5F1NA

Mhc complexed to 11mer peptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAPWVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYGCDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLVEPVTRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 75
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5f1nA01
3MV9A 5C0RH 2B5IB 4RFOL 2C7UA 1Q9OB 2QSTA 3SKOB 1QFHA 1CE6A 4GAJH 2R1XB 1BD2A 2NPLX 1K5NB 1GOHA 2LU3A 2NMSA 1BVLA 2DLHA 2JELH 2VXQH 2J8UF 3S36X 1T1YB 4QCIB 2EC9T 2NXYC 5ANMB 1XGRB 4RFNB 3AS2A 1RU9L 2ADIA 1CFSB 1LEGA 1MLCB 2FNBA 4HJGA 2ESVB 4OQTH 5SX4I 1QRND 1CTNA 4NQEE 2X70A 2BHZA 2WLYA 3QCUH 4V1DD 5ENWA 2B20A 1BQSA 3FO2B 3K4ZA 4QRQB 2FJHB 4H5SB 4FQQA 3QI9B 1D5IL 4JR9L 4PS4H 4OGAC 5IHUL 2YPLB 4X5WA 2WUBL 4N1HB 1DLFH 4X6EA 4O2FB 1ZGLP 4GW1A 4FG6D 5HI3D 1RK1B 5E8PB 1RZKH 3JWDL 3IDJB 1K3IA 4MDIB 4DVRL 3F7YB 4F58H 5GHWL 2J8UA 4U1HA 5IB5A 5DMYA 3KNBB 1JWUB 2FO4B 4QXTA 5C08A 3WMSA 5I8OL 4R26L 3T4AA 4ELMA 3FT2A 5IHZB 2AK4E 1D9KC 4JANB 5IJKC 2XZZA 5ITBH 2EXWC 3MRGB 1Q0XL 4I3SH 4FQJH 4LVHC 1H3PL 2M8XA 4Z0BL 3SO3B 5CJXC 4YXLL 3L3JA 5TDOB 3CFIC 1UKSA 2V9RA 3VXSA 2CLVA 4NKMB 3PWLB 2DBJA 3GSRB 2GSGB 5AD0A 1N2RB 3ABZA 3B9DA 1L9MA 4JLRB 3KLDA 2DQJH 4Y5VC 1C5BL 3RDTA 1DQQB 1U8PB 1KSRA 4AENB 2DBLH 4MA7L 2DIBA 2AJVH 4NIKB 3UTPE 1BOGA 2WBWB 4KMTH 2BOCA 3RL1B 1EJ6A 5ILTL 2C5DC 3T2QA 5IEKA 2KZWA 1JNJA 2BCKA 4ZFOL 4HUXB 4JY6B 2Z9TA 2ZUQB 5GS3A 7CGTA 4YUEH 1MFCH 4NQEB 2LFGA 3FOMB 2PYEA 4LCWA 4JZOA 3I6LE 4KTDL 3DTXB 3G5VA 3QDME 5DEFA 1KN4H 4L3ED 4AL8H 4K9EL 3CSBA 3I84A 4L3CA 4XVUC 3SQOH 4N0CA 3RGVA 1P6FA 4JFDE 2HJLB 1QO3A 5SWZB 2AAVA 4JO3H 3SKNB 3KDMB 5GJTH 4O2CB 3WHE1 3VGAC 5HVFB 3WNLA 5FO8A 4QRUB 4XXCA 1X4ZA 3NGBB 4PRPE 4RQQA 1WV7T 4ZFFA 3QSKB 4WWKD 1RPQA 5SWSB 5E6ID 3QUXC 1SBSL 3KXFE 5E8OB 1HINL 4EN3B 3C5ZA 3B9KC 3VFOA 1CYGA 5H35B 4ODSH 1OWWA 4GLRH 4LLVB 4X6DA 2XNAA 3RWFA 4LPYA 5IB3A 1H3GA 1YNLH 4ONGL 4PUBH 3IFPA 4PY8I 1UJTA 1UWGL 1RURL 1M71A 5EA0H 5EFIB 5CZXC 2LAGB 5CINH 3MYJA 3ZKMD 3LRSB 1ONQB 3QULA 4UQ2B 3FRUB 1S5IL 2I07A 2Z8VC 4JFFE 5L8LB 3SDCA 1VSCA 1AQDA 5BV7H 1AQKH 1BQLH 2G5BA 3IXAB 5DRXB 1MH5A 2R0LH 4F7MB 1U8MB 3VGHA 1XCTA 3TZVA 4I2XE 2BC4B 3PJSB 2CLZA 4IM8A 3P4MA 4AJ0A 1CCZA 2XA8H 2Q6WB 1HHKA 4H88H 3U4EB 4KK9D 3GJFB 3NCCB 1ZGLM 1VERA 2AJUH 3NIDF 1I8KB 2YWYA 3PWPA 4KROC 4POUB 1B0GB 4HKBA 4N0YL 4JG0L 1XIWA 1PZUB 5I1CL 2P24A 4N9GB 3GDBA 3SDXF 4OZGF 5D1XB 4MNQE 1UCBH 3QFDB 3DLQR 3UBXA 5EZIH 1Q72L 3F5WA 4U3XA 2FWOA 5HDQH 3DUSA 1ZS8B 1Q9KB 2W0LA 4G3YL 2OZ4A 2AV1B 1AO7A 1BAFL 4L9LB 2A9NL 4PRPB 4ZOAA 3TJEL 4G7YH 4DGIL 5DWUH 4WO4C 5I76A 3L95B 1BM3H 1NCCH 3WUWG 1JFQH 5CZVH 2AJYL 2IADA 4NQDE 1FFNA 4N68A 3V5HA 1VA9A 4GLRI 4TTGA 3QHFL 3KXFB 4OV5B 4DGVL 5CD5D 4TUOB 3H9SE 3LEVH 4CN1A 2DI7A 1CDHA 1FV1A 4LASH 1Z5LB 3MA9L 3EFDL 1SJEB 1I1YA 4DN3H 3AXLB 5SV4A 3LRHA 2CIIB 1F2QA 2G2RB 4ODTL 4UTAH 3CFJB 2DQCH 4XP4L 4P0DA 1LMKA 1VPOL 1YEHL 4ODUB 4JDTH 4FQIH 4L3AA 3PGFH 3HC3H 2VLLB 2VLKA 3ZE0E 3SE9H 3BGMA 4NNYB 1IEHA 4AG4H 2F5AH 4YJZL 5J1AA 1NMCB 3GI9L 5KVEL 1RQ5A 4EEEA 3CVHA 1FIEA 4DUVA 3PGCB 1UA6L 1XEDA 1YEGH 4I9WE 1T89A 3CAFA 4OQ1A 4HCRL 3ERYA 3IJYA 2CIKA 1MWAH 4R97B 3TH4T 1YEDB 3I6GB 1T5WA 1NUNB 3ULUD 4RFOH 1A4KB 2IPKA 3O3AB 2Q8BL 4RX4A 3IXTA 1JGDB 1NBYA 2P7TB 1QZ1A 4LFHD 1TIUA 3BH8B 6FABL 1GC1H 3QZWG 1F8TL 3KS0J 4N0UE 1AP2A 2GSIB 4QHKI 3UAJC 2JJTA 3O6FD 3K1KC 2VQTA 4JQIL 5HYEA 4ORGB 2VABB 1BFVL 1F3DJ 1MFBH 2DQFB 4HFWA 4RNRA 2HVJB 5JW4M 3WFBH 3ZSTA 2CDEB 1IC7H 1D5IH 2R0ZL 4JR9H 2UY6A 4WEBL 2AK4D 5LVEA 4G5ZH 4BM7A 3ULSA 1DUYA 4P3DA 4NKOA 1CGXA 4D9LH 3M45A 4DKFH 1Y6MR 2WIMA 5IG7B 2UYLA 4NQDB 2JCCF 4UV4L 2VZOA 3KYOB 3OAYH 2O93L 3OQ3B 3BRGC 2VN7A 5E4EB 1U2CA 5HHPB 4O4YH 1IAKB 1NDMB 3H9SB 3DV6A 5CP7B 1H3WM 4HWEH 3RKPA 1OP3K 4Z7NF 5C0EA 1UVQB 5TGBA 3EGSA 4Z7OE 5M94B 4RWYL 2ARJQ 2SEBA 3SDDC 3ES6A 4FFYH 5E5UB 3D18B 3GMQA 2ARJA 4WU5B 3UTPD 3HRPA 2YUWA 3PP3K 5D71L 4LPXA 1HQRB 4ZNEE 3QWQB 3V4PL 4JPWL 4QGTA 2FO1A 5D96B 3TO4D 1UJ3C 1VKXB 5E8NB 1F00I 2HLAB 2LU4A 3I6LD 1KPVA 1OTSC 1H3PH 3FKUS 3QDMD 1D5MA 4LSQL 2HVKA 1MCCA 4QHLA 2EDBA 4LP5A 4UQ3B 1OB1A 4JFDD 1ZVSB 3JWOL 3P40A 1ZE3C 1AKJB 3KWWB 5DHXB 3MRHB 3V6OA 3AU1B 1FN4A 3OPZH 4OF0A 4TOYL 1I3GH 5MEPB 2AXHA 1QVOA 2GCYA 3DETD 4PRPD 4EBQH 4PJ7F 4XNQA 4PB9L 3CDCA 3RX5A 4FZEH 4DTGL 5FCUH 1EK3A 4BZ2L 1HHHA 3S4SB 1AR1D 4BJLA 1EFQA 5ILTH 1C12B 2W0PA 5FO9B 3MRNB 1ZHNA 3KXFD 1LDSA 5IQ7H 1UWEL 4KTDH 5DSCA 2EDFA 2IJ0C 4I48B 4Y4HD 5EH1A 1WIUA 3VU2A 3K2UL 4GRWF 5JW3L 3IU4L 3GSUA 1BEYH 2HN7A 4FG6C 4JB9H 5T1LB 3FT4A 2HG5A 4WHYG 3JV4B 4K3DH 3RZCD 4MNGE 4PTTB 4XWOD 4FRWA 1NCNA 3ROOB 1KC5L 2WWKT 3K0WA 3PABB 4S2SB 5E00B 4NO0D 1ITCA 5T5FH 3DUUA 5HYFA 4NHCH 1WFOA 2LV4A 3QQ3B 5F7UA 4JFFD 1DVFD 2R2HB 5TQ2H 4XC3L 4GQ9H 4QXWA 1F90H 3BO8A 3P0YL 1KJ2B 1BZ9A 4OF6A 4P3WA 3WFEH 3BKCL 1XH3A 1AC0A 5DUML 4WUUA 3TFKD 3D9AH 1BBJA 3SGKA 3WFZA 2P43B 1DQJA 1Z9LA 4KHXL 4NUGH 1NCWH 1RJYB 4N1EA 4ONGH 1K4CB 4XHJD 4LVOC 1MFEH 1RURH 3TT3H 1YNKL 4IBLT 4X98A 4K7FA 5BS0E 2RCSL 4TVPE 3L7EB 1LEIB 3TA3D 1INQB 5JQ6H 