2ZOKA

Crystal structure of h-2db in complex with jhmv epitope s510
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
252
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVQNYCRVYHEGLPEPLTLRWER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 66
structure length 252
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zokA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zokA01
3P9LA 1F4XL 4POYA 2GSGB 3JTSB 4OIIH 5AG9A 4JZNA 4OLZL 4YDIH 5SV4A 4XNUH 1F13A 2Q7YA 2ZNWA 1A0QH 4O4YH 5B4MD 2NW2B 5ITFB 3G9VA 2BSTA 5F3BB 3KLDA 5JORB 1DE4A 1CZ8H 4Q9RL 3D85D 5JOPD 3N50A 1GPOL 1NCDL 1UYWL 3LIZH 3QI9B 1UM4H 2CLZA 3O8XB 1JCKA 2XICA 4IRSA 4P5KA 3KDMB 3QB7C 3PWUA 2EYRB 3MNWB 4NO0D 4TNWF 2J6EA 1KNOA 3TYGL 1XMWA 1WWAX 4NM4H 4MJIB 2YS4A 3TNNA 2CMRH 5EWIH 1DBBL 4PJXE 3VWJC 3QQ9C 4MD0A 5ICXA 4CJ0A 4EXPX 1JWMA 1RZFH 3HNVL 3BT2L 3U79A 1H0DA 4U1KA 1K4CB 3UJJL 3PQYA 3SGEI 1NCWH 1RK0A 4AEEA 3MUGA 5HTSA 3BEWB 5E8PB 1FFQA 4AIXA 4HH8A 2N7BA 4LVEA 3U0WL 5HYIA 5MEPB 3VMNA 4KROC 3AB0B 1OB1B 3I3BA 2CK0L 4A6YL 1WBZA 1G9NC 5DJXA 1U8MA 3V5DB 3VWKB 4Q0XL 1KXTB 3C8DA 5TQ2L 5I19H 4LLYA 4DFHA 4TVPE 4HAGA 2HKHH 1NJ9A 1EXUA 2NR6C 4PJDF 2DQUH 2QQLL 7FABH 5EPMB 1R0AL 3ZE2E 3MRQA 2AJSL 5LBSH 4P99A 4F58H 2VISB 4KFZC 3MBEB 1XR8B 5GRYA 3IDYC 4PJ8A 2IANE 3T0EE 1U8IA 2EIBA 3I9GL 4LLMB 4M7KH 5JR1H 1AQDB 4I8DA 4WY7L 5EZOL 1BQUA 4KJQC 4PGZA 1KB5B 3RBSA 4YE4H 4P49A 1AGBA 3TO4C 5DMYA 5GHWH 5I8CB 3C08L 5DMJB 3H7BA 3VXPA 1F3JA 3QDMA 4JFEA 5DS8B 2OYPA 2IGFH 1OARL 5F71A 4D3CL 4HFWB 3GZKA 1QBBA 1YEHL 3HG1A 5FKPB 1UEMA 2BFVL 3MFFB 3N9GH 4S1RH 4Y19B 3ZL4L 3PWPD 4OZFH 4JRYA 3L3HB 3FT3A 1QSEB 4ZUVA 2IAMD 3SDDB 4QHNB 1OD7A 1OAYL 2IANA 1OM3L 2XTJD 4O2FB 5DD6A 5EU3B 3SGEH 4V1DA 1XZ0B 4L4VA 3EIFA 5I18H 4PJHF 4H26A 5DJ2A 3EYSL 4PJGF 1A6AA 5DRZB 2NXYC 1D5IL 2HN7A 2OTPA 5M7QA 3QRGL 1BD2A 2FX9H 1KTLB 1OF2B 4OZ4A 5A3IC 3QXUA 1IGJA 2DL9A 4KRPC 3LEYL 4JM2F 4JY5L 4XCCH 1XF2A 1KIRB 4UIMA 3WFZA 1AE6L 1U3YA 4MNQD 5T1DL 3FKUS 1J1OH 3GSVA 1PKQE 1LE5A 3INUH 2ZUYA 5IB2B 1ZXQA 4FZEH 4RFOH 4HUVB 4N0RA 4XX1E 3V4VH 1MSPA 2D0HA 2IEPA 2K3TA 4JB9H 3DETD 1JWSB 2L4OA 4PJGA 4ZFOB 2BNRA 3IGAA 4MS8D 5D7LD 3RWJA 1I8KA 4X83A 1T6VN 3MR9A 2E6JA 1S5HB 2O5ZH 2PYEB 3SO3B 4L3CA 3DVNB 4QEGA 5ID1A 4JM2A 5BQ7A 3N1GC 1JWUA 4B0MM 3SPVB 4PJ8C 1IL1A 3CLEH 2HT4D 3BN9D 5E6IC 5TGBB 2C1PB 4WUUA 4ZOAA 1CICD 3I2CL 4X9FA 3STZA 2OP4H 1HYSD 5E4IA 1JP5A 5FXCH 4NKMA 1PSKH 4OFVA 1TXKA 4PG9A 1WICA 5IW6B 4PG2A 5IVZA 2AVGA 3R8QA 1IVLA 5IHZA 1IAOB 3QEUB 5B38B 3T2PA 1SJXA 3P4NA 1JN6A 3WNOA 4WI8A 4WUKL 1YMHB 1RULL 5IVOA 5DK2A 1MAMH 5M95B 3C6SA 2DOCA 2ARJB 3PNWA 2K7PA 2H1PL 5JOPE 1FIGH 2VDQH 4PJEE 1U8NA 3DXAD 4M7ZB 4FG6D 4MXQA 1KCLA 1IAIM 3MZGB 3ALXA 2J6EH 1L8JA 4NNYA 5L88H 3VXNB 4GKZA 5TDOB 1BLNB 3QWOB 1PAMA 3DIFB 2LU3A 3Q0HA 1YJDH 2NX5E 4DTGH 5J4MA 5DDHA 4OLZH 4WIQA 1TMCA 2V17H 3OKNB 2R2BA 3BOVA 4XVJH 4O2FA 2WIIB 5JA9A 3BGFC 3QEQA 4LCIH 5F97E 3BZEA 5E6ZA 5BO1L 1BJ1J 2F53E 1B0GA 4MQSB 2UWEB 1PKQB 3GMOA 5EOCH 1OAKH 3IDMB 1JJUA 1U95B 2KKQA 2A74B 2NXZC 2B4CL 4W70A 4YNYA 5D1ZA 2AV7B 5GS0D 2APVA 1KCUH 1H3PH 1TZGH 4H1LG 5GIRA 1AIFB 1IQDB 1DBBH 1JZ3A 5C92A 1Z6JT 3DV6B 3E1F1 3WEXB 2FO4A 3FHAA 4ZTOL 4WI9A 4IOFC 5F1NA 3CH1A 3VJ6A 1RZFL 3QUZD 3S6CA 4JZOA 4DVBB 1SY6H 1OGAD 2HT2D 3QUYD 2ZUWA 3SKNB 3EO9H 2HVKA 1BOYA 2ESVD 1NCWL 3QCTL 4HJ0C 5EIVA 3SJVD 1ED3B 3TO2B 4HK0A 1CICA 1T7ZA 5C0RH 1FP5A 1QLRA 4DGYH 3QO0B 5I74C 1G84A 1NDGB 2V7NA 2CK0H 4JRXD 5DZNA 1KPRA 3QIUC 2ATPB 4YR6A 1EJOH 1EGJL 5TQ0H 1YC7A 4QRPB 1UQSA 2Z35A 2DBLH 2V7HA 3ARBD 5GGSA 1MWAB 3MA7B 35C8H 4I2XB 3HI6L 2HKHL 4OV6F 3OV6A 4KROB 3RQ3A 5E2UH 5IF0A 2R4SL 3G5XA 7FABL 4KY1L 4EQ3A 3D3VA 4X6DA 3NAAH 1KPVB 2VITB 1I1CA 1OWRM 3HLAB 4DW2H 3OKKB 3W0WA 2IH3B 2XWBA 1GIGH 4KPHL 1A6ZA 3KHQA 5EC2B 1C16B 4P59L 1I9JL 3FT4B 5CSZA 4J3WA 5E7FA 1HSBA 5HY9A 3LEVH 1XCTB 4NQDA 5DHYA 5C07A 3VRLF 3G5VB 3WHE0 4Z7QE 3TF7A 3GMNB 3E6FB 3LKPB 2ICWI 2PXYB 3C08H 4Q9QL 4I9WD 3L5XL 1MREH 3QEQB 3IRPX 1ETZB 2IGFL 1ZMYA 4C56D 1A6UH 2P4AB 5HGAA 1YEHH 3EFFA 2DQGH 1V3JA 1NANH 3LQZA 4D9LL 4X7TB 4LGRB 5DFVC 2J8OA 5E00A 5C08B 4MHHG 5I1LB 2R8SL 1NEZA 2IBGA 3KXFE 4OCSH 2VAAA 4KK9D 2BSTB 3E3QC 3MOAL 1A3RL 3SE8L 4ZMAT 1EHLL 2VDKL 2XKUA 1NLDL 2YRZA 4GKNB 3FQRB 3FQXB 4QO1A 4DN4H 4EKXA 4Z77B 3FB7A 5JW3H 3L9RB 5KOMC 5E6IA 4LIQL 1KPVA 2VITA 4OM0L 1PG7X 5A2IH 1ADQH 2AK4A 2XWTA 5C0IB 4YR6B 4QCIA 1QZ1A 3SDCB 1FAIH 2AEWA 2F53B 2PW2A 4Y1AA 3S37H 1Q9LB 1KYOK 2IPUK 2VO5A 4ZO8A 5MP6L 1LP9B 1ZE3C 3KYOB 5DFVD 4EEEA 5DT1H 3VI4E 4PJ8B 5D2LE 4JY5H 1BD2D 4X4XB 5HYSG 4ZXBD 2ZUSA 4KQ4H 4AQ1B 4YHML 4ETQA 1SM3H 3HI5L 4YHOH 3RZCA 4MVBC 5GGVY 1I3GH 4WU7B 5E99H 5IHZB 4URTB 4KV5E 4OQTA 4XT1C 4F7CA 4HIJA 2RR3A 32C2B 3ARXA 3RDTA 4NDMB 1D5MA 2XZAH 5DI8A 3GO1L 2VC2L 5DHVH 1T22A 4RGNB 3T08A 1ZHNB 2VLKB 2UZIL 1IAKB 5HD8C 4JKKA 4ACPA 3C60B 1P4IL 2F15A 1CD1B 5H2BA 1JI2A 4H1LB 4PJIE 3CLEL 4K23H 1KELL 4N0YH 5LWYH 2VLRE 5I1GH 1AY1L 2C1OA 5CJQH 3ZHKA 2FD6H 2G5RA 4NGHH 4L5FL 4PJGB 4WUUD 1X5KA 3QUMH 1PSKL 4U1NB 1UH4A 4TUKL 1BLNA 3A6CH 1YPZF 4OD1L 