2CIKA

Insights into crossreactivity in human allorecognition: the structure of hla-b35011 presenting an epitope derived from cytochrome p450.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN B-35 ALPHA CHAIN
publication title The Structure of the Human Allo-Ligand Hla-B3501 in Complex with a Cytochrome P450 Peptide: Steric Hindrance Influences Tcr Allo-Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cikA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2cikA01
1JIBA 4Y1AD 4KUCF 2P49B 2XKNB 1N6VA 4PREB 2ESVB 1PX3A 2BSSB 1UZ6F 4YHNB 4KXZH 1YY9D 3TYGL 1EDQA 2RR3A 4Y4KA 5IWLA 4NC0B 4HLJA 3SPVB 3TF7A 3P2TA 2JJWA 1W0VB 4ZS7H 4AYFA 1JWSA 2AJXL 3O6MH 4PY7B 2YHGA 3F7PC 3GRWA 3C2AH 2IFFH 4IBLT 2ZUYA 5H2BB 3EZ8A 4K7PY 3G9VA 5IMOB 4OV5A 4QRQA 1UZ8A 1NUGA 4RAUA 3ZL4L 4CGTA 2P43B 4Q0XL 2F53A 3SJVD 3LKQA 3I6GA 1HH9A 1ZAGA 1FNSL 2Z92B 3QCUL 1OLZA 4L8BB 5F97E 4IIQC 4QTIH 1KT2B 3T4YB 5GXBB 2GJ6B 1AXSB 1MF2H 1PW3A 3RIAF 4TVPE 2RBLA 2D9CA 4JVUA 2Q7YB 4KK5D 2KPNA 1QFWI 1ZSDB 1VPOL 5BJTA 1EIBA 1TQBC 2J8UF 4OTXH 1VENA 3TYFA 4BZ2L 2WY3A 5TQ2L 2JB5H 3QDMD 5B38A 3BP6B 5GS1B 2YR3A 2VQTA 4JQIL 2DTSA 2X4OA 3SE9H 4D0DB 2XA8L 4UUJA 4URTB 2IG2H 1RZ8A 4LP5A 5ESVB 4C4KO 5K59F 4WI8A 4PGJA 1EAJA 3HB3C 4BA8A 3MLVL 3CIQA 1CGSL 4HIHB 4RFEA 3P77B 5CJQL 3WSQH 5T3ZD 4PJIF 5DMJB 3AY4C 3MX0A 4L3EA 3MUJA 4IIQB 5IBTL 1MCPH 5CINL 4OM1L 4XAKD 4C56A 5D7KD 2B5IC 1OM3H 4UT7H 4IDJL 3S34L 3L5XH 1FV1A 1UKSA 1OAXL 1A7BA 4TPRH 5LQBL 1TQBB 1T5WA 4QNPE 1G9MC 4FFZH 4QCIB 2F8VA 5F9OL 4E42B 1FRGH 4NHCH 1BBDH 4C54A 4KHXL 1HQ4A 2C9AA 3WDHA 2XQBH 3UYOD 3T0AA 4ELMF 4YHIA 3W39B 1BD2E 4WV1C 2YBRB 1WBXA 4OZIE 5JXED 3LN5B 3DRQB 4L4VB 2R29L 3U0TA 5E94B 3TFKD 1HI6B 1BLNB 4Y5XA 5C09E 5IJVA 4V1DA 3MLYL 2VDMH 1D6VH 2B5IB 1UYWH 3F6IA 3PDOB 5HHOA 3DUHA 1GPOH 4F33B 2R0LH 4GSDL 3TJHC 5EO0B 2F5AL 2ITCA 1F58H 1JNHB 3WE6A 3Q6FA 2J1KA 4ZUUB 1XF3A 1LDPL 3DSNA 3H3KA 4WV1B 4X8JB 3DMMB 1J8HD 5CEXA 4KVCH 5MENE 3H7BB 2A0LC 3M8OH 3RAJL 1YEFL 1I7UB 2VN7A 4OCWL 3IT8D 5DT1L 5CIPA 3UTPD 1HHJA 2Y5TA 4M48H 3T0ED 2XTJC 2DQDL 1LK3L 2YXMA 1C16A 4UTAL 5JHLH 3BD3A 1NGYA 1ZA3A 2F54A 2V9RA 3I3DA 2LU4A 4PJ8C 1P9MC 1R3JA 1ZOXA 5K9KA 2DLEA 4YHKL 2A6DB 3V4VH 4ZTPL 3UTTD 4XWGL 2Y6SD 4CVXA 5I18L 2VDPL 2ATPB 1AIFB 4MA3A 4KZDL 4IMLB 5IG7A 5BRZB 1IGFH 4RZCA 5D1XD 4J6RH 4YH6A 4XMKL 2J6EA 4MQXD 2ED8A 3MNZA 2XTJB 3ARFA 4WWKC 5IK3B 1MRCH 4U1SA 3T65B 2EXYD 4Z7UB 2EC8A 4GRWB 3IAPA 3GNML 4XMPL 4CNIA 2ID5A 2P5WD 3ULUE 5F9JA 2CKBB 3IDUA 3V6OA 3PQYE 2DBLH 4QRPB 4LVEA 5KSBF 5HXMA 4J3SA 2XN9A 1MPAH 2H8PB 1XMWA 5GGRY 5D72H 4PJCB 2MJWA 3REWB 2NY2D 4PJGB 2XPGB 4ZO9A 5AAMA 1I1AA 2RGSA 3LEYH 4NRYA 5IEKA 2L7JA 1UCBL 4XBPA 3K2MC 4KQ4H 1OP3H 2DQJH 2EXWC 1H8SA 4Q74A 4WWKB 3T04D 4Y4KD 4LSRL 1T1WA 1NCWL 4BKLA 2VLMD 4M7KL 2KUTA 4UU9B 4LSTH 2J8UA 4J3WA 5DJ8A 1K3ZA 2DN7A 1C5DB 2D7QA 4FZEL 3U7YL 4Z9KB 2J3SA 4MD0A 5DXWA 5E8NA 3BEVA 1N59B 1NLBL 5JW5B 4ZMAT 1ORSA 1CXFA 2JKXA 1I85C 1N5YH 3BW9B 3FQRB 1GGCL 3MJ6A 3BE1H 3DO7B 1MQ8A 3QQ4A 4TSCL 2V5MA 3VGAC 4OZFB 4DN4L 3GBLA 3I50L 4X98A 2XZCH 4PJIA 3GZKA 3GSOA 3W9DA 2FIKB 1YN7B 4ZSOE 3P9LB 4J3UA 2IAMC 1B4JL 5I1KL 1MJ7L 1HHGB 3LKPB 3MGOB 2DWEA 3H3PL 4QO1A 1FFPA 1H3XA 2ZUQB 5DMKA 1E4XL 3WHE1 4R2GD 3X17A 5MP6L 1P2CA 1CDIA 1OAZL 3WL9B 1KTDB 4G9FB 4LGPB 4XWOC 3H9SB 2C4FT 4ELMA 2CD0A 1X5HA 1VGEL 1VFOA 3MRBA 3VFMB 1U92A 4HWUA 2AJ3B 3BH8A 4JRXB 3ULVD 3VGAB 5I9QC 2HVJA 2AEQL 5DS8A 2YWZA 3MCKA 4D9RE 2X1QA 4PJBF 5F7EH 3VFSA 3KLSA 1MREH 1TTUA 3VMPA 1JK8B 2BVOA 4AL8L 2IAMB 3UP1A 4ODVL 5EU3A 4C56D 4I5BA 4RAVB 2DD8L 4P57B 5E1AB 3TIEA 4F8QA 4XC3H 2R9HD 3DECA 2OJEA 1WWWX 5JQ6H 1NMAH 3TO4C 5A3IC 2YPLB 3SKNA 4L29A 5DFVC 3QEUA 1BQHG 2P5EE 2DQUH 3HNTL 5I9QB 3SKOA 3SGKC 3E8UL 4JFXB 2IFFL 5KVGH 4HUUA 2FX7H 3ALPA 1MJUL 5CP3A 1KXTB 4K23H 5E0QA 4V1DD 5FYJH 1TJIL 1KC5H 3BUYA 4G8EB 2JELH 3MBEA 3GSNA 2VUYA 3Q6GH 1IC5L 2NY1D 3P4NA 4N0CC 3I9GL 1OL0A 5HHOD 2PW2A 3QRGL 3P9MB 3MGAA 4NSKA 3QUKB 5AG8A 1UADC 5EUOE 1IZJA 1IC4H 4QTIL 1BECA 3FTGB 3LB6D 3MR9A 5HHME 2YKLH 4OF6A 2EECA 3IAGC 3K81A 4HCRL 1BJ1J 2HMID 1BZQK 5TDOB 1FZKA 5K93A 4HG4J 2EYSA 1AD9B 5BV7C 5DMGD 3E6FB 5C0ND 2BRRH 2W0PA 3IRPX 3CVHB 4U7KA 1UXWB 4P4RB 3TBWA 3BP5B 3QEQB 5EU6A 3S6CA 5A2JH 4O00A 2DF3A 3RU8H 1X5GA 1W8NA 3MJ7B 3WIHA 1A47A 1H3VA 2H3NA 1Z2KA 4EJ1C 4WHYH 5I8EB 1LVEA 1RJLB 2F54D 2XV6B 2GY5A 1DDHA 1MY7A 1OM3L 5E9DB 1FZOA 4UT7L 5KSBA 4GW4A 5CHNB 4QYOA 1NEUA 4JLRA 3WIIH 2HWZH 2D7MA 1ZANH 2K9UA 1JZ7A 5BV7B 3UYRL 4FG6D 1FRGL 4NHCL 1C5BL 4ZUTA 2LAGB 2N4IA 1OCWL 2XQBL 3CZJA 2NX5E 4WGVB 3AS3A 5IB1B 1NMCC 4LRIC 3QWOB 4GLRI 4OD1L 3QRFM 1GGBH 3S5LB 1WCBA 4P2QA 2G9HB 1E4XI 1ERNA 2C4XA 2DLIA 4X80H 3KHOA 4ISVB 1T1ZA 4RQQB 1YMHB 2E7BA 1UWGH 2XY1A 2QEJA 1D6VL 3VWKC 5DVLA 4XRCA 3SE3C 3GSVB 2R0LL 4U1NB 1EGJH 3FN0H 5A2IH 2XN9D 1MVUB 3QWQB 4Y4HC 3E3QE 1F58L 5E2WH 3TC9A 1Q9OA 4BH7B 3RWGA 3MLZL 4NQDA 2GAZA 1CD1B 1I1AD 3HCVB 4XP9H 4EQ2A 1KN2L 2IMMA 3MCG1 4I18C 1NMCB 4BJLA 3RVUC 4ODHH 3BFOA 4QGTA 3PIQA 3FB8B 2ZUUA 4F58L 2OQJA 5A16B 1BIIA 1CFVH 3JWDL 4U1HB 1DFBH 4KXZI 3OKNA 4UQ3B 