5F1NA

Mhc complexed to 11mer peptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAPWVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYGCDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLVEPVTRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Immune system
total genus 75
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5f1nA01
3C6LD 2F15A 1DDHB 1MFAL 1OSZA 4QCIA 3ZKSD 4R96B 5I6XC 3C8HA 4R0LA 1HH6A 1UWXK 1BVKB 4BQ9A 3C2AH 3IJYB 2BNUA 4FQ1H 4PJ8B 3BN9C 3MV9E 3F12A 4U1IB 4MXVE 3GMLB 2B5IC 2HJFA 1EO5A 3P2TA 4WCYH 2BHUA 3EYUL 3GMQA 4NQEE 3O3UN 4X8JB 1SMAA 2A6JB 5IBLD 4P3CH 4OLVL 3BP4B 3QJHB 1VHPA 1WWAX 4XNXL 4GKZA 4NCC2 4PPTA 3ULVC 1LGVA 2IQ9L 1MRCH 2MQCA 4G7VL 1KN4L 1P9MA 1INDL 5DEFA 1IGYA 4MNGE 2GTZA 4LMQI 1EHXA 2FIKA 4GKSB 5LG1A 3QIUC 1V7NH 2W65A 4MA1C 4ORGA 3TBWB 1J12A 1IT9L 5JXED 4TNVF 5E6ID 3IS1X 3I02B 5LQBL 4IMKA 4JM4L 3GIVB 1I4FA 4WNQB 1TENA 5F7HA 2X1WL 3QXWA 4KRMB 4ODBD 1H15A 1S9WA 3RUGF 4HJJL 3EDJA 3OR7A 2BNQA 3LKSB 4UOJA 4G9FA 1PZ5A 3FQWB 4XC3H 4IHOB 1I1FB 3IGAB 5H8DA 4G5ZL 1G7QB 1AR1D 4OV5A 5KVGL 3MLVH 2VDQH 2A83B 4YR6A 4QXUH 5DGQA 2QSVA 5IB1A 4FXKB 1MCRA 5D4QA 3OV6A 3HG1B 4RCAA 5DFWH 4X4YB 2V17L 3OB8A 5JOPE 3VXRA 2F53A 3M17A 3QI9D 4GQ9H 3FQUA 4OCYL 4KI1A 2ATPA 4H88L 2EDKA 1U36A 4JFED 4R7NB 1KNOA 2WWKO 3I3DA 3PGFL 3MRLA 1IQDA 3QUMA 3RFZC 2IGFL 1ZEAL 1I85A 2FH6A 2VDLH 4BKLA 5FYLL 2ZOLB 3W39A 3H0TA 5D7IA 5TDPA 2J8UA 2X7LA 1MQKH 3NA9L 1NJ9B 1WEJL 4FQXA 1KN2H 4U3CA 2NY4C 2D7TL 2EIZB 4MJ5B 1WGOA 3GSUA 3QUYC 3V4UH 2H45A 4PRBB 1CFQB 5GJTH 4IRJB 1J0ZA 4HXBH 3UTZA 4HKJB 1AIFB 1RK1B 2L7UA 1GHFL 1WCQA 1CBVH 3P40A 3BRDA 3VGBA 1JNJA 3FB7B 5I1HL 1FL5A 5CP7B 1WCBB 4EIZC 3HI1A 1UYWL 4ZUUA 5MEOB 2YUVA 4P5TC 4MAUL 3MJ7A 1XAUA 4M00A 5I1JL 1AD0B 1RZKH 2GJ6A 4YFLI 5INDB 4YBQC 4PRDB 1WWWX 5DC4B 3MFFA 4K94C 5GS2D 1ZT7A 1RPQA 4U6YA 4Q7DA 2AJUL 4OCNC 3VDCA 3EJYD 2YD5A 3R0NA 1AGDA 2HFFA 4QHUB 5EIIB 3EYFB 1RHHB 1LO2L 2XTLA 1F3RB 3JTSB 5CUSL 2DBLL 4DN4L 5TF1H 4RISH 2ZP0T 3UXFA 3O11B 1JNNH 5DD3H 2OK0H 1MVUA 1C16B 1HILB 5EU6D 2OM5A 2AXGB 2W60A 3QEUA 4MCYA 3KPOB 3F7VB 4J6RH 3VDAA 4WY7L 3DVFA 4I9WE 1CT8B 3LS5L 3C08H 4X80H 5I9QC 4QRTA 5SWQB 5GISH 1VA9A 4HS6B 1MUJA 4NP4H 4GUPB 4X98A 4XPGH 1LP9F 4FQCH 3CFJB 3SDDA 5HYQA 4HMEA 4MDIB 1YEKL 1CE1H 1UM4L 2J6EH 4ZFFA 1R0AH 2XZQH 1OAYL 2CO7B 2VUOA 3PDOA 3PP4L 4LPXA 1WFNA 2ENSA 4MWFB 2V9RA 1DQQA 1UXWB 4U6TA 1YMHA 3AGVA 4EIGB 3L1OH 1NCBH 4IIQA 1GC1L 2N4IA 1JPST 3EFFB 1AO7B 5DO2D 3BPLB 3L5WB 5F72S 1U9KA 3KNBA 1FV1B 2VDNL 1P2CB 2AJXL 3DIFB 2JJTA 2AXHA 4ODVH 1QVOA 3TFKA 3ARFD 1QPPA 5CEZE 2H1PL 3INUH 4PJIE 3OPZH 3CFBA 5JPNB 5DD1L 2XN9B 2Y1VA 1OW0A 3EAKA 5FM5O 1GAFH 1NC4A 2B4CL 4EEEA 1IAII 3O2VH 5J9PB 5C7XH 5C86A 2F74A 5J1AB 5BVJA 2K3TA 3IDIA 4G8FB 1A3RL 3RWFB 1QHOA 3WS3A 4P2RE 4Q6IB 1DANU 5E99L 5F7MC 3TVMA 5FA3B 1BFTA 1SHMA 3TJHA 3JV6B 4M5ZH 5C2BH 4CL7A 5KVDH 4Q9QH 3SEPA 5MP6L 3BE1L 1AHWB 1JWSA 5KBNC 4E41B 4NGHL 5I8EB 5ANME 1FBIH 1XGRB 1ZKAA 2XPGB 4KQ4H 4MQXD 3RDTD 3C5ZC 4XVTH 2MJWA 3ARGD 4NQDE 2JCCA 4NSKA 2OMBA 3ARPA 4JFFE 4NNPL 1GGUA 4K3DL 4XHJD 4JJHA 4RRPG 2OR7A 3EJZD 2O61A 1D5XA 3AREA 4FRWA 1X5IA 2R2HB 3GIZL 1XGQB 3MRJB 4OZGE 5E8NA 3OG6B 4N1EA 1P4BH 1A7OH 3KPMB 4TVPD 5J11C 5I8OL 5K9OB 5D5MB 4XVUC 1DN0A 1ZGLP 4AM0A 2HRPL 1B4RA 4O9HH 2XOTA 2VC2H 2CUHA 2DOCA 3O3BA 4K7FA 5JUEL 4RBPH 1NGZB 4CJ0A 5F3BA 1RURL 3C6SA 5J7CC 4PJBF 4K3HA 1N6UA 3PQYE 3QG6B 1KPVA 3TH2T 4FABL 1U8KA 4YGVA 3IVKB 4WHDA 2Y5EA 1NGWB 4EUPG 4X6CB 4NQVA 3N1MC 4HQQH 1T5XB 3MACH 3BN9D 3D2UB 1RIVH 1VFAB 1ORSB 4QRUB 2YEZB 1DQDL 3K4ZA 5J6GB 4UV7L 3NFPB 4U6XB 3CZJA 3KVQA 1G0XA 4XPHL 4YE4L 5F1IB 3GSOB 3FQRB 2DQFA 3ULVD 1DQLL 2AV7A 3DX8A 4Z95L 2ZSWB 2OTPA 3BZFB 3FQXA 1MREH 4A2MA 1EAJA 4P2OC 4DKFH 3VCLA 1IAOB 3QIUD 2E9JA 5MEQA 4PRPA 4WO4C 4KRPB 3ZSSA 4NZJA 4O2EA 4U1MA 3O6FA 1AGEA 4YHNB 2DQEH 3RUGE 4XX1E 1GGIL 4X9GA 5DJAA 2W9EL 4KJWC 1FZMB 3AC0A 3OZ9L 5ISZA 4AH2B 4U6HA 3FQTA 1IAIL 2R1YB 2BNRB 3T4AB 5DZOA 5JHDA 1HXMA 4PGCA 4L4VD 3FZUC 5DR5H 4D0CB 1L0XA 2HKHH 4H20H 1T3FB 3RGVD 5EIQA 4PB0H 4P46D 5HI3D 1FAIH 4HWEL 1BQSA 2W0FB 4BH8B 2IADB 3LH2H 1GC1C 3MQIA 5C0AB 2Q8AL 4AL8H 2MCPH 3QQ9D 2UY7A 2X05A 1J0JA 1UWEL 2FDBP 4N0UB 1VGKA 1HOCA 1MCSA 4L3ED 4ONGL 4LGRB 3AS2A 3B8SA 2GIYA 1TZIA 2GQHA 1CDHA 1EJ6A 2V7HB 1FNSH 4OGXL 3CSYB 5GGRY 1FIGL 4GXUM 4KK5D 1FJ1A 2B4CC 3MR9B 5FHAL 2BP3A 1KJ2H 4KJYB 4JY5H 1LEIB 3MNVB 3GM8A 3BIKB 1CE6B 3SDXB 3UYRH 3P9LB 3EGSA 3TF7C 1ND0B 3QXDA 1D5ZB 5E08H 1OAKH 4NZUL 5H2BB 4PGBB 4LPVA 2WUCH 4QOKD 3TPKA 3DSFL 5C8JB 1N59B 5C9KA 5DWUH 4BQBA 1R3IL 3ESVF 1A3LL 4FTVA 2HH0L 3CC5B 1GGTA 3KYMA 3TJEH 2XKNA 4AT6A 4FG6D 2XWJA 4WIQA 1P53A 2Y36H 3TCLA 1I7TB 2IF7A 1ERNA 2HWZL 4YBQD 3QDHA 3MRDB 5SX4H 4QRPB 4UI2A 5E8EA 2FBJL 3MLTB 1YPZA 2JKXA 1HHJB 4HJ0C 3BPLC 3LEXB 5JOEA 3NPZB 1M1SA 1VESA 4P57B 4MCZA 3RPIB 2CDEA 5I0ZA 4R97C 1RJYB 4PJFE 3LRGA 4X8XA 5JNYA 4YC2B 2R4RL 4MXQC 3MFGB 4LLUB 1JNLH 2JELL 2P8PB 1F42A 2VZSA 4Y4FD 3UJJL 3V0WL 1H5BC 1JZ4A 2X4UB 5ICZA 4F3FB 5IBUG 5IK3B 1EFXB 1F4WL 1LP9E 1WBZB 3SGKA 3CK0H 3KPPA 