5D7JC

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
263
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 263
sequence length 269
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5d7jC01
5D6CA 5TGBB 5K9QI 5KJRL 5J13B 2E6JA 4XCEB 5JORA 2VDLL 1P4BH 4OBRA 3D69A 4HKJA 3UYRH 3IVKA 1M71A 2E9JA 4JCLA 2JTDA 4PIRF 2R0ZL 5L7XL 4NUJA 5GRUL 1VADA 1FZKA 2QSCH 3ES6A 4MJ6B 5ALBL 1VFUA 4CKVX 1PYWB 3C5JA 5CMAB 2G9HB 5D8JH 4BJLA 1QHOA 4KJWD 1QSZA 3EYOB 3LVEA 5F6HJ 1N59A 4LKXB 3PXJA 2A2QT 5EUKA 1EX0A 1FNSL 2WBJA 1CR9H 4LSQH 2XZAH 4OD2B 1ZVSA 4LLVA 1DQLL 4JKMA 5A2KH 3TH2T 2DAVA 3Q0HA 3VGGA 3THML 1RSFA 4OFKA 1XF2A 4WY7H 1OGAA 1M7XA 3NIGF 5HYJD 1NBQA 5DJ6A 4V2CB 1J0JA 1ZK9A 5MERA 2W60A 3GIVA 2Q8AH 5GGRA 4S0TD 3BRFA 1XF3B 2GUOA 3MRDA 2X4QB 4NCC2 3T08A 1IL1A 2VLJD 1MCIA 5BV7L 3WNMA 4Q9BA 4P3WA 1BAFL 2MCPH 5C0ND 2EDKA 2F58L 4JAMA 2E7BA 4YIQA 5D6DC 4O5LL 5DA4A 5F3HB 3SJVD 3UTPD 4PJDA 2B7DT 1L0YA 4OLZH 2VDPL 1I3RB 4DN4H 1JUFB 5T33L 5LWYL 1NL0L 5E2VL 2FYYA 5FF6A 1OAKH 2EH7H 4E42A 5L2KA 1E4WH 4QXTA 2X7LB 4TULH 1CFBA 2AXGA 1JIBA 1ZHBB 4MD5A 1KELL 4OLXL 3PWLA 1B4JH 4JR9H 3MV8A 5L6YH 1RD6A 5MHSE 5DMGC 5DJ0B 3MRQA 3RPIB 5ACZB 5BMFH 1EDQA 3U36A 3L3KA 5K9OA 4P23D 4YFDB 2AJVH 2NY6D 5CEZL 5ID1B 1D6VL 5E8PA 4AM0B 3HZKB 3WFHB 2X10A 1P4IH 1OSZA 4ENEC 2FSEA 1YNLL 4LPUA 3VH8B 3AY4C 5CZKA 2GJ6A 1WK0A 3NFPA 4HAFA 4AT6A 3N1MC 4PJXB 1KXVC 1I7TA 4W4OC 5JQ6H 3MV11 4PLKC 3QUXA 4ESKA 4WU5B 3IU4L 5D7LA 5HI4C 4HGMA 2BHYA 3EOTH 1KTRL 4U0QB 4UV4L 2HMID 4K94L 4HAGA 2OQJB 4HV8B 1HSBB 2HRLA 5GZOD 1Q0YH 1FLRH 1CDGA 1RIUH 5DGQA 2CLZB 4LLYA 1C08A 4XNQA 4F2MB 1PLGH 2H8PB 1MWAL 3HNSH 1QUNA 4MHHI 1LEKB 3O3EA 3MRBB 4JO3H 3ZTNL 3Q48A 4O2CA 3BZEB 4WI5A 4X5XA 3EYSL 4M7KL 1UWEL 1A1NB 2IMMA 1KJ2B 4NT6A 2X89D 3LN4A 2FX7L 1CICB 3ORJA 3UXFA 1A6ZA 1PX4A 5DR5L 4BFBD 2X05A 3EFDH 3OPZL 4OZGB 3TO2B 1KB9J 3P30H 3SE9L 5FAAA 3RDTD 3W11D 3CXDH 2ITDA 2C1OA 1W72L 1R3JB 5CKAA 2XRAL 1JFMA 4CADA 4OAWA 4HS8L 3MRFB 4UNTA 5J3HC 3V5HA 3IXTA 1GGCH 2D3VA 4XC1H 4OSUH 2YUXA 4Q2ZB 3D0VA 1KLUB 3GI9H 5AD0A 5BW7A 1A6TA 5JOFA 4KTDH 3HUJE 2DQTH 2PN5A 4U6XA 5I75C 1AY1L 3LPWA 1S8DB 4QTHA 1YQ2A 1JF6A 5ICXA 5IROA 4FG6D 3V79C 4I4WA 2PW2A 2DQEH 3UJJH 2VIRA 2WSKA 3VD7A 4C56D 4J7RA 5C3TA 3G5VA 4YHZH 3OB0H 3IDXL 1FGVH 4IMLB 3KLSA 32C2B 1OTUC 1RZ7L 5DUPL 4JFFD 2DKUA 3F12A 3QDJE 3TZVD 5KSVA 2VZUA 1HHGB 3KJ6H 3QFDB 3GNML 4HXAH 5KANI 1CLZH 4NO0D 2ADFH 3FO2B 3AS2A 2HT2C 1CE1H 3PV7A 5BVJB 5FUOH 2D31A 3CFCH 4KMTH 5JUEH 4PRHE 2Q20A 4O02H 5BQ7A 4KJPD 4PGBA 2XXMB 2WUCL 3V4VL 3U46B 5DTFA 4LIQL 3V5KB 2XZQH 1N0XH 1HILA 4N0FB 3E0GA 2BY2A 2J8OA 2FGWH 1NGPL 3RNKA 5HTSA 5GRJL 1LMKA 5KSUA 5HDLA 5J89A 1JN6B 2VQTA 4KVNL 3MRPB 2M2DA 4YHKH 5DZOA 4ZFZA 1INDL 3DO3A 4G7YH 2CLVB 2QBWA 3ARDD 3FONB 3QNZA 3QUZD 4BQCA 4BH8A 4BKLA 1HYSC 1EJ6A 1EBPA 5HI5C 2OP4H 4YGVB 3KXFB 4IOIB 3VWKA 3CC5A 1DQQA 3EUUA 2ZJSH 5F7FA 4S2SA 1EFXB 3O6MH 1F8TH 3WSQL 1I4FB 1VFBA 4WW2F 1XGUA 5EH1A 1T1XB 2NW2B 1MREH 4OIIL 4OFYA 3T0EC 1H15B 1K4DA 1AHWA 5E2TL 4HC1A 5TH2A 3MV7A 4FQLL 1DVFD 4KKCD 1H3WM 4IRSA 5E6IB 3OG6B 1BFOB 1CL7L 4X99B 2IWGA 1I8MB 2Y5TA 2VXVL 2VDNL 3KPLA 3BQUC 3UZQA 4OCWL 1KACB 3T2NL 3WS3A 1KT2A 3KPMA 1JNNH 1JTTA 4FMFA 1U8LB 1UM4L 2QKIA 4ONGL 3TBSA 1S7TB 4C55A 2ORBL 1J8KA 1BJ8A 1MFBL 4CU8A 4HWZA 3IFLH 1CBVH 1BLNA 4JFPA 3RY4A 1JHTB 1LP9A 3HI5L 1T7XA 4NP4L 3W9EB 2OJZH 5AUMB 1OAXH 3CNKA 2P48B 1HOCA 3BKCH 3G6DL 4JHZA 5T1DH 3QJFA 4ODHL 1RFDL 2DQGH 5TF1H 3DBXB 4U1KA 1ZE3C 2BX5A 3BGFB 3FO0L 4HG4K 5DEFA 3ZE2E 3QIBB 3FOMA 2MNUA 5HDBE 1MLBA 2V2XA 5EIIA 4XNMB 1ZAGA 1QRNB 3CDFA 2M26A 1MCOH 3OB0K 2XTJE 2PETA 1D5ZA 3SHSA 4PJGE 2CDEB 2DMCA 1GPOH 2MTPA 2CXGA 4RX4A 2P46B 4JFQB 5D1XC 5I17A 4O9HH 3SDAA 2F8XC 1MJJB 3KYMB 1WCBB 3STLB 4DZ8A 5EU5B 1G7IB 5DD3L 3V0AC 2R4RL 5KVDL 4YZFF 4ZS7H 4GRWE 1FZJA 4JHWL 4FXGB 4X7SH 5A2IH 4P4KA 3BD5A 4EN3A 4M6OL 2I27N 3D85D 2MKLC 2H32H 1R3KA 4HEME 2XQYK 1MJ7L 2YC1B 5IJKC 3RWHB 4JPKH 1J88A 3O2VL 3TVMC 4Y19D 1PY4A 3LEVL 4MQXD 5CD5C 2AABL 2IQAA 1AI1H 3TT1L 2QQLL 5TJWK 4B7IA 1YYLL 3D87B 4LHUG 5CUSL 3V52H 4MA8L 4X6BB 5CS7A 5GGVY 2DYPB 3R1GL 4KI5C 1ONQB 3MJ9L 3SO5A 2BOBA 3BXNA 2ICES 4HHAB 4PJCF 2J12B 5T1KB 3VFOB 4TNWK 1M7IA 1N5YL 5J7CC 2Q6WB 2NY3C 2DM7A 3LCYA 5H94A 4QRUB 2FWOA 1SYSA 3ZTJG 5IW6A 5BZDA 4PB9L 2EKSA 4F33A 4DKEH 1YPZA 2IH1A 5DJZB 1LWRA 3N1QC 4X6EA 4YO0A 1DBML 1LEIB 4I8DA 5DMGD 3RGHA 3OKKA 1EERB 4GAYB 3WIIH 2ESVE 3C08H 5DWUL 4P5TB 4W68A 4HS6B 3D3VE 4M7LL 4ODTH 4ENED 5I1DA 3MLYL 1Q9KB 4WTZA 4RGMC 1IC4L 4JGJA 4WUUB 3W9DB 1F5WA 1X4YA 2YA1A 1YNTA 2QQQA 3VA6A 1A47A 5DZLA 4IBLT 1RJZA 4P2RD 3RPKA 4KVCL 3LKOA 5KJRH 5EO1B 5E2UH 3UPRA 3MGAA 3L3DA 2WQRA 3GJFH 3C9NB 5D7SL 5T3ZE 3ECBA 1DLFL 1E28B 1XEDA 3RNQB 