1UCTA 4M48L 4P3DB 3VWKB 3MRFB 4ODTH 5I1CL 3BRFA 5JHLL 2X70B 1VADB 3V6FB 3QULB 5IEHA 4HKJB 2WAHA 2X40A 3ARYA 3DVNB 4AIOA 4PJBA 3KXFB 3BP7A 1B90A 1R3LA 1U8HB 32C2B 1RURL 2CRMA 4HS6B 4M6ML 1A7QH 2E7LC 4I18B 5AYQA 4HGWB 2OP4L 4LCCC 1Q72H 3QO1B 2X4SA 3QCVL 3V95A 2I27N 4XH2B 4X5XA 4ZS6C 2Q3ZA 4PR5A 2ZG1A 1TIUA 3CMOH 1H3PH 4EBQL 3V9FA 5KS9E 3L5HA 4WEMB 2P8LB 3U36B 4PRBB 5TH2B 1XGPB 1V3MA 2DB8A 1I75A 4RWYL 5TE7H 4R4BA 4OGXL 1E0OB 5FOBA 3MLXH 1T0MA 2APTA 4Z7NE 4PTUA 5DK0B 4K9EH 1HYRC 2VAJA 4LCCB 3VH8G 5JPNA 1BD2B 4K7FA 3RWHA 4JR9L 3NVQA 2NY6C 4GG6E 4KQ4L 3EYVA 1XF2A 4P3CH 2O5YH 3MRQA 3IVKB 3A6BH 2WZPD 1GIGH 4LSTL 3RVXC 4L4TA 4NCC2 1EAPB 1MJ8H 3HZMA 4NKOA 5EO9B 4LPXA 2C3HA 3EDDA 4DVBA 4Y4FB 5FM4A 5DMIL 4F7MB 3S88H 3SCMC 3HR6A 2NY6B 4EIZC 1HKLH 1Z9SA 1HXYB 3C9NB 5KSAC 4OF0A 2H32A 5J12B 3NCJH 3OG6B 3WXWL 1JPSH 3QEGL 4S1DC 4JZNB 3BGMA 5EOCH 1CXIA 1BM3H 4U1JB 3T2NL 5I30H 1HXMA 1C08A 1G0YR 3NZ8A 3TZVA 4OBRA 5IQ9A 3GM0A 5GSVA 3PGFL 1AR1C 1HE7A 3MLSH 3OXSB 2MCPH 1MWAB 1OTTC 2VXSL 2AVGA 1XR8B 5D7LB 3VXOB 2JB6B 1SJHB 5ADOL 1ZXQA 4O2FA 4BSJA 1OPGH 1F3DH 1SJEB 1CXKA 5CCKL 3BH9B 3UZEA 2B8OT 3QPQC 3NZHL 5IVXF 4PGCA 2XZZA 5KSAB 1KJ2L 1FIGH 1U8JA 2A6JB 3BDYL 2HKFH 3BYYA 3CK0H 3OTTA 1T5XB 2FWOB 1NAML 2EKSB 1W72B 2V2XA 3T3ME 3BSZH 2AK4B 3WHXA 1EUUA 2DDQH 2Z35B 3RUGF 5FDYA 4I2XE 4I9WD 4JHBA 4BFGA 3L7EA 1SY6H 3H42H 3OKEA 2CH8A 4JREB 2BSTB 4DEPC 1KB5B 5GRJH 5I8OH 1QEWA 1QBLH 4JAMB 1EO8L 4YDKL 1H15B 1J05B 4XBGB 2KQMA 1JVKA 3O3BB 3PQYB 1U8PA 5DTFB 4GKSB 3O6KH 4JY4A 1ZKAA 5DVNA 4HV8B 1TZGH 4HK0B 2FX7L 3AC0A 5C0IA 1UB5B 4P2QD 4U1LB 5T1KA 4K23L 5FYJL 2P48B 2Y7QB 1IQDB 1HINH 5KSVB 3R1GL 2CIKA 3BZFA 3HG1D 4Q97A 1ADQA 4APQC 5IMMA 1E4JA 4LSSL 3NPZB 3DOSA 4YNYB 2NY4B 2WP3O 2YRLA 5GRUL 2DM3A 1JGDA 4DEPB 5MEQA 2R0ZH 4G6KH 4NQDD 5IVZA 3MCLH 4PJFB 3GB7B 1FORL 2FATL 3ALXA 3BZ4A 3ECBB 1DBAL 1RSFA 4PJDE 5D8JL 4DGVH 3TWCL 4DTGH 4N0FA 4XT1C 1JI2A 2APXA 1E6OH 3LQAH 4M7LT 3FB7B 4HWBH 5EOTA 3WO4C 2PTTB 3BD4A 2WSKA 3AFLA 5ID0B 5C8JB 3DVGA 2YD1A 4XZUB 4M3KB 3VXRA 4YHPA 1FL5A 2AV7A 2F5BH 1RZJL 3KPQB 1PFCA 4WO4A 3CGTA 5C9JB 5F7DA 4P4KA 3RTQC 3U4EA 3CX5J 4LL9A 3RPIA 1WISA 4N68A 4DKEH 3BP4B 3G5VA 3MJ9A 3PWPB 1U3JA 3QDHA 4F37K 3EO0B 5HDQH 1DBML 3OHXB 4JFFA 3WFCL 1B9ZA 1GRWA 2X9WA 4R8WL 3T77A 4Z0BH 4WTXA 4HH8A 2ZPKL 2X1WL 3HMXH 3L3KA 1MCLA 3W9EB 4JFEA 3UTSB 4HBCL 4J23A 5J9PA 4UBDC 1S5HB 4OCRH 5IP4A 3ZE1E 2UY6A 3LKNA 4M7ZC 5L9DL 1Z5LA 1GHFL 5DRNA 4DOHB 4X80L 4HGKC 5FK9B 3RTQB 4DGYH 1IM9B 1BOGB 1OTUD 5T3XH 3IJYB 3CDGB 5F6HJ 2H2PD 4K7PL 43C9A 1FZMB 1FFOA 5DYOB 4DUWA 2RAMA 1X5YA 3SGDH 1BEYL 1WIPA 2DJUA 1RQ5A 3JV0A 3PGCB 4P5MB 4GKZA 1IAKA 1RZKC 3EYOA 1AJ7L 4XNXH 3G6AB 2HRPH 4MXQC 4PYGA 2VDQL 5DD0L 1HILB 1RIUH 1X4YA 4G43A 4EDXA 2AJSH 2PO6C 3WFDH 4OCYH 4AJ0A 2EIZA 3TNNA 5E1HB 2IAND 4UDUB 4OAWB 1NCAH 4M7ZB 5IQ7H 3E2HA 5KVFH 1CFVL 4L4TD 2X7LB 1S7UB 2GFBA 2EYTA 3N1GC 4U49A 3F6LA 4WJ5B 3RKDC 5GZOC 3V6ZA 1M7XA 3BKYH 2IPKB 4ONHA 3UPCA 1AQDA 2BHYA 1SVZA 1VEOA 5HGDB 3DGGB 2CIIB 2NY3D 5DRWA 1PAMA 2ZSWB 4JVWA 1A6WL 5JQHC 2OXHA 1B4RA 4ODXB 4X7EC 5F93C 4UIMB 3FQNB 4LAQH 2PO6B 1QYGH 3W0WE 3O2VL 2OMBA 2LVEA 1XF4A 2DKSA 5BZDB 3RUGA 5F70A 3X3FH 3JBG7 3TZVD 1PGRB 4JFYA 4LLDA 1A2YB 1VEMA 4G8FA 3KWWB 5ETUB 3CMOL 2N7AA 2WNGA 4HAGA 3MRPB 3VI4F 2UZXB 2ZCLH 1ZA6B 1U36A 1MRDH 4S0SD 1ZLVH 1BFVL 2JJSA 3QQ3B 2ARJB 1J5OH 4QLRA 3SGEH 4JO3H 1UB6B 4PIRF 1NC4A 5LAXB 2YD8A 1OD9A 3E3QC 5E8PA 3DI2B 3GMOA 3F7YA 1WBZB 1SYSB 1JV5B 4H5SA 1CIDA 4K9EL 4CU8A 4M1DH 5CP7B 2VDOH 4R96B 3TJEH 5FB8B 1TVHB 3DO3A 4YHLH 1NJ9A 3S35H 4HH9A 4QY8A 5D2LF 5ALCH 3BEWB 3QI9C 3T4AA 35C8L 4FP8L 4KDTA 1V7MH 2XWBA 1JUFB 2IALA 4P3CL 4RAHA 5C0BA 5F3HA 4KTEH 4PGEA 1F11A 2BY3A 3CLFL 1NGQL 5MEPA 1JZ4A 4PJEE 2XWJB 2Z8VC 1CFQA 3FB6A 1NGXB 2ERJC 2WIMA 3L3DB 3C5JA 3E6HB 5DUBA 3KPRA 5T1KD 1QSFB 2CJUH 2XWTB 1U93B 3BRDA 1U95B 3J7HA 1PZ5B 4L8CA 3SO5A 1QBML 2BSRA 1F13A 3HRZB 5IHZB 3QCTH 5ESQB 1LO5A 3S88L 3HUJF 1HOCA 2BNUA 3G04B 3KVQA 3QI9B 4HLZH 1QSEE 1QRND 4YGVB 2QL1A 3L3HB 2ADFL 3QIUC 5DEGB 5LGHL 1BM3L 2GK0A 3ZKMD 1JHKL 4I77H 5ADPH 3CCHB 4JPWL 1I8MA 4N0UA 2R69H 2YA0A 2ERJB 3OB8A 5IOPB 4NKDB 2YC1A 3TNMA 2H2SD 3FO2B 5C08A 2CLVB 3PABA 4KJYA 1JGLL 3VXRD 4S1RH 3DUSB 4Y89A 4FS0A 4W81A 2R0WL 1U8QA 3BIBX 3KDMB 4WO4D 1A6PA 1EO5A 4P4KD 5JXAH 4TQEH 1LK2A 1TJGH 3F5WB 3CK0L 1JRHL 3QIUB 1HWHB 4ZAKA 5E6IC 1MEXH 5DRXA 4NKIH 1ORQB 4JFFD 2WBKA 1JHTA 1MAML 1S9VA 5F89A 1AGDA 1BAFH 4L1DA 4JN1L 1NCDH 3IDJA 1FGNH 4JFED 3UTQB 4UV4H 3MRIB 1M7IB 4GH7B 1TLKA 4XPGH 1EVTC 1TZGL 2EEBA 2N1KA 5D9SB 4F9PC 5IROA 3L1OH 2E9BA 3U2SA 1RFDL 5TQ0L 5I16B 4LSQL 3LV3B 4HPOL 3U0WL 4M61B 4LLVA 4OD2A 1CD9B 3QFJA 2MOVA 1R5IA 5FKPB 5DUPH 1I3UA 3HN3A 1EA9C 3B9AA 5FUCC 5E6IB 3STLA 1A9BB 4CVZB 1HHHB 1RUQL 1P84J 3JTSA 4LEOB 5EZJB 4M7LL 3GSXA 1ZT7A 3BYTA 5GPRA 1DR9A 3MCLL 4IRJC 5FIEA 4RDQF 5I19L 1LDSA 5FYJE 1KFAH 3QUMA 1LE9B 5TDNA 3LN9A 3RL1A 4QOKD 4RMTA 5FA3A 3AM8A 3VXUB 5DK3A 3BZEA 2F15A 5HPOA 1XIWA 3ZKNC 5EN2A 3HAEH 2RCSL 1FDLL 4G5ZL 3I3EA 4ODBD 1KB9J 1T89A 3P4OA 3ZT7A 1PVHA 2FJFB 3DBXA 3OKMA 4UT6L 