1I85C 4MCZB 1T1XA 3L1OL 5DD6A 1MCLA 4Z76B 4MNQD 3PHQA 1AHWC 3LS5L 2ED8A 1ZVHA 4YK4B 1NGWA 3TF7A 2DWEA 1QHPA 4N8CH 4G8EB 3FN9A 5GGRA 5ID1A 4OZHF 2H2PD 5T3XH 1ETZA 4JFOA 5BZDB 4PG2A 5AYQA 2HJFA 3V8OA 4P49A 4NQDD 4P2RD 1RI8A 3NPSB 3TPUE 1ZANH 1GHFH 3S98A 3DWTA 4Q9CA 3QXVA 5FYJH 4M1GL 1XGUA 5FCSH 1WEJL 3RAJL 2ZUYA 1LEKB 4IRJA 5L2KA 3T8XB 2EDHA 3ZT6A 3LKRB 4OLYL 3KYNA 2NY4B 4IS6B 5I1CH 4K94H 3O3UN 2V2XB 4XWGL 5ALCH 4Y1AE 2HRLA 5HJ3A 1GZQA 1U8IA 3QUKB 5GGRY 5FEBA 4OCWH 3HC4H 2ZKHL 4F2MA 1Q72H 1ZT7B 5JW5B 1HIMH 1FRGL 2OL3B 4WWKC 3CSYA 1I7UA 1OAQL 3QNXA 3GUTA 5E6IC 5DURB 4G7VH 3TJEH 2GAZB 5LCVH 2XQYG 1Q9WB 1L7TH 2AJYH 3GMNB 4I9WD 2B5IC 1RFDL 2X44D 1N64H 2AQ2A 3VD9A 4DGVH 1K4DA 4YHYC 5KSBF 1MUJB 3D25A 1QSFE 3D39A 5L9DL 4Z0XB 2VITB 1TJIH 5EIIA 5D5ME 2DKMA 4R9HA 2J8HA 2Z8SA 4Y4FA 3VDAA 4PJ9D 3BI9X 3DXAE 3QP3A 1VPOH 1YEHH 1EMTL 4KKLC 3RUGE 2X05A 2ZCLL 5KJRL 1PEWA 4ZXBD 1V3MA 2V5RA 4G8IB 1IKFL 3EOAB 2PW1A 4HW6A 2WIIB 3LKOB 3SJVB 1YMHB 2VAAA 5F7DA 4A6YA 3MLTA 4XP1L 1MY5A 4HCRH 4MA3B 3HE6B 5D7SL 1P6AB 4EDXB 2EDXA 1G6RA 3WLWD 2EYRB 4KK9C 3GFUA 4Q9QH 1E4JA 1ZMYA 4F7PA 3L5WA 4OZ4A 1UB5B 4RMVA 1MCPL 5DGRA 1MAML 5EZJB 2OTWB 2X5PA 1KELH 3TPUB 1WBYB 3HZMB 4HS8L 1Z0MA 5FM8A 5F96L 1H0DA 3JTSA 1CFQA 3BH9A 1CU4H 1D9KA 2VE6A 5J6HB 5IJKA 1ZEAL 1J05B 2J12B 1EHLH 3MV8A 1IM3B 2IG2L 2D7PA 3VG9B 4LPUA 4AT6B 2IBZY 3W2DH 1CTOA 4U3HA 1YY9D 3M17B 5CJXA 4P2QA 1DR9A 5I1JL 4HHAA 2NY3B 2EDTA 3DRQB 3I02B 5KSVA 4OGZA 2R0ZH 3WIHH 4GBXA 4HGWA 3SO3C 1FC2D 4Y5VA 3ZO0A 4M5ZH 2C4FU 3ALXA 5CD5C 4L5FL 1BMGA 2CMRL 1BF8A 3WXVL 2B1AH 1HOCA 5GGQL 1QLEL 4ONFH 5D8JH 3QDJA 5EC1A 2OTUA 5ACZB 1T2QL 4YAQB 2VSCA 3TBSA 1EGJL 3VFTB 5KVFH 1GRWA 2BXYA 5I66A 5I1KH 3N85L 1P7QD 3B2UC 4XMLL 4ONHB 43C9B 3VJ6A 5D5MB 4M6AA 4HFUL 2NW2A 2VDNH 4NO2B 2ZUQC 2OJEB 3STZB 1J8HA 1E4WH 4LLYB 3VWKA 5E56A 5C0GA 1VB9A 1XGYL 3K4AA 3KPPB 3S5LA 3UBXG 1RZIA 1MHHB 3V4PH 2P46B 1H15B 3HR5A 3UP1A 1I4FA 1FL3B 1II4E 2BVEA 1CL7H 4HUWA 5KS9F 5JIIA 3WL9A 2NY4D 1LNUA 3BKJL 4JRXE 5ID0B 1MRDH 5JHLH 3ULUC 2PETA 3NBNA 5HGBA 3D3VA 4DEPB 4JCLA 4V2BA 5C9KA 4M7LT 5D9SB 1R3HA 4FQ2L 5K9KA 1R5IB 3QJFA 2BDNH 3E8UL 3VGFA 4AIZB 1XAUA 2CUIA 1IGTA 1JTPA 4DKEH 1E6OH 1RUMH 2F8VA 1VENA 2CJUH 2VWEE 4S0UC 3S96B 3BWUC 1UXWB 4PGCA 1FJ1A 1ZHLB 2JIXA 4KQ4H 3AB0B 4XCYA 3BP7A 3OKNB 5FYLH 2EEAA 4NNXA 3IDGB 1FYTD 3AREA 1IC1A 1YUHA 4QNPE 3P30L 2FL5B 1RUQL 5GJSL 3MJGX 5EN2A 1DEDA 1FO0B 5JNYB 1AFVH 4F3FB 5JDSA 5INCA 2H26B 4HWUA 4DZ8B 2FD6L 4Z7UA 15C8L 4EDWH 1CDUA 1LO5B 1S7TA 5BS0D 2JJWA 5F9OL 4UBDD 5FOJA 4A6YH 4JGJA 5ITFA 4I4WB 4YEFA 4H26B 4X80H 5ESAB 4ZUWB 3O4LA 3P0YH 3TCLB 2DQEH 1YMMB 3BT2L 3WE6A 1OTUC 5DJYB 3HE6D 4MAYB 3NFSH 5GIRA 4BSVB 5DUMH 4PJFA 1FG2A 2WBJD 3LQMA 1VFMA 2YRZA 3B5TA 3IS0X 3A67L 3EYSL 5DRZA 3NABL 2FZ3A 1EH9A 1L6XA 3TO4C 3MA7B 4DN4H 2G75B 2XN9A 1VFAA 2KH2B 3LN4B 5T3ZL 1OLZA 4H0GA 1LO4H 1G0YR 3EO0A 4RGNE 3O6MH 1I1FB 1KNOB 1IM9A 3VFRA 4ZTPL 3MGTB 3SKJH 2OP4L 5HYQA 3X12B 1F5WA 2VL5A 4MX7A 4ZOBA 4WO4A 3MROB 5IGXL 1FNSH 1RJLB 3D85A 4XPTL 3QWRA 2ZUVA 2F58L 4ONOA 4Y1AD 4M6OH 4PLKC 3T04D 3IT8D 2VDQH 4LVNB 1IZKA 3NAAL 3RQ3A 2D0FA 3BPOC 5H37G 2E8YA 4MJ6B 2C3XA 1MQKH 1AR1C 3RI5K 3TLRA 5JOPE 4NSKB 4QTHA 2J6EA 1MJJB 1HCVA 3DIFA 1PSKL 1GPOH 3IVKA 2QSVA 2X7LA 4PV9A 2P49B 3D6GA 5EU6E 5EZLB 4Y4HC 5FGBC 2O5YH 1R24A 3HLAB 4FABL 4M00A 1QSFD 1DDHA 1M05B 4M1GH 2FCBA 4MNHA 4Z9KB 4G42B 5FF6A 3MLWH 4PJ8D 2EH7L 4MQ7A 5EZOL 5IOPB 3CZFA 2XRAL 5CJQL 1BP3B 1HZHL 2PR4H 1F11A 5TQ0L 3RZCC 1S7RB 4Z78B 5K9OA 3WNOA 3DXAD 1SY6H 1RY7B 4JFPB 4K3HA 4WJ5A 1KJMB 4PRIA 1RHHB 1S7XA 4PJHB 1DVFC 2VNCA 4H1LA 3DMMB 3O6KH 4UUJB 1KCRL 4KTEL 3EYVA 1BZ7A 1DBBH 2X4OB 1RZGA 4YQXL 1A7RH 3OBAA 5HYJA 3DGGB 3QQ4B 2EIZB 1MFAL 1CZ8H 3KJ6L 4KHTH 1FGVL 1PX3A 1NCTA 1WGOA 4NM8H 3LKPA 4A2LA 3NMEA 1MFNA 2A77H 4OCNC 3QUYA 5L9DH 3WNNA 4CU7A 1IGCL 4R8WH 4HIHA 1R3KA 5EB9A 4G8FA 1A21A 3U7YL 1I7ZA 1F3RB 3UZQA 3TA3C 4RGNB 3MLXL 2OXHA 1I7TB 2MWCA 1IKFH 3ORJA 5HHMB 4YX2L 1IGYB 1WISA 4OGYH 4WHTB 4LLUB 1C08B 1Y6KR 4M62H 4FFZL 4X0KA 3LKQA 2HWZL 1I9JH 2AABH 3GGWA 4ZPVA 4BUGA 1DE4B 5FKAB 5C8JA 4NN5B 1DQLL 5E4EC 5GRYA 4L4VE 2ITDA 4YHKL 3SDDA 4P23D 5B8CB 4JREC 4EZMA 3I6KB 2XWTB 4M8VA 5GGSB 3PDDA 2N1KA 4EQ2A 1XF3B 1F02I 4LSPH 4MAYD 1UJ3A 1TZHA 4XP6L 3JSSA 3G5YB 2ATPA 2XWBB 3LN5A 4WHCA 1KF9B 1BJ8A 2K9UA 4Y0GA 5D96C 1Y6NR 3DNKA 4U1GB 1KIRA 1S7VB 4M6NH 3SPVA 3O2WH 2BSSA 2BVUA 3W5NA 2I60L 4P5MB 1EERB 2OJZL 4Y16B 2GK0A 4Y4KB 3B9EA 3VMPA 3MRCB 2XZAL 2K3TA 3BZFB 5ICZA 4YWGH 3HKFA 4K23L 3FTGA 4KVCH 2X41A 1J0KA 4JRXD 4UT7H 1AGEB 1QRNA 2XIDA 5C6TL 4V1DA 3X11B 1K2DB 3BDXA 1CD1B 1EGJH 4OKVB 1CFTB 5CJBA 4PJ9C 4R4FL 2IQAB 3ZKXC 5IIEA 4XMLH 5KANI 5C0BE 5IB1A 1N6VA 5E4IA 5ICYB 2R0WL 4ZXBC 1TCRA 1IL1B 3FO1B 2XFXB 3OG4B 3K1DA 5GGVY 3I3EA 3ULVE 3BZDA 2DI8A 3D0VB 4GQPH 3V0VA 1J1XH 4TUJB 2YZ8A 5D7IF 1FPTL 1TTFA 5KAQF 2NLJB 1IEBA 2GJZA 3VH8A 5GS2D 2QKIB 3JVGA 1FNGB 3WIFB 3VRJB 5IEHB 3WLWC 4PV8B 1QA9A 4H1LH 1QG3A 5GS1C 3WFHB 2C4FT 3CFKB 3QIUB 3E8UH 4LNRA 4HIJB 1Z3GL 2VDPL 3C09C 5ERWB 4BH8B 4OM0H 2XPGA 4P99A 