2ZOKA

Crystal structure of h-2db in complex with jhmv epitope s510
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
252
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVQNYCRVYHEGLPEPLTLRWER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 66
structure length 252
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zokA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zokA01
3WFDH 4PJEE 5ALCL 1T20A 1MEXH 1QO3B 3P9LA 5FM4A 4H5SA 1SQ2N 2DQGH 4J3XA 2Q8BL 1DQDL 1JWUA 3D85B 3QQ4B 4YXLH 1NCUA 4TULL 3UYRH 2X05A 1PX3A 5HSFA 4TTDD 1N4XL 4NQDE 1UKSA 3VGEA 4KI5E 2VXSH 1JRHI 4X5WB 5FV2A 3T0WA 2NY0B 1MFDL 3RY4A 3QPXL 4MXWH 3MRDA 3P9MA 1IGCL 2QLVB 5EPMB 1YEFL 3GJFK 3ET9F 4FQHA 5EZIH 3GNMH 1NDGA 2QKIB 4QRUA 4BUHA 3OGCB 5D7IF 4PJFF 1ZLUK 1CD8A 3BE1H 5HHNB 3MO1B 4QOKE 2FYYA 2DAVA 3D39D 5IFJA 5HY9A 4M1DL 3P30L 3WNOA 4ZSOE 3KNBB 2EH7H 3DSFH 3FQUB 1VGKA 3O81A 3BRGC 4JANB 1HIMH 1VSCA 2GK0B 1A7BA 4B0MM 4RNRA 5IUSA 4ZTOL 1BQLL 2QQKL 2OI9C 4OCRH 2EYSB 3LKOB 3MRNA 2JIXB 4PGJA 5EBLB 3RWIB 3D3VA 1TDQA 2DM7A 2H2PC 3WHXA 5D9SB 2GFBA 4M6OL 3UPRA 1KBGH 1NL0H 3TJHD 1BFOB 1WZKA 1MRCH 2VISA 1MHEB 2D3VA 2X7LA 4F7CA 1FL6B 1CICC 4G8GE 4NO0D 3NA9L 4NQSA 4M1CC 4P46C 3ETBF 4GRWE 2DBLL 3T4YB 1LP9B 4EN3D 1ONQB 1YC7A 4LCWD 1NCAL 1X3DA 1CFNA 1KEGH 2APTA 1MHHA 3I6KA 2P1YA 4QXGH 5SX5K 4OD2B 4X9BA 1WWWX 3ARGD 5E08H 1IC5L 1CU4H 4O58L 4HQQL 4ISVB 3L6FB 1FPTH 3BQUB 1RK1A 1CLCA 5TFSH 4MD0B 4RIRA 4U1LB 3C5ZD 1T04A 1CF8L 5INCB 5IBLC 3B83A 2BVYA 3QHFL 1DVFA 2I60L 4AYFA 3DRTB 3C6SB 1ZVSA 4AIZA 4HF5L 4XMPH 4WY7L 1YEHH 1ADQA 3QZWA 2XXMB 1IILE 3WJJC 5EU6E 4Q9RH 4LF3B 3Q1SH 5IHZA 3GZKA 2OX5A 4AMKH 4QRQA 4Y5XC 4WTZA 3VDCA 3BXNA 1VEMA 2C4XA 2VIRA 4PRPB 5F97E 1EPFA 4NOBA 4KK5D 2X2YA 5EG6C 1RHHA 2V6HA 4JZOB 4NN5B 4RFEB 1G9NL 1KPRA 4S1SL 3VXPA 2NY3D 1X5YA 5H2BA 5EO0A 2G60H 4QWWC 1X9QA 1UEMA 1ES0B 4KXZI 4NQEE 3MJGX 1EMTL 1QYGH 3P2TA 1U8MA 2WBJD 5FYLL 3QA3B 2XKSA 2KL6A 1U8HB 2YEZA 4JJ5A 5H94B 5TQ2H 2UWEB 2XZCH 3EDEA 5JXAL 4R8WH 1II4E 2W38A 4G43B 5MEQA 2BOCB 2JIXD 2VR4A 4G3YL 4FQ2H 3GFUA 5CBEB 2BSSB 3U9UB 5CINH 1AHWC 1KB9J 1FL5A 4QHNB 5A16A 1L7TL 3H6JA 1H9VA 2PCPB 3S34H 2XWTA 5EZLA 4QEGA 4X4YA 2J8UB 2R56L 4YR6A 4KK6C 1FGVL 5C3LD 3QNXB 1BJ1H 1OTUD 3MV01 1NSNL 2BFVH 5ADOL 4N8PA 5JO5B 3O6LH 4MWFB 5DJ2B 1A2YB 4KVNL 3W5NA 3LEXA 1V8HA 3RU8L 3PWPD 4ZOAA 4OFKA 4G5ZH 4NPYA 5JW4R 1RZGB 1XAUA 4DK3A 4ZD3L 4R7NB 4Y7MA 4OGYL 1JZ8A 2W59A 2VDNH 2AEQH 3VFMB 1BVZA 5IBUG 3W39B 1V7MH 4MA8H 1A6UL 4IMKA 1TENA 3I84A 4JFFE 4N0CC 2YSSB 2VXTH 4ZODA 3KHQA 3FHAA 2E27L 2V7HA 3LEYH 1GZQB 2X4TB 1SVZA 1U58A 3OG4B 4UNUA 1FP5A 3GGWA 4WTWA 2EC9T 3TFKC 2DM3A 1CFVL 1KPUA 3KPMB 2X70B 5DEGA 1G0YR 4LCIH 2XTJC 3CZFA 1U9KA 1S5HA 4PUBL 5ETUA 1JHKH 5IHUL 4OM0H 3L3OB 1NBVH 3PP4L 5F72S 1MJ8L 1P4BH 4TN9A 1RURH 4RAHA 2JJSA 3CU7A 4X9FA 4R90H 5DVMA 5C92A 3HAEB 1MFCH 2IMMA 3HE7C 3OB8A 4KVCH 2AK4E 1LO0L 3KPNB 1ZGLA 4F33A 1EAJA 2X4RB 3E1F1 1FH5L 1MF2L 1BIIB 4KHTH 5DWUH 3IS1X 4NGHH 5CGMA 1JN6A 1FGNH 4X98B 3U0TA 1DFBH 2F58L 1EUUA 1CL7I 1ORQB 3UJIH 2OS7A 4RFOH 4AZ8A 2HT2D 4KQ3L 1ND0B 4OFVA 3RZCA 5DJDA 2R2HA 2GTWA 2IALA 5E1HB 5L0QC 4CJ1A 5I66B 4NFCA 4O2EA 4P9ML 2CSPA 4P2CG 3VU2A 1F45A 3MLVL 1FZKB 1NCBH 2C7UA 3MLRL 4D8PB 4JO3H 1U92A 4G9FA 4HDIB 5EC2A 1W8NA 4TTDC 4BYHA 2YPLA 4HJ0D 1A9BA 1WFNA 5GGVL 1CFQA 5CWSA 5E5MB 5DMGD 4DWHA 4HIIA 1DN0A 3SPVA 2HWZL 2D4DA 5D7IB 4PJFB 2JCCF 3ULSA 5JMOC 1QFUL 1MLCA 1IGTB 3MACL 4PJBE 4DKEL 1A64A 4LPWA 1BVLB 3ULUH 3BX7C 5A40E 3NN8B 4X6EA 2V7NA 3VWJB 5AZEL 3HS0B 3MRRB 4K23H 3BSZH 4MDJB 2GCYB 1YPZE 4F37F 3ZL4L 4KKAD 3VW3L 3P4MB 3EFDH 3GIVB 3QO0A 1E4XI 2PTVA 2PXYB 1HN1A 1JI2A 4LRIC 1HDMB 2X4SB 4HKJB 5E2UH 5DLMH 5F44A 1H3PH 5SWSD 4GG8B 1F4YH 5SV4A 2CMRH 3QXAB 3C09C 1JGUL 1X5FA 3LHPL 1KCUH 5LKNA 4TQEL 4YGAB 4Y4HB 4JFED 5ID0B 3JV0A 4JPKL 2WBKA 4U2YA 1QRNE 5KSUA 4P2OD 5TE7L 1TXKA 5F7DB 1U8QB 1RSFA 4YIQB 5HI3D 3CIQA 2VKXA 5TQ0H 3TBVA 3ZDZF 4U1JA 3S3JA 5TDNB 3RGVC 1BBDH 5ITFB 4UTBH 1HQRB 1D5BB 3PQYD 3SY0B 2PW2A 4M7ZB 4QF1B 1IAIM 3C87A 1TETH 5D5MF 2QQNH 5I8CA 3QUYA 5K9QI 3O0RH 1PW3A 3PABB 5HHMD 1CFBA 4ZAKB 3ZTNH 1JZ4A 2VLRB 3C08L 4U2ZA 4KK9D 5E2JA 3RZWA 2OSLB 2HYMA 4NM4H 4OUOA 4HWEH 2UZYB 5I1KL 2ADGA 2A6DB 4LRNL 3DIFA 1CLZH 3GMQA 3OKMA 3V7MA 1W0WB 2A83B 4TPRL 1FZMA 4Y19E 4RA3A 3QFJB 3C5ZC 3NCBB 5GHWL 2Q3AA 5C0BE 4HUNB 3D25B 1JGLH 1FSKC 1H15A 3MMEB 1N6QL 1DQJB 1DUZB 2P43B 4HW6A 1C1EH 4L3ED 4XCNA 3SDDD 5HI5C 4U1SB 3O9WA 5BO1H 3G5XB 4FQLH 5IJVB 3I6GB 1HWGB 4GH7B 4ZUSA 5FV1L 1CR9L 1UVQA 1BQHG 4PJ7A 2N1KA 5L2KD 1JCKA 4O2FA 3VXUD 2VL4A 3JTTA 5C2UB 5C6PB 4G80A 1AJ7L 3RVUD 5A3IC 3SE8L 2CDFB 1GC1C 4R2GC 4U7MA 3TWCH 5J89A 4JVWA 5DEFB 1HILA 4HWUA 4FXGA 1FL3B 2CLZA 4U6YA 3BGMB 3PGDA 5DRWA 4KK5C 3Q6GL 5J0BA 1EA9C 2HG5A 1JFMA 5FYJH 4BQBA 3SDAD 3KPSA 1RJLA 1RD6A 3O2WH 3QUKB 3VXSA 3X11A 2J3SA 4NJ9L 4D0CA 3PHOA 1PG7W 2HAZA 2NY3C 3NZ8B 4GLRI 2HVJA 1Q9OB 4EUPB 2ZKHL 4O4YL 2XPGB 4XBEH 4HWNA 3RI5K 1NANH 5D1XC 3LQMA 5AD0B 8CGTA 4NWTL 3WNPA 5FO7A 3SKJH 2FBOJ 3MROB 2WBJC 1FNLA 2BMKB 4LEOB 4Q6YA 2DOCA 5C09A 