5F1NA

Mhc complexed to 11mer peptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAPWVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYGCDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLVEPVTRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 75
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5f1nA01
3TF7A 4H1LA 3VFTB 1A7RH 1T7WA 4U1LB 5FF6A 1LO3H 1MCHA 5JR1L 1R3LB 1OTUC 4HFWA 2NLJB 4GRWH 4NM4L 3EO1A 3FMGL 3IDIB 4OCWH 4YZFF 1ROWA 3BP6A 2CGRH 1IQWH 4G8GD 4FFWC 1A7PH 4MSWB 2F8XC 4JZJC 4XRCB 4X4XA 1CT8B 3MRFB 2B7DT 4R2GD 1I8MA 3RUGB 2NY6B 2Z8VC 1NGXA 4H8WC 5TPWH 3T3MF 3B83A 5DRWA 5I1AA 2I5YL 3BYTA 3G5YA 2X4UA 2FO4B 4ZQKB 1FLTX 3GFUA 4HMCA 3DIFA 4IIQB 2YK1H 5E8EB 1RD6A 2C7UB 4QOKB 4F9LC 3VXSA 2Q8AL 4XNZB 2XA3A 3RA7H 3TZVB 3L95A 8FABA 2EDJA 4UOW0 1RIVH 3WS6A 4MVBA 1ZANH 2X9XA 2OI9B 2V9TA 4RAVB 4KJWD 3T0ED 5DUBB 3IU4L 5H8DA 2DQTH 5I9QC 4AIZB 1D5BA 4IDJH 5D7LD 1JBJA 3FOLB 3VXNA 1CDIA 3DI3B 2UUDK 1I4FA 3LQMA 4I77L 3E2HC 4OF0A 5FO7B 1I4FB 1VFMA 2ESVD 4JPWH 5CGYD 1IAII 1SJXA 4NWTL 5A2KH 4YC2B 1JCKA 1CD9B 1X5YA 4WFFD 4XBEH 4NQXB 2VERN 4ZFFA 3MGOA 4JRXB 4RDQG 5ACZB 3LV3B 4KDTA 5GSVB 4FFZL 3D0LA 1A6PA 4KJQD 5JIKA 1KN2L 1OGTB 1QFUL 1QQDB 3BP7B 4KROC 2APVA 1JUFB 3TJHC 3TO2A 1OAXL 3HNVH 4QY8B 4EDXA 4FN0A 5DJAA 4HLJA 4QXWA 4U1GC 4AG4H 1VADA 3LIZH 3QXDB 4E0RB 3P4LA 4NO5A 1FNSH 5LQBH 3CLEL 1MJJA 2FX9L 4P3CL 3QDMB 4Y8AA 1VFBB 2WK2A 3RX8A 2GJZB 2VUOA 2A6DA 4XWGL 4R0LB 5H37G 1WZLA 1MHPH 2ZCLH 4JRYD 1G7IB 1OP3H 3DX8B 2DIBA 1UZ8A 4UAOC 1GC1H 3SGEI 2QSQA 2AV1A 2VL4A 3LN9A 1U93A 3CUPB 3HRPA 1HHHB 4PJBF 5IB1A 4NYLB 1GZQA 1PG7X 2XTJD 2BVOA 1CLYL 2R1XB 4KQ3L 5KVFH 1WCQA 1A1NB 1KCSL 3QFDA 3HZMB 2QQKH 4QHUB 2R29L 3KPMA 4GG6B 5I17B 4MQ7B 5D1XD 2NX5A 4WUKH 4FFYL 5DUML 1WBYA 1OAYL 3CU1A 2ZP0T 2DQHL 3ROLB 1W8OA 4R7NB 3D18A 3S36X 4NKIL 5ICYB 5EBGA 3MLTB 4JM4L 4ZSOB 3GSVB 1F45A 4P46C 5T3XD 5J1AA 4GBXD 1FZMB 1AD0B 4JFPA 3V6OA 1MRDL 2GQHA 3WMSA 2BY1A 2P1YA 4HUMB 1J1OL 3FT3B 5FDYA 1OAUL 5A43C 5BVJA 3C60D 1X4YA 4AEHH 1RUKL 2DL2A 4R4FL 3GM0A 3NACH 1XGYL 3QUKA 1KXVC 5MENB 3VH8B 3CPLB 5F1NB 2ADJA 1NC2B 4JFDD 5CIPB 4B50A 4GKOA 2OCFD 3QO0A 4JN1L 3CK0L 4DN4L 3FO1B 3AM8C 2ADGA 2VXVL 1IGFH 2I25N 4R96B 3PQYB 3RHWF 3O4OB 4U6VL 1AE6L 1QVOA 1IC7L 2D7OA 3MXVH 3QFJB 3GSOA 1MCEA 3WFEH 3FRUB 1MHHB 4S1SH 4Y1AA 4CU8A 5D5MA 2QBWA 1Q38A 3LQAC 1I3RB 2Y07L 4JPVL 3QZWA 2AJXL 3HMXL 5JQ6H 2V2WB 2X5PA 2YA2A 4JFYB 3Q6GL 2R39A 1K5NA 5DMIL 3TCLB 5D6CB 4JO3H 1OQOA 5ADOL 4FQCH 4YFLF 5T33H 4F33A 4Y5XC 1HYSC 2YPVL 2AJVH 4P2OA 4RMTA 1UB5B 4ODVL 2PR4L 1FGNH 4L3CB 1KJ2H 1FVDA 4F7MA 1OL0A 4GFTB 1TVBB 4AH2A 2EDLA 1KYOJ 4FTVE 4XNYL 2ESVB 1Z0NA 1T03L 3IF1B 1MCPL 3C6LA 4LOUC 3CDGB 2ITCB 4XHJD 4JKMA 4L5FL 3EW3B 1NSNL 3C2AH 4YGAB 3N85L 2OR8A 4HPYH 3RVTC 3VWKC 4NUJB 5EU4A 3R1GL 2FEDD 4PRHB 2QQNH 5SWZA 3BPLC 4WW1B 5JW5A 4EI5D 5IVXF 5D7JB 4IMLA 1Q1JH 1SEBB 1NEZA 5DJDB 1Z2KA 4JFZL 4X0KA 2YD6A 3DO3A 1S7XA 1IM3B 3WYRA 4PBVC 4JHAH 1KCRH 3CSGA 5KAQG 3PWVA 2L7UA 3N0PB 4YEEA 3ARDA 4FZ8H 1T03H 3FQXB 4X6CE 3B9KD 3HC4L 3WXVH 1AO7B 3UDWC 5DYOB 2QQLL 5SV4A 4RX4D 4QLRA 4Y2DB 3GSOB 5HHNA 5TDPB 3MV9D 5IEHA 4PTTB 5E8PA 3UMTA 2EKJA 4J1UB 3IFNH 4ZPTB 1YY9D 1NAMB 3ZE2E 4XRCA 1CK0L 1G0XA 3H7LA 3L7EA 2XTJE 1FORL 4N8PA 2JB6A 1DLFH 3SDXA 5HI3D 2EIZB 1PX4A 2FJFB 3N1MC 4YPJA 5D1XC 4ZXBC 4F37F 2NW3A 5DTFB 4UU9A 4U3CA 4DEPC 2NY7L 3Q5TA 1FVCB 3E3QE 4ODSL 3Q48A 4F7EB 3AXLA 4IHOA 3IVKB 1Y6NR 4LQFL 4OCLC 4PRPB 1JTOA 3SEPA 5KSUB 1U8IB 1IM9D 1EAPA 1DDHB 4OFIA 2VDLL 2CXGA 3EYVB 5DYOA 5FUOH 3VA2C 1T22B 4Y2OA 5CEXA 4OM0L 1TCRB 2X4QB 1TZIA 2OTUB 1HSBB 4OF5A 3WUZA 3B8SA 3MV7A 1BP3B 1DVFC 4UUJB 5BO1L 4QTHA 5F8RC 2R56L 1RQ5A 3TZVC 1L4IA 1EERB 5FGBC 2EDQA 4Q9RL 4FOMA 3IETB 1F4XL 3UC0H 3DV4B 1JFQL 3D9AL 4DVBB 1CF8H 4QF1B 1V05A 1IAIM 3GJFK 1KXQE 4I3SH 1DQJA 4NKOA 3GEWB 3OAUL 4RMQA 5CP7A 4YUEH 3UEZA 3U7YL 5IVZB 4ZNEE 3CU7A 2ERJB 2NY4C 3SGEH 4N5ED 1NAKH 1G9EA 3C9NB 2MFNA 4FFYH 4Y4FC 1U3HC 2MHAA 1VKXB 1YUHB 1OSPL 3VXOB 5IHUL 4PJAB 3WHXB 1NUFA 4IMKC 1XGPA 3M1BB 1X4XA 3CH1A 2VXUH 5E8OB 3GSVA 5B3JE 1UXWB 4Z8FL 1CLYH 3ALXA 4FZEL 2VLJE 5E94B 2VRAA 4YNYB 4HKBA 1HSBA 4M5YH 1F3RB 2Z9TA 3OKYA 3ZL4L 3TBVA 2XZQL 4FQJH 2VDOH 5TE6L 5BMFH 4XX1G 2DWDA 4RISH 2VAJA 4UU9B 1DQML 4OF3A 4JRXA 1URLA 3L3GB 2ADIB 4P4KD 3KYAA 3W5NA 1S7WB 1QRNA 1KUMA 2EXYC 3LIZL 4M6NH 2FBJH 4FQ2H 4IRSC 2HKFL 1UC6A 4ZD3H 1AGBB 3EYQD 1HDMA 5LXGH 4GRWF 1DQLH 5T3ZL 4JN2A 4PJEF 4GBXC 1FZJB 4BZ1L 4CW1B 3QIWC 2GJZA 5KVMC 2X89A 4K3DL 4LDLB 1OT1A 4A6YH 3I75A 3QNXA 5DD0L 5JO5B 3MLVH 3ZKXC 4GQPH 3RQ3A 4ZMAT 5CWSB 3MLSL 5FUZH 5GQBA 2F74A 5C6WH 4DGIL 3DX8A 1TPXC 4QRUA 5HD8D 4MA8L 5DVNA 1RMFL 4NWTH 3O4LE 1QBLH 3GSXA 1AKJD 3M8OL 2HLFD 2FH8A 4BSWB 4EZMA 4KUCD 3E3QC 1UWEH 1N5AB 2MQ3A 3KPSD 1XF2A 4DVBA 2NY0C 4APQC 4G42B 3QYCA 1ZANL 4F7CA 1ES0A 1NGZA 1ODAA 3TLRA 3CX5J 3OKKA 1T5XA 2VLKE 5B21A 4PLJD 5D2NC 5JUEL 4MS8D 3NFSL 2PYED 1MREL 2QV2A 3O41A 5GS1A 5IFAH 2DDQH 5DK0B 1VESA 2CDGA 4H20H 3PGFH 1NCWL 2ITCA 3MROA 1FLRH 5IROC 4CN1A 5L2KE 3BQUB 2Y72A 3WSQL 3TM6A 