5F1NA

Mhc complexed to 11mer peptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAPWVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYGCDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLVEPVTRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Immune system
total genus 75
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5f1nA01
3O8XA 4J12A 2V7NA 4OLWL 5C6WH 3IDYB 2IEPA 1T7ZA 5LKNA 5JW3L 2Z31D 2P8PB 2YN5A 3QDGE 1C7TA 2YEZA 4GAJH 3SEPA 3GMQB 1FFQA 1UM6H 1ZT7B 2DI7A 2HVKB 4LGRB 2P5EB 3UPRA 1F58L 1RV6X 2OK0H 2R4SH 1VCAA 1Y6KR 1FC1A 2FGWL 2JE8A 5KSAD 3HA0A 1EVTC 1NGQL 5CJXA 1SBBA 2R2CA 3BO8B 5SWSD 4NKOB 1PYWB 2F54E 4LSSL 3VWJB 5JHDA 3D2UB 3JBG7 3ESUF 1U8PA 2D31B 4EI6A 2XA8H 5GS2D 2IALB 4Z76B 1HINL 1VDGA 2IPUK 2CLZA 1E4WH 2XTJC 4EBQL 2UWEF 5GGUB 2R9HD 2LTQB 3VMNA 4P2QE 1EFXD 2YUWA 3V52H 5D7IF 3FRPA 4D0DB 3QRFM 2AI0H 3DX8A 4OTXH 3PHQA 4QHNB 4XBPA 3IVKB 4OLXH 1Q9LB 3B2VH 5DC9B 5DJYA 5GS0C 4CDGC 3GJEB 1KXTB 4IMLB 4DTGL 1IZJA 3B5HA 3VMPA 5ANMA 1JWSB 2XN9D 3H9SE 1XF4A 4PP1C 5E1AB 1QFWL 3B9KD 1EJ6A 5BOZG 1JHTA 5I76B 1ZEAL 4FQQA 3U4AA 2VLLB 1TQCB 4YUEL 5JLZA 1IKFL 3QUXD 1U3ZA 1V7NL 4YDLC 1KJ2H 4GT7A 3V7AG 2R1WA 5FM5M 4A2LA 5F1NA 2H32H 1FE8H 1WZ1L 3E8UH 3IFNL 1EPFA 3C2AH 2DWDB 4JJ5B 4POZC 1JYNA 1BVLB 4QT5A 1DFBH 4HPOH 5L2KD 3SO3B 3LEYL 1NAML 3GKWH 1ZHKB 4LEXH 5SX4H 4Z7QE 5MENE 1MHHB 1RZIA 2DKMA 3QIUB 2NCMA 2Z31A 4RDQF 4F2MA 5KTEH 3MRRA 5HYJB 1JTPA 1B2WH 5F71A 5EU3A 4X5WB 2O26U 1WIPA 1MCCA 1E6JH 2ITCA 4WFGD 3S5LA 4Z7NF 4JKWA 4R90L 4HAGA 2NQCA 4ZNEA 5KSAA 3D6GA 1JMZA 1SEQL 4OM1H 3WFCL 3QCTL 3PNWB 5JOPD 3JUYA 2EXWC 1JZ6A 1F02I 4N1EA 5SWSA 4I0KA 3B83A 4OUUA 3DX9B 3HZYA 4PJDA 2AEIT 4U1MB 3DETC 3FOLB 3S36H 3P4OB 3P4MA 3FHQA 2F19H 1H3XA 5K9JH 3BQUB 1IAMA 2QV2A 2X4NB 4R8WL 3QDJB 3ISWA 3U36B 3B9VA 3QXDA 4WEUD 1WICA 4JM2C 3DV6B 3FMGH 3O6FD 1EFXA 4OIBA 4BZYA 5I6XB 5I1JL 1NGPL 5T3XE 43C9A 3WDIA 1UB6A 3N0PB 3RJDA 3RIFF 2XICA 1VKXB 5HY9A 1GOFA 3O4LD 3Q6FA 3LZFH 4P2OB 2DI9A 3QZWG 3FT2A 3W0WE 1P84J 1S9XA 2XN9A 1K6QH 4JFZH 4IHOB 3L3JB 4X6BA 1B9ZA 1ITCA 1KG0A 3B9KA 5EPMA 5GZND 3B3IA 4MJ5A 3X3FL 3D39D 3OX8A 1TDQA 4S0UC 4UZGA 4XC1H 4GFTB 3PG2A 1KV3A 4O58H 5D1QC 1DQML 1KB5B 4LCIL 4Q97A 3QUXA 2XOTA 3B2UD 4KGJA 4NN6C 3NH7L 2XWJA 5EO1A 1G7MB 3O2DA 4TNVK 1T66D 3L3OB 4JO2H 1NGWB 1NLBH 5ETUA 2CLRB 4V3DB 3V5HB 1PFCA 4N1HB 3UMTA 2PW1A 4DVRH 2QKIA 5MP6H 1SM3H 5L2KA 3DROB 2AEWA 4P2YA 5GGSA 4QOKD 1ZLWK 5IB3A 3R1GL 1BBJB 1DQLL 3ULVF 1FLTX 1XZ0A 5L7XL 5BV7H 3GHBL 3EOTH 4QRUA 2H9GA 4CNIA 2FIRT 1LEKB 2K1MA 1S9VA 2E9BA 4TSBL 2X1PA 2VL5B 4JPIB 4TVPL 1ACZA 3TN0B 2FSEA 1ZLWH 4XPHH 4C56E 1YC7A 4JFXA 1VENA 2VXQH 4BH8B 4FQIL 3FQRB 2XIDA 4M3KB 2HLFD 1G9MC 3QFJB 1LE9B 3WEXA 4DK6A 1GAFL 3D0LB 3F7PC 4D9LH 3TJEH 3W11C 3FT4B 3NCMA 3ZSSA 4CVZA 4K3HA 4J3UA 1XEDA 4MCZB 4XNXL 4XPFH 3NN8A 5EORL 4HIJA 2CR6A 3HG1B 3D48R 5C9JA 5GGTA 3O6FA 3G6JB 5IK3B 3ES6A 4DFHA 4WJ5B 3I85A 4OCMC 4NDMB 4NNXA 1OPGL 5TE7L 1TJIL 3CMOH 5I8OH 2HT2C 4Y5VC 1J5OL 1KN4H 3TZVD 2NW3B 5B38G 1QFPA 4E41E 4OV6F 3FB7B 3C9NB 1CXFA 1J12A 3W9DB 3HRZA 2F9BT 3O4LA 1RUPH 2ZNXA 5D1ZC 2Y23A 4FTVD 4JPKH 2NXYB 5EBLA 5IR1B 2R15A 5KJRL 1IAOA 2R0KL 1JFQL 2X4TA 1R3LB 4RFNB 3P2TA 1D5ZA 3MJ7B 1JPTL 1X5YA 4GMTH 4O9HH 4JFOB 1UACL 3AREC 1RMFH 3SKOA 1KCRL 1IQWL 3D39A 4G9FE 3HMWL 4XCYB 2F58L 3TH4T 3MYZA 3ZKXC 5SWQA 3OR6A 3HI5H 4WHTB 4EXKA 1P4LA 2AV1B 1H8NA 3EYSH 3BESR 4R26L 3DVFA 5I1CH 4Y1AE 4HGWB 5LBSH 4GBXC 2WV3A 4OZHF 3C5JA 4OZIA 3KR3L 3PV7A 1SJEB 3RNQB 2W9EH 3SGKA 3O11B 2F53E 2PTTA 5ERWA 3QZWB 1RZJC 1P1ZA 5DHVH 4QOKA 3NTCL 4QTIL 2LU7A 4D3CL 1UWEL 3HB3C 2RGSA 3QNYB 3ORJA 3B43A 2M26A 3PWJB 4N0FA 2DQDH 2QQKL 4UQ3B 3ZHKA 3RZCC 3TT1H 4X5XB 1S7SB 1T1WA 3DRTA 4AL8L 4PRAA 4YXHH 3EDKA 4OI8A 4MJIB 3IU3A 3JV6A 4G6JL 2EC8A 3CFJA 4MQXD 1MJ8L 3ARBD 4P46D 4ONGH 5IJKC 4RGOL 3UTQB 5FOBB 4PJ5E 4HQQH 4XC3L 5I15H 4CBPA 2JB5L 4LSUL 4AYFA 2DQEL 4PUBH 1AQDB 4OZGA 4ODVL 1OP3K 4KPHH 2V7HA 2FR4B 4AEIH 2ADFH 5KZCD 1F13A 1RZFL 4KKCD 4LBEA 3MBEB 1T5WA 3MLVH 4MJ6A 1YYLH 4P3WA 2AXHA 2APVA 1TVBB 3T08A 3C5ZC 5FHAH 3LN4A 4QXTA 2NY1C 4FFYL 5HDQH 4YWGH 1OP3H 1TETL 3LQAL 1X4XA 4YFLI 3VXSD 1A1NA 4RFOH 5ECJE 4BJLA 3TZVA 1N4XH 2P44B 1S9YB 5CSBA 3DOSA 3BKYL 4LK4A 3KWWA 4FTVA 4UOW1 2OR8A 3GJFA 5GRJL 2MCPH 2VZSA 4JFFD 1CGTA 4YK4B 4QRRD 1KPRB 2YUVA 4AY0A 3IXTA 5EULV 1X3DA 3SPVB 4JREC 1DQTA 4RMWA 4OKVB 2HJFA 3Q5OA 5FYJH 4D8PB 3RVWC 5GGVY 4WCYH 4KUZH 4XBGA 3FQWB 4W6WB 3U9PL 3V6OC 4MAYC 4P5TB 3AM8A 3FRPG 2HFTA 4ZSOE 4AEFA 3ZDXF 5B38B 2CIKB 3LDBB 4TTGA 4HWUA 5FM8A 3FO2A 5GS1C 4ZFOA 2JK5A 5E6IC 5T5FH 4Y4HD 3MBXH 3H7BA 1R5VA 2JB6B 3OKDA 5CBEA 4S0TD 3UTZB 3D1MC 3U2SB 5I74B 3DECA 5E08L 4PGEA 3RKDD 4K9EL 4OFIA 3QQ4A 4Q58C 2EO1A 5DMGD 5KVDH 1EEQA 3ARBA 4P46A 3RNKA 2DQGL 3ZE1F 1RUQH 4Z0BH 4MNHB 1OT2A 3A6CL 5KSVA 4XCCL 2CMRL 2X7LA 1L0YA 3HUJE 2P43B 4Z78B 2EDDA 2NLJA 1B6DA 4JZOB 1SY6L 2IMNA 3ARFB 3UTTD 5JDJA 4EVNB 1G1CA 5JR1H 3MGOA 3REVB 4G6ML 1UEMA 4NUGH 3OG6B 1NGZA 5FGRA 1DJSA 3EFDL 3NZ8A 5IROA 4WRLA 3PJSA 3KPMA 3VXSA 1WZKA 2NYYC 4KUCD 1YUHA 3OBAA 