2ZOKA

Crystal structure of h-2db in complex with jhmv epitope s510
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
252
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVQNYCRVYHEGLPEPLTLRWER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
total genus 66
structure length 252
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zokA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zokA01
3ZDXF 2MFNA 4TNWK 2DKMA 2E8ZA 3WFBL 2ENSA 1IL1B 5T3XH 4GAYA 1D6VH 3MCKA 3CZJA 5AG9A 3UTQB 2WBWB 1ZWIA 1CXHA 2QTEA 3NVQA 1JF1B 1JHTA 3QFDA 4U2ZA 3IDIB 5H35B 4CGTA 2NY5L 4OV5B 5DXWA 1CFVL 1WEJL 1IM3A 1BWWA 5T3ZH 4JY5H 5ID1B 4XWOC 2JKXA 1F2QA 5F44A 3GSRB 2OL3B 4U1SB 4Y1AE 5C70A 3EYUL 5H37H 5E8NB 3QO1A 3S6CA 5E9DA 1KIUA 3DI3B 1XCTB 2EKJA 1BEYL 4FZEH 5B4MC 1R3LA 3QQNA 4IIQC 25C8L 5J1TC 4JN2B 2FEDD 3BSZH 4G80A 2HKFH 5CGTA 4G7YL 4KRNA 3S96B 4F7TB 2R56H 4HCRA 1G7HA 1NFDA 4LCWA 5T3XD 4A6YA 3MACL 3VGFA 4TSAL 1DQMH 4BUGA 1A14L 2DKSA 5DJCB 1ZHNA 3O11A 1JFMA 4PIRF 2CIKB 1BAFL 2ORBL 2EZ0C 1HILA 2X70B 3ES6B 1I1AB 1JZ2A 1NJ9A 2R1XB 4QRQB 1K3ZA 1GVIA 3CX5K 4LVNC 3NH7L 1BOYA 4LPWA 4N0UA 4F8QA 1INDL 5IQ9A 4OZFA 1DUZA 1VACB 3DV4B 1DANT 1M05B 1QKZL 4HKJB 5T3ZD 2P24A 1W2KT 2CLRA 4I77L 1HKLL 1OVZA 1PLGL 4KI5E 1JUFB 2GJ6E 4PJHE 3V5HB 5B38A 4UTBL 3VRLE 2Q8BL 4K9EH 5FUZH 4MX7A 5IUSA 2DYPD 1T5XB 1AGFB 1QRKA 2J12B 5FM8A 3GK8L 4WFHE 3BKMH 1RK0B 1NMBH 4PJXA 4W4OA 3VXUB 5J9PB 3K8LA 5J13B 1R3KB 3FT3A 1OTUD 1I8LA 1RUPL 4XVTL 1DL7H 1MAML 4J3VA 4XMKH 2J2ZA 1J18A 1NC4A 2PTTA 3TVMA 3DX8B 4I2XB 5BS0D 1G7LA 4JHBA 3PWLA 1LO3L 2BDNL 1RFDL 1NL0H 2WWMC 1P53A 1FL6B 1WZ1L 5CKGA 2FZ3B 1ZK9A 2SEBB 1DR9A 5JW3H 1JNNH 3UTTE 1VERA 2GT9B 4MLSA 1QR1B 4XNUL 3KPRE 1MFAH 4G8EB 4PJFF 2YPKA 5DD3L 1A1OB 3BIKB 3JWOH 1IGMH 1OPGH 4O2FB 3FOLA 4JO1L 5EU7C 1FFOB 3RVTC 3Q6GL 1YEFL 3QDMD 3VWJC 2W60B 3DVFA 2I07B 1MHPL 5LGJB 5IR1A 1NUNB 3MLSL 2ADIA 1N6QL 3P4MA 4I8DA 3JWNC 1HIML 1KN2H 2BY0A 3KPMA 5DUBA 3O4LB 2AI0H 3I6LE 1J05A 2NQCA 2VJXA 4UOJA 3BPOC 4LPVA 3KPSD 4AEIH 3STLB 2CH8A 5DURB 5IT2L 1LNUA 4EXPX 1TZGL 5C0BD 2IANE 2APXA 5MENE 4OZGF 4WFED 1X44A 5IMOB 3U7YL 3BZEA 4PD4J 1NCBH 1FZMB 5IBUG 4EZMA 2V7NB 2F53D 3EJZC 4NWUL 5BXFA 2AK1L 4UUJB 4MNQB 2GIYA 1RZJH 2V2XB 5KOVC 2C1PA 4LSUH 5D1QA 4TUKH 2ICWJ 4MSWA 2VN4A 1T89C 2VLKA 2BVQB 2WBJA 1CFSB 4KXZH 2BCKA 5TFSL 4RGNE 5GPRA 2QQLH 1OGAD 3TO4B 4K55A 3SKNA 3C6LD 2JJWA 1N5AA 5HGDA 4U1LB 3O3BB 3L95A 1MI5A 3O9WB 3TJHD 3V6OC 2FX7H 3QI9A 1OLLA 2DQFB 3QIUD 1H3PL 3ROOB 5I18L 2NY0C 3FZUD 4Y8DC 2E7MA 3C60D 4HC1A 4HJGA 5H94A 1HHJA 3NABL 4KMQA 1YNLL 3O2VH 3U36B 1UM6H 2H41A 2A6DB 1YMMB 3WHXA 3HB3D 5JOPD 4DOHE 3BPCB 5FV2A 4ZXBA 1UXWB 1KB5H 2VISA 4RFNC 1T6VN 3EO1A 3EJYD 3SKUD 4ZTOL 4N90D 3BD4A 1J1PL 1Q94B 5HD8C 1FVCA 2QHRH 2D7OA 5ESAA 1KJ2A 4XP1H 5CSZB 4X8JB 1REIA 5EU6A 3VXMA 1RURH 3QUZC 1E4XI 5D6DC 4HUXB 5FB8B 4OLEA 5IHLB 4IHOB 4YDKL 2VDKH 3O4OC 5AD0A 1RJLB 4FQIL 4M6MH 1RIUH 3WHE0 5GS1C 4OZIB 3V4VH 2D7QA 4NRXA 5IVXB 4WU5A 2ERJC 1OM3H 3PP4L 1KXTB 3KLDA 4AH2B 1IL1A 2OQJA 2PTUA 4X6CB 1P7QB 5ICXB 4PB9L 5DJYB 1CIDA 3B9AA 4MS8A 1M1SA 1BIIB 3VD4A 4AL8H 5JMRA 1O5DT 4L29B 1RK1B 3HN3A 3MV9E 1A7QL 1QBML 4P2RB 3FQXA 2X4SB 1KGCD 3U4EA 3U4BH 1T66C 3GM0A 4HH9B 4X6DF 4W6WB 2ITDB 3IDIA 3JWDC 3K2MC 5DK2B 5CLTA 5EN2B 5AYQA 4OV5A 2VXQH 3ECBB 1Z2KA 4XNQB 3MXVL 4P23D 3BH9B 3QQ9C 1BQLL 3PV6B 2D2OA 1FN4A 3RY4A 4L4VB 3WMSA 4RAUA 3GSRA 3RTQB 2OL3A 3LKPA 4U1SA 2V5YA 1R5IB 4XH2B 5E8NA 3L7FB 5F9OL 3DNKA 5EC2B 3T08A 2D7NA 5JHDD 3I75B 3UMTA 3GHBL 4YPGB 4JN2A 4PJEB 4OF5A 4KAQH 1DSFH 4JO2H 5IEKB 4F7TA 3BZDA 4QY8B 1KT2B 2OZ4H 4LLQB 2QSQA 1QFWL 3JUZA 4XCEA 1QBLL 2AXFB 5DJCA 2VH5L 2IG2H 1T20B 2P5ED 1F3JB 4XNZC 1U8MA 1WK0A 3KVQA 2AABH 2X70A 5AZEH 1EUUA 3ES6A 4B0MM 4NC0B 4QRQA 5IM7B 1RQ5A 2HT2C 3PNWA 1IE5A 2EDEA 3UC0H 1JWUB 1MCKA 4KKAD 1VACA 3RVVD 2R0ZL 3DV4A 2VXSL 4F15C 5ENWA 1GOFA 1JUFA 1MRDH 3V5HA 1CGUA 5AAMA 4MQTB 3UJIL 5C09D 4RCAA 2YN3A 2XQYK 4M5YL 4N68A 1AGFA 1MHEB 3RWIA 3S3PA 3BESR 2F54D 3IJSB 4LSDA 1RK0A 5LBSL 1U2CA 4RAHA 1FFPB 2CQVA 5J9PA 1CLOH 3CSBA 5CWSB 2EEAA 3NZHH 1YN6A 4PRID 4Z7WB 4OD1H 4UTAH 3MV7D 4FXLA 4NQDD 1KELH 3DX8A 4I2XA 1RUKH 1HHKB 1GZQB 1A0QH 2YRLA 5HYFA 4M8VA 2C4XA 3KPOB 1FL6A 1RZ7L 2FZ3A 5JHLH 5HI3D 1T04B 4NGHL 2SEBA 2JF1A 4XHJD 1N3NB 3C08L 2H26B 5EA0H 2GT9A 5EU5B 1QR1A 5FIEA 4G8EA 4OAWA 3HC4L 1MJUL 4R90H 1ETZB 1D5ZB 1A1OA 4GKSB 3CNKA 4LCCC 3NFSH 4O2FA 5EIQA 3EGSB 4WI3A 5F7EL 1TLKA 1FFOA 2KDGA 3MLRL 4J8RB 4Q97A 1IC7H 3CXHJ 1J1OH 2W60A 3PP3H 4MAYB 4ZPVB 2I07A 2R29H 3QNZA 5LGJA 1U2HA 4NRYB 4PGZA 3PF2A 4YUEH 1C1EL 4UT9H 1NGQH 3HMXA 1S9WB 3I6GA 1LE5B 1LO2L 4LSQL 3STLA 2YEZA 4KKLC 1F4YL 5ADOL 4MXQA 1P5VA 1P9MA 4YK4B 3CH1B 4C59B 1Q1JH 5IMOA 4RRPA 2HWZH 3DTXB 3WJJC 1CXEA 1W0VB 2Q3AA 3C5ZC 3KWWB 5T5FL 1FZMA 4QRPE 2V7NA 5B3NA 4UUJA 1LGVA 4MNQA 5DJ2B 2V2XA 4GRLC 1CGSH 4G8GA 2HAZA 1MCPH 2WINA 3WS6C 5J57B 2BVQA 1A9EA 2R2CA 5HVHC 1K6QL 1CFSA 2BSED 1GAFL 5EO0B 4BQ6A 5GXBB 5GJTL 3TO4A 4IRSB 1FZJB 3I9GH 1WBZB 3D3VE 3O3BA 4JPKH 3WLWD 3WXVH 3LS5H 1ZVSB 1E27A 1CLZH 2Z8SA 