5F1NA

Mhc complexed to 11mer peptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAPWVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYGCDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLVEPVTRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Immune system
total genus 75
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5f1nA01
5KANG 4ZOEA 4HLZH 3V2AR 3T3MF 3QI9D 2QQQA 1DQLH 1HEZB 2RFXA 1G7IB 3KPPA 4NN5C 3FQRA 3IRPX 4MNHA 4HFWA 2FNBA 2F58L 5C8JA 4QYOA 2QADD 3BQUA 2QTEA 1QZ1A 4JFPB 4YO0B 4LCCB 4PJDB 3FFCA 3SY0A 5L6YL 2DJUA 3DBXB 3MZTA 3MRGB 2WBJB 4Y8DC 5BRZB 4NBYB 5I15L 1OTUC 2YZ1A 3NVQA 4BH8B 2BVTA 3P4MA 1WFTA 1A47A 4KUZL 4UZGA 2NW2A 2OR9H 1ZT7A 2WWMC 4M8QA 4JDTL 4C55A 1WWBX 1KLGA 1U2HA 5GS2D 2AXGB 4PJDF 3S35X 3OHXB 2ICWI 4Y4HC 1A22B 2X4PA 2JKXA 3VH8B 1O0VA 1NEZA 3SJVE 3MV9A 4X9FA 4RQQA 4G6FD 5C09E 1KJ2A 3X13A 5DTFA 4K7FB 4XXDB 3AB0C 4LGRB 5C7XL 5C0FA 1T1XA 4X7TA 3HAEA 3TCLB 1BQUA 1K5NA 2W9DH 1DE4A 2W1NA 4MNQE 2W38A 2X89D 3C6SB 2VXSH 4AEIL 2KKQA 4NC1C 5SWZD 2X6MA 3T2PA 5L8JB 1A5FH 5CINH 4ZFOL 5ADPL 4PB9H 4L3CA 5BCAA 3V5KB 4NQSA 2FATL 4JG1L 4YHIA 4QXWA 3QULB 1Q94B 3N50A 3RFZC 4X6EA 2ITDA 1V3JA 1ZHLB 4DUWA 1WT5A 4WHTA 1W72L 3S98A 5JPMB 1JPTL 3TO2A 4YWGL 1XGYL 1BWMA 2RQ8A 5DRXA 1UJ3A 3NFSH 3TJHC 5DLMH 2Z31A 3PNWA 5EC1A 4ZFZA 1F3DJ 4ODVH 4KJYB 4HWNA 4W4OC 1HK6A 3KJ4C 1PY9A 4P46B 1KTDA 3RVUD 3UTZA 5MEPA 5F9DC 4X4YA 4LSRL 4JY6A 3FT2A 2E5EA 1BLNA 1QFOA 4QHUB 4F57H 1HINH 3L3IB 4ODWB 5B22A 4UTAL 5JORB 3RWIA 4G7VH 2AI0H 1D9KA 4H1LG 1ZGLA 5LXGL 1T5XA 4L3EA 4QF1A 2NLJA 2DQCL 3SE4A 5A3IC 1F6AA 1S9VB 1UKSA 5JIPA 3I02B 3QFDB 1FL6A 2ZG2A 4LSPH 3GBNL 5DJ8A 1RUMH 3PWUA 3P73A 2GSGB 3QHFH 5GGRB 3UO1H 1HHGA 5D7SH 2YPLE 1ZT4B 4R97C 4XVUD 1XF5B 1IEBB 2HLAA 3VXME 2WUCH 2NTFA 3WFCL 1UA6H 5HGBA 2APBA 4UQ2B 4Z7WF 4WTZA 3OAYK 2HMID 4EUPB 1BMGA 1I3GL 3OB0K 3QCUL 3UBXB 2ZSWB 3DIFA 5E8PA 4HCRH 4LHUD 4XP5L 2C1PA 3MROB 2DM7A 3O2VH 3SKOB 2D0FA 3G9AB 3RL2B 2PTUA 4YQXL 3PIQA 5BZDA 1A7PL 1HCVA 2AJYL 3MRLA 2J8UE 5DC0A 3WJJC 2X4SB 1WAAA 3RRQA 4GOSA 5I8EA 4P2RB 1XCQB 3QDJD 4XPTH 1FFOA 2L4OA 3PJSA 3LKQA 4Y16C 4C59B 3MLXH 4JZOA 2CKBA 4JZJB 1WFOA 4XNUL 4PJHB 3CLFL 3GIVA 3VXOB 4XXCA 1E4XL 5JHLL 2WWKT 4WUKH 2DQDH 1U92A 4GRLC 5CILH 2V2XA 3R1GH 3MCLL 3O9WC 4NQTA 4PJ5B 2QKIB 4EIZC 1MCNA 4N5EC 2EE2A 2X4QA 1N7MH 3GKWH 5T3XE 1FGVH 2LVCA 1IC7H 2WM0A 3SGEI 3MJ8B 1RZJC 3W39A 1DLHB 4HWBL 2V9RA 3TA3A 1I8MA 2KZWA 2ADFH 4PJHF 3VFSB 2ARJA 3Q5OA 1L6ZA 2XKNA 2FHBA 1CFSA 1KJ2H 1KIQB 3TO4D 2Z0BA 3AAZA 5DF0A 2EDTA 5E5RB 1AO7A 1DQDL 3VFMB 3P30L 3SHSA 4JM2D 3HAEH 3IF1B 4M6OH 3GNMH 1IVLA 3MRIB 1CLOH 5KS9B 1NH6A 4I3GA 1L6XA 4XPHL 1XR9A 4XGZB 4F58L 2I07B 4PYGA 1IFHL 4J1UB 1FH5H 3QDME 3Q6GL 4O5LL 1IGYA 5IJKA 6FABH 2DDQH 4G7YL 5E6IC 2ZUXA 3WIFB 2EKSB 5GGRY 4JFQB 2EXYD 4M02A 3TBVB 1QRND 3LN5B 2C5DC 4KJPD 1I9RH 2OBGA 2CKNA 3D85B 4IRJB 5KS9F 2GJ6E 1WFUA 3X14B 1U0QA 4R6UA 3UCRA 2XWBB 4JFOB 4ZUWA 3BGMB 1E4KA 1UACH 4DK6A 2BNRA 1FYTA 5IIEB 3MBED 1IM9D 4JFDB 4M5YL 2E7LA 4JGUA 4RGOH 5H2BA 5HHVH 2AEPH 5HYSA 3LRSB 4PTTA 3OZ9H 3OX8A 5EOTA 2XIDA 1OAQH 4Z78B 3VFWB 1DSFL 1OP5K 1KEGL 2WBKA 4G6KH 4XVSH 2OTWA 1B0RA 1ZHBB 3GSRB 3BZEA 4X5XB 3I50H 3D2UA 4XP6L 4S0UC 1U58B 4PPTA 5EO1B 1S5IH 3P77A 5JHDA 5GRJL 5CUSL 1ES0B 5HHXH 2C3VB 5I16B 1AXIB 4L4TA 3R06B 3S8WA 3GI8L 1KIRA 3GJFB 3R4DA 5ANME 3VJ6A 2VRAA 3ZO0A 3C60B 3SOBH 1J0IA 4MA8L 1GZQB 4G5ZL 4OKVB 1M05B 3OAYH 5MHSD 4XWOC 4WFGD 1GZPB 1OD9A 3VGGA 3OXRB 5EU5A 1P53A 3TCXA 1T66D 4HGWB 3UBXI 3OB0H 4KI5C 3P0GB 1U42A 5DJ6B 4L8DA 3DRQA 1ITCA 2A6DB 2HFGL 3CDGA 4IMLA 1NFIA 4ZUVB 1YY8B 3BWAB 4D0BA 1OF2A 5JA8B 4A2LA 1E4WL 4DKFH 2DWEB 1SY6L 1OY3B 2VUOA 2G5BB 2DN7A 2OR8A 4R4BB 2ADIA 1CWVA 5KJRL 3NZ8B 4WWKA 4AQOA 4KHXH 2R4RL 4ZOCA 4IIQC 3DMMA 3T8XA 2CIKA 3ROOB 1YEKL 3SE9H 2J6EL 3SDDA 1NCBH 4JREC 4C83A 4P2QB 1JF5A 2RGSA 1DQQA 2CMRL 4DGYH 5AAWA 1DCLA 3UC0H 4GSDH 5C0AD 4JZNB 5AZEL 1KPUB 4HIXH 1X5JA 4WTXA 3V6OC 2EXWD 2D2OA 5D96B 4GBXB 4ZO8A 4HQQL 5GGQH 2EDHA 3KPRE 5HD8C 1TQCC 1XGRB 4KH2A 5H35B 5DMKB 3TPUB 2ZCKH 1NGPL 1CDIA 4OIBA 4MJ5A 1ZLSH 3PV7A 2HWZH 4YLQT 4EEEA 4U6HA 5IW1A 3DVNB 4LEOB 3PL6B 3UTTE 2F8XC 5GS3A 3NOIA 2XPGB 5EUOB 2HKFH 3JXAA 3SGKA 1V7ML 43C9B 1KJMB 3X17A 2MHAA 1WGOA 5AWNH 1QHPA 3Q6FB 2A74A 2VLRA 3ZKXC 2R0WL 1UVQA 3H0TB 5ADOH 4H20H 2L0DA 3HS0A 3HCVA 5FCSH 3S4SA 3VWKA 3A6OA 5F72S 5GSRA 1AHWC 1IGJB 4EQ3A 3VRIA 4LHQB 5JPNB 4RMRA 1YMHA 3VU2A 5KSUA 5IBUG 1JHTA 3BEWB 1KCUH 2P5EB 4XCNA 2OL3A 3OPZL 4RSVA 2HRPH 5HPMB 3H9HB 3T3ME 5CEXA 4CVZA 5DA4A 3MV8A 4MMXC 4M93B 3ULUL 4OT1H 2AJ3A 4K7PH 4K23L 2VR5A 3U36A 3QEGL 5TDOB 4YHKH 4AL8L 3KLAB 2JCCA 4W6WB 4DQOH 2UY6A 1OP5H 3IS1X 4UINH 4BK5A 1YC8A 3KXFB 1VFUA 4FQHB 4PRHA 5MEOA 4JFYA 1HSBA 1EEQA 4NM8L 2VLMD 2VLLA 4CVXB 4TSCH 1SMAA 2MQCA 4MAYC 5DUPH 4PREA 3QWRD 4UV4L 1MRCH 1XGPA 4OZFG 1S5HB 3X3GH 1X5ZA 3E6FB 5E8DH 3TZVD 4EXPX 4Y2DA 2HFFB 4TULL 1EJOH 1U3ZA 3IJHA 3V4VL 4WFED 3LD8C 4HAGA 2MKWA 3JSSA 4PJDE 1P4IL 1FFNB 2Z92A 4PV8A 3CC5B 1DUYB 3BHBB 1T3FB 3LEXB 1TITA 1G9NL 3KYOB 2L7JA 2R9HD 5DD6B 