2OBGA 1RK1A 1MHPL 4HK0B 3VJ6A 4KGJA 2R0ZH 5EB9A 5L7XH 1XFPA 3B43A 5GRUH 3VFUB 2AP2A 5CJXC 1HQ4B 4G7VH 3LKQA 5DI8B 4Y5VA 1V7NL 1YEEL 5DJYB 4RWYL 5J6GB 2F8VA 4J1UB 1S7WA 3KR3L 2WMPA 5ESVA 4PRIE 2EZ0C 1I3UA 4RZCB 1BWMA 4LLQB 3PABB 1FNSH 2P8PA 2F54A 1TQBB 1DQLH 1OAQH 3WFDL 4HKZA 4PJBA 1EV2E 3THMH 3QXWA 3MR9B 4N8VB 5AYUL 3QDJB 1I9JL 1VESA 5GRXG 3DXAE 3BD4A 5AG9A 2DM4A 2D4FA 5D93C 1MCWW 1T1YA 2UV3A 4GLRI 1QPPA 3TIEA 1PG7W 2BDNL 4BZ1L 4PRHB 4OZ4B 5L9DH 2F58H 2ADIB 4O5LH 5J3HD 1T1ZB 5ICZB 4X4ZA 4WO4B 4XBGB 4ZUWB 3QAZB 4I0PC 4WI6A 4HLJA 3P0VH 3GSUB 4ZAKC 1FCCA 4NQTA 3GI8L 4N1EA 1PZ5A 1NMAL 5BRZA 3OHXB 4M9PA 2AV1B 4WUKL 4RMUA 5T33H 5JDSB 5L88L 1NL0H 1QHPA 5E2VH 5EZLA 3TCLA 5E5MB 1EEZB 5D1QD 3H9SD 3WNNA 1OOAA 5DJXB 4YWGH 3PDDA 3MJ7B 1T0NA 3CPLA 4H26B 1KCVL 4PJEF 2YD3A 3NACL 3P9WB 4RGOL 1CG9B 5J11B 1KELH 2BVEA 4HLZG 1S7VB 3JVGC 1RK0B 1OTUD 3KPPB 2Z35A 5ERWB 3MOBL 4KY1L 5C0AB 4ELME 3M1BB 1LO5A 3GSRB 4LLUB 2XFXA 3HMWH 3FKUS 2EO1A 4TNWF 43C9A 4RAHA 5ICYB 4FQCL 3S4SG 5CEZH 5EU4B 1D6VH 3NZ8A 5DUML 2DD8H 3QULA 1XGRB 1YNLH 5FM8A 3NCYS 1EEUA 1FFOA 4QRTA 4MNHB 1DEDA 5CBAB 1OGAE 1S9VB 2G2RA 1VGKA 3QG7H 1I1RA 3UTTA 5IWLC 3ZKXC 1FVDA 4NJ9L 1NMBL 5I9QC 1PDKA 2OTPA 3PIQB 3KPRB 5D72L 4UV4H 5I1EL 4Y4HA 2WZPD 1ZLSL 4Y4FB 1YNKL 2WIMA 1ZOXA 3SE3C 3RWFA 4IMKC 3HB3D 1PKQA 4PJ8B 2F74A 3SPVB 2H45A 4WGVB 1RZJC 4O4YL 2LTQC 1MWAH 3CSBA 5DO2C 3WCYA 3S5LA 3ZTNH 3GJFK 1QG3A 5HI5D 2R2EA 4PGCA 3EYSH 4M7KH 4PJFA 3VXUB 1INEL 1U95A 4L4VA 1WBYB 2PW1B 4ZOEA 5L2KE 1FO0A 2OYPA 4U1NB 2ZOLA 2FX7H 4AQOA 3V6FA 4PP1C 3QP3A 5DR5H 1W0VA 3T0ED 2C3VB 1Q9OB 3RL2A 4GUPB 3OPZH 5HGDB 2OTWA 5GJTH 1A6PA 4PP2B 3VMNA 1F3JA 1T21A 4GAFB 2XTJB 1QLRA 2W59A 2XRAH 4PJGB 1ND0B 3TF7C 4HS8H 3BQUD 4I2XA 4P49A 4NWTL 3BYTA 4X0KB 3HC0B 5T5FL 2X41A 5EZJA 5D1ZA 3WV0A 1KULA 2XXCB 3RTQA 4GRLA 4O2EA 3T65A 3MUHL 2VL4A 3OF6D 2APTA 3WLWC 1A3LL 1QQDB 5H35B 4WW1B 2LQRA 1L7IH 1AJ7L 3HR5B 5IB3A 3L9RA 1I7RB 2H32B 2OM5A 2Y5EA 3FT2A 4HS3A 1EO8L 1OP9A 2AGJH 5GPRA 3IDXH 1KLGB 3QZWA 3PWPA 5D7IA 3QUMA 4OCYH 1RZ7H 2F15A 5DUPH 1NCNA 4L4TE 4F3FA 1H5BC 4TTGA 2Y25A 4WI9A 1XH3A 5F96L 1P1ZB 3GNMH 2ZSWB 3HFML 3LDBC 3IKKA 3G6AB 3QI9A 4ISVA 2WW8A 5ALCL 1TMCB 2YD5A 3D5OF 4X98B 2KQNA 5EULV 4WNQA 3FRPG 2AJZB 1FE8L 2WUCH 5D1XD 3V4VH 3M45A 1Z9SA 3C60B 1IEAB 2DDQL 1J5OH 1YEFL 3KNBB 4QHNA 5J13C 3JV4A 3DUUA 5H37H 1NGPH 4KZDL 1OHQA 3RY5A 1U91B 4OF8A 5DD1L 4OCRL 2CPCA 3VD4A 4KVNH 2R2BA 2GHWB 2WINB 1GAFH 3ABZA 1INDH 2ZCHL 3D3VB 3MV9D 4G9FD 1RVFL 4H25B 5C0BA 2A6DA 2PNDA 4H20H 5CD5D 2H3NB 2P5WB 1P7QB 5EU6B 2CO7B 2NZ9C 2VISB 4E41D 4MA1B 5IHBA 4KI5D 3UBXG 2BFVH 4GBXB 2WBWB 3X3FL 3EO1B 1CTNA 3I02A 4F7MA 1MUJB 5ACMA 3BIKB 4OIIH 2X4RA 4F7PA 2E9IA 4MS8A 2EIDA 2NY3D 4P2YA 5E2TH 4Z9KB 3LRSB 3BZFB 5KTEH 4FZEL 3OR7B 5C2BH 2ZUVA 1CL7H 1M6OB 1WC7B 5I18L 3UJIH 4ODBD 2VXVH 3UAJC 2EYTB 4NNPL 4Z7WF 1G0YR 2N4IA 2B8OT 5TDPA 3FN0L 1G1YA 4PRIB 2ERJB 1JF1B 3PL6A 4IRJD 5IBTL 3T2NH 4YFLF 3IAQA 5C07D 5FV1L 1KBGH 4KK6C 1J8HB 3HA0A 4KI5F 2UUDK 1UM4H 4NQED 5DC4B 3WIHH 1IEBB 4ONGH 4UT7H 3MBED 1S7RB 3T0WA 1SM3L 2ORBH 5TF0A 3QA3A 4YDKL 1FL5A 2ZUUA 3KVQA 1EVTC 1KTDA 2J8UB 2VWEE 1HYRC 3HI5H 3IDNB 1D5MA 4JGMA 2GK0A 2JLLA 4P59L 4NKMB 5F7HA 1C12A 3O6FD 4LOUC 1FNGA 4R7NA 5D5ME 5K9KA 3G6DH 2PO6B 5BV7B 3E6HA 4ODHH 4PJAA 5CSBA 4QNPE 1QTYT 4AEEA 2P5EB 5F9OH 3FO0H 4JO1L 2EC9U 3VXME 5DJ8B 1XT5A 2K7PA 3GSNB 3QCUL 4MGXA 4GG6A 4Z7NE 3WUWA 1UENA 5F1NA 5EBWB 3MNZB 2V6HA 4J4PA 3DVIA 4YHIA 5JO5B 1U3YA 4DUXA 2JB6B 4UUJA 2DJSA 2D9QB 4JPIA 2OL3B 3WLBB 1DANU 4G6ML 2PTVA 4Y8DC 2DTSA 4JDVA 4GKZB 4PJIE 3FRUA 4C4KT 2YWYA 3EHBD 5DD3H 2R4RH 4N8PA 5I0ZA 3OB8A 5KVDH 1M05B 2NX5E 4JHWH 4LSSL 1TVHA 3T3MF 2BSRB 3BVNB 5LKNA 3HZVA 4M6OH 4N0RA 3TA3D 2N1KA 1MJ7H 1S5HB 1AR1C 2VLRA 5K9JL 2GYSA 3LEVH 3OKEA 1FL3A 3TT1H 2QQLH 1YYLH 5CUSH 3SKNA 1UC6A 1W8OA 3FTGA 3FHAA 3R1GH 4ZAKD 1LP9E 3MJ9H 4HSQA 3I2CL 1G7MB 5LGJB 5FUZL 4QRRE 3VD5A 3T2QA 5GS2D 4LCUA 4K9EC 1N5YH 1GHFH 4B41A 1CICC 4L8DB 4UI2A 5LXGL 3GRWA 2F8OA 4Q0XH 2MFNA 5C6WH 1RZKC 4Z76A 4QRPE 1I1AB 5IW3A 2B2XH 2BRRL 5SX4I 1T5XB 1F13A 2X70B 3ZO0A 3LKPB 3BH9B 3QQ3A 4XBPB 4OZFG 2Y6SC 1UXSB 2PYFB 5GGTA 1AQKL 1DBMH 1CFQB 2XNAB 3AGVA 3VXPA 5DWUH 2XZCL 2NW3B 3MRJA 4WJ5B 3SBWA 5JPNB 2YD4A 3V6ZB 5HYJA 3MLYH 4J12A 4OLEA 4OJFL 4L8BA 4M61A 3BX7C 4X6DF 3VRIB 1D5IL 1WV7T 3FB6A 3RIAK 1TPXB 3RVVC 5B38B 2VLJA 1Z3GL 2BZDA 3GK8L 4KVCH 1RJYB 5FYKE 1GGIH 1I9IL 1W72B 4JHAH 3GSXB 3S4SA 3ARWA 3SJVA 3WS6C 1NDGA 4FP8H 2HVKB 1PQZB 1QSFE 1DLFH 5I66B 2CDGB 4AEHL 1MHPH 5GS3A 5IEKB 1ERNA 5FA3A 2NTFA 4GKSA 5F1IA 3CGTA 5ID0A 2E9WA 1V7NH 3AMLA 4D0BB 3KR3H 4APQB 4IS6B 2XYCA 3V9FA 1HH9A 1OLZA 5JXEC 4EUPH 4YAQA 3MRCA 3SKJH 3WFDH 1FZMB 1MCKA 3DX8A 3ROOA 