1UWGL 4LSVL 3QXTA 5I30H 3H42H 4FXLA 3BVNA 3BPOC 5EC2B 3P73A 3CDGA 2CDGA 1ZK9A 3U9UA 4E5XA 4ZTPH 5FEBA 1QYGH 4HJGB 4Q6IC 5DRWA 4ZAKB 3VXNB 1CGYA 4WV1A 4APQB 1TQBB 3UTSB 1RJZA 5E8DH 3QH3B 4PB0L 1CVSC 1YEFL 4K7FB 3O8XB 4QRRA 3QHTC 3RIAF 4F37F 5JIHA 2V7NB 1I3RA 5I8KH 4YHYC 5DQJA 2WIIA 5GRUH 4TRPL 2YEZB 2W60A 1KENL 2IQAA 1H3TA 2NPLX 4XHQA 5EDXA 3IF1A 3UPRB 4GW1A 2VLME 3KS0H 3VXRE 4RMQA 3QA3A 4Y4HA 2NX5E 3Q5YA 1OAZH 3UBXA 1IGYA 5JHDB 5D5MF 3PQYE 4ZUUA 2XTJD 1VGKA 1U8PB 4EI6B 2HJKA 1DSFL 3PUCA 3IDGA 5EZOH 2UY6A 4IOSD 5LCVH 2AEQH 5DD1L 4M1DL 1RURH 2CLZB 5DUML 3EIFA 5HDOA 3BP4A 4LSTH 1AD0A 4OJFL 4PLJC 5JUEH 2EYRA 2M8XA 3PWVA 1I1YA 1MFBL 5GS0D 4H20L 3N9GL 3DX8B 4P9HC 3PHQB 5GZOC 4ONFH 3UTTA 4XBPB 4PP1D 5DJYB 3KG5A 1PKOA 3QDME 1P4IL 5GJSH 3HCVA 4LSRH 5ANMB 2R0LL 5GGRY 1NBYA 1XF4B 4JRYD 4FQJL 4BZ2H 1H3WM 3TM6A 1M6OA 2UUDH 4ZO7A 1JHTB 4FQQB 4FFVC 3VG9B 1A6ZA 43CAA 4DN3L 2ZCLH 5JLZB 4RDQG 1TTUA 1A22B 5SWZD 1DUYA 5TGBA 4POZD 2R1WB 4YC2B 5F1NB 2EIBA 1OB1A 4HK3J 5I1AA 3SGJA 1KELH 3KYNA 4QT5B 5JIIA 4K3EL 1VA9A 4UILH 5F7NC 2DD8L 3F7RA 1RZIB 4H8WH 3RI5K 4NGHL 4NN5C 3WHE0 1UT9A 2Z31B 4F2MB 2QR0A 2K3TA 4RGMB 2W0FA 3JV0A 1Y0LA 3MRRB 3KDMA 3VXMD 1GGCH 5I17A 4JY6A 4B7LA 2VISA 5EU3B 1LO2H 4I2XE 3FO1A 2EXWD 5FFLA 2XV6B 4BQBA 3SKJH 5C86A 2ITCB 4BSJA 3S5LB 3CLEH 3DETD 2JJTC 5KSAB 5SWSB 4XH2A 4U6YA 1ULVA 5HHVH 4OUUB 1YEEL 2NZIA 3HZYB 4PJDB 2LVEA 5F7HA 5M95B 4GRWE 4HIXL 3P4MB 5I1LA 1J11A 1SJHA 4B50A 3L3KA 4KMLB 4OF5A 4KTYA 3MV7D 5B39G 3P0YH 3RHWF 2Y5TA 1LNUA 3QXUA 4JM2D 2Z8RA 4UNVA 3RKPA 2YPVH 3QXDB 1A14L 1NBVH 1G7IA 3MRDA 4QXGH 2I9TA 4QYOA 2C4FU 2PCPA 1MCKA 1EFXB 4M1CC 2C9AA 4H1LA 4PP2A 4X6DE 1MCJA 3C8KA 5ITBL 43C9B 1UB6B 2DKUA 2J6EL 4KY1H 3ULUF 3CSYA 2GJJA 2ICCA 5HY9B 4MA8L 3ARXA 3QCUH 5CLTA 3LS4H 3Q6FB 1ZMYA 3N1PC 1MPAH 4N8VA 3FT2B 3O6KH 5FYKH 1S9XB 3MLYL 4KI5F 2XN9B 4BSWA 4JRYA 1I3VA 4M6OH 2FJFA 4OCYH 5F9WC 4OLVH 4PS4L 4X6BB 5D1QD 1KG0B 3B9KB 2B20A 1E4JA 2XZQL 1TTGA 3PWLA 4EZMA 1W0VA 5E94A 1GIGL 5EPMB 3B3IB 4MJ5B 3OX8B 2AP2A 4QHKJ 3T2OA 2FATL 3U0WL 3T0DA 4JGJA 1M7XA 3BISA 2LE9A 3QUXB 2HAZA 4WENB 5DZLA 2XWJB 2IH1A 5EO1B 4ALAL 3HR6A 4FZ8L 5SWZA 4G80A 4S1SH 5DUPL 5E2WH 2APXA 4X80H 5ETUB 1C16A 1I8MA 1M7DA 2PW1B 5CSGA 4Z7WF 2QKIB 5M94B 3MJ9L 5L2KB 3QNXA 5GGSB 2EYTA 1X5XA 5IB3B 4YHKH 3CJJA 1DBBH 3Q2CA 5JOFA 3VXMA 1XZ0B 4PRHE 4QRUB 5HJ3A 2B1HH 4IS6A 3V5KA 2H9GB 5DEFA 4CNIB 1JUFA 1QD0A 2YR3A 3IT8D 1S9VB 2WINA 3U1SL 5FDWA 1GGBL 2FSEB 2CRZA 3I6LD 3U4BL 1D3CA 4JFXB 3W11D 1U9KA 1RVFL 3GI8L 3WEXB 3I02A 1P4BH 2DQTL 2D0GA 3MV7A 3P3YA 4CVZB 4JM2A 4P5MA 2AVGA 5IFAL 2WMPA 3NN8B 4GRLC 4HIJB 4JCMA 1BFOA 3ZKQD 4WO4C 3RJQB 5C9JB 2HT2D 3S35X 1FFPA 3O6FB 3ES6B 3C8HA 4AMKL 1I8KA 1V5JA 3QXAA 4JG0H 4WY7L 5J57B 4NNXB 5JW4Q 2CKNA 4XP4H 2R2BA 5D1ZD 5C92A 4KDTC 5HYIA 3BAEH 5BZDA 2G60H 4LF3A 3HRZB 3O4LB 4HUXA 5FAAA 5IMMA 3ARED 3LQAC 5EBLB 3GBMH 3UROR 1IAOB 2X4TB 5L8JB 4U3XA 1D5ZB 4GS7C 2E27H 2YPLA 2QQQA 5D1QA 3SKOB 4A6YA 5T3XL 1DBJL 4YQXL 3D39B 4LSQH 3WO3B 5BXFA 1G0XA 1P53A 1P84K 3GI9L 5D7LD 4YHZL 5SWQB 3OR6B 4PJHA 2A77H 3TIDA 5EOQH 2JKXA 4GBXD 5GGSY 1MREL 5DHYA 4HUNB 3O6ML 3BZDA 3BEVA 2OSLA 1J18A 5J12C 3ROLA 4ZOCA 4Q9QH 4Z7VF 3C5JB 5I75B 4OZIB 1U95A 2ZCHH 3ILQC 2PTTB 3E3QE 3L5IA 5ERWB 3HB3D 5GPRA 4N5UA 1P1ZB 4YXKL 1JHLL 2UVFA 4QOKB 3RZCD 5CJOL 4CN4A 1LMKA 4N0FB 2D0HA 1NUGA 1IQDA 1T1WB 1CFTA 3DRTB 4KK9C 4PRAB 1IC7H 5H37G 1EMTL 5HTSA 1NCNA 3IU3B 3JV6B 3CFJB 3TO4C 3QPXL 3D3VD 5DJDA 4K9EC 5JW4N 3L3DA 5A1AA 4I3RL 2R0WH 4OZGB 3LV3A 2V7HB 1A3RH 1MCFA 2FECL 3VGBA 3ULVC 1FNEA 3C5ZD 1ZS8A 4LBEB 4MA1C 1T5WB 4MJ6B 2NY1D 2A73A 3MCLL 4BZ1L 4EI5C 1MHPL 2VKXA 1YEKH 3PP4H 5HHOE 4ODBD 2ESVE 3AGVA 1J1XH 4WNQA 3LN4B 4QXTB 4F7CA 1DLFH 4Y5VA 5DJ2A 3H9ZA 1B0GA 1R5WA 2FO4A 1MJ7H 1GOGA 5EBGA 1A1NB 4Z7UE 5D1ZA 3EYUH 3TZVB 3K8KA 1EVUA 2OL3A 1A6WL 4H88L 1KYOJ 1KB5H 2J5LC 3KWWB 4FTVB 3GJFB 3UBXG 4OZ4A 3MGTA 1FGVH 2A9ML 4IEFB 5EUKA 3GEWB 1JNHA 4I77H 5IB4A 3IXTB 1JGVL 3RVWD 1EUUA 4UT9L 4MXQC 3LSOA 2ZJSL 5IHLB 2O5YL 4MAYD 3BPNC 2HJFB 5D7LA 4NC1C 2P1YA 1INDL 2OLDA 4XBGB 2FEEI 4TTDC 5HYSG 3VI3E 2APBA 1MELA 5E6ID 1EV2E 3I2CL 3MRGA 2QL1A 4CJ0A 4CN6A 1UQSA 3FO2B 3BEWA 4ZFOB 4XPTH 2JK5B 4XAWH 1I9IH 4JJHA 1E27A 3H7BB 1R5VB 3OKDB 5CBEB 4XGZA 3RZCA 3HG1E 5CWSA 1X7QA 1FAIH 2P47B 4JFHD 2GI7A 3G6JE 3K1KC 1KOAA 5AZ2L 3H9YA 4PGEB 3T2NL 5IJKA 3QQ4B 5DD3L 1KB9J 4WWKC 4PG9A 5GGQL 5I1GL 2W91A 4R97C 1WTLA 3ARBB 3D3VA 3IDXH 4P46B 3RNKB 3FZUC 4KJWC 4HC1H 5KSVB 3N1GC 3T3PF 2X7LB 3PDGA 1QSFD 4K2UL 2NLJB 3DI2B 3W5MA 3CK0H 4MNQE 5KZCB 1QRNE 3C5ZA 3WXWL 2VXSL 3IDJA 4AG4H 2QBWA 5DXWA 1A0QH 4GG6F 4MZ2A 3MGOB 3ZDYE 4DCQA 2R2EA 3WS6A 1NGZB 2NYYD 5AWNL 4HAFA 1I8IA 1MIEH 3HLAA 3NZ8B 3SDCC 4HXAL 3PJSB 3KPMB 3VXSB 1KLFA 1YUHB 3WNLA 4NN7C 5H2BA 4FQ2L 2NY0C 3MRCA 1UZ8A 3CMGA 3BVNB 1KGCD 3P73B 4HIIA 3CDGB 2CDGB 1YEHL 1U3YA 3U9UB 5IHUH 4E5XB 1UKSA 2NY5H 2AK1H 3GIZH 5FGCB 5DRWB 5KG9A 2E9WA 4WV1B 5B3JF 1RJZB 4NIKB 5HGGS 1PG7L 3MRKA 4JPWL 5F7DA 4X9FA 4QRRB 3RWCA 1U2HA 1I3RB 4CW1A 4Q9BA 5E9DD 2CGRL 3V6OA 2RFXA 3KPQA 4MAYA 