3VG0L 1KBGL 4LVNC 4NRYB 4Q6IC 1EGJL 4XXDB 1J10A 5HGBB 3MLSL 3R1GH 2ADJA 1EAPA 4JO3L 4WDIA 4NKIH 1BX2B 1I7UB 4WFED 2HLFD 1G6RH 4TUJA 4C56A 4Z78A 4KJPD 4YAQA 1VFBA 2VDKL 5IB2B 2FX9L 3FB6B 1PKOA 3W0WA 2ZCHL 4JQVC 4G59A 1J8HD 3KPSE 3BAEH 4NN5B 1S7TA 3HZMA 4WU7A 3TV3L 4X4ZA 1FGNH 1JVKA 1UCTA 2DYPD 1F4XH 1OF2B 3AMLA 3NN8B 1QNZL 4G6AC 4S2SA 3UZQA 3QXTA 4G6JH 1J05A 3HNSL 5DJCA 4UINL 1AXTL 1EX0A 1U3HA 4PP2B 5I1KH 1U95A 3IRZA 3P11H 4DAGL 3O6LH 2HT3C 3EUUA 2ILLA 3MRQB 3BGFC 4O02L 3IF1A 5GGVY 4P59H 8FABA 3BEWA 1UM6H 4KROB 4OCMC 3UTSB 4Q0XH 5KS9F 1P7KB 2P5EA 4ZAKC 4N5ED 3OKNA 4XPFL 15C8L 3QEQB 3VE0A 5TPWH 1OGAE 2QTEA 4KDTC 3B2UC 3DX7B 1YUHA 3LKPB 5ICXB 2P5WD 1CD1B 4NNXA 1X5JA 1C08B 1F6AB 4JY4B 1T2JA 2WIIB 1QA9A 3RA7H 4KY1L 4F57H 1NFDA 5HYFA 4TYUA 4R8WH 4PJ8D 4JANB 3W2DL 3MJ9H 4F8TA 2NTFB 4J1UA 4PRAA 2UWEF 4G6MH 4OLWL 1AR2A 3BSZL 3RX5A 1U42A 4OJFH 1ZT4A 3PGCB 5C0JB 1TPXC 3RVWD 1OAUH 3H7BB 3BH8B 2V2XB 2GSGB 3U1SL 1HN1A 5DD6B 1DANT 5EBMB 3ILPB 5EB9A 2F54E 2BCKA 2EXYD 4KTEL 2ZCKH 2LU3A 3PL6C 1LEKA 5L2KB 4LLAA 5GGRB 4EDXB 1CDGA 2YBRB 2R1XB 1D6EB 4K2UH 4Y16A 1UACL 1ITBB 5E70A 3O81A 5ACLA 4LL9A 4MDJA 1FNEB 3KG5A 4G3YL 1MJ7L 4QRSA 5C0GA 2VLKB 3N9GH 1IKFH 1MAML 3WHE1 4PJBE 3GSNH 5FV2A 4DW2L 1YEHH 4B7LA 1TCRB 4LF3B 3BKCL 1DBML 4N8VG 4OCLC 4PTTA 1B0GB 2Y23A 2A77L 1YN6A 2Y7QB 3EDDA 4LLQB 25C8L 4UQ3B 5BRZD 3BMWA 1J0IA 3SCMA 1JPSH 1RUPL 3HG1D 3JSSA 1NDMA 4UUJB 3U4BL 5D72H 1DUZA 4JKPL 4KH2A 4UILH 4QXGH 1RJLA 2R56H 1QEWB 3LKRB 4K94H 2XNAA 4WUKL 1ZHBA 3WN5B 1EBPA 5T5NF 1RZGB 1M05A 2NY7L 4WFFD 1N4XL 1CXEA 5JW4Q 4Y2OA 4OI8A 1IRAY 2NR6C 1PKQA 4YPGA 3S35H 5AZEH 5LJYH 4PV9B 1XF4A 1M71A 1MWAB 2CD0A 4FQ2H 4XB8A 5EWIH 3LEVH 4I5BB 3FQNA 3MCKB 1MELA 1ZVSA 4NDMB 1KFAL 4KJQC 4M6OH 4XP9H 5AAWA 2P24B 4YXLL 4IRJD 2EYRA 4KJWD 5BQ7B 4F9LA 1MFAH 4QHKI 1KJ3L 4HZLA 5CWSB 2NW3B 5JR1L 2VQUA 4V2CB 2HJKA 2VLRB 3QUZC 3QAZB 2F19L 1MLCB 3A6BH 3FZUD 4D0DA 3QDGB 4JRXB 3MLYL 2HFEB 4XRCB 1WC7B 4U7SA 3KLAA 1BMGA 5C0BB 1Q38A 5EA0L 2OCFD 4F37K 3EYUH 3AY4A 1GZQA 4HPYL 4XBGA 5DJXA 2R2BB 4XNXH 3JUZA 3DVGA 3GMPA 2FRGP 3DYPA 2IQ9H 4G7VH 2VRAA 2YPLB 4X5LA 1KN4H 3W9EB 1G9NL 4NYLA 4AY0A 1I9JL 2X2YA 2J6EA 3I3EA 3VFOB 1EUUA 1U8MB 5KW9L 3QNYA 4QNPF 3M8OH 1IT9H 1HQRA 1QR4A 1UENA 4J23A 5LQBH 2XQYK 4JM4H 1IL1B 1OHQA 4YC2C 3TNMA 2H2SC 1H9VA 1VCAA 4KMQA 2AQ3A 4XAKE 3DYMA 3O3DB 3QG7L 5GXBB 4HJJH 2BOCB 2BC4A 2DI7A 5ETUA 5EOTB 1J88A 3MYZA 1G6VK 3CZFB 2YA2A 4G5ZH 4HV8B 1M7DB 1XIWB 5M94B 5KVGH 1PG7H 2AJSH 2H32B 1S7WB 5HI4C 1F4YL 4JHWH 5JXEA 5F6IC 5E6IA 3O3AB 5ACZA 1YQVH 4NN5C 5DD0L 2KKQA 4QF1B 1H0DB 5CKGA 4OCYH 2Y25A 3WIHL 4NJ9L 4H88H 1A1MA 2E7HA 4IRSB 2GAZA 3MA7B 3PGFH 1KG0A 3PV6A 2IGFH 3ARBA 4FP8H 4K07A 5FYLH 1AO7D 3CU1A 2JB6A 2QADB 1BQHB 3MLXL 1BP3B 2JLLA 1WF5A 1ZA3A 4F2MB 4Q58C 2D7TH 3RKDC 1NL0H 4HK0A 1TQBC 2VQ1A 1QG3A 2XY1A 5D7IF 1NBZB 2J8UF 1IGJA 1ZGLA 5CGMA 1WLHA 2XN9D 4MXQD 1GHFH 1HHKA 4ZUTB 1M7IA 1UG9A 3B3IA 2AJYL 4HIJA 2C4FU 4FQLL 2XWBB 4F37F 3H9SB 2BVPB 4EVNB 4JFDB 5A43C 5I1HH 1IGCL 1HI6A 5ALCH 3HLAA 3VFTB 1IEAB 4KKAC 1UYWH 3CUPA 4YHIB 5GZOC 2FEDC 2NY5L 4CMHC 3GBNL 5I1JH 4QXWA 3FRUA 2VN4A 3HR5B 4PRHA 5GS0D 5E5UB 4M7KH 4RGNB 4U1SB 1NAMA 1ZVYA 4P4RB 5I1DB 4JCLA 2X09A 3V6FB 1BF2A 4X6EB 4P2QB 2AJUH 1T66D 4Y4KC 4E41D 4GO6B 4ODWB 5KSBB 5I1IL 2C7UB 4G6AD 4XTRD 5CUSH 2DBLH 4DN4H 3BHBA 3MRBB 3EIFA 4U1KA 2JE8A 2VJXA 3QFJB 1NCWL 1QSFA 2D4DA 5HDBF 2HT3D 5LAXA 5IT2L 3U6RA 4RFNB 5D2NA 3SDAB 2HG5A 4DKDC 2YPKA 5KS9E 2DLGA 4N0CA 3LS5H 4NC1C 1FVCA 1LEGA 3D18A 2CSPA 6FABL 1SBSL 2VZ3A 4TTDC 5GRJH 2X1QA 2IBBA 3FO1A 5ERWA 2GJZB 4S1SL 1R3KB 4KDWA 1P7QB 1OTSD 2E27L 1S7XB 1YEKH 3G08A 1UM4H 1OAYH 2AAVA 3S35X 1N26A 3WD5L 3PP4H 3X13A 3B2UD 4YWGH 2X42A 4DKEH 5KTEH 4H0IA 3X14A 1F97A 5EU6A 1K3IA 2X4OA 1I1YA 5I1AB 1TMCA 1WITA 4G8EA 2UWEE 1V8HA 3W82A 1B88A 3D2UD 4GFTB 1ZOXA 1G9NC 2CMRL 4LRNL 3BPOB 5HYSG 2BJML 4GBXB 2VDNH 2AJXH 4WW2C 4XNYL 2BY0A 5ESVB 3S5LA 3O8XB 2H1PH 5GQBA 4GRWH 2ZJSL 4ZFGL 3GMOA 2B4CH 3MGTA 5K59F 5LGHL 1MY5A 5F96H 4KRPD 4I0CC 3MNWB 5CD5C 5DHYA 1OQXA 3ET9F 4BFBD 2J3SA 2YS4A 3EYOA 5D1ZB 5EO0B 5FO7A 3PWJA 7FABH 4RMSA 5E99H 3VXUA 3FFDA 3ARDC 3AM8A 4BJLA 4OLEA 3OB0K 1MFDL 5GZND 1H3GA 2BNRD 4OFDA 2AEQH 4ZXBA 3ARRA 2E7LC 4HIHA 3O45A 3LKNB 1C5DA 3BE1H 5D7KE 1ZHKA 5BCAA 4N0YL 3EO9L 3ULSB 4H5SA 4M6ML 2R0WL 2ESVD 3BKML 4F7MA 1QACA 4OZ4B 3H8NA 4OKVA 5E8PB 5C0AD 4LRIA 5BO1H 4CMMB 1T0MB 1BD2E 4F7TB 3N06B 1PG7X 4JG1L 5ID0A 1EHNA 5H37G 1KB5H 3V7MA 1JZ6A 4Z6AT 4IMLA 4NNPH 4EOWH 3HZVA 4FXGB 5FOBA 1U8QB 2QQQA 5IW3A 5T3ZE 5D2LF 4OZIB 4LAJH 1FO0B 2JCCF 3S3PA 4Y2DA 1A7QL 3MUJA 3VG9B 4N8CH 2O5ZL 2OJEB 3ZLQC 1NLBL 3U83A 4M93C 1AXSB 1S78C 4AG4H 4NHUE 1Y0LB 4BSWB 4X6DB 1TTFA 3WS6A 2CK0H 4OF0A 1DQJB 3IDYC 1I1AB 2HRPH 1SYSB 1X5XA 5JUEH 4CADB 3MGOA 4LCCB 1KJVB 1RURH 3VWJB 2DAVA 2NY5C 2EE9A 7CGTA 3ARGA 3CVIL 3LQMA 4FABH 2ICEB 3LEYL 1WT5A 4QXTB 1TIUA 2DQTL 4I2XA 2PYFB 4FQPA 1DN2A 2VOTA 2IH3A 2OMNA 3LMJL 1PD6A 3GHBH 3GUTB 4WTZG 1VFUA 1DQDH 2EXWC 5LGJB 2KZ1B 4K3EL 5T3XD 2ERJC 3VXNB 4BSVB 4I4WB 5HYIA 3QEHA 4IRSC 