4XT1C 4YZFE 1ZA6A 1CZ8L 5C8JA 3QSKB 4CU8A 1HNFA 2GT9A 1WBYA 4GKNA 3BGFB 4DOHB 3O6MH 3CNKA 4X7FC 4M43H 3QT2A 4OLYH 1MRFH 3QDGA 4Y4HD 5JIHA 3H9ZA 4WV1A 1KGCD 5TH2B 5HYJB 5I18L 1UT9A 1RUML 4IRZL 4UV7H 2AJ3B 2VDLL 3P9WB 1JPFA 1K2DB 1LEIA 5EIVA 3HHRB 3JV4B 2VLMD 1OTUC 3S37H 2FGWH 2WLZA 4WU7B 1H5BA 1YNTB 4HK3J 4DGVL 1YNKH 1EXUB 4HC1L 2A9ML 3EGSB 1EUTA 3QDMA 1GOHA 3PXJA 1NC2B 4D9LH 3HRZB 1KTKE 3CH1B 4HLZG 3QR2A 4UU9A 1GGIL 4HAFA 2EKSA 2ZUQC 2V17H 3H7BB 5DD1H 4YHYB 2GAZB 2Y07H 3I9GH 3QCVH 5HBBA 4WGWB 1B2WL 3EYFB 4QXUH 1VFBB 1LHZA 32C2A 1MREL 4X6BA 2IANB 2P8PB 3MNVB 5MENA 3TF7C 4JZNA 1KPVA 1AKJD 1NEZG 3GSVA 2OQJA 4LCYA 5I75B 4KK8C 3MRJB 3AS2A 5HHQA 1XF2B 1KTLA 5HHVL 3I3DA 5FA4B 2X4OA 3BH8A 1WZMA 4GMSH 3LIZH 2ENSA 3W81A 3CDYA 2A6KB 3QISA 2BVPA 5BVPH 3P4NB 3TBYA 3OF6D 2VDOH 4L9LB 3U82B 5JOPE 2IAMD 4DZ8B 1K4CA 5ILTH 2F5AL 3DUUB 2Z31B 4NQCB 1MLBA 3V95A 5JW5A 3H9SA 1Q94A 4PJDE 4G6AD 4JFZH 4M62L 1AXSB 2HT2C 1QLFB 3SGDH 1EHNA 4I3SL 2HJKB 5F6HI 3TNNB 5IW1B 1QQDB 1F4HA 2J7LA 2R4SL 4FHBD 1OF2B 5EZJB 5HVFB 1OSZB 4ODWA 4ZNEE 4POZD 2FJFA 2HTLD 2AJUH 5D2LF 2M26A 1U3HB 3T0EB 3FO1B 3IVKA 3OKKA 2P4AB 5EO1A 3F7VA 4UDUA 3TZVB 5EBMB 3VFNA 3UCRA 4FFVD 3VXOB 4I2XE 1DQDH 2Q8BH 2VZUA 4XMKL 2JCCB 5CUSL 4V1DB 5JUEL 4BUGA 3V5KA 4TULH 1PY4A 3UDWA 3EDFA 1GZPA 2I9TB 5J4MA 2QR0A 2VDRL 2CUIA 3IKKA 4LLAA 2R1XB 3K4ZA 2Y5TB 3UO1L 4MB4A 1MFDH 1RZJC 3BIAX 3NVQA 4MLSA 5T1LD 4MB3A 4LNVA 1CT8A 1IGCH 3IGAB 3EYOA 3QNZB 4OGAD 3U4AA 3BHBB 3MRLA 4J3UA 5IW6B 3WCYA 1M6OB 1KJVA 2JB6B 3DVNB 1CGSH 3PDGA 5DURB 3H3BC 4U6HB 1INDH 2H3NA 4HT1L 1N8ZB 3L3GA 1ZXQA 2GJJA 3ZKND 3I3BA 4F2MB 4F58L 4JRXB 4XP5L 4F7EB 4OZFB 4M1DH 1NC2D 3P30H 3OZ9L 4NBYB 3S5LB 4NUGL 3WDJA 3HG1A 2A77L 2UVFA 5A1AA 4XAKE 2ADJA 3TBTB 4XPTL 5KSBF 4KUCF 1WT5A 5IMMB 4DUVA 5E95B 5E7BA 5DDHB 4ZTOH 3ALPA 1QFWI 1YEIL 4F9LA 5DJAA 3IDXL 1F3DH 4N68A 1A7OH 5GGQL 5J06A 2IAND 1QTYT 4DN3H 1C16B 3CFEA 1N64L 2EXWD 1I3UA 3UC0H 4P2OC 1F2QA 4L8DA 3PDOA 4K3DH 3M1BB 2B2XL 3VXRE 2YD6A 5D5MB 4RGMB 1CWVA 4R4FH 4LU5H 3K2MC 5IW3A 1MWAL 4HH8A 5I9QB 2BDNH 3LKNA 2I9LA 5I8EA 5F1IA 2F54E 1RMFL 3KHOA 4QTHA 2X9WA 1UADC 4GRLC 2D2OA 2YXMA 2C3GA 5D1ZD 3G6JF 5DC4B 3JWOC 3HMWH 5IWLA 2OR7A 3ECBA 4KK9C 1S3KH 5EORL 3CFCL 4O5LH 4ZQKB 4I5BA 4Q0XH 4O58H 2FJGB 4PLKD 3VG0L 1NAML 4UB0L 3BKYL 4H5SB 4QYOA 5DFVC 1CF8H 5TPWL 3V4UL 1JZ3A 3V6OE 1JWUB 3GHEH 3K8LA 5H37G 1ODAA 2DI7A 1EO7A 1PKQE 4WY7H 3T0ED 1HYRC 2AXGA 4RQQB 4GAGL 1GGYA 4BQ9A 5FF6A 3P9MB 4QRRD 2ERJB 3F12A 1EO8H 4FFEX 4WI5A 1ED3B 4FQHB 4M02A 1T22B 1NDGB 2RAMA 1LO2H 1P9MA 3VGGA 1KJ2L 2P5WE 5IFJB 2DYPB 5HY9B 5IVNA 3SDAC 2VYRE 1BVKA 1T1XA 1OSPL 2JELH 1VGKB 3GMPA 5GGTL 3AGVA 1BD2B 4OZHE 1ZMYA 2YWYA 5EA0L 1T83C 4RNRB 5DURD 3O6FD 2P24A 4YDKL 4NFBA 4Y5VA 1A6WL 4K8RH 4LVNB 5LXGH 3PJSA 3RWJA 3MRNB 4C4KT 4LLQA 1J10A 2HKHH 3QEHA 3HC0A 5DVNA 3WHXB 15C8H 3QUXA 2GFBB 5FYLH 3UPRB 3QG6A 4NBZB 5CJQL 1WIOA 3BZFA 5DD3H 5KSAA 2VDPL 3MBXH 2VISB 2X7LB 2ESVE 3RPKA 4F7CB 4LKCA 1J87A 4GXVL 1CXHA 3PHQA 5EFIA 4KKLD 4EEEA 2CO6B 1IBGL 2RQ8A 2A6IA 3HC4L 2A6JA 1CFNB 5SWZA 2AJSH 4WW1A 1MHHB 6FABL 4MB5A 1OM3H 4QRSA 2KBGA 1QSZA 3IFLH 2XG5A 5FOJA 4N0RA 3C8HA 4K71C 1L6XA 4KVNH 1S7WA 3ILQD 3UTTE 4RIRB 1XGRA 2GHWB 5D70H 3IDMA 3H42H 4ALAH 4KJWD 4M7KH 1JWSA 4PJIE 5DQ9A 4O02L 1NGWA 4WUKL 4APQD 1AIFA 3V0AC 5GS2H 2GUOA 4FQIH 4Y2DA 4RRPG 4YHNA 2YN3A 3WIHL 1WUNT 1ERNA 1V3MA 3QZWB 2ICEA 1XF3B 3UTZA 1BM3H 5GRYA 5IHZB 2APBA 5DD0H 1TZGL 4GQ9H 1JFQL 2ENYA 3H9HB 1B0GA 5DMYA 3BXNB 3QCTL 4MX7A 1OT1A 1HHHB 3FRPG 2UV3A 2YD7A 3UTOA 4OZIE 4WDIA 1RHHB 3GMNA 4W6XB 4NQEA 5IHUH 4QGTA 4YXKH 3QUZA 1SM3L 3QCUH 3TV3L 1MJ8H 4KGJA 4NWUL 3I02A 3VXPB 25C8L 3X13A 1XF5B 4N90D 5EOCL 4ENED 2NY2D 1RU9H 5IJKC 4NKOB 4IEFB 1CDIA 2IAMC 3ESVF 2K1MA 5JOEA 1UACL 4LAJH 4L4VA 1EV2E 3VXMA 3DXAE 4I4WA 4L4TB 1U8MB 4M6NL 4G6AC 2OJEA 3QDJD 3FN9A 2F58H 3BPLC 4JJ5B 3CMOL 3VG9B 5J13C 5D2LB 1HINH 2P46B 2VE6A 3VE0A 2RGSA 1J1OH 4NRZB 1U8LB 5MEQB 1TZHB 3FFCA 1AGCB 1IT9H 3D3VD 4PJAF 3HE6D 4C56B 5KW9L 3G5ZA 1T7WA 4Y5YC 1ZT1A 5A16B 3ARDA 3GMRB 2UUDH 3MLVH 2C3VA 2E7BA 2XWTB 1WF5A 3MLRH 4UQ3A 3MLWH 4JFPA 1GVIA 2DQIL 2R1WA 4M6ML 5K59F 5GGVH 5J9PA 3U0PA 1UWXK 3RKDD 1X4XA 4YGVA 4XMLH 5E6YA 1QFUH 1OAQH 3MACH 2O5ZL 2CXGA 4I0PC 4OGAC 4MXQA 4YHOH 2C1OB 5T1KB 4HKBB 3UTSD 5SWQA 5DO2C 3IJYB 3WV0A 1UB6A 3CD4A 4HUKB 5KSBB 1KB5L 5ABDE 1T03L 1NKOA 3CX5J 3VW3H 3NFNA 2V7HB 2ZCHH 4Q6IC 1CD1A 5BXFA 1NMAL 1J05A 2GY5A 5IESH 1DVFD 1T2XA 4W4OC 4U6VL 1T6WA 3GGWB 1FLRL 5GS3A 2I25N 1KPUB 5DVOA 3DETC 2FCBA 2D0HA 2E6JA 5ISZD 4XBGA 2ADIB 3LHPH 1KJ3H 4FOMA 4R97B 3CZFB 1S5HB 5ETUB 5BS0E 1S7SA 4RMWA 2E9WA 1RULH 1XR8A 1FYTA 1OP3K 4I9WE 3RVWC 1KCGC 1DCLA 3PWUA 2EC9U 5E4EC 1MJUH 5ESQB 1NCWL 3C09B 1TITA 1ZGLB 3CXDL 1SJHB 1XH3A 4F33B 3QEQE 3EIFA 2O93L 4KROB 1NCTA 1V3JA 3HPLA 3CFDA 1C5BL 4J23A 1F5WA 4YDIL 3U0TB 1MHCA 3HMXH 3MC0A 5D1ZC 4Z8FL 4HS3B 1FLTX 4TUJA 2G5RA 4N0YL 1NGPL 5MP6H 4OCYH 1MRDL 4HFWA 3VGAB 3C08H 5DJDB 1INEH 2R2HB 1CGXA 3DVGA 3AXLA 2IALB 3Q6FB 4NNPL 3MOBH 3C60A 3LH2L 5GS1C 3FONB 4HCRH 4OD1L 1KCKA 3BVNA 