3OXSB 3PDOA 5FYLE 4ZYKB 4PP1D 4L4TB 5K59E 2X1XR 3BIAX 4R4BB 3BRDA 1I7UA 4PJ5A 3Q1SH 5DK2A 1KF9B 1UKTA 4P23A 4AEFA 2J6EA 1KB5B 4F9LC 3KYOB 1ZT4A 2P8MA 1HI6B 1NUDA 4G6KH 4KXZI 2XWJA 3K81A 3MRGB 3CU1A 1XGYL 4BZ1H 5KVEL 3EOAA 4AENB 2B0SL 1KEML 1RULL 4QHKI 5D2LF 2ADJA 1JGUH 3GI8H 5DK0B 5FDYA 1FNLA 3WN5B 1MQ8A 1H0DB 1QFWL 5DDHA 5ETUA 5C09E 2CLRA 2CIKB 3RX8A 3WLWD 2DIBA 3BI9X 2FJFA 4JRYE 1KCVH 4FTVD 3NACH 4X8JA 5HHOB 3EDJA 2CGRH 3CXHJ 5E6IC 1NGZB 1UJ3A 2XQYG 1A1MA 4MA3A 3VFTA 3QUYB 4KY1H 1RMFL 3H9YA 4QHKJ 4CL7A 2R1WB 3ULVL 5CAYB 2AK1L 3ZE1E 2X89A 4U1JB 4L5FH 1CFSB 4TSBL 4FQCH 5F1SA 5IMLA 4KMLB 4EOWL 3DGCR 4PJBE 5DUMH 4P2QE 4CJ0A 5IBUG 2RFXB 4ZUSB 3RDTA 1T22A 2YA0A 1NFDF 4X83A 4K7FB 3SGEI 3U2SB 5I2IA 4NKOA 4KK9C 1A64A 7FABL 4NJ9H 1NMBH 1JJUA 1JTOA 4Y89A 1YY8A 5D72H 4HJJL 5FHAL 3D48R 4FFYL 5I1EH 1ZLSH 3FRPA 4KK8C 5DQDH 1YNKH 3BGFC 1WFOA 4QXGH 2Y36H 1YECH 3QIBC 3F7PC 1NGWA 3RUGE 3DURB 4PV9A 3L5WB 2H26A 4O4YH 4LF3B 1E4XI 3RIAF 4WHYG 4PRPA 4TSAL 1NC4A 4C83B 5I1GL 4PGZA 3BN3B 1ZT7B 4U1MB 2NZ9D 1INEH 4C56A 5D5MB 1SJXA 5JLZB 4ZD3L 2WY3A 1J0IA 2WBKA 4JFFA 4JFYB 1NCAL 2HFFA 4JRXB 4P9HH 3TZVA 3G04A 4ERSL 3RAJL 3L7FA 3MROB 3FFDB 2W38A 4XPAL 4CBPA 4NO0A 3C6LB 4JZJA 1H3TA 3KLAB 3BYYA 3UAJD 5E5UB 5DXWA 1RZGB 1OPGH 5CBEB 4LBEB 1IGIL 1WF5A 3SDXB 3IFNL 2AW2A 1Q38A 3RZCB 3FO1A 4HPOH 3O2DL 5T5FH 5DQJA 2FECI 4P5MB 3DOSA 1ZHLA 4L9LB 3E6FA 2G5BB 5T1LB 1LILA 3MMEA 4MD4B 3PWVB 4NZDA 2BMKA 4ETQA 1A3LH 3ARFD 4X6FA 1ODAA 3HE7D 2DM2A 4BSWA 1AJ7H 3U4EA 5H8DA 1U9KA 4WDIB 1T80A 4KPHL 5F1KC 3UBXI 3L95B 3ARDA 4LOUD 2VDKL 3QUZA 4PJHF 3PJSB 5E1AB 4OZHA 1YA5A 1EO8H 3GMLB 3DX7B 1T89A 2FH8A 5HGBB 3WNLA 1H8OA 4MNQE 2W1NA 1J0KA 5F96H 2QQKL 3UC0H 3HFMH 1CIUA 4QRRB 1LDSA 4L4VE 1X7QA 5ALCH 4Z95L 3GSVA 4P5TC 1DVFA 1P2CA 1FVCA 3CFEB 2P49B 3OJDB 1FE8H 4X9HA 3HZMB 4QT5B 1KJMA 1G9ML 3LEYH 1MHEA 4UAOB 1KNOA 4BH7A 5I8CA 2DDQH 3CCHA 4I48B 1YEFH 1YDPB 2X1QA 2E7LA 1C8PA 3K8LA 1T2XA 4XWGH 1U8OB 4KZDH 3G5ZB 5DD1H 3BJLA 4Z18A 4NM8L 1OW0A 1IGTB 1NUFA 5E94A 1IAIL 4ONHB 1I8KB 2ZCHH 2R9HD 4Y2DD 1RVFH 4HFWA 1J05B 4GMTL 5E7BA 3MV01 4G8FB 2NY1B 4HUWB 2CD0A 3EO0B 3SO3B 3X3FH 4XTRC 3RY6C 1WSST 3MLWL 3P0GB 1UQSA 3QXDB 2ICCA 3WIFA 4PS4H 1TQBC 3C8DA 1QSFB 3WO4B 4N90E 3D0LA 1Y0LA 4XPFH 5SWQA 1CICD 1EAJA 3PWPE 3WXWH 1QLFA 3F6IA 1N26A 4KUZL 1BZQK 4FZEH 1KCLA 2DLFL 4PRDB 4Z77A 2HAZA 3ALWA 4GKNB 2IANE 1QO3A 4NNPH 5DD6B 3FN0H 4RMQA 5AYQA 2GSIA 3P3YA 5IBTH 5FOBA 2Y6SD 1A4KA 1GRWA 2H2SC 4EUPB 3MXWH 4WO4C 4PJCA 3QAZC 4P3CH 3QQ4B 5F93C 3L6FA 1SM3H 2YBRB 3JWOL 3N06B 4BFIB 5C0DB 2ARJB 2Q3AA 4YDKH 4L3EB 5EFIA 1A9BB 3LQZA 3M17A 1XGPB 1R3LA 2LU3A 2EIEA 3DRQB 4OZFA 3D85A 1DBJL 5EUOB 1PD6A 4NQXA 5SWZB 4P59H 4U1IA 1WICA 4OZGF 2Q1EA 1NGYB 4LSVL 1K4CA 1BIIA 4WEBL 3HPLA 1CGSH 3RVXC 4CN4A 3QCTL 5J11C 1SMAA 5EC2B 3H42L 4JO1H 4D9RD 2YUZA 4G43B 4X6CB 1A7OH 2YD9A 3OKNB 1W0WB 2D03H 4J3OC 5GJSH 4Y16B 1KPVA 4KQ3L 1G7LB 5F9JA 3OKOA 1RV6X 2WNGA 5GIRB 2PKDA 4KRPB 2HVJB 3A0OA 2XOTA 3ELAT 2FLBT 5JHDB 3RU8L 2RB8A 4JRYB 3C5ZB 2KZWA 1A4JA 5C8JA 1NGXA 1MOEA 1YZZA 3AXLB 3B6SB 4ZQKB 5HJ3B 3ILPA 3DVNB 3WKNA 1F4HA 2VNCA 5GGUA 4LRNL 3TNMA 3QDMD 4LSSH 4QGYA 5ANMB 1CD8A 1FIGL 1KN2L 15C8H 3AS0A 2IALA 4P2QB 1PG7L 3RL1B 4Y4FC 1IGCL 1QP1A 3LQAC 5K9JH 3BMVA 3AY4A 1GZQA 2Z8VC 4PTUB 5BS0E 1ZGLM 4PJ8C 1FGNL 3GB7A 2CUMA 4W4OA 5EOTB 2ZUWA 2ZG2A 3I2CH 3KXFD 1BQSA 1AR2A 5FUZH 5JW4M 2HYMA 1EFXD 2A6IA 3BISA 5DT1H 3QQ9D 1HEZB 3MLSH 4JKLA 5IOPB 4LL9A 4TVPE 4XNZB 1EEQA 5D9SB 3RUGB 3ZDXF 1U8QB 3FL7A 1RZIA 1OP5H 4XT1C 2NY2B 4HUVB 4F7CA 5E6ID 1IC1A 2ILLA 4LDLB 2MHAA 3JWDC 5DRXA 5FO7A 2XTJC 4XVUC 4GFTB 5E6YA 4P4RA 5EG6C 5MP6L 4HZAA 3NZHL 1SMOA 4L8CA 3GGWB 1URLA 4J8RA 2DQIL 1HQRA 2QSVA 3O3AB 1FN4A 3AUVA 5GGQL 1T3FB 4OJFH 3TPUA 1RUAL 4NKDB 1HWGB 3MO1B 1D5IH 1X5XA 4PJEA 3GK8H 1I9IH 3CFJA 4XCYB 1T1WA 1B0RA 3L3OB 2X4NB 2LVEA 4P5KA 4G59A 2C1PA 1MIEL 3HE6B 2BNUA 4HG4J 2IADA 3SGKC 4V3EB 1TZIB 3WHXA 4HZLA 4AEHH 2R1YB 3MCG1 4KK8D 5FGBC 4XXDB 4QOKB 3AU1A 2BK8A 2CRMA 4H1LG 3BHBA 4JFOA 1WFNA 3H9SA 3IJHA 1CFNA 1U8HA 2ICEA 2F19L 4ORZC 3UTZA 2R23B 4XZUB 1U3ZA 5EPMA 1TVBA 1AGDB 3T1FA 3KS0H 4JDZB 2A73A 3C60C 5E0QA 1AC0A 1N3NB 4MVBC 4R97B 5MHSD 1K5NB 2Z31B 3I6GA 4I0CC 4CN1A 1NMCC 3PWNB 4PJ9B 3GMMA 1F4WL 4MCZA 3QNYA 1XGQA 4LSDA 5I15L 5CIPH 5D7JB 1XGYH 4HC1L 4I3SL 1SBSL 4ONFL 1PFCA 5KVEH 4U6HA 5M95B 4ODXA 1RULH 1DEEA 2VUYA 3KLHC 4GRWH 2OJEB 3QHZH 2DYPD 3RQ3A 1QFWH 4GBXC 2OSLA 3D39E 3LSOB 5T1KD 4P2OB 3QEQB 1FVEA 1F42A 5DMKB 3T0XA 3DI2B 3EW3B 1H8SA 3B83A 1AP2B 1YUHA 2XKUA 4F7EA 2HP4A 1XIWD 5I1JL 5J06A 1RMFH 4FA8A 5IIEA 3BO8B 3ULVH 4LSPL 5EDXA 4TOYL 1AGEB 2AK1H 2ERJC 3X17A 1XF4A 2A83B 4JKKA 2GT9A 1PAMA 4TSBH 5IK3A 1OP5K 4KTEH 2F53A 2UWEE 3T0EA 