4X4YB 2DAVA 4JLRA 1LE5B 1KTLB 3GMRB 2WUCH 2A9MH 2VLMD 5FO7A 5ETUA 5CD3A 1TTGA 4XC3L 3V6FA 4UAOB 3LKQA 2D7TH 4JKWA 3WN5B 1TNMA 4GAGH 5LBSL 5FECB 1UGNA 4DGYL 1P4IH 3MBEB 1ZT7A 7FABH 3WEXA 1TVBA 4Y5YA 2BXZA 4NWUL 2F9BT 1QLFB 4LCIH 4DGVL 2OXHA 4KGLA 3D87B 4Z78B 3MBXL 3ZTJG 3SJVE 1FYTB 5AWNH 1W0YT 1DQLL 5T3ZH 1JZ6A 1IRAY 3HAEB 1FJ1A 3RPKA 4OZHB 2VLJB 5HGBB 4M6NL 1EHLH 2NXYC 4D0DB 2IQ9H 1T5WB 2DLTA 5F44A 4RRPA 3V7AE 3UCRA 1RUAL 1ZHLA 4MNQA 3TVMA 3VXME 3JBG7 4NQDB 2CDEA 2Y5EA 4YE4H 1VPOL 4AIOA 3K8KA 2DQFA 3FQUA 4KJPD 5CP7B 3S34L 3VE0B 1U8JA 1QSVA 4KDWA 2H2PC 3QG7H 4LIQL 5LCVH 2BRQA 5I8EB 2BNQE 2QQQA 4XWOC 1OB1B 2I60H 5C09E 5I1LB 5L88H 5DD5H 5IHUH 5GGVL 1RZ7H 4HJGB 5JPNB 5F93C 5HYFA 3THML 2HRLA 2IC2A 1Q9KB 3U7YH 4LKXA 1M7DB 3V0AC 3L7EB 1AI1H 2IANA 2J4WH 4G6AD 2HTKC 4S1DC 3VW3H 1A14L 3CFDA 3TBVB 4ODUB 1ADQA 2EYRB 3ZYOA 1JFQH 2Z8WC 5K59E 2EDHA 4GAYB 3P9LA 4O58H 4K71B 3BPNB 1HINH 4N8VG 4CVUA 4WI3A 1R5IA 4P23C 3QCVL 4JJ5A 3B2UD 4NHUE 4K8RC 5B39B 1WFOA 2IFFL 4ZUTB 2VMFA 4NZTL 4C54A 3ETBF 1PD6A 3SGDH 4L4VB 1FG2B 1DVFB 1H8SA 3TCXA 5M95B 3C5ZB 3BMVA 2Y7QA 1U8HA 1RZKH 4HUXB 3WUWA 2HVJA 4HBCH 1HEZA 3DROB 3DSFH 3LS5L 1ERNA 4O9HH 4UINL 5INDA 1ZGLP 3F62A 3BGMB 1CICA 2FYYB 4OQTL 4K2UL 5EU5B 4G6MH 4U6YB 2W92A 4M6ML 3RWFB 4JKKA 3WIHA 2YD9A 3FT2B 1NCUA 5GGRB 1HKLH 5CJ5A 2KZWA 4J4PC 4Y4FB 2YRZA 1ZLWH 1BVKA 1MI5D 1UEMA 3MV7B 5DFWH 1FH5H 3VFVB 3DX7A 2LQRA 2IF7A 4ORGA 1CXFA 4XPHH 4LNRB 3SKOA 4X9FA 4M6OL 1WICA 2PYEA 3L5WB 1MRFL 3L3GA 1CK0H 5EN2B 3ZDXF 1I8LC 1A3RH 1MLCA 1B2WH 3TT3L 3SGKC 2VZTA 4LLWA 4MNGB 2ZWLT 1HHGB 4PIRF 4KK5D 3VGFA 2FWOB 1AFVH 3VXTA 5JLZB 1CDBA 3EDJA 4F9PA 1BGXH 4OLZL 3U4AA 4E5XB 3GHBL 4MNQE 4I4WA 4JGMA 2QADC 4V1DD 3SDYH 4LSRH 3QUXA 1BX2A 3X11B 2EIBA 4RFOL 3BP4A 3I2CL 3MV01 4O2EA 1KCRL 3HKFA 2A2QT 2BJMH 1N7MH 3NIFF 2A6KB 1T66C 1MIMH 1UM6L 2JJVA 3S6CA 4KAQH 2RGSA 2XA8L 4CN6A 2OMBA 3RU8H 4PGEB 2ERJC 3VXSD 3GO1H 1NCBH 3BE1H 3MLZL 2Q86A 5AZ2L 1D9KD 1WWCA 3QI9A 3QQ4A 5DURB 3VXQB 4NN5C 4KXZH 4MZ2A 3D3VB 4D9LH 4PRNB 3A67L 1EBPA 2XXCB 1IGYB 4L4TD 5D7LA 5JA9A 1CFTB 4APQB 4Y1AE 4JRXD 1M05A 4MB3A 3WNOA 2BXYA 3FQWA 3VXPB 4X9GA 1ZA6B 2XI9A 1AQDA 3C5JB 1DR9A 2BDNH 4EOWH 5CBAB 3QIWD 4YDJB 1MFBL 1F13A 5AYUH 5GRYA 5AAMA 4P57B 1MJ7L 3K7UA 1N5YH 3RDTC 5C7XH 4JG1L 4RQQB 4L3ED 4R4BB 4NO0A 1QFOA 1WWWX 3V6OC 3IDMA 3MV7E 3A6CL 3AUVA 1YC7A 4IIQC 1A7OL 5JORB 4NQEE 4B0MM 4IHOB 4IRZL 5EBMB 1ZT7B 5BOZG 1T0PB 3X3FL 3I6KA 2XZAH 2N7AA 4KHXH 1OGAA 4IS6A 4P2QD 1F8TL 2C4FT 4IS6B 4EQ3A 3WFEL 3S96B 4CJ1A 1AHWC 5I1HL 4Z7UE 1EO5A 3CMOL 1GGTA 3ZO0A 3QG6B 2PCPB 2XWJB 5FO9B 3VJ6A 5A16B 1KPUB 2FGWL 4U7KA 1N2RB 2B2XH 5IHZB 4DKFH 4GG8A 4QYOB 3VG9C 1RV6X 2MOVA 1W0WB 3MRPA 3V52H 1S7VB 2DJUA 3OZ9H 3P2TA 4WWKD 4YBQC 4CN4A 4QWWC 4FA8A 1ORQB 1QEWB 1IGCH 1IEHA 2NY5L 4MWFB 2PYFB 5L8LB 5A3IC 2X1WL 5D1QC 4BQ9A 3C08L 3HE7D 3LKRA 3LRSA 4OUOA 3ZE1F 4IRSB 1XGQB 2OZ4A 1KTDB 1QO3B 2I07B 1QRNE 1ZVYA 3BD5A 5CILH 3RVTD 1H3PH 1BJMA 5KANI 1G1YA 4JFHE 1NEUA 1DQDL 3ARXA 2XWTA 5DUMH 1MCSA 4GRLA 4KKLC 4OB5L 4NJ9H 1J05B 3CX5K 4XMKL 4XMPH 4M48L 1IAOB 2E7MA 5JZ7C 4JFXB 1QFWH 2B8OT 4WDIB 1SYSA 2DN7A 3BSZL 4QKXB 3E2HB 4LGPB 5JORA 2H2PD 3LQZA 5GGTH 3MX0A 1HSAB 5HHOA 4X7TB 2R23A 4YXLH 5I71B 3HS0A 2QSTA 3HNTH 1U58A 2XY2A 1W2KT 1I3GL 2JJTA 1A0QH 4FS0A 5CZKA 4YHML 3DX6B 1MWAH 2PF6A 3ARGA 1TMCB 1KGCE 2ADFH 1ZHNB 4ISVB 3OX8B 3H9SE 3IB4A 2A0LC 1OF2B 4CU6A 2F8OA 2MQCA 3BRGC 1QFUH 3CGTA 3DMMA 4XTRD 1G84A 4FTVA 3O3AB 4I0PA 4NBYB 4FFZH 4KU1A 5CCKH 5JOFB 5KG9B 4NRXA 4XBGB 5I1DA 3DBXA 3QH3B 5CBEA 2HTLC 1IM3A 4UTBL 1A6WL 3SE8H 4JPWL 5E1AB 3RHWK 4PRID 1BZ9A 1T1ZA 1KG0A 3QIUA 5AYQA 1MRCH 4WWKB 5AUMA 1UJTA 3IXTA 4O9HL 3D69B 4ZNEA 3O4OC 5IFJA 2FEEI 1EGJA 4XAWL 5ADPL 5EUOA 5I1KL 4HC1H 3A6BL 5D7JD 1DDHA 1INDL 4JDTL 3GNMH 3VFSB 4ZTOL 4O51A 4PJCE 3IFLH 3SJVA 3AS3A 3H9SB 4HXAL 4PJCA 1AD0A 3PABB 1M7DA 6FABH 1TDQA 2NXYB 4PJDA 1ZV5A 4QHKJ 4ZFFB 1JNLH 4W4OA 4P2QB 1FNAA 1WT5A 2FJFA 4HT1H 1GAFH 4P2QA 4CUCA 3ARDD 2AV7B 1TQBC 3LQZB 4LLDA 2Y25A 3LY6A 2CKBL 3LH2H 1JE6A 5GZOD 5GGVH 3IDYB 5A2LH 2A9NH 2CJUL 3G9AB 3HUJE 3KXFA 5H35A 2GTZB 1J8HA 2APXA 1CDJA 4NM4H 4NKDA 1NUDA 2P5ED 4HMEA 1A7RL 5DQ9B 1G6RL 2YA0A 3VFWA 3QA3B 1AD9B 1RZFH 3PHSA 4H26A 5D72L 3FFDB 3LZFH 1SVZA 4ZFZA 4FMKA 4K55A 4K71C 4X6CA 4YLQT 3HE7C 4LSVL 1S7UB 3GRWL 4TUOA 3GDBA 5DRXA 1SYVA 1U3JA 2YC1B 1AR1C 3HMWH 3MYJB 2P44B 1IGIL 3GHEH 3LPGA 3VU2A 5ISZB 3RP1A 3H3PL 1HXMA 2CK0L 1PZUB 4M9OA 3S8WA 3ZKQD 3PDGA 3EYUH 3DHJA 4JG1H 2FEDC 4X8JB 3RUGE 4RX4A 5FHBL 2HFEA 5IVXB 5MERB 3I75B 2ZJSH 1YN7A 2BVQA 3JV0A 2BNRD 1NCAH 4LAJH 1NPUA 1J86A 4OBRA 4ZXBB 1CFSA 2IADB 2BOBB 1QOKA 4HC1A 4LCYA 4RFEB 5I1EL 2X1QA 2P45B 3O3UN 3R0NA 1BVLA 3QWRA 2PKDA 4OBSA 4F8QA 5CMAA 5KVDL 1KIPB 5EIIA 2O5YH 1Z5LA 3JVGC 2E8ZA 4Y8DC 1OP5H 3D3VA 5JHDD 2DL9A 5D1QA 3UTTE 4JZJA 3G6JA 1CICB 1VFOA 4N0YL 3LSOA 5EIQA 5D1QB 2BNUA 1YEEH 3AY4A 1OAKL 3EOAB 4JQVC 3TJEH 2LV4A 4GXVL 4MSWA 1LO4H 3FZUC 4ZUVA 1OGAD 4RFOH 3O3BA 4I2XB 3BEVA 2J5LC 1RVFL 4WW2A 5BV7B 2F19H 1KEML 4PLKD 4RBPH 4DGIH 1IVLA 3MNVA 5HYIA 