5DQJB 2WIIB 5FUOH 1TVHA 4MJIE 2QSCH 5JQ6L 3MRJA 2W60B 4FZEL 2IQAB 1I7TA 2FX9L 5GS1A 3MFFA 1H3PH 4X0KA 5E6IA 3IF1B 4GW1B 1N2RA 2IGFH 1U6AH 1S7RA 5I1IH 2B39A 5FYLH 4EEEA 2BY0A 3QA3B 3BJ91 4IBLT 4Y4HB 4OLZH 1EXUA 2XACC 4KVCL 3F7QA 4LCUA 1OGTA 2FEEL 1MCNA 2CO6B 4LDEB 3UBXB 1IGYB 3L5JA 3RUGE 3KPRE 5HHQA 4ZUUB 2EDWA 5LVEA 1P6FA 1VGKB 4MDJA 2HJKB 3RY5A 5FM5O 3IDGB 3T0EC 5E6ZA 4PLJD 4AIXA 3MACH 4MLIA 5D4QA 3RRQA 3QUYC 4Z5RA 5I16A 3K1DA 3BP4B 1PSKH 1AD0B 4J6RH 5ILTH 3GFUA 2EYRB 3PWVB 4S11A 4M7ZB 1I1YB 1CK0L 5GZOD 4JN2A 2NR6C 1IARB 1QSFA 1SVZA 3B8SA 5C9KA 5C0EA 3ARDC 1MRFL 4OKDA 3UTTB 5IWLC 5LG1A 4LVOB 3HCVB 1NBYB 4FFVD 5LQBL 5I19H 1MAMH 3O2VH 1M6OB 1JZ4A 1KEMH 1LQVA 4IOIA 1RZ8A 4PG2C 4XVSH 5MHSD 1A6ZB 4JHAH 4Q6IA 5F7YC 43CAB 2HRPL 3LKNA 3SJVE 4XP1L 1I9RH 2YS4A 4FXKA 4FQCH 1DUYB 5TGBB 1GXEA 1MAKA 3FONA 4WTZA 1OB1B 3O2WL 5I1AB 4X4XA 4UI2A 3FTGA 4S1QH 3G5XB 3UJTH 5B8CC 5I71C 3KYNB 1NGYA 1KIUA 4ODTH 4PY8I 4M4RA 1ZLVH 4P59H 2LV4A 5E9DA 1IC4L 1CWVA 3QUML 2BC4A 5D72H 5HD8C 2QR0B 2W0FB 1NAMA 4XXDA 4NBZB 1Y0LB 2VN7A 5E5UB 3KDMB 2XYCA 4GOSA 5I17B 4OFDA 1OP5H 4JY6B 1MFAH 4KQ3L 3RVXC 4XP6H 2VISB 3GSRA 3FO1B 3TBVA 2IFFL 1QLRA 2DLIA 2N7AA 3KYKL 4XPAL 2IAMC 1K4DA 2IPTL 4U6YB 4XH2B 4TVPD 5DK2A 4R4BA 4U6VH 1P69B 3OKKA 3BKJL 5ID1A 3AS3A 3HC4L 3QG7L 3S3JA 1HZHL 3WFHA 2PO6C 1ZKAA 5I1LB 2YUXA 2XTJB 4LARH 1SJHB 3GSVA 3L3KB 1WLHA 4QHMA 2Y5TB 1LNUB 4X6EA 2AKRA 3GKZA 4N68A 5IJVA 5JO5A 4TUKL 1QUNA 1UH3A 2BMKA 3BP7A 4M1CD 3LKRA 1G7IB 3MRDB 4OQ1A 2VDKL 2I9TB 3DLQR 4QYOB 5CKGA 4YHOL 1F3RB 2PCPB 1NSNH 3DX7A 1A7BA 5DFWH 4H1LB 1MH5A 2JJSC 4PP2B 2EH7L 3C8KB 4ZPTA 1ZA3A 1LEGA 1IFHH 1RZ7H 3S88L 3CSYB 3Q3GA 2MJWA 1J1PH 3VI4E 1QZ1A 5AG9A 4N8VB 1J8HD 1A4KA 1F6LL 1MFCL 3VDBA 2ZUVA 3TH3T 4BSWB 4JRYB 3ZTJG 1PG7X 2FJFB 4K3JL 4O4YH 2VDRH 3FO0L 4P4RA 3DUHA 3PWLB 4MD5A 1W0VB 1K8IA 5E94B 3ZE2E 4YDLB 2Z4QA 4KHTH 5DGRA 4N0CC 4YFDB 1RIHH 4NQXA 3MUJA 2CPCA 2IH1B 1UGNA 5SWZB 5CUSH 1EJOH 2CLVA 4G80B 4BFEA 2X4PA 1C16B 1I8MB 4NNPH 1M7DB 5BRZD 5F7UA 4XT1C 1SMOA 1UA6L 4XVJH 1CE6A 1XMWA 5I1KH 3GBNL 3QNXB 2UY7A 3GZKA 4DGIH 1KEGH 3FOMA 2EYTB 1NCAH 2VC2H 3FB6A 3U6RA 5JOFB 1BGXL 3VXMB 1LDSA 2CSPA 1Q9KA 4FMKA 5HJ3B 4FQLL 4IS6B 2JJTA 5DEFB 1FDLL 3V5KB 1JUFB 1VEOA 3TJHC 3W9EA 1VFAA 2WINB 5FDWB 4OCWH 3F8UB 5FO8A 1MNUH 2AJSH 1ITBB 3WFDH 5ANME 1GC1L 3I02B 2PYED 3LN9A 5K9OA 3BIBX 1YMMD 4PJFA 3T3ME 1JRHI 4GMSL 4LCYA 4GRLD 1MIMH 3MV7B 4IJ3C 4JDZA 4WFED 4WO4D 4JM2B 3JWOC 4G5ZH 4P5MB 2Z8VC 3V4PL 5TF1L 2MWCA 3CLFH 3PL6C 1BFOB 3ESVF 3MLTA 2RR3A 1FFPB 4FXGA 2X10A 1I8KB 2DICA 3QXAB 3MOBL 4N0RA 2R2BB 2GYSA 1B4JL 5ALCL 5BZDB 4LF3B 5DMKA 4OIIL 5JOEA 4HUXB 5IMMB 2P7TA 4G3YH 1J8HA 2WWKT 3VFPA 2W9LA 2YPLB 1A7PH 1J1OL 3L95A 5D1QB 4A6YB 15C8L 2W9DH 1FL3A 2WWKO 5DRNA 1AXSA 2BRQA 1CDUA 3CSBA 1LK3L 5BXFB 1AIFA 2WW8A 5EU6E 1KIQA 4P5KA 1S7TA 4PJHB 1Q1JL 3NIFE 1RHFA 3TIDB 3UP1A 4JB9L 1ETZA 2RQ8A 4NKDA 4U1SA 5DHYB 3S34L 3WUWA 3BEVB 4HMDA 2OSLB 4PJDE 5T1KD 3ILQD 5BRZA 3ROLB 5EBWA 1U95B 4IDJH 1HI6A 5C0RL 1DBKH 1R24A 5F88A 1BEYH 2YMXL 5IVNA 3QQNA 5KAQF 4X7SL 5DT1L 1BX2A 4L29A 4KK9D 3HI6H 4U1HA 3I50H 3TO4D 1CR9L 4NRYA 2PUQT 1IQDB 1CFTB 4ISVA 2EDBA 1S7QA 5GISL 5DJDB 3ROOA 3IDNA 3ULVD 4LL9A 1U42A 3UYRL 1FNAA 3L3DB 4B0MM 1OAYL 4EI5D 1VEPA 3LV3B 2PYEA 2XN9E 1YMMA 1CLOL 1FNEB 4UDUA 1ZS8B 4GRLA 1CTOA 2A73B 2ZPKL 4WFHD 1KCSH 2D7TL 4WO4A 3KLHC 3LD8C 1AC0A 3D25A 4M62L 4WNQB 1A7RL 3CFBA 2VZ1A 4F7CB 2I5YL 4Y5VB 3DSNA 4KDTA 5DJ2B 1B0GB 1R5WB 1JRHL 1B90A 2FO4B 4YDKL 1GSMA 3RA7L 4FRWA 5D1ZB 1L0QA 2CQVA 3BYTA 3OWEA 2OL3B 4ZYKA 1T6VN 1YZZA 1OWWA 3RWFA 4JKPL 4UIKH 1OW0C 3O2DH 4N1CA 4OZ4B 3MGTB 4MXQD 5EUKB 3RWIA 1JNHB 5IB4B 4L9LC 2GTWA 4WW2F 3ZKXB 1NL0L 2B8OT 3L3GA 4F3FA 4TTDD 3G04A 1LWRA 2X4UA 3LSOB 5D7LB 3P30L 3P77A 1DL7L 1FL5A 2V5SA 5TPWL 4RWYH 3FN9A 4KKNA 2YKLL 5KSBF 5T1KA 1OSZA 1T80A 1LO0L 3C6SA 3ECBA 3MRGB 4GXUN 2E9JA 1UQSB 4G6FD 3BEWB 2VXTL 4LDOB 4P99A 1E27B 3KAAA 3VGGA 5GRYA 4XGZB 4M9OA 2FNBA 4NFDA 1BQLL 3RZCB 4R9HA 3TPUA 1WIOA 4WWKD 4O5LH 4OGAC 5CWSB 1X7QB 4CDHA 3TO4A 2UZIL 3CU7A 1CL7I 3FZUD 1C1EL 3OAZK 4KJWD 4PG9B 5DLML 5HSFA 2H26A 2PYFA 5C0JA 1JNNH 1UCBH 1Z0NA 2VRAA 3D3VB 1AY1L 5FYJU 4RMSA 4LCWE 2XNAA 4QNPF 5GGTH 2VITA 2VDOH 4YEEA 4EI5A 4NQTA 1NEZA 1S7WA 1S7VA 2EIEA 2PR4L 2CRIA 3C5ZB 4N0UA 3OAZH 4HPYL 2NY1B 5J1SC 2V5RA 3IDJB 2DMCA 4LP5A 3RVTC 1SY6A 3SDCD 4DCQB 4LPYA 5CILL 2R2EB 2O5ZH 2XTLA 1ORQA 5EFIA 4K7PH 4B41A 4CUCA 4XCFL 1I8IB 2NY0D 4KV5F 5E8NA 2E6PA 3HLAB 1WAAF 3PGFL 5LXGH 4OZFG 3V8CA 5H2BB 3GMNA 3MRCB 1UZ8B 3SE9L 2ZKHH 4HIIB 7FABH 3DRQA 2Q86A 4OZIE 1CD8A 5KG9B 5T3ZL 3S96A 4R4FL 1G9NH 2FBOJ 5D2LE 3MRKB 4D9QE 4JREB 1DQDH 1RULH 4MXQA 5F7DB 1SBSL 2UZXB 4LOUC 5C2BH 1KCVL 3RWCB 4HS8H 1HWGB 4L1DA 4CW1B 1LP9E 1KYOK 3KPLA 1JI1A 4KQ4L 2RFXB 3KPQB 2GIYA 4MAYB 4RWHA 2WNGA 3RTQC 3IFPA 1YECH 1TVHB 2C3WA 3GMRA 1OQOA 1IGML 1A6UL 1R3IL 2E8ZA 3MRJB 3BH9A 1I7TB 4J2XA 4OLYH 2Z35A 3IU4L 3MFFB 5CZVL 5GS1B 4X0KB 1A8JH 5E6IB 2Q6WA 1N2RB 1S7RB 1EHNA 3JV4A 4JO3H 2KBGA 3S4SG 2QQLL 2B4CH 3VGEA 1TZGH 4NRZA 4IRJC 3BI9X 1MQKH 