3DO7A 3GMQB 3OAUL 2V5YA 3EGSA 4P5TD 3QEHA 2ZNXA 4PJ5E 4XPGL 3QJHA 4MSWB 2W0FA 1LD9A 1Y18A 2GITA 7FABH 2A9ML 4JVPA 4WFEE 3BQUA 3NA9L 4QHUB 4NRYA 3OX8B 4HWBA 5IVXA 5T1MB 1HKLL 2PO6C 4LLMA 4HJJH 1U8IB 5FHAH 5BV7C 5DJDB 4FFYH 1P9MA 2IPKA 4U0RB 3BAEL 2X4SA 1AKJD 3HRZA 1XF5A 4NDMB 1INQB 4KRLB 2RHEA 3S36L 4W6WB 4TSAH 1U42A 5I1GH 4L3CA 4GAGL 1OSPH 1WTGT 3MLVL 3QBTB 4GXVL 1TJGL 1B6DA 3VGAB 3JSSA 1QA9A 4XTRD 1K8IA 1Q94B 2ITCA 5I8EB 4I5BA 5I71B 1N7MH 4C57C 1YMMB 4ZSOE 1IC7L 1XGTA 1NCAH 2BVQA 1WT5A 1EAPA 4PRBA 1BBDH 1B90A 1MHCA 1MI5A 3DGGB 3QDJD 1Z5LA 4QY8A 2PTTA 1IBGL 1SJEB 1Q0XL 1KFAL 4M6ML 3MSPA 3HUJF 1ZLWH 4RMRA 4QEGA 3GSQA 1CLOL 1ES0B 2YEZB 4YGAB 1IGIH 4PD4K 4U6VL 3CZFA 3V95A 3IFNH 4S0SD 5D1XA 4PRHD 2H2SD 2L0DA 3O2DH 1JPSL 2ZPKH 4WO4D 3AREB 4QHMA 4RFEB 2E7HA 1JPFB 5GGSY 5D2NE 5KSAB 4LLWB 3TJEL 4Z8FL 1E0OB 3REWB 4LGPB 1HXMA 4ZOCA 4KPHH 3MV9A 2R15A 2B1AL 4KROD 1QKZL 1HHJB 4G9FA 3IRPX 2VDKH 1PEWA 3JV6B 4K94C 4Z7WA 4EKXA 1UZ8A 1I1AC 2Y72A 5F7EL 3RVXD 4HH8A 3P9LA 1IFHL 1P4LB 1YN6A 4PRPE 1K3ZA 1SEBA 2NY5L 2WWKO 1DUYB 3STZA 4FFEX 2QQKH 2DRUA 3BP6B 4LNVA 1JI1A 3U7WL 4UNUA 4JN1L 3LS4L 4U3XA 4Z95H 4FOMA 2J3SA 1MCFA 5HSFA 3VXRE 4I3GA 1TJHL 2LU4A 2W9DL 3IU3A 4NC2B 1RZ8A 2Y23A 1G9MH 2GFBA 4WWKB 5DHVA 4LK4A 1TPXC 2PR4H 1KIPA 1SJHA 4IRJA 4FQXB 2GSGA 5C07A 3K2UL 3B4NA 3I75A 4NQEA 4XPTL 2I60L 2HFGL 4NM8H 2JCCE 4FXKA 1IAIH 1CIDA 1OB1B 1IM3B 7CGTA 3X11A 4Y4FD 4R7DA 5KG9B 3ARUA 2FJHB 4RQQB 4GMTH 2AJUH 4K3GA 3JV0A 4CRPA 4GSDH 4LVOC 1CDCA 2R69L 3O6FA 3PUCA 2ZNWA 4XBEL 1ORQB 3IDIB 3MLWH 1Z2KA 4MJIE 4AYFA 5E4IA 4X5WA 4Z0XB 4FHBD 3J7HA 4OZHE 5J1TC 1IZKA 3VCLB 1JNHB 2FR4B 2YPKB 3MNVB 4UDUB 2DLFH 5CJXA 1WWWX 5IB1B 3CSYB 4OD3L 3LKNB 3DSFL 1KPUA 4JQIH 3GMPA 3AAZB 2XTJD 4PG2C 1KV3A 4XVUD 1HNFA 1IGJB 1TTUA 1HZHH 1X5YA 4LMQI 3O45B 2H2PC 1CZ8L 1M4KA 3HI1A 3FB8A 1U92B 3S9DB 1V3MA 5CP3A 3JWOH 5I6XB 1BHGA 4QF1A 4MDJA 4KZEL 1ZLWK 2AAVA 1KTKE 3NN8A 1ZSDA 2YPVH 3O3DA 3WN5C 4NKIL 4PY7B 3TGXA 2CUIA 3ZE2F 4LSTL 5HDBF 4X7TA 5HYQA 4LSVH 2DI7A 4LCWE 3P2TA 4LEOB 4ZFFB 3H7LA 1JZ2A 3RIFK 1UCBL 3QCTH 3TESA 1O7VA 1NJ9B 4I0PA 4K7PX 3H42H 4PJGF 25C8L 5E2JA 4ZAKA 1DQJB 2PXYB 3D2UB 3V0VA 2F9BT 3QUYC 4PREB 2VAAA 5TFSH 4HIIA 1IAOB 3ULUE 3IJYB 2VABB 3OL2A 4V1DE 1TZHB 3D39B 1CN4A 4X6DA 4GRWF 3RU8H 1DN0B 1TDQA 4JZNA 4R4ND 4ZUTB 4OGXH 5B39B 2NPLX 1ORSB 1CDJA 2ZUYA 1CK0L 4YHOH 1FNEA 3ARTA 3VFWB 2JK5A 3T2OA 4Y4KB 1IEHA 4H1LA 1ITBB 3MC0A 3C60D 4LRNH 1UEMA 1X5GA 3IDMB 3DJ9A 2X6MA 1XZ0A 1LHZA 4DK3A 3FB7B 1FO0L 1FIGH 3ZKSD 4UMGA 4GW1B 4UDTA 4EVNA 3PNWB 3DETC 5CINL 2SEBA 1PG7H 3MYZA 1T0MB 3W0WA 2FBOJ 5HD8C 3D3VD 1OWRM 3WDHA 2VWEC 1T20A 1BX2B 3KLHD 1P7QD 4CMHB 2J7LA 2JB5L 5ITFB 5IG7B 1CD1B 4UQ2B 3GUTB 4GBXD 5IMKB 1D5XB 5JA9A 5IB4A 3INUH 1D5BB 2BSED 3IXAB 5ENWA 5IEHA 3KJ4B 3H7BA 4MA7L 3V7MA 4Z0BH 3MLZH 5T3ZD 3Q5TA 1I1FB 3QFJB 4IMKA 4KDVA 1EEYA 3ZYJA 4JJ5A 2HKFH 2FX9L 1K8DB 5EBMA 5JA8B 4HQQL 4N5ED 1S7UA 3MLRL 3BDBA 3C6LC 4M1CD 3BSZL 2VO5A 4PRID 5D2LA 5DVKA 5MP6H 1PBYA 3FOLA 2FBJL 3HG1E 3O2WH 3LQMA 3P4NA 4CVUA 3QUML 3RZCC 4ZSOB 3AM8A 3BGAA 3EOYG 1U3HB 5KVGH 2DQIH 3DTXA 4L9LC 1RUAH 2AJXL 3T3PE 2V2TA 2UYLA 1AIFB 4Z78A 3BKYL 3DXAD 4ZXBB 1XCTA 3PG2A 1KIQA 3G08B 4XMLL 4ZMAT 3V6OA 3TFKC 3TF7A 1YN7A 5KW9L 5CZXC 1S7XB 3MGOB 1MIEH 2R2HB 4XPBL 5FECB 3LEXA 1MVUA 4PGDA 1EMTL 4DVBB 4NC1E 3U7AA 3FN3A 4HT1H 4NZJA 4O51B 3VMOA 4D0DA 1MFEH 4LPCA 3PQYE 4HUXB 4ZDHA 1FFPB 2DI8A 4M8VA 3A6CL 3HZYA 3S88L 2F19H 1R0AL 2NYYC 1NFDA 3RWDA 4M62L 4K8RL 1S7SB 3QH3B 3DV4B 4PGJA 4FTVA 5LBSL 2EDXA 1R5WA 3HLAB 5EO0A 5F7WC 3CZJA 5DVLA 3L5JA 3SKMB 4UAOC 1EXUB 1H5BA 1X5HA 4M00A 2A38A 3ET9F 2IJ0C 2X4PA 3IFOB 4KKAC 4XB7A 1OAYH 3HKFA 3IDJA 3DVGA 4N8CH 4WI3A 5F21B 4ELKA 3H3PL 4XVSH 5EOCL 3IS0X 5JORB 4AIXA 1F4WH 1JGVH 5I15H 1AC6A 1O5DT 2HLAA 3VXRB 4HC1H 5I76A 4HKJB 4WU7A 3RI5F 3PDGA 4I3SH 1SBSH 3WIHA 3MUGA 4NUJB 1VADB 4OF7A 3ES6B 1SVZA 1CFTB 1ULVA 4L8SB 5HYEA 1MJUH 2Q7NA 2NY1C 3D6GA 5KS9B 5TGBA 3SO3C 3VDBA 1CL7I 4XCEA 3PP4L 2WBJB 1QFUL 3RVTD 2FATL 3WO4C 4ELMF 2JCCB 1J11A 4NHCL 4UOW0 4OI8A 4MJ6A 4XP5L 4ZNCD 1I1AD 3PGDB 3KYNB 1PYWA 1I7ZB 1EVUA 2P7TB 5I1JH 5CMAA 5GGRB 4WEMB 2G9HA 3MRDB 3EYOA 2AI0H 4LKXA 3SDDB 4DKFH 4G42A 4MJIB 1ZVYA 2CR3A 3TYGL 4OD2A 3H3BC 1CLCA 1KG0B 4JAMB 4YIQB 5K93A 1CCZA 5TQ2L 5KZCD 4FQ1L 1RHHB 4XNUL 3HNVH 4XPGH 2EC9T 4WHDA 4U2ZA 3D18B 4PJHA 2X4QA 4MB3A 2A9MH 4OD1H 3NA9H 1WWCA 4I18B 3I3DA 4OKVB 2P8LB 4ALAL 4PUBL 2NMSA 2ENSA 4YBLB 3EDEA 5F3HA 3LN5B 2CR6A 2DBLH 1KN4L 2OK0L 2V7NB 3BFOA 3BAEH 3C2AH 3DLQR 4MQSB 1DANT 4MD5B 4DCQB 2KUTA 5EU7C 5DHYB 4NRXA 4XRCA 4DUWA 1JUFA 4YNYB 1LE9B 3ARFA 1LNUB 4Y16C 3UJTL 2OTUB 3HE7A 4GAGH 3ZYZA 4KRPC 4EQ2A 3MLVH 1TJGH 4LCWB 4I77L 3GMNB 1CXIA 1PGRB 