5FF6A 1FGVH 2D2OA 5I75B 1CR9L 1OCWH 4P5KB 5C07D 5IB2A 3H9SA 1XAUA 2Y6SC 2CGRL 1FZKB 3TVMD 1U9KA 1KB9K 4LBEA 3CPLA 4XNMA 1BZ9B 3TN0C 4LNRB 1G6RA 3QHZL 2B5IB 3FB6B 2VDPL 3H3KA 1T5XA 4GG6E 4GAYB 4WUKH 5DD0L 2Q6WA 5ID0B 1LO2H 5DUBA 4FQPA 1AJ7L 4LLDA 4TVPL 4P9HC 2A9NL 1I9IH 4MLSA 4CU8A 3MYJB 4FTVA 3NABL 5C6WH 3FN0H 2DQEL 1JMXA 4ODTH 5CZXC 2F53D 3QDGE 1LDSA 1DVFB 3HHRB 1M4KA 4LSTL 3MRLA 2QEJA 4O5LL 4NJAL 4WO4B 2VLJE 1JMZA 5SWSE 3L9RA 5IBUG 1I3UA 3L7EB 4LSUL 1JF1A 2HFFB 1G7QA 3NZ8B 1EZVX 1NBVH 1J5OH 4KUZL 5FA4B 4GKNA 5IJVB 4DZ8B 3UYOD 3IDNA 5B38A 1E28B 5FDYA 1A21A 2HVJB 3KJ6H 3BQUB 2MPAH 4FQJH 2PTUA 1RUKL 3VFRB 2W0KA 4U1IA 5CJXC 4CADB 2A9MH 4Y5YA 4UDUA 4BQBA 3FT2A 3QNXB 4O51A 1VENA 1U2CA 4LLMA 4LKXA 2FH6A 2OL3B 4OZIF 2E3VA 1S78D 3ZMRA 1DVFC 5IBLC 4LVNC 1PZ5A 1JUFA 5DR5L 5ESVB 2VLME 2B4CH 3CZFB 2WW8A 3RUGE 1S7UB 3C6LA 2IQAB 2QKIA 3VWJA 3LV3B 5FYJU 1A3LH 4M4PA 5HPOA 4X99B 2X1WL 5EPMA 4MAYA 2IMMA 3NPSC 3T0WA 4IRSC 3VXRD 1QBAA 2CRYA 2H32A 4IOSD 3M07A 1C5BH 2ZUUA 3VXOA 3QCTH 3U7WH 2FJFA 1INEH 5FO7B 1J05B 3OAUL 3QRFM 2NW3B 4ETYA 4K3DL 4UT6L 4YXHH 3HFMH 3BKML 4TPRH 1KCSL 1RIVH 4X6EB 5DD3L 1S78C 1HE7A 4N1CA 1EGJH 1T1XB 4JFQB 1VFBA 1GJIA 3RL1B 5F7YC 4LSRL 1P7KA 4PJFA 3P0VH 1EK3A 4HZLB 5JA8B 3LHPH 3S96A 4KRLB 3B5TA 2Q76B 5JXED 2COQA 3TEUA 5SWQB 4QTIL 4WGVB 4ZFFB 3CZFA 5TE7L 5IHUH 3FT3B 1OP5K 1F8TL 3UTSA 1IGYA 4BZ2L 4MAYC 3MRDA 4YUEL 4ERSL 3ES6B 5A2FA 4O51B 3VXTA 5J13B 1I9JH 4PJBB 2Z31C 4G42A 5FYJL 1MIMH 1ZLUK 1KC5L 1WVZA 4M7LL 1UB6B 4HBCL 2NTFB 4LPVA 4HUUB 1HWGB 5MI0B 5JTWA 2GAZB 2DYPD 1MREL 4U05A 1OGTB 5D7KE 4E41D 2ZSVB 3I84A 3VI4F 5AYUL 1G7QB 2BP3A 5FGSA 3O4LE 5I1EL 1NSNH 3G9AB 3KPSE 5DK2B 3O2WH 3JTSA 5TPWL 5HDQL 5CJXA 2DLGA 5FO8B 1ZTXH 5F7WC 1P6AB 3A6OA 1NGWB 2VE6A 2EKSA 4LLUA 4YDLB 1JF5A 5T33L 4KJQD 3MGAA 4JFXA 1Q94A 3QIBC 3IVKB 1J1XH 4HFUH 1QQDA 1OAQL 4LIQH 1HCVA 1U92A 3G08B 3SY0B 2UVEA 1RPQA 3KYKL 1S8DA 5AG8A 5MI0C 1T04A 1T0MB 3S37L 1RHHB 3QHFH 3SKUD 5MP6H 2DQTL 4OAWB 3IAQA 1SMAA 3NFSL 1EUTA 5B21A 2VDNL 1F42A 3KGRA 3P73B 1ZK9A 3S9DB 1RZJC 2AK4E 1HXYB 1JYVA 1TJHH 4QGYA 3SE3A 2PYEA 4UBDD 4AEIH 1CE6A 1MCPH 4FXKA 5I6XB 4ELMA 3HE7C 3P4NB 1D7FA 4H88L 4B50A 4HF5L 2NY1C 5IWLC 3SBWA 3QUMA 4PUBH 3VFPA 2HLFC 3IRZA 4MCZB 4PP8C 2DLTA 3NA4A 1J9CT 3WS6A 5J0BA 1MI5A 4GQPH 1YMMB 3U82B 5J1SC 4JJHA 4NSKA 4WV1A 4RRPG 1KN2L 2VC2H 4R7NA 1KEML 3MREB 3RPKA 1K9TA 2C4FU 1N6QH 4OIIL 1X5AA 3M45A 4HXBH 4N9OB 3VGHA 2FATL 3UTPE 5MERB 1S7VB 4GS7C 3UTSD 1Q9KA 1FG9C 3MLYL 4HDIB 5C3TA 2OBGA 3AY4C 5I1HH 3EUUA 2FD6L 5F88B 1CTNA 4BELD 2RFXA 1GPOH 4G5ZL 3O11A 1NCDH 1U8OA 2OMNA 4NUJB 4HWBA 3MOQA 4I0PC 4HS8L 3O41A 5SWZA 4U6XA 4L29B 1IMHC 5D6DA 4AJ0A 4X6DE 3S35X 4X4XA 3RKDD 1CXLA 1F6FB 4Y8AA 5EU5B 1IKFL 1BWMA 4GO6B 1HH9A 3QHZH 4RFNC 4H5SA 4LLUB 1Y18A 2ZPKL 4KKAC 4JLRB 4Y89A 1LILA 2DKUA 1TETL 1OQXA 3VXUB 1KLGA 2AGJH 3HS0A 1MCBA 1N5YL 2E5EA 1IM3B 4NN6B 5GGTA 3U30B 2A9NH 5E8EB 4ODWA 1NL0L 3REVB 3CDYA 1S7RB 1M6OB 2A6JA 2A6KB 2ZOKA 3HUJE 4HD9A 2DQEH 1W0WA 3TBVB 4G6MH 3EDEA 4LSTH 1N7MH 3VFMA 1DQJA 2VABB 4H26B 1Z3GL 5D5MF 3KR3L 2G60L 2EDJA 4GW4A 4Q0XH 4OF8A 3OX8A 1ZA6A 4UINL 5FV2A 1SMOA 1MHPL 2H2SD 1FG2B 3OB0K 1SEBA 3MUZ1 3NFPB 3QXDA 3HPJA 4S0SD 4XVUD 3ARFA 3HLAA 4Y19A 4O2EA 1QSFB 4ODSH 2YEZB 1LO0L 1O0VA 1FNHA 3I9GH 5JR1L 2PYED 5IG7A 3RVVC 1AR1D 4H20H 3W82A 3T0BA 1ADQA 1DL7H 1T1XA 4YFLF 1U8MB 1MCDA 2A77H 1MCHA 1P9MC 4YE4L 2DAVA 3MRHB 1MI5D 1U3HB 3V0AC 4NZRL 1R5VA 2BXYA 4LAQL 3ZYIA 5GZND 1QFWL 3UPRA 4NQEA 2BFVH 4OZ4B 1AR2A 4UQ3A 5EOQL 5IGXH 2VXVL 1OTTD 2X4NB 2R0KL 1S7WB 1A4KB 3F62A 1W72H 4I4WB 2R2CA 5LGHH 3SGDI 3G6JF 1BX2B 1EEUA 2I26N 5CEZH 1G1CA 2VL5B 4K3DH 4OI7A 4IMLB 5TDPA 4QRRA 2XIDA 5F9AC 4HS6B 4B7LA 1NBZA 5DD3H 2F9BT 3L3OB 3TV3H 4EBQH 2VXUL 1V05A 3Q3GA 3B9VA 2X70A 3C9NB 4LCCC 4HGWA 5KVGH 3KPSD 5BVPL 1YY8A 4TQEL 1B2WL 3P0VL 3FAWA 3AXLA 3EYQC 4LPTA 5AYQA 1X5ZA 5HVFB 4ZSOE 1CZ8L 4U6YB 4WEMB 4YWGL 5E9DB 2GT9A 5IHUL 1W72A 2APTA 4LRNH 1F8TH 5T1DH 5IT2L 1B88A 1MUJB 5I16B 1KLGB 1CFSA 4G80A 3PXHA 3G6JA 1XIWB 2FR4A 2NY4B 4I5BB 1DBAL 4NM4L 5HHQA 1X9QA 5E8EA 5GRJL 3GEWB 4GMSL 5IK3A 3WUWG 4OFYA 1QNZL 4CN4A 5ENWA 4WO4A 4JB9L 2AJZB 2ADIB 4X9GA 3MODH 1CBVH 1MCRA 5E70A 4UOJA 5FGCB 1Q72H 3L5WA 4UQ2A 1C7SA 2HT3D 3ULUL 1U8NB 2WLZA 4MXQD 4OFIA 5GS2H 3U0WH 1HNGA 4S1SL 1RAMA 3MMEA 2E7MA 5DF0A 1PW3A 2F8VA 2MHAA 1FVCA 2CH8A 3FFCE 3FQTB 4RA3A 1FYTE 4H1LH 3NCBB 5KTEH 1YPZB 4HFUL 3AAZA 3HB3C 4XCNA 1XIWC 4ODHH 1YMHA 4F58L 2E7LE 1RV6X 1U8QA 2E7BA 5HHQB 2BNUB 1A7QH 3QG6A 1HHGB 4M7KL 3BN9C 5E6ID 2DMCA 4V2BA 4WY7H 1CFBA 4MB4A 3LKSA 4MJ5A 1T89C 3O9WD 3KPLB 2PCPA 2R0LH 5BV7H 2W59A 3RJDA 1JYWA 4Z76B 4QHUA 5KSUA 4X0KB 3QO1B 4ZFGL 3BGMA 1M7DB 1CFVL 4D3CH 4NCC1 3K2UL 5I1JL 1V3LA 1T04B 4JKMA 1XF4A 1WZKA 1XEDA 1FORH 3ZL4H 3WKML 1GCFA 1QQDB 3MXVH 1GSMA 2YZ1A 2EZ0D 2FWOA 3JUYA 4JQXA 4WFGE 3VI3E 2W0FB 5GGRA 1OAYH 1OM3H 1NMAH 4KMTL 4I4WA 4KGLA 1I75A 5KOVC 2V17L 1U92B 2GFBA 3P30H 2J8UF 4YAQA 2YA1A 5ETUB 5DQJB 1Q94B 4NO3B 4HKXA 4HKJB 1B9ZA 4K7PL 1WZ1L 1RUMH 4HEME 3C8HA 3S3PA 4I5BA 3U9PH 2NMSA 4GXUN 