1R3HB 4WTXA 5ITFB 3TBSB 1CDGA 2CXGA 4ZMAT 5AZ2H 4LSRL 3ROOA 3R1GH 1GYAA 5C0AD 2EXYC 1NC2D 1HZHL 3DX6B 2XG5A 3E6HB 3U36A 5HHME 4G5ZH 4N0YL 1YMMA 3CMOL 4DW2H 5I8EB 2ARJA 4WW2A 4S10A 5EDXA 4KJQC 4YBLB 5C0RL 1VGKB 3NBNA 5EBLB 5C08B 4QRRE 1Q94A 5I66B 4FFYL 3RZCD 2E7LE 2FLRT 4HHAB 4Y4KD 5CSZA 4X8JA 5IMMB 3DJ9A 2NY2C 4UB0H 4KRMB 1F4XL 4XP9H 4HUXA 4JM2D 1YJDC 5FB8A 1YY8B 3WIHH 2R2EB 4KK6C 4PGEB 5FUCE 5L0QB 4EI6B 4OZIA 3P4NB 1U8PB 3SGEI 5IVXA 4CVXB 5B39G 1U8JB 1TTGA 4AH2A 2MHAB 5D7KE 4GW5B 4X6CA 3HZVB 5KSAB 1P7QA 3D18B 3QWRD 5ILTH 4R4NC 5ICXA 5D96B 3QDGD 1GOGA 4JDVA 1IQWH 4WWKC 1BIIA 1LD9B 4L29A 4UI2A 1RK1A 4P2RA 4HCRL 4IRJC 1P7HL 1NGZA 4XP6L 4KK9C 2CK2A 1NLBL 4Z95H 4HH9A 5K33A 4JKLA 2ITDA 1YEEH 5DK2A 1BM3H 2CO6B 4I0PB 5EN2A 1JTTA 3GSVB 3V0WL 4CN1A 2XA8H 4L3ED 3B8SA 4R2GB 2X42A 4MAUL 4YHYB 4XNQA 5DLMH 1P4LB 4HKBB 5EH1A 5B21A 5JQ6L 3PV6A 3IDXL 4A2MA 3BWAB 4Q58C 1MQKH 1AFVH 5FHAL 4Y2DC 3RGVA 4L4VA 3RTQA 2BMKB 1UB6A 1R5IA 4XH2A 3L7FA 4GRWF 4EN3B 5J6GB 5CZKA 2J8UF 2QSCH 2C1OB 3R0NA 3ARSA 3I75A 3N1MC 1J10A 4YPGA 4CW1A 3DXAB 5FXCH 1T2QL 4X7SH 2FIRT 1RHHA 1A6VH 2M26A 4QRTB 2OXGA 5IEKA 4IM8A 5ALCH 4QY8A 1KT2A 3KHQA 3RWCA 4YHLH 4U1MA 4LLQA 4HWBA 3VE0B 3H7LA 3GFUA 1MY5A 4ACPA 4EIZC 4HLZG 1ZSDB 3NFPB 4KVNL 2AXFA 3HMWL 3UTSA 1QQDB 3GKZA 1F3JA 3BE1H 3OZ9H 2X4OB 2GQHA 4MD5B 4L1DA 4QO1A 2DF3A 4Z7OE 1KFAL 5IM7A 4M61B 3ZKXC 3ZE0F 4F7PB 1JWUA 3WKNA 5D7LB 5I8OL 5IROC 2PW1B 5FYKH 4RGOH 5FYLE 4FQCH 5D2LF 1HHHB 4FFWD 4KDTA 3U1SH 4NHCL 5DMGD 4HKXB 4N0CD 2EH7L 4O58H 1RZIB 5BW7A 2RIKA 3ARPA 4GBXB 5F96H 3ULUH 3OKDB 3O6FB 5CD3B 1MHEA 1NBVH 1MFDL 5I6XB 5I9QB 1JFQH 4DKAA 3IJSA 4LCIL 4PP1D 4N0RA 1FFPA 1KCVH 1HXYA 4OKVB 1WWWX 5IBLD 5CWSA 5IMLB 2OLDA 4HUKB 4Z7WA 3MLUL 2G5BA 2CDGA 5I1EH 4GW1B 1FGNL 1SEQL 5BCAA 3O3AB 2Z31D 4ZS6C 5CGMA 1OF2B 1XGQB 4M6OL 2JJVA 2XWTB 4XNYL 1HHKA 1GZQA 1YNKL 3JV5A 4NN7B 4ODWB 2VSCA 4M6NL 4X4YB 5JR1L 3KPOA 3CFEB 4KKBD 4JFEB 1T04A 4PJ5D 3TNMB 2AGJL 2XICA 5EIIB 3AB0C 5E5MB 3SO3B 2H26A 4L9LB 4PG9B 4K94C 5EU5A 1PG7L 3TF7C 3TYGH 4BYHA 4AEFA 4TVPE 2AEWA 5ADPH 1D5ZA 1FNGB 3IDUA 3EGSA 1C5BH 4J8RA 4DKFL 5IBTL 4ZPVA 4F7MB 4MAYA 4WTZG 3T0EB 1FGVH 4KFZC 4NRYA 1NUFA 4W4OC 3NAAH 1CG9A 5I74C 1DBJH 1S9WA 2KQNA 1D9KB 4LLAA 3VXRE 1LE5A 1HXMB 1I8LC 1BOGA 2HT3D 2K1MA 3GMMB 4UINL 3I50H 5DF0A 1S9KC 2HLAA 2R4RL 3TVMC 5C6PB 3MRRB 4G6KH 5K9KA 1NGPL 4HJ0C 3HRZB 1KEGL 3FO9B 3DTXA 2A6KB 1T1WA 1KLGB 3P4LA 3K74B 1G9ML 3FQTA 2FO4A 4F33B 5DJ2A 3T0VA 1J88A 1KCSL 4GG6E 4MA8H 1FFNB 4OCNC 4OQTA 5A16B 5I1JH 2X4TA 3VXOB 3RVUD 4XC3H 5KN5B 5GGTH 5EO0A 3LMJH 3CC5A 4KKNA 3MGTB 4IRSA 5GGVY 3VH8G 5AEAA 1WBZA 1KJ2L 2XKNB 5GGQH 1ZTXL 1IJ9A 1UVQB 4NUGH 1ZVSA 5E1AB 7CGTA 4IEFB 3LN5B 1R3HA 4F58L 3TBSA 5ITFA 2H6PB 2VLJD 3P0YL 4YPJA 2BVTA 2GHWB 2UY6A 4JPWL 1HNGA 1VA9A 3E6HA 3TP4A 3WJLA 5ITBH 2ZCKL 4U6YA 3VWKA 5FGSA 2XWJB 4LRNH 2CDFB 1V8HA 1CDBA 4MQXC 2DMKA 5I8EA 1L6XA 5FGBA 4UOW0 4OT1H 1AO7D 2FJFB 4PBXA 5GZOD 3O8XD 5F9DC 1LP9E 5IG7B 3OKYA 1HHGB 1VGKA 3N1QC 1YY9D 4G6MH 3AS3A 4X83A 2LE9A 1J5OL 2WBJC 5EBLA 1IQDA 5C08A 3UBXA 5T1KD 3NN8B 3QSKB 3ULVE 1QSED 2I5YH 1UH4A 2BVOA 1KEML 3WIIH 1DBKL 2H2SC 2QKIB 4LDEB 1DQLH 3HAEG 3UZEA 1MFNA 3LIZH 5KSUB 1SJXA 2IBZY 1T7YA 2NYYC 4PGEA 2C4FT 5EOQH 4V2BA 3QFJE 3P4NA 1U8PA 3HE6D 4EI6A 4CVXA 1OP5H 3SQBA 1U8JA 5D7IE 1KOAA 2KZ1B 2JIXB 1QSFE 3HZVA 5IW6B 3D18A 2EDTA 4FQXC 3U9PH 1IT9L 3IU3B 1LD9A 1PKQA 1EGJL 3QDJD 3TA3C 5CILH 4TNWF 1BFTA 1WQVT 2V7HB 4HWEH 4OBRA 4GQ9L 2GTZB 4J7RA 3E1F1 4I0PA 1JCKA 3GSVA 2NLJA 1I3RB 4HV8B 3KJ6H 5F1IA 1CDYA 3JVGC 1EDQA 1BFSA 2JCCB 4MD4B 4TUOB 4AIOA 2F19L 1F90H 3RPKA 1KUMA 4GMTL 1T83A 4OQ1A 4P9HC 3LEVL 1OHQA 3KGRA 1A7NL 1TDQA 4EN3A 5J6GA 4TTDC 4X5LA 2O61B 3TH3T 2C1OA 4P4KB 5D70L 3B9EA 4UNVA 3IXTA 4GSDL 3DX9B 3X17A 5D1XA 1TZIB 1YPZF 1QSZA 4QRTA 1RZFH 4N5EA 4ZPTA 3C09B 3SQOH 3NACH 4HZAA 3H0TB 3QDMB 1DN2A 5DK0A 1KG0B 3VE0A 1LEGB 1ZSDA 3GO1H 3NFPA 5KANI 3SOBH 1QQDA 1O7SA 1UACL 4LEXH 3FONB 1ROWA 3NGBB 1R0AH 2DOCA 2X4OA 4RZCB 3VXSE 1S9YB 3AS0A 1OT2A 3W9EB 5C0BB 4JZNA 3WSQH 2ZJSL 1BLNA 4HS6B 1NGXB 4G6AC 2XTJC 4JRYB 3HAEH 4LPCA 4QNPE 1X5LA 3CU1A 1HHHA 4HBCL 4KKCD 3EYSH 2F53B 3GMLB 1VPOL 1RZIA 4PJDF 4NKOB 1KCRH 1MCDA 3TT1L 4GBXA 1NFKA 4X4ME 5K9JH 1C08B 4GRMA 3O6FA 2IAMB 3BPLB 4XCCH 5CD3A 5J4MA 4LPYA 1Z9MA 3E2HB 4DK3A 4KDVA 2RCSH 1OSPH 4XGZB 5C7XL 2D4FA 1OAXL 3KYKL 1EVTC 3C6LB 3UDWC 1HSBB 1TITA 5IMLA 1KPUA 1ZHBB 4P0DA 2C3VA 1JGDB 3FFCE 4N5UA 2AK4A 3DETC 4Q6YA 3O3AA 5KZCB 3QIUB 1OF2A 1XGQA 4MJ4A 1NFDF 1SYVA 3FMGL 3C60B 1V05A 4ODWA 1GC1C 1T7WA 2AXJA 4X4YA 5L2KD 1MCNA 4DUXA 1GGBL 3CFEA 4CNIB 4ZYKB 2YD3A 5HY9B 1P5UA 5KVGL 3RDTD 1S7WB 3TNMA 2J7LA 2CKBB 2X9WA 3VFUA 1JGEB 4PJGE 3LRGA 1J8HD 3SBWC 5D71H 3MLZH 5JUEH 1AKJB 4GLRI 1DQTA 2AJVL 4M48H 4I9WE 4NO0B 3ARUA 4RMWA 1FNGA 4X99A 5KSBB 1WISA 2VZVA 1TMCB 4JKWA 3TPUB 4NPYB 4F7MA 4YDLB 2Y6SC 2ZUWA 3T0EA 2YPVL 3LQAC 4K7PL 3HFML 5J0BA 4PDCE 4CU8A 2VC2L 1IGYB 1BJ8A 1TJIL 3UPCA 1FZOB 1D9KA 1EIBA 3HLAB 5C0NC 1KB9J 5CCKL 1BX2B 1FLTX 1HXMA 3C2SA 3QUML 4POYA 1B4JL 1YUHA 2VZTA 2W9EH 3GMMA 3H42L 