1FYTD 3UBXI 5I16B 1OW0A 3U4BH 3ROOA 1SYSB 1WWAX 4K3DH 4A6YL 2EEBA 5ALCH 5I30H 1HZHH 4NQTA 3W5MA 1O7SA 5CGTA 3T77B 3ECBB 2DM4A 4XAKE 5CEZH 4P0DA 2WQ8A 2FBJL 4WV1C 2R2EA 4XPHL 2XTLA 4E42B 1FL6B 5I1GL 5EO1B 1T1YA 2FJGB 4OCSL 1YZZA 3HHRB 3ESUF 4ZO7A 1X5JA 3TO4A 2WLZA 1AJ7H 4E5XA 2GTWB 5F9JA 4F15C 3PP3H 5HHMB 1FH5L 5C9KA 5CJXA 3ZE0F 5DD6B 4FHBD 4UT9H 4X6FA 4J6RL 4FQJL 4LLUB 5TE6H 5BMFL 3TV3L 4KK8D 4Z95L 4MJID 3V0WH 1G9NH 3OAYK 2DB8A 4GOSA 1NC4D 3FOMB 3IS1X 3T04D 3GSNH 3RZCA 3QJFA 4HULB 4TN9A 2ZOKB 1MWAB 1T7XA 4LPYA 3V4PH 3KXFD 3PNWA 5JZ7D 4YDVB 1Z0MA 2FZ3A 3BVNA 4OZGA 4R6UA 5FYKE 4EUPA 2ICEB 1KLFA 1OSPH 1WTGT 4UNVA 4QF1A 4PJAF 2R69L 1IGIH 3GHEL 1MJJB 3QUMB 2A1WL 2ICES 3JWOL 3TN0A 4O58L 1C5DA 4JR9L 5JMRA 2NY3B 1GRWA 4LAQL 2DWEB 1F6AA 1OLZA 3VW3L 3DURB 1EHNA 4I0KA 5J13C 3P0VL 5A2IH 5D72H 3VDAA 1J1XL 3ZT5A 3B3IA 4ZYKA 2DM7A 1KLUA 4KVNL 5D7KD 3UTSE 3NOIA 3HA0A 4S2SA 4PRAB 4XP6L 1JGVH 3K46A 5MENA 5SX4H 2B0SH 4UQ2A 4F9PC 4ZAKA 3GMLA 3BKYL 5GRZA 4Y4HB 3E2HA 3KWWB 2GCYA 4U1SB 3DSNA 4NOFA 4MQXC 5KSUA 1D6EB 2G5RA 2VLME 5C0ND 1D6EA 1OWRM 4Y7MA 3DLQR 1T1YB 2FJGA 3I50H 4LK4A 4TUKL 4U1JA 5J57B 5AEAA 1UB6A 4Z7VE 4M5ZL 4J7RA 4DN3L 3WJLA 3QPXL 1DLFL 4ZUSB 1ZS8B 6FABL 4H88H 3CFBA 4KTEH 5CEYB 1MFEH 3E0GA 4XBGA 5L9DL 3GSXB 4HXAH 1IAIL 4MVBC 1X7QB 3SJVD 3WS6C 4PJBA 1QEWA 2VQ1B 2IG2H 5GHWL 1XAUA 5FV2A 3ULVH 1T89C 3A6BH 3ARDC 4R7DA 4YHPB 5I8OL 1A47A 1ZLVH 2BSSB 4HIJB 2B39A 2M2DA 4CADA 1X4ZA 3EOAA 3BGMA 1MRCL 4Y5VB 3RWEB 5KSAD 1MY7A 3KDMB 2P5WD 4U0QB 1QUNA 1A6WH 4KMLB 4JFZH 4PRPD 1IGJA 3TBTB 5BRZE 3VGEA 1TQBB 5KN5A 4QHLA 4ODWA 5E7BA 5C07D 1ZAGA 5A3ID 1NANH 1FLRL 5DEGA 4LVEA 4Y16B 1ZWIA 3MRCA 4BQ8A 3O3DA 4GW4B 4YHOL 4G43A 4NN7C 5ENWB 1EVTC 2DDQL 4WDIA 2IADA 4LP4A 2K1MA 1F02I 3ARFB 2ED8A 3GSWB 2B4CL 1NGQH 1KT2A 3WLBA 2UZIH 1MCPH 2EYTB 2WINA 4QEGA 4L9LC 3D25A 3KJ4C 4D0BB 3VFPA 1NLDL 1QBML 1FL5A 5JOPD 1J11A 1QSFE 5LGKA 1KJ2L 4U2YA 2XNAB 1PX3A 5HGHB 2BOCA 1WZ1H 5E8PB 3BO8B 2P8PA 4KRLB 3PGDA 4FQCL 3RIAK 2WWMC 5I0ZA 1QFWL 4H0HB 1T0NB 4V3EB 1TJHH 1T7YA 3IU3B 5T3ZE 2AJXH 4I0PB 5JQ6L 1CDCA 4NJ9L 4M02A 1G7MA 5EFIA 3STZA 5ESAB 4LMQE 3G5YB 4ZD3L 1H3WM 3EFFA 5C0EA 4XPAL 5DS8A 4JO1H 3B2VH 4OCYL 1YNTA 4HGWB 4JG0H 4LDEB 4NNYB 4URTB 1K8DA 4DK3A 4K94H 5DEFB 4Z7VA 3Q5YA 2JB5H 2FHFA 1I8LA 3NAAH 1NFDA 3B6SA 4FABL 2AXFB 4N90D 3RGVD 5IW6B 3CK0H 3MRLA 4DN4H 3S4SA 1SJVA 5I9QB 3U0TB 3F5WB 1HILA 3UYRL 2GYSA 2HTLD 4S10A 5FGRA 1CWVA 2Z93A 3UZQA 2Z31B 4YHKH 4LLVB 5D71L 2Z93B 3P73B 1FE8H 3D3VD 3OXSA 4K7PH 1J1OH 5DJ8A 4J4PA 3O6ML 1S3KH 2PXYD 3O2DH 1YEGL 4NSKB 4Z0XA 4JJ5B 4PLKC 1T6VN 4DN3H 4JM4H 5I2IB 1QQDA 1IEAA 3ARWA 4I3SL 4L4TA 3BW9A 5TDNA 5EWIL 1UWXH 2ARJA 3BAEL 1KJMA 3CDFA 4K9EH 3MREA 5HPMA 1F4XH 3KHQA 3U82B 4JFDA 1TJIL 3L3OA 1XGQA 4G8IB 4APQA 2A6IB 1YEIH 1G1CA 3BDYL 5E03A 2XIDA 4WI5A 3S97C 2BY0A 1G7IA 1M7XA 1T83A 4MJ5A 1D5BB 2V2XA 3RUGF 3HR5B 1YEKL 3QQNA 4WVRA 1U93B 3AMLA 1CCZA 3EO0A 3HZYB 2VZOA 3VXMA 5CEYA 3MRNA 1DE4A 5F9OL 2ZUVA 5FUOL 4V1DE 4XT1C 2XG5A 1RZGB 5HD8C 1ZLVK 4NPYB 2Y6SD 2XZZA 4H1LH 4LLYB 2QSVA 5LQBL 4JGUA 3MRBA 4LU5H 4OTXL 2C4FU 4BKLA 4PG2C 4ODSH 5HSFA 4D9LL 3F6IA 2AXHA 5GZOC 3O11A 1T7ZA 3CFCL 1FZMA 3DX6A 3DETC 4U2ZA 1IKNA 5D2LE 2X1XR 3EHBC 1T22A 3G6JE 4HH8A 5MEPB 1WV7T 5I66B 4JDZA 2IBBA 2VE6B 1ZT4B 2HFFB 2XA8H 4AIXA 5J12C 5LGJA 1ZSDA 3C6LD 1QFWM 2HP4A 4LEXL 1KOAA 2F5BL 2W0FA 1UACH 1CFSB 2V5YA 4BSWA 1JHTB 2DQTL 4L3EA 1XCQA 4Z95H 1NMBL 5E8NA 2I9LB 5FGCE 4L3EE 3EYFA 3WKNA 1SBSL 3TPUA 3LKRB 4ALAH 1T2QL 2NX5D 1KTRL 2BSSA 4LCWD 3BPOB 4Z7WE 3QHZH 4BFBD 4ZO6A 4NKDB 4OCSH 3U46B 1UQSB 3QFJA 3LSOB 2A6DB 4J1UA 3HAEA 4RRPG 4BH7A 1XGUB 1P9MA 1IKFH 1T20A 4NGHH 2IH1A 1JIBA 2NY0D 4X7SH 3AB0C 1JGLL 3O3AA 4X6CB 4XNQA 5BVPL 1NCDH 3G5VA 3T3ME 3MYZA 3RI5K 4PB9L 5LWYL 1S78D 4G6ML 5DK2A 4Y19B 3BT2H 3T0XA 1FCCA 3DETD 2CLVA 3AROA 4WTZA 1S7QA 5DJ6B 2BK8A 1KENL 3TJEL 5JMOC 3MLTA 3PXHA 1H3VA 4NRYA 4J2XA 1DEDA 4M7ZC 4PP8C 2AKRA 2IFFH 5CIPH 3CIQA 3QWOB 3NCCB 4NN6C 2C3XA 3P4NA 2GK0B 4CDGC 1P4BL 2H3NA 5FEBA 3MRQA 3FB7B 4S0TD 3KPLA 2ED9A 2E7BA 4MXWL 4U33A 4JFYA 2YD4A 3MA7A 5I1EH 3GIZL 1OP3K 3FZUD 5CHNA 5HDLA 4MNQB 5CSZA 1HHHA 3LKSB 5CFHA 5K9OB 1NCAL 4ZQKA 1N5AA 3OXRA 4Y5VC 1M71A 4PG9A 5IB4A 4FQHB 1L9MA 3RZCC 5K33A 1T3FB 3UDWA 4I3RH 4H5SA 4PJDE 3V5HA 1AXTH 1T3FA 1MJ8L 2EO1A 2F5AH 3LB6C 4IRSA 5HHNB 3RWGB 5I74C 1YEFL 3OHXA 3IKKA 1M05B 3QEQB 3NACL 4JHBA 4R4FH 5ESQB 3CH1B 5E8OA 4OFKA 3TO4C 4F57L 2V17H 2NXZB 5GJSL 3RWDB 5FO8A 1PVHA 3F58L 1Z9MA 1R6VA 1JP5A 1RUAH 1PDKA 3MJ7A 3BI9X 2YZ1A 4RDQF 3GMNB 4QT5A 4HK3J 3QUXB 4OI7A 2Q76A 2FIKA 2EC9T 2FO1A 2RCSL 4LCWB 5E6IB 3H7BB 3L3KA 3UP1A 2EZ0D 3L3HB 1SJHB 3P77A 2VH5L 3WN5A 2DLFH 3OKOA 3LZFL 4EUPG 4ODHH 2C1OB 5D93C 1FFNA 5J3HD 4P5KB 4PGBB 1FFNB 4WTXA 1I7RA 1PYWA 1BBJB 5KOVC 5IV2B 3ISWA 4Z7VB 2EYTA 3PP4L 5I1LA 4K3GA 5C8JB 4Z6AT 1PAMA 3GKWL 3ZKMC 2CRIA 1UXSB 4NCC2 3C6LB 3EDKA 4HUNB 1G7JB 5C8JA 4D0CB 4JFEA 1QHOA 2OZ4L 3HNSL 4X8JA 2WWKO 4HUUB 5GISL 2VXQH 3B2UC 5DJYB 3FB8B 3JWOC 1QYGL 5EC1B 5D7IF 4ODXA 2L4OA 5IMOA 4XVTL 3C6SB 4P57A 3AC0A 