1C16A 2ICEA 2YA0A 5JOFB 3MR9B 3HPLA 4S1SL 2ZCKH 1RAMA 3K8KA 1XCQA 3QRGL 1MREH 4DVBB 3MOAL 4PJDE 3EOYG 1U8HA 1YY9C 3P30H 4YHZL 2W0FB 3VW3H 5IVXE 5GJSH 4Z18A 2A73A 2EECA 1RIHH 1MRFL 2EC8A 2DF3A 5L88H 4N0FA 3VD5A 4PGDB 1OP3H 5T1DH 3JV6B 3DPBA 3RTQB 3NH7H 1UH4A 1AHWA 2VSDA 1DSFH 2ATKB 2FD6H 2BY2A 4XPFL 5DD3H 15C8H 2AK1L 3PP3H 4XCFH 3QAZB 4AEIL 1TMCB 5IF0A 3BEVA 2AJZA 4Y2DD 5F9OH 5I74B 5TE6L 1HH9B 5J13B 4YDLB 1CGYA 4RAUB 3G08B 1V5JA 2VRAA 2BNUA 3TT1L 5E8EB 2C1OA 1NC4D 3MFFA 4JDZA 4NQVA 2CK0L 4X6FB 4Y2OA 5F7NC 3BE1H 5BRZE 3UX9B 5C92A 5C0BB 5JOPD 1I3UA 4G43A 1VGKA 4P2OA 3EYSH 3W5MA 3NABH 5C07D 1VFBA 4M7JL 5FUOL 3GI8H 2NY0D 2HFFA 4W4OC 5T3ZH 1WAAF 5EU6D 2FECL 5I1EL 2X9YA 2NY4C 4XCNB 4C4KO 3BWAB 1CICB 4R0LC 4WWKA 3GNML 5JIPA 4ZTPH 1HQ4B 5I75C 1PBYA 2AS5M 1PQZB 3WO4B 5E6IA 5FO7A 3OAUL 5EUOA 3S37H 1JWMA 4MD4A 1OQXA 4LL9A 3T3MF 3BPCB 4JFXB 4GH7B 4EIGB 4JZJC 4WI3A 4E9LA 1B6UA 5JW4R 3NAAH 4JM4H 2R29L 4Y16D 4UIMA 5GRJL 3TYFB 1W8OA 5I71B 1WFNA 1RUAH 1LK3H 2X4TB 2ICWB 4YXHL 4X4YA 3AS1A 5I1HH 5JR1L 3OR6A 3KS0H 5I0DA 3BUYA 4ZS7L 5C0JB 1U41A 3MJ7A 4U1KA 4PJDB 1F3DH 3S5LG 4WGWB 1XR8A 4FNLL 2DB8A 4QXUH 3KPQA 5DVMA 3FHQA 5E2TH 1UXSB 3MCLH 5T1MB 3T4YB 5HY9A 1FFQA 4NKDA 3GSXB 4X99B 4UBDC 5F7YC 2V5YA 2F8XC 3VG0H 2VLJB 1F4YL 1QEWA 1HXMB 1U8LB 2X4UB 3MJ9A 1U93A 3C2AH 4G6ML 4PG9B 1YJDL 1KCRH 1RUPH 4JCMA 1LO3L 3D0LB 4G6FD 5JLZB 3HE6C 4CU8A 1JNLL 1O7VA 3TIDB 1T7ZA 1BIIB 1T1ZB 5D2LA 3WJLC 2WBJC 2V7HA 4ZPTA 3ALWA 1FL6B 3GSVA 2MMXA 1YN6A 3GBLA 3GHEH 4O9HH 2AI0H 1I8LC 1UM4H 5J12B 2R69H 4DQOL 4HIEB 1MCDA 3RWGB 3DX9A 3S97C 1NGXB 3QUZA 4L4VD 4OFYD 4LHUB 1DUZA 3QPXL 3RJDA 3B2VL 1G7HB 1IBGL 3RWIB 3NN8B 4LP4A 3L6FA 1N26A 1PJ9A 4FTVE 3VG9C 3IU3B 3WFDL 1C5DB 2ZG3A 1J0HA 1CQKA 3EO9H 4ZS6C 2BJMH 1NLDL 4LF3A 5AAMA 3QDAA 3U0WH 4JFEE 4QY8A 2ZOKB 5DA0B 2ZPKL 4YX2H 3VFUA 1TJGH 2PTTA 2NY7L 2OTPA 4U1SB 4OUOA 3ZYIA 5FIEA 2HWZH 3MZTA 1IEAB 4QHMA 2NR6D 4QRTB 1PFCA 3TIEB 5SWQB 4H20L 3OKYA 1QR1A 5EPMB 3W9DA 1E28B 3A0OA 3QA3A 5D1ZB 4PJ8C 3IETB 3CJJA 1T22B 1KENH 1GAFH 3ARFA 3BDYH 1P2CA 1UQSB 3QDGB 4XP6H 5C0BD 3C6SA 2J5LC 3RPIB 4U6YB 5HBBA 3KG5A 4NPYB 2AEQH 2V2TB 2I27N 1A0QL 1SEBA 5E94B 5DD5L 4JPIA 1EJOL 2I60H 1A3RL 4NQUA 1S3KL 1KGCE 1IQWL 2DWDB 1CICD 3ULVD 1NFKA 3SGDH 1UT9A 3MJ6A 4CU6A 5K33A 1KIPA 4NZTL 1BWWA 1NSNL 5T33L 1IT9L 3DX6A 5AUMA 4LRNL 2YPVH 3AAZB 5KSUA 4WCYH 2E3VA 3N06B 3I75A 1D5ZB 1N0LA 1T0NB 3R06A 5L6YL 5C6TH 3O6FA 1CGVA 4KUZH 4YBLB 2F53D 1M6OB 3SY0A 1K8DB 3WFCH 4ZG1A 4XNMA 4CVXA 3G5ZA 2OR9L 3OF6D 4E5XA 3FO9A 4R4FH 3AB0C 2BRRH 2XXCB 3C6LB 1H3TA 2IBZX 4J6RL 2AK4A 5CKGA 1INDH 1TITA 2EYTB 1JTTA 3V6ZB 3PL6B 2R4RH 5DD0H 5KVMC 4OZFB 1OGAB 4FTVB 3ZL4L 3QEUB 4UDUA 3LDBB 4I0PB 1N0XL 4P2CG 4QOKA 4JFEB 1MIEH 2X4NA 4JO4H 1WWCA 3QHZL 1LE9A 3IFOB 3TNNB 4TNVF 4Q0XL 1G7IA 5LGHH 4XCEA 4K8RC 3KHOA 3MJ9H 1FFOA 1J1PL 4P23C 4PRDA 3MPCA 1EEQA 4PY7B 4XPBL 1UACL 3D87B 4QHUA 1JPFA 2F15A 1KTDB 5J11B 3TO4A 4MAYC 3VWJB 4XRCB 4PJCE 3MRKA 3L3KA 4AM0B 3VGDA 3QDMA 2YD9A 2DQIL 3RA7L 4MJIE 1DN2A 3QRGH 4L29A 5BRZD 3RGHA 4JFDA 1NFDB 1B6DA 4CMHB 1M7DA 5D2NE 5F7WC 2MPAL 3SGDI 5GGUB 5I17A 1J18A 4ZOCA 1KN2L 5HGAA 4MCYA 3UTZB 5I9QB 2YC1A 3MRRA 4O5LH 2LVEA 3FB6A 1S9WA 1SJHA 3HR6A 2MKWA 4AEIH 4XB7A 5MEOA 3CX5K 4FQCH 1XF5A 3HG1B 3NCBB 5C09E 5BXFA 1AE6L 1HHJA 3DVNA 2Y07L 3IDXH 4IRSD 1YPZE 3CUPA 5CP3A 4L8SC 3ROLA 4IOIA 3VFNB 2Q20A 1RIUL 2VWEC 1MCRA 4Y4HA 1A02N 3UPCA 2A6JB 5FM4A 3CFBB 3LEXB 3BJ91 4JFZL 4LLWA 4CMMB 4U6HA 2DDQL 2HT3D 1X5IA 2XKSA 5EWIL 5E2VH 1T6WA 2XTJE 1FL5A 3RZCA 4GG6E 5FUOH 2D7QA 2LTQB 4R3SA 1FAKT 3UTQB 3LH2H 1U58A 3GSWB 2ZOLA 5FHBL 4NO0A 3TO2B 5I1EH 1IQDA 4JFFA 1DVFA 4EUPA 1A5FL 4HWBH 3F12A 1DL7L 2EDKA 3MUGB 4ODVL 2DMCA 1MJ7L 2W60A 5T5NG 4PJ5E 3WJJA 1E0OB 4LEOB 3NZHL 3MLUL 4D0CB 9CGTA 3L3DB 3MRFA 1Y0LA 4R6UA 3TFKA 3DMMC 4NWTL 3WXWH 3R1GL 3BZ4B 3GMPA 3C08L 4GSDL 2C1PA 4I2XA 1FZKB 1I1CA 1KJ2L 4LDEB 2M1KA 3U0PB 4LSVL 3SKMB 3HMXA 4P59H 4L8BB 1XZ0A 1A6UH 3QUMB 4PJCB 3HS0B 4XP9H 5LXGL 5DJ8A 4ZO7A 3MRPB 4U1JA 1X4YA 1DN0B 4MLIA 3TA3A 1NCUA 2CKBB 2GFBA 3GMOB 3ZE0F 4OSUL 5DMIL 4I5BB 4MNQA 4RA0C 4Y5YC 4RGNC 4S10A 1F4HA 3H0TB 3CX2A 1HILA 1QBMH 3VH8G 2LABA 4HQQL 1RMFH 3GRWA 2APWA 3FOLA 1KTLA 4Y2DC 4ZSOE 1F6AB 4UU9A 5DYOB 3ZMRA 3QZWB 2EIDA 1ZLSL 3U9PL 4UT6H 4P2RA 4Z77B 1TZIA 3MUJA 4CNIA 4G6MH 3GMRB 2BX5A 3QIBB 4HH8A 3IRPX 2FX7H 4U33A 2P5ED 3F58H 5C09B 5TE7H 2A2QT 2BRQA 1JNLH 2VR9A 1R5VB 4W4NA 2MJWA 4NN5C 3BW9B 5DC9B 4NZRL 3FFDA 3DURB 4H8WC 5LGJA 4NFCA 4XVTL 3QB7C 5B8CC 2RFXA 5GSRB 2NY0C 5FGRA 4NNPH 3MV9E 1KLGA 5ADOL 3NIGF 4MD0A 2FECI 5HI5D 1BD2E 2Z91A 2XTJB 3B2VH 4PYHA 4OCMC 4E0RA 2ZSWB 4S1RL 4PJEA 3VWJD 5J0BA 4JM2B 2ILLA 1VEMA 1TJHL 2DYPD 3BKYH 1J5OL 2R23B 3MMEA 4IMLB 4U1GC 1WK0A 1PLGL 2OL3L 5IMKB 1NDGB 4GAYA 5IWLC 3QCVH 2Q3ZA 3O9WB 1EHXA 1Z9OA 4Y16C 3JV0A 4KQ3H 4FFEX 1D6VL 3SDYL 5KZCD 4FQHB 3KPRD 5K93A 3OJVC 3BMVA 1U8JB 1YDPB 1SYSA 4HMDA 4PJ9A 4Z7OF 3PIQA 5GS0L 5CP3H 3GSOA 4QO1A 1LVEA 2VIRA 3IDUA 2F74B 3MLRH 3TEUA 1MVFA 4HZLB 1U8QA 4YHPB 4ZXBA 4KI5E 4N0UA 1DBML 3PWJB 3VE0A 1FNEA 