4YE4H 2AABH 4QRPD 5JA9A 1S7SA 4WWID 3GSVA 4Z95H 5EOCL 4QNPE 3QPXL 1OLLA 5DZLA 3WFHA 4CU8A 1FVDB 1G6RA 3KWWA 4TQEL 4IBLT 5FYKU 3QYCA 1AGCA 3QULA 5IP4A 2H2SD 5FF6A 1GGIH 2YD9A 4H0GA 3LQZB 5M95B 5H94A 2W9EH 1FIEA 1CGUA 1P4LB 1XFPA 2NY1B 2M8XA 1EFXD 2BNQE 2IBZY 2P44B 4HUXA 4G9FE 4XMLL 2JTDA 1KGCE 5TFSH 3UCRA 4C59B 5A2LH 1N8ZA 2QEJA 5HI4D 4WI3A 3CX2A 3LN5A 2N1KA 3BJLA 4LKXB 2X44D 2NLJA 3OF6D 2IAMC 4RGNC 4MA3A 3VXRE 2F53E 4RFEB 1UWEH 1F90L 1N64H 3BZEB 2XZCL 3W5MA 2Y4SA 4ONGH 5BMFL 2GITA 5K93A 1CLOL 5EBGA 1I9EA 3C09C 4OGXH 1ZSDA 3V5KB 1FIGH 3B5GA 5D7IE 3GGWB 2J8UE 4PJCB 3PWPB 4KGJA 3BPNB 5FHAH 3BI9X 3CH1B 4LAQL 4JJ5A 3LIZL 2YSSA 3U2SA 2GTWA 4PJAF 4ESKA 3CLFL 2VE6A 3MJ9A 1JYXA 5FXCH 4KROD 3UTSD 1MHEA 1KCRH 3FB8A 4NZUH 5B38A 1I8MA 4JHAL 1REIA 3DSFH 3G6JA 1DQTA 1S7QA 3CFDA 1UM5L 3D69A 1J87A 3IFLL 1R3IH 3B8YA 3QEQD 1HHHB 2GHWB 3L5IA 1WISA 2HH0H 4KKAD 1PQZB 4AQOA 5DS8B 2C3VB 4LK4A 2FLBT 4IJ3B 5FO8A 5FYKL 1JHTA 3ARZA 3LKQB 3X12A 1INEL 3JTCA 3RIAF 1MCDA 3HCVB 4XZUB 2HWZH 5C6WH 3HRZB 3QUYA 1UGNA 2GJ6E 1T2QL 1Q9KA 4Z7VB 1I3UA 1ZA6A 2FBJH 3BGMB 2NMSA 1RJZB 4HUUA 2H8PA 1SJEA 4XC1L 4F8QA 4HUVB 2C4FT 1X5AA 4HLZH 3BYYA 3GSNA 1YPZF 5HDBE 3CSPA 2XTJE 3O0RL 4M1CD 3O8XC 1NEZG 5TE4L 1WV7T 1HYSC 3PUCA 2R4RH 4P5TA 1EO7A 2H6PA 2JELH 3UJJH 2YD4A 3OMZA 5CEYB 2GT9B 2A6KA 5FB8A 5L2KD 1NLDL 1OM3H 3VXMA 3T0EA 3OL2A 5LXGL 1EGJH 1WBXA 2RIKA 3DV4B 4MJ6B 3G9AB 3P4MA 5KVFH 4JO3H 1H8NA 4PJGA 2VLKD 5F1NB 1BREA 2AXJA 3RWJA 1LO3L 1AC6A 2CDFA 4TSAL 2VDKH 3GK8H 2FX9H 2Z35A 3RU8L 3MODH 3UZVB 2ZCHH 43CAA 3TV3H 5I2IB 3RI5K 1XGPB 4FQIH 1GGCL 3GSQB 3S36L 3HC3H 4PJ7B 1D5BB 1NUGA 3GNML 5EOQH 4NOFA 5CZVL 1HSAB 3HNSH 1C5CL 1MNUL 1WFUA 4UINH 1UKTA 1AXTH 2Z31B 5D7SL 5BRZE 3U82B 4O02H 2E9BA 3SDCB 3ZDXE 1KTRL 5K59E 5BOPA 1J8HA 3VG9C 5IMLA 4LP5A 2EICA 2D0FA 1Q94A 3S4SB 1TZGL 2NXZB 2Z93B 3A0OA 1LMKA 2DD8L 3SJVB 1HZHH 1HIML 4XPFH 5CD5D 1LE9A 5ID1B 5EO1B 4BH7A 1JTTA 4FN0A 4IM8A 4U0RC 4X9BA 3TA3C 3VWJC 3TPUB 3OKEA 5FDWB 1ZE3C 1KLGB 2VLRD 4OF6A 3DLQR 4U1JA 3RWGB 3MTRA 2NPLX 4KY1H 3QDGD 4H1LB 4JRXD 4P4KC 2PO6B 5E6YA 5EU3A 4OI7A 1WQVT 4PJEB 3W2DH 1FYHB 1ZTXL 5C0BD 3OX8A 2LU4A 4OLWH 5FA4B 4YXHH 5CCKL 1TZHB 5HJ3B 1NFDF 3T4YB 3TNNB 1K8DB 5TGBB 3LN4A 1UB6A 4JHZA 2ADIA 2XWTA 2P8LB 4RGMB 4NNYA 1NDGA 2YPLD 1U8JA 4EXPX 2DDQL 3DECA 3UTPD 1N3NB 2ZOKB 5D2LE 4KTEH 4QY8B 3RWEA 3OHXA 2JCCE 5GSRB 1FYTB 3QQNA 5D6CA 5JQ6H 1S7RA 3IJYA 4LVOB 1KACB 1UACH 3HNVL 2YZ1A 4U1IA 1A6AB 5I1LA 5FCSH 1T1WA 3BP7B 4G3YH 1MJ7H 3RI5F 5C0CA 1A9EA 1MAMH 1DL7L 2G2RA 2NY1C 1YNKH 5DLML 3BP4A 4JKWA 1PSKL 1W72L 5EZJB 5DJYA 5H35B 3C5ZA 4D8PB 4PY7B 1XIWD 5IHUL 2A77H 1ORQB 4ELMB 4LSRL 1UZ8A 25C8H 4NFCA 1NCUA 4Y1AB 1I8IB 5IWLC 2OTWA 4PG2C 1RUPH 2A73B 4NO5B 4L4TB 2CKBL 2EEDA 3NCEB 3U4BH 3I02A 4JKPH 1AGBA 1A3QA 2EXWD 4MAYC 3GIVA 4B50A 1CFNB 3F6IA 4WUKH 1GGBL 3E1F1 2NY6B 4P9ML 2JB5L 2NY7H 4IRSD 1Z2KA 2YRPA 3TP4A 4NCC1 2GEEA 4IHOA 3FB5B 3VGAC 3VFUB 4JDVB 2UUDH 2QADD 2I26N 2XG5A 4I3GA 5HHVH 2MKLC 4FXKA 4M62L 4PRPE 3RVUC 4N68A 4EN3D 1KFAH 2IMNA 2G60H 4Y5YA 5I76A 1B4JH 4NQCA 5EG6C 4R4NC 1OGTB 3GSWA 1KJ3H 5T1MA 2NCMA 1JF6A 2QQLL 3MXWL 1IC4H 3DI3B 4R7NA 4WI6A 2BDNH 3H9SD 5ISZE 4QRRA 4JFDD 2YN3A 4N9OB 3CCHA 2DRUA 5DRNA 1V3KA 3AAZB 5GGUA 1Y6MR 3MLYH 5JHDE 1P5VA 4RQQA 1RZ7L 4M7ZB 5EA0H 4P2OA 3LPWA 1F4AA 4WO4A 4YJZL 1DUYB 5I16A 2OR9L 2OI9B 2YD3A 3NABL 3IAGC 4RGND 4KK8D 1IEBA 1UT9A 3E0GA 5HI5C 1KLUA 4PJDB 1WZMA 3M07A 1G9NH 4P2QD 3L7EA 4QO1A 3LKOB 1TLKA 4MGXA 3OAYH 2MMXA 3N1FC 5BV7H 1N5AA 2VDOL 5IMKB 3MV8A 3QFJD 2FX7L 1P1ZA 4PJAE 1FQ9C 3MRGA 4OD2B 1U8HA 3QG7H 2VB5A 3SDAD 1B0RA 2DJUA 3GI9H 3UTQB 5HGAB 3KYOA 2I5YL 4YHOL 5B3JF 1AD9A 5JZ7C 4QHUA 2DLIA 4ZD3L 4FTVE 4RAVA 4NUJB 3MUZ1 3N50A 4X4XA 4GMSL 4G8IA 1R5IB 5DD0H 3EFDL 4O2CA 4QTHA 3WIHH 3WNLA 4NJ9H 3KPOA 1F00I 3AXLA 4XCEB 3VFRB 2DWEB 3CNKA 1HQ4A 1CIDA 1CT8A 1X5FA 3NH7L 4OLXH 4YX2L 4CNIB 3TF7A 3VXSB 5D1QA 4X4MA 3H3KA 5B8CA 1X5LA 1YPZE 3WYRA 4U4BA 1M6OB 5MERB 1ULVA 3MLXH 5EZOH 3JUYA 4GBXD 4MHHI 3WUWA 3W9DB 2EC8A 3G5XA 1ROWA 4AK1A 3LCYA 3O8XD 5FM5M 3SDCC 1HYSD 4N90E 5IMOA 4F33B 3RVXD 4OIIL 1DVFB 2AJYH 1UWGL 3FJTA 4FQHB 3S7GA 4FQLH 1A1NB 2NXZC 2UZIL 2CR6A 2BFVL 1DQML 3ALXA 3HHRB 1IGCH 3BVNB 4NOBA 2VIRB 4EI5B 3L9RA 2VZOA 1KCUL 1KB5A 2JF1A 4WGWB 5D1ZD 4PGDA 3FO2B 2DTMH 3L5WA 5MI0B 2NY5H 3EDKA 1K8IA 3GBNH 1FV1A 4X0KB 4I3RL 4M03A 1LK2A 4C56E 4U1NB 1OSPH 1T1YA 5ALBH 3RWDA 2JK5B 2PO6C 3W0WE 5JPNA 3K4DA 3QSKB 1MHCB 2YPVL 4X5XB 1F58L 2I07B 5A3ID 2E6QA 1H5BA 3U4EA 2RR3A 5IHZB 2AI0H 3U7YH 4Z77A 5E8OB 2K7QA 4OUUB 4PLJC 4OZFG 2FJHB 1LK3L 4Q6IA 4RGMC 3OJMB 4P23B 1NCWH 3L3OB 3HE7B 2ZNXA 2A9MH 5IT2H 4YQXL 3MYJB 3GJFH 5FO9B 3JV6A 3RY5A 2AJ3A 1K85A 4R9HA 4LVOC 3K74B 5J8OA 2QQNL 1SBBA 2XY2A 4RMUA 2E5EA 3G5VA 4CU7A 4NKDA 4S1SH 2P5EE 2E27H 1JFQL 1I1AD 1BBDH 3EYQC 4YO0B 3DMMA 4JFPB 4LHUB 3D39B 3O9WC 3WD5H 1FORL 3I84A 3QO0A 5C9JB 5IEKA 2YHGA 3QIWB 4LIQL 4XCYA 2KQMA 4ZO7A 4WI9A 5J06A 4HGKC 2CLZB 4NCDA 1T2XA 2J2ZA 3V52L 4GW5B 3IJHB 4JY6A 4N1HB 4KZDL 5LBSH 4RMWA 3S37L 4N0FB 1NFDE 3O3EA 2VLJA 3RHWK 