3RI5K 3KDMA 4HUWA 1EZVX 3MRRA 1W8NA 3K8MA 4OM0L 4L8SB 4NJ9L 3ZYOA 3HRZA 1GGIH 4DKEH 2Y36L 4PJXF 2A6KA 4O2EB 1A7OH 3VI4F 3WIFB 5KSVA 3RP1A 1KLGA 3PWVB 4FMKA 2NY4D 5F7MC 1UM4H 4F33A 3D39E 3THMH 2NPLX 3H9SE 3VJ6B 4J3SA 4QTHB 4Z7UB 4OIIH 4HH8A 1FFNA 3QEQE 5A16A 3VXOA 3BQUD 2VDML 5KN5A 4G59A 2W9DL 4K3JL 3SJVB 3MGTA 2X4RA 4PFEA 4KI1A 4BFIB 2IH3A 5IIEB 1SM3H 2APWA 2W0KA 4GH7B 3N50A 5CGYC 1UVQA 3PHOB 5C0DB 2BNQE 2UZXB 4OV6F 5E1AA 4RMUA 3SGDH 5T33H 1XF5B 4M8QB 2EDYA 3ARZA 3QPQD 4LSVL 3RIAK 1U9KA 1JGLH 4PJCE 3W0WE 2NXZC 4MLIA 4YXLH 3GEWB 2HJFB 1LO4H 5E4IA 1C5CL 1DQDL 4JVUA 5C9KA 1RI8A 4R8WH 2Q87A 2CDFA 3QRGH 1WT5C 3L5XL 1A6UH 1CGVA 5GGSY 4D8PB 4PJ7E 3ARFB 1IM9D 2FJFA 1AE6L 3WFBH 5FYJE 4E42B 3BRFA 3L3JB 5IG7A 1HHGA 2DB8A 3RWEB 5F7DA 2DTSA 4UQ2A 3NN8A 2VAJA 2L7UA 2JJTC 4Z78B 2HYMA 1ZT4B 3U0PB 2QKIA 3RVWD 1CF8L 1J0KA 5KSUA 3LEYL 5CEYB 2NY5H 4I5BB 4DZBB 1CGTA 3R0MA 1WEJH 2VIRB 1VFMA 3F6LA 4GKOA 3ARDD 4ZUUB 3BD5A 1P1ZB 3HTLX 2VXTL 1Y0LB 5IW6A 4J4PD 1EAPB 5EC1A 1VCAA 3N1GC 4Q9BA 1ZT7A 3EYUH 3IU3A 3K8KA 3T2OA 4J6RL 2F54B 4WW2C 5FCUH 1SJHB 1BEYH 25C8H 2V7HA 4QKXB 1L8JA 1CTOA 4PRDB 2DMCA 4HWBL 3GDBA 2YPLD 2W07A 3KXFE 4G7YH 4UZGA 5I0ZA 4PRIB 1NKRA 3IRPX 3SPVA 3QJFB 4LVOB 2E6PA 4PJFE 1I3RA 4HV8A 3BP5A 3MACH 2FHCA 3JV0A 4H20L 4TSAH 2AJYL 4NQDB 3WNOA 5EOCJ 5C1MB 5ID0B 3RWFA 2JCCA 4HGWB 1A14H 1KSRA 4ZO6A 3T09A 3S3JA 2NXYB 1BQUA 3IKKA 1BAFH 4M1DL 1LMKA 1JP5A 2YD5A 5MEQB 3BUTA 3RX7A 4BZ2L 2O61A 2HVKA 2DQJL 4YBHA 3NH7H 1KIQB 1INDH 1J1XL 2Z9TA 3TIEA 3BD3A 1WC7B 5C2BL 4NZUL 3LKSB 3VMOA 1TZIA 5DUML 4ZFGL 1QKZH 4U0QB 1BREA 4WEBL 5DMYA 3GUTA 3V4PL 4I77H 1HKLH 1PLGH 3H0TA 3QDMA 4FFVC 4UTBH 3D0VB 3MV8D 3QP3A 1QA9B 4C58B 2J4WL 5C92A 1S7UB 1DLFL 1TJGL 5F6HI 1WZMA 1X5YA 4Z18A 3GK8H 4PP2B 1A9BB 4RX4D 4RZCA 5I1CL 4ZSOB 1FSKC 3FB6B 5BQ7B 2VWEC 2UWEA 2NZIA 3IDNB 3GMOB 1YEIL 2P1YA 2A74B 3GNML 5C0BA 3W9EA 3HZYB 1BFOB 3UZVB 3E8UL 4OLZL 4O51A 5F72S 1IFHL 4HS6A 4Z7QE 5M95B 2NX5E 2Z93B 1CICD 4JRYA 5SWSD 1RUPH 3RGVC 2W0FB 4XVTH 2HT4C 4P2OD 1JHKL 1MAMH 4F37K 4LF3B 5J12C 1TIUA 2VUYA 1LEKA 1XIWB 2BXZA 2F53A 3GMLA 4AMKL 5B8CC 4YBQC 4NKOA 3IAGC 5BJTB 1LO3H 1A3LL 3PWPE 3ZKNC 3CVIL 4QCIB 1RFDH 2IAMA 3CSYB 4B7IA 1WZ1H 4U6XB 4AQ1B 1RD6A 5I8CA 3E2HA 4DKDC 4NKDB 5D5MB 1OGAA 3C6LA 2B20A 3T3MF 1HSBA 2K9UA 3CFJB 5DD3H 3V5KB 5GRVL 4J3WA 2C26A 3E3QC 1ZHBA 1I4FA 5C07E 3QZWG 1JGDA 4JO1H 5DT1L 3TJHA 2IPTL 1IAMA 1IMHC 3S36L 2GKIA 3Q6GH 1YEFH 3VGAB 1CIUA 1IAIL 1MHPH 3QIUA 4WY7L 5E8DL 1NAMB 3MLSH 5C0AB 2ED9A 1N6QH 3C60A 3M8OL 4Q0XL 1HIMH 1NC2B 5I73B 3OG4B 4IRZL 4XPBL 2OMNA 4ZYKA 5HY9A 3QT2A 1UCBL 2VDPL 2CKBA 1JGEA 1TZGH 3NZ8A 1LILA 1LO0L 3W11D 5BW7C 2ZKHH 5DD0L 3BJLA 3U7YH 1MREL 1BQHB 3CX5J 5E00B 1VFBA 3HHRB 5KSBA 4OQTL 3O3EB 1QSVA 1TMCA 1U6AL 3DOSA 1WIUA 3TEUA 4YHIA 4RA0C 1FE8L 1IGYA 3DIFB 3EDFA 3KPQB 4JM2B 1FG2B 1MEXL 5ESVA 1FZOA 4UBDC 4Y5VB 4HFWA 1VFAB 1G9NL 4BFBD 3HLAA 4GRWH 4PTUB 2YK1L 1BX2A 5TFSH 3PHSA 5DGQA 3CDYA 4G9DB 1X4ZA 5FKAA 3AREB 1YEHL 1CU4L 2XWBA 2D0FA 1XFPA 4PRNB 4L8SA 3O6ML 3UO1L 2IEPA 4UV7H 2AJUL 1EFXD 3WIFA 1VKXB 1R5VB 5CHNB 3PWVA 1C16B 3WNPA 4MXWL 5GS0L 1H3PH 2DLEA 1H3WM 4JRXE 5I18H 1XR9B 3WLBA 3VJ6A 1FYTD 4QTHA 4Z7UA 4WO4C 4MJ6B 4QHKJ 4YHZL 2BFVL 4G9FD 4C56E 1UWEL 1KB5A 4EBQL 2VAAB 4L3EB 3UAJD 5E95B 4M5ZL 3VGBA 1YN7B 4P23A 3FOMB 4BFIA 5IIEA 1NEZB 3BP6B 4N1HB 4ZTOH 3PHOA 5C0DA 4EDWL 1BQSA 1J1PH 1NBQA 1XF5A 1H3UA 4WCYL 2PUQT 4MVBD 3N9GL 3IYLW 2HJFA 1T0MB 4PV9B 3U2SB 4YK4C 4LPXA 2LTQC 2R1YB 4YDKH 1CS6A 2G60L 4FQIH 1DVFB 4D8PA 2AJZB 4ODVL 1FL3B 3PP4H 1S7VB 4E42A 1HN1A 2IBGA 3L3JA 4PJAB 2EIBA 1Z9OA 1A02N 1T7ZA 4PB9H 4MYWB 1HI6B 4WFFD 4WUUB 3RWEA 3JUYA 4N9GB 2WV3A 4B53A 1DZBA 1A7QH 1QBMH 1XGPA 1RUAL 4IRSC 1MH5B 3TN0D 2AVGA 2F5BL 2VLRE 4CVWA 5HHOE 3U0PA 1X4XA 2R2HB 3FB8B 1WJ3A 3VD5A 5CEYA 3ZE1E 1A7BA 3B9KD 1KENL 4I5BA 4DZBA 2WQ8A 3T0BA 5GS2H 3MFFB 5INCB 2VIRA 2R0WL 3MXVH 1QBBA 1BQLH 4ZUUA 3AS1A 1P1ZA 3BP7B 3K4DA 5C09A 3DRQB 3JSSA 2VITA 3T77B 1MCSA 2DLFL 3NA9L 3VWKC 4YFEA 3SKJL 5DZNA 4YFDB 5F9OH 2F54A 5E2WL 1SJHA 3BOVA 1GPOL 1PG7W 4RIRB 3MRLA 1QRND 5TQ2L 3T8XA 3GHBH 3UPRA 4PRDA 5CJXA 4R96A 2QADC 5I1KL 2OZ4A 4ZUTA 5E2TL 3NCFB 4PRIA 3BO8B 3ZT5A 4I3SL 2EDHA 3TWCL 1DEDA 3MV7A 5KW9L 3UYPA 4NQDA 5ID0A 5IB3B 4YEFA 2Z31B 2ITCA 1ZGLP 4KUCF 1QBLH 2R8SL 4PLOB 4FP8L 1WICA 2BNRE 4JFDD 4YWGL 1A6ZB 5IFHL 3TV3L 4XB8A 1OOAA 4LMQI 2OK0L 5MEQA 2HTLC 3QAZC 4PJ5B 4OCYL 5HDOA 1IKNA 4YEEA 5EWIL 1VEMA 5GS2D 1KIQA 5EZIL 1TTUA 4APQD 2DBLL 4Y4FD 5EU7E 3LKSA 2R0ZH 5HPOA 2VXSH 2VMFA 5HJ3B 4P48A 4L8CB 5CJOH 1ZEAL 4FQLH 4LAJH 4D9QE 1RSFA 1U58B 4IMLB 4OZHE 3D0VA 5F9WB 3FN3A 4OCXL 3LKNB 3UJIH 4XRCA 3MLXL 5IVXF 1S7UA 2GTWB 4M5YH 2P7TA 1RU9H 5IVNA 4K2UL 2PXYC 1F13A 1A9BA 2EXWC 4X6CF 3SGEH 1JNLL 3RVXD 3OBAA 4ZSOA 5LBSH 3FB6A 5BQ7A 3GMOA 3IDNA 3HZYA 1BFOA 2E8YA 4NN5B 1T83C 4FXKB 2W0FA 1JGVL 1PJ9A 4LF3A 1S9VB 4MDJB 3TNNB 3CPLB 3UBXI 1XIWA 5EORL 3ARBB 2DBJA 3A67L 5DD1L 5EUOA 4HPOL 5BJTA 5EOCH 4QCIA 1YC8A 3O45B 5D1XC 3RAJL 2OP4L 3CSYA 5HGGS 1RZ7H 4U6XA 3AU1A 4NGHH 1HCFX 1U0QA 3C08H 2AS5M 4NKDA 