2UWEA 5LQBH 1RIVL 4ZAKA 2QV2A 4YDJB 4U7KA 3JTTB 4M7LH 2HTLD 3V0WL 1TVDA 4TVPL 1HYRC 5C9JB 4XC1H 5AYUH 1K9TA 4NM4L 4LEXL 2APFA 1NL0H 1SYVB 4ZSOB 4YPJA 2CLRA 5TFSL 4KRMB 3B8SA 3V5KA 4KDTC 4IEFB 4GMTL 4BH7A 4ELME 5DD5H 4JRYE 5GS1A 1HDMB 1BLNB 1T0PB 2P47B 3FCTB 3ARGB 5L7XL 2XG4A 1JZ8A 3UTTB 2H3NA 1NSNH 2WLZA 3G5XA 1JGEA 5MEQB 1PD6A 3VXSE 1A1MB 3PQYB 3IDMB 3EHBC 1CDBA 3FN0H 1FORH 5FGCE 3NZ8B 3DV4B 4YNYA 4ZUTB 2YK1H 3HMXH 1U2HA 5A2IH 3MV9B 4OFIA 2OR9H 4ZNEA 2ICWJ 1CE6B 1BD2B 5F9JA 1EEUA 4TULH 3GHBH 4TUKH 3SCMD 3N50A 1BVLB 2JB6A 5DVOA 5GISH 2YA1A 5IBLD 4NGHH 2GJ6D 3ZL4H 4MJID 5CJOH 2ADIB 4HJGB 1LEGB 1H8NA 3QCTL 3OKLA 1N0XH 2X70B 4ODWB 4LCWE 5ENWB 3RTQC 4HT1L 1Q9LA 1A7PL 1C7SA 4MLSA 1B9ZA 5I18H 2NR6C 1OP5K 1NEZA 1G9EA 1UWXK 3ET9F 1P7QA 1FGNL 1JYXA 1MCEA 2VISA 2IALA 4X5WB 4LCUA 1J1PH 1WTGT 5D7JD 4X6EB 2A74A 3ISWA 3D5OF 4GW1B 2ZUXA 4NZUH 1VACA 4XCCH 1QFUL 3RKDD 5C09D 1DFBH 1UZ6E 4UILH 3QXDA 4HC1L 3TN0D 5DQDL 2YBRA 4YFEA 1VEOA 1CLZL 2FH6A 3LSOA 2J8UB 5DJCA 3KPOA 4R0LA 4U1HB 3LPFA 5IB5B 1ZT4A 3CNKA 1EEZA 1T3FA 4X6DE 1DP0A 4YHLL 4QXTB 5C08B 1CICC 3ULVC 4MNGA 2J3SA 3ARYA 4Z7VE 4TRPH 3V7AG 4ELMB 1KN2H 3FT2B 1VCAA 4JZJA 2H1PL 4KAQL 1JI2A 4D3CL 2YN5A 3X3FL 1AGCA 2FATL 4YEEA 2UV3A 2ENYA 4OCSL 1UM5H 1FYTA 3H2WA 1U8OA 3FB5A 3L3JB 4PJ5D 2DM2A 3E3QE 4TTDD 3NIFE 3VXSB 2CLVB 4FMKA 1AE6H 4I18C 2A1WL 5AD0B 3EYFA 2FEDD 5E8DL 1T2XA 2APTA 3RDTB 3GSQA 4WW1A 2QSCL 4NT6A 4JFZH 2J88L 3PP4H 4WW2A 4LCCC 5IFAH 4PD4J 4YLQT 1BOGB 3O2VL 2HFGH 4HKZA 1G9NC 2BOCB 5BS0A 4PB0H 3BMWA 5IEKB 4POYA 2CDFA 1KCVH 3QG7L 3S35X 5AZ2H 2BCKB 3F7VA 1GGTA 1ZV5A 4U0RB 5KW9L 1GYAA 1MRCH 2PYEB 3EDFA 2ZNXA 4JZOB 1KLUA 4LCWB 4RMUA 3PWPE 5MP6L 3G5VB 5DEFB 4MDJA 1DL7H 3RIFF 3ZTJG 4EI6A 4L3CB 3FFCD 2E7LE 3RGVB 4X9HA 1QO3B 3MLUH 4J8RA 1A7NL 3WJLA 2WBJA 5BVPL 1NANI 3RFZC 1CGWA 1N4XH 1HKLL 1U0QA 1I8LA 4L8CA 1OD9A 3T65A 3BQUD 5FO8B 4HS3A 1S7QA 1AO7E 4WRLA 3VFSA 4ZFGL 4RQQB 3C60B 5D5MF 4ZFFB 4L1DA 4ACPA 4CJ1A 3UO1H 3WDHA 3RWHA 4M48H 2FX8H 2FB4L 2H45A 1EO7A 3C5ZB 6CGTA 4NN7C 4Y1AA 3MV9D 3VFOB 1UM6L 1P5UA 4OCYH 4Y19D 3HA0A 2D9QB 4X6DB 2XNAB 4BKLA 2FX9H 5DJ6A 3RWFB 1TCMA 5IB3B 2AXGA 7FABH 4PJAA 3IFPB 5IW6A 5CJ5A 1M71B 4ENED 5F6HI 3QEHA 3U2SA 5I73B 2YKLH 3H7BA 2VLKE 4WUKH 4ZFZA 1ZLSH 3MYJB 2Y6SD 3U9PH 4IRSC 3QULB 2R56H 5I1DA 2I07B 4UOW1 3O3BA 4PREA 5CZKA 1QSFA 4OCRH 2I26N 3SDCB 4PJ8A 1AQDB 4CW1A 5C86A 3VMNA 2G5BB 2HT3C 5ALBL 4KRPB 2WM0A 5DHYA 2HTKD 1MH5B 5D1ZC 1TFHA 3DXAA 3T77A 3TYGL 3TZVB 3RUGA 1A7BA 2CLZB 4WV1C 3P4MB 3C5SA 5CLTA 4F15C 2IEPA 3F8UB 1T66D 2LAAA 1HHKB 4NKIH 4YIQA 4PDCE 3A6CH 2XA3A 4UINL 5JXAH 3VMOA 3PWPB 4BUHA 4HKBB 1XIWB 4PD4K 2P24B 2VC2H 3L9RA 5DMKA 4XP5L 1AXTL 1CFVH 1CGSH 1WIOA 2FH8A 1IGML 3UBXB 3AGVA 2R9HD 3O2DH 1ZLWK 3LZFL 3F5WB 5FHAL 3Q6GL 5FOBA 2FWOB 4JRYD 4RSVA 3DUSB 3ZZ1A 1AO7B 3H3PL 3VGBA 5DEZA 4LKCA 5I76B 5DC4B 3ZHKA 2F19H 4NBYB 5GS0H 2IADB 1FFNB 4R2GB 3V5HB 8CGTA 3M8OH 3B5HA 4GMSH 4OFVA 4JPVH 1FV1B 1KB5A 4YDVA 5I8KL 1I1YB 3EJZD 4ZOEA 4EUPG 4PR5A 4TVPH 3ZYOA 1MEXL 3LDBC 1W0WA 4YGAB 4YHOL 2ENSA 1V3LA 3ETBF 1TVHA 3HZKA 4KV5E 1B0RA 4NWUH 2N56A 3CXHK 5E0QA 1ZLUK 3OSKA 5DVNA 4N90E 1DBKH 4XVJL 2VLKB 5CIPA 4P23A 3BGMB 3ZKSD 1JHLL 3W9EA 5J1AB 1W8NA 3P4LA 1NLBH 1OVZA 3O4OC 3CVHB 4W68A 3WKML 4JHWL 4K3GA 3RWJA 4QTIH 3IJYB 2OI9C 5HI5C 2CIKB 1PY9A 3V6OE 3ZDYF 3V6FA 4QNPF 3BESR 1KCGC 4RMRA 1SEQL 3VWJC 4G9FA 4RRPG 2IPKB 5I1GH 4WFHE 5HDBE 3IXTB 4M3JA 3KLAA 1U6AL 4M7ZB 1NBYB 2V2WA 2H2SD 1YZZA 2FRGP 5CHNA 5DJ0A 5I19H 5B39A 2OQJA 4UT9L 2V6HA 2H6PB 4PJHF 3IDYB 5F9AC 2E6QA 2X10A 4JRXA 4ERSH 4O51A 1AP2B 1U91A 5JDJA 5DT1H 2DD8H 1DBAH 2B1HL 3G6JA 4HFWB 4K3EL 35C8H 2P5WE 5EC2A 4MB3A 5E70A 4L8SA 4KK8D 2DQHH 3ULSB 1TQCB 1DUYB 4XPAH 3HAEG 4P3DB 3ZDZE 4M93C 4NKOB 2V17H 1J0IA 2UYLB 4Z8FH 2NY1D 4G6KL 5BW7A 5JUEH 2HTLC 1DEEA 4NN6B 1JGUL 3SDCD 3WSQH 2JF1A 4U6XA 3FJTA 3U4BH 3DV6B 5AZEL 5HVHB 5C0EB 5TGBB 4WUUE 3EGSB 3GK8L 5GPRA 1IC4H 2SEBB 4IDJL 2ZUTA 3VFWA 3ES6B 4YFLF 2D31A 3GMQB 5D72L 2ARJB 2WQ8A 3TZVD 4UZGA 1G7MA 3VA6A 1ORQA 1XF4A 2DIAA 1NMAL 3RP1A 1OCWH 2UZIH 3T09A 1T1WA 1NQBA 1OARL 1CE1L 1YYML 5C0DA 1XF1A 1UB6A 3QNYA 5IT2L 2DQUH 1JF6A 1D5MB 4OCSH 1AIFA 2HVKB 2DN7A 4QHLB 4PBXA 4CRPA 1OF2A 5FXCH 1OB1B 2YXFA 3I50L 1JBJA 1FN4B 4PRNA 2EKSA 3L7FA 1AO7D 2HH0L 4FXGA 1QVOB 2GCYB 5C71A 4HXAL 4KH2A 2IMNA 4Y5YA 4XNQB 1SVCP 5IBUG 1HHHB 1FO0H 4J3UA 4X6CA 4M1DH 1KB5H 2AEPL 1NMBH 4YR6A 3KGRA 1ZHNB 3FMGH 3IKCA 5D2NC 2QR0A 4JHAL 4OJFH 1Z6JT 3V9FA 3W0WA 4GKSA 5MP6H 5BO1H 5DSCB 4XNXH 2OXGA 5KG9B 4K8RH 2FEEI 1NC4A 5D7JC 3U30B 4LIQE 4U1MA 3GSUB 5CIPH 1A7NH 2HN7B 3KPLA 4TSAL 3FT4B 2HG5B 5BOPA 5C07A 3RKDC 2I24N 2VLKD 1J88A 1PYWA 3B5GA 3SHSA 5EU6A 3DUUB 4QRRA 1S9VB 3UEZA 4LPVA 4P9HL 3EKCA 1U92A 4Z7WE 3BO8B 3DO7A 4WDIA 1BZ9B 1XH3B 4HF5H 2XTJC 4WUUB 3ECBA 4DGYL 1BBJB 2MKLC 3CSGA 3D39E 5I1AA 1KCSL 2XOTA 4NZDA 3J8F7 5IWLA 5MI0B 4P5TA 2ZNWA 1WWWX 3LMJH 4K71B 1KIQA 5CCKH 4AMKL 1V7NL 4X98B 3MGOA 3O9WC 4K7FB 4LARH 4TTDC 4FS0A 3BAEH 3SBWA 3GM8A 3MOBL 2FEDC 4JQVA 1T1XB 5DD6B 4OLZH 3PHQB 3CC5A 1G7LA 