2BOCA 3ARBB 2X7LA 3C5ZC 2MPAL 4LP4A 5DVOA 1IC7H 4QRQB 2NY0D 4Y5XB 2RAMA 4AT6B 4L4TD 4DGVL 3N50A 5AZEL 5DJ0A 3QUXB 1X44A 1SY6A 5ACZA 5KVMC 4H8WL 1IBGH 3TYFB 4UTBL 1KFAH 4M6MH 3GRWL 3UDWC 5ID1A 4CDHA 3HZKA 2F53E 4TUOB 4U6VH 2APWA 2I26N 2X4OA 2QHRL 1I1CA 2BVOB 2ED9A 3W2DL 2H2PD 3G9VA 1WCQA 1JPSH 3BRGC 1C08B 2IFFL 4D8PB 5F6HI 4HKXB 5GGTL 1O0VA 4Z5RA 4O2CB 2VITB 4J3XA 2Q3ZA 3C87A 3NIDE 4U7MA 1ZHNB 5IVXE 4NT6B 4WWID 3FQXB 2EDJA 2DLTA 2OQJA 4FQJL 4HV8A 4Y2DA 4XNZC 1A14L 3CVHB 1A6ZB 1KJVA 4YDVB 1CXEA 4Y8AA 2CLZA 2D0FA 2WP3O 4F2MA 1XMWA 2H8PA 5HHOD 2NY2C 4BK5A 5CD3A 1IFHH 3MRBA 3QWRD 5JHLL 2NY5H 3BZEA 3QUYD 1A1NA 3HHRB 3U7WH 3BP7A 1KJ2A 4U1GB 3LS4H 3IXTB 1CICA 3SQOH 1LE5A 1BVZA 1QFOA 3VG0L 5TE6L 1HNGA 1TJHH 3EDKA 4OB5L 4OZGA 3TO2A 3C6SB 1A7RH 2P4AB 3IJSA 1MI5E 4XVJL 4K7PL 2BSTB 2W65A 3ZKMC 1R3JA 3N85L 4LHJB 3MRFA 5F3BB 1BQHB 2VTFA 4XPTH 2I60H 3HE6C 5DRZB 3G5VB 3KWWA 1P7HL 4Q2ZA 5C08E 1MFNA 5DD5H 4AH2A 2EO9A 4TVSa 3F12B 3SCMC 2J6EL 3MGTB 5KSVB 5HD8D 4AZ8A 4YHML 1S8DA 2EXYD 1EHXA 4HUNB 1U8PA 1BMGA 2R69H 3U9PL 2Y06L 4XBEH 5F89B 1KPRA 1X4ZA 1OTSC 3ZL4L 3ZLQC 2B39A 4LLAA 5IHZB 2AEWA 1GCFA 5E8EA 2UZIL 32C2A 4JFDE 3DYMA 3IGAA 3PQYB 4G8EA 4JRXD 3VXMD 5FHBL 4CVXA 1IGML 3MXVL 4R97C 3RWGB 3O9WB 4K2UL 4OD3H 3QFDA 4ONOA 3DSFH 2Z31C 2YSSB 3FO2A 4PJ9C 3RNKB 3TBVB 5D7JC 4YXLL 2O5ZL 3MRMB 1CZ8H 4BSJA 5FYKU 1MCNA 3RZCD 5D5MF 4KZEH 1IRAY 3QDMA 4RAUB 1BD2E 4N0FA 4QNPF 4TUJB 4X7DC 2NX5D 1IZJA 4LSTH 5CJ8A 1NEZB 1KJ3L 4P2OC 4X9BA 1JN6A 3MRPA 1A6VL 1EGJA 1VEOA 1TETH 3OR6A 4Z7NF 2BHZA 1AHWB 4NQCE 1UCBH 1JWMB 4Y1AB 5HYFA 2CLVA 4XC3L 3K3QA 4EDWL 3RVUC 25C8H 2FHFA 4G80A 3NCBB 4X80L 4DOHE 4FFZL 4YGVA 3KXFA 2Y5TB 4IOIA 3RJQB 4PGEB 5JNYB 1EFXA 4PJIF 1QFWM 2VXQL 1R3HB 1I4FA 1FDLL 2YPLE 2FIKB 2AERT 1CTOA 4QRRD 2HTKC 5IQ9B 1H15A 2NYYD 1A1OA 1CGUA 5TDNA 4LPXA 4LPWA 5C6TL 1JVKA 3S98A 1CK0H 5E6IA 4QRPD 1BFOA 4X99A 1I8MA 1BLNB 5FK9B 1NGQL 4NHUE 4KKAD 4JM4L 2P24B 3QB7C 3QJFB 1LP9F 4OF3A 5CINH 1U8LA 2VQUA 4U0RC 3LV3B 4UNVA 5HHPB 2F5BL 5B3JE 4X4XA 4XCFH 1S7TA 1AQDB 4XH2B 5DEFB 4ZNEE 3FOMB 5GSVB 5ADPH 1LK2A 4AIOA 3V8CA 5EBGA 3WYRA 1JHTA 3MJ8A 4KV5E 5EIIB 3QDAA 1A02N 3W9EA 3LZFL 5AUMA 2JB5H 5BXFB 3IETA 3VGAC 2NY1D 2BXYA 5FYKD 4Q97A 3ZHLA 4YEEA 4YK4B 1VFMA 5HHME 5I71C 5I17B 1QSFD 3DBXA 1K3IA 4PPTA 2JKXA 2CXKA 3MODL 3WMSA 4LARL 3LH2L 5FOJA 2FX9H 3ZHDA 2EDRA 3ZKQD 1I75A 1ZHKA 1OF2B 1FZJB 3MLRH 3WFZA 1UCTA 4XNMA 5GZNC 3TH4T 3PXHA 2CDEA 3W39B 2APBA 2FBJH 2XWTB 4W6YB 4JFQA 4XI5D 1DBKH 5CILL 3QIWD 3VFSB 1MJJA 1WCBA 2A6JB 2NR6D 5EU5A 1G7IA 2ZUQB 3AREC 5T3XE 3IYLW 5FYLD 5J9PA 3WEXA 2AJXH 1BQUA 4LASH 3KG5A 2ICWI 1MIML 4FXGA 5KSAC 3BKYH 1K9TA 4XMLH 4MNGE 4LNRB 4BM7A 4FQ2L 3OXRA 4Z7VE 1M7IB 2YC1A 4U3CA 2J4WL 3RP1A 3RWHA 5KW9H 4XPBH 3W0WE 4ZPTB 3TO4B 3UPAA 1EMTH 1FYTE 3U4AA 4X6BA 3WJLC 1SYSB 2DYPA 2E7CA 1ONQA 5IW6B 1ZT1B 4Z7UE 3CMOH 5TE4H 1KENL 2IH1B 2GJZA 2ICWJ 5T1KA 3VFOA 3A6CH 2FB4L 5K59F 3OKKB 1R0AH 2MCPL 5C09D 4XWOD 4KRPD 2Q6WA 4M62H 3ZDZE 4K8RH 5EWIL 5LBSH 4QRUA 2NXZD 5J4MA 1UKSA 4JRYD 4ZFOA 4BFGA 4LRIC 1XIWA 4DN4L 1T03H 1C16B 4WWKC 1P5VA 2OZ4A 4FQXC 5DJZA 5I0DA 4S1SL 4UT9L 2CKNA 3H3PH 1R6VA 3CSPA 3ECBB 3MRIB 2R0LL 1OCWL 1RI8A 4P5TA 1ZV5A 2GTZB 4P2QD 3HAEB 4RA3A 4HS6A 3KHOA 5DEGA 2X40A 1Q9KA 1CDIA 2H1PL 3B5HA 4MJ5A 4WUUA 4Y7MA 3W9DA 4FQIL 3LKQB 3FT3B 4P99A 4DW2L 4HBCH 2XPGA 4UTAH 1F02I 5ESVB 5EO1A 4U33A 3N1GC 2HT4C 2RIKA 2MWCA 4UQ3B 2F54B 3C9NA 4HUMB 4X4MA 4HKZB 1E28A 3RNQA 5C08B 3ZE1F 4NHCH 4HK0A 1IAIM 3VFUA 1J86A 4XP5H 1OAUL 2ZKHL 1HQ4A 2AXHA 2EDLA 3KPNA 4PJBF 5DI8A 1UWXH 2NY2D 5DJYA 4UB0L 5KN5B 4J1UA 1JZ8A 4PRAB 4NO2B 3GSOA 5DS8B 2V7HA 2O5YL 1T1YB 5GHWL 3EJYC 4RZCA 3PABA 4J2XA 3TIEB 3MX0A 3TYGH 4NQVB 1S9XA 2IBBA 1NFKA 4TVPH 1Q0YL 4JFDB 5F97E 4AL8L 1KLFA 3MR9A 4XNUH 5I6XC 1D3CA 3HNSL 4M3JA 4N8VA 3QDJA 5GRWA 5BOZG 5J57B 5IR1A 1DJSA 2DN7A 3UTQB 4OM1L 2HN7B 3RUGF 1U8JB 4LP5A 4ALAH 1IKNC 4PUBH 2R0WL 3BKJH 4PRHA 4OZ4A 4WHTA 2ADIA 4G6FB 4F80A 1T0NB 3CPLB 1KN4H 4WO4A 4XBGA 5GRYA 2OK0H 1HWHB 2PXYC 3P30L 4YXKL 3CXDL 1AXSA 1BD2B 3OHXA 1FLTX 2HJFA 3PF2A 2AV1A 2YD1A 5JDSA 3SCMD 3UJTH 5INDB 3KPTA 2IF7A 5CEXA 3L3HB 4PG9B 3F7RA 3MCLL 1S7QB 3AC0A 4HBQA 4UU9B 4EXKA 4DQOL 4I77H 4FABH 2IAMB 4M03A 5F7YC 3QULB 3S97C 4H26A 2MPAH 2RJMA 1FFOB 3PE9A 4QRTB 4JFHE 3LAFA 1CG9A 3GEWB 3EJZC 5JPMB 1IARB 2DQTL 3L1OL 3O4LE 4WFGD 1F58L 5ERWA 3CJJA 4Y4KC 4MNQD 3M1BA 5AZEH 4LLUA 4H8WH 5E6ZA 3UJJL 5F9WB 4JCMA 4UTBH 1EZVX 5ICYA 1MHHB 4GG8A 3U6RB 3GRWH 4OCNC 3NAAH 1GOFA 4L4VD 3VFMB 4Y4HB 1HHIA 4YHZL 5D7JD 2QHRH 2NXYB 4MNHA 1WAAA 3MJ6A 3PGCB 3TJHD 3U7YL 1FNAA 3HS0B 4M1GH 5JW4R 5CBAA 1S9VA 3EFFB 3QHFL 2EEDA 1BP3B 4BELD 3N1FC 2HLFC 2VZSA 4HXAL 1G84A 4CMHC 5HYSB 4NHUB 2Z4QB 2HFEA 