PJGE 4LPYA 1Q8MA 3GSNA 3QEHB 3S88H 3LKNA 4Z7VA 1FYTE 4UUJA 4ZNEA 4XMPL 5ILTH 1QBML 2Q76A 5FM5O 5CP7B 4KUCF 2UUDH 3L3KA 3AFLA 5ESVA 5IMOB 4MB4A 4PJ9B 3K1KC 3O8XA 3NGBB 2BJML 1MUJB 1KEGL 4XPGH 3STZA 3PDGA 4U6HB 4LCWB 2FJHB 2Y07L 5DRXA 4JFPB 3RX8A 1DUYB 3KYAA 3TVMA 3PWPE 5J4MA 5I9QC 5I2IA 2ADJB 3VW3H 2CXGA 4PGEA 1ZT1B 5BMFH 5HHNA 1CD0A 4XNXL 4X99B 5GS0H 2QQNH 4R96B 4WUUE 4X4YA 4TUJA 4IEFB 3RWFA 5JW4N 2QHLA 3K2UL 2X4NA 4CNIA 3MUJA 4KVNL 35C8L 3TN0D 5H2BA 3O4LD 3RY6A 2Z91B 4K9EL 1BBDH 4MQXC 3M8OL 1S9YA 4PBWD 3ROOB 5JUEL 3ARGD 2GQHA 5DJ8A 2YKLH 3ULVL 3MUHL 3RIAF 4MNHB 3DWTA 3NIDE 3TO4C