1HHIA 2CKNA 4MSWB 2P5WB 3T0EA 4RZCB 3VRIB 3O45B 4XCCL 3LKNA 3ULVH 2GT9B 4C56A 1JNHB 1EHNA 5I9QC 1KFAL 4U6YA 3EOTL 3TBSB 3PGDA 2AJ3B 1IKFH 3QH3B 4S1DD 5F1KC 1J1OL 2ZPKH 1VADA 1YEFH 4ZODA 2JJSA 1OQOA 2J8UA 3V4PH 4IIQA 3JV4A 2B5IC 4WW2A 5EZLA 4JFFB 3EFFB 3DX8A 2HT2C 4GQ9H 1NL0H 1CDUA 4OCYH 4WW1B 5DD6B 4NKQB 4WFFD 1AI1H 3VRJA 3JWNC 4NFCA 4HFWA 4ISVB 3EDKA 4G6ML 5F6IB 5MEQB 4NQXA 1Q0YL 2OR7A 5DURB 3JTTB 2EH8L 3O0RH 1RFDL 2NTSP 1JNHA 1FNFA 5HGHA 1P2CA 3VFGL 1TZHA 2DBLL 2R1WB 4OCRL 4DEPB 2FNBA 4MD5A 3R06B 3ARBC 1VFBB 5I76A 3BI9X 3SO3C 4E41B 1BFVL 4JCLA 4MNGE 4U3XA 4M7ZC 1R5VB 5I30L 3PP4L 3I6LE 2H9GB 1RMFH 4RFNB 5I6XC 3SE4C 1TDQA 4KJYA 3UBXA 3ZO0A 1MFBL 4YO0A 5CSGA 2AP2A 2X4QB 4Y4KA 4KU1A 2NXZB 1GIGL 2JIXA 4KPHH 5F9DC 2DLHA 1F90L 4P59H 4PJDA 4OGZA 1JFMA 1QSFA 5EBMB 1TVBB 2BNRD 1RULH 5DGRA 4TUOA 4W4OC 1NCAL 4JFFE 4PJIF 2F54B 3RUGF 4L8CA 4FQ2L 5B39G 3SOBH 3SEPA 3KPOA 4O02H 3C2AL 1A2YA 2H1PH 4XHJD 3WD5L 4FG6C 2OJEB 2R2EB 3U9UA 3TZVD 4PY8I 1XF4B 4NHCL 5DO2D 5IBTL 2D31A 1ND0A 1NMCB 3MCLH 3OHXA 1P1ZB 1E4WL 3I85A 2LU4A 2DKSA 2VDRL 4DK3A 1PG7W 4IRJA 5I1CL 3O4LB 1S9XB 1HYRC 3FMGH 4ISVA 1YJDL 1IC5H 1H3VA 1C08B 4PLOB 1W2KT 1DN2A 4NKDA 1T80A 3MNWA 1FAIL 2Z8WC 3F12B 4Y4FA 3LCYA 5DZOA 3BPNC 1SEBB 1UM5H 4JLRA 5KVGL 3VFOB 4QRRB 3C8KB 5F7KC 1J7VR 3D87B 4OSUL 3HG1D 4JY6B 2I60H 4U4BA 4PJHA 4PRHA 4JY4B 4YWGH 1URLA 1HYSC 1BVLB 3QH3A 3QXWA 4ZS7H 3SGKC 4KDTC 3Q5TA 1FYTD 2J8UB 4MB3A 1JNJA 1I3GL 5E99L 4FTVB 1K4DB 3KPRD 2PW1A 3ZYJA 1KCUL 1Z2KA 1H3PL 5EU7C 3HMXL 1LDPH 2QQNL 4Y2DC 3D69B 4H0GA 3KPPB 3FHQA 3BKCH 1EAJA 4HPYL 5SWSA 5GGUA 2XZAL 4HSQA 2EXWC 1Q72L 2OTWA 2XNAB 4U1SA 2CXKA 1WIOA 3ARUA 3S7GA 3ULUH 1BHGA 1YN6B 3QDMD 4JFED 4MQ7A 4EI5B 1RVFL 2YA0A 2HRPH 3GSOA 3DV4A 4DGYL 1MUJA 1I1RA 3QCUH 4S1SH 3I02A 5I16A 3GJFB 5A16A 1KJVA 4K23L 2HH0H 2DKMA 5T5FL 3UTZA 1EJOL 5LWYL 1BWWA 4NGHL 1OLZA 3MJGX 2AV1B 1DDHA 2P5EE 3QPQC 4FRWA 3K1DA 1CR9H 4QXTA 3BXNA 5GRUL 4DUXA 1DQTA 4K8RC 4PTTB 1VEOA 2NXYD 3H9SE 5J1AB 2FIRT 3DUUB 4LARL 3STZB 5I1IH 3V5HA 3P9WB 4FQHB 1T1WA 2X9WA 3ISWA 1IRAY 3ZDXE 1MCSA 2ZOLB 2VN4A 4CJ1A 4MA1B 2HFGL 1TTUA 3B3IA 4BFBD 5J6GA 3TCLB 3HMXA 1P4LB 2AERT 1VCAA 4X7FC 4YFDB 4MNQA 2IQ9L 2AEPL 3IU3A 1FVEA 3ILPB 4QOKA 4XCNB 3ME0A 5ANMA 3OR7B 3EOYG 4GAGL 1A6UL 2UY6A 4LHJB 5I1JH 4PGEB 4JCMA 1JGEB 1BQSA 2EE9A 3MRHA 1CVSC 1LK3L 1FORL 4LDEB 1XCQB 4PRPD 1LEGA 5E5RB 5IVXE 3Q5YA 1J0ZA 4LSUH 3MXVL 4ZNEA 4ZSOB 2VDKH 3T4AB 1LGVA 2DYPB 4OFYD 5D9SB 5FGBA 5JW3L 3P30L 3WS3B 1NC4B 5EO1A 4AG4L 5JHLL 5ITBH 2G5BB 5I66B 3W0WD 1PQZA 5E5UB 3UTOA 2ZG3A 1FG2A 4JPIA 3LN4A 1T0NA 4Z0BH 4BH8A 1BVLA 4K7PH 4MXVF 1MFDH 4S1QH 4CNIA 2IQAA 3VWJB 4QRUA 3GBLA 2WUCL 4AEFA 3LKPA 4JN2A 1L6ZA 1FZOA 3ULVL 3G5VA 1BVKA 3UJIL 2OX5A 4QYOA 2YC1B 1W0WB 2XACC 3O6FA 5B22A 1MY7A 3OWEA 5HYQB 2MCG1 4ZUVB 2Y7QA 4WWKC 4JFQA 3MRIA 3E6FA 2X89D 4Y5VA 4AEHH 3RWHB 5DHYB 5C07B 2MTPA 3FB5A 3MRNB 4M43L 3U7WL 4S2SB 3VW3H 5HHMA 4OIAA 3S4SG 5E2JA 4PJCA 4XNQB 3HFML 1L0YA 3BKMH 2UZIH 2X4OB 1Q0YH 5EFIA 1A2YB 3NMEA 4JKLA 3O0RL 4YDIL 1KPUB 4ZXBC 1F4YH 3O3EA 1A5FH 5BZDB 1A0QL 3O41B 3L3OA 3C2SA 5IVXF 5EU4B 1N64L 2HLAB 1QLFA 1F5WA 1BFVH 3BPCA 5JPNA 4CW1A 5IKCA 2YSSA 5I30H 3PP4H 3VXSD 3RGVA 3V6ZB 5DC4B 2Y25A 2ATPA 4TUKH 3A6CL 1Z9OA 4IMKC 3QUZA 5C09E 2V9QA 1A4KA 1MFBH 3RVUD 4GFTB 1H3WM 1NANI 1C1EH 4FFWD 2QTEA 4LF3B 5I8EA 4NQCB 4CBPA 2AXGB 1CGVA 5HHPB 4NQEB 3NN8B 5EWIL 2BVYA 1T0PB 5FYJH 4OLVL 3BDXA 1CE1H 4DKFL 1A47A 1BPVA 1KC5H 1HHJB 4RISL 2GHWB 4WFHD 4D9QD 1MI5E 3NCMA 2H8PA 2F5BH 1KXQE 1AJ7H 3KPRB 1BGXH 3VFPB 4U49A 3L3JB 5IMOA 5B3NA 2O5XL 2P48B 5EBWB 5L2KD 2NY2C 1KT2A 5DVLA 3ORJA 4G7YH 4FXKB 2PYEE 3O2WL 5IB4B 4ODTL 4P2OA 4QOKE 5HDQH 1GRWA 1FFRA 3IDMA 5D7IA 3PG2A 5JXEC 3MCLL 4I18A 3QUXC 4NJAH 4P46C 2VQUA 1B0WA 4R7DA 2NZ9C 1X5LA 1KJ2A 2L0DA 1AC6A 1OAQH 1QFWI 2NNAB 3KJ6L 2R2BB 2MPAL 4EIGB 2YUZA 1QSZA 5DVKA 3WL9A 4RAVA 2AJ3A 2DJ4A 1PBYA 4LK4A 5LBSL 4WENB 5J11C 1RUQH 3EOAA 1EVUA 5HSFA 2CXGA 2A9ML 3QHFL 3KLSA 3NGBB 3GSNL 3BQUA 4NKIL 1S9WB 4G3YH 1DEEA 3LPFA 2EKSB 4LCCB 5E8NB 1HH9B 1U8QB 5D7IF 3AGVA 5D2NB 5GHWL 5F7LB 4TVPD 5FA3A 4AEIL 3KPSA 4YDJB 4XP6L 3DMMA 5EU6D 1JGVH 3HMXH 1OARH 4MA8H 5FUCC 4PJ9D 5E94B 1NBYB 3WO4B 3OXRA 2XWTB 4P9HH 2J7LA 4C59B 3LV3A 4R96B 1F97A 5FUCE 1S7XA 4HIIB 1J18A 1N8ZA 4UTBH 1INEL 5F70A 1WBYA 3QT2A 5TDNA 1P7QA 2JCCA 2PO6C 4HXBL 4UT6H 2EDKA 3GBNH 1I7TB 2WANA 2Y5TA 5DJ0A 3UTSE 2FATH 2WWKO 4TPRL 1LEKA 4Y5XB 5I18L 1QKZL 3EFDH 3CFCH 1RUPH 4ZQKB 3SPVA 3EYSH 3UROR 3MJ9A 3EZ8A 1FNGB 1I4FB 1D5IH 4X6BA 5HPMA 3ALWA 5CUSH 5AAWA 1A1NB 4N5UA 5ACMA 3IDNB 2J8HA 3VFWA 3VXME 4LCWA 4Y16A 43C9A 4XPHH 4Z18A 5KW9L 5F3HB 4JDVB 4BZ2H 3R0MA 1AKJD 4YBQD 4UV4L 2AK1H 3EYFA 4YZFF 5JMRA 4JVWA 3TA3A 3O6ML 1V7ML 2Z4QA 5IFAH 3KPNA 5HDBE 2Z8SA 3PWLA 3STLB 5J12C 3GB7B 1C5DA 3WN5B 4EXKA 5D7LE 2O5ZL 2Z0BA 1BVZA 4LKCA 5FFLA 5I1EH 2PR4L 3IFNH 5DRZA 3T3PF 5AWNH 2XN9A 5TPWH 3S98A 5K9OA 1XGQA 1X5YA 1NGZB 4RCAA 4RAUA 2BNQE 3PUCA 3IB4A 1VPOH 4U1GB 2H45A 2EXWD 4IRSD 4UINH 5C0GB 5T33H 1KLUA 2OP4L 1GC1C 2BVQA 5EA0H 3D18A 4Q6IB 2Q3AA 1MJ8L 4GBXA 