2CMRH 3I6LE 4WUUB 1Q0YL 4ZAKA 1MPAH 2NY3C 2NY6C 3S34L 4GG6B 1IGFL 1MIEL 3I2CL 2EH8L 3IDNA 4XNYH 1BOGA 4I0KA 4LEXH 4X99B 3VRLF 2ZJSH 4ZFGH 5GHWL 3UO1L 2NX5A 3FT3B 1KIPB 1TJHH 3MRCA 5F8QC 3IDMB 1VFAA 3G5ZB 1HSBA 1EERB 5DK0B 1FNGB 4U6XA 5CSBA 1JF1A 1L0YA 3MC0A 2C3XA 1KCLA 2NY1D 2OQJB 1E4XL 4D94A 5F1IA 2WLYA 2LAAA 3MRHA 4LCIH 5FYKD 4XHQA 1VADA 3BZFA 1MCIA 2IBGA 1IGIL 4M7ZC 5DEGB 3EO9H 3PL6A 3ZZ1A 4M6MH 1U92A 4M1DH 1E28A 3BKMH 4Q6YA 2OI9C 4JFQA 3IFOA 3UBXI 4MVBC 2BSTA 3KHOA 5E0QA 1OB1A 1TTGA 5ESAA 3UJIH 3PHSA 1FH5H 5DTFB 4OD3L 2R1YA 2BNRA 4ODXB 2EYTB 4HG4K 1A7QH 4BFIA 2YK1L 1PKQE 2O5ZH 4YDKL 1OWWA 4Y8AA 1NLBH 3B43A 3B9EA 4F7PA 3PWPD 1RVFL 1ETZB 2GY5A 1BM3L 3H42L 3MBXH 3QZWB 2B1HL 4NUGL 4M5YL 2AEWA 4R4ND 4Z9KB 3WNPA 4XNUL 3CVIH 1A4JA 4UDUA 3FO9A 3LEYH 2DQTH 2X4RB 1CDJA 5SWSA 3UX9B 4Y19B 3QR2A 3VXOB 3LMJH 1KCVL 2I24N 4W6YB 3T1FA 1C1EH 1MFBH 4HT1L 4OGYL 1OTUD 3MR9A 5FOJA 5GRVK 1I3VA 3UBXB 1EGJA 3RL1B 3RY6A 4BM7A 5F7EL 3RWIB 4DEPB 5H2BA 2V7NB 5CMAA 3QUZA 1U3YA 3QWRA 1QP1A 4TQEH 1HK6A 1AQDB 3WIIH 1FFNB 3LPGA 1QRNE 4YHYC 4H8WH 5IFHL 4TPRH 4TOYL 4KHXL 1DVFC 2VAAB 2NXYB 4M43L 3HC0B 5B3JE 3UROR 4MD4B 4FZ8H 3WJLC 5DJ2B 3MV9B 3FFCA 3QXAB 5JZ7D 5DK2A 3LEXA 4PRNB 4NQEB 2AJVL 4XP4L 5C09A 3KPLB 4J3SA 1JPGB 1OAZL 3RPIA 2SEBA 1OT1A 4NQXB 3ULUL 5F97E 3VJ6B 5GRUH 4KKBD 3AMKA 4MNGB 1F90H 2XICA 1UC6A 3MUGA 3GMMA 5BMFH 4F3FA 2AW2A 1EVTC 2X1PA 2GSIB 3L6FA 4O51B 2I9TA 1UFUA 3MRIA 3T0BA 4XMPL 1CLOH 4X7CC 3WNKA 4KC3B 4NRYA 2CLVB 1PW3A 4KZEH 1NMBH 3D87B 2BSRA 1FL6A 2Z31D 4LAQH 3SBWC 2Q6WB 3LIZH 1CD0A 3BWAB 5T1KB 3CLFH 2DKMA 3SDCD 3L3KA 1XH3B 3HE6B 1BBJB 2VQTA 1JE6A 4HWNA 4ZFZA 1RY7B 2ICCA 4FQJL 4PTUA 3VFPB 3TBTB 4JHAH 1T7ZA 2NXZD 5KVMC 4XCCL 1UM5H 3BYTA 4WFHD 1W0WB 1CGTA 1P6FA 3SJVD 5E4EC 5IB3A 1RUQL 2BY3A 4G80A 5MEPA 3G6JF 1OVZA 3T0VA 2VN7A 4XNZB 1GYAA 3SO5A 1INEH 2LTQB 5E7FA 1DBJL 3NTCL 3STLA 5DURB 4HLJA 5A2IH 4PRHE 1T2QH 4K3JL 1G7PA 2GUOA 4XC1H 3V6ZA 3RGHA 1BFVL 3X3GL 3MLUH 1OCWL 2MPAL 1U8NA 4NQUA 4MS8D 2OL3L 2FWOB 3O0RH 3M1BA 4HF5L 5TE4H 1GZPA 3NZ8B 1X4YA 5A2JH 3DX7A 1MI5A 1QSFE 3IDJA 3EZJB 5IB5B 3U9UA 3VFSB 4PUBL 5DJ8B 1FYTD 5D2NE 1K4CA 2VUYA 2DIJA 3OKOB 3K46A 3B9DA 4GW4B 1DSFL 1J1XL 4HGWB 4JANA 2EE6A 2XG4A 2A74A 2Q7YB 3TN0A 1KCSL 4UV4L 4Y4KA 2R4SL 1JBJA 2W0KA 2VR4A 2X40A 1YJDH 1LO3H 4TSAH 4XNQA 1LQSR 4C54A 1G7LA 3MGAA 5DHXB 3RU8H 1AI1L 3QNZB 3BGAA 3V5DA 4PJGF 5E9DA 4D0BB 1X4XA 2XFXA 1XGUA 3KJ4B 2G75A 3KYNA 1EHLL 2H2PC 3DHMA 3GI8L 1GGCH 3FONA 4U0QB 3PG2A 3I50L 4Y1AD 3TT3L 3S36H 1TVBA 3BPCB 3BD4A 4L4TD 5EUOA 1N5YL 3GNMH 5CZVH 5J4MA 1D6EA 2KUTA 1C5CH 1G7IB 2BOBA 4J3UA 2NY6D 4LKCA 3BT2L 1EEZA 4GRMB 3VRLE 3EHBD 3MRNB 4ZFOB 2BVOB 3O2DL 3OKLB 3F7YA 1TCRA 3BKYH 1QR1B 1TVHB 2Y7QA 3EKCA 3T2NL 3ZHKA 2EDYA 2FL5A 4RGOL 2DD8H 4CVWA 5HD8D 1HIMH 5DRZB 4EUPH 4KI5C 3U0PA 1CD8A 4ERSL 4HBQA 5F7WC 5DQ9B 2VISA 2YN5A 1UJ3C 3DV6A 3LOWA 5ITFB 3VXUE 3DRTB 5I75C 5ACMA 5A16B 4WW2A 1XF1A 1YN7A 5FYJH 5HHPB 3ULUC 1ZTXH 1DE4B 3RPKA 5CCKH 4U3XA 1QBBA 5DVOA 5EU5B 2DQHL 3UYOD 1NMAL 2VR5A 4I5BA 1Q1JL 3MCKA 4RMQA 4HX1A 4HIIB 5JPMB 4E0RA 4OF8A 4PJIB 1S5IL 1MCKA 4WRLA 1EMTL 4HWBL 5EULV 4DEPC 2DDQH 4OV6F 2BMKA 4MQ7A 2NW3A 3RJQB 3ARDA 5AUMB 2VZ1A 1VACB 4F58H 1A2YA 4FFVC 4KGLA 4NN6B 2E7LA 1MH5A 3OGCB 4P2RB 2Z8WC 2HFEA 3WIHA 4KRNA 4J3WA 1UXSB 1ZHLA 4LQFH 5F70A 4WU5B 4MX7B 1FG2B 2NXYC 4CU6A 5MENA 2VWEE 5E94A 3PWLB 2R2BA 3ARTA 5DLMH 1FN4B 3SKMA 1JUFB 2EO9A 1D7FA 3SKOB 1PSKH 1W72H 4LLYA 5IHUH 4JEGB 1JGLH 2GFBB 4LSRH 4TSCL 2EEAA 5ANMB 3TT1L 2IJ0C 3BUYA 4I2XE 5HVGB 4OI9A 3D0LB 2CR3A 3VWKB 2CKBH 1XZ0A 4LEOA 2GCYB 3MREB 1S9XA 4I48B 4NQDB 1R3LB 1GGBH 1H3VA 3PHOA 3WFCL 4DZ8A 3GSRB 1RZ8B 4P9MH 5F3HA 4G9DA 1UKQA 4JFFB 3HI6H 1FVEA 5AAMA 1PAMA 1G9EA 3VXSD 4C83A 1NQBA 1SY6L 5CEZL 2G5BB 4FHBD 4OZGB 3O41B 4XI5C 3TBSB 3VFVB 3ECBB 4M1GH 5GS1B 3R06B 4M62H 1A6WH 3V0VA 5CP3H 1YECH 4L9LA 2FSEA 3E6HB 2XV6B 3PQYB 3VFNA 1DVFD 2QL1A 1CF8L 3KS0J 3Q1SH 2QQLH 3MXWH 3P0VH 4GRLC 4ONHA 1IBGL 5C0FB 2EDOA 4R3SB 1F3JB 4ZDHB 1YY9C 3VXQA 2D31A 2W9DL 3QIBC 4EI5D 5LGKA 4JPKH 2F5BL 3TM6A 4YHML 3NCJH 1BQHA 1I9RL 1T89C 4KVCL 3T3MF 2LTQC 3GJFA 2Y6SC 3WIFA 3P77A 2OR9H 1YEDB 2PYEA 2YR3A 1BLNA 1CFTA 1RHFA 4O2FB 3STZB 3VGEA 5ADPH 3GSXA 1EEYB 1JMZA 1UCBL 2XZZA 1HCFX 2VDOH 3VFTA 3C8KB 3KR3L 3RUGB 1IEAA 4MZ2A 4P23D 4H26B 5J56B 2ATKB 2HT2C 3HE7D 1KJMA 5L8KB 5I73B 3Q5OA 4UNTA 2BHYA 1KC5L 3K8LA 2IAMA 4GJTB 3B9KB 4L1DA 3QO1B 4JFHE 1HDMB 1UVQB 2I5YH 4YHOH 1LDPL 3RNQA 1Z5LA 5IEHB 2ZUQB 3G6JE 3QQ3A 1JK8B 1FZKA 1R5WA 4JFXB 1ED3B 5D7JA 4ZD3H 4LLVB 4LHUD 2HLAB 3D39D 4GMSH 4S0UC 4I0PB 3QIWD 3EYSH 1Q9LA 2HFTA 3KJ4C 5JIKA 3EFDH 4KXZI 4GRWF 5HBBA 4OLYL 4JN2B 1KIRA 2DF3A 4PLOB 3WCYA 1HINL 5CD3A 4CRPA 5JW3L 1LO5B 4YX2H 2GY7B 3ZE2F 1IGML 1UZ6F 3EOAA 5ILTH 5EFIA 3FN3A 5BJTA 1DLFL 3IDGA 3ZYJA 4WUUD 2VXVL 1CGWA 1P7QA 4NKQB 4AIZB 5HPMA 4AEHL 1F8TH 5HY9A 4X6BB 2DB8A 3DBXA 2FO4A 3ME0A 1UWGH 4OZHA 5EC2A 2UZIH 5ADOL 5TDOB 2BFVH 3ROLA 3IFPA 1YYML 1FSKB 3T0EE 3VXME 3T2QA 3OKKA 4LLWA 5ESQA 4KTYA 3RTQC 3LHPL 3U36B 4V1DA 3DURA 2CH8A 4PJGE 