5BMFH 4K2UL 3QXAA 1CLOH 1NGWB 3EW3B 4XVSL 2DWEB 2IQ9L 4NJAL 4Q6IA 4JO1H 1R3JA 5ALBH 2E27L 5GGRB 3LKSA 5ID1B 4X4XA 5CS7A 4WFFD 1ETZB 4JFOB 3P9LA 2HJFB 4M9PA 1KBGL 1IGFL 4RISL 5GS2H 1MI5B 3EYQC 4KDTA 1QBLH 3MXWL 5L8KB 1XGUB 3Q1SH 4IRJB 5L2KB 4XMKH 3BIAX 3MV8E 5JTWA 3KYNB 5HYSA 3IDNA 4HMCA 5LJYH 3BQUC 5HJ3B 1GZQB 1U8IB 4HJJL 1IGMH 2YA2A 4NJ9L 2IBGA 4L4VA 1OAXL 2ARWA 1RJZA 1TQBB 3IFLL 3CSYB 1I7UB 3QNXB 3MXVL 4PGZA 5GRUL 3GUTB 4X8JA 4W6WB 1JPSH 1BREA 2NQCA 5DJAA 1MCOL 2QQKH 3FQXA 4LLDA 1RZ8A 5FA3A 3DO3A 1WZKA 2JB5H 1K8IA 2NXYB 3HNSL 2ZCHL 1K4DB 3CLFH 4FXKA 3D25B 1LE5A 5I8KH 1HE7A 3D39B 4BQBA 2RQ8A 2XKUA 4GUPA 1AH1A 4M8QA 5EIIB 4WFHD 3VD4A 1A7OL 2JE8A 2Y6SC 1DLHA 3GKWL 3WD5L 1SM3H 1MHEA 3LPGA 3B43A 3PHOA 3ESUF 1ES0A 2UUDH 1KCLA 2KQMA 2IMMA 3QT2A 4N5EA 4XVJH 5ACMA 4U6VH 4WY7H 2N7BA 4OLXL 1NAMA 4AYFA 1NCBH 2PW1B 2YUXA 1GGUA 3S36H 4PPTA 5DF0A 4MSWA 1ODAA 4M03A 2HTKC 3RVVD 1X6NA 2P5WD 3MX0A 2VAAB 5F7DB 4A6YB 3U1SL 3MLTB 1V05A 1MLCA 5DMGD 3Q0HA 4ISVA 1NAKH 4PJDF 1KJ3L 1A6WL 1G6RB 2J2ZA 3GBMH 3MBXH 1SEQH 4PFEA 4KI5C 4S0TD 5DK2A 4WEMB 2WQRA 5AWNL 5A16A 5GZOC 1WITA 4JKPL 4FHBD 3RHWK 1MAKA 3O0RH 4F7PB 4CL7A 4WNQA 3L5WB 1L4IA 4OZ4B 2ADFL 1F3JA 4JFHE 1CR9L 1TETH 4F80A 5LBSL 4FOMA 1IAIH 1H0DB 3JTSB 1CFQB 3BH9B 1D9KB 2VE6B 4F7CA 12E8H 1CDIA 2JKXA 4O02L 1I9RL 2CGRL 4WUUD 3MV8B 1L7IH 5HHXH 4LVHB 1S9YA 5FYKL 3ELAT 2F53A 2I5YL 1AI1H 4Z7QE 2W9DH 1S9KC 4LCIL 2MTPA 4TQEL 4P2QB 4K3EH 3QEQE 1KXVC 5BJTA 2EDNA 5KSVB 2LE9A 1A7QH 3WDIA 4I18A 4MJ4A 4GBXB 3TV3H 4HGWB 2DLEA 4AEHH 4Y5VB 4EOWL 2ED7A 1G9ML 2CK2A 2ZJSH 3KNBA 2IPTL 5DTFA 4C56D 5KANG 3H9HA 5EOCL 4LCCA 4QGYA 1HOCB 3P2TA 2FBOJ 1N7MH 3EJZC 2G9HA 3QDJB 1HEZA 5EC1B 1P9MA 4K7PH 5IVXA 1OLLA 1TNMA 3EBAA 2OTUB 4JANA 2EO9A 2Z35B 3O4LE 3TBSB 4D8PA 2HP4A 3T2NL 1YEJL 2VDLH 4C4KT 5I66B 1TXKA 3HUJA 4OLVH 4HS6A 4PJFE 3VJ6B 2QHRH 5MEND 2NW2B 4CGTA 3VWKB 1J8HB 1IC5L 4D0BA 5C0GB 3PGDA 1Q0YL 2F8OA 2AGJL 2B2XL 3S5LB 1RZIB 4KRLB 3NCEB 4W81A 3HR5B 1PDKA 5GGTA 5F7EH 3VGAB 1I4FB 2B39A 1NBVL 1YNTA 2DLFL 4HUWB 1IGIH 3L3IA 4UNTA 5I1IL 1Q94A 4OLWL 1GZPA 1LNUB 1WC7A 5BRZA 1GGCH 1RZJC 4HUXA 1V7ML 5HGBB 3I9GH 3D3VB 1ITBB 1QPPA 3K46A 1OP5H 1UWXH 4JFQA 1R3HB 2H2SC 5K9KB 3QJFB 1AR2A 1QLRA 3OKKA 4MB5A 1OSPH 2NXZB 3IDIA 1I9IL 1IGTB 1KPRA 4PGCB 2L4OA 1KCKA 1P4LA 2JIXB 3C5ZC 4MJ5A 4XCYB 1S7UA 3BP7B 4S1QL 3TBWA 4NNXB 3MCKA 3AREB 2WSKA 1YUHB 5EO9A 3WIIH 5DD1L 5EN2B 3D39D 4IRSA 4KK8C 3HCVA 4WHDA 1OAYL 3DBXA 4PJIE 5I73C 3O41A 5KBNC 5JDSB 4Y4FD 5INCB 1INEL 5DHVA 3QO0A 4U3CA 4Z7UB 2NYYC 1NAMH 1KV3A 1S7TB 3RIAF 2NY1C 4PJBE 3E3QC 1ADQL 3H3KA 3KPSA 4KMQA 2BNQE 5DQ9A 3SDCC 4G9DA 3EOTH 3HNVH 5E2WL 3VGEA 5ITFB 4WV1A 5SX5K 5J6GA 1VDGA 2X4SA 4WIQA 3O4LB 2VXUL 3ZKQD 1BGXH 4NHUA 5DDHA 2P42B 3WE6B 3TZVC 3P0VL 3ZTNL 4OM1H 4HEPG 3AVEA 4UQ2A 5GIRB 4PJFB 2F5BH 1FG2B 2FHCA 4KROB 4LAJH 4Z95H 2B4CL 4X6BA 5DRZB 5TJWK 3ULVH 2FZ3B 1RK0A 3A6BH 4LAQH 2XN9B 1R6VA 1VFAB 1AGFA 1O0VA 2ORBH 4BFIA 1QSEE 3EO0B 1JZ7A 5EO0A 2CXKA 2E7LC 1IM9B 1V7NH 4Z5RA 5DFVD 3VFRB 3TBYA 5IBTL 3GIZL 1RZ7H 3WEXA 5HYQB 3ZLQC 2VL5B 1NEUA 4MX7B 4WO4B 3R8QA 2P44B 3D85B 3E2HA 5C0RL 2C4XA 1W0VA 2D7OA 4AIOA 4GAJL 3DHMA 2IQ9H 4Y8DC 2JELL 2VXQL 4R2GC 1NC2A 1EHAA 4LGPB 4QTHB 2YPKA 4TN9A 4PP2A 1G9NH 4CBPA 1MNUH 2DJSA 4OQTL 3DARA 2MQ3A 3DIFB 2OK0H 2V5TA 2WK2A 4C57C 3IVKB 2X7LB 4PV9B 4WTWA 2D7NA 1R24B 2P5EA 1DDHB 1T0MA 4LLMA 4MNHB 5FF6B 3BP5A 1FDLH 1LP9A 4MQ7B 4R4ND 3CZFB 1X5LA 4PS4L 3T0ED 1CXHA 1F11B 4FZ8H 2BVQA 1DLFL 5K9OB 4WJ5B 4PRIB 5GGTH 4RMSA 1S7XB 2VJXA 4YE4H 3AC0A 1N5YL 2OI9A 5TDNA 1RZKL 1I1RA 3IFLH 5TE4H 3SO5A 5GRVL 2QQQA 2HKFH 4H1LB 1T89C 1L8JA 3C9NA 3TH2T 2EIEA 2PUQT 2VXVH 3EYVB 2VXTH 1BZ7B 1RZGB 2DYPA 5HYJB 4ODUA 2R0KH 2H8PA 1QRNE 2L7UA 3LKPB 2LVCA 3FB7A 1ZTXH 5BZWA 1A6AA 2AJSH 1S9XA 3QUYB 3UXFA 4KY1H 2NXZD 4HIHB 2ITCA 3KPRA 4G8FB 4HG4J 1I7ZB 4TNWK 3IDYC 5ITBL 4I3SL 4JFHD 5D93C 3GKWH 2ZP0T 4FQJL 2Y06H 5C7XH 1MF2H 2DRUA 4OGXH 2VTFA 2ICWI 3QWOA 3ARXA 5FYKD 3LCYA 5HVWA 2EXYD 2QADD 4OIBA 1JHTA 4PJCF 4X0KB 3QEQD 3LKQB 2DBLL 2EH8H 3JXAA 3GGWB 4I77H 3WUWA 5C8JB 3KVQA 2AJVL 4BQ6A 1KJ3H 4CUCA 1KEGH 3WDJA 5C0CE 1ZLWH 4G6AD 3QJHA 2ITDB 3SDDB 3S8WA 3KYMA 4YUEL 1MFCL 1QLFA 2IH1A 1CR9H 1KN4L 5LBSH 5KTEH 4AL8L 3LQAL 5GZND 1GSMA 2AJXH 3SQOL 1UJ3B 1TZHB 5EUKA 4LPCA 2CGRH 2CRMA 4I1NB 2ATPB 3LN5B 2HLFD 3O8XD 1JYNA 3VRLE 5GJTL 1KIRB 3B9AA 3SPVB 2OCFD 2V9TA 2BSSB 2DICA 1ZA6A 4L8DA 1KCUH 3SCMA 5B22A 1N8ZA 3OWEA 3OAZK 2GK0B 1IM9D 2EE9A 1GXEA 5CEZE 5FA4A 1ZLUH 5ICZB 5J57B 3V6OC 2GJ6A 4MJIA 4HIIA 5IW1A 3FTGB 5EOTA 2J8OA 2VKXA 4JG1H 1QRNB 4V1DB 4ODSL 5CILL 4GRLD 3U6RA 3EYUH 3MCG1 5D2NA 3TVMD 2IC2A 4OZFH 3HZVA 3H42H 1WWAX 1YNLL 5IIEB 3HI6H 4PUBL 5KAQG 3HI5H 5IB1B 2X1WL 1WT5A 4M43L 5HYSG 2EDDA 5D7JA 1TCRB 3LB6D 4OBSA 1J0ZA 1HSBA 4P46D 1FLRL 4KUCF 2B2XH 5D7KE 5CSBA 1OAZH 1A14H 3WS6C 1B88A 3RVVC 2B8OT 3V0VB 5IK3A 1YPZA 5DMGC 3TN0A 3BHBA 1IEBB 2GJZB 1AQKL 3VH8B 1BQLL 1JI1A 1U8KA 5F1IA 5EUOE 1F4XH 5LAXA 2R0LL 5CUSL 5E7BA 3X14A 1QA9B 3VXPA 3D69A 1KPUA 4GG6A 2XA8L 1YEKH 5BCAA 2BNQD 4FQLL 2Z31D 