1MCLA 2FIKB 2YA1A 5C3LD 2HTKD 1HXYA 3V4VL 4NN7B 1EJOH 4XP9H 4M1CD 3T65B 3OGCA 3QBTB 3QFDB 4YGVA 4U6TA 3T1FA 3T65A 3OJ2C 4EEEA 3F65A 4Q9QH 4RZCB 1E4XH 1CR9H 5I15L 4QRQB 1RUQL 4WTZG 1NGPH 5DMGD 2XPGB 4PJEB 4PRNA 4R2GB 4J4PD 1BM3L 2Y4SA 2X1OA 1A7NL 4JFFE 1FIGL 3G6AB 4HDIA 4L8BB 4XAWH 2E9WA 5ITFA 3WIFA 5IW3A 2P43B 2ARWA 5HHMA 4QCIB 3P11L 3MA9H 1YEDA 4WFHE 4LIQE 3CFDB 1OARL 5TE7L 3U36A 5HI5D 3BUTA 5CJ8A 2K7PA 3MLVL 1MJUH 1K4CB 3HPLB 3MLYL 1RIVL 1ORSA 2QJDA 3TFKA 1MFCH 1K6QL 5CAYB 3Q6FB 2X1PA 4JQXA 5I1JL 3U0PA 3HG1D 2WLYA 4PJXF 3VFNA 2FWOA 2E27H 4NRYB 2UY7A 5EULV 5HHXH 2R2EB 4JFDE 4G6AC 4IOIA 2FR4B 1VA9A 4AZ8A 3SO3B 1MWAL 3PF2A 2NY4D 3VXOA 1PZ5A 4QXGL 2DF3A 3OG4B 1CXHA 3UPRA 3VRIA 5K9KB 1WBXA 4QRTA 1A22B 4PTTA 2DMCA 3FQNB 2CIKA 3FN0H 4IOFC 4GW1A 2HT2D 2R1XA 4GXUN 5KJRL 3VGDA 5CJOL 3WXWH 4PRDA 1KN4L 1MCOL 1JYXA 4X80L 4KRPC 4LPWA 3X3GL 1UM4H 5F9DC 1XIWA 3LMJL 4YAQA 4I2XE 3OR6B 3WKML 3QWRD 1UH2A 2E9BA 1DBKH 1BQUA 1C8PA 1CF8L 5IMMA 3SDAC 2AXJA 2MMXA 3LKPB 4Z77A 4PPTA 1BF2A 4BH8B 3VXUA 4Q9RH 5FFLA 1ZHNA 3FO0L 4ISVA 5JHDE 2VOTA 4LARH 3PUCA 3VH8G 5MEPA 2HFTA 4G6JH 2CIKB 5IR1A 3F6LA 3MLWL 4XBPA 3QFJD 5ACZA 4TRPH 1I9RL 4WW2C 4FP8H 5IOPB 1NC2A 4XP1L 1RU9H 4UI2A 4KMTH 1AKJA 3I3BA 2BVOB 1MJ8H 2F5AL 3FONA 4HPOL 4ODTH 1JWSB 5GRVL 4WGVB 2Q7YA 3H0TA 5FYLL 2YN3A 1B4JL 4NKQB 4YAQB 5F7EL 4O4YL 5DMYA 5LKNA 5TQ2L 1U8NA 3V2AR 1JGEA 1I9JL 5KS9A 1YEJL 4V1DB 1MCCA 1I7TA 2NPLX 1OWWA 3DUUA 4G7VH 2XZAL 4AQ1B 3RWDA 5FO8B 4N9GB 5ABDE 2ENSA 1KIUA 4MA1C 5T5FL 5K59F 4GW1B 5GJTL 4P48A 2WAHA 4RGNE 4XPFH 4BM7A 1DE4B 3IFPA 3L6FA 3Q1SL 1RURL 2YWYA 3GBLA 4NRXB 2EDRA 2DYPD 3PWJB 2DKMA 1N5YL 1NC4A 5IFHH 4UBDC 1JWMB 4QRRA 2IBZY 4GKNA 4MCZA 4QGTA 4PJGA 1S7WA 3W2DL 3CC5B 2G75B 3QJHB 5D8JL 4FZ8L 1U6AL 1R3LA 2FH6A 4X83A 2D7PA 4M7JH 1ZHBB 3AS1A 4GUPB 3MXWH 2ZOLB 3UTPE 3VD3A 5SX5K 1E6OL 1K2DA 3QG6A 1I8IB 1VFAA 2YR3A 3SE3A 3KG5A 3U36B 3MODH 3BE1L 3QDGE 3QUZB 4OD1L 3PJSB 1A7BA 1R5IB 2VC2L 5KVEL 4YBLB 1ZLUK 3ULUH 4YPGB 3N06B 1MIML 5D6CA 5I1AB 5F7LB 4Y4HD 2YKLH 3EYSL 4HGKC 3RVVC 1DEEB 3QDHA 4ZFGH 2CRZA 5HYJE 2MJWA 5DR5H 1KJVA 1G9MC 5HYJA 2NXZC 3MTRA 2P5WA 5H94A 1IGYA 4J3WA 5MHSE 1A3LH 1IC4L 4DFHA 4PJEE 1WFNA 3TWCL 3VRJB 3QQ9D 5BZDA 5EPMB 3N1FC 4HSQA 2P42B 3TT3H 2VABB 4CBPA 4JKLA 4Y4FD 2QHRL 4FXGA 3PWUA 1J0ZA 5DLML 5IMOB 5INCA 2AJZB 5C9JA 1IE5A 2AAVA 1YN7B 3BP5B 3U48A 3QIBD 4N1EA 2ARJQ 3I85A 3RVUD 3T0EA 1I9EA 5C3TA 3QXAA 3KYKH 4CMMB 4UT6L 5I18H 4M7JL 1G6RB 4E9LA 5LJYH 3VD5A 4NQCD 5DVLA 4AM0A 1N4XL 1A6VL 1AGBA 5IV2A 1FL6A 1U58B 4U1HB 4IOIB 4E41A 4HUKB 5F6HI 4JN1H 2GJ6B 1R5WA 4Y4KC 3U4EB 3BEWB 3F5WA 2BVPA 1FFQA 5DMJB 3EO1B 5JHLL 4XCNA 4AEFA 5E5MA 4HWBA 3JTTB 1RZKL 4K7FA 4G8GB 2XKNB 4HKJB 3G5ZA 4G6FD 2VZSA 4NZTH 3Q2CA 4LMQI 4QRRE 3HLAA 1W72A 3UTQB 1GPOL 4LKCA 1ACYH 4IMKA 5E6IC 1CFNB 5JOPE 1DL7L 3ARFC 3ABZA 2NNAA 2AGJL 1ZHLB 2EH8L 4ONFL 4YXKH 1OD9A 2EECA 2NTFA 4A2MA 2YD7A 4H0GA 2V7HA 5TE4L 4JZOB 1A6UH 3QDMD 5L2KD 1U8KA 2QLVB 5J6GB 4F2MB 1CDGA 4OLWH 3RGVA 4P59L 5AUMB 4WO4B 3V5HB 4EJ1C 1EIBA 4NQVB 1FZJA 1EAJA 1UM5L 5HYQB 3O41B 2J12B 1MHCA 4NC2B 4F7TA 5EU6E 2UWEA 1EGJH 1MCFA 5DQJA 5KAQF 5IGXL 3HR5A 1DUZB 1QR1B 1RU9L 3O8XD 4XP1H 4LASH 2VE6A 1T4KA 3MQIA 2Z4QB 3DECA 4PGDB 1VPOH 2BVUA 3OAZK 1JYNA 5EOTA 3SCMA 3QB7C 3V0VB 1JPGA 3NAAL 3R8QA 3JV5A 3EDFA 2IQ9L 4JG0L 1REIA 5IQ7L 1E4WH 3CVHH 4OZFB 2A77L 1VEPA 1OP9A 3LRGA 1KCVL 1BFOB 3RPIB 5HPOA 5FCUL 3E3QA 1IARB 2OQJA 1Q0YL 4JN2B 4YWGL 4DQOL 1RY7B 2H41A 3K2MC 1EO8H 3J7HA 4N1HB 3C5SA 4CNIA 1UVQA 1MCOH 3PWPE 4DWHA 1RZJH 1Q8MA 5KJRH 4I1NB 1P4IL 1AXSB 4I77H 3NA4A 4GSDH 3P30H 2R4SL 5I16A 4X98A 3ARZA 3TIDB 4ENED 4J8RB 3DMMD 1G6VK 4F2MA 1Z5LB 4PJEA 4TVPE 2DQGL 3QEQA 3CLFH 4QY8A 1AIFB 2GEEA 4EDXB 1HH6B 3PWPB 4YHOH 5E00B 2BRRH 2J6EH 1PSKL 5JXEA 5GS0C 2IEPA 4WUUA 3SDXF 1M6OB 3MOAH 3TGXA 2EDYA 2IJ0C 4U1NB 1J0YA 5IEKA 5LVEA 1H3UA 2HH0L 3V6FB 3N1GC 3WNKA 3UBXG 4OF6A 1XF3B 3WO4C 4XNUH 2Y06H 2NY1D 4LQ1A 4NNXB 4UQ2B 5D96C 1NJ9A 2R1YA 2VZVA 3FL7A 1JWMA 3IJHB 4MA8H 3QULB 3D39D 5BS0D 1JFMA 3MLUH 3MLSH 5FUZL 3MUHL 3I3DA 3DNKA 4XZUA 4EDWL 4L9DA 4L1HA 4MQ7A 4BQCA 4E42A 1NLBH 3LRSB 3OPZL 1PEZA 1LHZA 3RWCB 2OSLB 3ARUA 2G60L 1Y18A 2EXYD 3DUUB 2JJSA 4FQ1H 4XNMB 4KY1L 2PW1A 5GGRA 3V95A 1J8HD 1I7TB 4M5ZH 1XGUA 5IP4A 1NMAL 5E4EC 5F3BB 5CD5D 1T5WA 4ZUUA 25C8H 1K5NB 1U2CA 3EO0B 4IBLT 3VXMB 5KG9A 5KTEH 4IMLB 1NKRA 4Z18A 2QEJA 3TBSB 3GRWA 2FZ3B 3BVNB 2VXQL 4FQLL 1JPTL 3SDDD 1I7UA 5C86A 2Y7QB 2R2HB 4XH2B 4ZOEA 4HWBH 4OLVH 1Q9WB 4DTGH 3PWNA 3I9GH 3AAZB 5JXEC 4Y2DA 5EBWA 4HS8H 3WE6B 1FVEA 1YDPA 1HN1A 2O5XL 2KBGA 1UJ3A 4F7PB 4MX7A 2XN9D 2AEPL 2NX5E 1A1MA 1BD2B 2O26U 4YBLC 2VLKA 1HQ4B 1XGRA 3RKDD 2YHGA 3RKPA 3HFMH 1L7IH 3OXSB 2PXYC 3PHQA 3E6FB 3IDNA 4YXKL 1BFTA 2UZXB 3SQBA 4DAGL 1L7IL 3D0LB 2W0FB 3JWOH 4LLDB 3PDOA 4Z7QF 3V7MA 5FECA 5DMKA 4XGZA 4WW1A 4LCUA 3WHE0 1CDYA 3LDBC 5BO1H 1ZHKA 1KB5B 3OSKA 3IS0X 3GM8A 1SVCP 2GCYB 4U1SA 3VWJD 2AEPH 1JGDB 2BHUA 5ID0B 3X17A 3OKNA 1X5FA 3V8CA 4G59A 5ID1B 4Z76B 1ONQA 1FYHB 2C4XA 1FPTH 2P49B 3DOSA 2F53B 4DTGL 1DANU 