3MLXH 1EXUB 4LCUB 1OGTB 4LKXA 4ONHA 4LHJB 1OTSC 3T0ED 5IHZA 4PLKC 5HHQB 4WWKA 4JZJA 3SHSA 3QUYD 4MDJB 3QDGD 4NOFA 4HFUL 1T83C 2EH8H 2GTZA 4Z5RB 5I16B 1WWBX 1PLGL 2NR6D 4K94H 4ZUVA 3NGBC 4TUJA 1M1SA 3ARDD 5J1TC 3GJFK 3SDDC 4JN2B 5IBUG 4ZODA 2WAHA 1QSFB 1CL7L 2F54D 5C0EB 1IGFH 3U7YL 3G5ZA 1SMAA 1P9MC 1U3JA 4I13B 3SDCA 2VZOA 4U0RC 1JYXA 1WIUA 1YPZA 4XI5C 4PJ7A 3GJFH 4I9WD 4C83A 4OV5A 5I66A 3BPOB 4WU5A 2V9TA 2ICWJ 1RZ8B 4IOIB 4P2QD 3MRFA 1DANT 4ODHL 4Q6IB 4PBVC 3GO1H 3LKNB 1YEIH 4PJCA 1CDYA 4PJXF 4FXKB 3VFWA 1JZ7A 3FONB 3LEVL 5A2IH 3S97C 2D7PA 1FIEA 4X4XB 4YHYB 3FTGB 5M7QA 5CEZH 3H9SD 5HD8D 4N0YH 1F4WL 1NGYB 1M05A 3IB4A 1U2CA 5E9DB 5DVOA 2BC4B 4U2YA 3RVXD 2O61A 2VQTA 4M1GL 1NAMB 5GGVL 4XXDB 3CFCH 3HZMA 4NM4L 1AI1H 1FORH 5JIKA 4LASH 5DD6A 5H8DA 3GSRB 5KVEH 2IAMD 3P0VL 5CJ5A 2BVPA 3TBVB 1IT9L 5TDPA 1WEJL 4WW1A 1QLRB 1QACA 3DUSA 1Q9WA 5E99H 3F7YA 3EZ8A 4PLOB 1K4DB 3DX6A 4GAYA 1F11A 2PO6D 1WT5C 4TYUA 3SDYH 5DK2B 1FCCA 4R4BB 2HT4C 2RCSH 4O51A 4ZS6C 4BFIA 4CVUA 3OKKB 5ID1B 4L3AA 3FQTA 4WHCA 3WFHB 3KJ6L 5KW9H 3GSVB 3QUYA 3QDGA 3MA9L 2YXMA 4QHMB 4GKZA 4X6EB 2AKRB 5IJVB 5JO5B 1JNLH 3VXSE 4HMEA 2BMKB 3AMLA 4DKAA 3BP7B 3LKRB 1L7TL 2IG2L 5C8JA 4MZ3A 1JHKL 4X6CE 3BZFA 3DX7B 2HT3C 3ARDA 1FBIH 1MH5B 3ELAT 4HXBL 5CJ8A 5IWLA 2UYLA 4ZPTB 1ZA3B 5EZLA 4JFFE 3ZLQC 2F54A 5I1HH 3SE8H 1LEGB 3Q3GB 1XF1A 5H37H 5AZEL 2J6EA 4HGKC 4XNYH 3QHFL 1A4KB 4D9RD 4DKFL 4PG2A 2DQIL 3CFEA 2HKFL 4N0CD 3RDTC 4P4RB 2F5BH 3GMPA 4MD5B 2ADGA 1K8IB 2Z4QB 4P2QA 3MLPA 4LPWA 4NQXB 2CUIA 2L7JA 3TLRA 1UWXK 4GQ9L 2VL4A 3JWDH 4TULH 1VEMA 3IJSA 4XMKL 4KAQL 1YEGH 3U7WH 2BX5A 2CLVB 5BZWA 3MODH 5FA3A 5SX4I 5B8CA 2X4PB 5IBUB 1IGIH 3W0WD 1ORSA 3MRLA 3OKNA 4MCYA 4CAGA 2D7NA 4RISH 4NN5B 3H9SA 1W72L 1CE6B 2VDLL 3RWDA 1RFDL 4TNVF 3IJYA 4PY7A 2PW2A 4K8RH 3FOMB 3MJ9A 1AHWC 2YD8A 5I1EH 3TJHD 4NCC2 3FB6B 3U6RB 3MLUL 1GH7A 1Q9KB 4CJ1A 4NHCH 5F7EH 2IAMA 4KTDH 3W9EB 1VFAB 3QBTB 3GRWH 3QPQC 2EDLA 1WCBA 2PO6A 5FO8B 4PRNA 2BVTA 4L5FL 2CRYA 4DWHA 3FQUA 4DOHE 5K9OB 4P9MH 2BJMH 2YD2A 2ZUSA 4PJFB 4YX2H 3PL6D 3TP4A 4LCYB 4PJAA 4JDZB 2AERT 5K33A 1LHZA 3CX5J 3OB0H 2JJSA 3WJJC 3MLTB 2VQUA 4M03A 4FXGB 5FYKE 1U92A 4HJ0C 4C56D 1KT2A 1IEHA 2AJYH 2YA0A 1N6VA 4G7VL 2C1PA 2X1XR 5DVLA 3TBTA 4Y89A 5DMKB 2AI0L 4OTXL 5F9WB 4MYWB 2P7TB 4LU5H 1D6EA 1J8HB 4OLXL 4H5SA 3SDAC 3VFPB 4LSDA 3N06B 1MCIA 3KGRA 4OIAA 1J86A 3L95B 4DGYH 4PJ9C 4QY8A 1FL3B 1QVOA 5ALBL 1RUMH 5DRNB 1AXSB 3S3PA 2RHEA 1WTGT 3S3SA 5KS9E 1AIFB 1KIQB 4P5KB 1S7TB 5C6PB 2RIKA 4E41D 1CI5A 3OJMB 1ETZB 1ZLSL 4NKDB 1S5HA 4U1SB 1N26A 1KJ2L 3WUWB 5ACMA 3SE3C 5EG6C 2FD6H 3W0WA 5BRZB 5DYOA 4ELME 4I3SH 5TDNA 1A5FH 5EBWB 3E8UL 2DQHH 1HI6B 5JW5A 4NO0A 1R24B 5F88B 2XQYK 3BRFA 3GKWL 3ARSA 5F6HI 3TJHA 1BX2B 4L29B 2EECA 1TZHA 4U1HB 5IESH 5KTEL 3P9LA 4NRYB 4JLRA 2R56H 3BSZH 4Y1AD 4ISVB 3KPPA 1F6FB 1S7QB 1KULA 3ROOB 2VMFA 3IDNB 1LO3L 3VFUA 4OM1L 3AU1A 3HN3A 2F53D 3NOIA 4HWBH 3QULA 1EHLH 4XXCC 1OM3H 1QHOA 2DQCH 2PYEB 1LVEA 3KLHD 1YMMB 1INEL 3S36L 4UDUB 5GS0H 3LS5L 4GRLB 3E3QC 3REWA 4WO4B 2F19L 4OFVA 4TVSa 3W39A 3D25B 5K9JL 3OZ9L 3CFBB 3F6LA 4HW6A 2VYRE 1A7QH 5HVWA 3BGFC 3HC0A 4HH9A 2Y9RT 3MV11 1A64A 2VR9A 1X5LA 3OAYK 5SWZE 4C56A 1NCWL 1A1MA 2PTVA 3WXVL 4PJ5D 5ABDE 4P57A 4F7MA 1FC2D 2DM7A 3RL2A 3L5WA 2QJDA 2M1KA 5IVXE 2VWEE 2VXVH 4ZYKB 1MLCA 4GS7B 3RWFB 4JVPA 3DUUA 1TPXB 4ZXBC 1MQ8A 3OAYH 4PB9L 1BAFL 3RWIB 3M8OH 1K6QL 4M8VA 2GTWB 2Y06H 3L3GB 4F3FB 3G04B 2X4UB 3CUPA 1NUDA 3P77B 1FL5B 1UM4H 1UM5L 4XC1L 1FFRA 2NY3C 1B88A 3QFDA 4O58L 4E41A 5J12B 2YK1L 5J89A 5T1KB 1OSZB 3ULSA 3C6SB 1HIMH 4NBYB 1NCBH 2YD3A 3ECBB 1NLBL 3LQZA 1P2CA 4FQHA 3LPWA 1HXYA 4OGAD 5I9QC 4RGNC 2WBKA 4XTRC 2PN5A 1TJGH 3TPUB 4GKOA 1GZQA 4AT6A 4AQ1B 2JCCE 3TO4B 1G7HA 5BV7L 2DBLH 4Y1AA 2H26B 2PYFB 5C0JB 3L6FA 5INCA 5CIPA 2IBZX 1FNFA 2XNAB 3UYOD 1OAKL 3CH1A 4M93C 3BYYA 4MA1B 2VITB 4B5EA 2F53A 4EI5B 1NEZB 1S7WB 1S7VB 5J6GA 3NCBB 3RVTD 4N0UB 1EDQA 5TFSL 1Y6NR 5HI3C 3TNMA 4OCRL 1S3KL 4Q7DA 4EOWL 4M7LH 5DSCA 1URLA 4J3XA 5EFIB 1ORQB 3S37L 1TMCA 4XPFL 3WNOA 5CCKH 4LQFL 5E8NB 5GRVL 4K7PY 5EIIA 4U4BA 1T89C 4LMQE 3NIGE 4M5YH 2QADC 1O7VA 4PJ5A 4A6YH 5D8JH 5T1LD 4BQCA 3GMNB 3H9HA 3U30C 4JFDE 2J5LB 4F9LC 5B3NA 4CGTA 2VH5L 3ULUH 3QIWC 1EEYA 3ZHLA 3CMOL 1QR1A 1OW0A 1V3LA 3DRQB 5I8OL 1D6VL 5BVPL 2Q86B 1JCKA 4G8GE 4LOUD 3G9VA 4L9LA 3S96B 3SQOL 5IVOA 2CO7B 4JPKL 1J0HA 3EDFA 4UT7H 5DUBA 3BPNB 1GHFL 4O9HL 3RTQD 3CZJA 4KKLC 1RMFL 3KPLB 1JE6A 1I1CA 3Q6GH 5L88L 4OGXL 2VOTA 3M17A 1NFDE 3IFPB 3GMRB 2FL5A 2VSDA 5ADPH 5JZ7C 1JZ8A 2V5MA 3BH9B 4XB8A 3I6LE 5FF6A 4KTEH 2Z35B 1JJUA 4ZO6A 1PG7W 4IRJD 5IW3A 2Q6WB 4OSUL 4GAGL 4F33A 5I1CL 3JV4B 1OTSD 1QEWA 2D2OA 4NRZB 5LBSL 4PLKD 3F58H 4LKXB 4L8DA 4ONHB 5IHZB 4HUKB 4K3GA 4YHMH 4WWKB 4AIOA 1XF5A 4JZJB 4R97B 4GXVL 4PJGF 3QEUA 4FP8H 2ICEA 4UINH 1Z2KA 2G5BA 4QWWC 2MKLC 2YWYA 2DQDL 4ZSOA 2GTZB 3HNTH 2J12B 4MB3A 3SDDD 2YHGA 1VSCA 3VXRD 4YXHL 2YD1A 3UYPA 4ZUVB 4DGVL 4TUJB 4XNUL 4I3GA 4M48H 5E03A 1W8OA 2OTUA 1R3JA 4PUBL 5TE4L 4KPHL 3PQYD 1F6AA 3G5ZB 2ADFL 4XI5D 3IFLH 2J8UF 2OL3H 