3NIGF 4JPVH 4ZNEA 2GW5A 3ROLB 1D5BB 1ZT1B 4AIZB 4M8QB 4QRUB 1NFDE 5JNYB 1Q94A 1A1MB 1TNMA 3FO1A 3RNQB 2NYYD 1IGTB 2CDFA 4OIAA 1FYHB 2CGRH 4HKXB 4IRJB 4K3EH 2CRZA 5DC0A 5FO9A 1T20B 2OZ4H 1FPTL 3BMVA 5T3ZH 1GC1C 4AEHH 3MSPA 1QLEH 4OKDA 4Z0BL 5D2LA 4JFPB 2PYEB 1FNAA 5DJ0B 4JKMA 3SOBL 3QHTC 1PG7W 1ZVHA 3F12A 1U3HC 3NFPB 4JQXA 1QKZL 5HHPB 5IBLC 3RWDA 1YPZF 2GITB 2NY7H 4NQSB 1EXUB 3V0WL 2PCPB 4OQ1A 2BHZA 4LLYA 2W9DH 5IHUL 3VRLF 1KJMA 5ICXA 3N06B 1FNHA 2O93L 3EGSB 5K9QI 1NC4D 4I2XB 3EFDH 1Y18B 3BJ91 1EFQA 4XCCL 3VD7A 2VLRA 3QZWB 3OB0H 4A6YH 1T21A 3WLBB 5T5FH 3KG5A 4HFWA 5GSRA 1ZVSA 3BUTA 4R97B 1EK3A 4MNHA 4NO5A 3HUJA 4HXBL 4OFYA 4XNXL 1L9MA 2Q8AL 1A7NH 1WTLA 1I3VA 1MELA 5C0EA 2NMSA 3RZCC 3VRJB 4LQ1A 1QNZL 5JORB 4KRLB 4XP5H 4JFDE 2O61A 2EE9A 4WI2A 4ZXBA 3N1MC 5MERA 2Q1EA 4KKNA 5D93C 4OKVA 5KVFL 2HFEB 3BQUC 5E00A 5A40E 2WM0A 3P4MB 15C8L 2Y9RT 5EOQH 3BKYL 3KPRD 2FZ3A 3B43A 2OK0H 1G1CA 1HHKB 2Y72A 4LVOC 4C4KT 5L7XH 5EC2A 1PY4A 1JYWA 3MV7D 4Q2ZB 1HHIA 3BKCH 4KK8D 3U7WH 3MRLA 2Z0BA 4LAQL 3RZCB 2EDDA 3P0VH 4N9OB 4P5TC 4CRPA 4Q6IA 4XNUH 4LDEB 1VFAB 3RIFK 3V5KB 4GRMB 1Q9LA 5I1HH 5J1SC 3O2WH 4G6AD 5EU5B 1N3NA 1A1NA 5I1LA 3O45A 3BQUB 5EFIB 3CD4A 5A2KH 5E8OB 1IFHL 3P0GB 1S9XB 5H94B 2CLRA 5JOPD 1WJ3A 4PRIE 1CS6A 5B39B 5IKCA 1VGKB 5C08D 1ZMYA 43CAA 4ZD3L 4OUOA 1K4DA 4LVOB 4JM2D 4Y19E 4OLUL 3TIDB 5JIPA 1UA6H 2YPKB 2C1PA 4HWZA 5LXGH 1JBJA 4H1LG 4OGAD 2IQAA 5KVEL 3C8KB 2YD5A 2YSSB 3CFBA 3CMGA 4XP1H 1FNFA 3B6SA 1OAYL 4G8GB 4P5TB 4PD4K 5IIEA 1JF6A 4M1DL 4FABL 3MV9A 4ZAKD 1B3JA 4H26B 4N9GB 4L1HA 1G7IB 3S35L 4RNRA 5DWUL 2JF1A 2VR5A 4XX1E 5L0QC 2FEDC 4BFEA 1SM3H 3G9AB 5GJTH 2Y4SA 4PUBH 1X9QA 2K3TA 1DBKH 4HKBA 3FQUB 5L2KB 3RA7H 2Q6WA 1QLRA 1WAAF 5AEAA 1X5LA 4YPJA 1DLHB 1MH5B 2AABL 3IXTA 1Q9KB 4G6ML 4MD4A 4K8RD 5ERWB 4R0LA 4FQXC 3T1FA 3GSUA 1YJDH 4KMTH 3PWJB 5ACLA 5DDHA 2DQCH 3AREA 3QFJD 4KMQA 2B1AL 4X6DF 5FGRA 2BOBB 3S3JA 4CMHC 1DL7L 3MJ8B 5L0QB 4OB5H 5E4EC 1QSVA 2GEEA 1OOAA 3HZYA 1I8LC 4KI5C 2RJMA 5DJAA 3HA0A 3QDGB 4JKKA 1QR1A 3SGDI 4MJIB 5HJ3A 1CF8L 4MNQA 2G5RA 2DM2A 4KROC 1I7ZA 1HH6A 2A83A 2EYRA 1S8DA 4RISH 2NW3A 4EI5A 4FQXB 4YFLI 1XIWD 3VXMA 1KLGA 3IAQA 3H9YA 1CDYA 5FYLD 3T8XB 4HUXB 3IJSA 1YPZA 2FECL 1YMME 5L88H 5D1ZA 4Z7OF 3KNBA 3O3DA 1S7WA 3W0WB 2YA1A 4UOJA 5FGBC 1N64H 5F21B 1EO7A 4NT6A 5C0AE 4CMHB 2VE6A 4KRPD 1WFNA 1AHWB 3MFGB 1TJGL 4U1KB 1CWVA 5E4EB 2LV4A 4M1CD 3ULVH 2R2BB 4QHUB 5FAAA 1EFXB 2BMKA 2ORBL 1O0VA 3QDAA 5SWZB 1G6RL 4KROB 5M95B 4O2CB 1DBJL 1BAFL 1NCCH 4K94L 1PLGH 4OGYH 2B4CL 5D7JA 4ZUWA 3AU1A 4QHLA 5GS3A 3CPLB 4ONOA 5B3NA 2D03H 5D2NE 4FFWD 4JZOA 1IAIH 3L1OL 5GS2D 4Q9BA 2AQ3A 1DSFH 2AS5M 4OUUA 4PBVC 1TCRA 12E8H 3T0BA 3DI3B 1BVLA 2W65A 4TN9A 3VCLB 3UJIH 5DUPL 2VLRD 4LCIL 3FHQA 2KZ1B 2FEEI 3BPNC 1PG7L 1WTGT 2A1WH 4HIEA 5A1AA 1JWMA 4QHMA 1I1CA 5E2JA 4OFYD 2D0HA 1QA9A 1NDMA 5BZWA 2C1OA 1ZHBA 3FO9A 5FGCE 5ICYB 3IRZA 3EW3B 1P7KA 2E27H 4WEBH 2R39A 4ZXBD 1VACA 1NEZG 4NNYB 3KPSA 3WNLA 1N8ZB 1FO0B 3V4PH 2BVPA 4K7PX 3MZGB 2X4NB 4NKMB 1NUNB 4XTRC 4F8TA 4M4RA 4D0BB 4IS6B 1KCVL 4X6EB 4PDCE 2ZNWA 5HI3D 2VC2L 1HDMA 2V5TA 3ZE2E 4WUKL 4Y5YA 4D9QE 3RL2A 1FLRH 2WBJC 1UVQA 4BFIB 3SHSA 1JMZA 5CIPH 3DXAE 4Y16C 2ZWLT 4I48B 4XBEL 1BZ7A 2OZ4L 3U1SL 5T3ZL 2HJFA 2Y23A 1S7VA 4AEHL 2VSCA 1QLEL 2ZOLA 5DEFB 2VAAA 3MA9H 3IKCA 3GBMH 3L3IB 3MV8B 4OBSA 3VXSE 3VFUA 4KZEL 4RGND 3ES6B 5IB5A 2DQIL 3LSOB 4H0HB 2NY7L 3OQ3B 1FN4B 1WAAA 1HYSC 2AXGB 4YIQB 2NZ9D 4JO4H 5I1IL 1ZGLP 1CL7H 2WBJB 4TUOA 4LARH 3SO3C 8FABA 4LHUB 1AGCB 4S11A 2X4PA 1WFUA 2J6EH 4KKLD 1LNUB 3OKKB 2P8MB 2RIKA 4Y16B 1MCBA 3EJZD 2FNBA 4XP6L 1FIEA 3HE6A 1A3QA 3MV9D 4X6DA 3D18B 3SQOH 2XZQL 2DOCA 1A1OB 2WQRA 4YDIH 3I85A 1YEDA 3O11A 2R2EA 3IFNH 3UJJL 3FAXA 1WC7A 2OX5A 4NWTH 4XP5L 2ZUTA 4RFNC 5D1QC 2DQFB 4OLXH 5T3XE 2W92A 1SMAA 1CTOA 3FONB 2DS4A 4M7JH 4X9HA 1CGTA 3VXNB 1CI5A 5GGQL 3HZVA 3SO3B 4ELKA 1I9RH 1SVCP 3FMGH 3D9AL 4WU7B 3WCYA 3H2WA 4FQHB 3VGHA 5I2IB 4ZPTB 3X12B 4O58H 2DQGL 3GMNA 3I75B 5SX4H 5C0CE 4IOFD 3ARED 3X14A 3EDKA 4GXVH 5I76B 5KG9A 4P2RE 1HQRA 3CFEB 1F45A 1UKTA 1K6QH 4X6CB 1H3UA 3U7WL 3HTLX 1XGQB 2NW2B 5H35B 3P0VL 1D5MA 2BNRE 4UINH 4RFNB 2R23B 5D1QB 1ZT4B 4XNQB 1BVKB 2XNAA 3O2WL 3SEPA 3VFRA 5JOFA 3B8YA 3HMWH 3NFSH 5IBUB 3ZHKA 2QKIA 4KUZH 2DRUA 4MNQD 4F15C 4H1LA 1SBSL 3NA9L 1F6LL 4C57C 1KCUL 5GRWA 4NO0A 4EI5D 4NC1E 4YC2C 3CH1A 3VXMD 5KANG 4NZRL 3IFPA 3G5XB 4MJ6A 1CDUA 3P73A 1UG9A 1A6UH 2V2WA 3S37X 1OP9A 5T33L 4RGOH 4ORGA 3MO1B 3C6LA 5D1ZD 2HFGH 4N90E 4NM4H 2FYYB 3KJ6L 3QAZC 5TFSH 5HHXL 5C9KA 1I7TA 3VWJC 3LCYA 3EYSH 5I73B 5BXFA 4HJJH 4Z7VE 2H6PB 2EH8L 1WK0A 3BKMH 1XGRB 2FLBT 1IEBA 2GJZA 4F15B 1ZLVK 3V0AC 1CFSA 2MSPA 1SM3L 3MV01 5CGYD 5GJTL 2Z9TA 2FH8A 1AD0A 1ACYL 1T2XA 4PUBL 1SBBA 4HIJB 3STZB 4YC2B 3RA7L 3X13B 3NAAH 3RNKB 3SGJC 3K4AA 1BZ9A 1GAFH 5D7JD 5GGSY 1CXLA 5JW3L 5DA0B 1J1OL 3R8BB 3O4LE 3MLUL 4YHML 1DVFA 1KEGH 1DE4A 1TVBA 2ZKHH 5MEOB 1CFBA 3QAZB 4TTDD 5CUSL 1KTLB 1OGTB 1YJDL 4YDVB 2XKNA 3VWJB 4WENB 4PREA 1S9WB 2ESVA 2BSSA 2PUQT 3A6CH 4MA7L 2VLJB 4YHNA 4M5YL 3VDCA 1J88A 5DF0A 4PJ5B 2ADGB 