4LNRB 1EUTA 4H88L 1I9IH 2XZCH 2XPGB 3P4NA 1C16B 2ICEB 4N0RA 3HPLB 4OAWA 2E9IA 1EHNA 1BQHG 5D7LE 3OB0K 1XCQB 3E1F1 4X9IA 4XMPH 5MI0C 4C55A 1U8HB 4PJ5A 5I1LA 3OKOA 2A73B 5EZIL 5L8JB 1MIMH 1J0JA 4K71C 4N0FB 3STBA 5HDQL 1OAYH 5F9WB 5C0ND 2O26U 2RR3A 1AHWB 1PKQA 4G7YL 1QSED 5DWUL 5J9PA 5TDPA 1JGLH 1BM3L 1NCCL 1AY1H 5CZVL 3BRFA 1M7XA 1JMXA 1ROWA 3ARTA 5IF0B 5B4MD 3BEVB 2GTWA 4MHHI 2QL1A 5HPMA 2A0LD 1OT1A 2W65A 3NCFB 5J06A 3LEVL 1JTOA 4LASL 4OCXH 2A6DB 4DN3L 2BNRE 2BNUB 3EIFA 2V7NA 4UTAL 2C1OB 3MFFB 1IFHH 4E42A 1CG9A 2FIKA 4JDZB 4NQVB 3FFCA 4PG2C 4CADA 2DQCL 5DJ2A 3ZTNH 3U9UA 3VFPA 5DMJB 3T0XA 4JDTL 4FQIL 4WI5A 1X3DA 4G43B 1VGKB 1P1ZA 3PGFL 4P2OB 1FAIH 3HC3L 1VFBB 3RHWF 3TWCH 3SE9L 3BQUA 3B83A 3CFCH 5DR5H 2EEBA 3BXNA 4RBPK 4WWKB 2V5SA 2X6MA 5IBTH 1YEGL 5JZ7D 5E6IB 1MCFA 5FO7B 3PHSA 2IFGA 5EUOB 4JVPA 2QBWA 1GGYA 1TQBC 1JWMB 1WF5A 3HNTH 3ARDD 4MD4B 5F71A 4CVZB 3V7AE 3NA4A 4HWZA 3NTCH 4KI5F 4FFVD 2MCPH 1LGVA 4Y19A 3QUMH 2GJJA 4YHYB 3MUY1 2Y25A 4UIMB 1FNHA 2CKBH 1A9BA 3CH1A 1UZ8A 2D0GA 2MQCA 3HPJA 1GC1L 4X4YB 1T7XA 4KJQD 4MAUL 3GSNA 3BSZL 3OR6B 3BUYB 3DYMA 3LIZH 4ELMF 3MJ7B 4U1KB 1XR8B 1MY7A 1MFBL 5GRXG 1D7FA 3KPQB 4Y4FC 2YMXL 3WFBL 1MJUH 1IC7L 4G5ZL 5HY9B 5DZLA 4DOHE 3FQTA 1F97A 3ULUE 3MODL 4D9LL 1MUJA 4DKFL 2RBLA 5A2JH 2FJGA 1N5YH 1QEWB 3K7UA 1OSZA 1U93B 5FV1L 4JN2A 2GT9A 4PLOB 5HDOA 3IAGC 3UTSE 1HHIA 4O4YL 4MA1C 3VXME 3EOBA 2APVA 2L0DA 3BGAA 4HWEL 1JF1A 1T2JA 2IPUG 5D2LB 4ZPTB 2V7HB 5EOQH 3GSVB 3UPRA 3SE8L 1YN6B 2R2BB 3DROA 1C1EH 4FFYL 2Q86A 4WI4A 4P9MH 3CLEL 1WZ1H 4YDIH 3QUZB 5C0CD 4HLJA 1DUZB 1LILA 4UTBH 4WFGD 3C87A 4LK4A 2R2CA 2RIKA 2NTFA 4K7PX 2HYMA 3DX7A 4O2EA 1GOGA 5DFVC 1BIHA 4JRYA 3TNMA 1FZOB 4TSBH 1QP1A 1N5AA 1CIDA 4V3DB 3IF1A 2HAZA 4UI2A 4I8DA 3C2SA 4LF3B 4QOKE 4QY8B 1I8IA 3PWUA 4GBXC 3OPZL 2PTTB 2YHGA 4LKXA 1UYWL 4LSTL 1RSFA 1UZ6F 3GMMA 1I3GL 3UTOA 2CO6B 1JZ2A 3FONA 4EBQL 4J2XA 1OAUH 4QHMB 5A2FA 4FQXD 3OXSA 4FZEL 4XZUA 5FCUL 2GY7B 4HMEA 1QOKA 4OD1H 4OI8A 5CEZD 4XTRD 4GKNA 1ZSDA 2D0HA 5EG6C 4FA8A 5CEXA 3M17A 4RFEA 4J3TA 1QR1B 4X6DF 3W9DB 2D2OA 3QA3B 5IQ7L 3HMWL 4R4NC 4P5KA 4OD2A 5ESQA 2A38A 1LHZA 3VWKC 3LQAH 4OFDA 1LO2L 3ARFB 1BEYL 1P2CB 5I15H 4GRMA 4JHZA 4N8VA 3C6SB 4JB9L 4P2OD 4K3DL 3RL2A 4DOHB 3NFNA 3NIFF 5HGHA 3H7LA 3V5DA 3MLYL 2BVTA 3CVHL 5CKAA 4ZUVA 1FVDA 4U0QB 1P53A 4JPIB 3T0VA 5D7KD 5T5FL 4ZUSA 4NHCL 5JQHC 4WHYH 3F62A 3JUZA 4YGVA 5TQ2L 2A6KA 4KWUA 3SGEH 4GQ9L 1F90L 1KIPB 3WFEL 3HC0A 3DX6B 2Q7YA 5AUMB 4S0SD 5KSUB 3R06B 1H8OA 3I75B 3D9AL 5DRNA 2NXZC 3O6FB 1TZGL 5CILH 4APQD 4NUGL 3SY0B 1NCWL 4XNMB 4CVXB 4E5XB 4UIKH 3FO9B 4WWID 4Z7VA 1HKFA 1MFEL 2AK4B 3AREC 4M43H 3TT3L 3CDFA 3DI3B 5D7LD 5DI8A 5JQ6L 1ZA3A 4UDUB 1HHGA 2WUCL 2EXYC 2QADC 1FLRH 4A2MA 4BK4A 2IFFH 5IJVA 4QOKB 3E3QA 4IIQC 3N0PB 2PKDA 2X4NB 5KSAD 5BVJA 1IAOB 1LE9B 3FQUA 1QFOA 3OKDA 1G7IB 5HTSA 4N8CL 4XCEB 2NY5C 5CUSH 4G6AC 1R3IH 1FFOB 5T3XL 5IVZA 4PRDB 3PV7A 2GI7A 3H6JA 1ORSB 4FQLH 1ZANL 1GHFL 1JPFB 1PG7H 2R15A 4QHUB 1UH3A 3TO4B 5FYJL 2AKRA 3MRKB 3L3KB 2BNRD 5CSGA 3QDMB 2HLFC 1A9EA 4GFTB 1VFOA 3JBG7 1E6JL 2XXMB 4L29B 4K94L 4WENB 2X09A 5FUCE 2BSRA 2PO6D 5ALCL 2E7LA 3BVNA 4JFDB 2BVOA 3QXWA 2R1YA 1M7DB 2F54E 2X9XA 3QUZD 4OCWL 3HC4L 3DYPA 1HIML 2B0SH 1OM3H 1MQ8A 5I17B 5HGAB 1YMMA 4MCYB 2ZSVB 4B7IA 3FQWA 1QHOA 4G7VL 4LGRB 2YC1B 4KJPD 1PKOA 3MRRB 3VXUA 5LCVL 1L6ZA 3BPOB 1SJHB 4F37F 1L7TL 4MQTB 4P2RE 1RD6A 3MRJA 5MEOB 1KYOJ 1N64L 2G75A 3TVMC 1XF5B 5DK3A 4Y5XC 5BXFB 1HHJB 3DVNB 5F7LB 3IKKA 5HSFA 3CUPB 3ROLB 3IAPA 4IOIB 1TJIL 1ZAGA 4MXVE 5IQ9A 4OLUH 4Z7NE 4Y4HB 2H32A 2E8ZA 3LB6C 4NC1E 1F4WH 4OF3A 4LLWB 3RNQA 3AUVA 4U6HB 1R0AH 5C0AE 3R8BB 2EIBA 3RZCB 1FL5B 5JO5A 2VZVA 4R3SB 3MBED 4PJEE 1U58B 2ZOLB 4YBHA 4ZO8A 4ELKA 1QNZH 4NO0B 5D4QA 1G7JA 1EAPB 1IQDB 4JFFB 3X13A 3MRDA 1DVFB 4KVNH 4EUPB 4NCDA 3RWEA 3F12B 3ARFD 3MNZA 4JRWA 2W60B 4UB0H 1RZJH 2FGZA 2GTZA 3MRFB 1Y0LB 1NPUA 2Z31C 4HK3N 5F88A 3GMPB 4XAKE 2C1PB 4Q9QL 4I2XB 2NNAA 1KELL 5DZNA 1WUNT 3UTSD 2CH8A 1XZ0B 3VXMD 1CU4L 1IILE 4MAUH 4HPYH 3BSZH 4HGKC 3CU1A 4KV5F 1B90A 4LSUL 4HH9A 3PWNA 5DJ8B 1EHLL 4U1JB 3OXRA 3QUYC 3TA3B 2PTUA 4NRXA 1A6VH 4HUKB 2UWEE 3LY6A 3W2DL 5HHOE 3K2MC 5A40E 2DL9A 5SX5H 4MNQB 5IKCA 2QQLH 2YWZA 3P3YA 5DZOA 5C0NC 2YMXH 3BZEB 3NFPB 5F7FA 3WIHL 2EIZA 4GRWE 3LKNA 1IMHC 1B3JA 5B4MC 3FOLB 1KTLB 2A0LC 4M5ZL 4TSCL 3U7WH 4IDLA 4UU9B 3MODH 5C70A 3HI1A 2DJUA 2MHAA 4X4ME 3PE9A 2B1AL 4ONFL 4I3RL 5D8JL 4P2RB 4QOKD 1IGJA 1TZIB 4CNIB 2XKNA 2UVEA 5FUZH 1PZ5A 5HDBF 3V7MA 5KVFL 1A6ZA 1GOFA 5IMLA 3S9DB 5I1KL 1G0XA 3IJHA 4JREB 3FFDB 3SE8H 3CFEA 5LGJB 2VDNL 2RFXB 4KK6D 4HBQA 1E4WL 3BEWA 1KLGB 4B53A 3CLEH 4ALAL 4MD0B 5F70A 1KYOK 2Z91B 1VADA 2AVGA 5E9DD 3FN3A 4QRSA 4E0RB 4PJEB 4GXUM 5JZ7C 3QRFM 2HFEA 2AXJA 4LIQL 1CL7L 3ARDC 3MMEB 1MRDL 5JHLL 4AY0A 4FFVC 3O6LL 1OT2A 1KG0A 1HSAA 2W9EL 4GAYB 5EULV 5T1KD 2OZ4H 1SBBA 5H94A 1UYWH 4LSTH 2BDNL 2C3HA 4KJQC 4LDLB 1E6OL 1RUML 4DKEL 2CJUL 4OZHE 1SYSB 2R4SH 1I1AD 1NGQH 4PJ9B 4KQ4L 3ZKXB 3Q5YA 2MCG1 3PIQB 1JV5A 1YQVH 3EAKA 5FYLL 1UKTA 4ODHH 3GSOB 2HT2D 1L9NA 