5D5MA 1A47A 5FAAA 4PREB 2N56A 4N8CH 3HC4H 1MJUH 3CFJA 1AQKL 4XAKE 1CE1H 2RGSA 5F7EH 4PJEF 3GMPB 3MLRH 1QHPA 2VLJB 1RPQA 2E27L 4WFGE 3MCLL 2Y25A 1FQ9C 5DTFB 1TQBB 4N1CA 4CN4A 5KOMC 5C0AA 1A1NA 1NC2A 1C1EH 3HUJE 1DN0B 4MA1B 3GM8A 1LO2H 1J7VR 1FO0H 3BKCL 4LSQH 4JG0L 2JELL 1F4YH 2LAGB 3QNYB 5ADOH 1A5FL 2Q76B 2DRUA 3SE9L 3VGEA 4OF0A 3O8XB 2EYSB 1BQHA 1M7DB 1X5XA 2E7BA 3EFDL 3O3EA 2DQIH 4FHBD 1KJMB 5T5FH 5I9QC 1ZV5A 1P4IL 1QSEB 3RZCA 5TJWK 5LJYH 1UH3A 4U05A 1ZA6B 5EZLB 4Y4KA 4V1DD 5JOFA 4M3KB 1JV5B 3DIFA 1L7TL 4P2QE 3KPQA 4JM2A 1FG2A 1K6QH 3AFLA 4Y5VA 3DSNA 5ALBL 1VFAA 4JZOB 1GAFH 1QR4A 4PTUA 3QUYC 1U8OA 1C5DB 3U79A 5GJTH 1CXFA 1FBIH 1HNFA 3EW3B 4LCUB 4OGXL 4ENEC 3SO5A 3MRBB 5DJXB 3PABB 4JKKA 5JIPA 4PRNA 1X5HA 4OZFG 5JXED 3VDCA 3QWRA 4QWWD 1V7NH 3QDGA 4QRUB 1R5VA 4EVNB 2J8HA 4LIQE 2G2RB 4Z7WF 1UG9A 4LSRH 3ZKQD 1MF2L 5B38G 5JPMA 5F7FA 3QDJB 1WVZA 1HZHH 1B2WL 2J8UE 1YYLL 5DRXA 4N0YH 2ZPKL 3CMOH 1IGJA 2VAAA 5AG8A 4L3EA 1LDPL 4JQXA 4V2CB 3PDDA 4H8WC 1YN7A 2ZWLT 5GRYA 3FOMA 1NEZA 5C0RH 5BO1L 3BP6A 4C83A 3TYFB 2NW3A 1WIPA 2E6JA 1PX4A 4XC1L 3B43A 3ORJA 4FFYH 4LARH 4G3YL 4KRPC 5B3JF 3WIHA 1NMCC 2YD4A 4EUPH 2APBA 1F4XH 4PV9A 1T0MA 1C12A 5DMIL 1JTPA 4HIEB 2R1YA 5FGCE 3LPWA 4JR9L 4S0UC 3TFKD 4H0HB 4YZFF 4KRLB 1J0YA 3QFJD 2VDOL 2AJZA 2PNDA 3WE6A 3N85L 2DLHA 3Q3GB 4PJHB 2GJ6B 1FL3A 5DEGB 5D2LE 1S7VA 1TCMA 3TBYA 1HI6A 1FPTL 4WUUA 1EJOL 4N9GA 4GT7A 1LQVA 4HCRH 3U0WL 4A6YH 4XP6H 1MH5A 4O02L 1NLBH 2R0KL 4Q6IB 3V0VB 3QR2A 2R2HA 3FB8A 3QJHB 1OQOA 1HDMB 1O7VA 4GXUM 3GGWB 3V0WH 4U1NB 15C8L 4OZGB 3T1FB 2DD8L 5SX4I 3AUVA 5JQ6H 4N0CA 4BA8A 3IDXH 5DSCB 2DJSA 3OAZH 3SKMB 3EKCA 5GZNC 2FEDC 3DRQA 3T77A 5FHAH 4CU7A 3PQYE 3X3GH 2ICES 2NR6D 4WI2A 5SWQB 4WHCA 2AJSL 5BZDB 4JANB 1U3HB 3EDDA 3ZYZA 5TE4L 1BMGA 4QHUA 3UTTB 4I48B 2X2YA 4PRAB 2VRAA 3KPRB 1T2QH 2GK0B 4QXWA 1EXUB 4X8XA 1GIGL 3EAKA 5E9DD 1NCNA 2FX8L 1HH6B 3MLTA 3AMKA 3B4NA 3QRFM 4NIKB 5DFWH 5AYUL 5IB3A 2Z31A 1A3RL 3WNMA 5GS3A 1JPST 4TSCL 4Y2OA 4KVNH 2CJUL 4O5LL 3HMWH 3PXHA 3H2WA 4OKDA 1A6ZA 3U0TB 3BFOA 1J0IA 4PJ5A 2C3XA 3WDIA 1BZQK 1KFAH 5KANG 5KG9B 1T5WB 1E4KA 5HYIA 2IANB 1WLHA 5DHVB 5MENB 2EO1A 3NPSB 2WANA 4U2YA 4Z7VE 4HIIB 5HJ3A 2Y5TB 4L8CA 4KZDL 4MDIB 4NHCH 3M45A 4Q7DA 5B39A 1U58A 2EH7H 4IMLA 2ARJQ 3ME0A 2AEQH 3LKNA 2H32H 4UIMB 2KH2B 1A4KB 4JGMA 1BVKB 5ACLA 2ESVE 4CJ0A 2GTWA 1QFHA 3RKDD 3SCMB 1MFDH 5CEXB 3BRGC 2ZCHL 4RGNB 3FB7B 1CL7L 3MRDB 2W59A 5LXGH 4LCIH 2DQGH 3PWUB 5F6HJ 4EI5D 2FHFA 1VSCA 4FXKA 5FUOL 3MLUH 3S37L 4JAMB 4JN1H 1FGNH 5EBWA 3CJJA 4BH8B 1S9VA 1SEQH 4LNVA 3LN4A 4MDJA 4JGUA 3ARGD 3CPLA 4U3HA 3DBXB 4M6OH 3OKEB 4XNYH 1YNKH 3D48R 3T4AB 3OXRB 4M6NH 1FFRA 3O45A 5JR1H 4JFYB 2PF6A 4YDIH 4NDMA 1ERNA 5DEZA 5T1LD 2GAZB 3Q1SL 4X6DB 1MHCA 3C09C 2AGJH 4K9EC 4IJ3B 4DOHB 4W6YB 4YDJB 2DM4A 5FF6B 2X89D 1QD0A 1ADQL 4Z0XB 3NGBC 3GMPA 1VADB 4PJ8D 2VLJA 4DKFH 5IBTH 4YHPB 4MNGE 3O3DB 4JFHE 1F6AB 3VFMB 3TIDB 5A3ID 1FDLH 4W70A 1DN0A 3GBLA 4ODTL 3TBTB 4UINH 5DA0B 4KQ4L 1ZXQA 5EIVA 2BVYA 2R4RH 2XQYG 3N0PB 3QNYA 2EC9T 1IM9B 1AO7A 5SWZD 4JFFE 5HSFA 5ACMA 5HHXL 3O8XA 1AC0A 1NGPH 2EYSA 4HC1H 1KEGH 1M7DA 2Z92B 2A9ML 4OCWH 5MEOA 4LFHG 3B6SB 1ZVHA 2PYFB 2MCPL 1KJMA 1G9MH 4WUKL 1INQA 1QSEA 5EZLA 1ZA6A 2EICA 4M1CD 1KCSH 4LCYB 5GGTA 1JV5A 1OL0A 2ICEB 4S1SL 1MWAL 1NDGB 1D5MB 1TVDA 4R26L 3KLHC 1Q9LB 4JZOA 1ND0A 1RZKL 3TJHC 1C5DA 4OI7A 4LCUA 4EXKA 3HE6A 2ZUXA 4IMKC 3MRBA 5DJXA 1KJ2H 3ARDB 1KCUL 1TPXC 8CGTA 3KJ4C 3PGFL 3FRPA 1ZTXH 5JNYB 5BRZE 2BNQD 1HWHB 2V5MA 3WV0A 4QRUA 3P0YH 4F9LC 5F1KC 3RI5F 4EVNA 2AJXL 2G2RA 1AY1L 3S88L 4JPWH 3TBWA 1KIPA 3OKNA 3QDJA 1FC1A 3IS0X 1G7PB 4LLUA 5I75C 3GJFB 1T03L 2ZCKH 2YPLB 4X7EC 5L9DL 1RZJC 5A2LH 3DUSB 1G0YR 4JJ5B 1UWGL 2FEEL 3QDAA 5I16B 1OARL 2VQTA 3RUGB 2YWZA 4K23L 4XNMB 1J5OH 3TYFA 5FYJU 1DANU 4M7ZB 3FQNB 4ZXBD 2LVCA 4X0KB 1WZKA 5DK3A 3AXLB 4ODSL 4WTZA 4FQPA 1QLFB 4ELMF 2AV1A 5J1SC 2YUVA 4HIEA 4NN6C 1YYML 4XPFL 1U8QB 3CFKB 2GY7B 3RIAF 2OL3H 4ETQB 1CL7I 2P8LB 1FRGL 3Q3GA 4PJHA 5DEGA 3LD8B 2MOVA 5JIIA 3MV8B 4LLVB 3IKCB 4RGMB 1IT9H 5IJVA 5TDOB 1GC1L 2BRQA 3GSNL 1K85A 1ZLVH 3FO2B 1H3XA 3UYOD 2VLMD 3HE7D 4P23C 5BVPL 4Q6IA 1T1ZB 3V0VA 4GQ9H 4NRZB 1KC5L 3QJHA 4OGAC 1HDMA 3D85D 3GGWA 4RWYL 4U1NA 4OZGA 3T1FA 4TTGA 4XVJL 4JFOB 1JL8A 3BJ91 2F19H 2HRPL 4GMTH 3G6JE 4ZAKB 1T2JA 1J0HA 5DSCA 1UFUA 3LEVH 3SKMA 4HUMB 3U83A 3LQAL 5EFIB 4RRPG 4KXZI 1NFDE 4LCWE 1A7NH 5BZDA 4JANA 3WO3B 1U3HA 4C4KT 1W72L 5CKAA 4CMHB 1J0JA 3X12B 5D70H 2HG5B 4I48A 3GSUB 4PRAA 5C0IB 1R5WB 5EBMA 5IFJB 4GSDH 2GK0A 4Y7MA 2BP3A 5IB5B 5JW5B 1CCZA 1JE6A 5HDQL 1HH6A 2A6IB 2VZ3A 2OXHA 5E2VH 2WSKA 3F6IA 4N0UE 2Y1VA 5D93C 1V7ML 3SGKA 4LFHD 3LS4H 1UACH 2BY3A 3HZKA 4KKAC 5GGSB 2V5RA 3U0TA 5L2KA 2RR3A 3KS0J 5E7FA 3RDTA 3U6RB 3I3DA 5TDPB 4P46C 3VW3L 3RU8L 3V6FB 1T5WA 3HG1E 5DHVA 5TF1L 4DGYL 4HIIA 1I1AD 2BSTB 2QEJA 1TVHB 4GO6B 1J8KA 4MDIA 4HBCH 4YHOL 4QRPB 1VPOH 4FXGB 4HX1B 3TT1H 5FOBB 4UIMA 5F21B 3MUY1 3GMRB 1JYVA 1BVKA 3INUH 2OS7A 4M4RA 4ZUWB 1G6RB 3SCMA 3S98A 5I71C 2FWOB 1DBAL 3FB7A 3MRDA 2HKHL 1FP5A 3B3IB 5C7XH 1OAXH 3DSFL 