5GHWH 3P0GB 1FC2D 3BFOA 3V5HA 2C1PA 3VFPA 2A1WL 3C6LA 4G9FB 1IL1B 5EC2B 4WO4A 3VFVB 2AV7A 3U0WL 2YPLB 3L7EA 1RZIA 4JDVA 1A9BB 1H3XA 2F53A 1CFQB 5CWSB 1CR9H 4DAGL 3EOBB 1EHLL 4HIIB 3FZUC 5J7CC 3WS3B 2HFGH 1DN0B 3GBNL 4PV8A 3SPVB 5KS9E 3ULSB 3GSNL 5D1QA 2NX5A 3N1QC 1NGQL 1FSKB 1VFUA 5AAWA 4LLYA 2V7NB 4X4XA 3SE8H 5F88A 1Z5LB 5IQ9B 3HCVA 3S8WA 1YMMA 4PYHA 2DLFL 5JOFB 1Q38A 1G7QA 5EU3A 4MAUH 2B4CC 3Q6GH 2WIIB 1EVTC 1QLEH 2CUMA 5ACLA 4PRHE 3LZFL 4TNWK 4PGCB 3O6FC 4MS8A 4R2GB 5IVXF 3IETA 5DXWA 2BVQA 4KV5F 1VACB 5D4QA 4NZRL 4F8TA 1SHMA 4GRMA 3DX6A 4NWTH 1ZS8A 4K3EH 3IDNA 1UJ3B 2NXYB 4PY7A 2DF3A 2Z91B 5F1NA 5TGBB 2LFGA 5E1AB 4JAMA 4JB9H 3TBVB 4U0RC 4LSRH 2E7LC 3W0WE 2F8OA 3FO0L 2H6PA 2CDGA 3IFNL 4OFYD 4LEXH 3TESA 3BOVA 4HEPG 5M7QA 3HMXA 3QUYB 4U6XA 3KYAA 1FBIL 4POUB 1VFMA 1YEEL 3ARFA 2LE9A 4KROD 3FB7A 3MOAL 3HC3L 3S36X 3DIFB 3OKMB 1BAFL 1KC5L 2A9MH 2VWEE 4QRPA 3N1PC 3PL6B 4HCRA 4KJWC 3WNKA 2H26A 4Z5RA 3BD5A 1H15B 3F5WB 1UXWA 3RZCD 5EUOF 3VFGH 1P7KA 4APQC 5IROA 3D48R 4HUMB 2QADC 1MQ8A 1UYWL 2XNAA 4MNHB 4JKWA 4LVEA 4ZUSB 3VXQB 3BEVA 3OJMB 4E41A 1K5NA 3OPZL 4FFZH 1WIUA 4O2FB 1XGPA 1EJOL 3UZVB 1NCDL 3JTTB 5TDOA 4P9HL 4RGOL 2HT3C 4G9FD 3MCKA 2I24N 2J88L 3TPUE 2YPLD 2HLFD 4X6CA 4P5KA 4G9DA 4IOSD 4NKDA 4UINH 4NRYB 3BP4B 4X8XA 4P3DA 3OB0K 5D2NA 5ADPH 4U1HA 3BI9X 2CLZB 3D0VB 2EYTB 5DRWB 5JW4Q 1AY1L 4PB9L 1YEKL 2NY5L 4JLRA 1SVCP 2HG5B 3BZDA 4AM0A 1QHPA 3KPSB 2Q7NA 1H0DB 3VXSB 5HDBF 3PHOB 4ENEC 2NY2C 3QULA 3RTQA 3UJJL 3ZDYE 3LRSA 4I8DA 5C0DA 2F5AH 4KJPC 4XP1L 2HJLB 5C09B 2X1XR 1ZA6B 4PJAB 1D5XB 2YZ1A 4M62H 5I15L 2GT9B 1WBYB 4PJ5B 3VI4E 3LAFA 4U3CA 5AUMA 2R4SH 3O8XA 3QDGB 3HE6C 3O4LB 4K9EC 1GOFA 2DIBA 4WV1B 5C6TL 1DSFL 5F6IB 2JB5H 3DOSA 1MCNA 1F8TH 4P3CH 4UIKL 4Z78A 2AK1H 5JUEH 5HPMA 1ZHBB 4R96A 1ETZA 3B5GA 4LCWE 5DUPL 1NUNB 2IFFL 4K3JH 3CC5A 3QUYD 4OB5H 4XVSL 2PW1B 4PS4L 3QWOB 3QFDB 1QSEE 4UU9B 1YUHA 3A6BH 4M8QA 4I0KA 4YDLC 4JVUA 4X6DA 4XP5H 3RHWK 4WHTB 1R5VB 4NO5B 5JXEA 4NUGH 1I3VA 1G7JA 1DVFC 4HV8A 4X6BB 1TVDA 1V3KA 3VFTA 3O9WD 5MENB 4LPYA 3G5VA 5BZDB 1EERB 1F3RB 1U3JA 5FO8A 1R0AL 3DYMA 4JZNB 1QFOA 2EEDA 2FATH 1YECL 1KPVB 4PJGF 2WWKT 2ZUXA 3GSVB 2OQJB 1YEIH 4LCYB 4ACPA 4ZFGH 5CEXA 1Q0YH 1IAIH 5CSZA 5HHQB 1CE6A 1KTLB 1RIUL 1E27A 1HH9B 4YDJB 1N64H 3BH8B 3ULUD 1I7UB 2V5RA 3BKCL 4XCEA 1X5AA 1G6VK 5F6HJ 3B6SA 1JF6A 1V05A 3TBYB 1JGVH 2OLDA 4JM2D 1AQKL 1UKQA 2VC2H 3C9NA 5DHYB 5BV7C 1MLBB 2NY4D 5JW5B 3KPSD 5F96H 1TNMA 3RX5A 3QQ3B 4JRYA 3E6FA 3VXSD 3JWDC 1XIWC 1LWRA 5JQHC 3CUPA 1NGYA 3N50A 4HG4K 4FQJH 1I1AB 1MCWW 2VQTA 3F58L 2YPVH 3BPNB 3CFCH 5CJXA 3P0VL 2CPCA 4ODWB 3RIAF 5C09D 2FJFB 2H2SD 4OV6F 4UB0H 3HUJE 4CW1A 1GH7A 2EC8A 3F7VB 3L1OL 4UDUB 2R1YA 3OAYH 2OTUA 2IPTH 1AD9A 1A6ZA 1X6LA 1T66D 3QDGD 2ZJSH 1GZPB 2LTQC 5B3JF 3D0LA 3O41A 2QR0B 5D8JL 4GOSA 2XRAL 5DJZB 5E9DB 3AS1A 1DR9A 3KPQA 5ID1A 4NRXA 1VEPA 4ODTL 4GG6A 3FOLA 1CT8B 3KLHD 1PG7X 1M7IA 3EYOB 4Y4KB 3MRLB 5B38A 2YD1A 1KJVB 3PP3H 2WM0A 3S35L 1VCAA 3S96A 2MMXA 2YHGA 1KJ2H 1LP9E 2H3NB 5DZNA 4XVJH 3L3GB 3DJ9A 3QDMD 3LD8B 3PE9A 3CFJA 3FQRA 3B2VH 4UUJA 5HHXL 4DGIL 5C0FA 3HG1B 5LGJA 1IARB 1TPXC 5F8RC 3SE9H 4FXLA 5GGTH 2CIKA 2BX5A 3MLXL 3QIBB 4KZEH 3H0TB 4Z95L 4S1QH 5IMLA 4TRPH 3RAJL 3OAZH 1CD9B 2YA2A 4P23C 1DQLL 5DJAB 1J5OH 5DHVB 1MUJA 4CADB 5ACZB 3ULVF 1C7SA 3EDJA 3HR5A 1CLOH 2F54A 5MEND 2VERN 4WNQA 5CJQH 4M3JA 4OLWH 4L8DB 1E4WH 4MJ6B 2CRZA 4ZG1A 5F7YC 3QIWA 4AH2A 5KVFH 4LVHB 6CGTA 2CJUL 3N06B 3LKNB 1MCIA 5F1IB 5I8EB 5DMIL 5FYJD 2APWA 1P6FA 3K4AA 4QTHB 2I07B 3HC4H 2JJSC 1OL0A 1A9EA 2BNQA 2EZ0D 1JZ2A 1JTPA 4OCWL 4P48A 1PQZA 6FABH 2FX9L 3ECBB 2Q87A 5IV2A 3RKPA 3V6OA 4IS6A 1FNSH 4LLUA 1HXMB 3MJ9L 3H9SD 4HXAH 1G7PA 3H8NA 5EUOB 2W92A 2KPNA 4FQCH 4EDXA 5FO9B 2DQFB 1HH6B 2EDWA 4OZGE 2RB8A 1RHFA 1RZKL 4UV4L 3RZCC 3CSYA 5C0CA 2K7PA 1NBZB 4ORZC 1C7TA 5E2TL 1T1WA 1YQVL 5GS0C 2UWEE 2AXGB 5LJYH 2O61A 2IH1B 3WIHH 4OQ1A 2EICA 1VGEL 4JR9L 4V3EB 1LO5A 4PJ8B 3F12B 1KCSL 5FB8A 2HTKD 2V2XA 2PR4H 1TQBB 3A67H 5J1AA 1WITA 1RZ7L 3WN5C 3O3BA 4OZ4A 4H26B 1JFQH 3BD4A 4M5ZL 1S7UA 1KJ2A 3QCTH 3ZKXB 2J8UE 4DN4L 3AY4A 5GGRY 4LBEA 3W11C 1UKTA 1X4ZA 1YN6A 1T1ZA 4LHQB 1TNNA 4XPAH 3GMPB 5DEZA 4NWUH 1B9ZA 4JG0L 25C8H 5GGTA 4YBLC 4TSAL 4X9IA 2P24B 3CSGA 3EJJX 3U83A 4FZEL 4Y5VB 3VD3A 2NLJB 1U91A 3RWJB 2B1HH 2BXZA 4LLQB 3QEHB 4OKVB 3QUXB 3TN0C 1AFVH 1S78D 4J4PD 4DGYH 4UT7L 1A02N 3L95B 1JF5A 1WISA 3HRPA 3BZFB 4FNLH 5KSAB 4BZ1L 4N8VB 4UT9L 4HUXB 3CLEL 3EDDA 4LKCB 4C59B 3RWEA 2FZ3A 4TTGA 1IAOB 2HN7A 3MUY1 5EFIB 3BYTA 5F7HA 4X4ME 3DVFA 5FKPA 2P8LA 4PP2A 3SO5A 1A1MB 5KW9H 2A6IB 4RSVA 4XVUD 1IGMH 4QNPE 2A6JB 4DVRL 3CVHB 3QWQB 4YHMH 5IBTL 3KPLB 2D7TL 5SWZB 4WW1B 1UB5A 2DQIH 4M6MH 4QRSB 4P2QA 2VAJA 3UTPD 3WO4B 1BJMA 3FB6A 2VKWA 1BF2A 1S7WB 2V5MA 2P48B 1T2QH 4ZOBA 5HHME 4IRJA 3IDMB 2HJFA 5CEYA 1B3JA 1JWSB 2APXA 3NFPA 5DQ9B 2ZNWA 5C0RL 2NYYC 4AENA 4RFNB 1NGWB 1Y18B 2E8ZA 4MVBA 3J8F7 1AIFB 4IRSC 4X83A 3OJDA 3KJ6L 4KI5D 1T03H 5L9DH 4YHNB 4Y16A 1KOAA 4PJGB 1HOCA 2ICEB 3LRGA 3MLZH 4L3EE 3WIHA 1H8NA 4LQ1A 1W72H 4I0PB 3UTZB 3O9WC 3GSQA 