4JFDB 3GRWL 3SPVA 2GSGB 4GMSL 2W60B 4Z7UF 2IC2A 3B5GA 5D7IE 4PY7A 4GRWF 3O2DH 3MRCB 1F6AB 1OLLA 3KR3H 5I74C 1KEMH 4TSAL 5ANME 3IS1X 4IOSD 5H2BA 3QHZH 2AEPH 5IMOA 2AJYH 5GGVY 1EJOH 3B4NA 3MROB 3S7GA 4GOSA 4HUNB 3RX8A 1KJVB 5J6GA 4PJCF 2NTFB 3HC4H 3SDCA 5KZCB 2Z92A 5GGTA 4PJGF 3LY6A 4RCAA 3T4YA 2D31B 1KT2A 3DURB 1DEDA 5FO8B 1B0GB 3L7FB 2GJ6A 4TSBL 2Q7YA 1KLFA 1ZSDA 1PKQB 4ZFFB 3TA3C 5I74B 2XOTA 1T3FB 2A73B 2WUCH 3ULVL 3BP6A 5GS1A 5IW6B 2M26A 1T2QH 1D6EB 1BWMA 3SE8H 3WIHH 3UZQA 1ZLSL 2RQ8A 3UCRA 5JZ7C 4HCRA 5ESVA 1FGVH 4OLZH 1A64A 1MJJB 2XRAH 4HIHA 3P77A 3FFCE 3D0LB 1IAOB 1WICA 1I8KB 4PRHE 3MXVL 1GZPB 4IIQA 4PRDA 4A2MA 1IAIL 5DGQA 1A7RH 2GCYB 1EH9A 2WINB 4IRZH 2VDLH 3GK8H 1YN6B 1INDH 1AGFB 5I66B 4QCIA 1ZGLB 1G7QB 1WEJH 1QLFB 1FVCA 1FO0L 3HE6D 4Y1AE 3W39A 2GTWB 2A1WL 2YBRA 5D7SH 3KS0H 2IF7A 3CAFA 4MGXA 5EWIH 3DRQA 4L4VA 3Q5YA 5E94A 4JDTH 1BLNA 3VMNA 4L8DB 2RFXB 4WEBL 2R1YB 3NCFB 3AMLA 3AMKA 4N8VB 5CAYB 1LE5B 2Z91B 3X3GL 1TZHB 5EO0A 3Q2CA 3S5LG 4FFVD 3TBYA 4KKBC 1W0YT 2YPVH 3K7UA 1JNHA 4PP1C 3WXVH 5F7HA 3T09A 3BXNB 4TNVF 4N8CH 4ZUUA 1FFQA 3SJVE 4LASH 2EIDA 3WD5L 3JWOH 4X8JA 5L8LB 3DMMA 5HY9B 3WJJA 5DEZA 4QXTB 3H7BA 4P46C 4OQTA 3KAAA 4JY6B 3MGTB 1I7UA 2WWMD 5KVDL 1U8KB 2HN7B 5E2TH 1PQZB 3MLWL 5FHBL 5JR1L 1QRKA 1MCRA 2QQNL 5D2NC 1P4IL 3S36H 4PRNB 3QDME 4NNPH 2YUZA 4HC1L 4NZTH 5GRZA 3IDXL 4NO0D 4NDMB 3OKLB 1EZVY 5E95B 4TNWF 4Q6YA 1ED3B 4JO4L 2A6DA 5T5NG 1CL7L 2V7HA 1TETL 4QRSB 2OI9C 4D8PB 2ATPA 1AIFA 3WUWG 3C6LD 1YYLL 4IMLA 5T3ZE 1Z0NA 2HT4D 3RHWK 4EI6B 5BRZA 3I02B 3LS5H 4P46B 3BIKA 2A77L 1INEH 1WZ1H 3OAZH 5F88B 1VFMA 5D7KE 2VKWA 2X1PA 4ZPVB 3FL7A 5D5ME 3VG0H 5IK3A 3C60C 3C8HA 3SQOL 4AIXA 3VE0B 3PE9A 1BVZA 3MTRA 4Z7UA 5D2NB 5EIQA 2ICWB 4G6JH 3P11L 1T83A 3IFNL 4O02H 1QP1A 4NWTL 5IW3A 1CVSC 1VCAA 3CSBA 1P9MA 2CKBA 5B4MD 4QRPA 4M7JL 3ZDZF 4UTBL 4WFGD 3OB0K 1ZEAH 5E08L 2EE2A 2OI9B 1FBIH 4QXWA 4S10A 1DVFD 1I9RL 2H8PA 1YEKH 1FAIL 4RRPG 3FOLB 4PJCA 3REWA 1OAQL 1VSCA 4PJGA 2NXYC 4O58L 4WNQB 4Q9QL 3RGHA 1L7TL 2XT1B 2ESVD 5LCVH 3LQAC 4YBQD 1N7MH 1IAII 4WY7H 4BK4A 1NL0H 3C60B 2VLKD 4QT5B 4YXHL 1QQDB 2EDWA 1LP9E 1YEIH 3DYPA 3BVNB 2ZNXA 3OAYH 1C5DA 4UINL 1RV6X 3BN9C 2AV1B 3C6SB 1N59A 4NRZB 5JW5A 3HMWL 3NFSL 3BJLA 3NACH 3BW9A 3OX8B 5TPWL 3FQRA 5HYJB 5I8KL 1J8HE 3OXRB 3DO7A 3ULSB 1IRAY 1H8NA 1N0XL 5GGUB 4OZFA 5TDPA 1CDGA 4GMTH 2X1XR 4C59B 2NXYB 3UTPE 3SDCD 1L7IH 1XF5B 3T0EE 5EZIH 3H0TB 4QRRA 4NWUL 4RA0C 3TO2B 1A6UL 2BP3A 2FIKA 1YN7A 3ZE0F 4RGOL 4NM4L 2GJ6D 4MXWH 1HHGA 4V3DB 3MGOA 2QQLL 1HZHL 4F9LA 1UWXH 2XTLA 2XKUA 3DUUB 1SYVB 3EYSL 1ZHLB 4POZC 3VXSB 1IGIL 4IM8A 4AT6B 1ZLUK 2ILLA 1KTDA 4IOIA 3UTTE 3WNOA 2PXYC 4JGMA 3H9SA 3QSKB 4F80A 4JDVB 2DJSA 1I85A 5IF0B 1P4BH 1VFBB 3NMEA 3VFMA 5HGHA 2AJ3A 3ZT6A 2I5YH 4JRXA 1DANU 4CAGA 4N1HB 1BHGA 1REIA 3BGFC 3MLTB 5H37G 5A2FA 5EUKB 3UJTH 1HK6A 5AWNL 1JK8A 1KEGL 1RVFH 2DLGA 2IAMA 3U46B 4MQ7B 4X7TB 3QH3B 4U7SA 2ZKHL 4X7DC 1GH7A 2P5WE 2ENSA 3QUXB 3PV6B 4FN0A 5KTEH 3D39B 5BS0D 1JTPA 2B39A 3U79A 2Z31C 4YHOL 5B3JE 1BQHB 1KJ2A 4FQ2H 2PXYB 2J7LA 1K5NB 2CDEA 1SJXA 1RI8A 1L4IA 3GSNL 4JFXA 4KPHH 1H5BA 3BGFB 2ED7A 2AEPL 1BQLL 5J7CC 1EJOL 2AJUH 4G8EA 1YEHL 2Z8SA 1FYTE 2VLME 4Z95H 3DLQR 2XYCA 1BF8A 3IB4A 5C0CB 4ETQB 1CICC 4P2RB 3QG6B 3P9MA 1TFHA 4F7PB 1CLYL 1X44A 1IKNA 2WV3A 4PP2B 3FTGA 2Z31B 1IQWH 1QD0A 4UV7L 3RGVC 2VL5B 5I1DB 1TTFA 3REVB 4WTZG 4ZUSB 1A0QL 1KPRA 5DK2B 5TDOA 2CMRH 2GTZB 3OR6B 2ZOKB 3SGKA 1OAKH 3DMMD 1CQKA 3RDTC 1AD9A 2KBGA 3E6FA 3N0PB 4UDTB 3CVHA 1UXWA 4P4RA 3WIHL 5SX4I 4AG4H 1JP5A 4U1MB 2OSLB 3FZUC 4P23C 1FGVL 3BDXA 1KGCD 4I0CC 3QP3A 5FYKH 4N0CA 2VH5H 1CICB 4R3SA 1PJ9A 3MJ9H 5I8EA 5J6HB 4R90H 4HKZB 4LPVA 1PBYA 1RJLA 4KY1L 4WW2C 4OZHB 3VI3E 2OTUB 1A7RL 2R0KL 5E9DA 3TESA 4Z7VB 4PPTA 3RGVB 2UYLB 5CHNA 1U8IB 3ULVE 2OL3H 4CW1B 1FL6B 1EEUA 1INDL 3RRQA 5DJ2B 2JJTC 3RDTB 1D5ZB 4H8WH 3MYZA 4C56E 4LCWB 4MCYB 1EEZB 3DETC 1BFTA 3GIVB 4P23B 5D7SL 3PHQB 3QWOA 5GGSB 2FD6H 4X4MA 3S5LA 4UILL 5CMAB 2G9HA 2Q8BH 5EOCJ 4ISVA 2C26A 4RQQA 4WW2B 1YMHA 5LJYH 3KYMB 5E2UL 1VFUA 2VABB 3GSVA 4QRPD 4WEUD 2QSCH 4U1NA 1CLOL 3X11B 1H3GA 4OM0L 4YZFF 1A7OH 1MVUA 4ZFOB 2XACC 3OKOA 2YPVL 1CDCA 2RHEA 3EKCA 5D7IB 4V1DE 2N7BA 2NNAB 4WWID 3WXVL 1U6AL 1F3DJ 1FFNA 3MYJB 4BH7A 4JHWH 4TOYH 1CD1A 1SQ2N 5ANMB 4CN4A 1C7TA 5HHOE 1MCIA 3JWOL 4P3WA 4WFFD 5C6WH 4TUKH 3JTCA 2ICWJ 1YECL 4MNGE 3QNXB 2BDNL 5A16A 5EBMB 3QJFB 5SV3A 3B9DA 4FXKB 4LKCB 4U1HA 4UQ3A 4P3DA 5E2TL 3MRFA 1X5XA 4LSPL 3KJ4C 3RWEB 2BXYA 4E41B 4G8IB 3EYFB 2X70A 1VADA 3V6FA 5HYSB 2E7CA 4NNPL 2VQUA 4HKJA 4RA3A 3KPNB 4PJAB 3DPBA 3W5NA 2W59A 3LIZH 3EOBB 3WS6A 2YEZB 1FVDB 3KXFA 4QRRD 3EOAB 1DQDH 1U8HA 32C2A 4HS6A 2EXWD 4PJFF 3O9WC 4I18A 4MAUL 2F54E 3QXTA 3LS5L 1WZ1L 3QO1A 4XCNA 5KJRL 4XH2A 5DC4B 1YY9C 1R3HA 2DQEL 1BQSA 3H9SD 3KJ4B 3LQZB 5DZOA 2IPUK 4HK3N 3S96B 4G6JL 4DZBA 1D3CA 1YEEH 4PRBA 4RRPA 5AZEH 3U36A 1XGPA 4JRXD 5F7NC 4AY0A 1UZ6E 2VJXA 2G60L 3V7AE 3L9RB 1QFHA 4LCYB 2WUBL 2OTPA 3VH8B 1UWEL 4CN6A 1FBIL 4Z76B 3O9WB 2E7LA 3EYUH 1YEKL 2PN5A 4LCCA 5CLTA 1C5CH 3W2DL 2QSTA 2R4RL 2UWEE 