4OLVL 3BKJH 4RSVA 2VABA 3UJIH 4QNPF 5FM5M 2X4NB 3BIKA 5DHYA 1QSEA 3MRFA 3DMMB 3W0WB 3IU3A 4Q7DA 1KFAH 4HW6A 5KTEL 1LQVA 25C8L 3SDCA 1IFHH 2BNRE 1CZ8H 4L4VD 3O8XB 1YYMH 3LKNA 3ULSA 1E4JA 1KB5L 5FYJH 2H9GA 4MAUL 2NY0B 1U8QA 2EDDA 3BZDA 5HDBE 3HUJB 5DZNA 5I30L 3K80A 5I2IA 3WS3B 4MNGA 5IB5B 3IFNL 1EMTL 4MVBD 4OF7A 1F4YH 4KC3B 4BFIA 4RAUA 3TWCH 2CD0A 2P8LA 3BYYA 4OV5A 3K1DA 1GZPA 3QXTA 3CDGA 3KLAB 4MX7B 4KJPC 1VEOA 4CVXB 5CEXB 3S9DB 5LWYH 2C5DC 4D9RD 5MI0B 2GFBA 5IIEA 1OGAE 3VRLE 3W0WE 4TNVF 5E99L 3SE9L 3IDMB 1VACB 4QHMB 1KF9B 5JDSB 4TVPH 3SDXB 1DN2A 1KV3A 1M7IB 2XQYG 4BYHA 3IKCB 4WO4C 1PKQA 3Q0HA 5HJ3B 1BREA 2QQNL 3I6LE 3W11D 3EOTH 1S7UA 4RZCA 3H6JA 3MUZ1 3EYQC 3T0DA 5EUOE 2R4RH 3BESR 5C6PB 4JFEE 5IVZA 2OX5A 5DD1H 4N68A 4KMQA 2DJ4A 1AGDB 2OP4H 2YN5A 4ACPA 3D18B 3IFOA 2XACC 1YMMD 5D2LA 1YUHA 5HHMD 1BZ7B 3CZFB 5DQJB 3T0VA 4C55A 1NMBH 1TZHA 3WDHA 5DT1H 5J1SC 4F7TB 2IPUK 2ZJSL 3RDTA 5FHBH 2VDPL 5KSBE 5IFHL 4WHCA 5E2VL 1IL1A 2AJVL 2VIRB 3CFEA 3O3EA 2AK4B 2PW2B 4NQXA 3KPPA 4JRYB 2Q3AA 5DGQA 4N0FA 3B9AA 4QTHB 2Y5TB 5T1KA 1M7IA 3O4LB 3S98A 2GUOA 1T6WA 2JLLA 4KRMB 5FGSA 2W38A 3T08A 2X6MA 1Q0YH 2OJEB 4YWGH 4PJHA 4NQEB 2H26A 1BFOA 3IF1A 2WP3T 1UWGH 1DBAH 1D3CA 4HIEA 2EDBA 3BKMH 3CVHL 3EYVA 1JHLH 5E5RB 5D7LE 1HQ4A 1XGRB 4IJ3C 5JXAH 3WFHB 4PUBL 4OZIF 3ARGC 5IBLD 1RZFL 5DA0B 2ZG1A 3O3BB 4I2XA 4OI9A 2CIIA 5FYLE 1KGCD 1ZGLB 1MAML 2D7QA 5BJTB 4P9ML 4YDIH 4C59B 4QHNB 1I1FB 1YEKH 1KPVA 4NYLA 1GCFA 1OAUH 1DFBL 4OGXH 3VGGA 4XNZC 3QIWA 1CVRA 1X44A 1AR2A 4JDVA 4JPIA 3BHBA 1J0JA 3B8YA 12E8L 4NFBA 5BV7H 4NQVA 2YWZA 1CD1A 3MACL 3SO3C 4ELMB 3JTSA 1JRHL 5DVOA 1KELH 2Z8RA 1BQHG 2NCMA 4AQOA 1OF2A 3KPRD 1A6UL 1QSEE 1BOGA 2AEIT 2PW1B 4PJFF 4NNPL 2E9JA 3P0YH 4N9GA 1DL7H 3ILQC 5F97E 5FO9A 1U9KA 4U6HB 3ARED 5MERA 1A9EB 5CD3B 3T0WA 5CWSA 5HVWA 4N5UA 3ZTNL 3UTZA 1LDPL 4WEMB 4OJFL 4JVWA 2DKSA 4QYOA 3WEXB 5C0CB 3UYOD 5BVJB 4G9FD 2C1PA 5IJKC 4P2OD 1GHFH 1YYLH 2BCKB 3MLXL 4KHTL 5BRZB 4LCCB 5CIPA 4G8FB 3CPLA 1CICC 1OOAA 1NJ9B 1I7RB 1PYWB 1U3ZA 1OVZA 1RHHA 5E1HB 5C08D 4D0BA 2EYSB 3VFNB 4K94L 4QXGH 2FX9H 5IBLC 1R5WB 3U4EA 1MFAH 4DVRL 5CP3A 3T2QA 4DCQA 3CZJA 2E27L 3HNVL 4WCYL 4JFFB 4PLOB 2LE9A 2DYPA 1QSFA 4P49A 3CXDH 4X9HA 3UAJC 3VCLB 1ZVSB 2CMRH 2FECL 3C8KA 4M1DH 2JJUA 1A5FH 1XF4A 4LLQA 1OTSD 2HG5A 2O5ZL 4HCRL 3ARDB 4YC2C 4U7SA 1LQSR 5GXBB 3F8UB 3S5LA 3PWNB 1EEUA 3BHBB 2JJSC 4JM2D 2V2TA 3VFMA 1MVUB 4O5LH 1S9VA 1T5XB 2K3TA 2QR0A 3S37H 5L0QC 3SY0B 3BZ4A 3GMPA 3SY0A 2UZIL 3FHQA 1LDPH 4K9EC 4DW2L 2ZSVB 4M48H 3HPJB 2YUVA 1LE9A 1CGWA 1CGUA 4UT7L 4U1GB 4X6DB 3EFDH 4WU7B 4R26L 2AJYL 5KSVB 1KJ3L 2EH7L 3RVXD 3VWJB 4POZD 5EU3A 5EC1A 1QPPA 4POYA 5C09B 3HR6A 1RJYB 3CCHB 4XVTH 1BVZA 3MACH 3OAYH 1U42A 3UTTD 1L7TL 3ZHLA 4B7LA 12E8H 2X70B 4TUJB 1NBYB 3D25B 1QKZH 1OD7A 1JL8A 1QYGH 3U0PB 2PNDA 4OGXL 4ZSOE 3LN4A 4RWHA 3FFCA 4Y89A 3R06B 5MEQA 3WFBL 1A3QA 4J3SA 5HI3C 4PJ5B 2IG2L 1S9YB 2ORBH 3LQAL 3FQWB 3VXPA 4YFEA 4ELME 4PGJA 2Q7NA 2IPTH 4PYGA 3KYNA 5KW9L 4UIMB 1J0KA 3TBTA 2GSGA 5B38B 2APTA 4ZFZB 3VG9B 5JOEA 5DJCA 2DMKA 1FYTE 3W11C 2VIRA 1RUML 3CFEB 3O3EB 4G8GE 1A1NA 3MNWB 1TLKA 2AQ1A 1KIQB 1XF4B 1DBAL 3OXRB 2CKBB 2HMIC 1I7UB 4JZOA 4JY5L 4TUKH 2J2ZA 1YPZA 5KSAB 3BX7C 1XIWD 2F54A 5DK3A 3L5XL 3DGCR 5I1IL 4M1GH 1IQDB 2EC9U 5HI4D 4O4YH 3LEXB 1AGDA 3G6JB 3GSUB 3G04A 3L1OH 3EJYD 4NHUB 3QR2A 3S36H 4YQXL 5HHPA 1RZIB 4MDJB 4BSVA 3QXDA 4ODTL 4M61A 2ZZUT 5ERWB 4TULH 2RFXB 3O6KH 2HLFC 1JGVL 3MV8D 2XICA 4XP6H 4XVUC 5LGJB 4JJHA 2GFBB 4MJIE 1ITBB 4X7FC 5J11B 3X11A 3MRQB 2BOBA 4FRWA 2ZUXA 4NHCH 4N0FB 4PLNC 1MIEH 3MBEA 2GITA 5GSVA 1S7TB 1JPGB 1B0WA 2OP4L 4QHNA 4LCUB 5ACMA 4WHYG 4OSUL 4XCFH 5C0IA 5TF0A 4ZODA 4XPTL 3NCYP 4JFFD 3FQXA 1BZQK 2GAZA 2MHAB 1VKXA 5E24E 3LMJH 1LO2L 2WUBL 2Q87A 4UQ3A 4TOYH 4N9OB 5DK0A 4U6YA 4L8CA 1RK1B 1N7ML 3ZHDA 5GS2D 2ATPA 4D0DA 1KN4H 4U0RB 3PDDA 5IHZA 1VCAA 4MB5A 1I9IH 2V2WA 3MRGB 2HMID 3UTSD 5MI0C 2E8YA 1QR4A 3RVWD 4JRYE 4LRNL 3RZWA 5F72S 1KIQA 2D03L 4LBEA 3TH3T 1D5ZB 1WAAE 3MJ9H 3AREB 1WAAA 1OGAB 5JTWA 4JANB 4N8CL 1FGVH 3LVEA 5EBMA 3MCLH 4NP4L 5E2TL 1KIPA 2VDNL 1NBZB 2J6EA 5AZEH 5HHXL 4MAUH 5EIVA 5CEZL 3LHPH 2BC4A 2NY1C 5CD5C 4AT6B 1BHGA 5I1JH 1CTOA 5L7XL 4PJXB 2XV6B 2RQ8A 3LKPA 4JDZB 4RFNC 4I0PC 1KFAL 4U1JB 4CNIB 1VFAB 1T2QH 4X6CF 3SBWA 4JFEB 1OCWL 4ALAL 4LLUA 1JZ8A 4JLRB 1LE5A 5DD6A 3ARSA 2P46B 4YR6B 3GK8H 4K3EL 1WIPA 1N2RA 1MF2H 2FDBP 3ME0A 3V6OE 4RAHA 3ZSSA 1K4CA 3HPLA 4JHWL 2MCPL 5EG6C 4R90L 3GMLB 2PUQT 4YFDB 2C3VA 2J7LA 2JJWA 2BNRB 4PRDB 3QRFM 1DANT 5JNYA 5I1CH 1YA5A 5KZCB 1ZGLM 3AREA 1KG0B 2MCG1 1LP9A 1V3MA 1KTDA 3OJDB 3H3BC 4KKNA 4M7LT 4O2CB 4UDTB 4ELMA 1MCKA 2VITA 1E0OB 4EI6A 2H45A 4M4PA 3TYGL 1YY8B 3BH9B 4YHZL 3BEVB 4G9FB 4YH6A 1OTTD 1UZ8B 3U9PL 1MIEL 9CGTA 5F7YC 2Q6WA 5EZOL 3O4LD 4WHTA 4XP4L 1OSZB 3IRPX 4I18C 1FNFA 3THMH 1B9ZA 1YN6A 3NH7H 1OAZH 4RBPK 3V5DB 5L88L 1Q94B 2HLAA 5FA3A 5F9OH 5C0NC 5JQHC 1G0YR 3VMOA 1KACB 4DKAA 1KLGA 1N6QH 4KJWC 1VDGA 4LLMB 4OZGE 2WINB 3BN9C 1Y6KR 2W60B 4MDIA 3U7AA 4TSAL 2LTQC 4EI5B 1FN4B 5FF6B 1HDMB 1FVEB 2EE6A 