4AEFA 4HV8A 2VIRB 1D6EA 2KL6A 4M4PA 1U8QB 4ZXBB 4N0UB 3HMWH 2IGFH 2WWMD 1F13A 1KB9K 3VE0B 1FNEB 2UWEB 1BFSA 4BYHA 1AFVL 4OZIA 5CMAA 5JORA 3WS6A 3K80A 5GGSY 2P5WA 1JRHH 1LO2H 3CIQA 3KLSA 1A6TA 5HI3C 4EDWL 4JY4A 3ARBD 4Q6YA 3V5KB 2CLRB 3MLYH 4P4RA 4XH2A 4YHMH 2Y5EA 3CVHH 4BH7B 3UJIH 4ZUUA 4A6YL 3OJDA 4JGUA 5GS1B 3JVGC 3MACH 4X80L 5AEAA 5HHVH 3BYTA 1WCQA 2DQEL 3C09B 4D94A 2H3NB 1FYTE 1NFIA 4LCYA 3T3PF 4PGEA 3G5XB 3IB4A 5I30H 2AJ3A 1JGEB 3WN5A 1JZ5A 3NFSL 2NZIA 1T03H 3MRIA 4YNYB 1CN4A 1TZGH 3DRTA 4URTB 4DN4L 3FQNA 2DMKA 2BMKA 1F45A 4R4BA 1LO4L 5F9JB 3UBXI 3O6ML 2BOBA 3VXRA 1OAKL 2JB6B 3N1QC 1B4RA 3PUCA 1ULVA 1KXQE 1LK2A 1QUNA 2W59A 3SKJL 5C3LD 3I85A 4MWFA 4C56A 4U1NA 1I75A 5D6DA 4GG8A 2WUCH 1S78D 1FNSL 1QFWH 3OKLB 4QHKJ 5K59F 1MHCA 3QR2A 4M6OL 5F9WC 1Q9LB 2VDQL 5E1AB 2F54D 1YEFH 4D0DA 2BVYA 4YZFE 1NEZB 3LEYH 1P7QB 2YUZA 4NRZA 2IANE 4R90H 1MQKL 4Z7WF 4XTRC 1YQ2A 2VISB 4DVBA 2UZYB 4X83A 1YECH 2IALB 5JMOC 5MENA 1UCTA 4KMLB 5H37H 2A74B 1FBIH 1GPOL 1OPGH 1DQTA 1PAMA 4GXVH 2O5YL 1YN7A 1VACB 2NW3B 2AW2A 3MLVH 3QXDB 1MELA 4KZEH 3MLWL 2YBRB 1W2KT 4P2OC 2PR4L 1E6JH 1TMCA 1A6PA 5DJCB 1KOAA 2CUHA 3KPOB 4R0LB 3BP4A 3ZYJA 1ZT4B 5I75B 1SY6L 1EEZB 1T3FB 5C0AD 4Q9BA 3CCHA 4MNGB 3VI4F 4EJ1C 4PJAE 3O6KL 4EVNA 4HUVA 2FDBP 4JZJB 3UZEA 5BV7C 1DBBL 1A7RL 1N3NA 5E5MB 1WZLA 1UKQA 1AGCB 1JHKH 1CZ8L 4KHTL 3PDGA 4Z7WA 5CAYB 2IAMD 4NM8L 4APQC 1FYTB 1U8OB 3FB5B 3ESVF 1MHPH 2A77L 3W11D 1YEIH 3EYFB 1Z2KA 4R8WL 4XAKD 2JJVA 1FFPA 1HWHB 3ZKMC 3GSQB 4WW1B 4NT6B 4M1CD 1NJ9A 4WW2B 5DVKA 4N8VG 3ILPA 1JGVH 4HKZB 1HNFA 2PTVA 5BS0B 5KSAC 2CDFB 3NCMA 3WNMA 3MLSH 3T08A 3F7VB 1PG7W 5HHOD 4OGYL 1BJ1J 1FC1A 5ESVB 4ZAKD 1L0XA 3VCLA 1KLUB 4M62L 3OB0H 2DAVA 2VMFA 1I9JL 1CLCA 4MDJB 1MCBA 2AABL 5EBWA 4EI6B 5IB4A 5I16A 1FE8L 4FN0A 1JYWA 4KK5D 1A3LH 1C5CL 4J8RB 3S3SA 4HKJA 2WBJB 5IESH 4PJXA 4OB5H 3VXNB 4L8CB 3O3EA 3T65B 5HI4D 3MRMA 3V2AR 2P8PA 4HS3B 4S11A 1UXSA 1S7QB 2Y5TA 3VFSB 1IKNC 5HHQA 4X99A 3RX8A 4LSPL 3RWHB 5F9DC 2VDKL 4LSUH 3QUZC 5F8RC 1J87A 4Y1AB 4M6NL 5DJDA 3O2WL 2FYYA 1RJCA 2QSQA 3GEWB 4X7TA 4BKLB 1EA9C 5DJ6B 5FKPA 1FL6A 2AXGB 4PJAB 5IW6B 1WJ3A 1JNHA 1MCKA 1KUMA 5JXED 4TSCH 3QEHB 4YWGL 1SVZA 3U2SB 3H7BB 4KVCL 4ZFZB 4UT7L 4I3RH 3T0AA 5I1DB 4RBPH 2DIJA 3SDAD 3O3BB 4PREB 1QSFB 5JW4N 1D5XA 1EEYA 2H41A 4PJ8B 4CW1B 4DW2H 4KJYA 4G8GD 3C8KA 3T0EA 5K9JH 3MBEC 4WTZG 2D7TL 4G9FE 3DXAB 3M1BA 3T77B 4Q74A 4ALAH 1R3LA 1W72A 2J5LB 3REWA 3RUGB 4IJ3B 3C5SB 3TJHD 3ARFC 1FZMA 4YIQB 1J1XL 3ZE2F 4LIQH 4E41D 2LQRA 2VZSA 4Z7UF 1J9CT 4GW4A 4IHOA 3W82A 2VQ1A 2AQ3A 2IF7A 4KU1A 1X6LA 5K9QI 5KVDH 3O6LH 5EPMA 2W9EH 4HWNA 3L9RB 1M1SA 3G6JE 3QEGH 4MXQD 5DMKB 3BN9D 3JWDC 1A4JA 2X1PA 1EIBA 5FOBB 1X5XA 4FQPA 2CSPA 1ZOXA 4OM0L 2EE6A 3EZ8A 4ZQKA 3OGCA 4HULB 2ZCKL 4PJFF 4L4TE 2E6PA 4LKCB 3TBTA 3O6FC 3OZ9H 4WGVB 2NX5E 1MREL 2KBGA 3VW3L 4JDVA 1LDPH 4X9GA 3UJTH 4OF7A 1RIHL 1KB5B 4YDVB 5L88L 3UDWA 4PJGA 5T1DL 4IIQA 1PG7X 3QEQA 4NFDA 3AS0A 3NH7L 1RUKH 2D7MA 4PR5B 5KVGH 3N1GC 1MCWW 2ADGB 1DSFL 5DJXA 5J8OA 3PF2A 5DD3L 3GIVA 4P4KD 3ZYZA 1W0WB 4RIRA 4PRAA 3MO1A 3BDBA 3HZKB 1TVHB 4XCFL 2FLRT 2BSTA 1JMZA 4ZODA 1B0RB 3SGJC 5JHDE 1GVIA 2YEZA 3RVWD 1LWRA 8FABA 1HK6A 5CIPB 4P23B 4U6TA 3G9VA 2PXYD 5IFJA 4M4RA 4UDTA 3W9EB 1FZJA 1T83A 1H9VA 1NH6A 1G6RH 3QO1B 1G84A 1OGAA 1IE5A 3BE1L 2IAND 4HBCL 5DLMH 3RWJB 3KR3L 1WBXA 1U9KA 2OBGA 3O8XA 3V6FB 4MD5A 4QRPD 4XNZC 2VZTA 4U4BA 3GI8L 1CL7I 4JZNA 1X5JA 3KLAB 4K9EC 3U36A 3OHXA 1OAKH 2V2WB 3CMOH 4XBEH 2Z4QA 4X6CE 4J12A 4FQ1H 2EDJA 5CHNB 5DJ0B 5B39B 2OQJB 4PJBF 3S37L 4JRXB 1CGTA 4O51B 4DCQB 5FAAA 5HXMA 1U91B 5CWSB 2QQNL 3LV3A 3W0WE 2GK2A 3DETC 5D70H 4GRLA 1T4KA 3G6JB 3V4VH 3TVMA 3PV6A 3TP4A 4JM4L 5EU3A 3MREA 1I1AC 1V3JA 4Y5XA 5EC2B 3FO0H 1OL0A 3OV6A 4EXKA 1MCIA 4L8SB 1RUAL 1LK3L 2WAHA 3INUH 5C07E 5I1HL 2EDOA 3P9MA 1EO8L 3QUXD 3V95A 4RAVA 3VI3F 3IGAA 3HFMH 2WWMC 4P46A 5F6IC 4UNUA 4QRRE 1J12A 3B9KD 1K6QH 3GO1H 1P4IH 2J4WL 4QXUL 5I0ZA 1DEEB 4NC0B 3O45A 1YY8A 4KXZH 3MNVA 4U6XB 5E2TL 1FVCA 2ERJC 1NGYA 3MRLA 4YHIA 4JKMA 3MCLL 4PJIA 3ARBC 3K81A 3CFDB 4XWOC 2ED9A 4BZ1H 3G04A 2BY3A 4GS7C 5CZXD 5BOZG 3VFWB 4F9LC 2C9AA 2D31B 1T80A 25C8H 3VG0L 5DC0A 2P8LA 4PJBA 4J3WA 1M7IA 1G7MB 1ORQB 1ADQA 3C2AL 4L9DA 1XF4B 4J3VA 2BNQA 4ZTOH 1D5BA 2Z31A 5DRWA 1T1WB 1RUPL 4FP8H 5C0DB 2YRLA 3WJJC 4M9OA 1EDQA 1UB6B 3QNYB 3TFKC 4BFBD 3GHEL 1AIFB 4O9HL 1I7RA 2AI0L 1UM4L 1OF2B 2R69L 4HIXL 1QFPA 1U3HD 1U8NB 4ETYA 1DQMH 4XHJC 5EBLA 3RU8H 2DQTH 4PRNB 2EKSB 2HA1A 4BQ9A 2Q87A 3L7FB 4FXGB 4F33A 2ZUUA 4Y5YB 1QSEA 1S78C 5C1MB 5FUCC 4NO5B 3SE4C 3A6OA 4X6CB 3EO9L 3QFJE 2Q8AH 2BJML 3U0WL 4YR6B 3TM6A 4Y2DB 4YC2C 4OI7A 3IKCB 3NACH 2QR0B 3FB8A 3MNWA 1P4BH 1YEEH 1TJGL 3KPNA 5D7IE 3ZE1E 1HXYA 3W0WB 3DVIA 1JN6A 4GKSB 3CH8A 2H2PC 1J8KA 1NC4B 3FAXA 1FE8H 2NY5H 4NDMA 3MRPA 1WCBA 4U1MB 3VDCA 2Z93A 1C5CH 4M61A 4WFEE 4NQSA 3KPLB 3MFGB 5C07B 2NY0B 4GW5A 1PYWB 3WHXA 5EU6B 4QRRB 3BJLA 4RA3A 5CGYD 3DSFH 1KENL 3KYKH 1GAFL 4NC1C 1U92B 3DO7B 2VDKH 3BDYL 4WDIB 4LSDA 5E08H 2Q76A 3GJEA 3P4OA 2AEQL 3ECBB 3ARDA 3QIBA 