3D9AL 3FAXA 2EDFA 3O8XA 4RX4A 4MQTB 3PIQB 1JP5A 2VITB 2BSSB 2X4PA 2YPVH 1F58H 2VDRH 3JV4A 2Q3ZA 1S5HA 1U93A 4JFOB 1U8OB 2R1WB 3RNKB 3WFDL 4UIKL 2ZG3A 1JTOA 3MNWA 4DVBB 5L2JB 1LK3H 4Z5RB 2QQKL 1CXHA 3BEVA 4NO2B 4LNRA 2O5XL 1XCQA 4YQXH 5DSCA 4X9HA 1WWBX 1NC2A 3TH4T 5DJZA 1T21B 1GPOL 1LP9B 2AK4A 3ABZA 2QQNH 4HS8L 2DQUH 4ZO9A 4L8CA 2Z91A 3A6CL 5AYUL 4RZCB 5DT1L 3BXNB 4OSUL 5D9SB 3OKDA 1QSEA 1KXTB 3LV3A 1XR9A 4ELKA 4CMMA 1T0MA 4FFYL 4JKLA 4LCUA 5HDQL 1FORH 3KPSB 5F9JB 4Y4HC 1IM3B 3VW3L 4LIQH 1N6VA 4OQ1A 3L5JA 4U1HA 3VFMB 1EZVY 1P7HL 1RU9L 2WINB 3TWCL 1PFCA 2FLRT 4Y19D 1QLFB 4IEFB 4WV1B 3ULUD 4KZDH 2X70B 4OM1L 3S37H 3VWKC 2X89A 2AK1L 1DEEA 1QFUL 1U58A 2CJUH 4JB9L 1IGFH 1INQB 1MIEH 3I2CH 4E42B 2EH8H 2LFGA 1JWMA 2QR0A 4HHAB 4F7EA 3ZL4H 4XP5H 2MHAB 3GMRB 3E3QA 3TA3A 1EZVX 3VWJA 5HGDB 1GVIA 4M7JL 5C0EB 4PRIA 3UO1H 1S9VA 1A9BB 2H3NB 2IANA 4RSVA 4ZUWA 1S8DA 1T5WB 4FFVD 2OYPA 4ODTL 5C0IB 4P4KA 4P48A 1SJHB 5DRXB 5J1SC 1OGAB 2OR8A 4MJ2A 3DO7A 1B6DA 4HK3N 5DRWA 1FE8H 1XGTA 2XI9A 5DFVC 4BSVA 4G42A 4HMCA 2V2TB 5C0CE 3L7FA 1E4XH 5IKCA 4UQ2A 1FFRA 4MD0A 4QTIH 5FYLE 5ITBL 5D71L 5DFTA 1LO4H 3VU2A 3MV9D 2DN7A 1BVLB 4X7DC 2A0LD 4NQED 4HD9A 3D3VA 5FGRA 1ODAA 4XPBL 1BZ9A 4CN6A 4JAMB 3LD8B 2J4WH 2VNCA 3DETD 3HPLA 1JN6B 4OT1H 5DQDH 2FCBA 4D3CL 5DJ6A 2F54B 1NMCB 2FECI 4OD3H 4JFZH 4QLRA 2Z4QA 1NPUA 3I6KB 1PDKA 1NGXA 4WJ5B 2YK1H 4JM2C 4DGIL 4KK6D 1DBKL 2AVGA 2HN7A 1NSNL 1RVFH 4FZEH 3VRIB 1NUDA 4ZS6C 5I73C 4PG2A 1VKXA 5T1KD 4PJBB 3HE6D 2XQBL 4LGSB 4MAYA 2ZSVA 4GOSA 2BVUA 4XNUH 4KUZL 4NQCE 3BZEA 2C3HA 5J6HA 1N7ML 2M2DA 5DVLA 2R69H 4WEBL 4S1DC 1YNTB 1CDYA 4QRRE 1DLHA 5EZIL 1KCVH 2FO1A 3P0YL 1YY9D 5JOPD 1EUTA 3JTTB 3C60B 5IVZB 3V5KA 5CIPB 3HMWL 2YD6A 4HT1H 2WNGA 3RVVD 5J57B 1QYGL 5I8KL 4K71B 2NZ9C 5DURD 2PCPA 4UT6L 2UYLA 2WP3T 4TUKL 4YHZL 5IV2B 2XT1B 1W0VB 4NKOB 1KTLB 1T83C 5IGXL 3V2AR 5CEXA 4XB7A 3CFEB 1CZ8H 1MHPL 1C12B 1MCOL 5CINL 3MV8E 4NHCH 3ROOA 2HT2D 5IFHH 1S3KH 3V5HB 4TOYH 1VPOL 2XZAH 3T8XB 4TSBL 2D03L 4XZUA 2WLZA 4M43H 3PWUB 4RRPA 4YHPA 4FOMA 4Z7VA 3IU4L 3L3JA 3MCLL 3O4LA 6CGTA 2EDWA 1AFVH 5F7FA 2DWDB 5TDNB 3JVGC 3QEGL 4QHNA 1YDPA 3HS0A 4BK4A 4XP4H 2JIXA 3C87A 4H25A 1OAZH 4RIRB 1MJUL 1EH9A 4QRQA 5CBEA 3PWVA 4GRWE 1UQSA 5DMGD 3N0PB 3QUKB 3I6GB 2ADGB 1HH9B 1X7QA 1JZ5A 1CTNA 3ZE2E 1UZ6E 5I66B 4EUPA 3QH3B 3RAJL 1R24B 3EYVB 4XMPH 3DUUB 2AJZA 4X4ME 4OBSA 1CQKA 4Q9CA 1A47A 1IJ9A 2FHBA 2UUDK 1D9KC 4NM8L 2FECL 4I9WD 4KKNA 4YDJA 5D96C 1E4JA 1MLBB 1PX3A 3HI5L 5HHMA 1MCCA 5JHLL 2JJWA 4FQJH 1YEGL 5DJDA 5E00B 3QJFB 1D5MA 1X3DA 3ELAT 1G7JB 4ZUSA 3NIGF 4XCCH 2DM7A 1YEJL 4R4FL 3RVTD 1RUQH 2UY6A 1A02N 1T1ZB 1AGFA 1NBVH 3NIDF 1HSAA 3VH8B 1RUKL 4BELD 2CXGA 3IU3B 2AKRA 4ZUVA 4PV8A 5GIRB 4D9LH 1DBJH 2EDTA 4QHLB 3JWNC 1L0QA 3DVNB 4F15B 5KAQF 4XPTH 4W6XB 2QBWA 4WV1C 4K3JH 3SGJA 2G9HA 3D25B 4Q2ZB 1BIIA 3OXSB 1M4KA 2V2WA 3X3GH 1N6QL 1OCWH 2MPAH 3DUSB 2OL3H 2YWZA 3WDJA 5EN2B 1W72A 5CEZD 1TITA 2HKFH 1IM9B 4LSDA 4M61B 4HF5H 3HB3D 3QFDB 4U05A 1E27A 1S9YA 2ZUYA 3TPUA 1S7UB 4NJAL 3RL2B 5CJBA 3RWHB 2ARJB 1CU4L 4YBLB 1J1OL 2CKBA 1ZHNA 2NQCA 2DJSA 1I8LC 3U30B 4P2RD 2PO6A 3RIFK 5F7NC 1DSFH 1J1XH 2ICWI 3T04D 3O6ML 3EOBA 4RAUA 5FA4A 1KCSH 4UV4H 2NY2B 2IH1A 2HVJA 4X6FB 4S1RL 3T4YA 3S96A 2D9QB 1K5NB 3CLEL 3REWB 1IAKA 3GJEB 1OQOA 4ZQKB 2H26A 5A2KH 1AI1H 1ZLSL 5J12B 1NCDL 2DICA 3C6LC 1EHLH 4X7TB 2PUQT 3GI8H 5H37H 3I50H 4JG0H 5KSUB 3L95A 3VWKD 4DVRH 4MNQA 3LD8C 3BQUB 2VLJE 4HS3B 4XNMA 4NQDD 1A6AA 5EUOF 3BT2H 1EJOL 3ERYA 2NTSP 3KDMB 4JFFD 4LSQL 5IBLC 5KS9B 1V3LA 3OXRB 3O2DH 3O9WA 5CGYD 2X4QA 1QBLL 4D8PA 3U7AA 4NQSA 4PLKD 4PY7A 3DUHA 2DL9A 2X6MA 4PJ9D 1JZ3A 1JZ7A 2B39A 32C2B 2NX5E 1I8IA 2BXYA 2FR4A 4PR5A 1IC5H 5IW6B 5KSVA 1FAKT 2A73A 2ICWB 1CXLA 5B22A 2PTTA 1NGYA 4ERSH 5DFVD 2ZUVA 3PQYD 2FHFA 1WFOA 2ITCA 3JXAA 5FKPA 2UWEB 3GDBA 3VXPB 2F8VA 4L3AA 3C60C 4WW2F 5TQ0L 3C5SA 4HWZB 3TIDA 2YWYA 2Q7NA 1J0YA 3ZHDA 1NMAH 3DWTA 4ZSOA 1Q1JH 4LLDA 3WO4B 3T65B 4L8BA 4KK9D 1CIUA 3SKJL 1YMMA 4YIQA 1A6TA 1S5IH 3CDGA 1I7ZA 4HWBH 5I19L 3RIFF 4JVUA 3QI9C 1OGTA 2Y5TB 4WWKB 5KANI 5CBAB 4IDJL 5DHVB 4XCNB 5IW1A 3Q48A 3TEUA 4PJ5A 4KMTL 3GJFK 1WICA 2EDBA 1I7RB 1T20B 3QXUA 1V3JA 4NRXA 2N56A 2BX5A 5AG8A 2IG2L 1T4KB 3QPQC 4HH8A 5KG9B 1XF5B 3KS0H 4JLRB 3HC4H 3WXWH 3B9KD 4MVBA 3UJTL 1FCGA 1HHGB 4WGVB 3Q6GL 4UT7L 4TSCH 3ZE1F 1PBYA 4S1DD 3LKOA 2AERT 5DVKA 3TT1H 3GB7B 1HXYB 1XR8B 1P6AB 4TVPL 3HN3A 5SWSE 2Q87A 1BD2B 2VDML 3MOBL 3L3GA 4I0PD 2ITDB 4UU9A 5C0RL 4QGYA 1OT2A 3FT4A 5E1AB 3G5YA 4J4PC 4OD2A 4TUOB 3T0WA 1U0QA 2NZ9D 4RNRA 3X3FH 4PFEA 3TO4A 3U0TA 3P73B 4P49A 4B7IA 4OQTL 1RZFH 5DMIL 3U46B 3PDGA 5JORB 3C5JB 4N9GB 4NHUB 1Z9OA 5KVEL 4NT6A 5DXWA 3SGEI 4JZNB 4TULL 3EJYC 3F5WA 1NKRA 3HTLX 5IIEB 4NO3A 1PGRB 1MFEL 4V2BA 4FNLL 3QNXB 1I3RA 3CVHH 1ZT1A 4QCIB 1OSZB 2WUBL 1A21A 1CF8H 3F7RA 4L8SC 2ZG2A 1W8NA 1HH6B 1CCZA 1IBGH 2PNDA 3VFRA 4C55A 4DCQB 2JJSC 2YZ8A 3QA3A 5JDSA 2FB4L 1EHAA 5I17A 2WSKA 5D70L 2W9DH 1JYWA 2F5BH 2RHEA 3F12B 3FFCE 5HDOA 5MERA 4YHMH 1I9RH 2HJFB 1BFOA 4WHTA 4ZOCA 4JE4B 5C07A 3GMQB 5C09E 