1OCWL 2D4FA 2DQJL 3WS6C 5IT2H 1ZLSH 4YLQT 1FLRH 5BMFH 1CTNA 4LKXA 3RWDA 5I76B 5IKCB 5L2KE 1BPVA 1IKFL 5DJXB 1RK0A 3EO9L 1HNGA 2DDQL 2PETA 4X6CF 1E28A 3GMNB 4KZDL 5CBAA 3O4OB 4MAYA 4LPTA 3DXAA 3QUZB 3U79A 4L3CA 5B39B 3I02B 3X13B 4QT5B 1Z0MA 5FM5O 4JM2C 4ZFOB 1LEGB 4I3RH 5BOZG 1RUQL 5EB9A 3RDTA 4OSUL 3CXDH 4XCFH 4L4VB 2NY4C 2Q8AH 2NY1B 1OAZH 3VXMB 4NZTL 4YDIH 3NIDF 2OJEB 2G75A 2V5YA 1PSKL 4Z8FH 4HEME 1YYML 5F3HA 1NGPH 2CKNA 4PRAA 2GJ6B 2VE6B 3VE0B 5GRUH 1DL7H 1TJIL 4DKAA 3FFCB 3MXWL 1RZ8A 3MRBA 1S9YA 1MSPA 1ZLVH 4YNYB 3G5ZB 4RZCA 1XGUA 3UROR 1HHGA 2FJHA 1ZT1B 1Z9LA 3ARDB 5EC1A 3HZKA 3HNSH 5JLZA 5KSAD 5KZCB 1L7IL 2A1WH 5ICXA 4BK4A 3RA7L 1NGZB 1SJEA 3IJHB 3U0WH 1KGCE 2WUCL 3UBXA 5I1IL 1G6RB 5TE6H 1KIRA 4NN6C 4DAGH 2F19H 1IVLA 4YGVB 3GBNH 3EO0A 3NIGE 3GSNH 4XTRD 3ARUA 5SWZD 2YOCA 2VLME 3VD4A 2C5DC 1H5BC 5F9WC 5SWQB 1XGYL 2OK0L 3WSQL 2FR4A 1A7NH 1UB6B 5C07A 3LN5B 1OAYH 3NFNB 1BOYA 2W9LA 2VLRE 1CD1B 1MCOH 4KUZH 4WRLA 5BXFB 1J05B 4XPBH 4XP4L 2EIEA 4ZPTB 1W72A 4FZ8H 3LZFH 5EOQL 5C7XH 1A6AA 3QNYA 3L3JA 5D72L 2W65A 4MQ7B 1V3LA 3QFJE 4Y2DD 3QQ9D 4K94L 3FQNA 5FCUH 5HVHC 1F4WL 5E94A 3ARZA 4X5XB 4IOIA 2ZG1A 1SBSL 3SKNA 3HI6L 1XR8B 3C2SA 1FYTB 1U8OA 4NJAL 5EIIB 3PWUB 1BEYL 1QSFA 3KXFA 3OHXA 3AS3A 1P7QA 3TT3H 3NCCB 5GGUA 5KVGL 4Q58C 3FT3B 4Z7OE 1WEJL 4ZYKB 4DKDC 5ICZA 2ITDA 3ZT5A 4NQED 2A73A 3QUZD 3HPLB 3CFDB 2VDKL 4MA3A 1MHCB 3Q3GA 5DVKA 3P73B 1RJZA 2A0LC 4XI5D 2QL1A 5KTEL 4EQ2A 1FBIH 2R4RH 1F6AA 3CMGA 2VZ1A 2CLVB 5FM8A 1UEYA 4JFYB 4L4VD 1QBBA 1MNUL 4K8RD 4BQ8A 4P99A 3DVGB 2R69L 3VXMD 3VXTA 5DR5L 4JKMA 5L2JB 1UG9A 4PRIA 5FYLD 2BHYA 3VD7A 3VFPB 3WFEL 1OGTA 1FCCA 3FFCD 5IIEA 2LABA 2WW8A 3UPAA 5T1DH 1RZIB 1SEBA 4JDVB 3EJZC 2F53B 1DN2A 3E3QE 5F1SA 1IGFL 3ARDD 4PV8B 3OPZH 2EEBA 4OLVL 5KJRL 1NCDH 2NX5B 3SGEI 3GSNA 2BC4A 4P9HH 4RGOH 3U7YL 4EIZC 4LLYB 4X4XB 1LE9A 1NFIB 3NPSB 4CU7A 3HCVB 4RDQF 2E7MA 5LBSL 3PV6B 4NQXA 1DBKL 4OLXH 3QI9A 4NKMA 2M8XA 1G7QB 1U8IA 1N5AB 1AY1H 2NY5H 2WMPA 2Y06L 5JW3H 1ZEAL 1Q9WA 1F11A 1WCQA 4EVNB 1LMKA 3IETB 3U2SA 2BVQB 2FIKB 5GS2D 1MAKA 5EU4A 3F7QA 1JTOA 3DX6B 3ARSA 5EU5A 1N7MH 3IDNB 4P4KD 4XP1H 1G7HA 1S78C 2DLTA 4J4PC 3HI1A 2HRPH 3MRFB 4GXUM 2EKJA 1S7TA 4ZO9A 2O5YL 5I6XB 4OLUL 5I15H 1HKLH 1YJDL 2ZZUT 2D03H 4JAMB 2IANE 4S1RL 4X80H 1B0RA 2BNUB 3UAJD 2CRMA 1FYTD 5IR1A 4XVUC 4P3WA 1AQDA 2KZ1B 4UIKH 3TH2T 5D7KD 3GKWL 3QH3A 2Q3ZA 1XGTA 5E8DL 4YPGA 5HDQL 1OWRM 3NFSH 4TSCL 3FB7B 1QFWM 3FFDA 5DRZA 43C9A 1QBLL 4PGEB 3FOMA 5L88L 1LGVA 4WI8A 5DUPH 4QRPB 1WIPA 4O9HH 4PJ9A 2Z35B 4HK0A 1QBAA 2Q6WB 4Z5RB 5IWLC 4B5EA 4BFIB 3MLYL 3V7AE 2VDMH 3U4BH 4NQCE 4G6ML 1UXWB 4HJJL 3HZVA 4JVPA 1Q0XL 1UA6L 1Y0LA 2XNAB 3C60D 4KI5C 3BEVB 2EECA 3MLUL 4WHYH 5C9JA 4E41B 1K5NB 4AEIL 1XGPB 5GGRA 5F7UA 5A2JH 5I8KL 5TDOB 3C6LD 1E4JA 5I73C 1N6VA 1L9NA 4WO4D 1N59A 4X6CB 3FO2A 3T0EE 5JHLL 2F53D 4NKDB 4QY8A 4P3DB 2ARJQ 5CCKL 5D2NB 4U1HB 1S7VA 4OQTL 1I3RB 4ELKB 3TT1L 4W68A 4QRRE 5B8CC 5I8OH 3AS0A 4HULB 2JCCE 2VXUL 4KAQH 4PG9A 4V1DE 4JLRB 5D1QD 3R06A 2NX5D 3V52L 1DLHB 1PZUB 4AM0B 1RIUH 4IM8A 1UGNA 5E8EA 3QULB 3RTQB 3GSWA 1YMMD 4YUEH 1ITCA 5K9JH 5I16B 4YHKL 3LRSB 3MFFA 3QHZH 4S10A 2KKQA 5C0DB 3RWGA 3LS5L 1BLNB 3CPLB 3ORJA 3SE4C 1MVUA 4W81A 1UCBL 1UM5H 1A8JH 5D7JC 4XC3H 4MS8D 2FL5B 4WU5A 1JGEA 4HH9A 2R2EB 1JNNL 1RQ5A 3I2CL 2FNBA 3F58H 3RJQB 3O8XB 4DCQA 4IJ3C 4XNXH 2NXZD 1QA9B 3F62A 4XB7A 1C08B 1KF9B 1YYLL 1EFXA 2YK1L 4X0KA 4Z78B 3TVMD 4G8EA 1CDGA 4JQIL 3X12A 1HYSC 4J8RA 1KJMA 2E7LE 3V7AG 3ZDZE 3DURB 3IAQA 5HPMB 1KLFA 4ONGL 4R96B 2XTLA 1T89A 1ETZB 1NGXA 2XIDA 4KPHL 3EO1B 1OAXH 1MCRA 1HCFX 1S7XA 2FB4H 4ODTH 3BDBA 5D5ME 2ICWA 1U2CA 1UWEL 2VXVL 1DQML 5HTSA 1ZGLM 2AXHA 3EFFA 5CJOH 1C5CH 3ARFD 3UYPA 1YUHB 3IXAA 4M8QB 4BSVB 5LGHL 4OCLC 4CN4A 4QRPD 1XR9B 4EI5C 1UZ6F 4JGMA 5HHXH 1V7NH 5GJSL 3L3HA 3LKPA 1G7JB 4HV8B 3D85A 3RY6A 3O3DB 1U93A 4R4ND 3GBML 3VFTB 3FMGL 4C57C 3MLXH 5FO8B 4Y2DC 3ISWA 3QQ9C 3ZTJH 4X5WA 3NMEA 4ZXBC 5CEXB 4E41D 3BWAA 3SOBL 1DQLH 4YHIB 4S1DD 5CSZB 3V9FA 4Q2ZA 2YRZA 5I1GH 1T0MB 3UPCA 3WFZA 3G5YA 2QKIA 3TO4B 4M5YL 4N0UA 3MO1A 4MNGA 3ZE0E 3ZDXF 2ZCKL 5E2WH 3R8QA 3KNBA 3MR9A 4LHUB 2BOBB 3V6BR 3RVVD 3RVTC 5DMIH 4KH2A 3O3AA 4JRYB 1EDQA 3E6FB 4N90E 3H7LA 1G9NC 3RTQD 5I1HL 4XI5C 4XNMA 1BFVH 3CUPB 4OCWH 1NGYB 1JP5A 2EYSA 3G6DL 3LKOA 4G7YH 5F70A 5M95B 2J5LC 2OZ4H 2EDFA 4CW1B 2EEAA 2BJML 5IGXH 2P7TA 4OF3A 2OTUB 3NAAL 1RZKH 2VQUA 1AD9B 3OKOB 1A6ZB 4HPOH 3KJ4B 3O3EA 3D3VE 5I19L 2MHAA 1MIML 3O8XD 1KSRA 3D0LB 3NA4A 5DHXB 3CX2A 3O41B 4XPHH 3B9AA 4N5EC 5IB4A 4KI1A 1T5XA 3T4YA 1QACA 2CH8A 3N1MC 3BIBX 5HD8D 3EYSH 4NRXB 4JR9H 5ID1B 4M4PA 3FOLB 1KV3A 1KENL 1HQ4B 1WLHA 5B38B 5KOVC 1YMHB 5CZVL 3QRGH 2F5BL 2EDQA 1RZ7H 4ISVA 1GHFL 3L6FA 5FGBA 3TYFB 4M5ZH 1JRHH 4FRWA 1MEXL 3LKRA 2SEBA 4MD0A 3TPKA 3FQRB 5T1MB 4QLRA 4UUJB 3U30B 4DN4H 5C0FB 5INCA 1IC4H 4YXLL 4HLZH 1PEZA 3UYRL 3DRTA 4UOW1 3C6SA 1AC0A 2CIKB 3NCYS 4U6TA 2CR6A 2H1PH 4IMLA 4JG0H 3TEUA 3WN5B 2VABB 1ADQL 2VXSL 5IMLB 5FAAA 1BQHA 1B88A 2QSVA 5JXED 4MXWL 4P4KC 5F1KC 2L0DA 4RWYL 1MJ7L 4NP4H 5IOPA 4UT7H 