2YUXA 4DCQB 3L9RB 1ZHBA 4GUPA 5D9SA 2Z8SA 3QUYA 1N59A 4K9EL 5DDHB 1PZ5B 1S9YA 1UKSA 2DLFL 5D1XB 2P48B 4WEBH 5JIIA 3KVQA 3KPOA 5IQ9B 2PO6B 5J1TC 4HJJH 1R3KB 4NOBA 1KEGL 1DLHA 1YEGH 3SDDA 4W4NA 2GHWB 2FHCA 1FFOA 2L0DA 3BIBX 5E2WH 1XF5B 2IPTL 3OGCB 3F58H 4LVOC 5GPRA 4N90E 4NZUL 4WU5A 5E9DB 2DQIH 4UDUB 1BQLL 5EUKA 3ZKMD 4ZAKB 4HKXB 4R7DB 4YHPA 4OFYA 1CL7I 1JTTA 2WIMA 5EN2A 1ZLSH 3TBYA 1AH1A 4O2CA 4UDTA 3IDGA 3JV6B 2AI0L 4FABH 2D7TL 5TDPA 3ORJA 1ED3B 3V79C 5DO2D 3UZEA 3PGDB 2FJHA 4LPUA 3UPCA 5J9PA 3GI9H 4F80A 3DYOA 1BIIB 3MNZA 1RZ8A 2XRAH 1HHJA 3IDJA 4EQ2A 1NCWH 2AJYH 4YDKL 4P4RB 1VACA 1LK3H 5ITBH 3ILPA 3KPNA 5KANG 2DQGH 4WI6A 1L6ZA 4DW2H 1WUNT 3H9ZA 1JHTA 1OM3H 1UWXK 2X70A 3WUWB 1FL5B 3A0OA 4MJ2A 1EAPB 3BPCB 3LPFA 2VZ3A 2R4SH 3TFKD 3BPCA 4JFQB 2BMKA 2GW5A 1DBMH 2OR9H 4Q9BA 3WDIA 1FV1A 1QBMH 3RY5A 1I8IA 3HG1A 2V7NB 4Y5YC 2Q3ZA 1GGIH 1Z3GH 4Y88A 5ESVA 4M7LH 4TTDC 2NXYD 5IB1B 2CQVA 4ZTPH 4U1KB 3UJJL 1IKFL 1AGEB 1J88A 4NQCE 4QRQA 1Q9LB 2VQ1A 1F97A 4M3KB 5HHQB 2N1KA 4J3OC 2ADFL 5FK9A 1E4WL 1XIWB 3NIDF 4M7ZB 4HHAB 4XCEB 3O2VL 1IT9L 4GG6F 1F4AA 5E00A 5EPMA 2EC8A 5HYEA 5C0DA 5C0DB 4F8TA 4NCC1 3TNMB 2HFEB 1CE1H 2W59A 2XTJC 3X12B 4X99B 5GSRA 1N0LA 4XX1E 1FC2D 4QTIL 4G9DA 4QHKI 4PRHA 4XMKH 1FSKB 2A6KA 1UM5H 4YHLL 3DXAB 4NNXA 4F7EA 2HKHL 3CSYA 4NFCA 4U1KA 4ZS7H 4AMKL 2R23B 4OLWL 2VO5A 4AM0B 4W4OC 4JQXC 4YHYB 2NMSA 1JRHH 3O45B 2M1KA 3BQUC 4U1HA 3ZE1E 4XPBL 4E41B 1EEZA 2AGJH 1SHMA 2E7LA 5EU7C 5DQDL 4GBXA 5HYQA 4ZUWB 4N1CA 2FLRT 2Z91A 4EN3C 3GJFA 1T80A 3DTXB 3RDTD 3WFHA 5IEHB 3MV9A 3VFWB 5CEZD 4Q6IC 2J8UF 2CUHA 1DZBA 2P8MB 4YDIL 4NJAL 4CJ0A 4KTDL 2B0SL 4OM0H 4KTDH 4JRYA 4BJLA 5CJBA 5FYJD 5TF1L 2EIDA 3QFJE 5E1AA 4X98B 1RJCA 2ZPKL 1KBGH 1BBDH 4HXBH 1UH3A 3CVIL 1JHLL 5I1HH 5FXCH 4W6XB 1ES0B 5DQDH 2YMXH 5C0CE 1MOEA 3F7VB 3MLPA 5HY9B 2A1WH 1MFDL 3C87A 5D2NB 3NMEA 4BELD 3LCYA 1FZOB 3QAZC 3DARA 3P4OB 4MZ3A 1MFNA 4FQIH 1VGEH 2FATL 4ODUA 3UAJD 3FAWA 1TCRA 1S3KL 4WENB 3BP4B 1WJ3A 5DA4A 4QTIH 2VDRL 2EE3A 4LPTA 1V7NL 5K9QG 2F58H 1S8DA 1EPFA 2APBA 4UOW1 4GMSH 3HC4H 3WXVL 1PQZB 4J6RH 1I1RA 3KJ4B 5FA4A 3N9GH 1F3JA 2DQFB 3FQUB 3WNLA 5T3XL 5I19L 2HVKB 5KVGL 5E6ZA 1AR1D 4N5EA 4EVNB 1I85C 4C56E 5ESQA 2AP2A 4GT7A 3FRUA 5SWSD 5GRXG 4FMFA 3BISA 4OIAA 3RJQB 4ZOCA 2BSED 4H26B 3OKMB 3K4AA 4L5FH 3P3YA 5E94A 1IC5H 3RDTB 1CE6A 3OB0H 1X6NA 3EGSA 4NO3A 2FX7H 4TTDD 3WDJA 1U6AH 4OD3L 5CGYC 2NW2A 1C16A 3SQOL 4N5EC 4MA7H 3V5DA 2E7LE 5E95B 4HQQH 1DP0A 4H5SB 1P2CA 1CVSC 2GSIA 2VDMH 4PRPA 3E1F1 3WIHH 4J12A 4YHIB 1AFVL 1ZA3A 4HUXA 1XCTB 2OL3B 2YPVH 3ARBC 1BEYL 4Z0BH 4XVSH 5IVXE 3RPIA 4HK0B 5DFVD 2XNAA 5J1AB 5DDHA 4XPFL 5IVXA 4DKEL 1H3XA 3R06A 2BNQD 4IRJB 2O5YL 5IUSA 2FNBA 5I66A 4M6OH 3OKDB 1BX2B 4GJTB 5C0AB 1XR9A 5F3BA 5I0DA 2E3VA 4U31A 1ZWIB 3MRCB 5HHVL 2QADD 4XBPB 5FYKD 2VISA 2GITB 1I9JH 5HBBA 2FHBA 3L6FB 2VR9A 3MXVL 2JIXB 1IEBB 5SWZD 4YFLI 5ICXA 1LEIB 5FYLH 4MXVE 3BKJL 4K3HA 1MCDA 2C7UA 1A4KB 4FFVD 3D85B 1I85A 3L5WA 4WRLA 1LK2B 5GGSB 4WHYH 1ETZA 2XN9E 3LS5H 3P9MA 4YHIA 5TDOB 1JGEB 4HBCL 2IGFL 4LHUD 2VXSL 3KDMA 4FP8L 3IJYB 4PJGE 1F4WL 1MPAL 1HH6A 1C5BH 2VXTH 5KSBA 1CFVH 4G6JL 1GL4B 4WW2B 5D7SH 3C60C 5ERWA 3LB6D 1WK0A 5F3HB 1BECA 5L9DH 3P40A 4DAGH 3W0WA 1AHWB 4P2OC 4QNPE 1ZXQA 3GRWH 3H8NA 1JK8B 2GIYA 5HHOD 5F88B 1HI6B 3QIBB 5EZLB 1B90A 4YHNA 3GSWA 1DBKL 4XH2A 5DC9B 4N0UB 3MC0A 4K8RL 2ZNXA 2AV7A 1JGDA 2YSSB 4GLRH 4X7TA 5DD5L 5F7WC 3O9WA 5JIPA 4Y19D 5ID1A 4Y5YB 4YDLC 2EYSA 5L0QB 1XGTB 4TSBH 3WXWL 4KVCH 1OHQA 5CZVH 3VFTA 4FQQB 3KS0J 5F7HA 3K4DA 2P7TA 1U8NB 5CZVL 1U41A 3RNQB 3QRGH 3TNNB 3U9UB 3HB3D 4PREA 5C0JA 1ZLWK 1A6AB 1JYVA 1OAZL 4OD2A 2WSKA 5IK3A 3HI6H 5ISZD 1J1XH 1I8KB 3P0VH 4HS6B 3MR9B 2RR3A 4QHMA 1XIWC 5L6YL 2QKIA 4O02L 2F54D 4Z7VF 1HI6A 3QIBA 3QO1B 1RJLB 4OGYL 5I75B 2E7CA 4ZS6D 2ZKHL 1C12B 2R2HA 4HHAA 4CVWA 3MUGA 2AK4D 3MRJB 3QUMA 2NY2B 1NLBL 1ND0A 2R69H 3NIGF 3FB5A 1U95A 3QCTH 5D1QD 4HC1L 3KPRA 4MMXC 3MLUL 1MHCB 3Q3GA 1RK1A 5FUCC 3NCBB 3QEHA 1BD2E 3FFCD 1TVHB 2A83A 5CP3H 2CH8A 1DUYB 3V4PL 4PV9A 3GUTA 1OSZA 3EYOA 2HT3C 3L7FA 3BJLA 4IDJL 4UTBH 2AABL 3SE8L 4MA1B 4PRHE 1FRGL 3HI1A 3VI4F 4J3XA 2A9ML 4HK3N 3TV3H 3PJSA 3VWKD 1XMWA 3GSNA 4LF3B 2YD5A 1JUFA 1XCQB 1KT2B 5HHVH 2BRRL 1K8IA 4PJ5E 1M1SA 2C9AA 3BW9B 3I6KB 1SY6L 4MJ4A 1R24A 3O6FB 1UXSA 4DKEH 3STLA 3V4VH 3B5GA 5DJZA 4JE4B 5CSGA 3BEWA 4YHMH 3DTXA 3HI6L 4YXLL 3RWFA 4CMHB 3G5ZB 4P23D 3U4BL 5J11C 1A7PL 4JVUA 2VR5A 3PV6B 4HQQL 4HUWB 4F37K 4L8SA 1NCNA 1S8DB 2XZCH 4HUVB 4OZIE 2YRLA 1P53A 3UTZB 2PTUA 4KI1A 4XI5C 4PYHA 3G6JF 1GGUA 1OT2A 1OY3B 2OBGA 3O9WC 4WFGD 4QOKA 3IXTB 4DQOH 2EIEA 4LCCA 4N0CC 2F54B 5BS0E 4R8WL 5I6XC 4K8RH 4CMMA 1S9VB 2XFXB 2DS4A 3W82A 4Q74A 2XFXA 2A77H 2YPKA 4KI5C 1RZKC 3TO4B 4G5ZH 2YZ8A 4HBQA 4NT6A 3BQUD 4OSUH 5EO1A 1LO0H 3N9GL 4Y4KD 3LKOB 1IGCL 4GG8B 1LO5B 4UV7L 2DMBA 4EKXA 2HT4D 1JNNL 2VZ1A 5F7UA 3ARFA 4LCYB 5JW4N 3V52L 4Z8FH 5GS3A 2VDRH 1U0QA 4LL9A 3C5ZA 3M45A 3FONB 5DUPH 2FGWH 3ARBD 2W60A 1S7QB 4MDIB 1C08A 3TIEA 4PP2B 4ERSH 5SWSB 4FQIL 1H9VA 2NY1B 3WO3B 1UFUA 2R2BA 4PTUA 4DZ8A 