4NO0A 3ARVA 4IOFD 5IFAL 1I3GH 4F15C 2VL5A 4GKNA 4N8VA 3QHZL 4GKZB 1KYOJ 4EXKA 2E6PA 5DEFB 1IGYB 3TYFA 2GTZB 2E8YA 2FIKB 1U8PA 2APBA 3MRPA 4ORGB 2ORBL 4UAOB 1YQ2A 2X4NA 3DGGA 3KR3H 4A2LA 5T3ZL 3EO0A 3TIEA 3GRWL 4PY8J 4U1GB 3UZEA 1TJIL 1BZQK 5GGQL 1I4FB 5GGSB 1RUAL 1H15B 4WFGE 1QFWH 1S9WB 3J7HA 3OR7B 5CJQL 2BNQB 1QFOA 3L5HA 1CICD 4G9FB 5FKAB 1PZ5B 3NIGE 3U30C 4GQPH 3CDFA 4YLQT 1MHCA 4JO4L 4OV5B 3NIDE 3ESUF 2NY2C 4YR6B 1NFKA 3K8MA 3IXAA 5HHOA 3NAAL 5IB1B 1VGEL 3X11B 2OP4L 4Y5XA 2YXMA 3KPSD 5ENWA 3CFCH 2F53B 1CLZL 3ZKXC 3M17B 3FQUB 3SBWA 3Q3GA 1BQHG 3DX6A 2ATPB 4OLYH 2FGWH 1KNOB 3ES6A 3GKWH 1HINH 3MRLB 5JW3H 3DROA 3TYGH 3BZ4A 3QUMB 1LE5A 1IGMH 3WNOA 3BQUC 4BKLB 4LPTA 1DLFH 3W39B 3H0TB 5D7IB 5TDPB 2ZPKL 2J8UB 4A6YL 2VXVH 4FQXB 2CO6B 1C8PA 4R2GB 4UNVA 3FAWA 3GSUB 2P8MA 3MOAH 2FEEI 2P7TA 4MQXC 3RDTC 2NNAA 1MI5E 3FN9A 4XBPA 3OJVC 3BX7C 2K1MA 2MWCA 2CLZA 3TBYA 4XHJC 1KEML 1YYMH 5KJRL 1OGAD 3EJZC 4WI8A 4M7LL 1R3HA 1H3UA 3P4LA 4OZHF 3HI1B 3EOTL 4ZUUB 4CVZA 1UA6L 1ZGLM 3LHPH 4EQ3A 2GJ6B 3QDJA 1YY8A 4JFYA 5CGTA 3QRGL 3MFFB 5E9DE 4LSVL 4HPOL 1ZT7B 1YNLL 4U6YB 2P48B 2P5WB 2WIMA 2C26A 4HDIA 3IAPA 4HBCL 3WFDH 3LS4L 4NZDA 3ZYIA 3WO4C 5EUOE 3WL9A 2C4XA 2QQKH 1LNUA 4JCMA 4OF5A 2F54D 3LSOA 1KV3A 1MVUB 5CILL 4WWKC 4XGZA 3EDEA 3WE6A 2O5XH 2CXKA 2QHRL 2W60B 3QEUB 4P5MA 4JDTL 1GPOH 2Z0BA 3FKUS 3AB0C 4QRTB 5KSAB 5DQJA 4HS8H 1MUJB 4OFYD 2VKWA 5IVOA 3A6CH 4POZD 5DT1H 3MLZL 1EDQA 5DUBA 3SDDB 2DQDL 4OSUH 5HYQB 4PS4L 4ZFFB 2KQNA 5HDQH 3PDOB 3ARYA 3VW3H 1GJIA 4WW1A 4OCXL 1T22A 5EDXA 1B2WH 1DQQB 3FRPA 5SX5K 4OM1H 4IIQB 3C60D 3QP3A 3MXVL 2DJ4A 1GGYA 2AK1H 3B9AA 1QFUH 3VFWB 5E4IA 2Z8VC 3BDYL 3IETA 3H3PL 3RGVC 2CUMA 3KNBB 5BRZB 5DUML 4P46C 5HI3C 1BAFL 4JDZA 5EPMA 4XP6L 1QVOB 3KXFA 5F88B 5FUOH 4DQOL 4OCSL 3CFBB 3QQ9C 1QHPA 2EE2A 1UJ3A 1QUNA 4PGEA 1NC4B 3KJ6H 1CDBA 4BZ1L 3QWOA 1UB5A 2C1OA 2F74B 5BVJB 4I18A 3IDIB 2E7LE 3ZYOA 3D0VA 3THML 2GKIA 3RZCA 3TZVA 3QPQD 4KK5C 5EU4A 4HKZA 3TVMB 1ZLUH 2OX5A 3ZTNL 3TC9A 5MENE 3ZE1E 1IEHA 5ITBH 1LD9A 5D71H 5F1OB 3QDMA 3UPCA 1WIPA 1JWSB 2VLME 1JZ8A 1JRHL 2HTLD 3T77A 4DZBB 1FHGA 4XPBH 2VXSL 5EIVA 5FUZL 5F89B 5DJ0A 2FIRT 3IT8D 4D3CH 1BGXL 4FG6C 4J4PD 4MMZC 5TJWK 4C4KT 5D2LB 1P9MC 5E2VL 3V7AE 3V6BR 2JCCB 2VAAA 3ETBF 5E5MA 5GRZA 5CJOL 1ZVHA 1Z9SA 2O61B 2V5TA 1D5XB 4RWYL 5HYSA 3AREB 3F8UB 4IMKC 5T1LA 1JPFA 4XAKD 1JV5A 5E8NB 3T3PF 1NSNH 3IXTB 2F9BT 1CL7I 4AM0B 1L9NA 2XQBH 4X7SL 3DRQA 5F7UA 5K9KA 3O3BB 4K7FB 1FFPA 1ADQH 5F3BB 3C6SB 5I74B 4PJFF 1N7MH 1KPVB 4ZS7H 3VDBA 1I75A 2OL3A 4Y4FC 1U8KB 5DA4A 3DYOA 4WEBH 3DXAA 4AEEA 4JO2L 5JTWA 4NQVB 2W0LA 3P0YH 1WZ1L 2HFGL 2I9LA 1G9ML 1J7VR 4XBEL 4ODUA 2CLVA 5D7LA 3B6SA 3SPVA 1QYGH 4JGMA 3DHJA 3N1GC 2Z92B 2HLFC 5I1GL 3TESA 4XXCA 4KJPC 4TUKH 4YHZH 5HPOA 2AV7B 2PYEE 3DX8B 5TE7L 4KQ3H 3FQXB 3ZE0E 4Z18A 1L6XA 4E9LA 4GRLA 4MSWB 2Q1EA 4PBWD 3VCLB 4FQXC 2VYRE 1CFSA 4DFHA 5MEQB 4PRPB 4TRPL 4LSSH 1PJ9A 4O2EB 4U1MB 1IM9D 2FZ3A 1MCOH 4LCWA 3QIBA 4Z7WA 3O6FB 1AGEB 3OKMB 4HW6A 1T89A 5DJAB 4TSBH 5ISZB 2D03H 1T03L 3FQTB 1DBAH 1Q9WA 2BVQA 3I85A 1OTTD 3DTXA 3IU4H 4FFZH 4XWOD 1HXMB 5JHDB 4PGCB 4RAHA 2PW1A 3BRGC 3IDXL 5IJVA 4LBEA 2NY2D 4M7LT 4Q74A 1HEZA 3WEXA 4Z7VF 4LDEB 2E7CA 3O2DA 3T2OA 4YDVB 2FWOA 3M45A 4N5EC 4OZFH 3LDBB 5E56A 3QWQB 1VGKB 1HOCB 2M1KA 3BDBA 5IQ9A 3RAJH 3T0DA 4IOIA 1TZIB 4BQ8A 3BQUD 1Z3GH 5F7YC 4HGWA 4WTZA 4PJ8C 3LAFA 4PJAB 1FJ1B 4GAGL 1WFTA 1OPGL 1MJ8L 2GW5A 1A6VL 4GW1B 2XA8L 3RVWC 3HI5H 3QNZA 2IFFL 3EGSB 3WFZA 5KSAC 5DYOA 1EIBA 1YEGH 3QXDB 1U6AL 2E3VA 2EXYC 2A38A 4OZHE 1URLA 1YEJH 2H41A 3ARQA 4R4FH 3IAQA 4FTVB 4MD5A 3KYMB 4HWBA 4AT6B 2XKNB 1XT5A 1DFBH 1RULH 1RUKH 4JZJA 1NAMH 2XWJB 3MRMA 1SYVA 1JNHB 5C08A 5IF0A 4M48H 4PJHF 4V1DE 3TCLB 4UIMA 4BUHA 2X9YA 5K9JL 4UOW0 3MRNA 5I8CA 1CLYL 5F7LB 3CPLA 1BZ7A 1YPZB 1FL3A 2X5PA 1N6QH 2F58L 3TO2A 4JKKA 4MCZB 2CDEB 1NKOA 5GS0L 5JNYB 5CJ5A 4WWKD 3RTQA 3MROA 4ZPVA 5GS2H 5I30L 1DEDA 3DRTA 3MRKA 1OW0C 5ICZB 1CU4H 1J1OH 3UP1A 4MJIA 1MFCH 1C7SA 3KPPB 2FJGA 2D7NA 2AK4E 3P30H 5F8RC 2IPTL 5TF0A 5C0DA 2ADJB 4S1RH 1EAPB 4WDIB 3CLEH 1V3MA 4TUJB 1PLGL 4C56B 4Z78B 12E8H 1VFBB 3HZKA 1QSEE 1G9MC 2R0LH 3TJHC 2X4SA 1ZLSH 4IRJC 1NCDH 1S7TB 3HZMB 4WU7B 5D7KD 4AJ0A 4Z7OF 3C2SA 1F6LL 1JTPA 4GT7A 4LLMA 5AUMA 3FL7A 4IS6A 1MCQA 2VDPL 1BD2D 3E6FB 4S2SB 3CVHA 2EYSA 3QISA 1J05B 5DJCB 1CDIA 1OP5H 2R2EA 1PVHA 1U3HB 3B5HA 3G9VA 3ZKNC 5LVEA 1MAJA 4LSQH 3UTOA 2ESVB 5D1XA 3VGGA 5T3ZD 2DQIL 3IF1B 1EXUA 1FN4A 5AD0A 3KPTA 8FABB 4Y4HA 3E3QE 3BEWB 5JXAL 1KOAA 4OB5L 2LABA 1SVCP 2A6DB 4PRIE 4YNYA 2P5EB 2IANE 1NANH 4CVXA 2BERA 4U6VL 3OKNB 4IRZL 1NEZA 1QKZH 4H1LG 3VE0B 3CXHJ 3FT2A 2VXUL 4HUWA 1YUHB 1V7ML 3MV7A 5I74C 3MO1A 4NNXB 1IKNA 5FGBC 3WSQL 3N1QC 3R8BB 1QA9B 1NFDB 1UEMA 3D85A 2G5BA 5TQ0H 3F65A 4Z7QE 3O41A 3FMGL 3BP5A 4K7PH 2IC2A 3D3VE 3LY6A 3AROA 3CDYA 2ZWLT 1CD9B 1ZANH 3L3HA 1H3PL 3SKJH 3R4DA 4G8GA 2D4FA 1MOEA 2FYYA 5I19H 4HH9A 1MRFH 3CJJA 2BCKB 2CKNA 3PWNA 2DIAA 1LEKB 1T7XA 1VERA 5C0FA 1KELL 4R26H 3OR6A 4Y5VB 4K9EH 3T3PE 4UDTA 4FQ1L 2B20A 4Y16B 4RFOH 1T04A 4Z7NF 