1U0QA 1XFPA 1K8IA 2NY6D 4PJCF 2UUDK 3KPOA 4RCAA 1KN4H 3BE1L 5CZXC 43CAA 3BPOC 3CLEH 4MZ2A 4PRPA 3GI8L 1GIGH 4NQUA 3QIWB 3SGKA 4AH2B 4P59H 5GXBB 4MXVF 3MV7A 2EH7L 4L9DA 3DNKA 1T7ZA 4Z7VA 5DC0A 5TDPA 1HIML 3IB4A 1CXIA 2BNQB 4DVRH 5IBTH 2D7TH 3UXFA 4PJHA 4XCYB 5IV2B 4IS6B 1ES0A 1RAMA 2YWZA 2F8XC 1K6QH 3QJFA 1KEMH 4Z7QF 1G7PB 3IF1A 3QA3A 4JRYD 1KBGL 1NL0L 1U8HA 1MAML 4EDXB 4QXTA 3KS0H 2OZ4A 1U6AH 4LFHG 5ESVB 1I9JL 1UH4A 4G43A 4J6RH 4S0SD 1LO4H 2F74B 3GHBH 2BOCA 4H0HB 5C0RH 4L4TE 3QUMB 5DRNB 5CBEA 2BSSA 2DWEB 3C60C 5HDLA 4D2NA 1T1WB 1S9XB 3DTXA 3S36H 4LMQI 2O61B 1MH5A 1ZLWK 5JPMB 3P77A 2PCPA 1KEGL 1LO5B 4QXGL 3C6LC 3KPRB 4UOW0 2V2XB 2GSGB 4WO4C 1OARL 1OCWH 1JGDB 3QNXA 5J1AB 5E08L 1CU4L 5JO5A 3O3BB 4PJEF 1P5UA 1FPTL 5DJ2A 1A2YA 1GRWA 1S7UB 2VRAA 2VN4A 1URLA 4WHCA 5DQDL 1FG2A 2XOTA 4HAGA 5D1QC 4Q7DA 4F9PC 4LBEB 4LAQH 2DDQH 3ZYOA 4BH7B 1IQWH 4R7NA 4AEFA 1YN6B 1FE8L 1T1ZB 3SE3A 2DQUH 4XAKD 2HMIC 2F9BT 1P5VA 1ORSB 3BH9A 5DA0B 4PREA 5JR1L 3BGAA 4MJ5A 2V5SA 2IWGA 3QZWG 4MA1C 3QEGH 4UIMB 1U91B 2I26N 2W0PA 5ESAA 5DF0A 1BBJB 1CS6A 4WENB 5E8OA 5DGQA 1GZQA 1P2CB 2X4TA 3DRQA 1MHPH 2ATPA 1W2KT 4CNIB 4YFEA 5KSBE 4AMKL 1WC7A 3KPMA 3BMWA 1YYMH 2N4IA 1D5ZA 2X70A 4K55A 3RWEB 2FZ3B 4KXZH 3S6CA 2NXZC 4LSTL 2WAHA 4NIKB 3N85L 2P8LB 4PP2B 3L3OA 4KDTC 1KXTB 2G5BB 2F54D 3TVMC 2VLLB 5DRXA 1WQVT 2JJWA 3T2OA 1RUAH 1UB5B 2G60L 3KPNA 3QIWD 4HUUA 4H8WH 2OP4L 2PNDA 3FB6B 1BIIA 1YNLL 1MJJA 4KRPC 4OGXH 2AI0H 2BNQD 1W8OA 4IRJB 5CEYB 1KLUA 3RL2B 1ND0A 3BDXA 3NGBB 5E0QA 3WDIA 3NFPB 5SV3A 1N5YH 4CMHC 3B9VA 3ARFC 1YY9D 5J12B 1XGYH 1FQ9C 2OK0H 3D9AL 2YPKB 4GRWF 5I66A 2V2TA 3OJDB 4Y16B 1JNLH 5DC9B 2IJ0C 1NFDA 5CS7A 4D8PA 3GB7B 3BN9D 5IROC 3GSQB 2DQTH 5C0CD 2EO1A 3I75B 5F9WB 5D72H 1XMWA 3KLAA 5E5MA 3O6LL 2VLKB 4LKXB 3RWDB 4PG2C 2DRUA 2FH6A 5D7IA 4PJFA 1CXKA 1F4WH 2P5WD 1IGTA 5A2LH 1KLGB 3GK8H 4G5ZL 4G9FE 4I18C 5D96C 4Y88A 2YPLE 3NN8A 4XNUH 4Y4FB 3VWJA 5JIPA 4XZUA 3E2HC 2VDNL 3HS0A 1FC1A 1NBYA 2AEQL 3MRRA 1RVFH 1CCZA 2EDNA 1BEYH 1V7ML 3N1GC 1OD9A 4MDJA 2GCYA 4MA8L 2VXTL 4PP1C 1MI5A 1G7LA 3RVVC 1WEJH 3BP7A 4HKJA 4EUPH 4GG8A 5L7XH 5F3HB 1M7DB 1OW0A 4GQPH 4LCIL 2FD6L 3QIUC 3CFIC 4O00A 1CBVH 1WWBX 5F3BB 1S9YB 4OM0L 5D6DA 5ID0A 2QSTA 1XGUB 3NABL 3KLSA 2X4QB 1CL7H 4R90L 3VWKA 1RUKH 1I7TB 4CKVX 5JLZB 3KWWB 3BDYH 1MFCL 3WFEH 1L9MA 4YIQA 4KVCL 4PRBA 2ZUUA 5JZ7D 1PY9A 2P8MA 2FX8L 1B0WA 5TDNA 4Z76B 3UBXB 5E03A 4F3FB 1MCWM 4KHTL 2B5IB 2XYCA 4GAFB 4NGHL 1FGNL 1KIRB 3SY0A 1DFBL 5DI8A 4AT6B 5BVJB 4D9QD 3IDGA 5HD8C 3EO0B 4OI8A 4ODSH 4M9PA 1A7PH 3UJIL 3R8BB 4H25A 4RFOL 4ZAKA 4JRWA 4C54A 3U7YH 4TNVF 2VLRA 3VA6A 4EQ3A 5GRZA 2OSLA 4P2QD 3O11A 4LOUD 2PN5A 3CLFH 1DBMH 3SDCC 2A6DA 2FR4B 5T3XL 5LBSH 5C07B 1DBKH 1I85A 4UAOC 1W0WA 3T1FA 1IM9B 3MSPA 3NH7H 3QFJA 1AO7A 4M93B 4JZJB 1OGAA 2XN9A 3BUYA 3D25A 3IT8D 3MMEA 2DTML 1DQJA 1DUZA 1ZEAH 4HWZA 4JO3L 4JCLA 4U1SA 3TIEA 2WWKO 1W72B 1BF8A 1A6AB 3L7FA 1RPQA 3I6GA 3HI5H 3QNYB 3QPQD 4MVBD 4NUJB 4GS7B 2W65B 4OJFH 5T3XE 4PJCB 1PEWA 4Y16D 1QZ1A 2W0KA 4XP9H 1E4XH 1BFTA 2DMCA 3ULUL 2PYEA 2X89D 3SKNB 4DVBB 2NY6C 5HI4C 1U8OB 5LVEA 4K23L 3BSZL 3FQXB 1NLBH 3EAKA 4PJ7E 5DQJB 5ERWB 1QSFB 2R0WH 3OHXB 4BQ6A 1YJDH 1P7QB 3BGMA 3MRCA 5C0JB 4S1RH 1DBAH 1S8DB 1JPST 4DK6A 3ULUE 2ITDB 4NYLA 3QUKA 4JREB 4MAYD 5DLML 2A73B 3DXAD 5E2UL 1H3PL 1FNHA 3MUJA 2VN7A 1SJXA 3V0WH 1F4YL 4WWKC 3U9PL 1RJZB 1R5IA 4EUPA 1R6VA 2XPGA 3RDTD 1F6AB 4YBHA 5E8DH 1PBYA 1KCUL 4YX2H 3KPSE 3MROA 12E8L 3VXSE 4MCYB 5HDQH 3VXTB 4DFIA 3T0XA 1T2JA 1CGYA 3L5HA 4NC1E 4G6KL 3T77A 2D7PA 2KUTA 2LU3A 3SDXA 2PF6A 3R4DA 3ESUF 5HYFA 5IIEB 4JQVA 1FVEA 5C09E 4K3GA 1BBDL 4UTBL 4PJAE 3T09A 5HYJA 4LGSB 3Q5OA 1TZIA 1MCPH 4PJ5E 1SMOA 2AJ3A 1TETL 3FTGA 3MBEA 4AEIH 2QQNL 3DX8A 2UZIL 3QDGE 2BC4B 3O4LE 3ZTNL 2JJTC 5HYEA 1YNTA 4NM4L 4NBXB 1CTOA 2R39A 5IB5B 1QFPA 2X9YA 5K59E 4NQXB 4NKMB 4HG4J 2VXUH 4MCZB 4DJMA 1JGLL 2AVGA 2AEIT 1QUNA 3RRQA 1RIHL 1F11B 2JK5A 3DLQR 3AREA 4KTDL 4FQLL 4GMTL 3QDME 3JXAA 2PYFA 4OI9A 3U2SB 5C07D 3DGCR 4JPIA 3VGHA 4F15B 4X5LA 4YHKH 3WFHA 4WW2A 4RRPA 4HWBH 3LS5H 4L3AA 4P5TC 3MLSH 1VFBA 5CIPB 1GPOL 1A5FH 1UCBH 3HI1B 2WQRA 4QHMA 4GUPA 1S7TB 3TWCL 1YPZF 4XXCC 4WCYL 3OAYK 3BAEH 1N26A 3BPCA 5C0AA 1GCFA 5IM7A 1GGCL 1B0RB 2FWOB 3Q2CA 2DQCH 4U7KA 5I2IA 5MENE 3O2WL 2HH0H 5IR1B 5D7JB 4RMUA 2YN5A 4UBDD 2EDOA 2C4FT 3P4NA 3KXFD 3KYOA 1A22B 1P7QD 3TA3A 3L3KB 3QH3B 2ZUWA 3VGFA 4F7TA 3T8XA 1XGTB 4DZ8A 1M4KA 3PP3K 4MJIA 3DUUA 4Z7VF 2Z31A 4YPGB 4GAYB 3RVXC 4L8SA 43C9B 3FOMB 4EBQH 4GRWB 1AXSA 2XQBL 2Y5EA 1QLFA 3S9DB 1QR1B 4HK0B 2D0GA 2BERA 3O6ML 3V6OC 4M43L 4OLYL 4PY8I 1MRFL 3E8UH 3H9SE 1OF2A 5E70A 4U1GC 4LVOC 1Y0LB 3KGRA 1TQCC 1MCSA 1U3HA 5LGHH 2X41A 4PRID 3TZVA 5C9JB 4PR5B 3BW9A 1ZLUH 1QD0A 3VXOA 4GSDH 2J4WH 3BN9C 5GGRB 1BJ1J 5GJSH 2A74A 3S37L 1DLFL 2FGWL 3GBMH 2I27N 3ARBA 2VTFA 4JFXA 5GZOC 2I9TA 3QXVA 4QY8B 2C9AA 3LDBC 4FQXB 1S7VB 1INQA 4P2RA 1FO0H 2EYRA 4PG9B 4EI5B 1KG0A 3R06B 5DK3A 3BHBA 2VZSA 1M6OA 2BRRH 4ODXA 5ACMA 2JB6A 5GJTL 4M5YH 5HHPA 1VFAA 4IOFD 3VI3F 3VRJA 1TMCA 1RV6X 2V17L 5DD1L 4PB0H 