5LXGH 3TZVB 5JHLH 3GUTA 4CVZA 4ZAKA 2N56A 4PGDA 1ZWIB 1NFDB 2YOCA 3VE0A 4K7FA 1DL7L 4S1QL 5IBLD 3KG5A 1F02I 3TPUE 1YY8B 5FDWB 3VFRA 4P2RE 3V7AE 4UUJB 3BKYH 3ALPA 4HIEA 1CT8A 2MKLC 5DJ6A 4MNHA 4NDMA 5FCSH 4HIHA 1XF1A 3BPOB 4EDXA 5KVEL 1UJTA 32C2A 3HRZA 5FA4A 5BZWB 1O7VA 5J9PB 3DVGB 1HQ4A 1DN0A 2BVQB 2FCBA 4JG1H 1LD9B 1P7QD 2AXGA 3WXVL 4AEHL 1V3KA 1CIUA 2VQ1A 4BQ6A 2R0KH 4OFPA 5ESQA 3ECBA 1H15A 1QEWA 4RIRB 1FL5A 3WHXA 3VW3L 3IJYA 3I75A 3QJFA 2HFTA 4KI5E 3MRFA 4HHAB 5D5MB 1G6RB 4PLJD 4PJDE 2ORBL 4GG6F 1X7QB 2VRAA 4DTGL 5GSRB 1LP9A 4A2LA 1UB5A 4N9GB 3CSYB 5I66A 4JGJA 4KI5F 2V9TA 4GRWB 1WBZB 2OK0L 2WBJC 2VXUH 4OZGA 4Q74A 3AM8A 4KRPD 4X4YA 5I8OH 3KPNB 4QHMA 4XP5H 5I1HL 4NC2B 2VSDA 4LBEB 1UCTA 3PQYD 2VLRA 5EOCL 4NFBA 1UEYA 3ULVF 4HS8H 5JO5A 1OB1A 3MLTA 4QLRA 2V6HA 4WHTA 2X9XA 1C1EL 2VLJB 2FSEB 4X80L 3OGOE 1FL5B 3OB8A 3WBDA 1U6AL 4Y16B 43C9B 5GRJH 3MRIB 1FC2D 2JJVA 4LLVA 1EO8L 2IAMA 3F6LA 4DKFH 2NPLX 3R0NA 1ORQB 4RISH 2AGJL 4YDLC 4KKBC 3MUY1 4N0UA 1BFOA 4NBYB 3B9AA 3C60A 3ZHLA 2A6IA 4P0DA 4QXGL 1CK0L 2WAHA 3GMMA 3MV8A 4CADA 3F7PC 2O5XH 3LRSA 3WMSA 1DQJB 5HY9B 3PXJA 3MTRA 2LTQC 4AK1A 1KTDA 4QTHB 4OUUB 3CAFA 2E7HA 5BV7B 1HKLH 2O61B 1MVFA 4QRSB 1CDCA 2GSIB 1X5GA 1ACZA 3O8XA 2NY3C 4WTZA 3REVA 3SKMB 2VXTH 4G9DA 1Z3GH 5TQ0L 1I8MA 3MLPA 1CT8B 1NQBA 2VAJA 3OF6D 25C8L 4C4KO 5INCB 1S9VB 5D7KD 1XF5A 5E2UL 3SDCA 2BNRB 1HH6B 4TSAH 4KY1H 3LQMA 1P84K 4JZNB 1KLUB 3RWGA 1KJVB 4PRIE 1DQMH 2GJZB 4DW2L 4PGDB 1UXWB 4NBXB 1DQQB 1LO0H 1A7QL 5BRZD 3SDAB 1N59A 1G9NL 4NKIH 1N26A 3O11B 2LE9A 1AP2B 2NY3B 2CDEA 4NT6B 2MMXA 3VDAA 3SQOL 3O2VH 4D0CB 5IV2A 4BKLB 3GSXA 2ICES 3LQZB 4JFPB 3FO0H 4NKMB 2Z92B 2ZZUT 3L5XH 3UTTD 2NLJB 2FEEL 4LAQH 4Z0XB 3IVKA 2R56H 3AS0A 3K2UH 3BO8A 1FLTX 3I75B 3QJFB 4GRMB 3C5JA 4XBPB 1NLBL 1CLOL 2ZKHL 3WHXB 4P9HL 3EOAB 3O6LL 4LP5A 2F74B 4PTTA 2VXVH 3WKMH 3OAZH 4I77L 2C3HA 1Z9LA 1EEYB 4UTBL 5J11B 1EHLH 3PDOB 4H0HB 1NKOA 1MVUA 4KMTH 4N90D 5CEZL 3S4SA 1YYLL 3LMJH 3GMNA 3WJLA 3VCLA 2EXYD 3GRWH 1QKZH 1T22B 3CFCL 3EFDL 1T7VA 4OM0H 5CGMA 2E7LA 1IGTB 1N2RA 4H1LA 4JFYA 3FQWA 1C16A 1B0RB 4TNWK 2OXGA 5CUSL 3MLWL 4NCDA 3X12A 3U9PL 4CU7A 1TJGH 1F11A 5L8KB 3L3GA 2VDOL 1EIBA 3UJTH 4PGCA 5HPMB 4GKZB 5TDOA 1UXSA 4YHMH 1IGYB 1I7UB 3MBEC 4LRNL 1ZOXA 5KBNC 2L7UA 4XPBL 3GUTB 4XC1H 5IT2H 3L3IB 1HINL 1OW0C 4DQOL 1NBQA 2AK1L 3DGGB 1J0IA 3VFVB 4JZJA 4GMSH 3RY6A 2HVKB 4K2UH 1JHLH 3DPBA 2WMPA 1Q0XL 1MY5A 3MODL 3EDFA 4RX4D 3FOLB 4AT6B 3CX2A 1TVBA 1CCZA 1QLRB 4C58B 1CBVL 4OCYL 2GJ6D 5JIPA 4UOW0 2XTJB 4HK0B 4G6JL 3BP7A 3RVVD 3T0AA 2BVPB 3ARYA 4W81A 2JIXB 4FQ1L 1N0XL 3MGTB 1P4IH 4IOIA 3PWLB 1E4KA 3DGCR 4FFYL 4XCYB 3VFGH 1X5FA 3K80A 2XPGA 4UUJA 5CINL 4HG4J 5I1GL 1OTSC 2NY5H 2UWEA 1EAPA 4Z95H 5DVNA 4AQOA 4LCYA 3CFIC 3MLUH 4DVRL 5LXGL 2CJUH 3VFUA 5D7JC 1OSPH 5D5MA 4OD1H 1XF3B 1FGVL 3E6HB 3M1BB 1VB9A 2V5YA 3QIWA 4P4KA 4Y19E 4Y4FD 3RY5A 3UYPA 5MEQA 2FECL 2P8LA 1XCTA 1CXFA 3UTTA 3BIKA 3KYNB 3B4NA 2OL3A 1H8SA 1S9YA 8CGTA 2EE6A 1R5IA 3FN9A 1LO2L 3K4AA 4ZUWA 4X6FA 2NY6D 4WEBL 1J8HB 3TM6A 2IH3A 2YPKA 4FQ2H 1MCFA 3EHBC 3L3DA 4PJ9A 5T5NF 1ZLWK 3SOBL 1I9IL 1HSBB 5KANI 4ZFZA 3B9DA 3NABH 1F45A 5A40E 5E9DD 4U0QB 3BWAB 4RQQA 4ZFGH 3WXVH 1MJ7L 3MGTA 3BJ91 2UVFA 4N5ED 2QHRL 4O5LH 2BHZA 2XPGB 3C6LD 4LF3A 5I8EB 3QQNA 2F8XC 1KIRA 4HAFA 4UIMB 4OV5A 5ALBL 1DUYB 1YDPA 5ELIA 4MQTB 5I1DA 2VDRH 1NBVL 3T4YA 4NQUA 3FOMA 1FYHB 3BP6A 3FMGL 4HKJA 3P11H 3QEGH 3TJHA 3ZKXC 4O00A 4WFGD 4XP4H 1KTLA 2AI0H 3U2SB 5FOBB 3MV01 1EFXB 3BVNA 3QFJE 3TC9A 1WUNT 4OCXH 3S36L 1A6AB 2D0FA 2VL4A 4J4PD 4KTYA 5KG9A 4AT6A 1HHHB 5HHXH 3MJ7B 1N6VA 3QUYA 4MA7H 4P5TB 2APBA 1RUML 1U58A 5K9QG 4WW1A 4ZS7L 5JLZB 5CMAA 5CAYB 3QDGD 4TSBL 1RK1B 3QZWB 4X80H 5FEBA 2J5LC 1GGCL 1KFAH 3EOTH 1U8HB 2GKIA 4OGAC 4XI5C 2NY3D 5GGTH 4GS7B 3HUJA 1U93A 1NKRA 4YDKL 4WFHE 1YEFL 2WZPD 4YLQT 2GI7A 1ZS8A 3TBSA 5L6YH 2EYTA 2FEDD 4UNTA 3N1QC 4QXGH 3BUYB 3SDAC 4QXTB 4JM2B 1F6AA 2ICWJ 4QNPE 3BWUC 4PRID 4XAKE 3NTCH 1P7HL 5DYOB 1NAMA 3OAUH 4UU9B 1XGRB 5CEZE 4OI9A 3TZVA 2HRPL 4PRDA 3BUTA 5C9JA 5DRWA 4IM8A 4LPXA 4X7DC 4YHKH 4NQED 2CDGA 3OKMA 5DJYB 5EO0A 2BERA 4PREB 1G7HA 2XXMB 3M17A 4WRLA 4D9QE 3QI9A 1R3JB 4L3EE 5DTFA 2C9AA 3SKJL 4KK8D 5IMLB 1FNLA 3JTCA 3KS0H 1OPGH 5TE7H 1T3FB 4G6FD 3T1FA 5D70H 1FZKA 4LARH 3TH4T 5I1IL 4HH9B 3R8BB 2R39A 1F90H 2HN7B 2NY0C 5KSAA 1P4BL 1R3HA 3MUGB 2HFGH 5FOJA 1UH3A 3RWFA 1S3KH 1A9BA 1HIMH 5GZOD 2IQ9H 1C08A 1HWHB 1JWMB 5EC1A 5HGBB 2BX5A 3SKMA 4J3UA 2KBGA 4JN1L 3IKCA 4U6VL 1HQRA 5DRNB 3WD5H 4TSCH 3B9KA 5C0JA 1WFTA 4JQVC 2PF6A 3KWWA 1FJ1A 1ZTXL 2OLDA 4M1CD 4UT9H 3VG9B 4X9BA 4BK4A 4FZ8L 5B39B 5IQ9A 3U9UB 1E4WH 2ZOLA 2X42A 2D7NA 4OF0A 1YYLH 5JOFB 5JIHA 4P23C 2X70B 3EYUH 1I7ZB 1VFUA 2P5WE 2YHGA 4YPGB 1TQBC 4U6HA 5DFWH 4FFVC 5CLTA 4P5TA 2PXYA 3ARRA 3KJ4B 3GSRA 4LCWD 4Z0BL 4RGND 5DJDA 2Q7NA 4U7MA 4BFEA 1R5WB 1T6WA 1BAFH 1EFXA 4F57L 1ORQA 2G2RA 2OR8A 3L5WB 4UQ2B 4NRXA 4WHCA 2I60L 5L2JB 4NBZB 3UJIH 1YN6A 3WLBA 3F5WB 4LQFL 1S7SA 5KS9B 3RVTC 3BPOC 4XPBH 3NCFB 3B2UC 4NRYB 4M3KB 4DQOH 4NN5B 5SWSB 4CRPA 4PJDB 5J89A 2X5PA 