4LCCC 4RMRA 1YYLL 3J7HA 1MI5E 1HE7A 3SDCB 4OGYL 4EQ3A 1YPZB 5J7CC 4NN7B 4PJ7B 3WO4C 2NY0B 5FHAL 3RBSA 1GVIA 4C83B 4OV5B 1WZLA 4RRPG 5I66B 4WU5B 4MMZC 5HDQL 3MRFB 4YIQA 5T1LA 2OS7A 4XAKD 3HUJA 5FM4A 3NCJH 5C0DA 4WTXA 4BFBD 4X9GA 4PJCB 3EGSA 3VFWB 4HX1A 3MLRH 1QHPA 5EUOE 3QDMD 4UNTA 3VGDA 3SDXE 1V3JA 3MA7A 4F7EA 1CD1A 1XGTA 4AEHL 3RTQA 1M05B 3CCHA 3O3EA 1XGPA 2ADIA 5FYLE 4HULB 4C4KT 2O61B 4HWEH 4Z7OF 1F97A 3OXSA 3HZMB 3D3VE 4F8TA 5DD6B 4WUKH 5TJWK 4C4KO 2I60H 4IRJA 1PGRB 2BVPB 3RI5F 2XRAH 4NZRL 4ZS6D 2HT4D 5TDPB 2APTA 1RAMA 4NCC1 4WW1B 3DUSB 3X14A 1Q9WB 3F7YB 1NANH 3DX6B 4GAYB 3NAAL 1F11B 3NACL 4O51B 4BFIB 1IBGH 1A21A 1XCTA 4ESKA 3FQTB 1CFQA 4F58H 1AXIB 1T83A 3QUYB 2ZG2A 3QDGB 2FIKA 4GKZB 2H8PA 4P3CH 3TWCH 4Y4FC 1XIWA 4PV9A 1KTRL 1OARL 2HT3D 4GRWF 3SDDA 1AR2A 1L6XA 5C8JB 4JY5L 3VXRA 2B2XH 3S37X 1AJ7L 2V2XA 3BZFB 3ARDB 5IV2A 1E4XH 2UYLB 1P9MA 5EZLB 2F54B 5ENWA 3KLDA 5HVHC 3PQYA 5TQ2L 1NAKH 5FCUH 3RDTD 2JF1A 4CRPA 5CKAA 5JR1L 3CFEB 1RUAL 4R0LC 1N8ZA 1L0XA 3GMPB 4ZS7L 2ADGB 1MRDL 5BO1H 4P2QB 3PWUA 4WEBH 3A6BH 4G6KH 2KUTA 1DLHA 3NIDE 2QHRH 3IJSB 1MFEH 2WLYA 3Q0HA 1KC5L 5BZWB 5B8CB 5FA3B 5I71B 1ACYL 3QDMA 5JW3H 3H8NA 4Q6YA 2V9QA 1ORSB 3MRLB 3OKNB 4MCYB 2QSTA 3VXPA 3H9SB 4OBSA 3WFBL 3RWDB 4HFWA 3IJYB 4PY7B 1FYHB 2PW2B 1F58H 5CP3A 2V6HA 3IDMA 3BPCA 4U6XA 4QRPE 4KZEL 4GSDH 1NGQH 4Z0XA 3MRBA 3QPQD 2IAMB 4LSSH 1WT5A 1G6RA 2FB4H 2VERN 4XHJC 1WCBB 1OD9A 2PO6B 5DJAA 4PRNB 3GM0A 4EBQH 3EKCA 3FQUB 2D03L 3T09A 1OAZL 2Y07L 2X4QA 1BOGA 3D0VA 4MHHG 4PJAB 4PP8C 4PRHD 4BA8A 1QFUL 3ZKSD 3MXVL 5LCVL 4HJ0D 4JO1H 2AEQL 1KGCE 5HVGB 1U92B 1KT2B 1V7ML 4H25A 2ERJC 2C1PB 3TBTB 1QFWH 3SDAD 1L8JA 4X7TA 3O41A 5IQ9A 2DN7A 2NTFA 3RDTA 5F7WC 1D6EB 4ONFL 4PJ9D 5DS8A 5KANG 2XKSA 4H5SB 4F15C 1V7NH 1VACA 2IH3A 4QY8B 5LWYH 4BZ2L 1QVOB 2PXYC 1WZ1H 1X5GA 3IFNH 3V0VA 1H3VA 3LEYH 1NAMH 1OTTC 1S5HB 4XX1E 2E7BA 2ITDA 3GM8A 2VR4A 3M1BA 3W0WB 2QSQA 5DYOB 2KQNA 1Q0XH 4OZFH 5TDNB 1P5VA 1AHWA 2HN7A 3V6ZA 3K80A 5JW5B 1MJUH 3FFCD 4NO0B 3K74B 4DN4L 1S7XA 1BZ7A 3C6LC 1WUNT 1G7LA 4R90H 4GLRH 3WFCH 3E2HC 1TZHB 3O3DA 2CKBL 3P9LB 3MOQA 4HT1H 5EZJA 4JLRB 1GGCL 4MWFA 4IRSC 5IIEA 2ADJA 4PJBE 3QHZL 1IGTA 3KPPB 5C7XL 5JDSA 2A1WL 4JPVH 3SKJL 3VFUB 3HTLX 3AU1B 4IJ3B 4LGSB 1IM9D 3QULB 5BV7C 3WIHH 4M43H 2H2SC 3REWB 5I1JH 1NGPH 3WJJA 2EDNA 2VLRE 4PRHA 4RSVA 3W39B 1UB5A 4UU9A 3TO2A 3P0YL 5CD3A 1MHEA 1NBVL 3HC0B 4HH9B 1FH5H 4LHUG 4QXGL 4C56B 2EE9A 1A1MB 1M4KA 3EOBA 5C3TA 4P57B 4F7MB 2DM3A 3RL2B 1I1RA 3L5WB 1L9MA 3CX5K 4FNLH 3NFSL 4ZXBD 1MLCB 2H41A 2R0ZH 5C0GA 2DBJA 4KY1L 3X3FH 4PJ9A 5JNYA 3QCUL 2KZ1B 5HHOD 3DUUB 3LS4L 4MAUL 1YJDH 1DQMH 2ESVD 3LKPA 4LCIH 4KK5C 5T3ZD 2EDKA 5FYKL 3NH7H 2VDPL 4M6OL 4OCYL 2J3SA 4OLVL 3BIKA 2NY3D 4URTB 2W65A 3CUPB 1CFBA 2DLFL 2ZUTA 3SE3A 3QFDB 4E41B 3L7EA 4NM8L 3MQIA 3MLZL 5F96L 2BDNH 4U7KA 2GW5A 3ULSB 2X5PA 1FVDA 4S1SL 1DQLH 4X80L 3NA4A 4RGND 3LQZB 4XTRD 5L7XH 1P2CB 4FQHB 3FFCA 1HXYB 4WI8A 2AGJH 4MXVF 4DUWA 2UZYB 1WJ3A 4MJ4A 4U1IA 1V8HA 2DAVA 3TBWA 3D5OF 1GZQB 4AT6B 4FQIH 1G7HB 3CGTA 5FXCH 1UKQA 3FAWA 3KLSA 4Y1AB 3L6FB 2UWEE 3AS2A 4XXCA 1T1XA 5CIPB 2NW2A 5INCB 4C58B 1JP5A 3CH1B 3VD7A 5CEYA 1F8TH 5F72S 2F53B 5C0IA 3E3QA 5D7IE 5HI3D 1IM9A 4ZQKA 5EORH 5HVFB 5JHLH 5J6GB 3LD8B 2BNQE 2XXMB 4U1KA 1PEZA 2JELL 2HG5A 3VU2A 3TNMB 5DR5L 1VB9A 3WYRA 1OPGH 5DSCB 1TJIH 5A2KH 5F8RC 1QG3A 2QADD 1TMCB 1CXLA 3WSQH 3UPCA 2BHZA 5EIIB 3QIWD 1U8LA 4U7MA 4PJ5B 2R0KH 2R69H 2CXKA 3H9HB 32C2A 1JPTH 1EEYB 4XP4L 1RK1A 1UACH 1P7HL 1QR1B 5D7KE 4ZXBA 4MNQD 4MXWL 1IQWH 2Z0BA 2G60L 4L9LB 5HHOA 2F58H 4KKLD 2ESVA 1WZMA 4TOYH 3D85D 3GBML 3GMMA 2B0SL 5DUBB 4OD3H 4G8FA 5JZ7D 1KCGC 4PTUA 4RAUA 3RL1A 3M17B 4DAGL 4Z7UA 4LSQL 1D5IH 3RY4A 4XCEA 2FL5B 4BELD 3KR3H 3WV0A 2Z8SA 1OAUL 5FF6B 1F4YH 2A77L 3S98A 3PXJA 3RX8A 3NTCH 3L5XH 3KPSE 1PD6A 4F33B 4D3CH 4N90E 3L1OL 1UWEH 1Z3GL 4H26A 1QEWB 2QQKH 4Z7NE 4Q9QL 4WFEE 2CDEA 4L8DB 3FFDA 3G08A 1K3IA 1BVKA 1QSVA 4QWWD 3MUHL 4G6JH 4ODUA 1MJ8H 1JPFA 4RGOH 1XF5B 3C60C 4L8CA 2DLTA 2XXCB 3QEUB 1HSAA 2ICEB 2X09A 5IB1A 2G5BB 2JB5H 4HJJL 4ACPA 4YHLH 4ZSOB 4TQEH 3O9WC 3C2SA 1RZFH 3MZGB 1H8OA 1X5ZA 4R4NC 1W0WA 4YHPA 3GSNH 2OTUB 4I1NB 1DBMH 1R3JB 3K4ZA 2OTWA 3ALPA 2R0WL 3KPRD 1F6AB 4LLQA 3UAJC 3LQAH 4JG1H 1QSED 2YZ8A 4MA3A 1BFVL 3PHSA 1T89A 5IKCA 3PP4L 1R3HA 3BKYH 5EU5A 3U82B 1AGBA 2HFFA 4F9LA 3QIWA 2MQ3A 4FN0A 4YIQB 5T1LB 3A67H 2QLVB 1MJ7L 3HUJB 1XR8A 5C0DB 4DUVA 4MNQA 1JYVA 1QRNA 1CF8L 3C5SA 3EGSB 4HX1B 1FAKT 2VDNH 3R0MA 4X9HA 1QPXA 3QEGL 3I3BA 4WHYG 4Q9RL 2FHFA 3D85A 3GSUA 3X3GL 3MA7B 4F7EB 1CD1B 3QEQE 3VFGL 1XGTB 3RTQB 1UCTA 4L4JA 4I77L 3CCHB 2E6JA 3O3EB 4J3WA 1XGPB 2ADIB 3VG0H 1D5MA 4NHUA 1AD9A 4GRMA 3OXSB 1YEJL 2PNDA 2APFA 3SJVD 5F3HA 3ULVE 5HHXH 4IRJB 1VPOH 2ZG3A 3VFTA 4JFEE 4WEMB 2DIBA 4R6UA 3TNNA 3X14B 4EUPA 1O5DT 2DQJL 4F8QA 5E08H 3N1MC 4I0CC 4K9EH 4WFHE 1INQA 4EIZC 1XCTB 5KSBA 1I9IL 1A9BA 1G9ML 5DMIL 4Y4FD 1CFQB 1A3LL 3BT2H 1GGYA 1WBZA 3T0BA 3PWPE 4XNZC 1UC6A 2FIKB 1BVZA 2H8PB 4HG4K 3MRMA 3V0WH 1FAIL 4XCCH 4OQTA 4ZFGL 1XIWB 4PV9B 3NGBB 4O00A 