4MDJB 2IG2H 4TNWK 1Z0MA 2CLRA 2UZYB 4QRSB 4X7EC 5C0GB 2BNQD 4P3CL 4QT5A 4NWUL 4G9FD 1A6UH 1KGCD 1YEDA 4APQA 1N2RA 1ES0A 3U0WH 4R7DA 4GKOA 1MRCL 4PTTB 2OZ4H 1KT2A 1YN6B 3Q6GH 4UT7H 2WV3A 4G6KL 3ARUA 3MJGX 2YA0A 5FK9A 4F7CA 3WKMH 5C2UB 4TVPH 3SCMB 1V7NL 5BS0A 1B90A 3QUXA 4HAFA 1NDMB 2J12B 2VDMH 3MOBH 4JM2A 3UTTA 1DUZB 2F53D 3VXRD 5T33H 1RJLB 3LDBC 4JRYA 2XNAB 3KPRA 1ZHBB 1HHIB 2Y06L 3U9PL 4WVRA 5C6TH 5GS0C 3RZWA 1PKQB 1TJGL 4YPGB 3W5NA 3OAUL 4WENB 2R2CA 1XF2A 1AHWC 3LN9A 2PXYA 3MLVL 1M71B 4FQXD 1T66C 2VDQL 4QXUL 4R2GD 5T3XL 3FQNB 1OAQH 4S1QH 1ZVSB 5C71A 3P4NA 4HJGA 4I3SH 4XTRC 1MFEH 4UTBL 4FNLH 3ULVH 4J8RA 3W11D 3LVEA 1JMXA 2YD7A 1KTDA 2HJKB 4JN2A 5HHQA 5L9DH 1DZBA 2FB4H 4ISVA 4D0DB 4Z7VE 3O4LE 43C9A 2GYSA 3H9HA 3KLAB 2HVKA 1T83A 4M4PA 4EDWL 3CDCA 5CLTA 4L5FL 2GJ6D 1OTSC 4XBGB 3B5TA 5DJXB 4NRZA 4KTDL 1HYRC 2ZUSA 4HAGA 4AENB 3QHZH 3DVGB 5DDHA 5GJTL 3GMPB 3L3IA 5I1CH 4X6BA 2HTKC 1NBYA 4NYLB 3SKNA 3MLWH 3R8QA 3SGDH 4TNWF 3QNYB 2XTJD 1CR9H 3I75A 1HQRB 4R4BA 2CIKA 1DR9A 4CN1A 1QRNB 3GRWH 3JVGA 1TJIH 3MZTA 5GGQH 4CJ1A 2R9HD 4LVHB 3RY4A 1ZWIA 1RUAH 1T7YA 1IQWH 1RZKL 5FYJE 2BC4B 5ETUB 1DJSA 5EBLA 1K2DA 5IOPA 1D3CA 1YYLL 5KSAD 3TBVA 5HHME 4GS7B 3VA6A 2BSSA 1F11A 4JO4H 1TETL 3F7PC 4OIBA 5IM7A 3SDDD 5BW7C 1DP0A 3NAAH 3K0WA 3K7UA 1VGEH 3H3BC 4KRPC 4P9HC 3SO3B 4DVBA 1ACZA 5IBTL 5IFJB 4PJHE 4Z5RA 4G43A 4LASH 1CLZH 1E6JL 5ACZB 1D9KA 1Q9OA 5J3HD 1A1MB 2FD6H 3OJDA 1QBMH 3MRFA 2OTUA 2GAZB 4K7PY 5GZNC 4AIXA 1KSRA 1KG0B 3PV6B 3MMEA 3ARBB 5GISL 2Z9TA 3HAEH 1BWMA 2JB6B 2ZPKH 4NP4L 5F6HI 4XPGL 1RZIA 4A6YH 4CDHA 1U3HC 4FQCL 1ZA3B 5DK3A 1EEQA 3MBEA 3TFKD 2VQ1B 4ZTOL 1IGJB 1R0AL 1JFMA 1ZGLB 3KYKH 1BFSA 1SQ2N 1MHHA 3KHQA 5HVFB 4OGZA 1M7IB 4HIJB 1NC4D 3V4PH 3S9DB 2M26A 4WV1A 1KEMH 1HI6B 4M7LH 3HLAB 2WBJA 2APFA 3GM0A 4JPVH 1CGSL 1JWUA 1CFBA 5HYEA 3CUPB 5B39B 1UA6H 4YUEH 3TVMD 1INQA 4DGYL 4ODVL 2GK0A 5D6DC 5SWZA 1JHLL 4MNHB 4PG9B 4Z7OE 3TJHD 3BP6A 4PRHB 5CS7A 1KCKA 5HVWA 3EO1A 3INUL 3QRGH 4JPWL 5JOFB 4LSVH 3WXVL 1YNLH 4AMKL 1GAFL 2GI7A 1JYVA 4MHHG 2EDEA 3AS0A 3MPCA 3LS4H 1ADQA 5FIEA 4MNQE 1ZS8A 3BHBB 3WLBA 4FXLA 1F2QA 5FECA 5CILH 1QSFB 3MJ8A 5HYJA 1NGPL 4RMRA 3ZKND 5LAXB 2BRQA 2QHRH 3MCG1 5D2NB 4OLVH 2HG5B 2YPKB 1AKJA 4J7RA 1FVCB 1LEGB 4Y5VC 5C2BL 3D18B 3C6LA 3Q6FA 3ARED 1INDH 1YZZA 3DX9B 1PG7W 5BZWB 5ERWB 4GH7B 4K8RL 1PEWA 1RI8A 1FBIL 3G08B 4PS4H 1PYWA 3WJJA 5I71B 3X13B 4P3DA 3X14B 4OCXH 1KPRA 1A7PL 4I8DA 1MWAL 2X4OB 4ENED 1AP2A 1I1YB 1FRGL 3REVA 1TMCB 4G8EB 5IJKC 2V5SA 3MXVH 1NH6A 3CFKA 3BDYH 4S0TD 3H3PH 1W0YT 5A40E 1GL4B 4HKBA 5DUMH 1XF3A 1ZK9A 1BAFH 4XP6H 4GG8A 4ZSOE 2V17H 3S5LB 1FLTX 4O9HL 1YMME 2VC2L 4OCSH 1ZAGA 1U41A 1WIOA 4KI5F 3GMOB 4FS0A 1RZKC 2A6IA 3MGTB 5FGCE 3QB7C 4PRPD 4Z7NE 5SX4I 2EDJA 2EKSA 3K2UL 4OZFA 4PJ5E 1GRWA 1O0VA 1ZEAH 2NYYD 3HUJA 3RQ3A 3MACL 5DHYB 3O6FD 5JMRA 5IG7A 3THMH 3EYOB 2Q76A 3NA9H 5FO7B 3PWJB 4P5KA 1WEJH 3VXUB 3FFDB 5ISZD 4ETQB 3ZTNH 3HZYA 4EN3B 4KVNL 4ZXBB 1A1OA 5JHDD 4HFUL 4JZOB 3QI9A 4CW1A 3NA4A 3O45B 4KROC 5DVNA 1FZJA 1C5DB 3OKYA 1MREL 1ZHKB 1KJ2B 2ZUXA 1KXQE 1JRHH 4JFEA 1RK0B 4DKFL 4DUVA 1CXFA 4H5SB 5GGVL 2VXSH 3FRPG 5EZLB 3BO8A 4F7MB 5FUZH 4OKVB 1D6VL 4XCFL 1C12A 1FZOA 5HGHA 2DM3A 2VLLA 3PJSA 1BGXH 2CRMA 1TNMA 4MAUH 5ID0B 5E2VH 3T8XA 5F7DA 3V6OA 5CJOH 5JLZA 4IMLB 3WO3B 1ZXQA 3HZVB 1BPVA 5FOBB 5J1TC 4Y2DB 2HKHL 4H20L 1TVDA 4PB0L 1LO2H 1U8LA 4UZGA 3CSGA 3S6CA 5IROC 4X7SH 2RQ8A 4M1CC 3NCYP 4M8QA 4AL8L 2VXQL 3MGOB 3PABA 4ZPTB 3Q5YA 3T0AA 1XCTA 3OBAA 1O5DT 4WY7H 4XAWL 1AH1A 4I2XB 3MX0A 4FTVD 4JO2H 2IH3B 4PJXA 2HFGH 1G9MH 3UBXG 1FNSL 5DI8A 3QQ4A 5T5FL 5C07E 1SEBA 3QEHB 1KJ2L 5I1GH 4JY5L 2HJLA 3PNWA 3FOLA 1S7SB 5GPRA 3GSVB 2YC1A 4QHKJ 2HTKD 5E08L 2WY3A 1B6UA 4L8SA 5I6XB 3WFHB 5JW5A 1G6RB 3KWWB 4F80A 2JJSA 3DO3A 4GAFB 2CRYA 4TRPH 4BQ6A 5FM8A 2DLFL 1AGCB 1GC1H 3QULB 4N90D 5HXMA 4LIQE 4M9OA 3IU3A 5FF6B 2B5IB 2IQAA 4K8RC 5H94B 3PGDA 4PBVC 3WN5C 3NCYS 1Q0XL 1Y18B 4Z7WF 1T03H 4JHBA 2R23B 4HUXB 2BHZA 5DD1H 3VXTA 3IDXH 4MB3A 2BY1A 4OBRA 2ZUTA 1N8ZB 3ZDXF 3LN5B 3FTGA 4C56D 5HHOE 1A4KA 1A3RH 2DIBA 3GMNA 2AEPL 5FDYA 4OAWA 3W0WD 4NC0B 1O7VA 4MA3B 1ZLWH 1S7UA 3VD9A 1EBAA 3JWDL 2PW2A 2UZXB 3QAZC 3LZFL 1R5VB 3ARFA 2GITB 4ZMAT 1VEMA 2IFGA 4RMVA 4WHYH 3SY0A 4MZ3A 1SM3L 4CN4A 5MP6H 1ZSDB 1QSVA 3UDWA 1W8OA 1U3HD 5JIPA 4NGHH 4JJ5B 4NKIL 5IMMA 2YSSB 3U2SB 2GTWB 1MJ8H 4MJ4A 4ZQKA 1A6VH 1QLRA 2VE6B 1QO3A 4N0CC 1LHZA 4S10A 4QYOB 5FUCC 4HK3J 4OLUL 1FGNL 3FB8B 5B38B 1I8MB 1S7VA 2P5ED 2YMXL 3C9NA 2QSCL 1S7QB 3CFDB 3G6JB 4J3TA 3D69B 2VKXA 3LRSA 1F4XL 4K3DH 3A67L 3O4OB 3BFOA 4LOUD 4G6JL 3GIZH 4HS3A 5FO8B 4Z8FL 3X12B 4Z7UA 3P11L 5I8OH 3G04A 3O6LL 5JIIA 4ZG1A 1WBYA 5K9JH 3QUYB 3PE9A 5KS9A 3QDJE 5TE6L 1Q9KB 4L8DA 1VFMA 1ZA6B 1HNFA 4HUUB 2H8PB 1SJEB 3I6LD 5E95B 3RDTA 4MA7L 1XIWC 3WHXA 2F58H 3SHSA 3GSNB 2C1PA 2YRLA 2OZ4A 5GS0H 3GHEL 5IR1A 4P5TB 4UV7H 2E6JA 4IDLA 5EUKA 3WV0A 4XPHH 1JGUL 4GXVL 4QHMA 2A6KB 2UWEA 4L29A 5FB8B 1DQLH 3RA7L 3T0EB 3VXMB 5EC1A 5DVMA 5JMOC 4Y16D 1WBXB 2IPTH 4G6ML 5BZDA 2QADC 3P4MB 4HCRL 3AU1A 4PJGB 3BW9A 4D2NA 