2LAAA 4H88H 2P24B 4PUBL 1LDPL 2QQNH 4HXAL 5DJXB 3GRWA 1BD2B 5T1MB 5F6IC 4HPYH 1YEKL 4U1JA 5MENB 2A0LC 4QNPF 1T7YA 3FRUA 4NNPL 4V1DB 1MHHB 4DOHE 4HUWA 2P5EB 4LAJH 5JW4Q 3QAZB 5DK0A 1F4YL 4CW1B 1LQVA 1NEZG 4FFYH 1KJ2B 3KXFD 3DI3B 4CVXA 1JIBA 4XC3L 3VFOA 4XP9H 3KPQB 3WFDH 2J3SA 4PV9A 2NY4D 2EE3A 5I1KL 1ZA6B 3QWRD 2CUMA 5HGDA 2MOVA 5JIKA 4HJJL 5KSAD 1MFNA 2BVEA 2CJUL 1AH1A 5HHMB 3ESVF 2WWKT 2QQQA 4WU5B 4HIHB 4EDXB 5LCVL 4PJ5D 3P0GB 4J8RB 4HGKC 1XH3A 3ARSA 4OLVH 3DO7B 2QADB 4GAJL 4M7JL 1A7PH 1Z0NA 3VGFA 2OI9B 3MLXL 2BNQB 2F5BL 4EN3C 4FXGA 4P2QD 5HHPA 2QSTA 3S88L 1BGXL 2IADA 2MJWA 5ETUA 1S7SB 1A6WH 5KS9A 1HKFA 1U36A 4RAUB 2XQYG 2DTSA 1T66D 4G8GD 3HI1B 2AEPH 3DURA 3TO4B 5HI4D 3REWA 4GAGH 4PJ7B 2DM7A 2FWOB 1YEIH 2OTWB 1N7ML 1D9KA 2YPLB 3RTQC 4Z7VF 3RUGA 3DRTA 1IZJA 1CTOA 3KR3H 1UZ8A 5D7JB 1WEJL 1A14L 5D1XA 3K46A 3UAJC 3B8SA 3ZYZA 3TJEH 4F3FA 5GGRB 1IE5A 1FN4A 1MHPH 3P11L 2ZUQB 4OCNC 1TITA 1LE9A 5GIRB 4EN3B 3PWNB 5JDJA 4LHQB 5DUML 4Y4HA 3C5SA 5ITBL 4OCXL 1K4CA 2WP3O 3WIHH 1U3HC 4QRQB 4JDVA 1JYNA 1TZHB 4TNVK 4KDVA 4XTRD 2I24N 3VG0H 2ZCHH 1MFDL 5LAXB 5IW1A 3VDCA 4D0BA 2A77L 5JMOC 3BD4A 4OLXL 1NAMH 2BY0A 4JJ5B 4KRNA 2R4RH 2V2XA 4MA8L 1X5HA 4JN2B 2E9IA 4YDKH 4XNZC 2LAGB 3VRJB 2RCSL 3F7YB 5EOQH 5IGXL 5L6YL 1MJJB 2Q1EA 4WUUB 4G9FD 1TVHB 4CMHB 1T0NB 1UJ3B 4J1UB 2W9DL 2R29L 5JOEA 1BZ7B 4OD2A 3WNNA 4BZ1L 2FL5A 5ADPL 2R0ZH 3GSQB 3GMQA 5EO1B 2XKNB 2ADGB 3T3MF 3DRQB 1GH7A 5D6CA 3MV7E 1O5DT 5D7SL 5CJ5A 3MMEB 4N1EA 3RL2A 3TV3L 1GGIH 5C0CA 3SDAA 1WSST 3DRTB 3UZQA 2VNCA 4ZG1A 2X4SB 1BJ8A 2ADIA 4C56E 3DWTA 2HKFH 5EORH 3X11A 3WLWD 3HR6A 3OKMB 1KSRA 2FO1A 3CCHB 1A1MA 4AENA 4MNGB 3HI1A 2X44D 2BSSB 2YZ8A 3FO1A 4ZDHB 3EJYD 1D5BB 1CI5A 3NCYS 5D70L 3CFKB 4U1SB 3RA7L 4HK3N 4P3DB 2I9TA 1NGXB 3TBWA 2GEEA 4N8VG 3A67H 1DBAH 2EYTB 4IHOA 4QKXB 1WCQA 4G8GA 5KSBE 3V6FB 1A3QA 1P4BH 5E56A 2FHCA 1EHXA 4ZXBB 5E8DH 5LAXA 2HTLC 4LSQL 3IJHB 3WYRA 4OB5L 1AD0A 2APWA 2NX5B 1ZS8B 3AB0C 4F37K 2PCPB 3TJHC 2ZJSH 1K8IB 3BGMB 1T83A 4G7YL 4TSCL 1FN4B 1X6NA 1I1AA 1I3RB 3EYOB 4ONOA 4F3FB 3RBGA 1OP3H 4DCQB 4JVPA 1VPOL 3JV4B 3ETBF 3F12A 1UZ8B 2X4PB 4RDQF 1YUHB 2W91A 2X9YA 1QPXA 3OGCA 3DROB 5EA0L 1OGAB 1MJ8H 3TFKC 5KTEL 5DMIH 3L6FB 3SO5A 4WI4A 3THMH 1DUYA 3LEXA 4X5XB 5H8DA 1RUQL 2BY1A 3PABB 3VMPA 3UTQA 1Q1JH 4YXKH 3GSNH 4CVWA 1JI1A 3VMOA 4ZYKA 1QFPA 3D2UB 4G3YL 1E4JA 4XCFH 4ZPTA 1IEAA 1BEYH 1Z9MA 4LCUB 2V9RA 3VFNA 3QIWC 4P4KC 3UDWA 5CD5D 1HOCB 1T20A 2OL3H 3N1FC 5ACLA 3V0VB 4Q2ZB 5BJTA 2GTZA 3QQ4B 3TT3H 4JG1L 3SCMC 5JHDB 1JGVL 4G6AD 1XR9B 1GGBH 3V2AR 4HXAH 3W39A 4TULL 4O2EB 3C60D 3MRCA 1E0OB 1LWRA 4V3DB 5DMGC 2GCYA 2YPKB 3OAYK 3QG7H 4KKBD 5ERWB 5C07E 4NQDE 1AD0B 5F7DB 1UG9A 4Q9CA 5F9WB 3MRMB 3MJ9L 2IADB 1YNKL 3PGFH 4APQB 4B5EA 1NGPL 3WE6B 3OAYH 4PV8A 4PTUB 1IEBA 3TPUB 1UKSA 5GXBB 3WFDL 1TTGA 3O45A 3CFKA 2CLVA 4PJ5B 4PJCF 2CQVA 2ESVB 1D5BA 5I1KH 3IDJA 3PHSA 1WZ1H 3RY6C 2QR0A 3HZVA 1PEWA 3T8XA 3PHQA 1JF1B 2HFFA 4UNVA 2QLVB 3SGJA 2EDYA 2MSPA 4F7PA 4HGWB 5IVXA 3FFCB 4UT7L 3MBEA 4XPHL 5KW9H 3W5MA 5SV3A 1GYAA 3EJZD 5GGRY 4JFOB 3ZSSA 3BP7B 3SGJC 4OM1L 4JGMA 5CIPB 1FSKB 2ZG1A 3MLXH 3BZDA 3A6BL 2ZCKL 2F8OA 3S88H 1CK0H 3MSPA 3P2TA 3HZMA 3G6AB 5F89B 1KV3A 2K9UA 4GAYA 5ACZA 3ARFD 1AI1L 3DSFL 5FYKE 4F9LC 2YMXH 1UZ6E 2EIEA 2J1KA 1IC4L 2GYSA 3RTQD 4FQIL 2PR4H 3IFNL 2EH8H 3B8YA 1RFDH 5I17B 4L9LB 2IALA 4B53A 1DUZB 1U0QA 5F96H 5CBAA 3TJEL 2YUWA 4XMKL 2CDGB 3MYZA 1WC7A 4MJ2A 4CL7A 1J0KA 5HDLA 1ITCA 5MEOB 1EFQA 1UWXK 1VHPA 1RMFL 3ARDC 4ELMB 3DHJA 1I8LA 4ORGA 5DUMH 3DROA 1N2RB 1CDYA 3GM8A 4Y4HD 5J6HA 4U3CA 5GGSY 1YEJL 4IIQB 4BH7B 5KSAB 3MYJA 4JFHE 1RHHA 4Z0XA 3AMKA 4R0LC 4AH2A 2DIAA 2DQDH 2F19H 4LLDB 4FQXC 2HG5A 4LEXL 3ULUF 2NY0B 3MNVB 2C26A 2PYFA 5KVEH 4O02L 2XWJB 3LKSB 5E95B 1CLOH 2ZKHH 5CZVL 3TFKA 1PLGL 2R69L 3VXUA 1IM9B 2EDHA 5BMFH 1ZAGA 4NHCH 3LN5A 4MD4A 4N8PA 3JWOC 4XGZB 4KRMB 1D9KB 3FFCD 3CD4A 2R0ZL 4YH6A 5CD5C 5IMKB 1DLHA 3LMJL 4JRXE 4GBXD 3NH7H 1IJ9A 1M1SA 1KGCE 4HLJA 2ORBH 3T8XB 2RFXB 3RIAK 5D7SH 2W0FA 5F88A 1VGKA 5CHNA 1OSZA 1GGIL 4G7VH 5EUOE 4L29A 2PYFB 3MLWH 5I8OL 1UM5L 2FGZA 3N06B 4JAMB 1OP9A 3GMRB 1IM9D 2IAMC 3AMLA 4OSUH 3UJTL 1F2XK 3HUJB 4LASH 3WIFB 1UCBL 5J12B 3NOIA 3ZE0E 3TN0B 2BK8A 4JKPL 5HVWA 1TLKA 4XC1L 5DUPH 2W07A 4PJFF 2PO6D 5ECJE 2ERJC 4JPKL 3M17B 4L4VE 1U6AH 1TVHA 2HP4A 5IUSA 3ARGC 3OZ9H 2YPLE 1EO8H 3CFEA 5CBEA 4K71C 5CP3A 4ETQB 3RVXC 5H94B 5CEYB 1S7WA 3AM8C 2FZ3B 3EO0B 4XH2A 4PJEB 1QVOA 2WBJA 4M9PA 4MJID 3S35H 3NVQA 4RMTA 1K3IA 2ZJSL 2XWBB 1AO7E 2RJMA 1ZLSH 3VU2A 3LH2H 4Y4HB 1AGFB 2X1QA 5FM5O 3QDME 4JFEE 1OP5H 3T4YB 3UCRA 2F54E 2VUOA 3JSSA 2HH0L 3NIDF 5T5FH 4X4YB 2D4FA 1GGYA 2NY5L 4G59A 3DETC 3BPLC 5ERWA 3N0PB 1G7PB 5C0AE 5B8CB 4HQQL 3U7YL 3RRQA 2R1YB 3U30C 5DMIL 4Y19D 1OSPL 5CLWA 2P8MA 3T2NH 4TSAL 2ED9A 1S7UA 5MHSE 3ZTJH 1BIIB 3QXDB 1DQML 4PS4H 3ARED 4X4MA 4KZEL 2X4NA 2YBRA 5EH1A 1Q1JL 4YXKL 2AJXH 2DMBA 2XQBH 2MFNA 3LKRA 5T1LB 3SJVA 1R6VA 1UACH 3OBAA 4KJYB 5HVHB 4DN3H 4HC1A 5C8JA 2OI9A 4WEBH 2VLKE 2ZSVA 3F7VA 2Q8AL 4JRYE 5DJAA 3SQOH 3MV8D 4JRXA 4Y0GA 2WLYA 