1HIML 1FRGH 1G7MB 4JR9L 5DGQA 4CDHA 1I85C 3VG9C 1BOYA 5CP7B 2ZUTA 2ZJSL 5DHYA 3QXUA 3P4NA 2DD8H 4BFEA 1OP3K 1YEJH 1U8PA 3MLYH 1QOKA 5GGUB 3KR3L 4KPHL 5I1GH 2Q3ZA 1MJ8L 2V17H 1J7VR 5JZ7D 1IGFL 4OF5A 4U33A 2OJZH 1T0NA 3FQTB 1ZTXL 2ATPA 3EO0B 1U8NA 4ONGL 4KKCC 5D5MB 4Z7OF 3FRUA 1G9ML 4NBXB 5EA0L 4I0PC 5ESQB 3BZFB 3GJEB 2F54B 1BFOB 2YD3A 5HI4C 4F7MA 3U46A 4E0RA 3EOBB 4OLXL 2VDOH 5DJ0A 4LASH 1G0DA 4DZBB 5GS0L 3VD9A 1RHHB 3L3GB 3PDGA 3NABL 3EDEA 1JNHA 4N0RA 4HC1A 3I6LE 3IDGB 1IGMH 1ZT1A 5D5MF 3T0EA 1NGQL 1D5BB 4GXVH 3RWCA 1PEZA 1DBBH 5E2VL 1LDPL 1AD9A 3HTLX 1DBAL 4S1SL 3K81A 3O45B 3GO1H 5KVDH 1WV7T 2AJVH 5E4IA 4JPWL 3CFCL 2J7LA 2J8OA 3QPXL 3RPKA 3WNMA 3P9LB 3V8CA 1I7ZA 2IH3A 1OAXL 5IR1A 3SKMB 1JF1B 5HGHB 1NAKH 3C08H 4M7LL 4Z7WE 4RFNC 2WW8A 3CZJA 5HYQB 1DUZA 2OL3H 3EIFA 4ZSOB 3U79A 3P0YL 4XCFL 3LDBC 3LY6A 4ELMB 3FO2B 1MFNA 5ALBL 2F53B 1S7WB 4MQ7B 2FYYA 5BVJA 3ZDYF 3KPQB 3QXTA 1G7LA 3LQZB 1PJ9A 3B5GA 4N1CA 3W0WA 2RJMA 2GTZA 1R3JA 4GW5A 3ZE1E 1UENA 4OZHF 2O26U 5TDPA 1FNSL 1DBJH 2XNAB 1CICA 2IEPA 1QSZA 4NUGH 4HJGB 2BY1A 4AENA 4O2CA 1J1XL 1F90L 2NZIA 3QO0B 1RZKL 2NY0B 1DN0A 3EJYC 2A0LC 2EIZA 5FO9A 5D7LD 1WISA 2AERT 3QIUD 3VXSE 4NIKB 2AJUH 2PYFB 4TVPL 5E08H 4PTUB 3RWGB 5JMRA 3K80A 4LPWA 1NBZB 1SQ2N 1BBJB 2DBLH 4OJFL 4ZAKB 3P4OB 4K3JL 2Y1VA 5A2LH 1A0QH 3S5LG 2ZUUA 3K46A 2QHRH 1S7VA 3ZKMD 1F11B 1CD1B 4PJHE 1OARH 5IBTH 3MOBL 3TIDA 5DDHB 3TVMA 4PP1C 2ZOLB 4ERSL 4X4MA 2MQ0A 2R8SL 1RK0B 4U6XB 5JMOC 4K2UL 5I1CL 5BQ7A 2FGZA 4F7CA 2ARWA 4U1KB 2PW1B 1BFVH 3GBML 3L5IA 1QEWB 4PRBB 1TCRB 4KZEL 1OPGH 1EEYB 2K3TA 1NPUA 2KQMA 4XX1G 2PTTB 1AGBA 5B39B 2D7QA 5L2KE 2ID5A 2FR4B 3IVKB 2HT3C 1MLCA 4LLYB 4NN7C 2JE8A 4UDTA 3D39D 4ZTPL 4IJ3B 4YE4H 1YMMB 4X8JB 1DBKL 5LQBL 3O4LA 1JK8A 3VFUA 4FQQB 3E2HA 1RU9L 4H0IA 4XI5C 3MYZA 2DM3A 2GAZA 4KMTH 2G60L 1QFUL 2KQNA 2FL5B 12E8H 2YWZA 4HC1H 3LH2L 1HNFA 5CEZH 5C3LD 3ARBA 4WDIA 3C09B 3EO9H 1BD2D 4RX4D 3TGXA 3ZTJH 3ARGD 2BK8A 4D0CB 1K6QH 1QSFD 4C56E 1HOCA 5TDNB 4WCYL 3DWTA 1MNUH 4HPYH 1MCKA 3C5ZA 4UTBH 1KEML 4NO3A 3RL1A 4PJ5A 2P1YA 3MNZA 3UTOA 1FL3A 2AS5M 4PD4K 3CK0L 1F3JA 5ILTH 2Z93B 3MLZH 1MCHA 2DLFL 1UB5A 5D1ZB 1YNKL 3SGEH 1WCBB 5HHMB 2PYEB 4K3EH 4BZ2L 1S8DB 4EJ1C 3N1PC 4K94C 4EI5D 4RDQF 3HE7A 2A73B 2VDMH 5D7KD 2ZUQB 1MEXH 1DEEA 1FFPB 2VDNL 2V7HA 2BXZA 4KV5E 5IMKA 1M4KA 5I8CA 2FZ3A 4P5TC 5IESH 2G5RA 4OQTL 5F1NB 4ZD3H 1P7HL 4QT5A 1TZHB 2P5WB 3H9SA 4KJQC 3D3VE 5DEFA 4JJ5B 3Q0HA 2YD2A 2MFNA 3M8OL 3P9MA 3HNVL 2WUBL 5DK0A 4KRPB 4ZMAT 4MSWB 4ONHB 4F37K 3HZKB 2MNUA 3UTSA 3CXDH 1BOGA 4FABH 1OW0C 5BJTB 2CUMA 4NZTH 5E94B 2GSIB 4Y4KC 3VCLB 2YC1A 2LU4A 1OLZA 5ETUA 4KVNH 3ULUD 2W0KA 1OGAE 1SYVB 4Y1AA 5LCVH 3QEQD 5I8OL 1NEZG 5BXFB 5DEGB 1FZKA 4XVTL 1IGIL 5ISZD 5INCB 4O58H 4YXLH 3Q1SH 4J8RA 2P7TA 1CFNB 4LIQH 1WICA 1A6VH 3S35L 4NZJA 3HAEG 3MA9L 5JO5B 3O4OC 5I1LA 2X7LB 1X5FA 3REWA 1M7IB 3EZJB 4G59A 2CDGA 2QQKH 1VPOL 3IXTB 1MF2H 1MI5D 3G5YA 3L3KB 2C9AA 1Q9LB 2HVJA 3W9DB 1U95B 4O9HH 1EA9C 4P2QE 4ZXBC 3O2WL 3MRMB 1X5XA 3G6DH 1LK2B 3TT1H 5FECA 1S9YA 1E6OH 3P4LA 4BFIA 2EYRB 3VFVB 2X1PA 1NGWB 1VHPA 1FBIL 4M5ZL 1N6QH 2Z4QB 1MHHA 4GQPH 1G6RA 2NX5A 3BIKB 1NCNA 3B6SA 3C60A 3L6FA 1LNUB 4NM4L 1GZQA 1PQZA 1BBDH 5DD3H 2P24A 5I75C 3RY5A 3OR6B 4IHOB 4LSTL 3WXVL 1XIWD 4HGWA 4N0FA 4WW2C 2KPNA 1J8HD 4PJ9D 4Z77A 2R1XA 1WC7B 4HUWB 2HJKB 2ZSVB 3FB8A 1YY8A 1MAML 2FHFA 3LZFH 2W07A 3EOYG 5C9KA 3PGCA 1SEQH 5J1SC 4JAMB 4YJZL 1P1ZA 4WUUA 3GSVB 3W82A 3GSOA 4KAQL 2H1PL 4WI3A 4MJID 1BQLL 1JNLL 1NFDB 2AK1L 5T33H 3FFDA 1I1AC 4NZRH 1T4KB 3RX8A 3VMOA 5GS0D 5EG6C 1JWUA 2VIRA 4G9FA 1BJ1H 4WTZG 5EFIB 3MRJB 4S1RH 3MGTA 4TSAL 5E5MB 2YPVH 4APQD 5FV2A 1ZLUK 1N2RB 3HR5A 5ID0A 4JKLA 4CU8A 4X6DE 2CK2A 3MRFB 2Q8AL 5HHOB 5E4EB 1DANT 3IU3A 3DX6A 4I3RH 3TJEH 4POYA 4U0RB 1NQBA 5ACZA 1G7JA 4GG8B 3IDMA 3VFRA 5D2LB 5CEYB 4AMKL 1T83A 4K3HA 4L3AA 5FOBA 5D6CA 3GI9H 4HBCL 4R96A 4ALAH 4YEFA 3GFUA 4AM0A 1D6VH 4JO1H 2O5YH 4L4JA 5EUOA 2XPGA 2ZZUT 5KTEH 5FYJH 5FA4B 5IHUL 4WU7A 2IQ9H 1HYSD 2JJTC 3H0TA 2UZXB 2J88L 3K4ZA 1D5ZB 3C8DA 5L8KB 4QKXB 2E6QA 4G6JL 1MRFL 4LFHD 4U7SA 3X3FL 3MRCA 3FTGA 4CU7A 1GC1H 3G5VA 4XWGH 3SKNB 4HUVB 1FIGH 1RIHL 5MERB 5E2JA 4BSWA 4KDVA 4TPRH 4Z7OE 4K71C 2ORBH 5IB2A 3ESVF 4XPBL 4JPKH 2P5EA 3U7AA 4M4PA 1FE8H 3HE6C 3I2CH 3QNYB 1LEKA 4JRXB 2AABH 2BRQA 4NQCA 3QUMA 3UYRL 4KZDL 4UOJA 4U7KA 2JJSA 4TVPD 3C6LA 2FGWL 2UUDK 2E27L 4NWUL 1H3TA 1MCWM 3QH3A 4QO1A 2ZUYA 1NDGB 2MPAH 1PZ5A 5D5ME 3K8LA 1JGEB 2V7NB 3CH1B 3OF6D 2PXYC 3T08A 5GRZA 3FO9A 4DTGH 4NKOB 4XX1E 2OP4H 4L1HA 1R3HB 1PGRB 1G6RH 3DV4B 4TUOB 5IV2B 2IANB 1HDMA 2BNQE 1AGDB 3FN3A 4M1DH 4TUJA 1QBLL 1PW3A 3KPNB 4ZPTA 1A21A 1JZ7A 5IEHB 2BSED 5FGRA 3WSQH 3PWJB 4Z7UB 4KUCF 5HYSG 5DSCB 4QXUL 4WGWB 3MYJA 3FHAA 1QO3B 3TNMA 2XQYG 3VWJC 3VD5A 4UU9B 3S37X 2I27N 1RVFH 1S7QB 1U3YA 1R3IL 3FT4B 4GMTL 4E42A 1WZ1L 3U0TA 4GS7C 4HFUH 3LQAC 4RIRB 1AGCB 43CAB 2PETA 2XN9D 4PY7A 4K3DH 3RI5F 3D69A 2YD8A 3QG6A 4OGAD 4F7EA 3ZDYE 1U93B 3ZE2F 4W4NA 1CCZA 4Z7UF 4OD3H 2CLRB 4LLMB 5A43C 1SJEA 4JN2B 5E8OB 5EZIL 4JQIL 1FNEB 4OZHE 