3V8OA 3RWJB 5C92A 1PLGH 2CDFB 4W4OC 1OAUL 5F7KC 2Z35B 4EN3C 2P45B 2QSQA 43CAB 1NFIA 3P9MA 4MA8L 1FO0L 2X4TA 2Y5TA 2D7PA 4WWKA 5CBAA 5EO9A 3OZ9H 4LVEA 3V0AC 1KUMA 1IAIH 1QQDA 2VDPH 3KYAA 3SCMD 5I9QB 1A14L 5INCA 1JGDA 3P4OA 4MXWL 1T20A 1T6WA 4LRIC 4Z0XA 5JQHC 3T2PA 2W0PA 3D6GA 2MSPA 4HFWA 2MNUA 4HKXA 3QIUA 4HWEH 4DOHE 1IKFL 4TNVK 5GGTL 2IMMA 3KXFE 2C3WA 4RDQG 4KI5E 2Q8AH 4KK8C 4KKCD 5JXAH 4Y2DC 4OB5H 3WHE0 3NACL 2IBZX 1Q94B 5F9AC 2FJFB 4U6VH 5F44A 3UPRA 3WS6C 1JPSL 4IRZH 2VWEC 4DTGL 1LE9B 5EOCJ 2XIDA 4BH7B 4L4VA 5CJ8A 4QXGL 2Q86A 2VXUH 3RGVA 4ZYKA 3OKEB 1AE6L 4P46A 1MF2L 1G7HA 4RFNC 1QRKA 3CMOL 2OJZL 4U1JB 5EBWA 3SDAC 1WT5C 5CSZA 2R29L 3GRWA 3NFNA 5EU3B 5EU7C 5GRYA 3S35L 3QDME 3JWDC 4NHUA 5FEBA 3FMGH 4L3EA 1CGVA 5BXFA 1A3LH 1JI2A 2VZUA 3LN4B 5E5RB 1KPUA 2AXFB 1UB6B 4M6OL 5JW4M 4XP9L 2ADIB 2XWTB 3ILQC 4BZ2L 4NNYB 1U8JB 3QHFL 3RWEB 3DVIA 3OHXB 4DCQA 2I27N 2LVEA 1KELH 5HHNA 3FCTA 3A6BL 5D6CB 2PF6A 1S7RB 1QRND 1YEEL 2P4AB 2YUXA 4QOKA 3BPOC 5I1LB 1T1WB 4GBXC 5C0CB 1A9EB 4U1LA 2G2RB 4NWUH 3IKCB 3QHTC 1K9TA 3HAEA 2XYCA 3WFEL 4HWUA 4K55A 5DJYB 3C5ZB 4KUCF 4M3JA 4A6YA 3RVXC 3V0WH 3KLSA 4G6KH 1UZ8B 1SEQL 4YHLL 1A22B 2OTWB 3DXAE 3M8OL 1F4WH 1MEXL 1R3JA 3VG0H 1KBGH 1AGBB 4EI6A 1VEOA 2ZZUT 3MLSH 5D1ZC 4XVSL 2R8SL 5GGSA 5D7LE 1LWRA 5J11B 1U91A 4JM2F 2Y06H 3U9PH 3WLWD 2H9GA 5FKAA 1UH4A 3CH8A 3ARBD 2EIBA 5C3TA 5ICYA 2QLVB 1TJGH 1QSZA 3OAUH 4X5WA 5A3IC 5JO5A 4Y4FA 1PG7L 2AJSL 5T3XH 1QNZH 1ONQA 1I8KA 4JHWL 3X11A 3KPNA 3NZHL 4LPUA 2DLTA 4UTBH 4LCWE 4Y5YB 4Z7WE 5I76B 4EBQL 1MJJA 2ZKHL 4K8RD 1YQVL 4OIAA 4NQCB 3MA9L 3GSWB 5T1MB 4DAGH 3KPQA 4RA0C 1ZLUK 4QRRB 1RAMA 5HVHB 3CCHB 5DRNB 5GGUB 1XMWA 4FP8L 1ZMYA 4XH2A 3O4OC 1FFOA 4HULB 3MNZA 1G7MA 4RQQB 5DMKA 3FO0L 4YBHA 2DYPA 4P2OB 4EDWH 5IVXA 4L5FH 4WO4B 2RFXA 2R15A 15C8H 1K4DA 1NL0L 5I16B 3GFUA 4PRHD 4KTDH 1I1AC 3PHQA 1IEBB 4LCCC 1KLUB 4XX1G 3IB4A 3L7EB 3VRJA 5F9DC 3V95A 1JGEA 2VABA 1HKFA 3QCVL 1N5AB 2CIIB 5ALCL 3MV8B 4RWHA 2I25N 1P1ZB 5AYQA 1VDGA 3ZT6A 1QSFD 4KU1A 3G6AA 3NGBB 3BSZH 3MRGB 1U8HB 3FOMA 1H3XA 4N5EA 3EW3B 1B0RB 3HPJA 3ARWA 4N0CD 4XT1C 1GSMA 3U1SH 4M7KL 3T0EC 1YYLH 5L6YL 2EDXA 1DDHA 3KYOB 1TETH 3Q2CA 4R96A 2P5WA 1AD9B 3X17A 2R0KL 1CWVA 1BVKA 4G7YL 4UNUA 4RAVB 5IBTH 5J89A 4PJ8A 4GRWB 3SN6N 4X4XB 4G8IB 1E6JH 2WP3O 3GMLA 4KAQL 4O2CB 4QTHB 5C08E 2YUZA 4X8JA 5B4MD 1MCFA 4Q9RL 1LDSA 1YEFL 2A6JA 3AXLB 5I15L 4DW2H 3QJHA 1HQ4B 2DQJL 4E5XB 3P3YA 1SVZA 3BKCH 1DBMH 5D1QB 5KSAA 5B8CB 3NMEA 5GRJL 1JIBA 4CVUA 1PX4A 3ZDZF 4GKSA 1GCFA 3WNNA 1A7NL 3WUWB 3TBWA 3G5XB 4ZTOH 4JQXC 2IWGA 5IMOB 3F7QA 4YWGL 2P1YA 1FDLL 4WNQA 4DKEL 3CIQA 4IOSD 5KTEL 1N4XH 3LKSA 2J1KA 3FQWA 4MJIE 2L4OA 1I1FA 3IGAA 1G7QA 1CGSH 3L9RB 4KFZC 3VFWA 5LWYL 1KB5B 4NPYB 4PGDB 3VXUD 2A83A 3OJ2C 3BPNC 4YFDB 1K8IB 5BRZA 2BVTA 4JPIB 1JGVL 4DGYH 4HIEB 1JHLH 1LK2B 3HG1A 4R97B 5F88A 4X4YA 3I9GL 4ZXBD 4YXLH 1L8JA 3TLRA 1T1YB 3RWDB 4JPWH 1X6LA 4PD4J 3WXVH 2DBJA 4AMKH 5JR1H 1DBBL 1H5BB 4LNVA 3U4EB 2VSCA 4UT9L 5F96L 2F19H 2VR9A 4Z77B 1KULA 2LQRA 2ZOLA 4LVNB 2KZWA 3BJ91 1G0DA 1FFQA 5CAYB 4IJ3C 2WBKA 7FABL 3CMGA 1NJ9A 4GAYB 1NGPH 1OTUC 2EIZA 4HPYH 4MJ5A 2ID5A 4D9RE 4X9IA 4PRBA 1CFQA 2AEQL 2AJ3B 4IRJA 4Y2DD 1J18A 1AIFA 1RK1A 4HKJA 3K4AA 1I9JH 4K8RH 3G5VB 4NKDB 4DZBA 5KW9H 3FB7A 1CQYA 5CP7A 5F89A 4NBYB 1WCBA 5BO1L 3DMMB 2RCSL 3QO0B 4N8PA 2G5RA 5IEKB 3ZTJG 5L7XL 1MCJA 3D1MC 4ORZC 5MEOA 4XCYB 5D2LA 4D9QE 3T1WA 1KB5L 4HZAA 3MV7E 1AD0A 4OF3A 4MQSB 1A7PH 1MWAH 3BGFB 5INDA 1FRGH 4EOWL 4JY6B 4PRDA 1MRDL 3O3EB 2VLJB 4N8CL 4M8VA 5IHLB 5EIIA 1AJ7L 4AG4L 3EYFA 4ZAKB 1RHHA 1F4YH 3IXTA 3JTSA 2CK0L 3IDNB 2ARWA 1BOGB 3ILQD 2V5YA 4YEEA 3EZ8A 3SE4C 2AQ2A 4G8GE 3O11A 3CU7A 4KKBC 1C16A 4DWHA 1HILA 2E9WA 2AXGA 2NX5B 3F7VA 5FGBA 3TCXA 3K2UH 3MRCB 2CPCA 2OSLB 4GAJL 3DGCR 3GHBL 5SWQA 2HRLA 4HS6A 4Y5YC 1KENL 4GUPA 3SQBA 1HSBB 5DMJB 3CFJA 4JVPA 1JF1B 3HUJF 5D93B 3ZO0A 2Z31C 2EH7L 2Z92A 4MDIA 2FH8A 1TPXB 2AABL 5HVHC 4KVNH 3MRHB 1VADB 4HFUH 1IVLA 5DC0A 3CAFA 2NW2B 4NZRL 4ZNEA 4MWFA 3OG4B 4OLZL 3P9WB 1UXWA 4MSWA 3PL6B 5GGVH 4P2YA 1U92B 1E28B 2Y9RT 5BS0E 3HR6A 1D6VH 4XCFH 4FQQB 4JFQB 3IFOB 3EFFA 3OKMA 3UTTE 1AO7A 2BSTB 1OB1B 4JRYE 1OP5K 5ESAB 3KPRE 1P2CA 3DIFA 2B7DT 5J13B 2H32H 2X1OA 4DJMA 2HMIC 1NGQL 4U31A 4ETYA 5TFSL 1X4ZA 4MXQA 2XN9A 4BFIB 2APWA 4F7PB 5BVPL 3NGBC 5I1IH 3RBSA 5J9PA 2CRZA 5J1AA 4MS8C 4YDVA 4G8FA 2V6HA 3RWFA 4OF7A 4JFHD 2VXQH 1BJ8A 3WFBL 1N64L 4I1NB 4JQIL 5FA3A 4P0DA 1A4JB 4P2CG 4UDUB 1A6PA 3FO9B 4XAWH 5SWSB 4JQVA 4LPCA 3T1FB 6FABH 2FX8L 3MUHL 4PREB 1SBSH 1AHWA 4PJAA 5T5FH 4E41A 4PJXF 2NY4D 5I8EA 4LU5L 4BK5A 1XGRA 3QUYD 1ZV5A 4GW1A 2XPGA 5D1QC 3QCTL 2ZNWA 5B8CC 1KCRL 3MOQA 2WANA 5CMAB 3VGHA 3QUZB 2HA1A 2PETA 3P0GB 2DLFH 2YOCA 3U7WL 1PY9A 4JR9L 2R2HA 4L1HA 1XGQA 4LRNH 4P5TD 3MRJA 3CGTA 1JNHA 5MHSE 2BJMH 3WDIA 1HWHB 3KPMA 5K9OA 1Q0XH 5D5MA 2Q8BL 3EHBC 3VXMD 3T0ED 4KDTA 1NGZA 2L0DA 2O5YL 3FFCB 4NWTL 3QG6A 2L7JA 5DK2B 5C09B 5LGHH 3IVKA 1NGWA 4X6CA 3S88L 1IILE 1T5XA 5HD8C 2SEBB 4POYA 2AEPH 3D2UA 1ORSA 4YFEA 4QRUA 2YEZA 1NAKL 5J6GA 3NFPA 3JWDH