4RWYH 1U3HA 4M00A 3FO0L 2WUBL 1VESA 5C0ND 5CJBA 1AIFA 1IQDA 5SX4I 3MROA 4LVHB 1NLBH 2WNGA 4JFDE 2EDTA 3O6LH 4M61B 5C0EB 3W11C 2YD4A 2R1XA 1BBDL 1GL4B 4MD5B 3WDHA 1K5NA 4EI5C 5F9JA 1YUHA 3HAEB 3ZDZF 4I77H 1EH9A 5K9KA 1NUFA 3LKOA 1OHQA 2EDOA 2HLFD 1F58L 3O2DH 4H25A 3GRWL 4RBPK 3RWEA 1JBJA 5IIEA 1FFPB 4PR5B 5J56B 3V6OC 3DX8B 3SDDD 4R0LA 2WSKA 1NGZA 3Q6FB 1EJ6A 4MA7L 4RSVA 4D9RE 1LP9F 4X6EA 4LVHC 1NUGA 5T3ZH 2QL1A 3TO2A 1IEAB 1JPTH 1LO3L 4OTXL 4HH9A 4PJAE 3VXNA 4HUWB 3D39D 4KZDH 2VDOH 4OZGF 4KUCD 1A9EB 4UV7L 3RWCB 5GRWA 3DX6B 3RHWK 3CSBA 1SEQL 1D3CA 5J13C 3CFDA 4PREA 3CFBA 4XPAH 5D93C 5GGTL 1HINH 3ARDB 2XRAL 1XCQA 3NCCB 3PL6B 3QA3B 2SEBA 4OM1H 1WAAF 2FLRT 3PQYE 4F7TA 4K2UL 3KPTA 3VGDA 3CX5J 3FQNA 4YK4B 1JHLL 4M6AA 4OZHF 1FH5L 4M43H 3C6LB 5DJYA 15C8L 5T1KB 1FV1B 4LMQI 4TNVF 3DSFH 1MLCA 4KXZI 4G6JH 5EU7E 4D2NA 1IC4H 1MWAH 3HE6A 3H2WA 1MHEB 1L0XA 1CL7I 5IVNA 1A5FL 1Q9KB 4IBLT 1MLBA 4PG9B 5F96L 4LL9A 4ELKA 1BZ7A 5I71C 1N64H 1BQHG 4U1HA 4BFIA 3CDGA 5E4EB 4Z95L 3EHBD 2AXJA 4X8JA 3OKOA 2ITCB 1WT5A 3F7YA 3L3GB 4RMQA 3QO1A 4DVRH 2C1PA 4O9HL 3PDDA 4Y4KD 5HDOA 3TIDB 3MV8B 1EO5A 2XY1A 4WNQA 4YIQB 5I2IB 5DQ9A 3WUWA 2DQJH 5FM5M 5IESH 4WU7A 4PJBF 3GJFA 3HS0B 2IALB 1CE1L 3MJ8B 4JKWA 3FO1B 3RWJB 4RX4A 5CWSB 4C83B 3IKCB 4ZFOA 1HIML 4XCEA 5F1IB 3T09A 1FQ9C 4WI2A 3GSUB 4JM2D 3IS0X 4Z7WF 4JN1H 1HEZA 1VACA 1DZBA 1FYTB 1A8JH 4L1DA 3OJDA 4LHUA 4PY7A 1NH6A 1PLGH 2R69H 5FYLH 3PL6A 4M6NH 4GKOA 3MRRA 5LVEA 1HCFX 1G9EA 2GAZA 1SJHA 2WY3A 4S11A 4C55A 4P46A 1K8DA 1WFUA 2QHRH 4UT9L 4ZFZB 4PRHD 2RIKA 2Z8RA 2Z92A 2CKBB 3H0TA 4J3VA 5AD0B 1NMBH 3WL9B 4KKNA 2VMFA 2N1KA 4JQVA 3HC3L 1J0HA 4PJBA 3S3SA 5C7XH 2X4UA 4NYLB 3GIZH 4R90L 5ISZA 3O3DB 5IVXB 2E6QA 3VWKC 5J57B 1AHWA 2Q86B 1MJUL 1W0YT 1YNTA 3C09C 2AI0L 1IL1B 3RVWD 1NGWA 2VE6B 2A6IB 5KJRL 5C6PB 3RWEB 1XF3A 3E6HA 5HHXL 4U1NA 1OTSD 2ITDA 1UCBH 1S9VA 1IAKA 1TTFA 2CSPA 4XPTH 3L3HA 4LQFH 3HNSL 3MV11 1JGDA 3TIEB 4TSBH 5FO9B 2W38A 3IJSB 4F7MA 4NZJA 4IMKA 4XP6H 1I8MB 1OT2A 4WJ5B 3SCMB 3OZ9L 3RGVC 4H8WL 1L7TL 4YBLC 2GY5A 2I9LA 1QPPA 4G43B 3MA7A 3V5KB 5IR1A 4PP1C 3C9NA 3CUPB 3QI9C 1YEKH 3BP4A 2BDNL 2W9LA 2X10A 3LRSB 5J06A 3WCYA 5DJAB 1TJIH 2ZG2A 2JTDA 4LRIC 4P3CL 5JW4N 2I07A 2V7HB 3LH2L 2I27N 5FOBA 3W9DB 3TZVC 3GBNL 4M4RA 2VZTA 1ROWA 1I7RB 4LDLB 3RZCB 3REWB 3SDDC 1RUPL 1R3KA 4XP9L 3KHOA 3T3ME 5EU4A 4Y16D 4L4TB 5ESQB 3RKDC 3JXAA 2YUXA 4TN9A 4AL8H 1Q8MA 2BOBB 4RMSA 1AKJA 3FT2B 3QNXA 3T2NL 3SDXF 2XN9D 1AD9A 4JO1L 3UX9B 3K8KA 3O3BB 1OPGL 5LCVH 1BF2A 4K71B 2F5AH 2DS4A 5D7IE 3CDCA 3MOBH 1RU9L 1TQCC 1ZT7B 2AJXL 4UV4H 2X4OA 5E00B 4HWBH 5C08A 5I1LA 2M26A 1P84J 2Z9TA 2I9LB 4G43A 3JV6A 1GOHA 2VLKD 3RZWA 4ZPVA 1UWGH 3MV7A 4FNLL 1PKOA 5BS0B 3O6MH 1V7MH 5IFAL 5DO2C 1D6EB 3TWCL 4HLZG 4RWYL 2DQHH 4QYOB 2VZOA 3MLZH 2WUBH 1SVCP 5H94A 5CEYA 4ENEC 3BGAA 5FGBC 2W60B 4M62L 4Z7OF 4XBPA 3OAZK 4U6VH 1YEIL 4NCC2 4QRUB 1Z5LA 3SDXA 2VKWA 2NY1D 2W0PA 4OBRA 5AWNL 4X6BB 1KJ3H 3SDXE 5JOFA 2BY3A 1HQ4B 5A43C 1S7RA 1A14H 1X4XA 2P8LB 5CS7A 2AJYH 4MNHB 4WDIB 1NCBL 2AQ1A 5E2VH 4EUPB 1IAMA 5EBLA 1F58H 4I0CC 3H7LA 4BM7A 2CIIB 3EYUL 5BS0A 3O2DL 4ZDHA 2ARJA 1C5DB 3C5ZC 4L8DB 4RDQG 1FHGA 1T1ZB 4JANB 3O6KH 4R2GB 5C08E 4KMLB 1IC7L 1CDJA 2R15A 5DJ8B 3W9EA 2ZCHL 2E9BA 1ORSA 3EYVA 5EB9A 3CVHB 5C3LD 4F57H 4M1DH 3RWFB 1FL6A 3RIFF 1WTLA 1F3RB 2CDFB 2BCKB 3BKYL 3PP3K 2DLEA 1KN4L 4OLXH 5ESAA 2PUQT 4PJBE 1ACYL 4L4TA 2XRAH 3OG4B 5DEFB 5JW5B 1FZJB 3MRKA 4Y88A 2W0LA 3AU1A 2CPCA 2RCSH 1CXEA 1RZIB 4FQQB 5EG6C 2VAAB 2ITCA 3OKOB 3W9DA 4X0KA 3MC0A 4XNYH 3FN3A 2R29H 4ONHB 4YHYC 1T03H 5MERA 2VZ3A 4F7CB 4GRWE 5IROA 1E4KC 4R8WL 3H3BC 4WW2F 3DX7B 4NKOA 1VERA 5C0JB 3QYCA 1KG0B 1UM6H 1WBXB 1RZGB 5EOTA 2AV7A 2OK0H 4XC3H 4PLKD 3D1MC 3VXSA 4XP5L 1S7QB 4Y2DA 1DDHB 2ICEB 3EO1B 1LE5B 3BP6B 4HJJH 4QF1B 4O9HH 2F53A 2PW2B 4Y1AB 4YBHA 5JQ6L 2DN7A 3N1MC 2DMKA 2YD9A 1RI8A 3EDDA 3RA7H 1FCGA 4G8FB 3WNLA 3CFBB 1T0MA 4NNYB 4OF3A 3O3BA 4ZS6C 5CILL 1WGOA 1LEKB 2DQIH 1S9WA 4GAJH 4M7JH 3QZWG 4LSQH 1A7PL 4XXDB 3JWOH 1J8KA 5HI5D 2APFA 2RHEA 5ISZB 2E6PA 3CJJA 5DTFB 4ZOCA 3TVMA 1IGIH 2E7LC 3L7FA 3GJEA 2BMKB 3RGHA 1U91B 4KMQA 2Y4SA 1VFAA 1HKLL 5FYLL 1K4DA 2H3NA 1Z5LB 3JWDH 5E4EC 2EYSA 1MIEL 2VXTL 2D3VA 2HT3C 3ARTA 5I75C 1OAXL 4WCYH 1WEJH 1YDPB 4NNXB 2KQMA 4QRTA 3CUPA 2GJZA 1RJLA 3FT4A 2RQ8A 5CSZB 25C8H 5C7XL 4YGVA 4JANA 3GIZL 3ZDZE 2GIYA 4IOFD 4CN6A 1AQKL 4JFZH 1MJUH 3VXMD 3JVGC 4K7FB 1X5JA 4EIZC 3KPRA 3FO2B 1WLHA 5E2WL 4NUGL 4OUUA 1WV7T 2YXMA 3WIHL 3FB5B 3MRNA 4ZAKB 1G9NH 4K3EH 3GI8L 1RUAL 5KSBB 4QXWA 4GBXB 1IEHA 3VXPB 4NZTH 4GXVH 4XCFL 2ENYA 4XXCA 1BEYL 3HNSH 3O2VL 4KTDL 3MRKB 3TYFA 1JGLH 3TVMB 1J8HE 2E8ZA 4TUOB 2GQHA 1J88A 2R4RL 1YNTB 2R56L 4H8WH 2P47B 1MOEA 3IT8D 5ESAB 1YEDB 5DLML 4HBQA 5IKCB 4HUVA 3I6KA 1XR8A 3SHSA 2B1HL 3LRHA 1S5HA 4Y8DC 4TTDD 1TVDA 5HHMD 3K1KC 5FHAL 1XGTA 2BDNH 4XXCC 1OAZL 1ZT1B 1JFQH 3ET9F 3MJ9H 4PJGE 1KPUA 5IFHL 1K8DB 4BZ1H 2VR5A 1JV5B 5HDBF 1KB5H 5IR1B 4BSWB 1NUDA 4L4VD 3FQNB 2VWEC 4YBQC 3NIDE 2DD8H 3X12B 2ICEA 3B9KD 2X4QA 1JZ8A 1QO3B 1UT9A 1WCBA 5AUMB 4WW2C 1B90A 