3SCMD 3KLHD 1J18A 5IK3A 4I4WB 5ESAA 3QUYA 2FLBT 4KGLA 5GS1C 5BV7B 1VEMA 2RBLA 2NQCA 1MPAL 4UUJB 5HGAA 4XRCB 1FIEA 3L5HA 1NGYA 4RMSA 2BZDA 1AGEB 1UH4A 3TF7C 5J13C 2V5SA 3EOBA 1CDBA 1ZLUH 1SMOA 3GGWB 1U3HA 4CADA 2X44D 4M9PA 3EBAA 5C0BB 2JCCF 3BPNC 5FYLH 1YPZB 4X0KB 4XBGA 1HSAA 3FFCE 3BDYL 5J6HA 1NCAH 4P3CH 2A6IB 3FO0L 2FX9L 4HKZB 3D18A 4RISL 1HXYA 3D0LB 3MFFA 3L9RB 2VJXA 3EDJA 4U49A 4GAGH 1TZIB 1A3LL 4FFWD 3WS3B 3WNKA 3JWDC 3HN3A 4FFZL 3OKEB 4F9PA 1H5BC 3RDTC 1B4JH 4DKAA 1YPZF 3KVQA 3B9KD 2X41A 1XH3A 1CXLA 5MEQA 3LHPL 2D4DA 1E6JL 2XZCH 4FG6C 5JNYB 1TJIH 1BIIA 1X5KA 5F88B 3L7FA 4EI6A 3MV9E 1A6TA 2P48B 4MXWH 2CIIB 5HY9B 3WNLA 3EFFA 4O00A 1S7SB 3ARFD 1NMCB 5IM7A 1E28B 5I1IH 4O4YL 4PGDA 5K9OA 4QXTA 5DWUL 4H0GA 7FABH 5DEZA 1MIML 1T6WA 2R29L 35C8L 4NZUL 1VENA 3QUMH 1ZA6B 3NFPB 1A14H 3BWUC 1AJ7L 3PQYD 1S7WA 3IXAA 4YPGB 3GSNL 3TO4B 3JWOC 2R0LL 1Q72L 1Q1JH 1UZ8A 4WEBH 5EB9A 2X4UB 3DUSB 3EJZD 4JFZL 3FB7A 2UUDH 2PR4H 3O6FA 3ARUA 3MLVH 3RU8L 4X6FB 2KH2B 4JFFD 4QGTA 1DDHB 1K4CB 3ZKQD 4L4VA 5J57B 4FTVD 3SKJL 3NCEB 4Z5RB 4GW1A 3KPSB 2X4RB 5GRUH 2ADJA 5D1QC 2DJSA 1WBYB 3H9YA 1YYML 1JV5B 1XF3B 3RUGB 4QRRA 4PGCA 4OSUL 1YEFL 1MJ7H 1QRNB 2VDLH 4WJ5A 2NXYC 1SM3L 1AP2B 3LKRB 2C3WA 3UZEA 4K9EL 1S3KL 1C16B 2NNAA 5DQJA 1YUHB 1FC1A 1G0XA 2Y4SA 1U8IB 4XVJH 4TNVK 3TYGL 3DVFA 2WAHA 4HF5H 1CGSH 1FQ9C 2EDBA 3WIHL 5JIHA 2XWTB 4JCMA 1MREL 3ILPA 2NY6D 4L3EE 2E9JA 1H3PL 4P23D 4YBQD 5T1LA 3TYFB 5CSBA 1HQ4A 4U6VL 3FQUB 3DXAB 2AK4A 2W9EH 1A9BA 3RUGF 3B83A 3UZVB 1G7HA 2H2SD 2BCKA 3U4BL 5AYUH 5HHME 2NY5L 2Y5EA 5HHQB 2AXHA 4JRYB 4E41A 3IRZA 1PG7H 5CMAA 1OAZH 2HT4C 1F2QA 2P8PA 3QIWA 3V6ZB 2OTUA 8CGTA 5DD0L 3AGVA 3A6BH 3TJHA 3RWHB 1QLEL 5TE7H 2CDEA 2VXUH 2QSCL 3NACH 4J4PC 2ZCLL 4MD5B 3SGJC 5JR1H 5E1AA 4NKDB 1XF2A 2V5MA 3K7UA 5F9AC 3JV5A 3EOTH 4BSJA 5E2TH 3MACL 4RAUB 3MBXL 2X4NB 1CF8H 2X70B 3T0AA 4MNGA 4X5WA 5DMGC 4OLVH 5JIIA 4WO4A 3WNPA 1WAAE 3MV11 1HH9B 3H42H 1KFAH 1A1OA 2VWEE 3FQXA 3C5SB 5I17A 3PDOA 3ROLB 2BNUB 5E2WH 1F4WL 3DHJA 2P49B 3O8XB 1MWAA 1QLRB 2PO6D 2WINA 4JJHA 4XZUB 4ELKA 2VOTA 4JG0L 4IRZH 1TETH 4NO0D 1JGDB 3NA4A 3IDYB 5E70A 1NGXA 1RUQH 4HH9B 4WI7A 4DFHA 3LV3B 3VXRB 2Z93A 1U8OB 5I74B 3RZCC 3TLRA 4PFEA 1VACB 3RVWC 4B7LA 4BQ8A 4NQED 4E5XA 4LLVA 1YYLL 1VESA 4PDCE 4JEGB 5DVOA 1AO7E 4G8GB 3CFJB 4TQEH 3N9GH 4PRAA 1MCPH 4KROC 3ZHLA 4KY1H 3G04B 3RWDA 2IG2H 1L7TL 5F7NC 3L5WB 1FHGA 3QEUA 4HWUA 4BQCA 5C07A 4ODTH 2NYYD 2P5WA 3THMH 3ZTJG 1PBYA 4OF0A 2XFXB 2B8OT 1ZVSB 5GJTH 5H94A 1MHPH 1TJGL 1RZKC 1EUUA 3BKJH 1JE6A 4MB3A 1FORH 2YMXH 5SWSA 5LGHL 3HG1D 8FABA 1I1RA 4GRLA 3WUWA 1K2DA 5J1TC 3SDXB 5IMMA 3GIZH 3JTCA 3O9WA 4DVRH 4MVBC 1N5AB 3BISA 5GXBB 4R0LC 4Q9QH 4FP8H 4MA1C 4R2GD 1IQWH 1RUKL 1XZ0B 4JKPL 4WTWA 4YHOL 3VH8G 3RBGA 3QIBA 5AD0B 2ICWJ 4MQXD 2I26N 1FYTE 5HDQH 4ZPVA 4U1NB 4JDVA 4POZD 5IJVA 5F97E 1AC6A 2E7LE 5F8RC 4FRWA 4I18C 4Q6IC 3NIDF 4M7JL 1OTSC 3H2WA 5ESVB 5CGTA 3SKUD 3KGRA 1NC2B 5T3XL 3SDXF 3LS5H 3CVHH 4P9HC 2FB4H 1TNMA 1KCVL 1QSEA 4RGNE 2VO5A 3BFOA 5TF1L 1F4AA 4NSKB 3WN5A 1YN7A 2CH8A 3QUZD 2YRPA 1IQDB 5IHLB 3B9VA 3F12B 2FLRT 4DAGL 3OXSA 1KLFA 5JHDE 1UCBH 3ARDC 4JKMA 5K9JH 3GHEL 1TVHA 1KJVA 2HT2C 4L4TE 2P43B 3WFHB 1X5GA 5E6IA 1OAKL 5FF6A 1PZUB 2NY3D 2FD6H 3QQ4B 4Q9RH 1INEH 3I6KB 4PP2B 3MZGB 2DTML 3BZ4B 4D9QD 3WHXB 3DVGB 3KS0H 1YQVL 1MFCL 4D3CL 4L8SB 4OZ4A 2H3NB 1X5YA 5FB8B 3IGAB 1NBQA 1A7NL 4QRPD 4D9LL 3BAEH 1AR1C 1RULH 4KVCH 1AI1H 5CFHA 3MUZ1 4V1DD 4IDJL 4PJBA 3M1BA 5LGJB 1XF1A 4OCYH 5E99H 5FYKH 5HYJB 2AV7A 4NT6B 1EFXA 4G8EA 4D94A 2LAAA 1JTTA 2HYMA 2B39A 2N7BA 1BECA 3RTQB 1MWAH 2D9CA 3MMEA 1JPGA 3RNQA 4GQ9H 1U36A 5H37G 4TNWK 2DQGL 1GHFH 1D5MA 5DHVA 3HNTH 1KENL 1TVBA 2BJML 1DVFD 3L3JA 3DGGB 3GMNA 3LRGA 3UJIH 4XP4L 1J1OL 3MRHB 1KCRL 2Y07H 1OTTC 2VN4A 2W0LA 2C4FT 3QJHA 1J5OH 3KYNB 1KB5L 1QFWI 4OV5A 1U3JA 4PRDA 3QQ9D 3STZB 3CXHK 4J3XA 1KT2B 4KRLB 3UBXG 1YEIL 3I75B 4DN4L 4JRXE 5GZNC 4H8WC 5FFLA 5CSGA 3QFJB 3C9NB 3OKDB 1ORSB 1LEGA 1A6ZB 4D9RE 4Y4FC 5J3HC 4YNYA 3EGSA 4HH8A 1X3DA 2YKLL 3IDJA 4OTXH 5KBNC 3GK8H 3L3OA 5CP3A 1FVEB 5TE6L 3E6HB 3QI9A 5EOCJ 1MCOH 4U0QB 1JFQH 3W81A 4F2MA 4QHMA 1U8QA 2WLYA 3K3QA 3QNXA 3ZKSD 1FPTL 1KB9K 5DUML 2Y23A 1JNJA 2Z91B 3EYFB 5C2BL 3Q48A 3UJTH 3A67H 3F7RA 2R2EB 3B2UD 1MH5A 3T0WA 4GG6B 3B43A 4UB0L 3LKPB 4FQJL 4P3DB 1QYGL 1JUFB 5FO8A 3ZE2E 1I9IL 1S7RA 4S2SB 1WWCA 1A6UH 5D7JD 2FX7H 4XNZB 4R4FH 2X5PA 2OSLB 5D1XD 3UDWC 1RZJH 1L8JA 2AP2A 2A1WH 4EN3D 3PHQA 4UILL 4OI7A 3QQNA 4B5EA 3T1FB 4LCIL 3MV8E 1QLFB 3TNNA 3ZE0F 4AJ0A 2P8MB 1QR1B 1PEWA 2JCCE 4OIIH 2GFBA 3MTRA 3QXAA 5F7MC 4NQDB 5BS0B 1J88A 5B38A 4RZCA 5IT2H 3LKNB 1TENA 4IRSD 3RGVC 3AMLA 2X89A 3NA9L 5JW3L 3EHBC 5SWZA 3BEVB 5EWIH 1AR2A 4X98A 2OMBA 1ROWA 3HC3L 1TPXB 4G8IA 3WS6C 3VRLE 2IQAB 2D03L 1UM5L 5IV2A 4JFED 5E8NB 4HK3N 3FOLA 4OQ1A 3QCTH 4PGZA 2IPUK 4JFXA 5IW6A 3HC0A 2P8LA 1RZIA 1OQOA 5D7LB 1HHIB 4MNQD 3QYCA 3OKLB 1GVIA 1KCKA 3GMMA 4KU1A 4NNYB 3DVIA 2QSVA 2GTWB 3OKNA 4F3FB 4EDXB 4P2OC 2DQFB 3AY4A 2IAMC 5HYIA 5EIIB 3G6AB 5FHAH 2VQ1B 3ZZ1A 2R0KH 5DHVH 4NO2B 1ED3B 