1Z3GL 3QI9D 2BP3A 2M1KA 5J11C 4F2MA 4JRXA 2Y07L 3I9GL 4F7EA 3MTRA 3QCVL 3RWGB 4HWBA 3OJ2C 2D9QB 3KLDA 4MHHI 2IPKB 1JWMA 4WHDA 5I1HH 2XFXA 1Q9LB 3JTSA 4ODUA 3RX7A 1JGEB 3ILPA 4XNZB 4HH9B 1WTLA 4UTAH 1NMCB 1VFOA 2YD3A 4K2UH 3HG1E 5DYOA 2W60A 5JW4M 2AEPH 5HGBA 3H9YA 1FNAA 3I6LE 5E99L 4JPVH 3WLWD 4GMSL 3EBAA 2BJMH 3CXHK 1EFXB 3NZHL 5C0GA 3X12B 4OAWA 3ELAT 4QRTA 1H3WM 3BP6A 3CZJA 5EBWA 5JZ7C 5ILTL 1MIMH 1HSBB 1U8PA 2J8HA 3MRKB 1WK0A 5T5NG 1QVOB 3THML 5C0IB 5CGYD 4YZFF 1ULVA 5FA3A 4ZDHB 3TBWA 1WWAX 1S7XB 4YC2C 2ICWB 3JV5A 2H41A 3UTPE 4YK4B 3L3DA 5CZVH 2F5BH 3EFFB 1X5JA 1GHFH 2FJGA 3IXAB 4P46A 2D0FA 2AJUL 5H35B 2NPLX 5DSCA 1XZ0A 2WNGA 5E4IA 4PJ9D 2BK8A 3UJTH 1DEEA 3L3HB 3LKPB 4PRNA 4YHPA 1UXSA 3WUZA 1U93B 4MVBC 5DGRA 3QPQC 1U3ZA 5IFAH 1EEYA 3S97C 2YUXA 3PXHA 1ADQH 4LGRB 5E6IB 4RQQA 1NFDF 3RIFF 3CFBB 3EZ8A 3ROLB 3BWAB 5DK0B 5FIEA 5CFHA 2BZDA 4XNQB 4PLJD 1ZV5A 4RWYH 1MJ7H 5CZKA 4Q2ZB 1FO0A 2OJZL 1ED3A 1T22A 1D9KB 3TJEH 3G5YB 1CGSL 3QB7C 3T4AA 1INDL 4N0UB 5FUCE 1WWCA 4R0LC 4FS0A 5T3ZL 4MNGB 1Y6MR 4CMMB 1QFWH 1U36A 3GI8H 4JHWH 2DYPA 3HLAA 4IIQC 3MR9B 2K9UA 3WJJA 1IEHA 3MPCA 3C8KA 4MAYC 2VITB 5EZOH 1JE6A 4YBQD 3O3AB 4D9RD 3B2UC 1BD2A 4HFUL 3IFPB 5HDBE 4NO2A 4XVTH 4XNMB 4LASH 2OR8A 3RDTC 1KT2A 4Y5XA 1DUYA 2BRQA 1DJSA 4Y1AB 1A7OL 4DN3L 1PVHA 2ZG3A 2AEWA 1ZVHA 1MAMH 2BVTA 3UC0L 5I74B 2PTTA 2P7TB 4K3DL 4LSPL 1I9JH 4TUKH 4WFGD 1HZHH 3O3EB 4R4FL 2MHAB 4LU5L 2BDNL 4M7LH 2CUHA 1AR1C 3CVHL 5IB4B 1IC7H 2XKNA 5IFHH 1T5XB 4NN7B 4YQXH 3QBTB 1EFXD 1CQKA 1D3CA 1HI6A 1S7RA 2PO6C 5FHAH 3HMWL 2R8SL 1ZTXL 2DM4A 1L0YA 1OARH 1S3KL 3REWA 5J6HB 3VH8G 4O5LL 4W70A 4LSQH 4Q0XL 1OAKH 4XPFH 4GBXC 1A21A 2Z4QA 4FFWD 1CDHA 1QSED 1AHWA 3F8UB 4MNQA 4QO1A 2DL9A 5DQDH 5SWZE 3LKRB 2SEBB 5HPOA 2GJZB 2O26U 4NCC1 5DMJB 3GHEL 3PGFL 1FE8H 4IMLB 3WO3B 3B9KC 2AJVH 5JR1H 4U1MB 1YPZB 1F2XK 1ROWA 1BQHB 5IG7B 5BRZA 2N7BA 3ZYIA 1XF3A 5EU7C 2Z8VC 1EO8L 2B1AL 3D85D 4F80A 3PWNB 3BUTA 3DMMC 5IOPB 1K8IB 1LO2L 1FVDB 3KPOB 5J57B 3H9HA 2DQHL 3RWCA 5I17B 1T0PB 2V9QA 4ONOA 5FDWA 4ZS7L 4N0CA 43CAB 2NY0D 2NZ9D 1HHHA 2JJVA 3PWLA 3MV7B 2AJYH 3OKDB 4LSTH 1F6LL 2JELL 1CVSC 3N85H 1KACB 1QSVA 4UBDC 5HDOA 5T33H 4Z7VB 1UWGH 3K2UH 5TDPB 4ZFOL 1XF5A 4B53A 3TLRA 3TFKA 4DEPC 1EHAA 1G9ML 4NKOA 4FG6C 4K8RL 5LXGL 2DLEA 1LILA 4PJHB 1F13A 4TVPL 2YA0A 1A47A 1NFKA 1U8KB 2HKHL 2OP4H 5IMOB 4NQVA 4L4TA 3QJFB 15C8L 1YNLH 3IF1B 3OKLA 4QXTB 5DD3L 5D2LA 3MBXL 5FYKU 4L4VE 3BJLA 4NRZA 1U8LA 1TZHA 3VXME 1AGCA 2R0KL 1N3NA 3D9AH 1FV1B 2QQLL 2P45B 4C56A 5FYLE 3WD5H 3DTXB 2ZCLL 3GMRA 1MH5B 3SDXF 3LB6D 3P77B 1GSMA 2XQYK 2FEEL 5D93C 1JTTA 2AJSL 1DQQA 1IGJA 3SCMC 3FFCE 3GIZL 2B39A 2XY1A 1G6RL 1OM3L 4LHJB 4OTXL 3K7UA 1J0JA 3IFLL 5B3JE 4JCMA 5JIIA 1CLYH 1L0QA 5F7WC 2EIDA 1FG2B 5D70L 3H42L 5E2VH 4B41A 4ALAL 2W9DH 4H88L 2GSIB 4M7KL 4LLMA 3HB3D 2C1OA 2DTSA 5T1KA 1J8HA 4HKBA 1A0QL 35C8H 4AIXA 4ZFZA 3IJYA 3T2QA 3DUSB 3BH9B 3QI9C 1Y6KR 3BQUD 4FQIL 5KSBA 2YC1A 4PREB 4MJ5B 3TO2B 1I3GL 5ESAB 5E8OB 3ULVL 3DRQB 1BM3L 5M94B 2ATPB 5ITBL 5DD0L 4WW2F 3EHBC 1WC7B 4GQ9L 3GSXA 1JJUA 2FBJH 1D5ZB 3ARQA 3MJ7B 3D39A 2ADIA 3MV11 4XP6L 2FD6H 2MJWA 1FNEA 1LQSR 1ZHLA 4EXPX 4LRIA 4YXKL 4OZHF 5JW4N 3QCUL 4HIEA 3JTCA 3NABH 5DRXB 1RU9L 3GM0A 3OX8A 4JY5L 5ESQA 5F93C 3QG7L 1A3LH 4PRPD 5F7MC 5LWYH 1SJHA 1XF4A 2AV1B 3G6JA 4HUUB 2FX8H 3J7HA 3MV7D 4O2CA 1FYTE 5EWIL 1P4LA 3F6IA 2AKRB 1MJJB 2VWEC 3ES6A 3B43A 3U46A 1IEAA 5D7KE 4ONHA 2Y23A 4HS3A 1YC8A 1KELH 1A1NA 1HINL 1KLUB 4Y2OA 1B4RA 5IF0A 3DSNA 1J1OL 2Y4SA 2RHEA 3U6RA 4LCCC 3BESR 5CJBA 1IT9L 4MGXA 2OXGA 3Q6FA 5T3XH 3RGVA 1OTTD 1TVHB 2V2TB 3FONA 5AG8A 4CJ0A 3C2AL 1BZ9A 1HKFA 1WFTA 2DTMH 3ERYA 4FQ1H 1NFDB 3MLWL 1IL1A 3VFVA 4HBCH 2MNUA 3KLAB 3EOBA 3IYLW 3WS3A 1E4KC 4XMLL 1W0VA 3LVEA 1OAQL 2IMNA 3U1SL 4PJIF 4YHOL 4XZUB 4P9HC 2F53E 3VMNA 1XCTA 1NBYB 1Z5LA 1GGBL 4GKZB 5IQ9A 4V3DB 2V9TA 5JOFA 3NACL 2BHZA 3V0VA 2NX5E 1NCNA 5GRVL 2WIIA 1MI5B 2EDEA 2ZCHL 2OTWB 1G7LB 5L8JB 2NY5C 3BP7B 4NCDA 2K3TA 5IESL 1YMME 3O2DH 4HPYH 4PGCA 5INDA 3LN4A 3U9PH 1VACA 2AW2A 1F3DJ 1KJ3L 1A4KB 4OZIF 1UJ3A 3OKNB 12E8H 2NW3B 5IK3A 2Z91A 1RULL 1JYNA 3TJHC 1XT5A 5TGBA 4OV5B 2R2CA 3T0VA 5E1AA 4AL8L 4G6KH 3VWKB 3I50H 2AGJL 4FMKA 1MJUL 3SJVB 4PRBB 2Q20A 5D1XA 2P8MB 3NPZB 3SQOL 4RMTA 3SO3C 4GW4A 1J7VR 4LQFH 4EN3C 3HMXL 5DI8B 1MCEA 3IDGB 2AQ2A 3D69A 1EHXA 2VNCA 1IAKB 3T3PE 2UZIH 5DJ0B 4H25B 4KQ4L 5MP6L 2X4UA 4OCYL 3ARGC 5HYSG 5DJ8A 1J9CT 5E24E 1INEL 1P4IL 4IHOA 3O11B 4FFWC 4JGUA 1T89C 5F7LB 1H3TA 4OCNC 3MOBL 2DLGA 4HCRL 5FECB 3T1FB 3PL6A 1AO7B 1OGAB 2XN9B 3BUYB 3RNQB 5EUKA 4AY0A 3F5WA 4HWZB 1RIHH 5J3HD 3OXRB 3TIEB 4KTDH 4GMTH 3L7FB 4MNHA 1KIPA 5CKGA 5FXCH 3VXQA 4QRPE 4AJ0A 1WTGT 3IS0X 2BVEA 2HFGL 5K93A 1FZJB 3TP4A 5MI0C 2Q76A 1GPOH 3RY6C 5JNYA 2PYEB 3WLBA 3NBNA 4NHUA 3QO1A 4MHHG 1MCJA 2FX7L 5I0ZA 3ALWA 4NRYA 4XPGL 4WCYH 3BP4A 1VA9A 2G2RA 4E41E 2NY0C 2NZ9C 5FDYA 3D0VA 2EYTA 3MRCB 4MAUL 4OCXH 5SX4H 4X7SL 1QLEL 2X4PB 1J0IA 1GGCH 1BGXL 4KGLA 1ZANL 3VWJD 1H0DA 4X6CE 4NYLB 4WJ5A 3GDBA 4RISH 5D2NE 1VADA 4AEHL 3O2DA 1R5IB 3TF7A 4O51A 2ZUSA 