4UB0H 3V6OE 4DFHA 2G75B 4WY7L 3IVKA 2XN9E 3PL6A 2NTSP 4KK5C 2JIXB 1AI1H 3UXFA 1EAPA 1KCRH 4YE4L 1WBYA 3RIAK 5DR5L 3NACL 4NZUL 4LLQB 4S1QH 5IM7A 3SJVB 3SKUD 4QHKI 5K9JH 2J8UE 1OGAB 4Y4FA 4GMTL 2PNDA 2FBOJ 4F7MA 2JTDA 4NZJA 2ADJB 2MKWA 3F7VB 1L7IL 1MIMH 2VDRL 4GBXB 1A14H 1HXYA 1AE6H 3C9NA 4H20L 3QB7C 4BQ8A 3FB5B 5IMKB 3C09B 1E6JH 4NFCA 3Q5TA 5K59E 4U1JA 3L3GB 3KPLA 1N6QL 4NRXB 3AS0A 5DFVD 2XIDA 3GUTA 4TVPH 3OXSA 1MWAA 4HGMA 4UAOC 4M9OA 1XR8A 5D7LA 1C1EH 2JB6A 1UM5H 5INCB 1IM3B 2Y36H 1SJEA 4BELD 5KSUB 5JXEC 2FR4B 1TDQA 1Q0XL 4N0CD 5IJKC 4ORZC 5GS0L 5F96H 2EO1A 4OLVL 3CXHJ 5KSAA 2A6JA 1TQCC 1RVFL 2IADB 1T5XA 4GUPB 4ELME 5E9DD 2XXMB 4K07A 3WV0A 2EKSA 1NKOA 5D5MB 5DD5H 4JHAL 1XGTB 2AK4A 5HDBF 3TBVB 2Z35A 4QHNB 5KTEL 1WFOA 3FFDB 1R0AH 2VLLA 2BSTA 4HUWB 1KB5A 2B20A 3CLEL 4FQ2L 4JAMA 5J0BA 4UAOB 1CBVH 4FQLL 1H15A 2FL5B 1J05A 4XBGA 4K8RH 5D4QA 1ZS8B 2VZ1A 3PQYA 4TULH 4ZTOH 5DTFA 4XPFL 1CCZA 1RIHL 2J8HA 3S4SG 4KPHL 4HV8A 4HK0A 2BOCB 1QHOA 3EHBD 3GJFB 1UB5A 2BFVH 2I24N 4M43L 3VFNB 1ADQL 1NCBH 5GGRA 7FABH 2AJUL 2Y7QA 2P24B 3UC0H 5KSVA 4WI4A 4WTZA 1E4KA 2ZJSH 1MI5B 2VOTA 5BW7C 2G5BB 4YNYA 4LSDA 2VZUA 2ARJQ 2R8SH 1RHFA 3DSFH 3NH7H 5TE4L 5BQ7B 1S7RB 3MC0A 1R3KB 2PR4H 4PJFA 3GB7A 2CXGA 1CZ8H 4M62L 4MA8H 2Y6SC 3ECBA 1XCTB 3VJ6B 1XCQB 4O9HH 1J8HB 4NNXA 5FYLH 1Q1JH 3LKRB 3F58H 3FB7A 2YN5A 4LLMB 2NY5H 3FT2B 2PTTA 5CZXD 4AG4L 6FABH 5ID0A 1C12B 5AZ2H 5C8JA 4MQXC 1OARL 4XZUA 2Q3AA 3JTTB 1R5VA 1IJ9A 3KPQA 3MJ9L 4X8XA 1X3DA 5C9JA 2Y06H 3VGFA 3BP4A 5I71C 3EO1A 3PWPA 4RMWA 1G0DA 3GI9L 3ARGC 3KXFD 1B2WH 3EO0A 1OT2A 2O5ZH 3OHXA 4JM4L 1TITA 4Y2DB 3V0VB 2NY2C 4OIIH 1M1SA 1BF2A 4HUVB 3W9EA 3R4DA 5GS2H 1G6VK 3UTSA 4LFHG 4Y4KC 1S5HA 5GJSL 3TF7C 4I9WE 4OT1H 1NMBH 2WBWB 5FK9A 1B0RB 1IM9A 1BOGA 3JWNC 4G7VH 1RZFH 2P5WB 1MHEB 5I71B 2DAVA 5IVNA 2YOCA 3CDGA 3TPKA 3ARGB 1J18A 1CFTA 1IEAB 3JV5A 5DYOA 4K3JH 4H25B 5GQBA 5GGVL 4P2QE 2LTQC 3PGCA 4NM8H 3WLWD 4P5MA 5CSZB 2NY2B 5D6DA 5DMYA 1YQVL 4PS4L 4YDLC 1A7PH 4FTVA 3HG1E 3QJHB 1HILA 4NJ9L 5C6TH 4WU5B 2XQYK 3PL6D 1IAMA 4DWHA 1FYTB 4UDUA 3WFEH 4OAWA 3HNSH 4NQEB 2A9MH 2HKHH 5EDXA 5ALBL 4RX4D 4WW1B 4R2GC 2XZAH 1X6NA 2X7LA 4NQDE 4DGIL 4JFQB 5EBGA 4WJ5A 3BPCA 3NTCH 1DQLL 1NUFA 2IPKA 4TYUA 5GHWH 3NBNA 4P9ML 4ALAH 5HGDA 3DGGA 5TJWK 2CIIA 2ZSWA 2J88L 2LTQB 3LIZL 4Y4FD 2DL9A 1G7MA 2ZUXA 4IHOB 5LWYH 4MXQA 4ODXA 4JPKH 5KW9L 1DQDL 3FQNA 3RJQB 1DN0B 2PO6A 4WIQA 4QEGA 5BZDA 3GKZA 5EPMB 4GRLC 4YWGH 2R9HC 2GQHA 1U2CA 3WO3B 5DJDB 4R2GB 1U41A 3KWWA 3TYFB 4PJBE 5FYKU 1HN1A 3EYQC 3R8QA 3HC3H 5E2VH 4CVUA 3K4ZA 3P0YH 3MRPA 5HI5D 4XAWH 1X5ZA 1TNNA 5D7LD 3BAEL 4UUJB 2Q20A 5DD3L 1ZA6A 1YEEL 1RZ8B 1V7NL 3E0GA 3QQ3A 2ARJA 3QQNA 2BY2A 4XVJH 5LAXA 4RFEB 1KIUA 1YNTB 5I1JL 4XVTL 3ZYIA 2ICEA 4GS7C 3OAZK 5KSAD 4OD3L 1JV5A 4HQQL 5C0FA 4UOW0 5JLZB 5E8DH 5B39G 4OFKA 5CP7A 4LBEB 5FB8A 1TVHA 4S1DD 1C5CL 4GRLB 4XCFH 4OF7A 4I3RH 2AK4D 2OCFD 1P1ZB 4MB4A 1KELH 3BEWA 4BQCA 4V3EB 3GGWA 4NOBA 1JUFA 1F00I 1NGPH 5IFHL 3L5JA 3MRDA 1F2XK 1FL3A 1XFPA 4NQUA 2HMIC 3ZKSD 1LO0H 1SJVA 2XWJA 1KCRL 3WFHB 4M3JA 1NGXA 3W81A 2EZ0C 3E6HA 5DMGC 1JZ2A 2HVKA 4RBPH 5FUZH 1Q0YL 1QSFA 2XWTA 3RP1A 4XCYB 1U93A 1U95A 3GI8H 1PZ5A 1T0PB 5IHZA 2IANE 4WUUB 5ESQA 4LPUA 4L4TE 4JO2H 5JIIA 1PEWA 3G04A 1A14L 2D9QB 3G5YB 4P99A 2NY4D 1IGJB 2ITCB 3K1KC 3OAYK 3QI9A 4MNGB 4OFIA 2AP2A 4YGVA 3L3HA 1E6JL 5DEGA 3RX7A 3Q6FB 1G9NL 4ZYKB 2NR6D 3D3VD 4M02A 1XF3B 5D71L 3CCHA 3K2UL 2AJXH 4Z78B 1X4XA 4P2OA 4HMCA 3UAJC 5IB3B 5IOPA 4NKDA 3MOAH 3ZHLA 4FG6C 1K4CB 1IGCL 1JNNL 1UM5L 4O2EB 2CLVA 5D6CB 2Y36L 5CIPB 5CLWA 1RJYB 4Q0XH 2DJ4A 5HDLA 5TE6L 3RVTC 5EZOL 3H6JA 4KI1A 1RY7B 1HSBB 1C16B 4MYWB 4EUPH 1FNSH 1D9KD 5DUML 4JJ5B 1J1PL 1QOKA 3SDYL 3QCUH 1WT5A 1LEKB 3F5WA 1N2RB 3QIUA 3PWPD 3V6OC 5DD5L 4M4PA 3UPAA 2Q7NA 4YEEA 4KV5F 1ORQA 4D94A 1R0AL 5EULV 3IU3B 2AXFB 3KLAB 4JQIH 1MAJA 3L5WA 4Y2OA 5C07B 1T4KB 4K8RL 3WS3B 3KPMB 3MNWA 3UTQA 3UTSD 3MRIA 1M7IA 3LPWA 4U1SB 5FHAH 5CJQH 5D9SA 4UIKH 3AAZB 1T2JA 1G6RA 4PRPB 3LV3A 3KPPB 4CNIB 5IBTH 2FX8L 1IM9D 5D70H 5CINH 4OM1H 5E8EB 4M61A 3UC0L 5HVHC 2UWEB 5T1LB 3S34H 4KRMB 5FKPA 2EO9A 2XY2A 1OAXH 1FC1A 5E6IA 3O41A 2XN9B 1A9BA 1CGWA 4CVZA 1X4ZA 5LQBH 5EZJA 4LEOA 3LOWA 3ZE1F 2R8SL 3DSFL 2AJVL 2HP4A 5F9OH 4KC3B 3QUML 4UQ2B 2PR4L 4NRYB 4KHXH 1MRFH 4LNVA 4FTVD 1TXKA 1CZ8L 3BISA 3HE7B 1EPFA 3VXQB 4L9LA 3U9UB 1LE9A 2OJZL 3F58L 4F9PA 3VXUA 1QRNE 5DJ8B 3MLYH 5AZ2L 5FKAB 2CSPA 4TUJB 1MNUL 5HVHB 4NQCB 5E5MB 3T1WA 2FJFA 2GK2A 3ZYOA 1AGEB 1QBBA 3B2UD 4GSDH 4YK4C 1F4HA 1ZT1A 4AIZA 4QRUA 5JNYA 4HDIB 2VDNL 3VFOA 1A1MA 4IEFB 3RNQA 4U1GC 2APWA 1IGTA 1U91B 3SDDA 1K8DB 3VXRE 4HKXA 1LDPH 4IRJA 1WFTA 1LQSR 1S7SB 2HFTA 2YD9A 1T20A 2PO6D 2W1NA 4P49A 2DWEB 1NDGB 4OIIL 2MHAA 3CNKA 4JFPA 4X99B 2PYEA 5DJ0A 2VR9A 1VKXB 1YEFH 1FNGB 3KYNB 4OCWH 4JG1L 4FQ1H 1RUML 5DT1H 1J87A 2FGWH 3NFPA 4BYHA 1LK3H 5HHPA 2I26N 2GITA 4NQSA 5GZOD 1EXUA 2K1MA 2PCPA 4JFFE 4UTAH 1NMBL 3KHQA 2C3VB 1AGBB 5I0ZA 4NGHH 1GGUA 2DL2A 4G7VL 3EGSA 3OGCB 1OB1A 4R6UA 1TTGA 5DS8B 1Y18A 4JFEE 1ZTXL 4XB7A 1IL1B 2X4TB 4KI5F 3QZWA 4JG0L 4YHKH 4K3JL 