5EBLA 4NRZA 5CJOL 5DI8A 4MJ4A 2D9QB 5FDWA 4YAQB 5CCKL 2GITB 4GRMB 4Y19B 4NFDA 1MCDA 5D72H 1UADC 2YHGA 4NHUB 1S7TA 2R4SH 4LPTA 5E2UH 4UAOB 4QXGH 5IKCB 3IFOA 4LVNB 1BIHA 5CGYC 5I73B 1F4XH 3MLWL 1WWWX 1AKJD 4U3HA 2YEZB 2VZVA 4L9LA 1QHOA 4S1QL 1DL7H 3PV6B 4JVWA 1HKLH 5K9QI 5CEZE 3FRPA 5EOCL 5CP3H 1UJTA 4HKZA 4U1SA 2YS4A 4LHUA 5FKPB 4EOWH 3DURB 3SDYL 2NR6D 1BEYH 3BKML 4OLZH 2Z8WC 3GSUB 4LQFL 3KPSE 3VXPA 2MCG1 3U1SL 2DOCA 3ILQD 4O2EA 3AXLB 3VXMD 3OKEA 3QDJA 3P11L 1CZ8H 5DRNA 5I0DA 3V4PL 3TN0C 2D31B 4XNMB 3HNSL 3V0VB 1GIGL 3ARGB 1EDQA 4GKZA 2ZOKB 1QSFB 4XC3L 1I9JL 5LG1A 1EXUA 3BSZH 2NY2B 5C0JA 5J8OA 4PJ8B 2BVOB 1LO3L 3S97C 1D5IL 5A16B 3CPLB 1FJ1B 3QUKB 1TXKA 5DXWA 5F3BA 4RGMC 1FNGB 1IKFL 1Z3GH 3MLUH 3GMQA 3RA7H 5MENA 3AS3A 4JM4L 5D4QA 5ALCH 2VH5L 5LGKA 1JGVL 5KSVA 4NCC2 1M6OB 5DO2C 3UYPA 1SBSL 1HHKB 1J0ZA 4OZGB 3W0WE 2ICEB 5BO1H 1IAOB 1BGXH 5DMIL 1M71B 1T2QH 3EOAA 3OSKA 5CJQL 5L2JA 4AY0A 3CFEA 3IFNL 3PWLA 3QXDB 4JM2A 1CLZL 4LLWB 3HB3C 1FSKB 1B2WL 4KC3B 4DVBA 1ETZB 4XCYB 5T3XD 4O51B 1EHLH 4YHLH 2VQUA 4HKJB 5DD5H 3WJLC 2A83B 4KDTA 4B50A 1T20A 5ICZA 2A9NL 2NY4D 1J1PH 4X6BB 1WBYA 1Z0MA 4OCRL 4OZGF 4RFOH 2Y6SC 5JUEL 2DQEH 4LIQE 4I5BA 3FT3A 4XBEL 4F33B 1YJDH 5GGVH 3MRRA 1NL0H 3KPLB 2DL2A 1RZFH 1CR9L 3IU4H 3QEQB 4KI1A 3NGBC 2OMNA 4LCWB 4HHAA 3U4AA 1URLA 5DQ9A 1DP0A 3LB6C 4K7PX 2LU7A 3OKKB 4M3JA 4NN5B 4OFVA 5ISZB 5C0GB 1NLDH 3K1KC 3MBEA 3DSNA 1NMBH 4JO4L 2YXMA 4LMQI 1IM9A 3SGDI 5I1EH 5JXED 1MVUA 3LN4B 4KRNA 3MJ9L 4WIQA 2X4OA 4ZS6D 2DIAA 1Z9OA 4YDIH 3DX7B 5BW7A 4ZDHA 4NJ9H 4NRXB 2Y9RT 3UTPD 5KVFL 2KZ1B 1MI5B 3F58H 4NDMA 2YK1L 3QRGH 4KK8C 2DQUH 1CQKA 4JHBA 4N0YH 1N59A 2ICCA 5IHBA 4CMMB 5GRYA 2FJHA 4CMHB 1X7QB 3BQUC 1WIPA 1R6VA 3O4LE 5KSAC 4Y4HB 4F7TA 1MHEA 3NCBB 3TWCL 5IB4B 5IMLA 3S96B 3MV7B 3CMGA 5HDLA 3EYQD 5TQ0L 4U6YB 2VDPH 4D2NA 2ZPKH 1EH9A 3BP4B 2I5YL 3NIDE 2QR0A 4UT6H 5B8CA 4HXBH 3Q3GA 3AB0B 3ROLA 4QRSA 3CVHB 5KVGL 3SDXE 2ESVD 5TFSH 3T2NH 1J8HB 1NANI 4PJ9B 1FLRH 4XC1H 2FCBA 3VRJA 4PJ7A 3JV6A 5DJZA 2NXZC 5JQ6H 1CDHA 4JHAL 2IFFL 2CGRL 5C0NC 4JO3L 4XPGH 4YHPB 4S0SD 1LEIA 2ED7A 4HK3J 1OCWL 4Y5XA 1A64A 5IVZB 3GEWB 4TNVF 5C6WH 1BQHB 1AFVH 1AY1H 1HE7A 1OWRM 3KJ4B 5C0AA 5DMJB 5C1MB 2DMBA 4I3SH 5L9DH 1T1WA 4WI9A 4HWZB 5EBWB 4PS4L 3H9SE 1G7PB 5E95B 4WU5B 4NKMB 1FL5A 2D7MA 4HS6B 1I8KB 1P69B 2XKSA 5IHZA 1CIDA 5FYJE 1WT5C 4QRUB 1FGNH 3I3BA 2OLDA 3GSQB 4EVNB 5EO0B 1I3UA 3NCYS 3WD5L 4JLRB 1QP1A 3WXWH 1PYWB 1CFVH 3WE6B 1UJ3C 3KHQA 3QCVL 2X1WL 3IFLH 1RMFH 3B8YA 1Q9OA 3INUL 4GW4B 4Y1AE 3U4EA 2VZOA 3ARTA 5EN2A 1AC0A 4J3TA 5MP6L 4M3KB 4R97B 5D2NA 3MSPA 3U30C 3MV01 3RX5A 1PKQA 3ARYA 4LCUB 4YIQB 3LKOB 4Z95H 2D7PA 5JIKA 4LOUC 1D9KC 1A2YA 1MJUL 4P5TA 1E27A 4ZFOA 3SE4C 3CDYA 1U8HA 1T2XA 4HUXA 1IAIM 1N6UA 1Y18B 1IM3A 3MXWH 1VDGA 4WY7H 4ODHL 1W72A 2LFGA 3EO1A 1CK0L 4OBSA 4UI2A 4XHJD 4Y16B 4WW1B 4I8DA 1NGZA 1T89A 4BZ1L 1OWWA 1XR8B 2R15A 2J8HA 4RAVA 2LE9A 1IZKA 1U8LA 5FK9B 2NX5E 4HV8B 5EZJA 4L29A 1GPOL 1OLLA 2XI9A 5ID1B 5I1AB 3QWRA 3CH8A 5B4MD 1VGEH 4G6ML 4HKXB 3TZVA 1IAKB 3HI5L 4OI8A 1QNZH 2R39A 3T4YB 2BVEA 1U8MB 2B7DT 5JW5A 3ZL4L 1N4XL 2XTJC 4XXCC 4WUUE 2DM2A 2G2RA 3U9PL 1I7UB 3WKNA 4JKWA 1LE5B 4TSBH 2AKRB 3QEHB 1LDSA 3ZE0E 1QKZL 4YDVB 1UM6H 4DK3A 3BIBX 1NCDH 3BN3B 3VGAC 1V3MA 4I0CC 5HHNA 3DX9A 4G9FE 3SO3C 2X40A 1IGCL 4WENB 3EFDL 5B39G 4E9LA 4HPOL 4PGEB 3TA3C 3V0WL 3U9UB 4BSVA 2A2QT 3KYNA 4OZIB 4M7KL 7CGTA 4LVOC 2NCMA 2WBJD 4ZFGL 4Z0XB 5BRZD 1KACB 4WRLA 3BN9C 1OSZB 4N0UB 3RP1A 4RBPK 5D93B 3H7LA 5IGXL 5KN5A 5L6YH 3S88L 5C0IA 5BS0E 3DTXA 2EYTB 4EBQL 1Z5LB 3MOQA 1H3UA 4GAJH 2NY7L 4CVUA 4JDZA 3VA6A 1BX2B 3E6HA 4YX2L 4XBPA 2XG4A 3TBYA 1CL7H 3U7YL 3ECBB 1MOEA 1CQYA 1OB1B 3O3AA 4KUZH 3F7VA 5IJKC 3BE1L 2X1OA 4R7DB 5DK3A 4HS8L 2B1AL 3GSWB 4JDTH 3HMWL 4NYLB 5IQ7L 3HI6H 4WI4A 1Q9KA 4UT7L 4OAWA 1I1AA 3EDFA 3A0OA 1P2CA 5LKNA 3HZYB 4HWBA 1E4KC 2W60A 4Z76A 5J0BA 1JYNA 1KN4H 1N8ZA 1OM3H 4HUNB 3ZSSA 2LAGB 2E7LC 4KQ3L 1Q0YL 1CE6A 4K94H 2I9LB 4G43A 4GMSH 1MCWW 3K8MA 3G08A 3T3PF 3O3UN 1RIUH 2FO4B 5FA3B 4LQ1A 4CUCA 1WZMA 1MHCB 3TBWB 4F9LA 4NQCE 4RGNC 2E9BA 3T0DA 4G9DB 4J3VA 2WIIA 1DQLL 4M6AA 4JG1H 4XMKH 5EO9A 1WFNA 4AZ8A 1JF6A 2Z35B 4XNYL 4Z6AT 2GK0B 1W72H 4JY5L 1UEMA 3WUWG 1G1YA 4NZDA 3FCTB 2V2TB 3PQYB 5GRWA 2XWJA 3JTTA 3FHQA 1EO8H 1KPVA 3F7YB 1D6EB 5D7IB 5CD5D 3Q5TA 4XHQA 4KI5F 4LSRH 4IIQB 2OR9L 4YDJB 1FNAA 4JFFB 5I1KL 3KJ6L 3VXUB 1ACYL 4JREB 5EIVA 1VGKB 3BDXA 5DGRA 3D9AL 4Q7DA 3QIUA 3ZYJA 2CR3A 5C0CB 3GUTB 1A7RL 1WWAX 1B9ZA 5K59F 2ZNXA 5F9JA 2GTWA 4RWYL 1TQCB 4WWKC 2CDFA 3VFPB 2AQ3A 4PJGA 3DMMC 3EYSH 4H26B 1T21A 4LF3B 5CWSA 4POUB 5CJ8A 4FFVD 1NAMB 4QNPF 5ACLA 2VXSL 1A5FL 2PXYA 2CLVB 2B2XH 1C12B 4RRPA 3QCUH 1A6WH 4U1JB 1I1YB 2Y7QA 4ZNEA 4P2RD 1FZJA 4U1MB 1H8OA 2ILLA 1BQSA 4HZLA 5I1HH 5JLZB 4P4KC 1JZ2A 4XAKE 5CBAA 3VFTA 5J12B 1AHWB 2AEQL 4O2FB 2DICA 3AS0A 4RBPH 3VGDA 3D87B 4CNIB 3IDUA 1C5DB 1IEAB 3D39A 1E4XH 2NW3B 1KNOA 3SGKC 1AQDB 4F57L 3CCHB 4P5KA 5J56B 3HPJA 2PW2B 2J6EA 1JHKL 4NQVA 3QWQB 1FAKT 2VMFA 4M48H 5FUCE 3RPIA 3ULVC 1ACZA 5HGDA 3OQ3B 4A6YB 