2WWMD 3SDDB 4ZNCD 3VXRB 1SY6H 2H45A 2V2XB 1YMHA 3IDXL 1NMBL 5IV2B 2WZPD 1K2DA 4P4KC 3KPTA 3BE1L 4LCCA 5ENWB 3RUGA 3QSKB 3KPRA 4HS6A 3WD5H 3EFDH 4U0RB 3PQYB 1ZTXL 4XZUA 4ZDHA 4LSVH 2MQ0A 4AG4L 1OY3B 4PD4J 1IEBA 1EBPA 1N8ZB 4JDTH 1MIEL 3WMSA 3PWUB 4BM7A 4XRCA 5CEZE 1TLKA 1Z6JT 3HKFA 1G9EA 1DLHB 3BDXA 2DF3A 1YYMH 3P40A 3QDMB 3GIZL 4RAHA 2AABL 3ARGC 3VXPB 1KENH 4U3HA 1CDCA 4HFWB 4OZHE 3V4VL 5JMOC 3EO0A 1W72A 5E0QA 3GNML 3BUTA 5FO7A 3IDMB 2EO9A 1NLDL 4TPRL 5E7FA 3BPCB 4U6XB 4LNVA 4WWID 5FUOL 1W0YT 4Z0XB 4NOBA 1RIVH 3SJVA 3BRGC 3MRBB 5LGJA 5H94A 4XHJD 4UV7H 4MNGA 5CZXC 1G6RB 4H8WC 3VFSA 5DJAB 1DSFH 2WQ8A 5FYLL 1Q94A 5MEPA 5DD1H 2HMIC 4M1DH 3EHBC 5DUMH 4OLZL 1IM3A 5E24E 3TGXA 3B6SA 4QHLA 2X4QB 4OJFH 3VRIA 4PJ7E 3UJJL 1BOGB 3D0VB 5DZNA 3ZSTA 4YHIA 4N9GA 1RZKL 1MFBH 2RJMA 2H2PC 4B53A 1SYSA 1DTUA 4OF6A 3C8DA 3QO1A 1PSKL 4J6RL 1P4IH 1I1AC 4H25B 5FDYA 3S35H 4QGTA 4FQJH 1FZKA 1D5BA 4LVEA 3CVHH 3STLA 4X7TB 3O41B 5IQ9B 5DJ6A 4R0LA 2NTFB 4YFEA 3RDTB 2NY2C 2CDFA 5DS8B 2ZOLA 5L0QC 1Q0YH 3BJLA 2PXYD 1VACB 2IH3B 4PRIE 4KI1A 1N59A 2VZTA 4CU8A 4NQDD 5GGRA 5C6TL 5I19L 1KUMA 3O2VL 2EDOA 1HNFA 1KEML 2H1PL 3UZEA 1OTTD 4Y4KC 3V0VB 2DLGA 1N7MH 4JHAL 4YO0A 1MRCH 3WJLC 4K3EH 1JNJA 2CJUL 3Q48A 2ITDB 3M1BB 3T0EE 1CICC 1HEZA 1KJ2A 2Y36L 3GGWA 3C6LD 1AHWB 2DKSA 2HN7B 4D94A 1A4JA 2QQNL 1RU9H 3V6ZB 5CJQL 1GGIH 1L9NA 2H32A 3V0AC 1S7XB 4PJDF 1BZ7B 4I4WA 2ZOKA 1ROWA 1PZ5A 3LMJL 1G7LB 4IRSD 5D72L 2P48B 5EU6D 1QBMH 4G7YL 2OXHA 3O3DB 2VDMH 1YEEH 5EZJB 4C54A 4MWFB 4YJZL 1MFAL 1YNTA 3JWNC 4HIXH 4XP6L 3T4YA 5IIEB 5C09E 2ADJB 1IGTB 2Q1EA 3H3BC 3MV9E 2WM0A 5JDSB 3CNKA 1J88A 1JF1A 5EO9A 2HLAA 5ADOH 4H0IA 2H2SD 1VADA 1MCSA 3K8MA 3DBXA 25C8L 3GUTA 4I9WE 4CU6A 4LQ1A 4PRHB 5T33L 1UB5B 3NCFB 4UU9B 3TO2B 5A16A 3O3AA 1EH9A 5CD3B 4NQSA 1MHEB 5BS0E 3MNWA 4MA8H 3S8WA 1EEZA 5LGHL 5CINH 1F3JA 1MFDH 4RQQA 3EOBB 2DJSA 3MLYH 1EO8L 4PS4H 1FGNL 1T1YA 1GIGH 4KK5D 5C0GB 4PJ9B 4G42A 5JNYB 2FATH 4YDIH 2AV7A 3LKPB 2PXYA 2HYMA 3OPZH 1LEIA 1YQ2A 2X9WA 1CGSL 2DTML 3G6DL 1HHIA 4FZ8H 4NQDA 4O4YL 4EDWH 3BIKB 4KK8C 1GPOL 4NCDA 5E2VL 2A9NH 5IF0A 2W65B 1A3QA 1P6AB 1YN6A 5DMYA 1RIHL 3KYAA 3L7EB 4NKIL 1BBDH 4XP9L 1F00I 3ARWA 5CUSL 1EJOL 3WCYA 1FO0H 1FVDB 3IETA 3O6LH 1YQVL 1GGTA 2VWEC 4KROC 3C6LA 4NNPL 3W2DL 4EJ1C 4PJAE 3FFCB 2WIMA 5I1KL 3E2HA 4V2CB 1X5IA 3U1SH 4IOFC 4DGIL 4U1IB 1GGBH 4IRSA 1OSPH 3TBWB 1CXKA 5EU6A 3FRUA 3MLWH 3U4BH 3HPLA 1UZ6F 5IMKA 3MRIA 1NKRA 1TCMA 2GT9A 3GI8H 4GKNA 2Q3AA 4Y16C 2YN3A 4YNYA 4CMMA 1T1XB 2NW2B 5CEYB 2AW2A 1JK8A 1MNUL 5C0IB 1N0XH 1IM9B 4ZQKB 2Q8AH 3V2AR 4D9RE 5IFAH 4U1KB 5E8OA 4L8SC 4P9HL 2HG5B 4WY7H 3BGFB 3PP3K 4NJ9L 3D9AH 4WHDA 3KVQA 3VMOA 4ZUWA 3HAEA 4HLJA 1U8LB 4G43A 4LCWD 3FAXA 4NWUH 1WK0A 1JWUA 5F8QC 3CVIL 5KVGH 32C2B 1G7JA 1RK1B 2YA2A 3OAUH 5T3XH 1DBJH 4ZXBB 3N1QC 3VD9A 3IDUA 3RZWA 3K2UL 3ZTNH 1T1ZA 5HHOB 2ZNWA 2AEPH 4PPTA 1KCLA 3FQXA 3LHPL 2ESVB 4G3YL 3GI9H 5D70L 5C0CD 3GMMB 1CGVA 1M7IA 1JWMA 1BM3L 4NQUA 4OZIF 4G8FB 5DURD 2NY3B 3LKSA 2BNRE 4PTUB 4J7RA 2DI8A 2W9DL 4RAUB 3RL1B 5F3BA 1HCVA 4Z7UB 4XCEB 5HGHA 3CPLA 3BDYH 4YXKH 1JHLH 3MOAL 3T04D 4G9DA 5I9QB 4D9QD 4YAQA 4H26B 5CJOH 4RGNB 2R4RL 1WGOA 5FV2A 1EZVY 4MJ2A 4M6NL 3TPKA 2HFGL 2CDEB 3C60D 3FFDB 4IDJL 3RPKA 3G08B 3T0WA 1BVKB 4OZGF 4ODUB 1JPFB 4S2SA 3TYGL 4L8CB 2WK2A 3O9WD 1HSAB 1K9TA 5IB1B 3HI6L 5DVKA 2GK0A 3I50L 4NO2A 5L9DL 2NY7L 1AGCA 2FHBA 4M93B 4R4ND 3GIVA 4BZ1H 1MHPH 3TH2T 1W0WB 4YHPB 3UAJD 1CQKA 4X7FC 4JO4L 2OTWB 4XPBL 1KJVA 4LLQB 2ZZUT 5EZIH 2EEAA 3ULUE 1NPUA 4MA3B 3OKYA 5IKCB 2CUMA 2QADB 1R3HB 2J4WL 1A6WH 1QFWM 2C26A 2MKWA 5EU5B 1AGBB 1HH6A 2HFFB 3U30B 1MCWM 3QIWB 2A6IA 4BUHA 4LCWA 4AJ0A 4U1LA 3UZVB 1R5IA 2A9MH 4PJEF 4I18C 4Y5XA 1XR8B 4MNQB 4KVNH 1JGVH 1QRNB 3C5SB 4GKSA 4UT9H 3I9GH 1G0YR 3NMEA 5E7BA 5J0BA 3D85B 3GSUB 5C0CA 1INDH 3MLSL 5KOMC 3DGCR 2E7LC 5FGBA 4Z7WE 5F1OB 5I1DA 2RAMA 3MV8D 1D5MB 4NHUB 5D6DC 4LKCA 1AD9B 2NY5C 3SOBL 3I2CH 4GRMB 1K3ZA 3R0NA 5F3HB 2HWZL 1YC8A 5A40E 4LSPH 4DW2L 3VFTB 1BWWA 5D2LA 3TNNB 4EUPB 3B5TA 3T2NH 3MXWL 1INQB 3DYOA 2ZUUA 3C60A 5DD3H 4KMTL 1LP9A 5GGQH 2DB8A 3HR5A 5KSBB 1A9BB 2BSRA 1MWAL 1U41A 1JGEA 1WBZB 2EDYA 2OTPA 4OFYD 3O9WA 1TENA 1CLYH 4O5LL 3MRMB 1FRGL 3ZMRA 3SQBA 2P8MA 4M6AA 4K2UH 5FOJA 1AO7E 1UADC 3WXWH 5IP4A 2VXSH 1JNNL 4P4KD 1YMHB 3BD5A 3R8QA 3LCYA 3NCCB 1BD2D 1K2DB 5C0BE 5C3LD 2ORBH 1RZKC 1CZ8L 4LCCB 2VDOL 5GSVA 1A7NL 3V9FA 3RUGB 4HS6B 3KPRB 1CGUA 2Q76A 4HXAH 1IGJA 4XZUB 5CD5C 4HEME 3WO4B 2K7QA 1HH9A 4ZDHB 3MTRA 1MCDA 3G5YA 3JTSA 1IEBB 5LAXA 3V6BR 1QLFA 2O5ZL 4K7PL 2F5AL 1PG7H 4XRCB 5LXGL 1RIUL 2EXYC 4BYHA 5HI5C 1Z5LA 2DRUA 2ZKHL 3ARGD 3ZZ1A 2CGRH 4LRIC 4Z8FL 3NCYP 4X4YA 1TJHH 2IJ0C 3TVMC 5JQ6H 1IGCL 3WFEH 1DQDL 1I3UA 2C3XA 2FX9H 1MCEA 3EO0B 4HS8L 1W72B 3MV8A 1QOKA 2HP4A 5FO7B 5DFVC 5FUZL 5CZXD 3SJVB 1T7XA 1EK3A 1TXKA 5H94B 5LGJB 3EYFA 1EEUA 3E6HA 4MNGB 2HMID 1E0OB 3EHBD 3IS1X 3QRGL 3VFSB 2XQBH 1Q94B 5MEPB 1ZANL 2C3VA 3QG6A 3RX7A 4KXZH 4X4ZA 1MQKL 1IM3B 4JKMA 3B6SB 4QHLB 3VRIB 3ULVL 3I6KA 2H2PD 4LIQH 4OFYA 3WIIL 4XP5H 4YHIB 1CK0H 4D0CA 