4BK4A 3PIQA 3KPRA 5CGYC 5E24E 4HIEB 3CFCL 1I1YB 1IAMA 1FRGL 2VXTH 5ECJE 1MCWM 3SEPA 1FO0B 3KJ4C 4FQJH 4Y4FA 3P4MB 5SV3A 1A14H 3QEQD 4PV8B 3RWEB 4HLZH 1W0VB 2PCPB 2W0PA 1I9RL 4PJ8A 2UY7A 4YQXL 2XZQL 2OTWB 3EYUL 5D1ZD 5FDWB 3RTQD 4FQQB 1VEPA 5JHLH 3NCJL 3DMMB 4EI5B 1I9EA 1MRDL 3S37L 1WBYA 2PW1A 4LVEA 2C26A 4U1NA 1YY9C 4N90D 1UWXK 3VG0H 1JWUB 1U3HC 4M7JL 5TE6H 2HTKD 4Z7QE 2C3VA 1Q9OA 4OB5H 3PWPD 4GUPA 4KJYB 4NO5B 5HGDA 4PP2A 2EKJA 4GRLB 2Y1VA 3CFBB 4XVJH 2ZJSL 4CUCA 4K7PH 4ZXBC 1TNNA 5CEYB 3O6ML 1F8TL 2IAND 3N85H 4PJGA 5IB3B 5C0IB 2R39A 1GOHA 3EIFA 5CIPA 3BE1H 4X0KA 1HK6A 1YJDC 3HC0A 3BPCA 5D7IB 1FFNB 3QUMB 4PJXE 2J6EH 2J88L 4YHMH 5D2NC 3CUPB 2H6PB 5J6HA 3OKYA 1QQDA 4XMKH 3IS1X 4WW1A 4MAYB 4PBVC 1JHLL 4Z7VB 3HR5A 1JNNL 1I7RA 3VWJB 1QOKA 1AXTL 4WNQB 2UVFA 3OG4B 2UZIH 4L9DA 3SGKA 1KLGA 4OCXL 1FYTB 1TNMA 4TUKL 5FGBA 1QLEL 2Q76B 3IFLL 1NUNB 2Z0BA 5FHBH 5JIIA 3P4OA 4W6XB 4Z7UB 1IGMH 2AQ1A 1TENA 2OJZL 3TT3L 4K2UH 2ZSWA 5INCA 3JV4B 4NRZA 1HDMB 1DTUA 1TMCA 4XHQA 4PD4J 4X98A 5CLTA 4YXLH 1QFWI 3OTTA 2AJZA 5IHLB 5JW4N 5B8CB 5C2UB 4WTXA 1A2YB 5F7DB 3CIQA 1ROWA 4YHLL 2DIAA 4L8SC 4Q74A 3C60A 1IEAA 2AK4E 2IGFL 4JN2B 3I9GH 3B2UC 3D9AH 4MB4A 2VZOA 4MVBA 3KNBA 1NEUA 2CDFA 4OF6A 1MELA 3RWCA 2VLKB 2JIXB 2X44D 5KSAD 2WBJC 5FEBA 4POYA 3KHQA 4HWUA 1A6VH 4O9HL 2WINA 1V7ML 3D3VA 3MACL 3CFDB 4LHUB 3T4YA 4XC3H 4EDWH 5BS0D 4ZS7L 1JZ4A 2H3NA 2P5WA 2GTWA 1P7QA 4FFZH 4X80H 2VISA 4WI4A 4GBXA 4HWBL 3EO1A 3SDDC 1R24B 1FDLH 1MUJA 3IKCA 1T83C 2EDDA 4M93B 1BEYL 4FRWA 5I1IL 3FFCB 1YEIL 3BZFA 3LRSA 5C6TH 4TVPD 5B4MC 1LO4L 1IAKB 1WC7A 1DQDH 1PKOA 4MLSA 3ARYA 2R0KL 3MLXL 3C09C 2EYTA 5F9AC 4GRMA 4WWKD 4MLIA 1QBML 1UWGL 4I18C 4PRIA 5DFVC 1NGQH 5A2FA 3W5MA 1JF1A 1V3KA 4JM4H 5CCKH 3B9KB 4YBLC 1E6OL 2WQ8A 2HFTA 1J8HA 3BN9C 1BOGB 4PJAB 4X8XA 1IEBA 1S7RA 4DK6A 4IDJL 4UIMB 4WVRA 4DKEL 8FABB 3IDNA 3BDXA 4HWNA 3LZFH 5DZNA 1SBBA 1NFIB 3V5DB 2DWEB 3CH1B 3ARBC 4G9DB 4GH7B 2YXMA 5C0JB 1V3LA 4Q9RL 2HH0H 3B5TA 5E4EC 4Y5XC 4LARH 3LH2H 1FNHA 4NBZB 5GGRY 3KXFE 1R5VB 5DJ8A 1NC2B 3GSNA 3QUXC 2Z9TA 3DYOA 2X42A 1TVHB 2VZ1A 2BXZA 4HULB 5E2UL 4K3DL 5EBWA 3MNZA 2A9NL 4GQ9L 3VE0B 5JO5A 1NUGA 1DUZA 2JB6A 3OGOE 2PYEB 3U83A 2EYRB 3EJYD 2OL3A 3WLBA 5CILH 1GC1C 3LS5L 4GKZA 3O4LB 4G7VL 1A5FH 3SKNB 4YXHL 1U58A 4OZIE 4ELMA 1X5ZA 4HGKC 1MIMH 2BSRA 3BVNA 3VI3E 1B6UA 4FQ2H 4UOW1 3QXAA 5BZWB 1S5HA 1OAQL 2J4WH 3O81A 1U8MA 1BF8A 4OV5B 5JZ7C 4L1HA 3M8OH 1SVCP 3N1PC 4RMVA 5HXMA 2PXYD 4P48A 4KKLC 1KENH 1MRCL 1ZWIB 2FB4H 4U1GC 3U30B 1F4XL 5I74B 4LU5H 4DN3H 1MRFH 5KSBE 2FZ3A 5L9DL 4L8DA 3D39D 1HINH 5EWIH 2VN4A 3VXPB 3X14B 1DQML 3P0VL 1FG2B 1Z0NA 4UT6L 1M7DB 1I1AA 1XR9B 3KPQA 3S3JA 1S78C 2V2WA 4M61B 4S1DC 3EJZD 1IAII 3ULUH 3LKPA 3BH9A 4XBPA 3BP5A 1QRNE 2VLJB 1UXSA 1JF5A 2PYFA 4Y4KD 4WV1C 3QO0B 4S1SH 3RKDC 4UT9H 4YWGL 3S4SB 5HI3D 3K1KC 1DBAL 4LPYA 2R0LH 1OCWH 4MX7A 4XVTH 4WJ5A 2VL5A 2NW3A 4WTZG 1X6NA 3V6ZA 1QSEE 1UH4A 2H1PH 5DF0A 3NTCH 5EO9B 2NTFB 4FQIH 1F97A 4PJ5D 4GKSB 4TYUA 4UV7L 3FT4B 2P45B 4DW2H 3HMWL 3H8NA 3VXTA 1NAMB 2HLFD 5JTWA 4WFED 4NKQB 3GSXA 4ZUUB 2DD8L 2HVKA 1IKFH 4MJ2A 5EZIL 3MRCB 1PQZA 2QV2A 3QCVH 3L3JB 2EE2A 5I66A 2YD2A 4NC1C 3RVWD 4ZS6D 3QG7L 3CLFL 4Z6AT 1OAUH 1CT8B 2ZKHH 1I7UB 1VB9A 4OZFH 5LCVL 4NN7B 2UWEF 3LD8B 2YOCA 3O9WC 3V4UH 4JG1L 2BC4B 2D2OA 1MCBA 4DTGL 5F88A 4D0BA 4UB0H 4HIHA 3SKOB 1ZT4B 4IS6A 1NCBH 2O5YH 2CKBB 5GHWH 5C7XL 5FM4A 5FYJD 1FJ1B 43CAB 1EJOH 3EYFB 4XGZB 5A2JH 1VHPA 2AKRB 4AL8H 3OXSA 4ZYKA 1YY9D 3JUYA 2V9QA 4L4TA 4R4BA 2BCKB 2ADJB 5CFHA 1UM5H 2D9CA 4YLQT 5DMIL 1KB5A 4OM1H 3KYOA 5DDHB 4NO3B 4HJ0C 3QG6A 1MFAL 4ZXBD 4IOSD 3Q2CA 2R0WH 3K0WA 3MRGA 4PG2A 1N2RB 1AHWC 1H3UA 4AENA 4HCRA 2X9WA 1UXWA 2DS4A 1N0LA 5GJTL 1YYMH 4WUUE 4YXKH 3FQTB 1QPXA 2AK4B 3WKML 3WN5A 4PYGA 3UROR 3WE6A 4TQEL 5J0BA 1H0DA 3P9MB 1OTTC 3O3BB 3LKRB 4HUUB 3CX5J 4WCYL 2CIKA 5E70A 3MCLH 1WZKA 5IMLB 4X4ME 4DQOH 4YEFA 5E8DL 4FQHB 1PY9A 4HF5L 3SGDH 3K8KA 5HHOA 4RISL 1YEHL 2YHGA 1T22B 1NGZA 3L1OH 3QWRA 1HHHB 1F58H 3QEUA 2VYRE 2O93L 2XI9A 5FM5M 3BESR 3QUYA 3WJJC 4NJAL 4PRPD 1NC4D 4KMQA 2A77L 1L7IL 3EBAA 4OKDA 4U1JA 4F57H 1CFSA 2VDQH 1V8HA 2AGJL 1HIML 2CJUL 2VLLB 3ARVA 2YKLH 2RFXA 4OCYL 3VXRD 3WUZA 3AFLA 3U7YH 1NGWB 2LAAA 5CJ5A 2LFGA 2H26B 4K7FA 3QHFH 3U2SA 2VXUL 1T2QL 4U7KA 5JMOC 4XB8A 3B2UD 3F6LA 4YUEL 4YE4L 4YK4C 4CNIA 1YEGL 4YDIL 1GIGL 1FRGH 4BUHA 1XR8B 4LCYB 1LGVA 2DB8A 1BFVL 3DURA 1JYNA 1I9RH 3L5WA 4YQXH 2FGZA 4PB0H 1J5OL 1D7FA 3EYUH 4YC2B 3S5LG 3L7FB 4QLRA 5F7NC 3VG9B 5BJTA 3BPLB 1C5BH 4C83A 1N5AA 4XHJD 3NCJH 3UBXB 1ZT7A 4U1MA 3SE4C 1CF8L 2X9XA 1QSVA 1MRDH 5D5MA 3S37H 5JLZA 3NBNA 3SDDD 1GAFL 4MJID 4QRSB 5DQ9B 1KXQE 4M7JH 4H20L 4JRXA 3VXMA 4EDXA 2ZUQC 4N0UE 1D6EA 5KBNC 