3KYKH 3PWUA 2B1AL 4LAQL 4PJ9B 1ZLWH 4BSWB 2YD1A 5KS9E 1NAML 2NY6D 3HKFA 1OTSD 1FNFA 4NO5B 4JAMA 4BH8A 1EFXB 1CVRA 3OB8A 3VXUD 3DBXA 4XHJC 1Q0YL 5F1NA 3OKEA 1T7XA 3FMGH 3BH8B 3IDGB 4M93C 3GBNL 1RV6X 3OXRA 3T4AA 2JCCF 1JTOA 1TFHA 3QPXH 4QF1B 4JFYA 3UJTL 5HHMB 4F37F 4G9FB 5KVGH 2D31B 4X6DA 3BQUA 3S7GA 5BZWB 4HIHB 4L3CB 3QXUA 3MNZB 2F74A 3RBGA 3U30C 4YDJA 2AJVH 2WUBL 2BSRB 1K4DB 1EPFA 4Y5YC 4Z0XA 2HA1A 3RWGB 4QRRB 2ADGB 1VADA 2ARWA 4YHPA 3TT3L 2XY2A 1I9RH 2YPVH 1F6AA 4K7PH 5A2FA 1OD7A 2VC2H 3VFMA 1WWAX 4WI6A 1TJIH 2CLVB 5CCKH 4ORZC 2HFFB 3TBTA 3QUMH 1B4JH 3H42H 5J56B 1WCBA 1CDIA 1IVLA 1IM9A 1GZPA 3O4LD 2VLKE 4GXVL 4R0LB 4F3FB 3MLPA 4NJ9H 1DQQB 4KZEL 3QHTC 4P59L 2Z92A 2Y36H 3ILQD 2OI9A 2C3HA 3B6SA 3C87A 4MXQD 5D2NB 3DVNA 3W2DL 1GL4B 1MELA 3RGHA 1MI5E 1KTDB 5C8JA 3TN0B 4M7LH 4LCYA 4RMSA 2ICEA 2WIIB 1NDGA 1D5MA 1GGCL 2NY3C 1LEIB 3IAPA 1Q9LA 3WLWC 3EYOB 4RNRB 2VDMH 1S7XB 4K3JH 3SDCB 3K80A 4EKXA 5EO9B 3CDFA 4R4BA 4XWOD 4DVBA 3PV7A 3ARDA 3MO1B 4FQHB 5JNYA 2JB6A 3T2PA 5I73C 4J4PA 4BSJA 5IBUB 1IAIM 1MCLA 4ISVB 3BDYL 1XAUA 1NUDA 1IGFL 3DGCR 4I0KA 3O9WD 2ZUUA 3GJFA 1C5CH 1DQDH 1ZANL 2HFGH 2YPLA 3MZTA 4NZTL 4UDTB 4FZ8L 4AM0A 3HI6L 3L5XH 3O2WL 3PGCB 3ZDYF 3MXWL 5EU6E 1KXQE 3VXME 5FA3A 1NAKL 3DUSA 4JJ5A 3RZCC 6FABL 4Y4KC 1JHLL 1YMMD 4PPTA 2BHYA 3RUGA 4XNMA 4JFDB 4KUCD 4AEEA 4TOYH 4JM2C 2XNAB 1T4KB 3CFBB 3FQNA 5CBEB 4X0KA 1CN4A 3AXLA 2DQHL 3S3SA 1QLFA 5KSBF 3BT2L 4Z8FL 1CF8H 2B2XL 3D87B 3LEYH 4APQB 5E99L 4Y4FB 1U8QA 5JORB 1I8MA 2CRIA 1BPVA 3CFKA 3W5NA 3KYNA 4EOWH 4D9RD 1X9QA 3VG0L 3P73B 1U8NB 3BGAA 4FABL 4U33A 3LDBC 1ZLSL 2VXTH 3EYQC 3MV8A 4LLVA 4RMRA 1QFPA 1MOEA 3IKCA 3OKKB 4JPIB 1I8KB 1RIHL 3QQ3A 3GJFK 3TBVB 4J6RH 4RX4A 2NCMA 3FO2A 3VCLA 5KJRL 2NY1B 1T1ZA 2XTJE 4HWBH 3LVEA 5IKCB 3FO1A 3LKRB 3AAZA 3TGXA 5EUKB 1NCWH 2CD0A 1HOCA 5SWSA 4Z7UF 5DQDL 3MFGB 4P2OA 4H20H 4M6AA 4AT6B 2AJYH 3BZ4B 4JFOA 3WN5C 5DVNA 2PR4L 4MMXC 3JXAA 5K59E 2IQAB 3D5OF 5DZOA 3VXTB 5EFIA 4M1DH 4MJIE 5E5RB 4UU9B 3L3OB 5E4EC 2OTUB 2Q20A 1U95A 3X12A 4NQCD 3O41B 2HG5A 3L3KB 3GSUA 4L4VD 4Q9CA 1J1XH 5C0IA 1R5WA 1HYSC 1ZE3C 2H1PL 4NZUH 1BGXL 3RVTD 4Z7NF 5IB5A 5JW5A 4ZFGH 2A6IA 3FT4B 3V4PH 2D0HA 3H9HB 4ALAL 4Z76B 3T3PF 4R97C 2J4WH 1B0GB 1DLFH 4PLKD 4XP5L 1TJGH 3RZWA 1IGTB 5IHZB 3WL9A 4V3EB 1MJ7L 5I1CH 5F93C 2ATPB 4FFWC 3U6RA 5TDPA 5DMGC 1YEIH 2FSEB 3GNMH 3V6FA 4DN3L 3FB5B 4N0CC 3E8UH 1AC6A 4OLZH 1IFHH 1D5XA 3EJZD 1WSST 2BSTA 1JHKH 1TVHA 5GRUL 1ED3B 3ZZ1A 2FR4B 4URTB 3DYMA 5ISZD 5FOBA 5EO1B 4V1DB 4P3DB 3CVIH 1KACB 3GMRA 4GG6B 2BC4B 2ICWI 3EO9L 1DDHB 3E6FB 4FS0A 4ZUWA 5IBLC 4HS8L 3R4DA 2FWOA 3PL6B 4OLVL 5D7SL 4I2XE 1CK0L 1CLYL 2OTWB 4ZS7L 4MWFB 4P4RB 5IHUL 3SDDC 4XAKD 1AD0B 5DT1H 5E8OA 2IPTH 4NO5A 2MCG1 3SN6N 4X5WB 1EFXA 4KKBC 2GY5A 4M62L 1HINH 1IAIH 2V2TB 1N7ML 4WY7H 3WDJA 2Z8VC 1MCIA 2XOTA 3BH8A 4WTWA 3L3DA 2CGRL 3IDGA 1E4KC 2FATL 2HLFD 3M8OH 4P57A 5BMFL 3X13B 4IRZH 4XPBH 3JZ7A 4G9FA 2D31A 2FL5A 5LG1A 2XN9D 4JY6A 1JYWA 1UCBH 5BZWA 3ULUC 4S0TD 4HIHA 2NTFA 4L3CA 4YH6A 5D9SB 4BQ9A 1CTNA 4OJFL 3MNZA 1LO0H 4WHTB 5F9WC 3KS0H 1CXLA 3MRPB 3P0GB 4NZRL 5DD0H 5HGHA 3EDEA 4EDXA 1GSMA 1MREH 4I4WB 5HD8D 1LP9B 1K4DA 4ZNCD 4ONHB 4OQTH 4QRSB 3BUYB 3RWGA 2ADGA 2X4UB 2HT3C 1B4RA 1U6AH 1QYGL 4MVBA 5E70A 1NGYB 1FE8H 1JPSL 1AQDB 1MEXH 4NN5C 5GSVB 1G9NH 2CLVA 1PZUB 2YK1H 2HFFA 3HCVB 4W4NA 4JHZA 4G8GE 3MRGB 5LVEA 1YEHH 1CU4H 3QFJB 5DD6A 2E3VA 4TULL 1MLBB 2VDQL 4F3FA 4HT1L 5I1IL 3C9NA 3O6MH 3UO1H 4OIBA 4CN6A 5M7QA 1DQQA 5D7IB 2EDKA 1QSFB 4KROC 2AJUH 4HULB 2DWEB 3PWJA 4YHNA 3RVUC 3CLEL 5D2NA 4MXWH 5GS0H 5T1DL 1T66D 1JNJA 2M1KA 4P3WA 1FAIL 5GGRA 1KTDA 4K8RL 4WV1A 3TN0A 2VZOA 4KJYA 4YHZH 2WIIA 1LEIA 2BFVH 1UWEH 4EBQH 3EYOA 1E6OL 5CUSL 4QTIL 4UILL 3LSOA 5KVFL 3S8WA 5EO9A 4M5ZH 3RWHB 5GQBA 4M00A 4GS7C 1J87A 2VSDA 3MO1A 2VTFA 3ZYIA 2P42B 4EDWH 4WDIB 3RHWF 4UAOB 2CMRL 4PJDB 4I13B 2L7JA 4ISVA 5JIKA 2XT1B 5TE6L 2NW2B 4WCYH 3IJHB 4XX1G 5TDNB 4DAGL 4JEGB 3L7EB 3N9GH 4IDJL 1N0XL 1N5YH 3EIFA 4D0BB 5DC0A 1NANH 3MREB 4NUJB 2G60H 4G8IB 4ODVH 3S35X 2E6QA 4BFEA 4FQQA 3P9MB 4CBPA 4Y16C 5GS0D 4JFDA 1SEBB 1T4KA 3NIGE 5CBEA 5F1SA 1PBYA 4OZIE 4HK0B 3OF6D 5IVXE 1RUAH 3C5SA 5F7UA 5MP6L 4P5MB 5DR5L 3T04D 3HE6C 2F5BH 4LP5A 4X6CE 4LKCA 1I8IB 1D5BB 5C08D 5E56A 4APQA 5C9JA 2XRAL 4KQ3L 4AY0A 5A43C 1KENH 2VL5A 1CQKA 3BGFC 4Y4FA 3V7AG 3VMPA 5I2IA 5JORA 3A6BL 3HC0A 2X4QA 4D0DB 2R0WH 1OAQL 4P2CG 2Y9RT 3P73A 3ARYA 1U8NA 1I1YB 5HYSB 5GGVL 3BEVA 3GB7B 4H26A 3NA9H 2DLFH 3OKKA 1CDJA 4LNRB 3EJJX 1PDKA 2FRGP 2V2WB 3PQYD 3SKJH 1I8KA 3IB4A 5E2WH 1GPOH 1R3JB 3DUUB 5KSAD 3SE3A 4OZ4B 1T7VA 1YQ2A 2GSIA 3O6KL 4LGSB 2AAVA 3N1PC 3LKRA 2FB4L 1AHWB 3P9LA 4JQVC 5E2TH 5EUKA 4XPTL 4NQXB 5TH2A 3IRZA 2IADB 4I3SH 3TWCH 1OAKL 2WIMA 3LPFA 5KW9H 4AT6A 4P5TC 1IZKA 3ARGB 43C9A 4RFOL 2R8SH 3BAEL 4FP8H 2IQAA 4YWGH 4QXGL 4NOBA 1RUQL 4R2GD 5IFHH 3VFNB 4MA3B 2HTKD 3DRTB 3TV3H 3BZFB 5T1LB 4MJ2A 2OK0H 4OCYH 4POUB 5FECA 5GSRB 3UTSE 4PJGB 5EWIH 2DWDB 5EZIH 3NFNB 2Y7QB 2P45B 3L3KA 4AIXA 2DBLH 5EZJB 1UZ8B 4HQQL 3CFCL 3MLYL 4AG4L 4OCRL 1ZEAH 1H5BA 2M8XA 