2DIBA 1QVOB 2HKFL 5EORL 3NFPA 4RGNE 5KSAC 1S5IH 5EIIB 5C0FA 1TJGL 2G75B 4MWFB 3GNMH 1MCLA 1WZMA 3TLRA 2XZZA 3PWJA 1BD2E 4MYWB 1MELA 2EO9A 4QHNA 5IVZB 3IJYB 3RY4A 1CD9B 1WTGT 4MD0B 5IBUB 2AJUL 4HWBL 1PZ5B 4QHKJ 3T0EC 4L4VB 1AFVH 3F7RA 2EECA 3VGAB 2UUDH 1I8IB 2WQRA 3WN5C 4GLRI 4I48B 2ZCKH 5E8DL 5CSBA 5FGRA 4DGIH 5FDWA 1Q0XH 3TWCH 4Z7NE 4JFFA 4XP1H 2DQHL 2NZ9D 1MEXH 1G9MC 5H35A 3VE0B 1Z9SA 5I74B 4HUNB 3K4ZA 1HHIB 4MSWA 4PRPE 4PYGA 1JZ5A 4FQ1H 1N0XH 1U8PB 4JFDA 4XWOD 4AYFA 4L8SB 3W11D 2CRMA 3UTZB 5AEAA 1AKJB 3QUXB 1ZEAL 5CINH 2AJYL 1S7TA 4NNXA 3GI9H 2YKLL 6FABH 1JGEA 1ZSDA 1XF5B 3MLUL 4MNGA 2CO7B 2YD8A 2DWDB 1QHOA 3QWOA 1N6UA 3S36X 1ZGLA 2YN3A 3DGGA 3O3UN 5DRXA 2CIKB 4MQXC 3RNKB 4X4ME 4D0CA 5IV2B 1G0YR 4M1DL 3QFJA 2WBJD 4X98B 1JGUH 5EUKA 3DARA 4NT6A 2FDBP 3I50L 4PJXF 3V5HB 4JPWH 5IEHA 3CFJB 4U0RB 3GB7A 1YPZE 2OL3L 4JY4A 4AH2B 1EVTC 4PY8J 2OS7A 5CZVH 1G0XA 1YMME 1WWWX 1MJ7H 1TCMA 1ULVA 5BMFL 5C0NC 5T3XH 3VFWB 1X4ZA 3LQAC 1F00I 3EO1A 4ODXA 2QJDA 3SDCD 2N4IA 1QYGH 4QRPD 2VLJD 4G8EA 1EEYA 5DQ9B 3WUWB 5ALBH 2APXA 2WIIA 3GKWL 4LLAA 1KCVH 2WBJB 1YNKH 5EUOF 3FFDB 1J1PL 1CQYA 1E27A 3V4UL 2C3GA 3QEGL 4ONHA 2FJHB 4QRSA 2SEBB 4XP4L 4KJWC 2K7QA 2JCCB 4LEOA 3S36H 1ND0B 5BW7C 3DOSA 5JW5A 3PF2A 4LGPB 2R2EA 2PTVA 2EDEA 4XBEH 2DQFA 4LASL 4WWKB 4G9FE 1FVDA 4XMLH 4P46B 3BD5A 5A2KH 4P3WA 1A4JA 1XGYH 2DWDA 5DUPL 3ULVD 5DEFA 4HT1H 2NY6B 5JNYA 5D7JA 1GGCH 1INDH 4LHUB 1I8LC 1BIIA 1PYWA 5T1KA 1ZHKB 1ZVHA 3P9LB 1ITBB 4P2RD 5GGVL 1HH6A 3DURB 4UIKH 3MJ6A 1QRNE 3A6BH 4Y4FB 3SDAD 4TTGA 2ESVA 3S35L 1K2DA 3Q48A 3HAEA 3BPLB 5SX5K 3QDJB 3NTCL 4GG8B 4QOKD 4WWKD 4F7PB 5FM4A 4X4ZA 1MHCB 4ONGH 4XI5D 4K8RH 3JWDL 4YHKL 3D69A 4OGAD 4OCLC 4HULB 4FQIH 2V2TB 1MAJA 1I1YA 3LD8C 4DZBB 1NEZB 3G04B 3WFBH 4U1GC 2OSLA 3ZKXB 4JFFD 4X7TA 4PTUA 4BUGA 4HQQH 4JZJC 4XMKH 3U7YH 1JWUB 3SKJH 4CMMA 4UB0L 4XVSH 4F9PA 5E08H 4PBWD 2GJ6B 3DMMC 1G7LB 1DCLA 4PS4L 4KZEH 4NUGH 2IJ0C 4G6KH 1Y6KR 2HRLA 1INQA 4NN5C 5L8LB 3QNZB 1NDMB 4K3EL 1UACL 4DOHB 4KAQL 5A1AA 1OVZA 5F3BA 1MAKA 4DN3L 1YEJH 4K8RD 3PIQA 4GXVL 4PD4K 4MHHI 1S9XA 2Q8AH 3MV7B 2DQCL 1PQZB 4LSPH 1TQCB 1S3KL 2DQDL 3V5DA 2F19L 4J6RL 2YD7A 4LEXH 3UTQB 3VXOB 2B2XH 2Z31B 1P1ZA 1ZT7A 4WEUD 3D3VD 4M1GH 3G5XB 5F9OL 4KV5F 1IILE 5DLMH 4M93C 1EBPA 5IMMB 1SYSB 5HHOD 3TPKA 1FPTL 1X7QA 1MCCA 4D8PA 1MWAA 1BBDH 1Q9OA 4N0CD 2BOCA 4QWWC 4HKZB 1JFQL 3BPCB 4PB0L 1KOAA 2C7UB 3BDYH 4FZ8H 5IFHH 4PGEA 1CG9A 3MV9A 4HKBA 4JQIH 3VA6A 2X40A 1UKQA 5BV7C 4P2OC 2AXFA 2D7MA 3UBXG 2X4RB 3O81A 2E9JA 4KVCH 3V5KA 3ARFB 4GW4B 1AHWC 1INQB 2JCCF 3VWKA 4D94A 4ELKB 5C86A 2XA8L 1BAFL 4YO0B 3D39E 5FHBH 5JORA 4RNRA 4R4BA 3TBTB 3PGCB 2BY2A 1X6LA 4MMXC 4XMPH 1DVFD 3BRGC 2H2SC 3RFZC 3ABZA 2JB5H 3S37X 5B39A 4QHLA 4JKPH 1SEQH 4O2CA 3OR6A 5BRZE 1CN4A 4I3RH 3RZCD 4XPAL 4NC1C 3PDOA 4M93B 5TH2A 1I1YB 3RP1A 2A74A 3VRIA 5T3XD 5FM8A 5HJ3A 4PJEA 4PRPB 1NBYA 1VGEL 3OKNA 5I15H 1BJ1H 4Z7VE 1U2HA 4Z8FL 2RAMA 4DGIL 5HYEA 1MHCA 5GPRA 3TNNB 3KYMB 3BZEB 2UZYB 2CK2A 1KIPB 3V9FA 1T5WA 2KQNA 5ISZD 15C8H 2WINB 4XGZA 5FKAB 1L9MA 3ULVC 1I1AC 1B4RA 2YUVA 2CLRB 4M9OA 4NNPH 4OGXH 1MWAL 4WW2B 4NFDA 3V7MA 2ED8A 1AHWB 3BRFA 3FB6A 5L9DH 1NJ9B 4WV1C 4NYLA 3MRRB 1FE8L 5FAAA 4GG6B 3GJFH 1M05A 3U46A 3LN4B 5BS0D 5DC9B 3GI9L 1IGFL 4WFED 3KYAA 4Y5VC 4BSJA 4JHAH 4JY6A 4HV8B 3EJJX 3BFOA 4I13B 4QHUB 4WUUE 3O6FC 4DAGL 4ZYKB 3GSWB 5FKAA 3HE6C 4AIZB 4QXUH 5I8KL 3DLQR 1FFOA 2XQBL 3UO1L 3QUMB 5C0CE 3V6BR 2IFFL 3U0TA 2KZ1B 4POZC 5C2BL 3NIFF 1RZGA 2B39A 1SQ2N 4E0RA 3HPLA 1YMMA 4K55A 4E42A 1FC1A 3MBXL 1A6WL 1UGNA 4PRAB 4XHJC 3O3AB 2QHLA 2VDMH 4OT1H 3BP5A 3F7VB 1KYOJ 4M6NL 5BQ7B 4P48A 3BIBX 3S3JA 2FEDC 5T3XL 4APQA 2DIJA 5E24E 3LQAL 5C0DA 3H3PL 1FVCB 3KLHD 1NMBL 5D96C 3ZT5A 1I8KB 2EIZB 1KCVL 2D7PA 3K2MC 1J1PH 5CJOH 3L5JA 3E2HA 4E0RB 4LOUC 2EC9T 1AGEB 4F37F 5C0AA 1G7PA 1UH2A 2BNUA 4G8GE 2CIKA 5F7HA 5EBWA 2J4WL 4TRPL 5ALCL 5DXWA 2O26U 3CH8A 1FFOB 1GGUA 3VG0L 3MQIA 4QT5B 4JR9H 5HYJD 5T3ZL 4EI5A 1JPTL 1LO3H 1ZA3B 4OTXH 4KZDL 4ZTPL 2YPVL 1JRHH 1QFUH 3BZ4A 3QA3A 5IFJB 4HT1L 4PRPA 3CCHA 4UV7H 2EC9U 3BHBA 4ORZC 4GBXC 1NAML 2XZCL 3BW9B 4YXLL 4Z78B 5L2KA 1L7TH 3FO9A 3HZKA 2IPUG 4YPJA 1X5XA 1BQHB 2NY7L 3FZUD 5IIEB 4N5EC 3T0ED 2AXHA 2ADGA 4E9LA 3MCKB 1KCKA 1D6VL 3SDXB 3HPJB 5IOPA 2W9DH 4R7DB 1FH5H 3LKOB 3LS4H 4GKSA 5ADPH 5K9KB 2H6PA 3PL6D 4HMEA 4MVBD 4RAHA 3P4OB 5CKAA 1XGPA 2AJZA 4FN0A 3RX8A 2Q8BH 3UZVB 3PJSB 1P7KB 1XR9A 1U8LB 3GIVB 4ZPVB 4M8QB 4ZUTA 3S5LG 3IDGA 4Q6IC 1CXIA 1WC7B 3IJHA 3L3JA 5IMOB 3M1BA 2AJVH 3U36A 3NZHH 4Q58C 5HYSA 4HKZA 3O9WB 4KHXL 4KWUA 4X7SH 3D0VB 4V3EB 2G75A 4MWFA 5E08L 1CQKA 8FABB 2B4CC 4CU6A 3PGDB 5FECA 3UXFA 4APQC 3K8MA 5DHXB 4G6KL 2IF7A 2ADJA 3A67L 2W65B 4IRZL 2OJZH 3D25B 4KAQH 4HJGB 4OFDA 2F54A 3BISA 4L8CB 1KBGL 4XTRC 3HMWL 3IXAA 4NN6C 5HHNA 3T2QA 3D0LA 4FNLH 1IM9A 1HXMB 4J12A 4LSPL 4LPCA 4ELMF 2OZ4H 4OB5H 5D2LB 6CGTA 1CGWA 3QCVL 4K3GA 1CDGA 5T1LA 5F8RC 3HN3A 3IFOA 5DD5H 3UYRH 3WN5A 4M62H 4OZHE 4PJ7F 1NFIB 3VFNB 4TUJA 4YX2H 2CUHA 2YPLA 3ARQA 4L8BB 1FPTH 3ILQD 2VQTA 4XNQA 3D2UA 3X13B 4Z76A 4UDTB 4PB0H 