1X4XA 1BZ9A 1BD2A 4RX4A 2PO6B 3CSYB 2R1YB 3ARGA 2B4CC 4XP1L 3B5HA 4LSPL 5C6PB 4CN6A 1T0PB 5EU4A 4Z7VA 4UV7H 4MAYB 4OUOA 3RWEB 3UO1L 4OD1H 1A6AA 5D7SL 3UX9B 1BVLA 4HUMB 4RA3A 2IBZX 2C4XA 4MCZA 3V7AG 4GRWH 1IMHC 3G6JA 5FUZL 4XPHH 2JTDA 3LD8B 2Y36H 1K8DA 3W9EB 1IC4L 2XV6B 3ZHKA 1IFHH 4EI5A 5C9JA 1CGVA 3LKSB 3QDGE 5KG9B 4FXKA 25C8H 4HCRL 2EZ0D 2H9GA 1TFHA 3EAKA 1IGTB 3Q6GH 3O2VL 4UBDC 3D85D 4IRJD 2R2BB 3RVXC 3BUYB 2H26A 1F00I 4LRNH 3WLBA 3VG9B 3V9FA 4M7ZC 5IP4A 1RZ8B 4L4VE 1F3DH 2ZKHH 4XPTL 2Z9TA 4YR6A 4DKEH 5EIQA 3MLXL 2MTPA 4JFDD 3O6LL 4Y2DC 1JN6B 4G3YL 4X4XA 4OLEA 2VL5B 3HG1B 2DQDL 4QRRE 3RWFB 2FIKA 5TQ2L 3R1GL 5CGMA 4M7LT 2C26A 3OKYA 3UAJD 1N7ML 4Z7QF 3GKWL 3PHSA 1FGVL 4MJ6B 4I0PB 1IC7L 1BZ7B 1BM3H 5EORH 3QA3A 3OG4B 2DQJL 2M2DA 1I3RA 4J2XA 5DJXB 2BC4A 2FEDC 4NC1E 4PRIA 5F1SA 1KJ2L 2AK4E 5GRJH 1I4FA 4RWHA 3D0VB 4C58B 3BPCA 3V5DA 3GI8H 4MS8C 3JTSA 2DTSA 4U3CA 1ZK9A 5L7XH 3GNML 1CLOL 1J05A 4NRYB 3QDHA 3VG0H 5EU6B 3QUZB 4MA8H 4QGYA 2EDKA 2IADB 1FLTX 2LTQC 2XA3A 4G5ZH 1FH5L 3PWPB 4X99A 2BOBA 1XGUB 4AIZB 4H5SB 5CIPA 3SDAD 6FABL 2DDQL 1U41A 3NFNB 4UDUB 4XCCH 3TH3T 2B5IC 1HI6A 3PF2A 2HFGH 1I9RL 2E7MA 3MJ7B 4OBRA 4LCCC 4ZUSA 1LHZA 5FYKE 4G80B 3T0EC 3IETB 3PWVB 3MOAL 4DCQB 3TESA 1A4KB 1LO2L 4R4ND 1U91B 3QDAA 4HX1B 3RJQB 3G5XA 2BVQA 4RFNB 3IAGC 5KOVC 4P2QD 5DFVD 1NANH 2YBRB 4P0DA 2UWEA 1XIWA 2VAAB 1MCLA 4ENEC 4RGOL 5HHVL 4QHLB 3LDBB 1YEKH 1JYWA 2J6EH 1CU4L 1OAQL 2OJEA 4GBXD 3ERYA 5DJ2B 3MRQA 2CMRH 4P5MA 5JTWA 3WFDH 2GUOA 3I50L 4OD2A 4X5LA 1JWMA 1PG7W 3FB5B 2D3VA 4HQQH 4MJIA 1S5IL 4QTIH 3MX0A 1HHHA 3LEVL 3S34L 5IVZA 3PL6D 4J4PA 5C08B 3SGJA 1NGPH 4JGJA 4FFYH 1U8JB 4NPYA 1FZOB 4YXKH 5DJAA 1F13A 4GKNB 3VD7A 3DO7B 3LCYA 5IBLD 3CFKB 1J10A 2G75A 5C07E 4APQA 2YR3A 4LHUG 1DQJA 4MD4A 2EH7H 2JB6B 2VISB 3STLA 3W11C 4EIGB 1CICC 5GGSB 1X5LA 2VLKB 2H6PB 2V2WA 2FIRT 3BKYH 2ATKA 2R0WH 5KVEL 3QP3A 3MRBB 2JIXA 3N85L 3QUXD 4N0CD 3JWDH 1UT9A 4QRQA 3ZLQC 4OUUA 2X09A 5E7BA 1FYHB 4I48A 4GW4A 1KC5H 4P46C 4YFLF 4U2YA 5HHPA 5TE4H 3HZMB 3IFPA 1IL1B 3RZCA 1XGTA 1I8IA 5J1AB 3GMLB 3BXNB 4RMWA 5LAXB 1ONQA 5GZOD 5BMFL 3SE9L 3SDCD 4LVHC 1EBPA 3BP5B 1IAII 3PE9A 2F5AH 4K23H 4W6XB 4NN7B 3BP7A 3FN0H 4YHNA 4P4RB 5F1IB 4ZFFA 1I1FA 3TVMC 1KLUA 5D1XB 4MAUL 4PV9B 4PB0H 4LLQA 5CAYB 5F6HJ 4H1LH 5E9DA 3RBSA 2HFEA 15C8L 3JWOH 3FJTA 5GSVA 1LMKA 2EEBA 1N3NB 4N90D 1PD6A 3ARED 2BRRH 3CFDA 1GOGA 4FQLH 3QZWB 1HILA 4TULH 2DIJA 3V4VH 4UNVA 2CRIA 1GGCH 1ZHNB 1P4IH 3FZUD 5CIPH 1ZANH 4MXQD 1ND0B 5ID1A 2YUZA 1UWXK 3E2HC 5ADOL 4H20L 5LBSH 1HIMH 2GQHA 3EYVA 4Z18A 4JR9H 5BVPH 1ZS8A 3SJVB 3ABZA 4K55A 4PJBE 5C09B 3NH7L 2OX5A 3PGDB 4YHML 1RJLB 1T0MB 3V79C 3ARBC 1W2KT 1MLBA 3VI4F 2CXGA 4JZJC 3VDAA 3NMEA 2OI9A 1EGJA 1LWRA 3CUPB 3T3PE 2ADGA 1HHJB 3M17B 1XFPA 4KPHH 4PBXA 5DVKA 4B53A 3FOMA 2EDWA 4Y8AA 4BQBA 3X11B 2DL9A 2HRPL 1KIPA 3C5ZC 4HIIA 3L7EA 3HC4L 5GGSY 4ZTOH 1IGFH 5HDBF 3UJJL 2HKHH 4R26L 5IVOA 4K7PL 1CFBA 3L3DB 1CFTB 1PG7X 3T0XA 3MCKB 4YHKL 3ZYIA 1G9MH 4GUPB 4IOFD 5EA0H 2OXGA 2BNQD 4HKBB 2XN9A 4KK9C 2VL4A 3HE7C 4OLXH 1AXSA 3ZHDA 4YH6A 5IVXA 2O61B 2O5XH 1X6LA 1CLCA 4Y4KB 1HWGB 1YQ2A 4XCEB 1MRCL 2UVFA 2VXTH 4LLDB 4PLKD 2BVPB 3SCMA 2YD9A 3IB4A 3NABH 5EOQL 4M61A 3MRKB 5E8DL 5DYOA 4NO5B 1C08B 1RURH 3O11A 2QQNL 2WBWB 5E2VH 1LDPH 4ONFL 4LLAA 4RFEB 1MCCA 1DBAH 4HBQA 1OB1A 2WNGA 4YDLC 4JY4B 3MREA 3QNZA 3CFBB 1RY7B 5K59E 5GQBA 1FRGL 2B20A 4JPWH 3CFCH 5C0DB 5JW4N 2DD8L 3QPXH 3CZFA 4KKLD 1OAXH 4ZXBB 1P7KA 3BH8B 4QNPE 3MLYL 1FNHA 2YPLB 3S3SA 5J6GB 1A9EB 5F7LB 5I1GL 2Q7YB 3V6OE 2F53D 4NC2B 5DVNA 1RK1B 3OGOE 5C0CE 1CN4A 3V95A 2YSSB 1AIFB 4R7NB 3B9KA 5DFTA 1KPRA 4OQTA 4UQ3B 2OJZL 2DQIL 4XCFH 3FFCD 3MRDB 3M07A 1LO5A 5ALBH 2A6KA 3TT3H 4WGVB 3UROR 5IB5A 3MGOB 1CD9B 4PLJC 4I2XA 4LARL 4HS3B 2YUVA 3H6JA 2MSPA 2NY0D 1IARB 1FV1A 4WW2B 3ARFA 2J8UB 3BIAX 4YC2C 1KYOK 2GK2A 3WFBH 1D5XA 3FMGL 3MODL 1F90H 4C4KT 5J4MA 1RZKH 3QWOA 5SWZE 4ZAKD 3RAJH 2HRLA 5SWQA 3PQYA 1UH2A 3PDDA 5IEKA 3C60C 3LIZL 5C71A 2BSRA 1DBBL 3MV9D 4ZUTB 1KTLB 4OJFH 4PG2A 1VFBB 3FQWA 1MCEA 4KK6D 4WW2F 4K3JH 2J8UF 4Q2ZA 1NC4A 4JFFA 5FUOH 3GO1L 4FTVA 3UDWA 1UXWB 2AJSL 2AJVL 2DWDB 3LMJL 3BKCH 3MO1A 5I76B 5AG8A 1UWXH 2C3XA 2NY4B 3MOBH 5ECJE 5CSZA 4HD9A 2XOTA 1T22B 4ERSH 1FCGA 3NCJH 1EGJH 3C08L 3RY6A 1KV3A 2W0PA 5I1CH 4AT6B 3O3EB 2CRZA 2GT9B 3MNWA 3GBMH 1J0JA 4YGVB 1U8KB 1YEGH 4WVRA 3RVTC 4PG9A 1AD0B 4X7CC 2YRLA 1MVFA 2D7OA 4J3WA 1UKTA 1S78D 1F4YH 2Z31D 3RGVA 1ZA3B 2SEBB 4P23A 3QDMB 1SYSB 4YZFE 3V0AC 5GISH 4ISVB 4ZTPH 2FEEL 3HMXL 4GH7B 4LCYB 5T5NF 5E00A 1DBKH 2CR6A 3OGCB 2IH1B 3QQ3A 4NUGL 3V6FB 3LAFA 3L1OH 1MJJA 2GJ6B 3L95B 2G60H 1QFUH 1MFDL 5KAQF 2ZUVA 3LH2H 2O5ZL 1EEZA 1T83C 5EU3A 5E08L 4IM8A 3DX8B 1P7QB 3REVA 3ZSTA 2GJZB 2DBLL 4JGMA 5GGTH 4Z7QE 1R5IB 4WCYH 5CHNB 1MFEH 4LPXA 5DRWB 3OKMA 4P2OA 2R2HA 5M7QA 3HE6B 5D1ZD 2QHRL 1YN6A 1KEMH 5HHMD 4RNRB 3BRFA 1OARL 5IBTL 3AU1A 4G8FA 1REIA 3KYMA 2ZG1A 3MR9A 5GHWH 5IOPA 4PJAA 4BZ2H 3GMRA 2WP3T 3WCYA 1JZ4A 1VADB 5EC2A 4OLWL 5T1MA 1RFDH 5ANMB 4LNRA 4NO0A 5MENE 5F7EH 3VXTB 1EVUA 4H8WH 5J7CC 