3FT4A 4KWUA 2B4CL 4PJ8B 3DXAD 2E9BA 5CIPB 3H9HA 1BECA 1SYSA 4C4KO 4Z76A 3FL7A 4OCXH 4KUZL 3MLXH 4JO3L 3QUXB 4NQSB 4TVSa 1A7PL 5IQ7L 2B5IB 3SE8L 4K2UH 4L3AA 1IGTA 3MQIA 4PJAF 5I1AB 5IHZA 3PDGA 1JPTL 1JNLH 2ATPA 1MIML 1OAZL 4KKCC 2E7CA 4ZDHB 5SWZB 3FB5A 3V8OA 1X3DA 4H8WL 2VDLL 3V6ZA 5BV7B 5DJAB 1JRHL 4ORGB 4MCYB 1JGVH 2ZG2A 2FH8A 1ED3A 4GRLD 4XAWL 2FR4A 5EORH 1UH2A 5D7LD 2B0SL 3A67H 1X7QA 5DD1H 4YHKH 4UT6L 4RMQA 2H9GB 3H9SB 3V7MA 1LK2A 5EO1A 4V1DA 3T4YA 2BC4A 1BJMA 1DDHA 3E6FA 2OP4H 3QEQB 4NM4L 3RAJH 4E9LA 1D3CA 5SX4H 4OGYL 3MRMB 4I18B 1E6JH 1AD9B 4WGWB 4YFLI 4MWFA 1S9XB 1F4WL 3DROB 5JXEA 1JMZA 3I2CL 2BNQB 1F4HA 1AD0A 5DJ0A 3UPAA 2EDNA 4E0RB 2GJZB 2E7HA 1CFBA 4GG8B 3ARTA 2V2TA 3RDTC 3MGAA 3MCLH 4Y0GA 4E41E 4PJCB 2YZ1A 2R2BA 5FA4B 1MAKA 4Y19D 2Q7YB 3X13A 5B3JE 1PKOA 1TQCC 2MSPA 3BKCH 4MHHI 4BQBA 3BW9A 2JELH 4IOIB 4JG0H 4KJQD 5HYJD 1FORL 2BOBB 3QH3B 4PJ7B 5D9SA 5KTEL 1A5FH 3QB7C 3SE9H 4YZFE 3MRPA 4JFED 4I4WA 4ONHA 3EFDH 3OKOB 3BUYA 2X4UA 3K3QA 4HXBH 4S2SA 2NY2D 1P4IH 1I9IL 4DEPC 1NDMB 1MQ8A 1NGYA 1RJYB 3MRNB 1L7TH 1G9EA 4KK6D 5GSVA 5ALBH 2VO5A 3GMQB 4XZUB 1A4JB 3TFKA 4OD2B 3MRGA 4OGXH 3QFJA 2NY4C 4R4ND 2DKUA 2QQNL 2I9TB 3MR9A 1NFIB 2D0GA 5A1AA 1UT9A 1F02I 2P49B 2DWEA 4IRJD 5IHBA 1W0YT 3RL1A 5ACZA 3BQUC 4KK9D 1DFBL 3EOAA 4OLUL 1MF2H 4M3JA 1NCTA 3HE7B 1MRFL 4JY5L 3OXSB 4ELKB 3MA9L 3L3GB 2ZPKH 3D85B 4CRPA 1LDPH 1YEDB 4XCYB 3CFIC 4ZQKB 3O2DL 3QPQC 4X7CC 4K71B 1ZAGA 4JJHA 2PCPB 4QGTA 4WDIA 3MGOB 4CDGC 4PJDA 2Q86B 1BBJB 2R56L 2NZ9D 2VUOA 4XC1H 3PXJA 4EUPA 4G3YH 2NW2A 1AH1A 3IJHA 5TDNA 3FQRA 1LDSA 3BN9C 4KK8D 1IC4L 2A83B 1MCWW 1L0QA 5DMIH 4YDVB 5DO2C 3RWJA 2EE6A 3ULSA 1Z5LA 3ZE2F 4PY8J 1Z3GH 2EDXA 1HWGB 4JR9H 4W81A 5J89A 2OI9C 3IGAB 4PY7B 1DBBL 4PLJC 4G8IA 2VDOH 5DDHA 3N85H 3NIDF 1T3FB 1TETL 1S7QB 3P9MA 1WAAE 5DZLA 3WO4B 3QG7L 1SEBA 1FPTH 5TQ0L 1EJOH 1XGTB 1K8IB 4L9DA 4HK0A 3B83A 4PRBA 1ZHKB 5FO8B 5J11C 3U0WH 4P5MA 1ZS8A 4O02H 2R0KH 1U8KB 1HKFA 1D5BA 1PKQE 3WKML 3LOWA 4JHAL 5FDWA 2DD8H 4O4YL 5D7JC 2RFXA 4TRPL 4HDIB 4GUPA 4RAVB 3VG9C 1I1YA 5HYSA 3GB7A 1I7UB 8FABB 4LNRA 1DUYB 2V2WA 2MQ0A 4BSVA 2AJSH 4Z5RB 5HXMA 3MUGA 5TE4H 1QO3B 3DUUA 4KDWA 2JIXD 3FQWA 4OZ4A 2D03L 4EI5A 1GIGH 2NY6B 2VNCA 2IADA 3GJEB 4ZS6D 5C07B 4MXVE 4R7DB 4UDUB 3TM6A 2D4DA 5AYUH 2CO7B 5HHNB 1A3RH 3ARGA 2WZPD 4TSCH 5IMKA 4QOKD 2NY5C 2CJUH 5D1ZC 4O5LH 5K9QI 3P9WB 5CEZE 4PR5A 1IGML 1R3IL 3VFNA 5IEHB 4X4XB 5IW3A 3DRTA 3BZFA 1YMHB 4KV5E 5T1LA 2JTDA 4F57H 4LLMB 4I3RH 5GSRA 4JY4B 4G7VL 4PJGA 3REVB 4CKVX 2DWDA 3NFNA 2Y7QA 3HG1D 3CLFL 4C55A 5TGBB 3OAZK 5I1LB 1PEZA 3SGDI 4L8BB 1MNUL 5EZJA 1NMAL 4U7MA 2X89A 4KZDH 2ED7A 1IGIL 1G6RL 1BBDL 2H32A 4P4KD 4PJ8A 4JVWA 1A64A 4M7KL 1UM5L 3SDXB 4YFLF 4NQSA 1IGCL 4PJHF 4KI5F 1B6DA 5C0CD 4XTRC 3VRLF 4KJWC 4ONFL 1CICC 2G75B 5I1AA 4XX1E 2ZCHH 5FHBL 3MLWL 1FG9C 2WBKA 1CL7H 2DLTA 4P2OC 4R7NA 1P2CB 3MRCB 4MZ3A 4ZDHA 3S35H 1NSNL 1T22B 5SWZA 1OP9A 1OLZA 1CT8B 1TVBB 2P44B 4ONGL 5DJAA 1FNEB 5CLWA 1IAOB 4MCYA 4NNPH 5GJSL 3S37H 2K7PA 1X5GA 4DZ8A 4V3DB 1N8ZB 1KTLA 5C86A 1WIOA 5A2IH 3FCTB 4JPVL 4JRXB 2CKBH 2W65B 4JRYD 2H9GA 3H9SA 3FT2B 1NPUA 2IQ9L 2ZUVA 2KBGA 2H3NB 2AK4E 3Q1SH 1Q9KA 1DQJA 3WDHA 4XNXL 2X1QA 3MRMA 5DS8B 2XG4A 1V5JA 1AD9A 2MJWA 4OIAA 3SGJA 5FV1L 1F4AA 2IAMD 1LHZA 4KTEL 5DC9B 3V7AE 2XPGB 3DROA 1ADQH 2BNQA 3RY6A 2NY7L 4E0RA 2APFA 2GJZA 1FZKB 4GG8A 1OGTB 4IIQB 3KPNB 1JZ6A 4PJCA 5DQJB 2XKUA 3QUMB 5FA4A 2ED8A 2Q7YA 4MQXD 1Z6JT 4M43L 4U7KA 3ZL4L 3BP4B 4ODTH 5KZCD 2QHRL 4KQ4H 3DARA 4XP1L 1EFQA 2JJUA 1WBXB 1RURL 1F58L 4ZUVB 5HHXH 4QGYA 5JTWA 3G9AB 2A9MH 3IVKA 3X11B 3OKOA 2MCPH 1MJ8L 2CUMA 4WUKH 4CMMA 1SHMA 4LVNB 2LQRA 1AKJD 4OF7A 4NO0D 1N0LA 1NDMA 2VLRB 1RJYA 4YGAB 3ZDZE 4S1SH 5HHOB 1MWAH 2EC8A 4PGCB 4R26H 3QIBC 1F6LL 1QEWB 4BK5A 4HAGA 2CRZA 1RZKH 4QYOA 1A4JA 1KF9B 4X7FC 4OD2A 4OF6A 5MHSD 4EQ2A 1KCUH 2I9TA 3PGFH 3QULB 1T1XA 2P5WE 3IDJB 4LVHC 3TA3D 2DJ4A 5CJQL 2AJXH 1K4CB 1AY1H 4UOW1 3S88H 4KY1H 2VR5A 3HE7A 3NCJL 3UROR 1JJUA 1L9NA 1T03H 3CD4A 3OXSA 4ELKA 2BVPB 2OR7A 3BYTA 3OKLB 5F9AC 3UTQA 3D85A 3KAAA 4S1QL 4TQEL 1YEDA 2WY3A 4XCYA 4ZQKA 3CZFB 1JF1A 4F9PC 5H35A 1ZT1B 3UJJH 4NCC1 4YC2C 1DTUA 1OARH 4K23H 4RQQB 4X6EB 2PCPA 2BNRB 2OM5A 3DUHA 5D72L 3SJVD 4U1GC 3MGOA 2Q86A 1I1CA 4TTDD 5T3XE 2GI7A 4XVSL 4ODSH 4P3CH 4POZD 1Q72L 5FYLL 2A83A 5ID1A 4HIXL 4NQCB 3V79C 3UTOA 1YYMH 2LV4A 4XPFH 1V3MA 1D5IL 1W8OA 5EOTB 2D3VA 3VWJB 5LGHL 1XCTA 4PY7A 5DRZB 4A2LA 5D2NC 1FRGH 1MY7A 4NT6B 4PYHA 2DIBA 5FM5M 1T3FA 4JG1L 1KCGC 1EGJA 1NCAL 4WV1C 4YGVB 3S96A 3BPOB 3KPPB 1K8IA 3ARFD 5T3ZE 1OW0C 1ITCA 3B9KC 3GSNH 3IJYB 1ZHKA 4L8DB 4ZNEA 1YECL 2UVEA 4H0IA 5BVPH 1U93B 4G6AD 1KC5H 2CIKA 3I02B 4RWYH 3SDAD 4FNLL 1I1AA 2R1XA 4YE4L 3ZKSD 2X1WL 3LQZB 4HDIA 1UXSB 3NMEA 2HRPH 3ARWA 1YDPB 2MMXA 4RAVA 3VXPB 5ISZB 5DVLA 3NIFE 4KK5C 1I7UA 1S7TB 8FABA 3LQAH 1BQHG 4UT7L 1M05A 4HKJA 2V9QA 1DUYA 5L6YL 4MJID 3MUJA 4TVPL 1KELL 4Z5RA 1W72H 1QO3A 5JW4R 5BS0E 2R1WB 2NNAB 1T5XA 4XMPL 5DRNB 4DWHA 3DX7B 3GJEA 4MB3A 4R7DA 1AXSB 5F8QC 4UDUA 1ZLVK 2NY0B 1C8PA 2CLZB 3VXUA 3F8UB 1KJVB 1V7MH 