2XI9A 5C2BH 4ESKA 3T1WA 4K3EL 1GAFH 1MI5D 4X9GA 4FTVA 5L8KB 5F7EH 1T5WB 2PXYD 2HJLA 1FIEA 5H8DA 1PZ5A 3BKJL 4PJAA 1D5XA 4MLIA 3WIIH 3T77B 2XQBH 4PJ5A 3ZT6A 2IFGA 4JB9L 3SDXB 4LSRL 2HKFL 4HKZB 3O4LA 1FVEB 4DTGL 2B7DT 2VSCA 1MWAB 3SHSA 4LEXL 2EDXA 4AG4L 1TZIB 3LB6C 2VUYA 2HLAB 3DARA 3FTGB 3VWKD 2DKMA 3MBEB 1BZ7B 3DX8B 1TTGA 1EH9A 3P4OA 4LIQH 1DLFH 2X1WL 1ZHBA 1WZ1H 1DDHA 4CRPA 4L8BA 4ZS6D 1AGBB 1CD0A 1GJIA 4NT6B 1F90H 1NAMB 1UJTA 4PBXA 1T6VN 2R2BB 3WEXB 3HB3C 3L5IA 1HCVA 2PW1A 4ZAKD 1YEDA 5KVDH 1JMZA 1J0YA 2VLRD 3DUHA 1EEQA 2JK5B 3VFGL 3AREB 3QWOA 3QFDA 1AXIB 5GJTH 3BQUC 1U8NA 2PYFB 1DANT 4JPIB 3AB0B 1WCBA 1Z3GH 3WFHB 4WW2B 3QFJD 5CD3A 1AO7D 1AGFA 4FFZL 1OGAD 1R5VA 2XN9D 4WHTA 4NO5A 5FUZL 5KVMC 2VZ3A 1S7QB 1D5MA 3JBG7 4QCIA 4X7EC 1R3LA 4QHMB 5JA8B 4GUPB 3V2AR 5BZDA 2R23A 4UINL 4X6DE 4OZHB 2IQAB 3ZE2F 3STZB 5ADPL 3FCTB 5ANMA 3BPCB 5K9KB 1CDCA 5DHVH 5B4MD 5C0AB 5IM7B 1YDPA 3WJLA 2IPUK 1HH9A 2QHLA 5I2IB 4YDJA 4Y0GA 1ACYH 2BY0A 2PYED 5E99H 2NNAB 5F7FA 1I7UA 1WBZB 3FN0L 3NZHH 1NCCH 3KYOB 4C83A 4PY8J 3TA3B 4S11A 4F7TB 3T8XB 4AIOA 4ORGB 4MJIB 5DHYA 3THMH 2WUBH 4NN5C 4J3OC 3QQ3A 4L8SB 3MZGB 2Z8RA 3K74B 2MCG1 1RZFH 5DS8A 4K7PX 2C4FU 4EIGB 3NCYP 1I1AA 1M71A 2DM2A 4YWGH 3SGJA 5JHDA 3T2PA 3PF2A 4F7PB 4JRYE 1OTTC 3TNMA 1KIQA 2DIJA 3PQYA 2JB5L 3QAZB 3KDMB 3X3FL 2D7OA 3IDYB 1F8TL 4P3CL 4GRLA 3BW9B 3WIFA 3UTTB 2AK1L 2WK2A 4RGNB 1B6UA 2DKSA 1XCQB 4R6UA 1RZKC 2A74B 2HT4D 4HJ0C 4N1HB 3ARBB 3TM6A 4JFXB 5DMGC 4ONFL 2CXKA 1CN4A 2MWCA 5L6YH 5HYJD 1VEOA 5JQ6L 5DJZA 5E9DA 4JM4L 1INQB 4P2RB 4PP8C 3MCG1 3MBED 2EYRB 4K3JL 4LARH 4OB5L 1JNHB 1KG0B 4GKOA 4Y4KA 2OJZH 2YUZA 5HGDB 4ODXB 4RAVB 4WUUA 1B4JL 2I5YH 1TMCB 1VFAB 5HHPB 3VRJB 1J0HA 3A6BL 1UZ8B 3QJHA 3LMJL 3KR3L 5T3ZH 5IVXA 4GG6E 4KKAC 4N5UA 4Q9QH 1ZT4A 3MRHA 3VGBA 4XWGH 4OT1L 4OZIB 4NZDA 2R29H 3EYUH 4HFUH 3QIBA 4Z9KB 3H0TA 1JWMB 2XFXB 3JTSB 3DWTA 4ODUB 2FATL 2M2DA 3ILPB 5FYKH 3WUWG 4ZFGL 2R0ZH 5LQBH 4YHLL 5DMKA 1NAKH 1Q0YL 5DYOB 2W60B 3H3KA 1IAIL 3EDKA 5DHVA 5ACZA 3GEWB 2FIRT 4CADA 5HGBB 3WL9B 4JFDA 1FNFA 4JHZA 4QTIL 5CHNB 1T83A 4M48H 4MJ6A 5C0GB 5HI3C 1JGVL 4LSPH 3KYMB 4OAWB 4QRTB 3BP6B 5EBWB 2OI9B 2VC2L 1U8PB 5T5FL 2ARWA 4J2XA 2ED7A 1F42A 5F96L 3STLB 1KCRL 1G7MB 5FA3B 3CVHH 2I07A 3TBWB 4K07A 1KCVH 3TCLB 3VI4F 5F9OH 3WFCH 4NQTA 2Y36H 4FQJL 4GKSA 2R8SH 1ZTXH 5KAQG 5IB3A 2YPVL 3NIFF 1CICB 4MJID 3L3DB 4ELMA 1HXMA 5AWNH 2Z31D 4NQCD 1Q72H 4JO2H 4P46B 5EUOA 1JPGA 7CGTA 2BNQE 4E0RA 4TSBL 1AI1H 4QHLB 2WINB 5FO9A 2DQFA 1HH6A 5DSCB 1XZ0B 3MUHL 5CEZL 2IPTL 2CR3A 4FN0A 3QUML 2DWDA 4U1NA 1DEEB 3SDDC 2Y6SD 1TCRA 1IGIH 3PGFH 4PRNB 4YHPB 1UXSB 4HIHA 3SKUD 5LAXA 4ZOEA 2ZJSL 1NBZA 4TOYH 2GTZA 1EEYB 3VFRA 4ODHH 1U3HD 3BMVA 1CDYA 3GRWH 5IEHB 2IH1A 3TZVD 2W9EL 4KJQD 1WFOA 1HHJA 4RGND 5FKAA 1NUDA 4PJ8A 5C0CE 3RVUC 2B1AH 1FO0B 1TIUA 4V1DD 5GIRA 3FQWB 2BNRA 2JTDA 1LK2B 3ARBD 3P0YL 1QNZL 1EX0A 3T4AB 2XZAH 3R1GL 4H26A 2DQHH 4XVJL 4TUOB 4ZS7H 3OJVC 4P2RD 5GQBA 1A6VH 1FRGL 1T7XA 3B2VL 3KPRE 3A6CH 3HLAB 2QJDA 1CDJA 5J8OA 3VWJC 4HS8L 3C8KB 3SE9L 2B8OT 2HVKA 3P4LA 4JDZB 1I9IH 1N2RB 4OFDA 1N6UA 4KZEL 4NO2B 4S1QL 1G9MH 1KT2B 4TRPL 3MV9A 4Y5XB 4JRXD 1DUYB 2NLJA 4TVPH 3FKUS 1ZA3B 2PXYC 3W5MA 2VL5B 1J5OL 4OKVA 3QEQB 1EBAA 4MYWB 1OD7A 3L95A 1CLOL 3WXWL 2VAAA 4OLWL 2PTTB 2BSTA 1E4WL 2CDEB 4N8VA 2X10A 7FABH 1UWXH 4MQSB 4HUXA 5IJKA 1BWWA 1FG9C 3UP1A 5KVFL 1IAOA 3O2VL 4M9OA 4Y4HC 4QHUA 4GAJL 4NC2B 2R0KH 5CP7A 2VLJA 2QQLH 5D6DC 4PTUA 1A1MA 2XKNB 1I8LA 2ZCLH 4YXHL 3CVHA 3VRLF 3C5JB 1XF1A 3KPLA 5FM5M 1S7RB 1HI6B 2VJXA 3GIZH 4DFHA 1G6RH 4RX4A 3HNTH 4OTXH 3REWB 1I7ZA 4JQXA 1FNSL 4HXAL 1FFQA 2Z4QB 3HUJF 4M7ZC 2H2PD 4D9QE 1AHWB 4FQCL 4MNQB 4Y5YA 1P53A 3V6FA 5IQ7L 2HFTA 4ZAKC 4H88H 4P2QE 2MSPA 2OR9L 1A0QH 2CQVA 1Y18A 3S7GA 5C86A 1XGQB 1PYWB 1I9EA 3EOAA 1I85C 4M1CD 4P46D 1GXEA 3MV8A 3MCLH 2ZP0T 3RGHA 1WJ3A 1I3GH 4PJGA 5BRZB 3GRWA 3LS4L 3QRFM 3DX7B 4I0PA 4EKXA 3ULVH 4HX1B 2PR4L 3A67L 4M3KB 5J6GB 5ITBH 2XWJA 4HHAA 1LP9F 4PRHB 5I76A 5IKCA 3RWCB 1QP1A 2B4CH 5FDWB 3PHSA 5DJXA 4XP6H 4K94C 2VOTA 3PWLB 4EDWL 3RI5F 4Q6IA 3H2WA 4XPAL 3NCJH 5B39A 3S4SG 4QT5A 2ZPKL 1NUGA 4ZFOA 1LEGA 4JY5H 4JG1H 3QG7H 2DI8A 4R4BA 2DYPD 2B1HL 3S88H 2XTJB 4NQVB 5EWIH 4R9HA 4YHZH 2BVOA 2ITCB 1AFVL 4DGYL 1BD2D 3OKLB 4FNLL 4NFDA 4N8CH 4J3WA 3Q5YA 3OR7B 2GJ6A 3HE7B 2MPAH 3D2UB 1N3NB 4POZC 2HTLC 2EE9A 1IZJA 4YNYA 3L5WA 3E3QC 3C2AH 1IGML 3BGFC 1FAKT 3KPPA 4FFVC 4YHML 1R24B 2VUOA 1OQXA 4DUWA 1DQQB 1IGJB 3K1KC 3FN3A 1NGZA 4JQVC 1FCGA 1LEKB 3IJHA 4LLDB 1G6RA 5ELIA 4EOWH 5L0QB 5GS1A 4ZUTB 4OZGF 1T2QL 3L9RA 1QKZL 3U1SH 4LLMB 2WWMD 4RMQA 4KRMB 3JWNC 5LCVL 1J8HB 1I7RA 1X44A 3L3IB 1CK0H 4RA0C 4ZFZB 1GGBH 4I48A 4X7TA 1TJGH 3TPUB 4CU6A 3ZKNC 1WAAA 2YC1B 3WMSA 3NACH 1NBQA 5L9DL 2RJMA 3LN5A 2Y9RT 3MLZL 1IGYA 4A6YB 1W72L 3JUZA 4ZPTA 1JPSH 2X42A 3V4PL 5IT2L 1ZLSL 5C07E 1RJCA 5BMFL 4MQ7A 4YH6A 4YHYC 3HZMA 1S9VA 1PX4A 3GSXB 3U7WH 4LP4A 4WWID 3D39B 2HFEB 1KXVC 5BRZD 5EU7E 4X5XA 1FNEB 1F4AA 5TF1L 1NC4A 1ZHLB 2EXWC 3LPWA 4M03A 1I4FB 3K3QA 4HIEB 4AL8H 5EIIA 4J3VA 2AGJH 4N0CD 5I75C 3OX8B 