3QXVA 5L6YL 4ZTPH 3W11D 4XWGH 3OKDB 5EZLB 5I18H 2VDPH 1N5AB 4KZDH 3MQIA 1AC6A 3BWUC 4I8DA 4XMKH 3VRJA 5C6TL 4XVSH 3PWNB 2EDBA 4DFIA 1IT9L 3ARWA 3QXWA 4L29B 2GHWB 2HFEA 2A9ML 3GNMH 4XMPH 3CC5A 1MCNA 2X10A 1QSFD 3L3OB 3ZTJH 5JOEA 3BUYB 4ALAL 4QOKE 3D69B 1JE6A 4AH2B 4Q2ZA 5HYEA 1JNLL 3FQTA 4NO3B 1LGVA 5LWYL 3QDJB 1FH5L 1UCBH 4NHUA 3QI9D 1NBVH 2DI8A 1VFAA 3UPRB 3V5KA 1O7VA 1NCWH 1MHPL 1IKFL 4O51A 4M7KH 1H8OA 5EU5A 1FNEB 3BQUA 4H88H 1OQOA 5EFIA 4P2OD 3U7YH 5E8OA 4OFPA 3TPUB 1S9XA 5H94A 4AEIH 3P0YL 1NLBH 3EJYC 2V5RA 5B39A 1VGKA 4IRSA 1T22B 3TIDA 4TSCH 2HYMA 4DN4H 3I50H 4EN3A 4CJ1A 2Q87A 1QTYT 3LHPL 4WCYL 3OJMB 3C8KA 2H41A 2YSSA 4PGBB 4WI6A 2CUMA 3IU4L 2YN3A 4G8GA 4MJ5A 3QIUD 5I1KH 4UNUA 1OWRM 1FZOB 3B2VL 4H26A 1T66C 3H3PH 1G7IA 4XCFL 4MSWB 5LGKA 5ISZB 4Z0XB 3RWCB 4XNYL 5MP6H 3QUZB 4DKAA 2R2HB 1OAZH 2P7TB 1QPXA 3MRGB 3FQUA 4HIIB 5L2KA 4MDJA 4ZUTB 4WHYG 1VGEH 1KCSH 1DLHA 1MH5A 1A8JH 2AERT 3CFDB 1Q9KA 2AEQH 5ERWA 1NCTA 4NBYB 3MRJB 1V05A 4P2YA 4GAJL 4QF1B 3PWJA 4AL8H 4M8VA 7CGTA 3HG1B 4LLUB 4PLKC 1OW0C 3O6LL 2DD8H 2DLFL 1NGWB 1S3KL 2CDGB 3MJ8A 4YDJB 4YFEA 3KPRE 4KGLA 5C2UB 4J4PC 1RHHB 3NOIA 3IDMB 2GAZB 1T0NA 3ELAT 2EC9U 3QDGA 3SKMB 3SKJH 3MV7E 3D0VB 3MUZ1 4MJIA 4C58B 3HNTH 1VEPA 2V17L 4V2CB 1V3JA 2Y25A 5C0RL 3E8UH 3MOAL 2DLHA 1MCEA 1XGYL 3VXUD 1MJUH 2OQJB 4FQXA 2R1XB 1TJIH 3ZYJA 2IBZY 4MB3A 5SWSE 3JVGA 1ITBB 3T8XA 4HUXA 1IC5H 1N26A 1MIEH 3I9GH 1IMHC 1AXTH 2ICCA 1FLTX 2VISA 4N0UE 3QRGH 4G6FD 1A6VL 4NFDA 5IEHB 3O4OC 3CSYB 4X6CF 4PB0H 1OP5H 5JOPE 1AHWA 4P9HH 3O3UN 1OTUC 4U1KA 5HI4D 3BN3B 5AD0B 4XNMB 1NGZB 5C08E 1T7ZA 1I8LA 4PJBB 5C2BL 4HCRH 2H2PC 2R2BA 4QHUA 3SDDD 1EFXA 3WEXA 5SWZA 4HWEH 4HULB 4O2CA 5IFAL 2PYED 1MCWW 1WQVT 2X4SB 2CK0L 5DRZB 1I1FB 3ZKND 3QPXL 3GSWB 5AYUH 3CPLA 5FHAL 1S9YB 4NN7C 5F7MC 1BBJB 1BOYA 5FGBA 1I4FB 2OR9L 4UIKL 3ARUA 2NCMA 3KYAA 3LEVL 4HZLA 1KJ3L 5D70L 3V52L 1FJ1B 1MFAL 3M45A 3VCLA 4S0TD 3IDNB 4PGDB 4MDIB 2IFGA 2A9NH 2NY3C 3DTXB 4O5LH 2APBA 1IAIM 4K7FB 3RWHB 3UYRH 5MI0C 1C5BH 3TCLB 1MRFL 5DZLA 1OCWH 4XX1G 2VWEE 3QFJE 1NEZB 5ICYA 1DUYA 1CGYA 1XF2B 2X9XA 4NN7B 5IBLD 3ZTNL 4FQIH 4M00A 4OD1H 2IANB 4NNYA 1GZQB 1N8ZA 1XT5A 1FO0A 5DVKA 2X4NA 5I1EH 4NKMA 3VD3A 4D0BA 2JJUA 4XHJD 1J11A 2EDXA 4IS6A 1IEHA 3QEHB 4X6EA 1EVUA 2FJHB 4N8VG 3DX8A 4UMGA 1YEJL 4CL7A 2NY3B 4OQTH 1CLZH 4BFIA 4K2UL 4OF3A 2DQHL 3IGAA 3L95B 3MLZH 5MI0B 5FYLE 3TLRA 3IS0X 2AQ2A 3VI4E 4CBPA 3RY6A 1KN2H 4Q9CA 2F58L 1BJMA 1DP0A 4ZNEE 5DEFA 2BHUA 2D7TL 1HXMB 4F58H 3L3IA 3MV8A 3CZFB 1AH1A 1MCHA 3BQUD 4IDLA 1EMTL 5IQ9B 3JWDH 1MAKA 3ILPA 4FQ1L 5GSVB 5J4MA 1I7RB 5H8DA 2FGWL 3ES6A 3D85B 1FN4A 4PJXB 5I1CH 1A9EB 1BFSA 4YIQA 4CKVX 4IRSD 5L2JA 4NGHL 5CILL 5D2LE 2WBJA 2VXTL 4O2FB 1QPPA 4LHUA 3GMPB 4EN3D 2Y07H 3OKKA 2P8MA 3WNNA 4Y16A 2ARWA 4DAGH 2KL6A 4HC1A 4WI9A 3PJSA 1RURH 4G8GD 4M6MH 4MWFB 2I60L 2WIIB 2B0SL 1G84A 2OP4H 2FSEB 2DTMH 4LPTA 4Z77A 3D18A 2PTUA 5K9QG 3VDBA 4DCQB 3WHXB 1A1OA 3QCVH 1EEQA 2CKBH 4S0UC 3DV4B 3B9KC 4U33A 4CVWA 3HI1B 4XVSL 1HIMH 2VLRE 4EBQH 3RY5A 2DQFA 5DHVB 4JN2B 1CT8B 3ZKMC 5L2KD 3FONA 4GG8B 3HUJE 2VIRB 3GFUA 4JY4B 4PJ8B 1D5XB 4WU7A 4RWYH 2V2TB 3QQ9C 4FQHA 5I2IA 4OGXH 1NBZB 5AUMB 4ZPTA 3X12A 4C55A 3QR2A 3TEUA 1PX4A 3I75A 4RMQA 5I76A 2I07A 3CFEA 3GMLB 2BC4B 4KK6C 4JR9H 4WO4C 4X6CA 4X4YB 4M6OL 4P4KC 1XGQA 2NW2A 4R26H 1WF5A 5H35A 3B9KB 1NBVL 4YXLL 1QRNB 4BQBA 2DWDB 5MEQB 3OSKA 5GRXG 5D1QA 1EJ6A 5FCUL 3EFFB 1ZT4A 2DYPB 4XNQA 5FCSH 1BVKA 3Q48A 4OZFH 3QDGD 4MJID 1I1YB 3HLAB 4H88L 1DQML 4AEIL 1EUTA 4CU7A 4AM0A 3T2QA 1SEQL 4FQXD 3CUPB 1FE8H 1L0XA 1GGIL 3G5XA 3GBNH 4D2NA 3TV3L 2F53D 5F3BB 4DVRH 4H8WC 1FL5B 1W8OA 5DC9B 2FYYA 5DMIH 2PW1B 4RGNE 4F2MB 1EZVX 4WO4B 5F7DB 4U3XA 4P4KB 4JPIB 1GOHA 3Q1SH 1AY1L 3TN0C 3NIDF 4HK3J 2ZG2A 2H6PA 3G5VB 5JDSB 3IF1A 3WXWH 3QEGH 4KI5D 1CR9L 3T2NH 1XGRA 5F9DC 2W07A 4PJHB 4XVUC 1EFXD 3IETB 5SWZD 3PGFH 3LS4H 1BFOB 4MHHI 4ETYA 2OL3B 2AW2A 2VXSH 4HIJA 3STZA 4PB9L 4PG9B 3L3KB 3X13A 3GMQB 3RNKA 3MV9E 5ADOH 4JFEB 1ES0B 1KCSL 1VESA 2CR3A 5LGJB 2W0KA 5J9PB 3BGAA 4U7MA 2AKRB 3PP4H 2IH3B 5K33A 3IXAB 5CCKH 1RUPH 1N0LA 3HPJB 3NZHH 2OR8A 3PWLA 1Z5LB 3R0NA 5MEOA 5DRNB 1KTLA 1KJ2H 4L3ED 1AO7B 4YDVA 1VDGA 3BDYH 3VWJA 1ONQA 1S9WA 3TN0B 2QLVB 2VLJA 4NC2B 4HIXL 1NAMH 4PJ5A 2ADGA 2GSGA 4PV9A 2W60A 3TCXA 4PV8A 3LQMA 2E6QA 3GHBL 3MRCA 2WW8A 1F6AA 2NYYC 4GKZB 3AGVA 1EGJA 3FQXB 4R7NB 1IGYB 3EYOB 1EO8H 2BRQA 4K3HA 4RBPK 4YDKH 5I1GL 1UC6A 3SKJL 3MRRB 3NIGE 1CYGA 5IHLB 3MFFB 3MLRH 2DQTL 3MROA 5GGTL 1DUZB 4OSUL 2EIZB 3TNNB 1IARB 1KF9B 4QOKB 1KJVA 1MQKH 2NTFA 5BVPH 1KXQE 2GFBB 5J56B 2ZSVB 2E7HA 3R1GH 2D31A 3DURA 5CSGA 5FO8A 1B0GA 1MIEL 2VXVH 3L7FA 1AXTL 4MNQE 3V8OA 3K74B 1U3ZA 4LSSH 5CEYB 1PKQA 4PB0L 1UACH 3CFKB 3CVHH 4MVBC 4P9HL 3N9GL 5GRUH 4ZFFA 1WZKA 3VXME 4M1GL 1T3FA 2A73A 3TO4B 4GXUM 5IW6A 1YPZE 2N56A 4XCEB 1FORH 1D6EA 5C0JB 2FATH 4GQ9L 3AXLA 3V8CA 1IILE 1DBAH 1DQQB 2R1WB 5D8JH 3VRLE 4HWEL 2Z4QB 3TWCH 3ZE2F 4MAYC 1MJJA 1A4KB 3ARDA 3MV8D 3D0LA 4R9HA 1RULL 1IAOA 1I8KA 1Z9MA 3QWRA 4KDTC 1GZPA 5AYUL 4ZFGL 4U2YA 1RZJH 2M2DA 2GCYA 8CGTA 4KJPC 