1EERB 4HCRH 4N9GB 4S0SD 4V3EB 3HHRB 2FX7L 1I1AD 3CX2A 1SYSB 3UDWC 1MRFH 2F15A 2R29H 4P4KA 3QO1B 5HVHB 4W4NA 4PJGA 3U4EA 4NO3A 1BD2A 4KUCF 2P24A 2NY2D 1FZKB 1D5BB 3STLB 6CGTA 5DJ6B 4R0LB 4YZFF 1FIGH 2CDFB 2R8SL 5CGYC 2ZOLB 2HRPH 3L7FA 2F8VA 4S1RH 4XP1H 1N59B 1I9JL 4IRZH 4Y4KD 1T0NA 3NFNA 3S5LG 2BVUA 1W8NA 4X6CA 5GGRB 1F4AA 5FYKD 1VHPA 2FX8H 4U49A 5BW7C 3G9AB 3EYVA 1JI2A 1FNSL 3UZQA 4JFFA 4QXUL 5IGXL 4YO0B 4PD4K 2X6MA 4APQC 1CICD 5LGKA 3ARGA 1KPUA 1IC4H 3EJYC 3QUMH 1T7YA 5B4MC 1F90H 1HEZB 1KJ2B 3GGWB 1MSPA 1JBJA 2I27N 1A4JB 4NPYA 1VFMA 4KQ3H 1YNLL 1N5YL 5CEZL 3CDYA 1A2YA 2H32B 2VUYA 4YE4L 1CT8A 4I4WB 4K07A 2IFFH 2ZOKB 1PZ5B 3KYKH 4XPAH 5GQBA 1EGJL 4DQOL 2EDEA 3HAEG 4I5BA 1BF8A 3CFCL 1EFQA 1AI1L 1FORL 2W0KA 3BKJH 5FCSH 3HC4H 1HHJA 1YNTB 2CKBA 3T4YB 4OLEA 2OR9L 1BQUA 1DN2A 3BN9C 3D2UD 1JF1B 2FJGA 1B3JA 1AXTL 5EO9B 2HLAB 5E99L 1NKOA 1IILE 4TUKH 1KBGL 2ATPA 1VADB 4CKVX 4JGUA 5FECA 3DBXB 3T3PE 3GUTB 1I4FA 1BJ1J 3KXFE 1JL8A 4MVBC 3MRNA 2EH7H 4PYHA 5A16B 3O3AB 4NQSB 4PRBA 3HNVL 2R1XA 1I1AA 4XAKE 5JPNA 2ERJB 4MS8C 3MNWB 1EEZB 4C57C 3AB0C 4EDXA 4OFPA 4DEPB 1F3JB 4RQQB 4K7PX 3CXDH 1MFCH 4QHUA 3L3HA 4W70A 1FBIL 2WBJC 2Q8BH 1T1YB 4F15B 2OZ4L 2GAZA 4PR5A 2EKSA 3BZEA 4G42B 2AV7B 4KK8D 2PXYB 1A9EA 4JFPA 5JPMA 1LEIB 4Y4KA 1HHIB 4NQDB 2F5BL 2DM4A 3WJLA 5JXAL 5IF0B 1HN1A 5K59F 1YN6B 1UA6H 4OM0H 3DMMC 1CICA 4KROD 1A6PA 2VAAA 1RI8A 3BWUC 3JWDL 3U7WL 2IANE 1YEGL 5DJZA 3IETB 3C6LB 1BGXH 4M7JL 3DXAE 4ORZC 4IOFD 4FQLH 3ZE0F 3RWGA 3E2HB 5A43C 1ZGLP 1ADQH 1VGEH 5KS9A 4XB7A 1A1OA 4IRSB 2J2ZA 5TQ0H 5EU6B 3FRUB 4WHYH 3HPLB 4Y16D 5IMKB 3MRIB 3CDCA 4JM2F 3JTTA 2GT9B 4FFEX 4GKNB 1QKZL 1GC1H 2G9HA 3BW9A 4YNYB 4KTDL 2XZAL 4UOW0 4CMMB 5BV7B 4GMSH 4ELMA 3MJGX 4RNRA 1LE5A 5DA0B 4KRLB 4L8BA 1JK8B 5TF1H 2BOCA 1A47A 1B0RA 1OLZA 5E8OB 1OAXL 2VZVA 3JSSA 4YX2L 1FN4A 1AGFA 1V05A 3P4NA 4GRWH 1B6UA 3CFKA 4GW5A 4CVXA 1B4JH 3TV3L 2AQ3A 4ZUWB 3HAEB 5KN5A 1JFMA 4G43B 4XMPH 1MY5A 4UB0L 4M7KH 3ZYZA 1JMXA 4NBXB 1JWUB 4ZD3L 2BERA 4TSAH 2AJYL 1G7JB 1J1OH 1YY9C 1KTLA 1C5BH 1J0KA 4PJHF 15C8H 1SHMA 5DDHA 1T1ZB 1LK3H 3FQXB 1CIUA 2YD4A 1M7IB 1Q1JH 1ZHLA 4X8XA 1JWMB 4ODSH 4JB9H 3LKSB 4HSQA 3P4LA 4JN1H 2EE3A 5ID0A 2L4OA 3TBYA 5F3BB 3ARVA 3W5NA 4JFDD 5HGHB 1V3MA 5D93C 1MHCA 5IVXA 1XH3A 3CPLB 3OMZA 5ACLA 1GYAA 1Z9SA 4G8GD 5GJTL 4G9DB 3MX0A 5DT1H 2EC9T 4YAQB 3VH8A 4QRTA 4P49A 3ZDZF 2FD6L 1DVFC 4NYLA 3KLAA 1A5FL 1H0DA 5F9OL 1PQZA 3BDBA 1UYWL 2DQHL 3BFOA 4EXPX 4RA3A 2IWGA 3GK8H 1JTOA 5H35A 4Q2ZA 3BH8A 2YZ1A 4OT1H 4S2SB 5EC1A 1J10A 1ZHNA 4Y16A 2ENYA 4HBCL 2KKQA 2CIIA 2GK0B 4NO2B 1OAYH 1X4ZA 1AGCB 3VGAC 4U1JA 3DV4A 2LQRA 1CLOH 3GIVB 4YDJA 4PRPD 1OAQL 4L8SA 4M62H 4GJTB 4ZTOL 2I5YH 1EHLL 3DGGA 1KJVB 4YBLC 2JCCA 3NABL 2WUBH 3VRJA 5HDLA 3RA7H 1MCBA 3PIQA 5FGSA 3KYOA 2FZ3A 1T2QL 4JZNA 5F1KC 1HH6B 2Z8WC 2A6IB 4LCWB 4U1LB 4JKPH 2YC1A 1JIBA 1JYWA 1R5IB 2AJVH 4ZOEA 4Y5XB 1S5IH 4GKSB 4XMLL 1TZIA 5AAWA 4FFWC 3MZTA 3FFCE 2X9XA 5HHME 2NY6C 2DMBA 4Y2DC 1UJ3C 1DL7H 1MI5D 5C0CB 5TPWH 2KL6A 4YBQC 1WFTA 1KPVA 2R23A 1D5XA 5DURB 2BY2A 5I1DB 3LRSA 1P4LB 1HYRC 5IB5A 1BECA 4HS3A 2Y06L 4LKCB 2Y4SA 3F6IA 4JFDA 1T4KA 2VXTH 2BFVL 1W2KT 5AYQA 3WNPA 4G8GA 3NPZB 1GL4B 2W38A 4OF3A 5D2LB 3EO1A 4HF5H 4K55A 4LPTA 3K8LA 5I75C 2YRZA 1NCBL 1TITA 3WKML 1FLRH 4LAQL 3RU8H 3C60B 1C1EH 1FPTH 1LP9B 1XGYL 3HR5B 2Z93A 4R2GC 2BSRB 1JGEB 4ZOAA 5FYLD 4F9PC 3HMXL 3TA3C 4JQVC 4NWTL 1EO5A 1NFDA 4Z95L 3O9WB 3E6FA 3V4UL 3JWOL 2P8MB 1CCZA 2H6PA 2IQ9L 1FP5A 2PR4H 4KZDL 4HPYH 3LEXA 5F9JA 4PRPA 1T3FA 4K71C 2BXYA 3EO9L 5IMLA 4R3SA 5CD5D 5GSVB 5DEGA 5T3ZE 1L6ZA 2H3NA 1ZE3C 4HC1A 2WUCL 3PGFH 2Q76B 1IGJB 1L4IA 1HH9B 2MOVA 5D9SA 3G5YB 5EIVA 5DC0A 2ILLA 2BSSA 3JTSB 5IW6A 5LAXB 1QLFB 2JJWA 5MERA 1HWHB 4I18A 2GJ6E 3VDCA 4ETYA 4R4FH 5CCKL 2EXYD 5HI5D 3AREA 3QWRD 2P4AB 3QDHA 4M5YL 5J56B 1SBSH 4E0RA 3ULUL 2DQFA 4RFEA 4RGNE 4A2MA 3TVMD 1FZMA 1Z5LB 5FHBL 1T0MA 1TTFA 2E7LA 1HCFX 3RP1A 1NCTA 3ALXA 4X4YB 1MI5A 4NT6A 1YDPA 1IGMH 1U36A 1R3IH 4KHXL 7CGTA 5DEZA 1I75A 2AQ2A 4Y8DC 5DFVD 5CZVH 3MV8B 4GBXA 4K23L 4IMKC 2G2RA 1NH6A 3UJIL 3BUYA 3CD4A 3Q6GL 1S7UA 4YH6A 1NANI 2MPAH 1K8DA 3QWOA 3M45A 3EYFB 4OAWA 1MUJA 3E6HB 4PJIA 5EUOA 3WL9A 3SDXA 4WI9A 2P49B 3V95A 5MI0C 4MQSB 2C3VB 4HFUH 4R7DA 3QG6B 5AAMA 3DYMA 4IM8A 1PLGH 3BPLC 3I6KB 4L4VE 4QRPD 2OCFD 4XBEL 4D0CB 4DZBA 1E4XI 3NCYS 4FP8L 12E8L 2ATKA 5JIPA 1C5DA 4P4KB 2OM5A 1NFIA 4PJGB 3U4EB 4NO3B 1BD2B 1DE4A 2P24B 2ZSVA 4MX7A 4M48L 1T7WA 5F6IC 5C0NC 1CU4H 5CGYD 3QUZC 1F4XH 1FVEA 4PV8A 1WC7A 5T1DL 4ODHH 1KTKE 1F45A 4G8EA 2PETA 1FCGA 4NHUE 1UVQA 2V17H 3RGVC 4ENEC 3L7FB 2DM2A 2VABA 1KIRA 1T0NB 2LABA 3NFNB 4X6CB 4X7EC 1XFPA 3LEVH 4APQD 2VIRA 1XGUA 3QWRA 1NMAL 1QNZL 1CFVL 3EYVB 3NZHL 3RAJL 3EJYD 4JFFB 4LRIA 1I8LC 1F4WH 5B4MD 3TVMA 3NCJL 3ARGB 2EIZA 1KPUB 1CYGA 5KSBE 1P5UA 3P0GB 4M1GH 5GGVH 3TBSA 1ZAGA 2XQYG 4NM4H 2ICWI 4NPYB 3CDFA 1Q72H 3SY0A 5EBMA 1A2YB 1YNKL 2LVCA 3IGAA 3LVEA 1CT8B 3JWDC 1IT9H 4H1LG 2P8LA 1T03H 4I8DA 5D6CA 4AH2A 2YXFA 2X1QA 4I5BB 1RUKL 3U79A 3BN9D 4NZJA 4WUKL 1HHJB 2CKBB 4N8VG 1IVLA 1PZUB 