4MZ3A 4I3RL 4LDEB 3BIKB 1UFUA 1YJDC 1XF4B 3G6JB 5ECJE 4XCFL 3FT3A 2Q8AL 4O2CB 5DD6A 4ZYKA 1OAZL 4DZBB 5DT1H 3SQOH 1P4LB 1G0XA 1HHIA 2NZIA 5FK9A 4F37K 4P2YA 4HD9A 3ES6B 1QSFE 3KXFE 3P73A 3U46B 1IEAB 5JDJA 4L9LC 4ONHB 3MLTA 1N0XH 4XXDB 1A1NB 4KQ4H 2D7MA 1LDSA 5IF0B 1MY5A 5GRUL 1DL7L 3RUGA 2CLVA 4K9EH 3U6RB 2Z31C 4JFYA 1JI1A 4NO0B 2XTJD 1P4IH 3WHE1 1JVKA 4L4TD 4PLKC 5C0EA 3RGVB 5GSVA 5L2JA 4Z0XA 3HNSL 1SY6A 3OB0H 1BZ9B 2Y6SC 4C55A 4Q9BA 1DBJH 3INUH 5FYJU 4X7DC 4LGPB 5TE6L 3T0EC 4C56D 4PRIE 1D7FA 4PBVC 2F19L 3TZVC 2CIIB 1W0VB 1YEGH 2YD8A 3C5ZB 2QHRL 4XC1H 4KDVA 2AP2A 3K46A 1CI5A 2ZOKA 3FQTA 4JN2B 1NFIA 1MCQA 1XCTB 2FX7H 4OBSA 4XPGH 1A7NL 5EO9B 3PV6A 1MCLA 4D94A 4BM7A 3WNLA 1T0NA 1N5AA 2QV2A 3V0VB 5J1SC 4X7SH 5GRXG 1OAYL 3RJDA 5MI0B 1BGXH 1MCOL 2RCSH 3DI2B 4KUZL 4XPBL 3VRIA 1ZANH 5T1KD 1J8HD 3V5DB 4FZ8L 2YD5A 4EVNA 5C7XL 1GGTA 2EO9A 3RBSA 2O5XH 3T65A 4AEHH 5INDB 3LN4B 1FNGA 2FIKA 1YQ2A 4KUCD 5FCUL 4X6FA 3QXTA 5I1LA 5I1EH 4KMTH 3MRFA 4KFZC 5IK3B 4CL7A 1AE6H 3BKJH 2NY3B 3TT3L 3W9EA 1R3HB 4HGKC 5BV7H 3WHE0 4HJGB 1NMBH 2HKFH 3EUUA 4KKLC 2EDBA 5D1XB 2BNUA 4GT7A 4ZUUA 5C0ND 1PJ9A 4DTGH 5KSVB 3UZQA 3JWDH 1E6OH 2WBJB 4UZGA 4AG4H 4GW4B 1WVZA 3QDJA 3GMLB 3CDFA 3D69B 3HUJB 4RGMC 2X4UB 1YA5A 2R4RL 5I9QC 5DJ8B 4XRCA 4IHOB 3HE6A 1OB1B 3K81A 3MYJA 2MFNA 4PGEA 3ILQC 3AMLA 4KMQA 2Z35A 2Q6WA 4ELMF 3SGEH 5EUKB 1EJ6A 4BFIA 4WEUD 2CLRA 1HK6A 5T1DL 2CKBB 4OF6A 4QGYA 3RP1A 4M7JL 1LD9A 1KIPB 3RGVD 1OP5H 3VD5A 4RMSA 4KWUA 3CXHJ 5MHSD 3NIGF 3BJ91 4H1LH 1JUFB 2EH8H 1L8JA 3PWPB 3PWJB 4I0CC 5FUZH 4Z7NF 3KYNA 3GSOB 3OAUH 4QKXB 2Q76B 3MFGB 5JNYB 3IXTA 3WLBB 2XWBA 3UTSA 4M61A 5DVLA 3DO7A 4NHUB 3QO1B 1WGOA 4WVRA 2ZUQB 3BWUC 1A6TA 2G2RB 4OLXL 3BP5A 1I3RA 4ELKA 3NCFB 1T21A 2ERJC 4ZUWA 1DLHA 5JW3L 3DROA 4GFTB 5EOCJ 4ZFFA 3B8SA 4WJ5B 5HI5D 3K8MA 1VADB 3ARYA 4L1DA 3TIDB 3FN0H 1QBMH 1IQDB 1QHOA 4YFDB 5I16A 5ISZA 4O51B 4YDVB 1CFTA 1BLNA 1N7ML 3CPLA 4FTVB 2XQYG 4D9RE 4YEFA 5DK2A 1M05B 1ZT7A 2HRPL 3FB5A 1PZ5B 3QEUA 5A3ID 2FL5A 4KY1H 2A2QT 4R2GD 1X5IA 2R2EA 1HKLL 4LVNC 2D03L 1FIGH 2XACC 1TVBB 2LAAA 4Z7OF 4X80L 2NXYD 3GMOB 1T3FB 3DHJA 3MUGA 1OOAA 1AGEA 5F9JA 1QA9A 3AU1A 1C08A 3X3FH 5I1JH 3ZKQD 1XIWA 2EE2A 4WFGE 1MFAL 4DW2L 4Z0BL 3MODH 4OZGB 3P4OB 3BO8A 1JK8A 3DURA 4RMRA 5D1XD 4A2MA 1DDHB 4B7LA 1J86A 3GJEA 3NFSL 4ONFH 3RKDC 1SBBA 4L8BB 3ARRA 1MOEA 1H8OA 5JQ6H 1H3VA 1U3YA 3EO1A 4JM4H 3F6LA 1KN2H 1YEJL 3BEWB 4O9HL 2DQDH 2CK0L 2WWMC 2VDML 1YEDB 3U4BL 1B4JH 1P7HL 1OP9A 4NCC2 1U8NB 3X3GH 5GS0H 3LMJH 4BSVA 3KR3H 1WCBB 1KCLA 3SKMB 2FSEB 5T3XD 1QLRB 3PL6D 1XR9A 5CD3B 1AGFB 4H1LA 4OT1H 1D5MB 2EDLA 3ZHDA 4CVWA 3O3DA 4QCIB 3WDHA 5IB1A 1R3LB 4UILH 2R23B 3HFMH 2Z8WC 5DJ6B 2FECL 1I1FA 4JHBA 5ANMB 1DANU 1BP3B 2Z93A 5I8OL 3MXVH 3NTCH 4YHIA 3TH4T 4KAQL 1YDPB 3OR6A 5KVEL 5K9OA 5J1TC 1T0MA 5D7SH 2DL2A 1YY8A 4FQQA 5SWSB 3TO4A 4QTIH 4Y8AA 4YUEL 2PKDA 5K9JL 4C83B 1FVCA 2QSQA 3QHZL 1CIUA 2EDJA 2IADA 3M8OL 4P23A 4LHUA 2BOBA 3VDBA 2OMNA 5T5FH 5FOBB 1UM5L 4JFEB 1KCRH 2Z92B 4LPUA 1FZOA 4HK3N 4N0UE 4XC3L 1FDLL 5F7KC 3WKNA 1ZHKA 4MNGE 4P2OB 1YN7A 2W1NA 5DS8B 1WV7T 3B3IA 1M71B 5JHDB 4KK8D 5CKAA 4FTVD 1JZ7A 5BJTA 4XNXL 3TNMB 4UDTA 2IF7A 1BX2B 1KIQB 4OFYA 3PQYB 5TE4H 4TSBH 3VG9C 5GSRA 4GRLB 4U33A 3WIFB 4PJ5D 5CEZH 2ORBL 5HHMB 3QUMH 3OKOA 2ADFH 4Y1AE 3RNKA 3ZSTA 2CD0A 3LQAL 3OGOE 4UNVA 3MA9H 4HIJA 3O4LD 1D6VH 1BOGA 2H32H 4URTB 1OAXL 2W9EH 2FB4L 5DUBA 4HUVA 4JHAH 1HQ4A 2J8OA 4HZLB 1DBBH 4NO3A 3SDDB 4L3EB 4K7PY 4XNYH 1YMHA 2IGFL 4WUUB 1JHLL 3P0YH 2YRLA 3S98A 5CJOL 1C5CL 1QNZH 4U1KB 1DP0A 5DUML 2XA3A 2DI9A 3R1GH 3TYFA 3QJHB 3BYYA 4FABH 4OM1L 5IVXB 5L2KB 1FRGH 1ZT4B 4WHYG 5T1MA 3MRHB 3W2DL 3VXUB 1V7NL 2D31A 5MEPB 1FAIL 4HS8H 4KKNA 2YR3A 1WAAF 4WEBH 1UM6H 4HBQA 4IMKC 3ARPA 3EOTH 3WN5A 2VABA 4G59A 3OBAA 1EFQA 4Z7WF 4OF5A 5DMKB 3DX9B 3KYKH 4LSUL 5EOTB 3SDAB 1RIVH 5I1GL 1TTFA 2X9XA 4JFDB 1QRKA 3WXWH 4HSQA 5HXMA 2E9JA 2LU4A 1OHQA 4R97C 5A2IH 3CVIH 1F3JB 3O2VH 5C0NC 2YKLL 3PWVB 4GAJH 5E2WL 4WI7A 1OAUH 3TN0A 2DMKA 4YXHH 4PJXA 1BFVL 4PRPE 2Z0BA 3TBSA 4GKSB 4XCYA 4OIBA 3MV7E 2GEEA 5IB3B 3IKCB 4G7YL 4YO0B 4ELMB 5IMKB 4KROC 3T0BA 1K85A 1REIA 4Z7VE 1UM4L 4JFQB 3LKQA 4FXKB 3T3ME 3CSBA 1JPGB 2OZ4L 2DLIA 4E0RB 3IU3B 3EJYD 5D71L 2N56A 3CK0H 5C08A 5IQ7H 5IGXL 3RUGF 4PJHE 3LRHA 5ESVA 2WQ8A 3R0MA 3VGAC 1I1AD 2DWDB 2F74A 4U1NB 4HPOL 1TCRB 2OR9H 5JHDD 3D1MC 1A14L 2IBBA 4HIHB 3QUMA 5DRNA 5LAXB 4X99A 5MERA 2DWEA 2GTZB 3VFRB 2XY2A 2E7HA 4XPHL 1HHKA 2GITA 1S9XA 1MELA 2C3WA 4K71B 1Y6NR 5JPMA 5B21A 4GRLD 1AR2A 2H32A 3EYSL 4G6FB 3O3UN 1HHJB 1MCBA 2IG2L 3LS4H 5FKAB 1J18A 3KPRA 2GSGA 5GIRB 1RJYA 4OIIH 5HYQA 2HLFC 1JGDA 2BNRB 3QRGL 5CD5D 2OXHA 1V5JA 4IRSA 3TC9A 3VJ6A 1JRHL 4TNWF 5E9DD 3HTLX 3HPJA 3MYZA 4WFHD 5DFVD 4D3CL 2HA1A 4EDWH 1U8JA 4BH7A 4F7MB 1CFSB 1IC4L 4Y4KD 2HVKB 4WUUD 2FHBA 3WS6A 2H1PL 2ATKA 1ORSA 2ZPKH 3VI3E 4U4BA 1AKJB 4P4RB 3ZTJG 3MV9B 1J1XL 3G6AA 1TJHH 4G8IA 3C5SB 4UIMA 2DD8L 4EJ1C 1BBJA 5I1DA 3RQ3A 4C58B 3HG1D 1P2CA 4LCUA 2Y7QA 4NP4L 4D0DB 5JDSB 5I30H 4CNIA 4XH2A 1VESA 3I6LD 3QIBD 3AFLA 2VAAB 1A4JB