4WW2B 5DQJB 1ZHLB 3MROA 3FFDA 4QKXB 5C0AE 2JCCF 5B4MD 2BFVL 4JB9H 3C6LA 4W4NA 3KLAA 3MPCA 2K3TA 1MCPL 1RZGA 4XP1L 5CBEA 3U4EB 5C0GB 4FFVC 3I85A 1PW3A 3SDXA 3MRHB 2XQBL 1IMHC 3QUZB 5KTEL 1WAAE 5DRWB 3TO4C 4JQXC 3RZCA 3FQRB 4PJIA 3BN9D 5C2BL 2O61B 3UJIL 4LSUL 2OI9A 4WHYH 4M8QA 3OJ2C 4OZIB 4L9LA 2IBZX 2G5BA 2J88H 2NX5A 4OZHF 4HEPG 4MD4A 4S1QL 3PWVA 1Y6KR 3OGCB 3S7GA 3KPRE 2FX8L 1JHLH 1KBGL 3EYVB 4B0MM 1U8KB 1F6AB 3WIHL 4R0LB 4UT7L 1J0HA 3L95A 4LCWD 4PYHA 3PJSA 1AXTH 5E1AA 3QZWG 3DX7A 2R2CA 3ARBD 4OCXH 4TUKH 1VEMA 1QLEH 5GS0C 1BWWA 3TT3H 3UYPA 3VXUE 3ULUD 1C5DB 4QRRA 3F65A 4V1DD 5KSBB 3ZZ1A 1AD9B 4NUGH 2KL6A 3P77A 2FJGB 1UM6H 5F9OL 3CFEA 3NGBC 3OJDA 4OIBA 4P2CG 4QRPA 3HZMA 4YBHA 4LKCB 3MYJA 4HFWB 3ZYIA 4YHLH 4RGNE 2HG5A 2IGFH 2JJVA 4I48A 3NFNA 1YDPA 4MXVE 5DURD 5I16B 1KEGH 1UT9A 1U8OA 3SN6N 3G5ZA 4B50A 4LFHD 1KGCD 3ULUF 1IGTA 4U6TA 4NYLB 5SWQB 1V7MH 1I8KA 3MACH 1QSEB 4WFFE 1FP5A 4NFCA 2ZUTA 1J05A 4DWHA 5JZ7D 4Z77B 3BW9B 4G8FA 4CVWA 2XT1B 4HUWA 1QBBA 3EO0A 4HWBH 4JFXA 1U41A 3QXDA 1BREA 1QSFA 2X1PA 1BEYH 4MDIA 1F4YH 5I1IH 3K4DA 1WFUA 4PJCB 1YEIH 1SHMA 2C7UB 3QPXH 3Q5YA 2GKIA 1LO4H 5I30H 5GGVH 4GKNA 2R0KH 3MLXH 1YEDA 4OZFB 3WO3B 4LCIL 1S78D 4S1DD 1ZA3A 5DD6A 5IV2B 1QBMH 1UWGH 5I19H 1GHFL 3SDYL 2YD6A 4Q0XL 4Y19B 1E6OH 1K4CB 1BIIB 3QIWA 1J12A 3RKDD 9CGTA 1CU4H 2WIIB 1F11B 2RR3A 3HG1D 1QBAA 5GQBA 3QQ4A 5C0DA 4BFIA 2YBRA 1JV5B 3F7YB 2B2XL 2FO1A 3FO9A 4L3EA 4IDJH 2KPNA 3FHQA 3ULSB 1XGPA 1SY6L 2MOVA 3DRQA 5E8OB 5E08L 3T8XA 3OKOB 5IB2B 1HHKB 1NGYA 4E0RB 2IAMC 4BSVB 1A4JB 1NGXB 4Q9RH 1NCDH 5ABDE 3RFZC 2Z92B 4G43A 4X6CA 3ILPB 2P5WE 2VDOL 1W0WA 3GMOA 5EU6E 3CFIC 3PQYD 4ODUB 4Y16A 3WUWG 1G7LA 1BGXL 4PLKD 5DUBA 1GGIL 5HPMA 1P6AB 5F9WC 5C09A 4JHAL 3O9WD 5GIRA 4K3DH 5J1AB 2A9NH 3K7UA 4FP8L 4GQ9H 2HVJA 2A74B 1J10A 4I0KA 1O7SA 4MJ4A 5HI4D 3T3PF 3TBTB 5EZOL 4JRYA 5EBLB 3ARXA 2NXYC 4RFOL 1DCLA 3KAAA 1MCQA 3AXLA 3LS5H 3B6SA 4ZQKA 5HJ3A 3DVNA 1ZXQA 1IJ9A 4YXHH 2PF6A 4P2RB 4PJ7E 3QEGH 1QFPA 5TPWL 2D7PA 3TV3L 4X7CC 2P42B 1KJ2L 1MCDA 1QFHA 4S1RL 3SKJL 3UDWA 1J8HE 5F44A 3B9VA 4HJ0D 4P2QA 3RL1A 3TM6A 4P46B 1Y6MR 1TFHA 4FS0A 4PTUA 1JFQH 5JDJA 3Q1SL 5DHVH 5GISL 5FO9B 1Q8MA 2AJ3B 5EOTA 2J8UE 2VDRH 5FKAB 3T0BA 3E2HA 2D7QA 3ZT6A 4AIZB 3DMMC 1JGEA 2RBLA 3JTTB 3UEZA 4EI5C 2DF3A 4G6KL 1MRCH 4P4RB 3QDHA 2VSCA 1F4XH 2V9TA 1OTTD 2Q7YA 5LJYH 4NQUA 2I25N 5LVEA 2NY4B 1HEZA 4L8CB 1DQMH 4KUCD 4WFHE 2P5EE 4J8RB 5D9SA 1CQKA 3A6BL 3RUGA 1U8QA 4UT6H 1LO0H 5CGTA 5IBLC 1JGUL 4HUVA 1FBIL 1AGFB 3ARSA 4EI6B 1DP0A 3L7EB 1S9WB 5DC0A 1QD0A 1T1WB 3V7AG 5C71A 3VRJA 1IQWL 3GGWA 1DBAH 3BPOB 5IBUB 3O6KH 5CP7B 2CGRL 3I6LE 2YUVA 4HZLB 4YX2L 4HK3J 4N0UB 3O3AA 3QUKB 5FA4B 3BUYA 3PWJB 4NFBA 2VR5A 3GSWB 4KUCF 4WRLA 4UV7H 3GHBL 3BHBB 4HFUH 5TE7L 5HDQL 5D1QB 1VA9A 4MAYC 4L5FL 4NBXB 3IJHB 1Z9OA 4A6YH 4XCYA 3L3OA 2Y7QB 2Z8WC 1GH7A 2HT2D 2X4NA 3QR2A 3UTZB 3VWJC 5EZIH 5CEZE 1U8NA 3HE6A 1G7HA 4O58L 4O2FB 3CVIL 2GK2A 5IMOA 3MREA 5CP3H 5SWSE 1TZIA 4RMSA 2R1YA 3QRGL 4TRPL 3U4BL 2NQCA 1RUMH 4XXDA 4CVZB 3CLFH 4N0YL 1OWWA 3SCMA 3EOBA 5LCVH 1T66C 4YHPB 5KAQF 2CMRL 4JG1H 5IGXH 1U2HA 4DTGH 5FCUL 3EKCA 2NNAB 2XN9E 4ZO8A 3BKML 1EGJL 1DBBH 4MCZB 4XP6H 2R23A 1WVZA 5DQDL 4UILL 5C7XH 4JM2B 1YC8A 4QXGL 2Y36L 4XZUA 3WD5L 1YECL 2E6PA 1B3JA 5B8CC 4U6HB 1AGDA 2LV4A 4L1DA 1NAKL 1HYSD 3ALXA 4MNQA 4JDZA 3Q5OA 5I8KL 2WV3A 5DMIH 5GS2H 4MQ7B 2KQMA 3X12B 1T6WA 1S9KC 2Z31A 3UO1L 3PWNA 1WBZB 1MFAH 4JO2L 4CMMB 5D7JA 1JPST 3TJHA 4KI1A 1FFRA 2D0HA 2F53D 4PR5B 4P9HL 3GKZA 2AV7A 1A6WL 3VFNB 3TO4D 4RGNB 2UUDH 1JYVA 4H1LH 2OJEA 3RJDA 3WKMH 2EYSA 1G6RH 2IPTL 4TQEH 3IAGC 1OPGL 1OAZL 3LB6C 4WCYH 5FO8B 3LSOA 1BM3L 5IK3B 4M93C 3MA9L 4P2OA 1G9NC 3QEQA 4DVRH 2XKNB 2EDHA 4HPOL 1IQDB 2AXJA 5E8DH 5DMKA 4HF5H 1T7ZA 3DARA 3JTCA 3EGSB 2B20A 4RISH 1YEHH 1ACZA 3QEHB 1AP2A 3CDYA 1S3KL 1LD9B 3X13B 4NJAH 2GITB 4HGWA 2XZZA 4JY6B 1NLBL 1JK8B 1F4AA 2A77H 4I3RH 4NRYB 3RX7A 2A83A 1N64L 3B9KC 4MXWH 5L8LB 3E3QE 2EXWC 1JGLL 1HIMH 1A9EB 2Y4SA 2CJUH 3GMQA 1R5IB 3NIDF 3PHQA 4OGYH 5IVXF 5IESH 1RZJH 4NWUL 4POZC 1RJLA 4MSWA 5HHQB 1MQKL 2VXUH 5C0CE 1AGBB 3UC0L 2IANA 1MI5D 1T2QH 4E5XB 1W8NA 1G9EA 2V5RA 1DSFL 3OX8A 4YUEH 2A1WL 1ADQA 2ATPB 4YE4H 5FUCC 3DIFB 1KTLB 1YEGH 4KDTA 4YDIH 1GIGH 3RGVB 5DJDA 5CLWA 5DJAB 4I5BB 1DLHB 1HSAB 3LEYL 1BFVH 4OFIA 4B7LA 2IEPA 5C08D 3H9HA 4PRBB 1INQA 1BJMA 5DEZA 2PTUA 2KDGA 4LIQE 5A43C 4DFIA 2UZXB 3PHOA 4XWGL 2AXFA 1CF8H 1BF2A 1NBYA 2AVGA 2VXSL 4HIJA 5EN2B 1WISA 1Q94A 5I8EA 4CW1B 4JZOA 3TVMD 1YMMA 3PWUB 5HHOE 1RIHL 2MQ0A 4MYWB 1V05A 4JFDD 1KCGC 5JIKA 4NNXB 1HH6B 1LEGB 3DGGA 1OGTB 4N1CA 5F70A 5FM5O 3CDGA 1RAMA 1MCPH 5MEQA 4PS4L 4XP1H 5HGAB 1QEWB 5M7QA 4D0CB 1ES0A 1Q9WB 2YEZA 5HHVL 4XPFL 3GJFB 1RUPL 