3KJ6H 4K8RC 5E2TH 5JHDD 4RCAA 2FJGB 4QO1A 1NBQA 2QTEA 4JRWA 4I0PC 1QSEE 2ATPB 4N5EC 1CBVL 2XY1A 4QNPE 4WUUE 1L7TH 5FECB 5I8CA 2IG2H 4MVBD 1IBGL 1I4FB 1JHKH 4JRXE 4QRPA 4LPUA 3UDWA 5E00A 2P42B 4MS8D 4HXBH 2X4SA 3MRNB 5IVZA 5TE6L 3TWCL 4PRBB 4WI5A 2R1XB 1I1AB 4M5ZH 1QFWI 1QBAA 4X9IA 3K46A 2DQUH 5JPNB 5MEQA 3QP3A 2AJZA 2YOCA 2WBJD 4UUJA 2VNCA 3LH2H 4EDXB 2XKNA 4KV5E 3QHFH 1WAAE 4QHUB 3WUZA 3T1WA 3L3HB 3U83A 2NY2B 3T0XA 1E4XL 3ME0A 3VH8G 4V1DE 4DOHB 3PABA 5L0QB 4LGPB 1FSKC 2GAZB 4PR5B 2EKSB 3BZEB 2VLRD 5C0AD 5FCUL 2V2WA 1A9EB 4JFPB 5JPMB 1ZLUK 1RSFA 4U3CA 2OJZL 4Y4KB 4ERSH 1I85C 4XMKH 2OI9C 1BZ9A 2HVJA 3DMMD 3ET9F 5BO1L 4ORGA 4WEBL 4MNGE 1P7QD 1W72H 2YD9A 4MA7L 2VDQL 1X5KA 1CICB 1MCRA 2GQHA 2BCKA 2QHRL 2VAAB 2D7QA 1ZLUH 5K9QI 1MFEL 4QKXB 3SGJC 1CVRA 1A02N 5DJZB 4PGDA 3T2QA 4GLRI 1C8PA 1MCOL 3MLUH 1ZT1A 1BIHA 2C3GA 4P2RE 3LY6A 3RWGB 2J8OA 2AJXL 1C7SA 5KS9B 2W0PA 2A6DA 1A1OB 2EC9U 4QRSA 4PJFF 2LAGB 4L5FH 4GSDL 3JTTB 2X42A 3MUY1 4QXWA 2GEEA 2G9HB 2DLEA 3BW9B 4HUWA 3W81A 5ESQA 1U8QA 4ELMB 4RNRB 5ICZA 1VFOA 1LE5B 1KFAL 2FB4L 4L8BB 1ZGLM 2BOCB 2I25N 4MVBA 4YR6A 1B0RB 1NUFA 1MVFA 1QRKA 5C08E 1OGAE 1E6OL 4MSWA 1FN4B 1AGFB 3P4NB 4MS8A 5DD5H 2GUOA 3ZT7A 3CFKB 4G7VH 4GW5B 3VW3H 1UG9A 4CVXB 3JXAA 4JO1L 2WBJA 2VUOA 1AGDA 4PJBA 5KN5B 1UXWA 1YY9D 4X7DC 1FHGA 2FH8A 4NQVA 1KTLB 2EDHA 2BNQD 5DDHB 5ALBH 5ESAA 4PJXE 5IEHA 3MUZ1 2VLRA 1IKNC 4OD2A 5C0AA 4M00A 5C2UB 1KCKA 1BJ1H 1DQJA 1ZHLB 3PHOA 1ZLSH 4RBPK 5FKAA 2X70A 5IFHL 5GIRA 3B9EA 3QCVH 3V79C 5LWYL 3DMMA 4KJYA 5ID0B 3TBYB 1P7QA 2IFGA 4X99A 2C5DC 1MHCB 5IVXB 3JZ7A 4KROB 5D7KD 1XH3B 2N7BA 1DVFD 4LRNH 4RBPH 1QO3A 4OCSL 3VH8B 4QRTB 4FHBD 4NYLB 5TDOA 3AAZA 1Q0XL 3KLAB 3OG4B 4FFZH 1H0DB 1IRAY 1PQZB 3RX5A 3WLWC 4M9PA 1MJUL 1G6RL 5HYQA 1PEWA 35C8H 5H35B 4Q2ZB 3BH8B 5EC1B 4UT6L 1ZHNB 4Y16B 3SKUD 3DIFA 1LO3H 2RB8A 2CIIB 2J1KA 2Y5EA 4HT1L 4U1JB 3DV4B 4NP4H 3VCLA 3KPSD 1INEH 4OCXH 3LS5H 4N90D 4YDJB 2X4OA 4Q74A 4NNYA 4JPVL 4L8SB 2E3VA 3OZ9H 3ZL4L 5HXMA 4YPGA 3JV5A 2ICES 3DGGB 1SVCP 4YXLL 3B5GA 2V2TA 1VERA 3WIHL 1PX4A 4M43L 1EUTA 2JCCB 1NCWH 3NA9L 3PWNA 4NQDE 3VRJB 3WXVH 5J11C 3IAQA 2D9CA 3PIQB 2B5IC 2QEJA 1MCLA 3KYOB 2FZ3B 2Q7NA 4JZNB 4L3EE 1IAKA 2UWEA 2JJUA 4ETQA 2YC1B 5J4MA 1FH5L 4O02L 1X6LA 1KCUL 1I1FA 4FFWD 4JHWL 3STZA 2MTPA 4PB9H 5D7IA 1MEXH 5FKPA 3PV6A 1BAFH 2NY6D 5DD0L 5CZKA 2BNQA 1H5BC 1FYTE 4Y2DD 4FNLL 2VXUH 1TZIB 4YBHA 5EU7E 3RWJA 1QBLH 4YBQD 4DZ8A 5MEOA 2R0ZL 4NN6B 3O4OC 1X44A 3TFKC 1UM5H 4UV4H 1YJDL 4PJ8C 2YK1H 3DI3B 3ULUC 1KPVB 2FBJH 2R23B 1D5XB 4OD1H 2YRLA 4N8PA 2O5XL 1U8OA 3LRSB 4JR9L 5IB5B 4HS3B 3AS0A 4YPJA 4KI5C 4JFDB 1T4KB 2X40A 4U2ZA 5TF0A 3DSFH 5F7KC 4Q0XL 5F89A 5BMFL 1MF2L 1DVFA 4ZFFA 4G8GB 1RY7B 3U0PA 4D2NA 1I3GH 3U7AA 5CGTA 2BDNL 3EO1B 4R2GD 1CTNA 3QEQD 3TA3D 2NXZC 2Z91A 2BY3A 2Z93B 4DKEL 3DYPA 4Y19D 2AGJL 1II4E 1NFDB 3VFVA 6FABL 4Y5YC 5GS2H 1MWAA 1OAKH 2GY7B 3E6FB 3E1F1 5GRVK 2H6PB 2ARJQ 3KPSA 4JFED 5TFSH 3LEXB 5F9JB 4PRPB 4OCRH 1S3KH 1T3FB 2C4FT 4EOWH 1MCPL 3O0RL 3HAEH 5IMLB 4R3SB 1F8TL 3S37H 3MJ6A 5DEGB 4UTAL 5HDBF 5JHLL 2H3NB 4LQFH 1JPSL 3F62A 3ZKMC 3R06A 3PWPD 1A7OH 3S7GA 4QLRA 5L6YL 2EDQA 3RQ3A 2HKHL 5D9SB 1A6VH 2VH5H 4KKAC 5DZOA 2BSSB 5IW6B 1J9CT 2APWA 1D6VH 5MERB 5BVPH 4I18B 4JY4A 4YFLF 3O3UN 3WSQL 4JKKA 3SQOH 3AREB 2A83A 3X12A 2R69L 4CMHC 4E0RB 2DQFB 1JPST 4RFEB 4Y2DA 1GHFH 1UJ3A 1FZMB 1FV1A 1T0MB 5B39A 5L88H 1CDBA 4OGXH 4NJAH 1BQHA 1MI5B 4NT6B 1YDPB 2GCYA 2DL2A 1KLUA 2PKDA 2XG5A 4TOYL 4P2CG 2ZUQC 1F42A 2J88L 5AD0A 4OD3L 5J8OA 4PBXA 4GBXB 4HK0A 3QEHA 2G2RB 4GAGH 4OSUH 5DGQA 5CEZD 3BUYB 1S7UB 1D5IL 1K8DB 3QWOB 3FHAA 1T20A 3L3IA 4OAWB 1KJ3H 1MUJB 1JGLH 1F4YL 4BK4A 3WL9B 4PJIB 5EUOB 1O7SA 3FT3A 3L5XL 2OMNA 3SDXB 4GXVH 1DCLA 3QEQA 3TA3A 4JQVA 4F9PA 4R7DB 5CLWA 5C07E 1BIIA 4Y19A 3UO1H 2C3HA 5J6HA 1HDMA 4DGVH 4HZLA 4XNUH 2X05A 4MQ7A 1JN6A 2WY3A 4DZBB 1WFNA 1LO5A 3C87A 2ATKB 4JAMA 4WTZG 1C5DB 4JFEA 5TE4H 1YPZF 1KTDA 4PJ7F 4YHLL 1JGUL 4TQEL 5C0ND 3FN3A 3H6JA 3VRLF 1HHKA 3QUZD 4M3JA 1NFIB 5GRXG 4ZFZA 5E4EC 3WHE1 1DE4B 4OGYH 5EWIH 3RFZC 2ZSVB 4MX7B 1G84A 5C0CE 5EOCJ 3GSNL 4UTBL 3T4AA 3PGCA 4PJCF 1FVEB 4PV8B 3RGVD 1DBML 3PWPA 4ENED 1WC7B 4JQIH 3IKCA 1KN2L 4JG1L 4G8EB 5T5NG 3WS6C 5IHBA 1UVQB 4HBQA 1MFNA 4V2BA 1RZGA 2VABB 1KIRB 2X89D 2QSVA 4BK5A 5D1XC 1N3NA 4XX1G 2VIRB 5FYJE 1XGUB 4FABL 1NCUA 3A67L 4AEHH 4BUGA 3TVMB 4XWOC 3VWKC 4HKBA 3SE4C 1QR4A 2EIZB 5E6YA 2VLKE 2VDNL 3TBSB 2A2QT 2I26N 1ZV5A 5HPOA 3N85H 4PJEA 4IMKA 1YN7A 3SKMA 4OGZA 3DVIA 4NZTL 4PRID 3SY0B 5EBMB 4WI7A 3IGAB 1JF6A 4NZRH 2P8LB 3VG0L 5D6CB 4AH2B 4G59A 2I24N 3NAAH 3PF2A 3NACH 4ZPVA 1NUNB 4K8RD 5ITFA 5DJCA 3AROA 1EGJA 4I0PD 4LIQE 2WBWB 1LDPL 4N5ED 5HHXL 1VPOL 3GHEH 3INUL 2DIAA 4OZHA 1OHQA 2GFBA 1OARH 2ZCKH 1WV7T 5I8CB 2A0LC 4JY5H 1AJ7H 4QRPB 3BT2L 2YA1A 5JXEC 3Q1SH 4Y0GA 5E00B 2X4SB 4F7TA 5IVZB 3V0WL 3MJ8A 2AK4D 2FLBT 4XNQA 1ZT4A 5MEQB 2AJZB 5C09D 4LAJH 4UUJB 5TQ2H 3MV9D 4JM4L 3QUZA 4NQEE 2XKNB 5ICYA 3EYQC 3HZVA 5LJYH 4G6AC 2CK0L 3KNBA 4WI4A 3ZT5A 1QQDA 1RUAH 2MFNA 1IC5H 2E7MA 4ZS7H 3VXOA 3PABB