2XZQL 4DKDC 4KRPD 5K9QG 1P4LA 3BW9B 3P0VH 1S7UA 4PJGF 3CLEL 2HTKD 3V4UH 3C6LC 5I66B 1CTOA 2NZ9D 4NQEA 1BVKB 1R3KB 4YE4L 4X6CA 1UQSB 3HUJA 4WNQA 5IB3A 4JANB 3JUYA 4FQ1H 5EU6E 3VXQA 4LVEA 4YHZH 5IQ9B 2X05A 1XCTA 3VWJB 3S36H 3EKCA 3PWPE 5DUBA 12E8L 3UTQA 4YDKL 1B6DA 1MSPA 4GS7B 4HK0A 3C2AL 1FN4B 2NY1C 3TH2T 4NQUA 1ULVA 1MQKL 4KK5C 4UNUA 5I8OH 4OZFH 2OZ4L 3EO9L 3TN0A 3U6RA 2GCYB 3DUUB 1NCUA 3B5TA 4FXGA 1K6QL 4XVTH 1IGIH 1CI5A 1U2CA 2VLJB 1A4JA 1MNUL 1W0WB 4HPYL 3HI1B 5IFJA 3S9DB 4UTBL 3S35H 2GIYA 3S7GA 3MA9H 2F19L 5JOPE 5ILTL 5GPRA 3ARRA 2VDQL 3KPOA 3DPBA 1VPOH 5GS1B 3RKDD 1SEBA 4NP4L 4L8BA 1L0QA 3DROB 4PR5B 3KPRB 4U1HA 4WV1B 5J13B 1JTOA 1M7DB 2VDML 4JO2H 4Y5VB 1CT8A 2EEAA 2AJZB 3O2WH 3IS0X 1KGCE 4M6MH 2FSEA 1A7OH 1T1ZB 4LEXL 4XMPL 1XGQA 1IAMA 3SPVB 4AEFA 3U2SA 1NJ9A 2WANA 2XT1B 1OD7A 4M5ZH 4DWHA 3W5MA 3D48R 5D6DC 4Z7VF 3TPKA 3OR7A 3UTTB 2VITA 4N9OB 1S9XA 4LKXA 2ED8A 2Q6WA 4NM4H 3WJLA 1FYTD 4U1LA 2APXA 1H5BB 4FQXA 3RDTB 4FABL 1DLFL 4UDUA 3F5WB 1U3HC 5CZXC 4NZTL 2EDLA 4KVNL 1MAMH 5F3HA 3T1WA 4PRPA 4X4ZA 2VLKE 5MHSE 2WIMA 3IDIB 4O58L 3FB6B 5FO7A 3Q1SL 4KAQH 4YXLL 5I2IB 5KSBA 4W68A 5D8JH 1JNLH 1MY7A 1LP9B 5JHDD 2EYSA 3WNOA 1A6VL 4PGBA 2AK1H 2L7UA 4QRPA 4ODXA 4L4TD 4F9PC 3CU7A 1SJHA 5F89B 5HI3D 1ZEAH 4PJ7E 3K2UL 4H1LB 1C5BH 4V1DA 3QPQD 3WDJA 5IF0A 2H32A 3BP6A 3R8BB 4GKSA 1HN1A 1L0YA 4NQXA 4MCYA 1G7QB 1MF2L 5HHOD 2IGFH 3ULSA 3D1MC 4PRNB 3BRGC 1HXMB 1INDL 1WZKA 4IOIB 4BM7A 1BAFH 3VW3H 4LLUA 3G6DL 1LP9F 1QFWL 3VE0A 3BO8A 3T65A 3OJDA 1DVFA 4MA3B 3RY4A 4HWEL 1FC2D 1N6QL 5E8EB 5D1QB 5C0AE 5KSAA 2EDXA 3JV4B 4TTDD 2DLHA 1U8JA 5IVNA 1BPVA 1R3LA 4X7FC 5KANI 4ODUA 1H0DA 1GCFA 2Q86A 4GKNA 3H7BA 1RZGB 4IS6B 1ORQA 1BBDL 5DD3L 3UPRB 1VKXA 5IHUH 5GIRA 3O6FC 3ESUF 3K1DA 3VI4E 5EZLB 3SDDD 2J88H 3FO1A 3WLWC 1I7RB 1R24A 1GSMA 2F15A 3DYOA 4G6JH 2IPKB 2AV1A 1SEQL 1MRFH 3G5ZB 3X3FH 4CN4A 5HDBE 1Z6JT 4HEPG 1EAPB 1CD0A 3KWWB 4JRXD 3C8HA 5T33L 5DJYB 5D2NE 3L3HB 3WHE0 4XPBH 1F8TH 2VKWA 3GMLA 4BKLB 3MGAA 1PKQE 1P9MC 2EO1A 1T1YA 1DR9A 4LKCA 4D9RD 3D25A 1TMCA 4ZS7L 1A6PA 3UYRH 4NKIL 3TIEB 4KUCD 3GSNA 2YPVL 5D7JA 2FGWH 3MA7A 4I77H 5AYQA 3ZTNH 4S1DC 1S9WA 4NWUH 1U6AL 1LE9B 2J2ZA 5F96L 5ICXB 5CJ5A 4EN3A 2V9QA 3K4AA 3IKCB 4I3RL 3TJEL 2IAND 4PJCB 3B9DA 5C0RH 1WBXA 5J9PB 3VWKD 5I1DA 3BVNB 1WBZB 3KPTA 3QIWC 5TGBB 4PJIA 1Y6KR 3JV0A 4ALAL 3VFOB 5I18L 4ZQKB 3MLTA 5F7FA 2O5YL 3IDNA 5KTEL 4UIMB 4MWFA 3CX2A 4MDJA 2DQHL 4IRSA 4IJ3C 4YUEL 2VABB 2H2PD 5SX4H 5INDA 1VEOA 2VTFA 4PJCF 5EUKA 4WO4C 1H15B 1ZWIB 3WIHA 3MNVA 3HLAB 5CD3B 5F7KC 1NSNH 1R3IH 4GMTH 1CD8A 1QA9B 1WZ1H 1MFBH 1FZMA 5FXCH 5F7DA 3VD3A 4JFEA 1GC1L 4Z7WB 1KOAA 5JDJA 1FIGL 3RWJA 2UYLB 4TPRL 2FWOB 2UY7A 4N9GB 5IG7B 1YEDB 2FJGA 2J5LC 2R23B 3B3IB 4JPKL 4KROB 3C8KB 4F7PA 3EDKA 4KJWC 4MNQA 4PGJA 1JBJA 1OSPL 5EZIH 3C5JB 1JZ6A 5IMOA 4QOKA 2H32H 5DRZB 1AH1A 4HXAH 1XAUA 1UWEL 2R0ZH 2BMKA 5C0BD 4GUPA 4WI5A 1A3QA 3VFNA 2MPAL 3HPLB 1I7TA 2XACC 2DAVA 3J7HA 4R0LB 3TFKD 4X9GA 3VXSB 4XTRC 4MA1B 4DTGL 1ZHKA 4HZAA 4G42B 5HPOA 2OP4L 4JQXA 1JI1A 4JHWH 3ZE1F 4M1DL 3PGFH 2BFVH 4I18B 4Q6IB 5CLTA 4AIXA 1Q9WB 2YUWA 3WSQL 1NDMB 1AKJA 1G6VK 1OT2A 5EBMA 5HI5C 1PSKL 4ZNCD 5DJCA 3MJ6A 2X4TB 2OTPA 1P4BL 2LV4A 3N0PB 4ZUUA 1E6JH 3UPAA 2MOVA 5IB1B 4WHYH 3QIBC 1Y0LA 3ARDB 2WY3A 1CGYA 5GRVK 4I9WE 1TZGH 4Q6YA 4JPIB 2C1OB 4OD3L 1TIUA 2IBGA 3VXMA 3V52L 4O4YH 4GAYB 5L2KB 1FP5A 3RVVD 5DWUH 4GRWE 5JOFB 1CDJA 3NN8B 4AH2A 2C7UA 2EC9T 1NBYB 2R29H 2QQLL 1AJ7H 1A1MA 5I1JH 3F6LA 3GSNH 2CJUL 3WN5C 2R0LH 1Q72H 5ERWA 3WNNA 5B3JF 3H3BC 1FVDA 2HVKA 3GMPB 5EPMA 1JPFB 1T04A 3KPSD 3O3DB 3DETC 4OM0L 5FYLL 5I19H 3O3BB 3I6GA 4CW1A 1OGTA 3SKJH 1QR4A 2HG5A 1NCAL 5AAMA 4LU5L 1B0GA 2HJFA 2F9BT 4LGPB 1YY9C 5IVXF 3IYLW 4C56B 1LO0L 2G9HB 3CGTA 4M1CD 3PHOA 3TBSA 5CBEA 4OSUH 1YEFH 2HN7B 4Y7MA 3MJGX 4GAGL 1JGUL 1SM3H 1SHMA 2BOCA 4NOBA 4K9EH 4K8RC 5TF0A 4PJEA 3TYGH 3ES6B 5LVEA 1B4JL 1FO0B 4KKBD 1BZQK 1I75A 4PJXA 4D8PB 3DXAD 1RSFA 1HH6B 3QJFB 5FGCE 4LFHG 3WIHH 2XQYK 4N8PA 4QY8A 3U0PA 1YNTA 1EEUA 2DM4A 2DYPD 5K9KB 4MXWL 5IBUB 2BSTB 4KXZH 1CFQA 3TBTB 2N7AA 4JRYD 2BHYA 4NNXB 4Y4FB 4PJGE 1M7XA 2ITCB 1NKOA 2NY5H 3EYOB 3BT2H 1TVDA 3D3VB 2ARJQ 4Y5YA 1AD0A 1XF4A 1RJYA 5EBGA 5FKAB 1A02N 2I9TB 4P57A 2APVA 2VZUA 3MRPA 1ZA3A 4R8WH 4H25A 5JXEA 1Q1JL 4WEBL 5T1KB 1KG0B 4S0TD 2QSCH 2E9WA 3SE8H 2ZCLH 3DRTA 4KV5F 3QO1A 2AXFA 1KCSH 4OZFB 3KDMA 3MLVL 3MACH 3NCMA 2IH1A 4YBLC 1INQA 1LD9A 1OGAB 2JJVA 3O8XD 5DK2A 2YPKB 3MUGB 3SDAB 4YFEA 4QHNB 3QI9C 4HIEA 1Z0NA 3D39E 3WEXB 1F4WH 4GT7A 1FG2B 1MJ7L 2VDLL 2QADC 2CKBH 2XZAH 4TVSa 3T4AB 5JDSB 4CN1A 2VSCA 3KNBB 5ENWB 3VXRD 4XVJL 3PABA 5DRWA 2P47B 2A77H 2X42A 2PUQT 3CSBA 4RNRA 2VLJE 1KN2L 4Q74A 1KTRL 5J11C 4QTHA 1KB5A 4G8GD 3VXNA 2ESVA 2PCPA 4QRTA 3KG5A 4Z7VE 5M95B 1QVOA 2EEDA 1ZGLM 3GHBH 1KXQE 4N8VA 4GLRH 3O4LD 4FQPA 3W5NA 3WUZA 2B1HH 5FYJU 1R5WB 4L8CA 4P4KA 2BSSB 1EO7A 3CMOH 2BDNH 3EYUH 4DJMA 1JWSB 1Q8MA 1W0VA 5D7KE 2VXQH 3NACL 3O41A 4XNQA 1N0LA 4U1IA 1J0YA 4O02L 3EOTL 3BYYA 4LHJB 5E2TL 5CZVL 1UQSA 2CUHA 1CF8L 4J3SA 1TQBC 3LSOA 4OLVL 