2WINA 3NN8B 2WBJD 4LHUD 1W0WB 1YN6A 1J1XL 2W9LA 5I66A 1NC4B 5IV2B 2EDHA 4LHJB 3CVIH 5DD1L 5DJCB 5I1AA 1G7HA 3EBAA 1G7QA 1DBMH 2A9NL 3WFCH 1OQXA 4O5LL 5HPMB 4RMUA 4R8WH 2GTWA 3LD8C 3VW3L 4KUCD 4MAYB 5CJOL 3PDGA 2ZPKH 1FQ9C 4KK8C 1TVDA 1ETZB 4L8DA 3T4AB 4AZ8A 4HBCH 3ARFD 2R1YA 2IALB 3EOTH 3SDXE 4JE4B 4FQIL 1JGVL 1F11B 4N8VA 1G9ML 3HPLB 5L9DH 1HYSD 3SDAC 1GHFH 1LE5A 3DRTB 5BO1L 3DX6B 2Z91A 3SN6N 5I1EL 2HT3C 2WQ8A 2V7NB 4K7PH 2OTWB 3BXNA 5T1DH 3P40A 4RFOH 1BJ8A 5CGTA 4JM2C 1BEYH 4OQTL 1CLZL 1LO4H 5DVMA 3MV7B 4PLJD 5ENWB 3FCTB 5HY9A 1AJ7H 3HI5L 4M93C 4QXTA 4BH8B 3DGCR 2VDQH 5DD0H 3O3AA 4JY6A 2D4DA 1U8KA 2HN7A 5D1QD 3VFVB 1KIPA 1PQZA 4I3SH 5SWSB 2GK0B 3BHBB 3EO9L 4LP4A 3SDAB 4PRNA 1CE6B 1WWBX 3QO0B 1R24B 3LDBC 3U0PA 4NDMA 1RK1B 3OKLA 3WUWB 5C08B 2IJ0C 4X4XB 1ED3A 4P48A 4Y4HB 4JM2B 3LH2H 4HLZG 4QRSA 4D8PA 3O8XC 1JHLL 3HC0A 1A6WH 2Y07L 5HYSG 4ZFZB 1YC8A 4LVHC 4EI6A 4DAGL 3HS0B 4PBXA 3I02A 4OFDA 3BD5A 3H3BC 3HI6L 2MKLC 1LO3L 1HWGB 1WAAE 2DMCA 4ZPVA 3O2VH 2VWEC 2DTML 4ONFL 3VE0A 2M1KA 1CG9B 5D2NA 2CKBL 2ITDA 2ICWA 1M71B 1HIML 4YJZL 2AXJA 2P44B 2B2XL 5F89B 4DQOH 1CDHA 4OZHF 4HS3B 2V6HA 4MS8A 4FFYH 3IDJB 2YZ1A 3OBAA 1SY6A 2AXHA 4Z7VF 5MHSD 4X6DE 1BFVH 4LLAA 3O8XB 3UBXG 1R3IL 1AKJB 3FOLA 2FO1A 4LVHB 1KIQB 4J12A 1XIWC 3C8DA 3OWEA 1J0ZA 4P2CG 4WNQA 3M17B 1T89C 4JY5L 2VLJD 3QFJB 2QHRH 2NY5C 3C60A 4OZ4A 4PJ5D 4QT5A 3QA3A 4OZIB 1A02N 5HBBA 3BVNA 4KRPC 4R26L 2VERN 4OJFL 35C8H 1H3TA 4FP8H 4D0CA 5C09B 1ZT7B 4WW2F 4YO0B 4L3CB 2AV1A 3C6SA 5C3TA 3CLFH 1NGQH 4Z7OE 4U3HA 4NRZA 2AK1L 3OX8A 5HYJA 3ZDYF 4U6VL 1I3GL 3OXRA 4LCUB 3CFCL 3ULSA 4POYA 5GGUA 3EDEA 3O3EA 5IHBA 4N0YL 4X5WB 4HBQA 5D7IF 5KZCD 1FE8L 2QHLA 5EN2B 1XF5A 1QBMH 3GBNL 3KLHD 3TO2A 1YNLL 3MBED 3NA4A 4DVRL 4YBLC 1IBGH 4FFWC 3FT3B 3G08B 5E24E 4LSUL 1MWAH 5MENB 4KRPB 1NCUA 1SYVA 3Q1SL 3S37H 1ZHLA 1Q94B 3FO1B 2ADFH 3VXSA 4AT6A 5LGHH 1P69B 3ARBA 1JHKH 4JPWH 1U8MA 4OCMC 4JDVA 3WFBL 5FO9B 3T2PA 5IF0A 3HAEG 1CE1L 3EDFA 1NAKL 5DFTA 3GJEA 3LS4L 1FCGA 3SBWC 3BZDA 3ARDD 4PJAF 4R4ND 5ITBL 1CU4H 4CDHA 3ULUC 4I0PC 4X5LA 5EU6D 3MLTA 1J12A 5EUKA 1DBBL 2HJLA 3QWRD 2OLDA 1AP2B 1JGLH 3MXWL 4ZXBC 3RWDB 3P4LA 3PP4L 4U6HB 3AB0C 3HMXA 3BI9X 4MQ7A 2R0WH 4X7TA 3U46A 4Y8AA 1RUPL 5KVMC 3SCMB 3QUXA 1U42A 4HPYH 3WIFA 1JRHH 3D39A 1BQUA 5E5UB 4KHTL 5GRVL 4WFGE 5HI3C 1V3KA 1BQHA 1KLUB 4ODUB 1I8IB 1ZWIB 2PXYA 2X41A 1P4LB 1K5NA 1ZVSB 3I2CL 3ARZA 1MAMH 2CKNA 1WUNT 1FCCA 1ZHNB 2ESVE 1IVLA 4JN1H 4I0PB 4KKCD 4XC1L 5K9OA 2GIYA 2A6KA 2VLKE 3MLRL 1U3YA 4ZXBB 4O4YL 2BVQB 4ETQA 1MQKL 4XNZC 3KYOA 4JGJA 3MLPA 4GJTB 4P2RA 1RFDH 5TQ0H 5BVPL 4LSQH 3QG6A 4HPOH 5E00B 3U0WH 4F7PA 3A6OA 4RGNC 2B1HL 1E4WL 4HS8L 4PP2A 2VXVL 5DSCA 2VL5A 5I1DA 2AEIT 3RI5F 2H9GB 3WNPA 3REVA 4DKFH 1RUQH 1UACL 3CVHL 4M7LH 2F8XC 4LQFL 5DK2A 2GTZA 2HTKC 3OR6A 2ZOKA 4KKLC 5HHVL 4UDTA 3EJZC 2GJ6E 5I19H 2NLJB 4U1MA 1I9JH 2MQ3A 2MQ0A 1CICA 2KZWA 1QACA 4NZDA 1I9IL 5J6HA 2RCSH 1FDLH 4G5ZH 4HKZA 4RGNB 1OP5K 3MODL 4KKBD 4OZHA 3FN9A 3OJDB 5LG1A 2OTUA 4ZSOB 4PP1D 1UM6L 4APQB 4Z7VA 3RGVA 4UT6H 2UYLA 2COQA 5DHYA 5IKCB 2QR0B 1S7QB 1U8IA 43CAB 3T2OA 5BV7L 1K4DB 4CW1A 1FL6A 4J3VA 2C4FU 4WDIB 3BO8B 4Z5RB 1XR9B 4LF3A 2UUDK 4WVRA 4R0LC 3DHJA 3CVIL 3ARXA 1D5ZA 4LCWA 3GSQB 1FPTH 4MCYA 5ESAA 4IOFC 3G5ZA 3GIVA 1MFBL 3PHQA 4IMKC 1L9NA 5GGSA 4FZ8L 3SOBH 2XI9A 3WO4B 5BS0E 4YX2L 2O26U 1Z9LA 3ZO0A 4WW2A 4S2SB 1QKZH 3KYMA 3EOTL 3V0WH 1KIRB 2FIRT 3WNKA 4MS8D 2OR7A 1QLRB 5IHUH 5HSFA 4HG4K 5D5MF 4YXKL 4ZFOA 3ZSTA 4DUVA 5D7IA 4JRWA 4EI5C 4H0IA 3MYJA 3T1FB 4XCCH 1F3JB 5T1DL 4RFOL 2VZ3A 5EBLA 1LO4L 5D1ZC 2P5EB 4NQVA 1WIUA 3C60D 4HXBH 3HNVL 2VR4A 1H3WM 2Q8AH 3QNXA 3NFNB 3LN4B 3QJFA 1QNZH 4FXKA 4GW1B 4LKCA 3VGGA 4I3SL 5DJAB 5DFWH 1T80A 5FYJU 3RWEA 2FX9L 4E41A 4G8IA 1FZJB 5HYJD 5DQJA 3RKPA 3T3PF 2HLAB 1I7ZB 15C8H 4NQTA 5EUOB 3KPNA 4PJAA 3UO1L 1F2QA 2EYRB 4EI5B 2NXYD 4MX7B 3EOBA 5HHMB 3FJTA 2YEZA 1FVDA 4P5KB 5D7JC 4N5EA 1J0JA 4YPGB 1KGCE 3EOAA 2IBBA 1OF2B 3LH2L 1LEIB 3DIFA 4L4JA 5D1ZB 5IVXA 4G7YH 1S7WB 1Y0LB 4XI5D 1MCSA 1KG0B 4TTDC 2PKDA 5FDWB 4EUPB 4L5FH 2FJGB 4JKWA 5EG6C 3K80A 4DN3L 3BN9D 3ARBD 2I25N 4N1EA 2DIAA 3IYLW 1LO2H 3LQZA 3MRMB 4MMXC 4YHZH 1RZ7L 3S96A 4X6BB 1IFHH 1X5KA 4HXAH 4DQOL 5IB2B 5CJBA 5F1IB 4FFYL 5B38G 5D7JB 5F8RC 5IGXL 4LCYA 4ZUWB 4ZD3H 3TH2T 3VH8A 4OLUH 3B9VA 5KVEH 4JZJC 1KCKA 2XKSA 4RGMC 1X6LA 2D7OA 4XPBL 3QUXD 1OAYH 3Q3GB 3D39D 1UEMA 4QRPE 1RPQA 4FABH 5GS0D 2G75A 2NX5B 2QHRL 1NLDH 5DWUH 2PXYD 4Y5YC 3SDXB 2JIXA 1JPTL 4M5ZH 4PJCE 2ZP0T 4NUJB 3V4UL 4PJGE 2FBJH 2KH2B 2SEBA 5F6IC 4PLNC 1DEEB 1L6ZA 1P6FA 1ZHBB 1YDPB 4LLQA 4WFFE 4LOUC 2AABH 4RSVA 2EE6A 1BGXL 5ICZB 1PYWB 4G6MH 4X7FC 3CFJA 1OGAA 2E5EA 4JZJB 2VZOA 1AC0A 2ADJA 4P2RD 4RGMB 3F7VA 4GBXA 5C7XL 2ZUWA 5ACZB 3FB5A 1J7VR 5IMKA 1IBGL 1MFDL 2B1AH 4LIQH 1B0WA 3L3GA 1MWAL 2BNQA 4NRXA 1DL7H 1T04B 3S37L 3WJLA 5F6IB 3RVWD 3U7AA 1U0QA 4U4BA 4QRRE 4BZYA 3GKWL 4C83B 1ZVYA 3QG7L 5CZKA 2CR6A 1CF8H 1IM3A 4G42B 3ZKQD 3HE6C 5HHNA 3MOQA 5KSUA 1MHHB 2FR4A 2VMFA 4L9DA 3GHEL 1CICD 1CU4L 4N90D 2FO4B 1W72L 4POUB 3WBDA 4NOFA 4R7DB 2WLYA 3ZT5A 