4G9FD 1JWSA 5I1AB 1NGPH 3QHTC 4MGXA 3LHPH 1KEMH 1ZHKA 4J3OC 1NCDH 4P5TB 5INDA 2NY6D 4WEUD 1CD9B 3MTRA 3VFVA 5F3BA 4MS8D 1LQVA 2KZ1B 2IAMC 1EUUA 1KIQB 3MGOB 2YPVL 3HE7D 3W11C 4WCYL 4KUZL 4LQ1A 3NCYP 1AJ7L 3S34H 1XGQA 5ISZA 3WFCL 3CC5B 3MV11 1CF8L 1G7LB 2J6EH 1FVEA 4I0CC 4M1CC 5ANME 1DTUA 3QXAB 2BRRL 1VESA 2ID5A 2M26A 1YA5A 2ESVE 1R3JB 1INDL 3LKSB 4WI8A 2DQDH 1XR9A 4X4XB 2D7TH 2R4RL 5DD0L 4L4TD 4RAHA 2NX5D 3P9LB 5SX4H 4ZAKC 3ARPA 5CSZA 5FDWA 2YD3A 1J7VR 1MIEL 4JO4L 2YPLE 4MZ3A 2Y72A 4G6FB 4KK5C 4U1LA 5LGHL 2NY2B 4RMTA 4XBPA 2E7BA 3MJ9L 4ZMAT 5HYSB 3IDNB 4LRIC 4OI9A 2F53E 4UAOC 5HI4C 3LAFA 1CK0H 1GH7A 1I3RA 5TPWL 1NGZA 5F89A 5JHDD 1P69B 2XWJA 5C0CA 4L4VB 4P57A 3MRBA 1RJZB 1BWMA 4HGMA 1AGBA 1JPTH 4NCC2 4X8JB 1UC6A 2MFNA 4EKXA 2DLGA 1MCSA 1WBZB 5DJAB 1JNNH 5B38A 3FQXB 4LLDB 3CSPA 1RZ8B 5FA3B 4JN1H 3O3DA 4LHJB 4YPGA 2Y23A 1K8IB 1EVUA 3TH3T 3QIWD 3LVEA 4GAGL 3STLA 1T04A 3HUJE 3SKUD 1CFNA 1FCCA 4GUPB 5T3ZD 4M8QB 5JXEC 3KJ4B 5EUOF 4O5LL 5E2UH 4JAMA 4FQXA 3PQYA 4EI5D 1MHEB 1B2WH 3JWOC 3PHOB 1ES0B 5D1QD 3SDAC 4FQCL 4KC3B 3IDXL 1NAMB 3W0WD 5DJZA 4MSWB 4U31A 4HZAA 3U79A 1CXFA 2Y36L 1HWGB 4Y8AA 4HBCH 5IB2A 3JTCA 3KR3H 4BA8A 4U7MA 4ISVB 2KQNA 4ODWA 1HYSD 5E2VL 3TJHC 4P3CH 5DK2B 2XQBH 5A16B 1L0QA 3LH2L 4WNQB 1JE6A 4QRRD 2CUMA 5SWZE 1F3JB 4JE4B 4HWBL 4PRHD 4J3XA 1URLA 3ULUL 4MXQC 3BN9C 1MCHA 4F7CB 3AY4C 4LSRH 2QQNH 2XY1A 1JK8A 4LHUG 1S9YB 3WXWL 2OR8A 3N9GH 2F53B 5DFWH 4APQA 1CDGA 4MA8H 4P5TD 3ZDXE 5SWSE 5D2LF 5BJTB 5GGVH 3DYOA 3OB8A 4I18B 4P59L 5L2JA 5HHNA 3WCYA 1ZHBA 1A6UL 5ICXA 3KPSE 4XP9L 2XI9A 1EO8H 3VXQA 2O61A 2D9CA 5DTFB 5D7LA 3H9HB 4LCCB 3B3IA 4LSSH 2E9WA 2G9HB 1HEZB 2J4WH 5CD3A 5IVXB 4MQXD 5KSAA 1BX2A 3DVGA 1JZ4A 1LO0H 4D8PB 4WW2C 4NHUE 4P4KC 1QBML 3JWNC 1BJMA 3HUJB 4HS6B 3C8HA 2RGSA 1RMFL 4Q7DA 2Y7QA 3RVWC 5F72S 1N59A 2G5RA 1KFAH 1C8PA 3G6DH 1MFDH 4D0BB 2PXYC 4J1UA 3QFJD 2VLRA 4UT6L 3PGDB 1BPVA 3BISA 3HB3D 2FX7L 3F58L 3KHQA 5TE7L 4R96A 1G7QA 2NY2D 3WO3B 2GITA 1YNTB 4PTUB 1FYHB 2A83A 2B7DT 2BNRA 5FM5M 3UC0H 3L3IB 3MGAA 1V8HA 1Q94B 1GZPB 1IKNA 4F57L 3S35H 1WC7B 3IRZA 4HIXH 2PO6A 5BRZB 4NNPL 3L5JA 2GKIA 4WFED 1HH6A 3THML 1A1OA 5EORH 5ETUA 4AH2A 4JFQB 4JPKH 1U3JA 1FNFA 1QLRB 3OKKB 2DTMH 4NN7B 4R7NA 3IDIB 1XF2A 1JP5A 3BKYL 1KPRB 4MJ5B 1P4LB 3BIBX 1S7UB 1RHFA 3TBWB 3ULUF 4IOFD 3T1FA 5EO1A 3MCKB 4XNYL 4OF5A 5F1KC 3QCVL 4DFIA 5EO9B 1MWAA 2DKUA 4H25A 1OP9A 2P5EE 2EDLA 3C60A 4KQ3L 4IRSB 1LP9E 5F7KC 3HCVB 2YD2A 4MHHG 4TYUA 5CEZH 3DBXB 3F65A 3O41B 4BK5A 4OZFG 3D2UD 5DK0A 5F1NA 5DHVB 3QO0B 3H8NA 3KPMA 4L4JA 3I3BA 2HJKA 1KLFA 3MLRL 4N5ED 3KPSB 2BSED 2AV7A 3MBEA 5DQ9B 5IHLB 4KZDH 1GIGH 4G9DB 3DI2B 5CLWA 5LQBL 4MXWH 2EO1A 4WI2A 4WV1B 4UV7H 5J6GB 3QH3B 3R0NA 4M7LL 4F15B 2X4SB 4NHUB 5DDHB 2ESVD 4XC1L 5AYUL 3CX5J 4IJ3C 3W39A 4KKLD 2VH5H 3WLBA 1NL0L 3NA9L 2EEDA 4IMKA 4X6BB 4HLZH 1EO5A 1RK0B 3KPRE 3QI9D 1AGFB 2R2EA 2VDMH 4BFIB 32C2A 2YPLD 2X4RA 1QSVA 3QDHA 4KPHL 4LQFL 3UTSA 5EO0B 3VXMA 1WLHA 1FSKB 3IJSA 4ODXA 4U1IA 4Z5RB 1U3HC 3EDJA 3TBYB 2EDEA 3WEXB 2OX5A 2Z92A 3FN0L 1FORL 3GB7A 3VD7A 1AJ7H 2YK1L 3HMXL 4QF1B 4PRBA 3E2HB 5HYIA 1CF8H 3FT3A 1W0VB 4JQXA 1FCGA 4X9BA 4TULL 3GHBL 4TUKL 5L0QC 3RI5F 2Z0BA 1NC2B 5EBGA 1K3ZA 5GISL 2VXSL 4NGHL 2YPKB 5ADPL 3BRDA 4PP2B 4NQXA 4D9QD 5CJOL 3NCJL 5C2BH 3SGJA 3GRWL 5I18L 3LD8C 1U95A 2P5EB 1T0MB 4LLMB 1J1OH 3BP5B 1LP9B 3X3GH 4TPRL 3RNKA 4CVUA 4N8PA 4NUJA 43CAA 5C0IA 4CDGC 2BVQB 1OW0C 3O4OB 4Y7MA 5TPWH 4UMGA 1BQUA 4WVRA 2NZ9D 2OI9B 1U36A 5CGYC 5TDNB 4NZUL 3DVFA 2DKSA 5E9DA 3CDYA 4ZFOA 4XCCL 1ZXQA 1DFBL 4UILL 3C9NB 3B2UD 2A9MH 2DYPB 2GJ6E 4KKNA 5IMOA 4DUWA 4BQ8A 2H8PB 5TF1H 2FBJH 2VL4A 3V52H 2AXFA 3SDXA 4OZGA 5T1KA 4AIXA 4ETQA 4NQED 2PYFA 1ND0A 2NY6C 3FB7B 5BZWB 4XBGA 4XHQA 4GAGH 1A6AB 4F7EA 1S9XB 4MS8C 4TRPL 3OKEA 4NC2B 5KZCB 2HKHL 4JJHA 2ITCB 3KPRB 2EYSA 5DUPH 3RWCA 5IMMA 3KPTA 5SWZD 4OT1L 3HE7C 5BQ7A 5GSVA 1I1AA 1RULH 5ELIA 1UM5L 5C6PB 2QTEA 3QWOB 4F9PC 4M93B 5LGKA 3T0DA 1JHTB 5SWSD 2Y36H 5TH2A 3H3BC 1RU9H 2H6PA 3Q6FA 4QEGA 2GUOA 3PP4L 3WUWB 5IFAL 1OY3B 3ARZA 4EN3D 4JKWA 3NIGE 2HFGL 3F7QA 3KPSD 3ARBA 5BW7C 5JOEA 4PB0L 2E9JA 4OKDA 1KCVL 5AZ2L 3QJHB 2YD8A 2I9TA 4F9LA 1BJ1H 3QISA 3KYMB 1QLFB 1FP5A 2IH1B 3CDGA 1YC8A 1MRCL 1CWVA 3PDOA 5IHUH 2WUBH 1GCFA 1FLTX 3VFGL 3ULUH 4ZYKA 1R5WA 5EUKB 3RWDA 3JUYA 3DX8A 5C3TA 4HX1A 1MAJA 3JWDH 3Q48A 3U4AA 1N4XL 5I6XC 3ZTJH 4DVRH 4MXVF 1ZA6B 4L8DB 1PKQE 3SCMB 4HPOL 5I2IA 1N8ZB 5GHWH 3UO1L 4X7SL 3O11A 4M48L 2FX8L 5FA4B 1OTUD 2BVPA 5C0FA 2GJ6B 3QIWC 4MJIB 4HIIB 5IW1B 5EOTB 5I8OH 4R26H 4RDQF 3SE4A 4PJEF 4OCYL 4RRPA 5JMRA 2F54A 3U6RB 1TTGA 3SN6N 5D2NB 3X17A 2X1OA 1Q0XH 2FX9L 3HZVB 3FFCE 4EI5C 1H5BC 1OOAA 1PX4A 2HMID 2D3VA 7FABL 4Z0BH 1NC2D 3OKMA 4YXLH 5D1XD 5D1QC 4H0IA 2YKLL 5D7JB 4GAFB 5H2BA 4WUKL 3ZSSA 1S5HA 1E27A 4CN6A 5IR1A 1HSBB 4MB4A 2JCCA 2R56L 1C5BH 4PLKD 3B6SA 4OTXL 4MA7H 4ORZC 4OCRL 5IK3B 1YPZB 3C5JA 3TN0B 3BHBB 1SHMA 4CJ0A 1U8KB 5F1IB 3T2PA 5HGDB 1HYSC 4F57H 1IJ9A 3HAEA 1S7WA 3HRZA 5LAXB 5B38G 3X14B 3ZT5A 3VXPB 4Y19E 5C0AA 3THMH 2UWEF 3D69B 3PWVA 3CPLA