4HJJH 3CIQA 2KDGA 5D70H 2IALB 5F93C 4GAFB 4D0DA 3G9VA 1RUKH 1WQVT 2ICWA 32C2B 2D0HA 4YHOH 2IAMB 2I24N 4PY8J 3T77A 4FQCL 1UB6B 1UXSA 1NC2D 2OQJB 3TV3L 3BDBA 2E7CA 1YJDC 3HKFA 3IJSA 4R3SB 4HUUA 4M7JH 1QTYT 3QUXB 4FMKA 1MUJB 4IRZL 1NMAH 1RUQL 4LK4A 3KPMB 4LSUH 4XP9L 2PF6A 4ZYKB 5TJWK 1LP9E 4JVPA 3V5HA 4X6DB 1CG9B 3RVUC 5J06A 5TF1H 4NOFA 1R5VB 3WL9B 1MAKA 2CO7B 4PRIE 2W65B 5AUMB 2A6JB 4U1GC 3AY4C 3SDCB 5BOZG 2VUYA 2A38A 4CJ1A 1ZSDB 1BFTA 5I9QC 3GHEH 4PJAF 2EO9A 5D9SB 3HZVB 3ZYZA 4TQEL 3N9GL 1MCPL 2Q76A 3BPLC 5C0EB 2H8PA 4KY1L 4M9OA 1JRHL 1MRDL 5DD1L 4LSDA 3FQNA 4ODTL 1MQ8A 4Y1AD 4MDIB 3THML 1AGFA 4X6DF 4BH7A 5GJTL 1YQVH 4KKAD 1MFCH 3DV6B 1CLYL 3MRNB 3GMOA 3O6KH 1MHPL 4AYFA 5BV7C 3OKOB 4D3CH 3JUZA 1FVCB 3NPSC 1FORL 4DZ8A 1VFAB 2XY2A 4XVUC 4ETQA 5HYJD 3AREB 1A7NH 4PJFA 1WIUA 4L9LC 4DVRL 3O0RL 3RTQD 1A7QH 5HBBA 2HMIC 2HJLA 4XH2A 2F5BL 3BH9A 4FP8L 4X6CF 4Q9QL 1IQWL 2D7TL 4LBEA 1A1NA 1IBGH 5ACMA 4EKXA 4JHZA 3GRWL 4HIHA 4MX7A 3S5LB 5BZWB 1J8KA 4LP5A 1BHGA 4HDIA 2UWEE 1TTFA 3WO4B 1J9CT 3VI3F 2HTLD 4NUJB 1RZ7H 1RJZA 1KENH 5TH2A 3CVHL 1Q38A 1T5WA 4XNXH 2FB4L 5HGGS 3CSPA 1QQDA 4MS8A 3ARQA 3QFJD 4H88H 1KB5H 1UGNA 2E3VA 2HA1A 2R1WB 1S9KC 1S7XB 3F62A 4FZEH 5ICYB 2R2CA 4MJIE 5KW9H 4DN4H 5K9JL 3R0MA 2HLFD 5DZNA 4OFYA 1Q0XH 3MC0A 1HEZA 2YD6A 1G7IA 1NMCC 2FD6L 4Q9RL 4G6AD 1E0OB 4MA3A 2BNQB 2IFGA 4OGZA 4JFPA 4YO0A 2FECI 4LCCA 4PJDA 4PJCE 1RUPL 4LRIC 3DBXA 3MRGA 3TO4C 2WBJA 5BRZA 5F8QC 1FPTH 5DUMH 2M1KA 3WYRA 2CPCA 4JM2C 4BH8A 5C2BH 3NGBB 3BAEL 1RULL 2VN7A 3RNKB 5EZLA 3GBLA 4FQJH 5E99L 3B9AA 4G9FD 3AM8A 1B6UA 1EFQA 4HJ0D 4KDTC 2VE6B 1I9IH 1K8IB 5DS8B 3ULVH 5F6IC 2AXGA 5F71A 1EMTL 3OHXA 1GYAA 1LO4H 5ELIA 3VH8A 3WIIL 4LDLB 2B4CH 2EXYC 4KJPC 4OZHB 1SBBA 1GHFL 5FYLD 4UILH 2F74B 2YOCA 5ITFB 2IMNA 3S3PA 1CBVL 5BS0D 4NQDD 4K7FA 4XXDA 2GYSA 2IPTL 5KSBF 2RFXB 3KPPB 3TCLA 3FQRB 2XRAL 4MNHB 4HFWB 3MBEC 4CRPA 5C8JB 4QYOB 3UMTA 3BQUB 3C6SA 5B21A 2N56A 5E9DE 1C8PA 3FFCB 5ICXA 3SY0B 3V5KA 5BW7C 4MB5A 4Q9BA 5JW3H 3QULA 1Q94A 3UYOD 1ZHLA 1FCCA 4OM1L 3P4MB 5JPMA 1MCOL 4TVPE 5F7WC 2NW2B 2D03H 1UM5H 1JFQL 1ZT7B 1X5AA 3VFOA 4M8QB 4HW6A 4KJYA 1MAJA 1KLGB 4ONOA 4P46A 1VA9A 3A67L 4S11A 2X4PB 5B3NA 1NEZB 3MV9B 4QHUA 2AJXH 3L3IA 4ODWA 3HRZB 4RQQB 2FO1A 4NHCH 5JORA 1KJ2B 1V3KA 3X13B 5B8CC 2YUXA 5DTFB 4HSQA 1T66C 3MJ9A 5C0FB 1T1XB 4X7TB 3HAEB 4OCNC 1K5NB 1S9VA 5A2FA 2A1WL 1DANU 4N9GA 1DE4B 3I02A 4HMCA 4Z8FL 3QFDA 4Y19D 1TDQA 4OLUH 5GGRA 2GSGA 5FCUL 5B3JE 4L3CB 4C4KO 4NQSB 1B4RA 4YHIB 1ZT4A 2E7HA 1XF5A 1QBMH 1IEBA 4OIIL 1GAFL 1I8LA 4X6EB 2ITDB 1R0AL 4LAQL 4WHTB 1OQXA 1VEPA 4UQ2A 4Y5XC 2DKSA 4EUPA 4UMGA 5IVXE 3TO2B 3MQIA 3ZKND 5DRXB 3HPLA 3AFLA 1UJ3B 2XYCA 2Z31B 3PNWB 2ZSWA 3MLWH 5EC1B 5F21B 4ZFZB 3UBXA 1OAUL 3MROA 5EWIL 3SKOA 3RL2A 1KTDB 2EXWC 4OB5H 5EOCH 5MEPB 3UTZB 1G9EA 4X4YB 4HIJB 4JY6B 3FT2B 2X4SA 1BLNB 3SDYH 4P2RA 3U30B 1XCQA 4F8TA 3QCTL 4QWWD 4LQFH 2ZUSA 4MA7L 3KLSA 4JZJA 3RWIB 1OVZA 3U1SH 1AXTL 4PJHA 3VXOA 1D9KB 2NY2D 3P11H 1T5XB 4L3EB 4QF1B 2NLJB 4UT9L 3V4PH 4PJ8D 1F6AB 3QHZL 3GKZA 2QKIA 1FL6B 1I9JH 1IKNA 1UZ6E 3QUYD 5DJ8B 3PWUB 3P73B 3S3JA 1HHGB 1D5IH 4FNLL 2EDYA 4HT1H 5D2NC 3MJ8A 2HLAB 1DLHA 3T2OA 2N4IA 1EVTC 2NTFB 5IWLA 4XAKD 5FHAL 2MWCA 3VFSA 5HGBB 2R0KL 3LVEA 1JGVH 1MCJA 1KIQA 2Y06L 3QBTB 3DIFB 3VFMA 5E8PB 2FBJL 1SBSH 2C1PB 2R56H 5CKAA 3IF1A 5D72L 4Q9CA 4I2XE 1II4E 2DI7A 4FS0A 3MRIA 5KS9A 5L88H 3PIQB 5DMIH 5BZDB 1GRWA 4QXGL 3MRLB 1L9MA 1YDPB 4XGZA 2I07A 1CLZH 5I8EB 4J1UA 1FFOB 3PJSB 5CZKA 1B2WH 3LKQB 4L5FH 4JZOB 1T89C 2CKBB 1DL7L 3WIFA 2RB8A 2EKSA 4JFQA 3GIVB 3TBVA 3LN5A 4WHYG 2A9NH 1U92B 4EOWL 2H45A 3D85A 2WP3O 4IRJA 2V2XB 3X14A 1YECL 2Q8BH 2XWBA 4JFOA 3NAAL 4LCWD 3BGMA 4XBEH 4CVWA 2X4QB 1WAAF 1CR9H 4FTVE 5IIEA 3SO3B 4DGVH 4JFDA 3TZVC 3W39B 4NCDA 3TA3B 1I8MB 4FZ8H 2ARJB 3SBWA 3CU1A 3LRSA 2XKNB 4FN0A 3BSZL 1HYRC 1CFSB 3QDGD 4LVOB 4JO4H 4Z78A 4M43H 3V6BR 3VFWA 3AAZB 2JB5L 5K9KA 1AO7B 1OTUD 5MI0C 1ZHBA 3GSRA 4X5XA 4ESKA 2R9HC 1U58A 3TEUA 4L4VD 1XR9B 5EO1A 5KVFH 2WWMD 1GOFA 1KULA 5H37H 1ES0A 2C3VA 2J4WL 5I16A 3QAZB 3R06A 1EV2E 1IGYB 3GJFA 4Y4HD 3QZWG 5BO1L 5FYKU 1BGXL 1NAML 2Q1EA 5I8KL 1T2QL 3MV7D 3JZ7A 1UEYA 3NZHL 5JZ7C 4MLSA 4NJAH 4OKVA 4PUBL 1M05A 4JKKA 3TWCH 1ZMYA 1GZPA 4ZUWB 1NUFA 3OXRA 4JN1H 4U6TA 2MQ3A 5DJ6A 1FYTB 2A6DA 2I5YH 4AK1A 4ZUVA 1J1PL 2FH8A 3BWAA 2H41A 3SQBA 5KVGH 5H2BB 5DT1H 2DQEL 2DWEA 4PTTB 3OX8B 2G5BA 3U0WL 1NL0L 3H3PH 5EOTB 3EZ8A 4R4BA 5HJ3B 5T1DL 4PLNC 4AG4H 3NZ8A 4RGNB 2OTWB 1B0RB 3BZEB 3D2UB 2EDQA 4JHAH 2IFFH 3ROOA 2CGRH 4PJAE 1NLDL 1W8OA 3PXHA 3UP1A 3VMPA 4JO3H 1NMBL 3TJHD 1UWGL 3P77B 3OTTA 5JHDB 4P2QA 5I1EL 2GY7B 1OCWH 2EDNA 4PJXF 1LK3H 4L4TB 1V5JA 4BFGA 4JZNA 1KPUA 1KIRB 4A6YL 1P84J 4YDIL 3VJ6B 4NJ9L 4OGYL 4GBXA 1BVZA 1BJ8A 4QEGA 3F65A 1XGRA 4F9LC 5H35A 3DSFL 5DMKA 3TPUA 4LL9A 4Z0BL 5EU5B 4GFTB 4NQEE 4IOSD 4L8DB 3DRQB 5A3ID 4IMLB 3CDGB 4M6NL 4X6CE 1NFIB 3DVNA 3PL6A 4LEOA 2V6HA 1RUAH 2GJJA 4D0BB 1OF2B 2I25N 3WD5H 2F8OA 3NIGF 2BY3A 4TRPL 43C9A 1KJMA 3UXFA 5E0QA 3OAUL 3HRPA 2VQTA 1IRAY 3BX7C 3Q6FA 4B41A 3VI3E 1TJHL 