1R3KA 1MCRA 3I85A 4GAGH 1H15B 1FIGL 2IH1B 2VN7A 4QHMB 5IEHA 4X4XA 4APQC 4HSQA 3HUJB 3AROA 4Y4FC 1YMHA 3RUGF 3QDME 1SY6L 3V52L 2XN9B 3IS1X 4RFNB 2NXYD 1DE4B 4LLMA 1MFBL 4JY4A 3VW3H 3RU8H 3REVA 1OSZB 3GSXB 1U92B 4XWGL 1U3ZA 5TGBA 4PRHD 4WNQB 5TF1H 2R9HC 4L5FL 4L8BA 4DGYH 1I85A 3KPSE 2Y6SD 4Y5XC 4YHOH 2UWEE 4NQTA 3V6BR 3VFVB 1R6VA 3QUZB 1EHLL 2CIIB 3RVXC 3SDXA 1NEZG 4UV4L 4WFEE 5DWUH 3BIKA 1TJHL 3BMVA 3O4OB 1U42A 2G75A 5GS1B 1E4WL 1DBAH 3RNQB 2PO6C 2ERJB 1Z0MA 2HKHH 2FJHB 2J5LB 3MRCA 3MLVL 3DSFH 2B1AH 4LAQH 3IDYC 1T22A 3O4LA 1CT8A 4AENB 1NAMH 1ZGLB 4YR6B 1TVBA 1MCCA 2YBRB 4PJIB 5DUPH 1FNEA 1IAOA 3QCVL 1OGAE 1N8ZA 2I24N 1A1MB 1H3VA 1Q0YH 2VDNH 1P7KB 2A1WL 3GBNH 4JCLA 1JZ8A 3WFHB 3T65B 3UJTH 2H3NA 1F8TL 1X5JA 1XIWD 1H5BC 1LO5B 4XPGL 4RDQG 3ULVL 2HN7B 2WUBH 3TH2T 3BVNB 2XPGA 1X6LA 3L9RB 2VDRL 1YQVL 1I3GH 5JOPE 1FZKA 4BZ1L 1MVUB 3TT3H 2YD9A 1OGTA 4IIQA 4U7SA 4U1LA 3KPNA 5DQJA 3LKQB 3QUMA 3O9WA 1ZLWK 1VGEL 4N90E 3RIFK 4K07A 2DQFA 1TNNA 4OCLC 4MCZB 5DQ9B 4IOFD 2V6HA 4B41A 1N4XL 1EJ6A 5FGCB 5KAQF 3IFPB 3QXAB 2UUDK 1QFWI 1JYNA 2DM2A 2OX5A 3WFZA 1WBXA 4GXVH 3DURB 4DVRL 4ZUVA 3QCTL 4KZEH 2A6DA 4P59H 4XVUD 4XNZB 4RISL 2ZUQC 1HH9B 1TNMA 3BPCA 1UXWA 3W2DH 2HJLB 4KMTL 1EHNA 4RMVA 4R4FL 1RHFA 3HNTH 4PJBB 1GGCH 5JW4Q 4F15B 5JXEC 1QEWA 3GSWB 4F2MB 5F71A 1Y18B 2UV3A 4L4JA 1I7RB 3NTCH 2JJSA 4Z7UE 1I3UA 1EEQA 2B8OT 32C2B 1IBGL 4IHOA 4KJPD 1K2DB 3EYVB 3JV6B 4IBLT 3IDJA 4HEPG 2DMBA 1RJLA 3ARED 1SJEB 3PQYB 2EYRB 2F8OA 1MUJB 3BDYH 4AEHH 2FYYB 1IGFH 1KCLA 1F5WA 3P11L 4EJ1C 3PHQB 3UTPD 1QHOA 1ZANH 5DJYA 2BVPA 5FEBA 3F5WB 3OKLA 3HI6H 2RJMA 3KYOB 2D9CA 1EEYB 3O2WH 2P48B 2BNUB 2X4SA 5JHDE 1NAKH 2D9QB 5JZ7D 6FABH 4DCQB 4ODXB 1JHLH 5DFTA 5SX5K 2BNRA 1S7SB 3T3PE 3ECBA 1INEL 4ZTPL 2AEIT 1ZMYA 3BH9A 3QBTB 5F7YC 2DQHH 4K3DL 3TFKC 3GI9L 4UQ3B 3C8DA 4U1JB 3BT2H 1IKFL 1U3YA 2A6JB 5F9JB 4Z8FH 5LGKA 2GSGB 2B2XH 4NQCA 2KPNA 4LCCB 2P5EE 4DGVL 3W39B 5E99H 5EOTA 3MJ9L 3DMMC 3ZKMC 4OF3A 2LABA 5EC2A 3VWJA 4FFVD 1UC6A 5DJ8B 3WUWB 3VG0H 4HFUL 4X9HA 2O5YL 1UCTA 4NT6A 3KLAB 4FABH 4PJEA 1ZLSH 4PBWD 4YGVA 2Q6WB 3CK0L 3TZVD 1DVFD 2O5ZH 3KPPA 2ESVB 4IS6B 1RIHH 3UZQA 4FTVD 3IJYA 1KBGL 4L8DA 2OJEB 4ZODA 4DGIL 4GMSL 5C09E 1T20A 3P77B 4WUUD 4F7CB 3I02A 4ZOEA 3OX8B 3C5ZB 2F54E 3B9DA 5DQDH 1G1CA 2OSLB 4K7FB 4NP4L 3OR6B 4YBQD 4HKZB 2NR6C 2R0LL 4GRLB 3F65A 4M9OA 1UXSA 3VXPA 3ZKND 1YDPA 5ISZA 3UP1A 1T89A 3D0LB 4CVUA 5HVHB 1HEZB 1S7TA 1GGUA 1X5KA 1UKQA 3S97C 3MV7E 4NQDE 3JBG7 4U1IB 3UXFA 1GHFH 3MBED 4MMZC 2DICA 1NUGA 3V6OA 2A0LD 2H1PH 1BGXH 3TCLB 3DX7A 3OWEA 3IF1B 3CFDB 3VFGH 3MSPA 4ALAH 2CLZA 4FG6C 5E8PB 4NKIL 2XYCA 1KJVA 4FMFA 3FRPG 3ALWA 1AR1C 1UQSB 2YD6A 5ADPL 4XP5H 1H15A 4NKMB 4U1KB 4X7DC 4Y19B 2B39A 3HUJA 4XCFL 4BH7B 3P0VL 5BV7L 1MJ7H 3OAUL 5A40E 3QO0B 2XN9A 5MI0C 1RZGB 2YUZA 1DE4A 3C6SB 4JGJA 5HYJB 1XGYL 2A77H 3GSXA 4JFFB 4NQVB 4WNQA 3DHMA 3ZSTA 4NBYB 1Z9LA 5D8JL 3M1BB 2R39A 1N3NA 5GRUH 1SBBA 2G9HB 4AYFA 4OM1L 5C0FB 2RBLA 4BK4A 2NY2B 3C8KB 2CIIA 4H1LB 5IVZB 1ETZA 2ATKB 4GKSA 5ICYB 2YWYA 4EI5C 3EO9H 2Z91B 3LHPL 4ELMB 3PJSB 5GS1A 3RNQA 4OLVH 4PRPE 1QFUL 5D7SH 3BKYL 1CK0H 5EUOE 5EZOL 5GGUB 2DIAA 1H3GA 4ZS7H 3ARGC 1R24B 5JW4M 3HPJB 2WUCL 3FRUB 5IHUH 4AENA 3S34L 1ZGLA 4YR6A 2VKXA 2YBRA 2AJ3B 4PJIA 2X7LB 1F11B 4LGPB 3T0XA 5D5ME 5CINL 4M62H 2VXUL 4IRJB 1A1MA 1WFNA 4E41D 4WO4D 4TSBL 2CUHA 3CH1A 1P7KA 2FATH 5GGQL 1KYOJ 5BMFH 4RWHA 2APVA 1FVDB 3WFHA 1W0VA 5FYJL 3KWWA 3LZFL 1JMXA 3TLRA 4QHKI 3ARBD 4JREB 1LO5A 3ESVF 1PX3A 4OJFH 2KKQA 5IJKA 4KH2A 2HN7A 4NZRH 4Y2DB 4MHHG 1ZA3B 3BVNA 1WBYB 2XKSA 5A3IC 3L9RA 3B5TA 2OR9L 1OWRM 2DQDL 1FZJA 1QVOB 1A6AB 4NC2B 4L4TD 1QYGH 2WQRA 1JPSH 3LKQA 3VA2C 2FDBP 5GRVK 3IFLL 2X05A 3G5XB 4GAYB 4BUHA 2XACC 1G0DA 4MCZA 4RA3A 5DQ9A 3QXAA 1B88A 3IT8D 3DX6A 4TULH 3DURA 3MTRA 2VDQH 4HT1H 5I1IH 3MA7B 4M1CC 3LIZL 4U6HB 3BEWB 1A2YB 2A38A 4S1DC 5J7CC 1IC1A 3OF6A 5T1DH 1AXTL 5D1QC 1MJJB 2HJLA 3ZKXB 1FAIH 5LQBL 4K8RH 3SGJC 2EEDA 4PJBA 3QDGE 3GSWA 1E6OH 5I66A 3QO1B 4QTIH 4UILH 1Y18A 2IPUK 4GG6F 4HHAA 3P30L 4PP8C 2MKLC 4S11A 5KVFH 1I7RA 5IMMA 5TF0A 4OTXL 2LAAA 32C2A 1YY8A 3G6JB 4G80B 5HGAB 1K2DA 2IMMA 1CFQB 3EYVA 3MMEB 2R2EA 5HYQB 2UVFA 5JOEA 3QI9C 1OP3H 4L3EE 1FCGA 4LCWB 3PQYA 2EYRA 1MUJA 1EUTA 5TE6H 1A7RL 1F00I 4DAGH 2FYYA 3QNXB 5BOPA 1F90L 2MHAA 2QADD 4K3GA 4GW5A 4IDJH 3WCYA 5C0GB 3PHQA 3V2AR 3I3EA 5KSAA 3VD3A 4Y1AD 1G9MC 3F5WA 2DQCL 5E03A 4JKMA 1EEYA 2BNUA 1DCLA 4ZXBC 2IBBA 5DVMA 3OGCB 5FCSH 4DCQA 4ODXA 4QOKB 4S1RL 1S7SA 2HTLD 3K81A 3SQOL 4K8RD 4NC1C 3NACL 1V3JA 3AB0B 1P4LA 1LP9F 4HKBA 3RRQA 5MP6H 4UQ3A 5DR5H 4OCSL 3BWAA 3GO1L 4U1JA 2A6JA 4MX7B 5F9JA 1AGDB 3ULVF 3HG1B 4LCCA 5E08L 3W39A 2XRAH 2BMKA 4U6VL 4YQXL 2CK0L 3A6BH 1OCWL 3FN0L 5FO9B 5E24E 4PTTB 2FBJL 3FFDB 5DJ8A 1OAQH 3WUWA 4XP4L 3DXAA 5GGVH 5I74B 3WSQL 4LSSL 1UWXH 2PXYD 3FT3B 4TPRL 2Q6WA 2EXWD 4ZFOL 4MS8C 3X14B 2C7UB 4XPAL 2ESVA 5C0CB 3MBXL 5D7IF 4KI5D 2GJ6D 2NTSP 1QFOA 2OJEA 1BF2A 1B0WA 3O6KH 1TTFA 3PWLB 4YXHL 3P77A 3BISA 4K71C 4F7CA 3WJJA 2FB4H 4YIQB 5J1AB 3OX8A 4XPTH 4WFHD 5KS9B 3C5ZA 4MD5A 