1S9XB 4JREB 3L5XH 4H0IA 3DPBA 1S9XA 1INQB 4Z7WB 2BX5A 3RWEA 1V5JA 4MXWH 3O11B 4X6DF 4R3SB 3DO7A 5T1MA 3QZWB 1XR9B 5FGCB 1BVKB 2R56H 4WUUD 1PLGH 4Q2ZB 5HDQL 3W9DB 4XNQB 1RZ8B 2FBOJ 4G3YH 4XVSL 5DMGC 1RZGA 5D7IA 4HWNA 1EZVY 2H9GB 3WL9A 4A6YB 3EOBA 3LQAH 1CIUA 1D5MB 1FNEB 3F12B 4H8WH 4WNQB 3D39A 3BT2L 1X6LA 5EBLB 2ICWA 2OM5A 1CD1B 1YEHH 4WWKC 4YBQD 1KIRA 2WWKT 3G6DH 5HGAB 1VB9A 1KIRB 3ZE0E 2WQRA 3ZSTA 2ZSWB 1HE7A 1I75A 4XNXH 2FJHB 4MJIA 4WY7H 5HDOA 1JGLH 4I4WB 1P4LB 2BNQB 3BUYB 4PREB 2OTUA 5AZ2H 3MV8B 5GGRY 3NCYS 5A16A 4MNGE 1ZSDB 3T0AA 4BZ2H 2YUZA 2Q20A 3PHQB 2IAND 5DZOA 1BFVH 1SJEB 3BWAB 4R26H 2QHRH 1B0RA 1AKJB 4UT7H 5BXFB 4G8FA 1TTFA 4Y16D 3FO2B 1INEH 4WIQA 5EU6D 1TITA 4XWOD 2LTQB 2W91A 2CO7B 4L8DA 1KCGC 3GHBH 1WSST 2Z0BA 2OJZL 4O5LL 1MAJA 4LSSL 2JCCA 4MD0B 5DR5L 3WFCL 3ZLQC 32C2A 2W9DH 3DVNB 3NZ8B 4TTGA 3RKDC 3TN0B 5IW6A 4F58H 2IH3B 2DQJH 5CSBA 4LRIA 3Q5OA 1EEYB 1TVDA 3DVGA 4PJFE 5CBAA 3MRGA 3HZYA 3CXDL 4LPCA 1F6AB 2AJZA 5CCKL 2PO6C 1IL1B 1QBAA 3PWUB 1JK8A 2FCBA 2XN9B 3KS0H 4HPYL 3O8XC 1UG9A 1SEQL 4EUPH 4TUOB 3VMPA 4TVSa 4OAWA 4XNXL 2NY6C 4DVRH 4LU5L 5T1LD 3NFNA 1GH7A 4L4TB 3MFFB 1I3GH 4MA3B 3LN4B 4XZUB 1HCFX 4Y4KA 4BZYA 1UZ6E 4OFYD 2BOCB 2GAZB 2PR4H 4PJGF 3DSFL 4EI5C 1SMAA 4KHTH 1CGTA 5J06A 3ARFD 3CNKA 5D70H 5F7FA 4Z5RA 5ADOH 4X4ZA 5FV1L 3RWIB 4RMVA 2OI9C 3HI5H 3PDOB 3V0VA 1MHEB 4OQ1A 4PS4H 2X40A 3EDEA 1J0IA 3OR7A 1B0RB 5LGHL 3MR9A 1ZKAA 4PRBB 3MNVB 5I1DB 4WV1B 3VFRB 3FO2A 5DTFA 4I5BA 5J13B 2ZCHH 5A2JH 3ULUD 3OKOB 4PJ7E 1YNTB 4HGWA 4NNYA 2L7JA 5TQ2H 3QWQB 4GRLC 4PJ7A 3REWA 1WBYB 4ZS7L 2I07A 3AFLA 3AY4C 4JQVA 4ZFOB 3MV7D 2V2TB 1MI5B 4APQD 2R9HC 4EN3A 2EXWC 5C1MB 2BNUB 3A6OA 1C5DB 1AD9A 4BQ6A 1FE8L 1VGKA 3QG7L 4LIQH 4OCRL 3VXUB 3NGBC 3DVGB 1UXWA 4ZXBD 3WLWD 2VLRE 1BAFH 1N3NA 4I9WE 4P9MH 1RUKH 1CE1L 2J5LB 4AENA 3HAEH 3HZVB 1UYWH 3L7FB 1JPSL 2CR3A 4E41D 3FN3A 4TNWF 5DEZA 3VI3E 5EZLA 5IB3A 3FT4B 2FGZA 3CFJA 5DJ8B 1IT9H 2X2YA 3HMXA 2JB5L 4OCMC 1VSCA 4HJJL 1CU4H 4NFDA 3CMOH 3QDJE 4L9LB 3DWTA 3FO1A 3LRHA 2FECI 1FG2A 1K3IA 1QLFA 4RGMC 2DQHH 4IM8A 1F8TH 4N0CD 1MELA 3EO9L 3I02B 3SKNA 1PFCA 4ZTPL 1C1EH 1UM4L 3K0WA 2H32H 3L3OB 2J3SA 2LVEA 4MLSA 2GK0A 3HCVB 4JY4B 1NUGA 1TJHL 3KPRE 5HDBF 3LN5B 1PW3A 1HKFA 3FB6B 1KCSH 1UJ3C 3KHOA 4KZEL 5L2JA 2D4FA 4JREC 2YD2A 4XXCC 7FABL 2AEQH 1QRND 3DGGB 5HYSA 2DQUH 2CIIB 2YPLB 3X14A 4GAFB 2R0LH 2Z4QA 2C26A 2YPLA 3X14B 2VDPH 2K9UA 1EEQA 2BFVH 4PJ9A 1UADC 2NY3D 2EKSA 3SKOB 1RZJC 2NX5B 3RVXC 3VE0A 1JF5A 1CI5A 3HUJA 3KXFE 2GSIB 3F7RA 4YHZH 2H26B 4LSDA 5JA8B 3CC5A 3QNYA 3GMPB 3WLWC 2A6JA 1FZKA 2OS7A 1B6DA 5JHDB 1MFCL 3WBDA 2AK1L 1F90L 3QEGL 3WIFB 4BH7B 3GO1L 3GMNA 3GMQB 4X5XA 1U8OA 3VWKB 4TVPL 1L0XA 5I8KL 1JV5A 5E99H 4WFHD 4ZG1A 1AGFA 3MA9L 4ZUSA 4PD4K 4LSRL 5AD0B 4GAJL 3U1SH 4ZUTA 3VH8A 2I9LA 3PHOB 2FSEA 3BD4A 1FHGA 2VN7A 1F3JB 4I13B 4P46B 4RGOL 5ANMB 3ARQA 5ICZA 1NMCB 1BQLH 1EMTH 1U8LB 3CFIC 5JIHA 5SWSA 4PJXA 1H15B 4KK9C 4ZS6C 4EVNA 4FXKA 2J88H 3C8DA 4YIQA 4M00A 2EDWA 4OGYH 5E56A 3WFDL 2HKFH 1XGPB 4XHJC 1FGVL 1TJGL 1BLNB 1MHEA 3DRTB 4IRJD 5AAWA 1J8KA 3MNZB 1NFIB 1CGXA 4RIRB 1E27B 1YMMB 3B3IB 4ZYKB 1FNGA 2JIXD 1ZE3C 5E6IA 5IR1B 5BZWB 1IQWL 1P84J 2Z31C 3UJIL 1RULL 5FK9B 4OIIH 1Z6JT 4KV5E 4G42A 3VA6A 3ZDYF 4LCWE 5D2LF 1TENA 5IB5A 3MPCA 1ZA3B 3MJ8B 2P5EA 4D9RE 5IROA 5TDOA 4UIKH 2P5EB 2ITDA 3BWUC 3IXAA 2ESVE 2VWEC 1G7QB 2M8XA 3QEQE 3WD5H 2PCPA 4PBXA 3MCKB 4AENB 4HUUA 4XPGL 2P24B 1Z9LA 3H42H 2N4IA 5F96H 3TYGH 3LD8C 4DFIA 5E08L 4PRPE 2DQDH 2Y9RT 3MA7B 4RIRA 1S7TA 1A14H 4P3DA 5BJTA 3BP7A 5BZWA 4YPGA 1DQQA 1FAIH 3QO1A 4KDTC 1IILE 5I8CB 1FN4A 2EDFA 5BW7A 5JNYB 3TPUB 3W39A 1CBVL 4PP2A 2EDKA 1LNUB 3FN9A 3KPSA 3VFOA 3TJHA 2VDLH 2UV3A 1Y0LB 2QHLA 2VR4A 1G9NL 4MQXD 2G5BB 5C0JB 3JTTA 5DUBA 5DZLA 5D7JC 1AQDB 4R97C 5SWZE 1N6UA 1IBGL 4UT9L 2DTMH 4OGAD 4PRIB 3TH2T 1N3NB 3ZYJA 5KS9E 3FCTA 3R0MA 5I1GH 4LFHD 5MENE 4YHNB 1MCIA 3S37X 2PYEB 5IHBA 5MEOB 3ZKNC 4LNRA 4Y19A 5C0EB 1GIGH 3STBA 3F12A 1C12A 4NKOB 1OGTA 2J88L 4HS3A 5AWNL 4X7CC 3M17A 3SGJC 4H25B 2R9HD 3MJ9L 3TBYB 3HTLX 1U95B 1KENH 4DGVH 2W0LA 5AG8A 3BZ4B 4TSCL 4EDWH 3WIHL 2A0LD 5F9WB 5H94B 1T66D 2JE8A 4G8IA 2WIIB 4UNTA 3ZKXB 5JW3L 3VXNB 5HGDA 2VL5B 1S7SA 2JTDA 4DGYH 2CUMA 1I1YA 2EE9A 4R0LA 3HC3H 5EZIL 2LU7A 5FYLD 1W0VA 3NTCL 4YR6A 4JHAL 4GXVH 4P5TD 1L7TH 4YBHA 1CQYA 1YQVL 3PIQB 3IYLW 3K2UH 1RJYA 2WUCL 4XP5L 5JDSA 2FSEB 4I48B 2NZ9C 3HE6D 3WSQH 2ADIA 4IRSD 4HEME 4ELKA 4NZRL 1A1OA 2CUIA 4K23L 4OZFA 4NM8H 3C2SA 3EFDL 5GRJL 5J7CC 3O6FA 1LMKA 5JUEH 4L3AA 4AEIH 3SKNB 2WWMD 3OKKB 5DRNB 4HH9A 3TO4D 1WIUA 3F7VA 1S5HA 4RAUB 3VXUE 1NBQA 2DICA 3Q3GB 4G9FE 4WI7A 3BN9D 5JHDA 3FT2A 2D2OA 2ZUQC 4MQSB 3UO1H 4GSDL 4ODVH 1QBBA 2VNCA 1BIIA 2O5ZH 4HCRH 3JSSA 4TQEH 5INCB 2AEQL 4NDMB 2CMRL 5IBUB 1N64H 3MBEC 3MRKB 2APFA 3X13A 3IGAB 4RGMB 5MEOA 2MKLC 2AJ3A 4L4JA 5IB3B 5D93B 2IAMD 2ADJB 1KNOB 4MHHG 3BFOA 4LNVA 1QHPA 3MOBL 1C1EL 3CFCH 5CLTA 2V7HB 4HX1A 5GS2H 4JFOB 4MAYA 5F1OB 4WCYH 2NYYD 1MCRA 1YNLL 3UYPA 2YMXL 3UTTB 3AM8A 1RUMH 1TMCA 1IC7H 2DBLH 4JY4A 4PJDF 2BVPB 