5DJCB 5JW4M 3GDBA 3TYFB 4EJ1C 3DX9A 4MA3A 1JZ4A 3ARDD 2A1WL 3X14A 4UTAL 1RY7B 4R97C 4GSDL 4Y5VB 3ZE0F 1B0GB 3K7UA 3THML 4E41A 3B43A 5ANMB 1ONQA 1XIWD 1PD6A 3AC0A 2JKXA 4W4OA 3FB8A 5KJRH 3AROA 2XA8H 1E28A 2HTKC 4PBVC 5FHBL 5ICXB 2XT1B 3QR2A 5JDSB 4KKCD 1KB9J 1YEGL 2PTTA 3DI2B 1QSVA 5T1KD 3TN0A 2JB5L 3Q5OA 4NQCE 1N0LA 3PJSA 4PPTA 1VFOA 4Y4KC 1LK2A 3WO4C 1IZKA 5HI5C 1AC0A 1U8JA 4P23A 3TT3L 3SE4A 1TNNA 4LLWB 1SVZA 3MO1A 1JNNL 3VXUE 1GGBL 4P4RB 4TULH 5DMGD 5INDA 2A6KA 2ZOKB 4HX1B 3QG7L 1OP3K 3GJFK 4K3JL 3VXMB 3SKOA 1HEZB 1VACB 1D5XB 1TJIL 2YD1A 3PGFL 3AS3A 4BSVB 4P3CH 4RZCA 1NGPH 3QIWD 4JHWH 4P4KD 1CLYH 4KHTH 2DLFH 4N8VA 1XGRA 1TCRA 1DQQA 4DK6A 4JJ5A 3F8UB 4F7EB 1JK8B 5HJ3B 3WUZA 1U3ZA 4S0TD 3VXSE 3ZTNH 3BKJH 5CEXB 1LNUA 2J88L 4MCZA 4XPFH 1EPFA 4JHAL 3ZE1E 4OLYH 4XBGB 4PFEA 4XRCB 4MVBA 1JE6A 3DSNA 2NY4C 3RJQB 3P40A 3PGCA 4UOW1 4UT7H 2PW1B 4P57B 2EDNA 5TH2B 3GMQB 3DYOA 1I9EA 1XGUB 1RU9H 3CDGB 5BOPA 1QA9A 4C4KT 2NCMA 4YEFA 1SBSL 2IFFH 2R23B 1MRCH 1YNLH 2FJGA 1K3ZA 3UEZA 5BVJA 1UWGL 1I7ZA 4L3CB 2QQKH 2VUYA 1HHKB 5IB4A 2PTTB 1OTTC 3SQBA 3BYYA 4BH7A 3MBXH 4NO5B 4PV9B 2IBBA 4PP2B 3IDIB 3MLZL 3K3QA 2E27L 5HYJE 4O58L 5DRXB 4TOYH 1UWXH 5SWZD 4N0UB 2YMXL 2HJLA 1WZLA 2DI8A 3FB8B 1B6UA 1NGYB 4E42B 3KYOA 1W8OA 3B9KB 1MIEH 4OF5A 1A1OB 1CS6A 3E3QA 1TZIA 3AREB 1KJ3L 4WCYL 2BVTA 4F9PC 5BCAA 3T0VA 1X4YA 3RAJL 2XFXA 4M6ML 3VG9C 1QFHA 3X14B 4S1DC 1JVKA 1YY9D 4X9IA 3LEXB 1NCBH 3NPZB 2PO6B 3G6AA 1Q9LA 5IM7B 2G9HA 4U3HA 1OD9A 4MDJA 5I1DB 3EJYC 5E2WH 4GRLA 3BH8A 4CDGC 3MLSH 5INDB 3OGCB 3KPOB 2HYMA 3KS0J 2J4WH 5FYKD 1P2CB 3O6KL 4OLWH 2A6DA 4YHNB 1IC7H 1RUAH 2Z8VC 4ZO9A 4HUKB 2X7LA 3C87A 3ARZA 1MCNA 1LK2B 1Q38A 5BXFB 1BBJB 4IDJH 4KUCF 4I0PD 3KYNA 3Q6GH 1KN4H 1JGLL 1J10A 4N68A 3UTSB 4KK8C 1DBKL 1M7IA 2XZCH 4X6FB 1XIWA 1DTUA 5DHVB 3VFMB 2AKRB 1ACYH 1CGSL 1SY6A 1MRDL 3HG1B 4M6OH 2Q20A 2VIRA 5IEKA 5FHAH 1L9NA 1FBIH 4Y5YB 1OAZH 2X09A 5KSBA 4L4TE 1U8PA 3HUJF 3CGTA 1NGXA 3TBWB 1FIEA 1T21B 5DEZA 1PGRB 3CNKA 1RD6A 2ZCLH 3O6FD 1QG3A 4LHUD 4R8WH 3BZ4B 3NH7L 5IFJA 5BW7A 1GZPB 5ICZB 4FQLL 3LVEA 3WLWC 2EDRA 3AXLB 5AZ2H 5IB1B 1UM6L 3FL7A 4GRWF 5HGDB 1KENH 3RVXD 4CNIB 1KIQA 4G7VL 5H37G 3P4OA 4HWZA 1QSFD 1A9BB 5SWZB 2X7LB 5LGJA 5EU6B 3MRJB 5JZ7D 1A6VH 1IT9L 4FABH 5EBMA 1YC8A 2NY2B 5KSBF 5KZCD 5D1ZC 1I1AD 3JBG7 2R1YA 4Q2ZA 3V8CA 4JPKH 4IRZH 2VLLA 1KJ2H 4YHNA 4U6TA 1I7RA 3ZTJG 3BHBB 3G6DH 2XG5A 3JWOL 4XP1L 3ZLQC 1RHFA 3QIBD 3NGBC 5IM7A 1AGFA 1HI6B 1A1OA 1VFMA 5HYJB 2AW2A 3D0VA 4MX7B 1YYMH 3DBXA 1IGIL 4NRYA 2HJLB 1IAIL 1NDMA 3MACH 5KSVB 4IJ3B 1ZLSL 4YX2L 5F7FA 2DRUA 4X99A 4Y2OA 3UMTA 1AO7D 4OKDA 4UU9A 4GRLC 3FFDA 1X5IA 1ZEAH 1MI5B 1U3HD 1OAXH 4R9HA 4G8EB 3TGXA 4TVSa 3RVWC 3RX7A 3PE9A 3D2UD 3LS5L 4J3SA 1VKXA 2A1WH 1QSEE 4UTAH 2VABA 1LO5B 2D9QB 1OW0A 1AQKH 5C0DB 2YD5A 3GM0A 2O93L 2DI9A 3EYQD 3OX8B 2HJFB 3UTTE 3GJEB 4MJ4A 4G8GB 3HZKB 4U1IB 1P9MA 3VH8B 1JGUL 3P4LA 3PWPE 1ZGLB 5I9QB 4NZTL 3FO2A 3VFUB 4XHQA 4Y4FC 4ZUSA 3MA9L 3D85A 1HQRB 1UVQB 5DRNA 1T2QH 3C6SB 1PZUB 2CLRA 4GRLD 3WJLC 4ZOEA 1GOFA 1A7RH 1K2DB 5IW3A 3PV7A 2BCKA 1J87A 5LKNA 4Q7DA 1J12A 4K9EH 5D6CB 3FQTA 2GUOB 2G2RB 3GKWH 2XWJA 4HMDA 4V2CB 2X4SA 3O4LD 4HCRA 2IH1B 3DMMD 5KVFL 1KB5L 4W6XB 1CXHA 5HHVL 3VXTB 2DD8L 2ZNXA 4KHTL 1BZQK 2O61A 4NHUA 4PJHB 4Y4HC 5KSUB 1AR1C 1HDMB 1HILA 3MO1B 3ZTNL 3BKJL 1NBZB 4XBEL 3TIDA 1RZKH 4OI8A 3QFDB 1S5IL 3LY6A 4K3HA 3I3DA 3DVNA 5GS0H 3V7AG 1XGYL 2IPTL 3UC0L 5KAQG 4AZ8A 4BFIB 3DUSB 1INDL 3IGAB 5D6DC 1RZKC 4ZFFA 5EN2B 4NP4H 1S7QA 4Y2DB 3IETA 1OT1A 2R9HC 3K74B 4A6YB 5H2BB 1NEUA 2N7AA 4ESKA 4PJ8D 3QULA 5E9DA 3ILQC 1CU4H 3ARBA 1YNLL 4CDHA 2P7TA 4P5MA 5EDXA 3W0WB 2QQKL 5CIPH 4EN3A 5KSVA 4F80A 5KS9E 3KLAA 1Y0LA 4WGWB 2J2ZA 3BMWA 5CP3H 5JO5B 1CLZL 4QRQA 5E6IB 5F1OB 2GITA 3F6IA 4K8RL 1HI6A 3HCVB 5GZOC 3H6JA 1SJEB 4PRNB 2C3VA 5KS9F 3T65A 3C5JB 2FYYB 2YA2A 3EJZC 3IAPA 1ZLWH 2YRPA 4ZS6D 4OKVA 3OKLA 4KKAD 5EUKB 3C60C 1R5WA 3WFBL 1Y6NR 3QUYB 3J7HA 5F8QC 5JIIA 3L3DB 4PJ9B 5FYKH 3CC5B 1R3JA 3VXQB 1FRGL 1CGYA 1BFTA 1WT5C 2YKLH 6FABL 5L2KE 4HZAA 1JL8A 3LKQB 1KF9B 1HN1A 1PG7H 3HE7A 4JFXB 2R2HB 4IDLA 3SKNA 5CGYC 1P5UA 3TO4A 5K9QI 4PLKC 2P46B 2L7JA 3MRBB 4F33A 2DQJL 5IESL 3V0WH 2V2WA 4WFFE 4J8RA 2IANB 3K8LA 1D5ZA 2DQCH 3U4AA 2A83B 2E8YA 4IDJL 3VFSB 3QBTB 3MZTA 2BNRE 4JO3H 3NIFE 5J7CC 4M1GL 2Z91B 4Z7NF 3VD3A 5C0EA 5F7DA 5HHOE 1JGDB 5IF0B 3TIEA 2DI7A 3MX0A 4CVZB 5BOZG 1R3HB 3H7BB 4JPVH 2R2HA 1AQDA 2BVPA 1FBIL 4KJPC 3ZKND 12E8H 1UQSB 1ETZA 2Z35B 1AGDA 3SJVE 5B38G 2C3WA 4YEEA 1QYGL 3MRBA 3FTGA 1BQLH 2F58L 4F15C 4OQTL 3AUVA 3HC3H 3LDBB 4LSVH 4Z78A 4Q6IA 5L2KB 4R90H 2BVOB 2J8UE 3V4UH 4FQLH 2KUTA 4GMTH 1PY9A 2M1KA 1JZ2A 3ZE1F 3V6OA 2NLJA 3OJ2C 5EIQA 2W9EL 2HTLD 1YY9C 1C7TA 1JHKH 1ZVYA 5IROC 4BSWA 2FSEA 4PRIB 2H2PD 2GK0B 5CP7A 1A6VL 4PIRF 2DB8A 3WEXA 3IFLL 43CAA 2HWZL 2FX7L 4GUPB 4XMLL 4XPTL 5C9JB 1ZHBB 1AD9B 3LD8B 5JQHC 4N5EA 2P7TB 3L6FA 1FYTA 3ARBB 3B9KC 1JV5A 1G7MA 4ZUUA 1BJMA 1F3DJ 2H32B 3KLAB 4AMKH 5GJTH 1YQVH 1H8OA 1T2JA 5T1LD 5F7UA 3WLBB 4L3ED 1JN6B 1ODAA 3ZKNC 5L2JA 5J1TC 1LP9E 1T4KB