5CZXC 1DEEB 4XT1C 4NCC2 1OAKH 2OSLA 4K7FA 3MX0A 4HKZA 2I25N 4GRLA 3R06B 4M61A 4F7PA 3WS6A 4KHXH 3BAEH 5D7LA 3D0LA 1S5IL 3LPGA 2PW1A 4QXGH 4YNYB 3WD5L 1HEZA 1RUQH 5LCVL 3K2UL 5E8EB 5DHVH 2YR3A 4PGBB 4FOMA 4J3OC 4HKXA 5K9QG 4U1IA 2DTML 4MA7L 3P4MB 3OKDA 5J06A 1I1RA 3KPMB 1L6ZA 3DYPA 4LU5L 4HQQH 4MQSB 1H8SA 3TCLA 3CFCH 3MLYH 4AG4H 1U3HD 2WP3T 4OCRH 1WZLA 1QPXA 4PJ5E 3O3UN 2B4CH 2I27N 3UTTD 3WFCL 7FABL 5FYKE 4BKLB 5I1HL 3ZHLA 2EC9U 3KPRD 5E8PA 4HJJL 3LRSB 2PN5A 4OKVA 4KUZH 1E0OB 4JO3H 1UQSA 4Y19A 4U1KA 1A7PH 4GW1A 3BZEB 1YEGH 3SE8H 3QEHB 3ULUE 4BH7A 1JPTH 3WBDA 3VA6A 1KN4L 1I1AC 3CX2A 3JV4B 3QO0A 1RZGA 1MIMH 2XWTA 3AMLA 1OAZH 5HYJA 4MSWB 4JFFA 2VLKB 4H8WH 4X9BA 2DQUL 2VDLH 3I6LD 3CDGB 4JFEA 1JRHH 2BCKB 5EIIA 2G9HA 2W9EL 4XAWH 5E5MA 5C0FA 4L9LA 2IAND 4PG9A 2FGWL 1UEMA 5FKPB 5MEND 2B0SH 3C8KA 4PS4H 4UT6H 4QNPF 1QTYT 2ATKA 5ICYA 3ZDXE 2RQ8A 3CVHL 2Z91A 4NM4H 2IGFL 5A2KH 1CZ8L 4ELMA 2IFFL 1OTSC 4ENED 4FQ2L 4U0RB 4OGYH 4D3CL 1R24A 5H94B 1HHJB 5J13C 1U41A 3HPJA 3T0DA 4QT5B 4FQXB 3SCMD 1F4WH 2AJ3A 3I2CH 4RGND 2WK2A 5F7HA 3TA3B 4IRJA 2VISB 5IB2B 1MLCB 1OAYL 4BQ8A 5D6CB 1RULH 3FO9A 2EIZB 1FVDA 3HC3L 2PYEE 1Z0NA 2VLJE 5T1MB 1EMTL 1FVCB 3AM8A 4P99A 5ESAB 1FORH 5KTEH 1PQZB 3VXMB 5DJZB 4YXLL 4Y2DA 1ORQB 4LHQB 3JTCA 1WBYA 4PJGF 4R8WL 4M9PA 5K9OB 4KRPD 4NRXB 1AO7E 4WU5B 1A6AA 1MWAB 1EO8L 2XKNA 1I9IH 2OQJB 1UA6L 2YMXL 4D94A 3LN5A 1CXKA 3QIWD 4XCNB 3G5XA 1FAKT 2H6PA 2BXYA 1RAMA 2I26N 3ILQC 1BD2E 1QSEE 3B8YA 3FQXB 3U4EB 4MXQC 2YZ8A 1P9MC 3GRWL 2QQNH 2P47B 2XWJA 3MA7A 4LOUD 3GJFH 4U6HA 2P5WD 3BEWA 1A2YA 2ZUTA 2WM0A 1JGUL 1DFBH 4OLUH 2YUXA 1MJJA 1MRFH 1FN4B 2AERT 5IROA 2XTJB 5KAQG 3MA9H 3VI3F 4RAUB 3LKPB 3GI8L 4HMEA 3SDAB 1ONQB 3MV9D 2MQCA 3R8BB 5FCUL 3TO4C 2MQ3A 1OY3B 3QDJE 3TESA 3O2DH 5F89B 1PYWB 5GZND 5E94B 3EDKA 2K7QA 3G6JA 4LQ1A 3HPLB 3O9WC 5HGAA 3MMEA 1CFQA 5HYQA 3GIZL 4MQ7B 3T2NL 1U36A 4LEOB 1CFVH 4MJIB 3QNXA 4NBZB 4XCEB 1IC4H 4GOSA 5C0GA 2JIXA 1JNHB 4MD0B 1VFUA 3LAFA 4PJCF 1QOKA 1W0WB 5DMJB 5CP7B 1U8MB 3TC9A 3P40A 3Q5OA 4JCMA 2AQ3A 1DBBH 2EDBA 3MOBL 3MYJB 1I7ZB 3OGCA 1JZ7A 3PNWB 2GTZA 1TETH 2OJZL 4QOKA 3GSNB 4PJ7F 3QG7H 5TQ0H 3ERYA 4NKQB 4JFPB 5ENWB 4MD4A 4TUOA 4LHUB 2QSTA 2X9XA 1E4XL 2JJSC 2IALB 3TF7A 1BWMA 4X5XB 1AGDA 3HG1A 2ORBH 4PRHB 4CUCA 3RWIB 3WKMH 1G84A 1EERB 2VXVL 2EDLA 5FO9A 2OYPA 4JHAH 4PTTA 4O4YH 3FFDA 4TRPH 4P4KA 2V9TA 3ETBF 4J2XA 1CI5A 3DX9A 3BIBX 1SBSL 1YN6B 5FO7B 1J9CT 3C8HA 4OZGE 1W72B 3X14A 2C7UA 5C0CA 3H3PL 5HVWA 2Q8BH 1KG0A 1UJ3B 4Y89A 1LEGA 2D03H 5IW1B 4ODUB 3R8QA 4YJZL 1VESA 3FONA 3CSGA 4YIQA 5J1AA 5KS9A 1JPFB 1AJ7L 1DEEA 2FLBT 5JIHA 3W81A 1S9YA 5HTSA 3K4AA 3WXWL 3R06A 1T80A 3S5LB 1OAUL 4OAWB 3EOBB 5EBGA 1NGXA 1F6FB 4YNYA 2DI9A 1R3IH 1QPPA 5E8EA 3RTQC 4PGBA 3EOTL 1H9VA 2A9NL 4Y8AA 1OB1B 3ARQA 2VOTA 4ZAKD 3V8CA 3QNZB 4G7VH 1C08A 2BDNH 3CLFH 5L2KE 1MNUH 3I6GB 1NMAH 4X80L 4D0CB 1NBZB 2J6EA 4PLKC 1IGIH 1JWSB 3H9ZA 4XGZA 1G6RH 1BBDH 2YEZB 2NXZB 4BKLA 4XNUH 1BZ9B 3B2UD 1J8HE 3DECA 4M7KH 1UM5H 3LRSA 2ZKHL 4P49A 4NM8L 1IGCH 1SMOA 4NFBA 3NCCB 2D7TL 1EBAA 5JMOC 4ONFH 3QEHA 1QFWM 4LASL 3MLWH 5FHBH 5I17B 3JV4A 1IEBB 2JK5B 4G8GB 2WINB 1NSNH 4LIQL 2Y4SA 1A9EB 4ONGH 4CNIA 3CDGA 3JWDL 4JB9L 4PUBL 1UGNA 1S7WA 4NQUA 1F42A 5GJSH 4KDTC 3OTTA 5IT2H 4X9GA 4O9HL 4Z7QF 2VKWA 5FKPA 4DTGL 4JPVH 4ZO7A 4QHLB 4Y4HD 1AKJA 1S7RB 4NO0A 4JRWA 3KLHD 2IQ9H 1E27B 3BRDA 4UV7L 4HWNA 1FVEB 4QRPD 3QEGL 4NWUH 3TPUA 2AK1H 4NPYA 4XNXH 4CU6A 3H9YA 3V5DB 3G04B 1ADQA 2ZNWA 4KTEH 4QT5A 4FQXA 1E28B 1JWMB 2HLFC 3MYZA 4X6DE 1ZOXA 2NY7H 2ARJB 4WW2B 3W9DB 3TA3A 4PJ9D 5IB2A 2IMNA 3D3VD 1MLCA 4B50A 4ERSL 1QBAA 5D6CA 3CU7A 1S3KL 2H2PD 1N26A 2EIZA 4M43H 1T21B 4O2EA 1ZLUH 4LSTL 3ZL4H 1N6VA 5T1MA 2X40A 3JVGA 1Z9SA 1FL5B 4GAFB 4NO3B 2V17L 3EOYG 2ZCLL 3NABH 1PQZA 5CP3H 5DJZA 1F58H 1YNLH 2YXFA 1FNSL 5HHMD 3VD7A 5CFHA 1ORQA 3SJVA 3WYRA 3HRPA 5K9OA 1MJ8H 4MAYC 3LB6D 1MWAA 2XV6B 2J5LC 5E5UB 2EDRA 2W0PA 5AUMB 2ZOLB 1JK8B 2HFEB 3L1OL 3K1DA 4M8QA 4XCNA 1Y6NR 4JDVB 4QRRD 3SDXF 3MRKB 1CWVA 4HIJB 3BGMB 5DD5L 1O0VA 1NGZB 4W6XB 4Z0BL 1I1FB 4HUNB 3RIFF 3TZVB 2IWGA 2DQTL 3ARFA 5CJQH 1FSKB 2CDEB 4KGJA 3FO0L 4FTVB 4RBPH 4NHUB 4OGAD 5D7KD 3NCJH 5IJKC 3RGVB 4GQPH 1UB6B 4S1QH 5J12B 4GFTB 4TQEH 3SDAA 1ONQA 4Z78A 5B8CB 1G0XA 4XBEL 1MSPA 5F89A 1ZT4A 1GH7A 1PYWA 4CW1B 5E94A 1G9NC 2YPLE 5AWNL 5E6ZA 3HPLA 5D72H 1RHHB 3SDCD 3F58L 3OKMB 4MQ7A 4LEOA 4XVSH 4MJIA 3RWCB 2VQ1B 2JB5L 4U1MB 1Q72H 5FYLH 1PG7X 3UDWA 1OTTD 3NOIA 3GIVB 1Y0LA 4HIXH 3RUGE 3WJLC 3MBEB 3UTSB 2DQEL 1EAPA 1JNHA 4MD0A 4CAGA 1D5IH 1W0WA 5GS0C 5CP7A 5LGHH 5FGBC 1V3KA 1IAII 3MYJA 5K93A 3WFDL 1I7ZA 3VDBA 5HI5C 1WTLA 4YBLC 3QA3B 4JG1H 1EBPA 5I30L 1NCAH 3GSNA 3MODL 1KNOB 4FQJL 1PGRB 3QJFA 4LRIA 1AGEB 1EK3A 2L0DA 5CJOL 4JFPA 4FQLL 4P46D 1QFWH 4HGWA 4LHUA 3SBWA 1YECH 4M7LT 2IALA 2VH5H 3MV8E 1WWBX 1QUNA 3ZHKA 4X5XA 5JXAL 4PRHA 1RU9L 5H8DA 4XMLL 4FNLH 5L0QC 4IDLA 5HDLA 1MIEL 4YE4H 3B5HA 3ZE1F 3ROLB 1HXYB 1LK3L 1WC7A 4S0SD 5KSAC 1CD1B 5D96C 4UT7H 5FO7A 5FYLD 5SWSE 2G5BB 2CDGB 1W72A 4ONOA 5L6YH 1M7XA 4TVPH 1UJ3A 3G9VA 1CDCA 1QA9A