3H9SE 2IADA 4GUPA 4GFTB 5EORL 5F7YC 4PGZA 4JRXE 1KB5L 1U8LB 1XGTA 5E6ZA 1UM4L 5F6HI 4QHNA 2YD7A 4HPYL 5IB4A 3FFDA 5J57B 4HUWA 3HKFA 2FL5A 3S4SB 4LCWD 3JV4A 2ORBH 1ZS8A 5KS9B 1G7JA 3HE6B 4HHAA 1G6RH 5F44A 3DX9A 1DBJH 2UZIL 5IJKA 4K94H 2YWYA 5IR1B 2BOCA 4P0DA 3GJFA 3P3YA 2IPUG 2B4CH 3O11B 5JUEL 4TNVK 3VFNA 1WC7B 4GAYB 2VZTA 2P24A 1EEYA 2VXUL 3V7AG 5CGMA 5E5RB 1Q9WB 5ILTL 1MI5A 1QFWL 4ELKB 2G5BA 4GG6B 3A67L 1Q8MA 5BQ7A 1U2HA 1S7RA 1E27A 4LCIH 4DKFL 4LRNL 3MREB 4OIBA 3C6LC 1XCTA 1PG7H 2VITA 3VJ6A 2HT4C 4WI7A 4EOWL 4GKNB 2HLFD 5EC1B 4LLMA 3FT2A 4TNWK 3ESVF 4Z7WE 1C12A 5DQ9A 5KN5A 3D87B 1I9JL 4KQ3H 1JPGB 5KOMC 3JTTA 4E41D 3HR5B 4HAFA 1L0QA 2GUOA 5BW7A 4KKAC 2GI7A 1KCVH 2VC2H 4ODSH 4N5ED 4WUKH 1GCFA 3UZVB 3INUL 1HKFA 4Y2DA 3V0VA 4B7IA 3DNKA 2R15A 4X9BA 2D4FA 4XBEH 1I7TB 2AAVA 3U1SH 3ZDZE 5E9DE 1Q38A 4YBQC 2DMBA 1NUDA 2Y1VA 2NY0C 3VFPB 4BK5A 1IEBB 3OKYA 1MCCA 5HGBB 1G1YA 4KZEH 1CFSB 4MD5B 5ITFB 1B0RA 2DQIH 3ETBF 2P5WA 1MHEA 1XH3B 3ARGA 2W0LA 3AS2A 3K3QA 5I1IH 4MXVF 4X4ME 2ICES 4NUGH 5CSZA 4ZODA 3SDCC 1FSKC 3ZHDA 4KAQL 4XP6H 3QJHA 3OF6A 1J0KA 2YD4A 5DJZB 2VDKL 3WUZA 1R6VA 2HTLC 4WU5A 1T1YB 2VLKB 2XZQH 2WWKT 1FYTA 3CX5K 2NY0B 4U3CA 2JIXD 3ARSA 3M1BB 2YK1L 1GYAA 4NQEA 1JRHI 3UJJH 1U3HB 5JIKA 4WW1A 4D3CH 4WHTB 5C0BD 3ZE0E 5GS1C 4JFQA 1JGUL 4NJAH 1RK0B 2UWEF 4P9HC 4OFVA 5EH1A 1TPXC 1RZKL 5GGQH 4E5XB 1G7LB 5IMLB 2CRYA 3D9AH 1OGAD 2EIBA 1INQB 1URLA 5J6GB 1EHNA 3SDCB 1FSKB 4IHOA 1RMFH 5IT2L 4GBXD 3RWJB 2DQGH 3SY0B 4XPAL 1Z3GL 3RFZC 1DN0A 5DI8B 4G7YL 4NIKB 4PJDB 5EPMA 3JZ7A 4G3YH 2BNQD 4M6NH 1UT9A 4UNVA 4L5FL 5DJDA 1ZHKA 5I15H 5CEZD 1LD9B 3KXFE 1ITCA 2LU3A 5D93B 4AMKL 1LO2L 4YHZL 5EA0H 1TPXB 2QADC 1QVOB 1SBSH 3FOMB 3NA9H 4FFEX 2ZCKH 4LKXB 1KCUH 4HXAL 3DROB 1ZLUH 4PG2A 1MCOL 1YNTA 4NZRH 2FHCA 3QUYC 1RJZB 5IESL 5T33H 5JLZA 1UJTA 5B8CA 4PRDB 3C5ZC 1FG2B 4LBEA 3KJ6H 1FG9C 1U58B 2JCCF 2MPAH 4GRLA 5HHXH 1P1ZA 4P59L 5C0DB 2QQKH 5BS0B 2EH7H 4B7LA 2EH8H 1NLDL 2E7LE 4PJ9C 2QADB 2AI0L 4M5ZL 1FVCB 3U9PL 4M6AA 2FBJL 4HMDA 3WFHA 1ACYH 3DMMC 2J4WH 4OCSL 3WJJC 4X7SL 4GW5B 4BQ6A 4A2LA 4XCYA 5JW3H 2CUIA 3QUYB 1J1OH 3MLUH 4YHMH 4WUUA 2EEAA 3C5ZB 1MLBA 2NQCA 1CXHA 5CUSH 1MI5D 4LSVL 3G5YA 3TBYB 4MA7H 3VFVA 1IGJA 4NCC1 4MNGA 5GZNC 4M5YH 1A22B 5HVFB 1O7SA 3JWDC 4LIQL 3GRWH 2PYFA 3WN5C 4BSVB 4GMSH 4F7EB 4ZYKA 3U6RB 1DQJB 4PJ9B 1UFUA 4Z78A 4KJWC 4XMLL 3CXDL 1PDKA 4U2ZA 3EZJB 5IB3A 2XQYG 4TSAH 3O81A 4WI5A 1CFNB 1K9TA 1E28B 5A43C 1K4CA 1MVFA 4O2EA 2P8PB 5D6CA 3I6KB 2ZCHL 1RJYA 4DKDC 1PD6A 1AFVL 3PF2A 1T6WA 1EV2E 1HSBA 3RPKA 1F3RB 3THML 4JJ5A 1T83C 4AENA 1K8IB 1LEKA 3QIBC 1N2RA 5D7LE 4DK6A 5CWSB 4TSBH 4W68A 1QR4A 3WN5B 3I3BA 4OZGE 2V7HB 5IW1A 3V2AR 1M6OA 4Y2DD 2F19L 3PWUB 3ARTA 3IU3A 5DURB 4F3FB 2AXFA 3KLAA 2VYRE 3BIKB 2D0GA 4FMFA 4ZOEA 5HD8D 5C07A 1T4KA 3STBA 3WS3A 3KPMA 4HUKB 1ZLSH 1CGXA 4W6XB 1F4YL 2ZZUT 4YZFE 2AK4E 4PLOB 1P7QA 1K3IA 3K46A 3AAZA 4PRPA 1U8NB 3MXVH 3KPPA 3H9HB 3K0WA 1ND0B 1TZIB 3QIBB 5E8EA 1A5FL 2UWEA 5B21A 5T1LA 3ARGD 3PP3K 4QGYA 1OTSD 4AEEA 3Q0HA 1LQVA 2GT9B 2IEPA 5LVEA 3VGEA 2VKXA 4FOMA 4UQ2A 3MUGA 4ZDHB 3BKJH 5JMRA 3OF6D 3HE7A 3SGEI 1FO0H 1A21A 3VXQA 4PJEB 3U9UA 1KNOB 4F9LC 1FYTD 1CK0L 4FA8A 2ZUQC 4NQED 2I9LA 3P30L 3OGOE 5FKAA 3D3VE 4KQ3L 4TUJA 4PP8C 4PJFE 4NQCA 5E5MA 2EDLA 3GO1L 4NCDA 4FQQA 2AGJL 1AGEA 5DO2D 3JUZA 5JHDA 3X3GH 4JCMA 3ARPA 2IBZX 4J3XA 5EU4B 3PWVB 5TF1L 1S78C 4HDIA 4KDVA 5TDPB 1WWCA 1QSEB 4FQJH 4ODSL 1U91A 4ZOBA 1K8DA 4QRRB 3IFLH 5HVGB 1S7SA 4X6FB 3BPNB 2ADIB 3WD5H 2HH0L 4LNRB 3GSRB 1JPFA 2JCCA 1S9KC 1NDGA 4X99A 3B3IB 5FV2A 1VKXA 1HSAB 3QIWC 1FNGA 3KYNA 3PWPE 4XXCC 3ZMRA 3SE4C 5KVDH 2YS4A 1QFUH 1XGUB 1DLFL 4BZ1L 4IOIB 3MLWH 4G9DA 5FHBH 5JR1H 5JW4N 2YZ8A 2QQNH 1P84K 1P4IH 4OV6F 2C3VA 1AGBA 4MLSA 4TRPL 5HGHB 4HC1H 3OGCA 1JZ8A 3IDXH 2Q86B 3TT1L 1H5BC 3DX7B 1GC1L 1GL4B 3MRHB 4E0RA 3UTSE 1IL1A 2X4TA 3OAUL 1TETH 3OKDA 5EZLA 4CDGC 4KH2A 1N5AA 4S1SH 1YYLH 4NUGL 4DOHE 3RWFB 2X9YA 4GRLD 4HX1B 2A77H 3QIWB 1KB9K 2FECI 2WK2A 3VD4A 1IKNC 3VD5A 5ID1B 1UKQA 4BQ9A 3PWNA 4JFOA 3EYQD 1KJ2B 4HT1H 4NYLB 5J89A 2BY0A 2F74B 2CDEB 4ZS7L 3P11H 5HDOA 3O6ML 3UBXI 2IPTH 1NAMB 1CDBA 4D3CL 3C2AL 4FTVE 1H5BB 2Q76B 4NJAL 1T1XB 4UTBH 1KV3A 3L3OA 2FRGP 2H45A 3O2DA 3U4AA 4LPCA 5E08H 4NO2A 5F1KC 3D69A 4WUUD 4JRYA 1FAIH 4AH2A 5JMOC 1OAQH 5L8KB 4NO3A 3CSGA 3LKOA 1RMFL 3QDJA 4Q9QH 1L7TH 2KKQA 4OGZA 2W0FB 1MF2L 4Z7WB 3UPRA 2QV2A 5FXCH 4YXHH 1II4E 4UNTA 4G3YL 4M6NL 1FNEA 1F02I 1JF1B 1KPRB 4OCLC 5I15L 4OTXL 1RZJC 4KK9D 3QISA 1I1RA 2EZ0D 3TPUA 2JB5L 2A74B 3SE9L 3EAKA 4K3GA 5EA0L 5TPWH 2ZUSA 5I8KH 2IG2L 1JJUA 1T22A 5HDBE 1N0XH 2ZCKL 3T0XA 1NFDB 3VXTA 3MA7A 2HA1A 2C3GA 3EHBC 4FXGA 4R3SB 3WSQL 5E56A 4JGUA 4PGBA 4NWUH 2EDNA 2B7DT 3PHOB 4F7CA 1MCPL 1OSZB 2QQLH 1HZHH 1YUHB 2MPAL 3L5XL 4MSWA 5ISZA 2CXKA 1W2KT 4TPRL 2QQKL 4Z0XA 3RWCA 2EH7L 1IGIH 1MUJB 4FFZL 3QUZA 3UAJD 2R2HA 2P7TA 2AJZB 2BVUA 3MRGA 4GT7A 4JDZB 4QRTB 1BBDL 4HIIA 5C07D 1UXSB 3ROOA 4PJXF 3DARA 1KCLA 3ZDXE 3NIFF 3RVTD 3K1DA 2J4WL 1JYXA 3CFDA 3LRSB 5SWQB 1P7QD 2YXFA 2ATKB 3I6LD 3MRJA 5CZXC 4PRPD 5AWNH 5E7BA