1UB6B 3OL2A 3DX9B 3BP6B 3UPAA 1FQ9C 2XKNA 1HYRC 3DGGA 3CAFA 3VFGH 5DJ2B 5L2JB 3V8OA 3GGWA 3O0RH 3O2WH 4L1DA 5FOJA 1YECH 4M8QB 1NGYB 1I1AA 2X4PB 3N50A 1R3IH 2MSPA 3OV6A 4NQSB 4OJFH 3ZTNH 5CKAA 1RJZB 3DXAD 3KNBB 4XVJL 4ZPVB 1NFKA 3CFKB 3TIEB 1KNOA 1Q9WA 5IFJB 1QKZL 5C0FB 2ATKB 2OMNA 2CKBH 1A6ZB 4NNPH 4PJHE 2N56A 4PJGB 4HFUH 1Z9SA 5E7FA 4YUEL 2A6JB 1U3HB 5D2NA 1J10A 1EFQA 5EORL 3G6AA 3V5KB 3D0VA 5I76A 3D9AH 3C5JA 5HGBA 4UV4L 2EH8H 1KJ2A 3MRRA 4ONFH 5IG7B 3GMQA 2HKHH 4YHLH 3QDGA 4U1MB 4PS4L 1A4JA 1AQKH 2R29H 4K7PL 1DFBH 4OCXL 5CS7A 3D2UB 3UZVB 4NO3B 4PY7A 1R3IL 4G6FB 4RGNB 5LAXB 3ELAT 1INDH 4YHKL 2FX8H 3RZCB 5LAXA 4Y2DD 1UCBH 2Y1VA 3ILQD 2B4CC 1IM9A 4MJ6A 4POZC 3VFGL 1S7XB 3DVIA 2OK0H 4UMGA 3B9VA 1VEMA 3BIAX 3QO0B 4OFVA 2F15A 1FG9C 1N8ZB 1A6TB 2GY7B 1A4KA 5TDNB 1ONQB 5JXAL 3ESVF 3TF7C 4M62L 1TTUA 1YNKH 2NR6D 4XTRC 3V4UH 4GBXB 1GGYA 4OFDA 1LDSA 3QI9D 1YNLH 1CL7L 3CXHK 4X6FB 1EXUB 1R5VB 5SX5H 1WBXB 2WBJC 3MROB 4ZFOL 43C9B 2FEEL 1EFXA 5DF0A 5GGVY 3K4ZA 4JZNA 5GGTA 3KPOB 5DC0A 4M1CC 2GKIA 5IMLB 2JB6B 4B41A 5DLMH 1G9ML 1IAOA 4QXTB 3NVQA 3DV4A 4PDCE 4UB0L 4PRAA 3TVMB 4IIQA 3ARGD 1SJHA 4C4KO 4OLXL 1DBML 2OR9L 1NQBA 3VI4E 2W9DL 4K8RD 2XKUA 2BHYA 1J0HA 3IDGB 4EI5A 1YYLL 4C57C 2R15A 1UA6H 3RBGA 2BC4B 3BGFB 4ZFGL 5IMMB 1RIHL 1RI8A 4AEIL 3DJ9A 1CFQA 5FM8A 3RA7L 3SE4A 2BSTB 3EYOB 5C08A 5KVEH 3QIUD 2X09A 3PP3K 4K23H 5SWZB 4OD1H 2DLIA 1CT8A 1DQDH 3WFZA 4NUJA 4PJ8D 2EDTA 5EU4B 3KGRA 1SY6A 3N85H 3S3PA 1UKQA 5EOCJ 1YQVH 5D7JA 5GZND 5J6HB 5K9OA 4CAGA 1IJ9A 4IDLA 5FYKL 3SOBH 2DI9A 3MXWL 4DOHB 1P7KB 3C08H 1IAMA 5IBTL 1WCBA 2VQTA 3O6LH 5D8JH 5DWUL 2EEAA 4KKCD 1ZK9A 3G6DL 4JFDB 1JN6B 1G7JA 4KRPB 1IMHC 4JFQA 1DN0A 3HCVA 3UTPD 4LGRB 4RFNB 3U2SA 4JB9L 2HT2C 4MNHA 1A7QL 2GJJA 4JO3L 1KEGH 5GGUB 4ODWB 5FHAL 2CPCA 5C9JB 5GS0D 1KB5H 3JWDH 2P47B 5JDJA 1CZ8L 1F2XK 2R1WB 3OG6B 1P7HL 2W0PA 3MYJA 4A6YA 2GK2A 1BIHA 3B5HA 3TPUE 3JUYA 2C1OA 5L2KA 1SYVB 4GS7C 5E8DL 1BFSA 1EDQA 3X3FH 1CXIA 4PV8A 2BVYA 2ICWB 3MRJA 4MGXA 4UTAL 1A7OH 1B4JH 3M17B 3FJTA 3P4MB 2WANA 3TN0C 1XFPA 2VXVH 1T2XA 3RTQD 1CXKA 1DVFD 4P5MA 5J9PB 1MJ7H 1J12A 4KMTL 4O2EB 5B4MD 4TRPL 2B5IB 4UV7H 3GIVB 3H9SD 3SCMC 4XP4H 4DUXA 1V7MH 3QJFB 1CFNA 1WITA 3NCJH 5KZCD 3BWAA 4XGZB 1S7VA 3F7YA 4LKCB 4XVUD 4RFEA 3A67H 3CSYB 3KAAA 3T1WA 4HAFA 3QUZD 4WU5B 1H0DA 3Q6FA 3S7GA 3VGAB 3RWJB 2WM0A 3MFGB 3PGCB 4KJQC 1LNUA 1Q72L 4KZDH 3ZKND 3U0WL 1G7PB 3KYOA 4AT6A 4RMSA 3STLB 4R8WH 4LLWB 3T3PF 1EFXD 3B6SB 4TYUA 5D1ZB 4HEPG 2FIRT 1MHHA 2IALA 4KAQL 4Y1AB 5IMKB 4HMDA 3UBXA 3QT2A 3FB6A 2CO6B 4ZPTA 4P5MB 2V9QA 3NZHH 3TVMD 5BOPA 2H2SC 5CUSH 2BERA 5DVMA 5EC2B 2BSRB 5FB8B 3MO1A 2VDQH 3V0WL 5DFVC 1P1ZA 5IVOA 2D4DA 5EFIB 1HHJB 4ZOAA 1MHPL 1ORQA 1Q9LA 1F4YL 3ZKSD 4JM2C 5CZXC 3QUKB 3IGAA 2A73A 2MNUA 5IJVA 5F7DA 1X5AA 4N0CA 5IJVB 3MJ8A 1MRFH 3OR6A 4KY1H 3LEXA 3UTSB 2CLZA 4MXQC 5FYJL 4YK4B 5C2BL 1AIFA 4N8CH 1U36A 5ALCL 4HG4K 2B1HL 1YMHB 3BH9A 1YJDC 1KYOK 3GI8L 4Q6YA 5JO5A 3QCUH 3S88H 2EZ0C 5TFSH 1F11A 4EN3D 4RGOH 4QXUL 3VDCA 1JNHB 5DJ0A 5T1MB 4XBEL 2VDQL 4PJ9D 2PO6A 3U1SL 5FB8A 4ZXBA 2KQNA 1ZGLA 1I8KA 3EJZC 1RVFH 4RA0C 2XQYK 1F6LL 4PFEA 3LKSA 4ELKB 1BVLB 4OGAC 2Y23A 4LLMA 3LOWA 1YEEL 4I5BB 4XB7A 4PJ9C 1LO2H 2WUBH 3LEYL 7CGTA 4QRRB 2B1AH 2HRPH 3PQYE 1E28B 3U0WH 4POUB 4PY8I 5D5MF 1ZTXL 3L95B 8FABB 1H15A 2CLRB 2COQA 1ACZA 1HXMB 1CG9B 1MVFA 2ZKHH 1EA9C 3TT1L 4OUUB 5GS1B 4Q9QL 1QLRB 2IPKA 4XXDA 4GRLB 5HHME 1YMHA 3ZHKA 1SM3L 4XP9L 1TXKA 2XWTB 3MJ7B 3TNMA 1YY8A 2I5YH 4U6HA 5L6YH 4XHQA 2VYRE 3LS4L 3GKZA 1YEDB 4X4MA 5F88A 2UYLA 4WHTB 3RIFF 3B5TA 4X4ME 3NGBB 4GLRI 2VN4A 1W0WA 1AXIB 2X44D 1IM9B 3O6KL 2WBKA 5GISH 1V8HA 4MCYA 4OAWB 4G6KL 1EX0A 3E6HA 5EA0H 1F00I 1LO3L 5JR1H 3MLRH 1LP9E 4UTAH 1AC0A 4GH7B 4FQLH 3CVHB 4XI5D 5FKAA 2X05A 2YBRB 5E8DH 4AJ0A 5TQ0H 3JTSB 2AJSL 2X4QA 3RY6A 1A02N 2AKRB 1F4HA 1VFBA 1KCVH 4LDOB 1JGUH 1MNUH 3SKMA 5DURD 2R0WH 3T2NL 5E6ID 1JVKA 3QUZA 5FHAH 2QSCH 3QUZC 4KV5F 2BHZA 3HE7B 4WEUD 3ZYZA 1WC7A 2FO4A 4JB9H 4GMTL 5D4QA 1AO7D 2X4PA 5HXMA 4HWEH 1Q94A 2ORBL 1C5BL 2VXTL 5JPMA 1FNHA 2UWEF 3BGAA 1TFHA 2IBZX 2IBGA 1CFTA 2NZIA 1CDHA 1NFDB 1MVUA 1P9MC 3M1BA 4GS7B 4RA3A 5EU7E 3SOBL 3MRMB 4EI6B 2ZOLA 4AIZA 4XC3H 3LH2L 2NXZD 2DLGA 1WF5A 5KSBB 3BIKB 1QSED 3ULVC 2BNQA 5C08B 3NPZB 2VL5A 3TA3D 1J05A 2DKUA 2X9YA 3SE4C 1HIMH 1JNLL 4M03A 1PSKH 3VRLF 3MUY1 3GBNH 1CTNA 4H20L 4QRPD 5IM7B 5ISZE 1HH9A 4YXHH 3FOMA 3FQRB 1YPZB 5KSAA 4KK6C 4LEOB 3D39B 1IEBA 5L8JB 1C7TA 4ZTOH 2B1AL 2HRPL 4BUGA 1VHPA 1K4DA 4OV6F 4M9PA 5D70L 4OZHE 3SGJA 3FTGB 4Z0BL 3S37L 3NA9L 5I1KH 2KPNA 2LU3A 5EO0B 5I71C 2P7TB 4Z76A 4QOKE 4ZFOA 3FFCB 4GW5A 3U2SB 3DX9A 4TPRH 3IDIA 1T21B 3MGTB 4MA7L 3OQ3B 2AXGA 4UB0H 4M1DL 4PJ5A 3BO8A 3B4NA 1CN4A 8CGTA 1G9MH 2WV3A 3PV6A 3JWNC 2V5RA 5DD0H 2YPLD 4JZNB 3QCUL 3S88L 1EO8L 2Q76B 5FYJE 4QRSB 5CEZE 3HE7A 2G9HB 1UEYA 1T04B 4PJ8B 2NYYC 5I75C 5GGQL 3BJ91 4NQDA 5C2BH 3PL6A 3WJLC 2V9RA 4S2SB 2JCCE 4P2OB 3DIFB 3MV9E 3QUXD 1MCWW 2XY1A 1T1ZB 3QIUB 3ZT7A 4L8DB 3MRBB 1YNKL 4XCEA 4KPHH 4DUWA 2DQJL 2YD3A 5D96B 3UTSA 3UJTL 3TA3C