2EIEA 2ICES 4HXBL 4WWKB 1TPXC 3ARZA 5TFSL 3DMMB 1FLRL 3T8XB 2CIKB 5DQDH 3SDDB 1IGJA 4C83B 1DQQB 5JPNA 4N0CA 2CK0L 1H3GA 3BEWA 3QIUC 1IAIL 5HPMA 5C07D 3H9HA 1X6NA 3CJJA 3LPGA 5F9OL 4Y16D 3ME0A 4PBWD 3MLSH 2CLZB 3GM0A 3O6MH 2I60H 5TDOA 2A6JA 3KLAA 1G0YR 4MJ5B 1KBGH 3ZKMC 1UC6A 5JXAH 3KXFA 1AY1L 1ZLWK 4FQHA 4GRLD 4K7PY 4U6HB 4BZ1H 5IW1B 4CVXA 3O9WD 3HR6A 5L9DL 3VD4A 4N5ED 1GPOH 1S5HA 1PDKA 3BPOC 4Q0XH 1IT9H 2MHAB 3E6FA 4ZO7A 2A74B 2VLRB 1UVQB 1WZLA 2HFFA 5CLWA 3PP4L 1FGNL 3HS0B 3HCVB 1MIEL 4MXVE 3S4SB 3VWKB 4G6MH 2E7BA 1CFVL 1FFNA 4UIKH 2BHZA 3CC5A 3CFIC 5GSRB 4JFHE 3HI5H 1RMFL 2RCSL 3VRIB 5HSFA 1DUYA 3BHBA 1T3FA 4D9QE 3LEXA 4Y2OA 3U7WH 1YMHB 4KGJA 3KYOA 4NNPH 4PRPE 5DD6A 5KSUB 3A6CL 2JJWA 1JHTB 1G7MA 4XCNB 2OL3B 4MXQA 5CP7A 3ELAT 5KSBE 3IT8D 3SO5A 1TLKA 3DOSA 4Q58C 5CEXB 4CVZB 1QKZH 2R69H 3MV8B 3ULVF 4QRPE 2AJ3B 1V7NH 5C6TL 3U36B 5E6ID 2K1MA 3C87A 4LNVA 4V1DE 4Z95L 5GGUA 2JCCB 4LGSB 4KMQA 1IGCH 4PRHB 5EZOH 5MEOB 4JFYB 1Z9LA 1HSBB 1A3RH 5D6DA 3ARGC 2VLLB 3DI3B 4HPOH 3V0WH 2QLVB 5I30L 3WFZA 3FQTA 3MXWL 3EO0A 5D5MA 4PREB 4ZFGH 1XGPB 5ESQA 2JF1A 3BZFA 1F58L 3GJEA 2F54A 1BFOA 1EK3A 4N1EA 4GKOA 4Y2DB 3MLRH 2ZG3A 4KHTH 3IJHB 4EBQH 4DZBA 4DN3L 4FQIL 1QBAA 1RHHA 4EI5C 2Z92B 3L3GA 3U7YH 1DQMH 4PV8B 1IC1A 2E6PA 4C57C 3IDGA 3OJMB 1A7BA 1D5BA 4Y0GA 4U05A 1JGLH 3DARA 5DHYB 3P4NB 3AMKA 3VRLF 4OFKA 3O45A 2EIDA 4LPUA 1V8HA 2QV2A 3MPCA 4KQ3H 4N8VG 3P9LA 1UM6L 1T0NB 4XWOD 3SKMA 2ATPB 1JF1A 1NCDL 1U8NB 4WI2A 5HGHA 3ULUC 4KI5D 3FRUB 4CGTA 3ZDXF 1KJ3L 2LTQB 4Z9KB 5HYQA 1WLHA 4F7MB 4ZSOA 3U46B 4E0RB 2OK0H 4HCRA 4OF6A 5F6HI 5I6XC 5DJ0B 4F15B 2B5IB 4ELMA 3FO2A 2IWGA 2F53A 4XNYH 4MQ7A 4NGHL 3KPQA 3LQZA 1JNHB 2DF3A 4KMLB 3FONB 4JY5H 4MGXA 2WWKO 1ZT1B 1C5CH 1B0WA 3T0EB 3S36X 2XNAA 3BD4A 3RWCB 1ZLWH 4GAJL 3VXUD 4HJGA 4PJIE 1AD9B 3QO0A 1CL7L 4LSQL 5I71C 3SE3A 2VDKH 5I1KH 3KJ6H 4N8CH 1ACYH 2DKMA 5C0CD 4CMHC 2PYFA 1G9NC 2WV3A 4PTUA 3HI6L 3RWGA 3IDXL 1NBZA 4ZAKA 1BBJA 5HD8D 3D9AH 3P4OA 1I7ZB 2IH3B 1P9MA 3MCG1 5IR1B 2C4FU 1A7RH 1F11A 1CD1A 1KN4L 3HRZA 1OM3L 4RWYH 4JFEE 1DUZB 1ERNA 5DDHA 1XIWC 4K94L 3NTCH 2ZOLA 4PJ9C 5IFHH 1V05A 4GMSL 1RK0A 4U6XA 3WV0A 5FHBH 1KF9B 1RIUL 5KZCB 2FYYB 2DYPB 1JHLH 5BVJB 4U1KA 2PW1A 1G7LB 4QOKE 4PRBA 1QEWA 3W0WB 1L7IH 5DURD 1TCRA 1G9MC 2GTZB 1R3JB 4GW5B 2IMMA 5CJXA 2GEEA 1EEYA 4CU6A 1YEEL 3FAWA 1GGTA 4XMKL 1SVZA 5TDPB 1CICB 1A8JH 2PTTA 2FEEI 5B39A 2FR4A 4AENB 3IVKA 4O2CB 5T3ZH 3OJVC 5GS0C 1YZZA 4LLYA 1DN0B 1N0XH 4EQ2A 2EIZB 5DC4B 5FO9B 3LOWA 4M1GL 1YMMA 2AEQH 1EO8L 2EDRA 3NIFE 4X8JA 4ZOAA 4FQQA 3U48A 4APQC 4S10A 4HIJA 3ARSA 2FL5A 4YFDB 4FOMA 4LVHB 1S7VB 2XTJE 4HLJA 1JHKH 3R8QA 4D0CA 4P2YA 3TIDB 5TDNA 3TVMB 1RJCA 4MAYD 5FM5M 3KLDA 1NUGA 4XP1H 5BQ7B 4F7CB 1C1EL 4EXKA 5C2UB 5D1ZA 2VC2L 1WCBA 5HHMA 2PYEA 3EYSL 1D7FA 1S8DA 3ET9F 1HYSC 2Q20A 1AGBB 2P4AB 2A73A 1QACA 2W59A 1FFPA 4KFZC 1MLCB 5FUZH 2B2XL 1IC4H 4UDTB 4ZO9A 2KBGA 1A6WL 2V5YA 5DC9B 5F1NA 3O4LB 5E03A 4P99A 1JK8B 3E2HB 3VFUB 1TZHA 4BFBD 4JJ5A 5I1HL 3RIAK 4OCWL 2GAZB 4EZMA 1YDPA 1N5YH 4TUKL 5KOMC 4MSWA 4ONHA 3HZKA 3ARBB 4WDIB 4BK4A 1JZ5A 3O6LH 5BJTA 4G3YH 2YRZA 5E94A 1HOCB 2GSIA 3VCLA 4WEMB 3SQOH 3O2DL 3TM6A 4KKCD 4PBVC 1FFQA 4NCC1 4OCLC 1FDLL 3C5ZB 5TQ2H 1SYVA 4NO3B 3RL1B 4I0PD 2BNRE 3MNZB 5BXFA 1FL3B 5HI4D 4FMFA 2BX5A 5DEGA 1F3JB 4PJEE 5MEND 4M48L 1BP3B 1UB5B 5INCA 5SV4A 3OMZA 4PJXE 1CFNA 1WTGT 2K7PA 2V9TA 3WFEH 3HE7B 2DQJH 5DR5H 3F6IA 5JO5A 1B90A 2X7LA 1M7IA 1DEEB 2OI9C 2V7HB 4UV7L 5I8CB 5IMKB 2FZ3B 4OD1L 1BF8A 3IXTA 4MHHI 3E3QA 5EU6D 3L3KA 5C86A 1Q9LA 1CXIA 3W9DA 4QT5B 1SJVA 3H9SB 3PWPD 1U95A 4OCXH 4P59L 5DEFB 5D71H 3MRMA 1L9NA 2Y36L 3P9MB 1LK2A 5DK0B 5AZ2L 5IFAH 1O5DT 4NWTL 25C8L 2EYRA 3VFVA 3NIGE 4YDLB 1NGWA 3UTSB 1BOGB 1NLBL 2Z4QA 3B2VL 3BIKA 4OGAC 2QHLA 4LRNL 4JE4B 2YC1B 1LNUA 3Q5YA 3MXVH 5ETUB 3VFGL 3UTPE 3SCMC 2ZKHL 5JOPD 4Y1AB 3KLHC 5D93C 4DKEL 4WHDA 1I3VA 1ZOXA 3OR6A 4IHOA 3BJ91 1FZKB 3MOAH 1WC7A 4HUWA 1P6FA 1LO2H 2HJKA 4J8RB 2P7TB 1JZ3A 2ZSVA 2B0SL 4UOW0 1KGCD 4F37F 5I1LB 3REWB 4JAMA 3Q2CA 1CU4H 2CDGB 3GSVA 4GXUN 2VB5A 2WMPA 5HJ3A 1NFDA 1BM3L 5EORL 3G5YB 3OBAA 4BQ6A 2HVJB 1T4KA 3ETBF 3EJYD 5C08D 1MCRA 4YC2B 2A0LD 2FX8L 2ESVE 3LEYH 4FFWC 4ODSL 5FECB 5EFIA 1S9YB 3MRJA 3LEVH 4EUPG 4OF3A 3S34H 4BFIB 5E5MA 1WK0A 5L7XL 3B9KC 1N2RA 1MHHB 1G6RB 2NX5B 3MRFA 1L4IA 3B6SB 3ZDZE 4X7EC 3L6FB 5HHOA 3VG0L 1F6LL 1PQZB 2VLKD 1PX3A 2HH0H 2P24B 2GY5A 4NBZB 2IBZY 3NCCB 4GG8A 4N0FB 4XCCL 1OAYL 3ARFC 4PP1D 5D2LA 5CEYA 4Z77B 2R1XB 1EZVX 1FAIH 5KVEH 3FB8B 5IROA 4YHYB 3N85H 1K3ZA 3PGCB 4NN6B 1OP9A 1MCBA 4XPFL 3J8F7 1P1ZB 2VLRE 4WUUB 5FA4A 3GSOB 3ULVE 3EJZC 2ZCHL 4PG2C 1D5ZA 3FFDB 4LDEB 1KXVC 3LQAL 2HT3D 1ADQL 3W2DH 5BMFH 1JWUB 2VIRB 4G9FB 3SKNA 4HUVA 5MERA 2ZWLT 2BHUA 1F42A 3MGTB 3WFDL 4XI5D 3LS4L 3HR5B 5ID0B 3VGEA 4MAUH 4KQ4H 1B88A 3QNYA 4QTIL 4JRXA 1HKFA 3RY6C 3IU3B 2A9MH 3DX6B 15C8H 2CLZA 5ACZB 4PRHE 1KTKE 1G7JB 3DJ9A 2AVGA 4FFYL 3K0WA 3IDMB 3VFRB 4YXKL 1NDGA 2UZIL 5FOBB 5D6CB 2NY6C 4R96B 4YXHH 4YBQC 4P23C 1K4DB 1JGEA 2V7NA 3CH1A 4AM0B 4RAHA 4HULB 2EH8L 2EH7L