4OLVL 3WXWL 4G9FB 2XQBH 2Z91B 4ZFOL 4Z7WB 2EEBA 1NKRA 1JZ5A 4G6FD 1PJ9A 2HT3C 1MNUH 4LSUH 4E41B 2OZ4L 4PJ7B 3IDGB 4RFEA 2ADGA 1JPFA 4S1QH 5KSAA 4QYOA 1BD2D 1DE4B 2R56L 3U30C 1BJ1H 5I74C 2FX8H 1CLYL 4ZTPL 1FV1B 4L4JA 3T0AA 2FRGP 3MXWL 5AAMA 2HKHL 2YZ1A 2BP3A 1RUQL 4LSRL 3D25B 4P3CL 3JV6A 3SBWC 5BS0A 5CZVL 1MFCL 5GS1B 4NQCD 2NLJB 3L3GB 1HCVA 2GFBB 4HDIB 1P4LA 3OJVC 3HNTH 4GXUM 1ZTXL 5F71A 2QLVB 1KIPB 3LRHA 4IRJB 4XNXL 5GGSB 1FC2D 1GYAA 2GSGB 1FC1A 5ELIA 1FPTL 1CWVA 1A6UL 3IF1B 3N9GL 4C4KO 5MEOB 2YPLD 1CGSL 3MBEB 2VR9A 1RZFL 2KH2B 3IFPB 3U9UB 4JRXE 5ESAB 4D9LL 1A7OL 1EO5A 2NXYD 5EOCJ 3SY0B 2HJKA 4NGHH 2D03L 3O6LL 5I1AA 3KPOB 4WWKA 1HN1A 5GJSL 5H2BB 4TPRL 4KJQC 2FEEI 2GY5A 4FQXA 3H9ZA 5D7KD 4R3SB 3O6FB 2BVPA 3HPJB 2EZ0D 1X6LA 3SDXE 4X5WB 2KBGA 3MLTB 1OB1A 5B22A 1IM3A 1PSKL 5KG9A 2FJHA 3VXSE 1GSMA 4RQQA 4NN7C 3LD8C 4DGIH 4POUB 3IDIA 4NNYB 2VR4A 15C8L 3H0TB 3GMRB 1NPUA 4EI5D 5IFHL 4Z0XA 4AK1A 5SWSB 5IQ7L 1SYVB 1ZGLB 5HHMD 3VCLA 1JNHA 2YPKA 3MNVA 4UDUA 4I0PD 1RIVL 4LPTA 1WGOA 5EORL 5IVZB 3QO1B 5MI0B 2AJSL 3O3DB 5IBLD 5IB1A 5IJVB 3CSYA 5B3JF 1II4E 3LKNA 1A6AB 4LCIH 3TA3B 5IFAL 2XN9B 3AAZA 3WDJA 4P3DA 4LFHG 5DT1L 5HYQB 2L7UA 3GBLA 3SDYH 1IGJA 3MLSL 3RBSA 4KV5F 1U92A 2OR7A 1J87A 4B53A 5D71H 1P53A 4RNRB 1ZMYA 5T3XD 2CUHA 1MWAB 3V0VB 1SY6H 2XWBB 4K7PY 4PY7A 1WIOA 3TWCL 3UTSE 3EAKA 1NBZB 3EJJX 5E08H 4RRPG 3S34H 5D4QA 4LEXL 4JFEE 1ZEAL 4MAYD 3FQWB 1IKNA 2CRIA 4LEOA 4ZFFA 1VACA 1U93A 1JBJA 3VWJD 3W0WD 4JVUA 3VFVA 1NJ9A 3I6KB 1EIBA 4HX1B 2FDBP 1DQJA 2PXYA 4H88H 5KANG 4LLDA 5JXAH 1FYTD 3MFFB 2VDOH 4PREA 3HRPA 3GJEA 1TVDA 3GBML 5HGHB 1IAOA 3IJYA 5FKPB 2A6KB 1BGXH 1MCCA 1J9CT 3SGJC 1P6FA 2ZUSA 1Q9LA 3D39A 3W82A 4N9OB 6CGTA 2LABA 3REVB 5E8NA 1DN0A 2SEBB 3H2WA 5EZOH 3VRLE 1EUUA 4BQ9A 4RFOH 4ZUTA 2GIYA 5B39A 1ORSA 1F3RB 4Z7VF 3VFWA 4ZO7A 5DO2D 4Y4KA 1UKQA 4R96B 4U1HB 5TPWH 3IDMA 5DVNA 3TV3H 1KJ2H 2EDOA 4OCSL 3GFUA 4S1RH 3FB7A 4K9EH 1UB6A 3EYQC 4GW1A 2E7MA 2VLKD 3PNWA 5EC1B 2JIXD 2UWEA 3F5WB 4Z7UF 4DZBB 2M8XA 1T0MA 3H7BB 1RZKH 3WBDA 5C3LD 1QYGL 1AO7E 3DRTA 4L3EE 1RU9L 4QHLB 1RJCA 3NH7L 5DSCA 4YC2C 5GISH 3ZDZF 1OARL 2OXHA 2WUBL 1BX2A 3VG9C 3N0PB 3JWDL 5C0CB 3BPLC 5EUOE 1UB5B 5SWZE 5IG7A 1CD1A 5HPOA 4UQ2A 3GUTA 4HJGB 2NTSP 5IMKA 1D5XA 3LB6D 1D5BA 4LGSB 3IXAA 2D0GA 3Q6FB 2MSPA 3DWTA 1I1FA 4LVNB 1ITCA 3A6BH 2ZCKL 4X6CE 4WW2C 4XNYL 1IM9B 3DTXB 1MJ8H 4NQSA 5EU7E 4HD9A 3QHZL 4URTB 4HH9B 1PX3A 1FBIH 2MQCA 5JW5A 4P57B 4Z78B 4O00A 3HCVB 4CDGC 4M43L 5JHDE 4U6YB 1P7KB 3B9KD 1IQWH 3QUZC 5GRVL 4ZSOA 5HHNB 5L2JB 2EXWD 4YX2H 3O3UN 1CGWA 3DHMA 3KLDA 4D0DB 1X9QA 3KPSE 2JJTC 1WWBX 3V2AR 2J1KA 1EHNA 4ZDHB 1J0YA 4F58L 3GHBH 4ZXBA 5TE7H 5HDQH 5ANME 3G08A 3VGBA 3MOAL 4XX1E 4XAKE 4KTEL 4CJ1A 3U79A 1F2XK 1N4XL 3RWDB 3SE8L 4R0LC 3MGOA 2R2HA 1L9MA 4FTVB 1K2DB 4O58H 3VXQB 5FECA 3CVIH 3CK0L 3DUSB 4NZUH 2DMBA 4UINL 4DVBA 3BWAA 1WTLA 4Q6YA 5EO0B 4O51A 3QRGH 3CXHK 4TRPH 3U4BH 4N0YH 3K2MC 4HUXA 5F7LB 2CMRH 5D2NA 4ODVL 4X7EC 1VDGA 3ILQC 2E7LC 1NC2D 3F58H 5FCUH 3IDJB 3B5GA 3DVGB 1LDPH 1WUNT 3BKMH 1EGJH 1S7SA 3QH3A 1ED3B 3DV4A 1T5WB 3K46A 4UILH 5KAQG 3BZ4B 3GIZH 5DJCB 5I76B 1VKXB 3WD5H 4U2YA 2PYED 1H3GA 1NAKH 4JFHD 3SKMA 1EA9C 3O4LD 3R0NA 1RPQA 1OSPL 5I8KH 3IFOA 3L3IA 3NPSB 4L29B 5HBBA 3UO1H 5T3ZL 4JO2H 1FHGA 5IB5B 2CH8A 1W0YT 1N7ML 3VXRA 1EH9A 1S9YA 2V17H 3DNKA 5SX5H 1JRHL 3ZDYE 2H9GA 1A6WH 1BBDL 4J3VA 3UTOA 1CFTA 4L8SA 1X5FA 3JUZA 2HT3D 1I3VA 4CN6A 1X3DA 2ZCLL 4IHOB 2IPTH 5E9DE 3T4AB 3ZKNC 5KS9A 5EIQA 1DDHB 5MENE 1OAZH 4G42B 5IMMB 1BM3H 5IM7B 4JDTL 3MA9H 1J0ZA 2JCCA 1ZANL 4KK6D 5DRNB 3QT2A 2ZPKL 4JLRB 1FSKB 3ARRA 4XAWH 3VXSB 3PGDA 1C7SA 1S3KH 3KYNA 4QOKE 4PP8C 1I7ZA 2E5EA 2P7TA 4PJHB 3IDUA 1NLBH 1UH2A 3TN0B 2QR0A 4GMSL 3SDDA 4OGZA 1FH5L 1N64H 4MJIA 2BRQA 5J56B 4OBSA 1KIUA 1T83A 4MQXC 1KG0A 5A40E 1JGLH 4WFGE 1N8ZB 1RHHA 1F6LL 4OGAC 1DN2A 3AROA 4NWUH 4X7FC 1QR1B 2AQ3A 4BQBA 3GSNL 4NRXB 4XRCB 4LGRB 2EECA 2OCFD 1FZOB 1MQKH 1ZGLP 3ARFB 3D18A 5BOPA 1ETZA 4HMDA 3HE7B 5CJBA 4MAUH 4KJQD 3OZ9L 4I18A 1DSFH 4OKVA 2P8LA 2A1WH 2OL3L 4F9PC 2N7BA 4ZTOL 4IDLA 2BOCB 3LN5A 3JBG7 4MWFB 2V7NA 4DCQA 1U0QA 2DQCL 5KVFL 2YXFA 5DHYA 2XY1A 3MZGB 3VFRB 2PR4L 4YNYA 1LE9A 4IIQB 3UTSB 1LNUA 3G5YB 2OTUA 4Z7QF 1UH3A 5ESQA 3TBYB 5FB8B 4F7TB 2I07B 4JFEB 2MCG1 2ZWLT 3BP4A 3MLUL 2LVCA 2VXSH 4LCWA 2CK0H 3QEQE 3GMNA 3VXNB 3ARBA 1AR1D 3ZMRA 4CU6A 2X4OB 4HXBH 1QACA 5TQ0L 1BZ9B 3HAEG 2AEIT 4OUUB 4QRQA 1RIHH 4Y5XA 1TCMA 2AJUL 3BWUC 3MRRB 3VXOA 3VW3L 4GSDL 1MAML 3K4ZA 1CYGA 2BVTA 2P1YA 4Z5RB 4NQDB 3MJGX 1H9VA 4V1DA 1TJIL 1T4KB 3TYFA 4PJXF 3UPCA 4ZUVB 1UYWL 3SKUD 5HHVH 4TUOA 4P46C 1RUPH 4OLVH 4Y2DB 2FCBA 2BVOA 1KJVB 1OQXA 4ZOBA 4D3CL 1E27B 5CD3B 2OZ4H 4D8PA 3VGDA 4HKXA 2AK4D 2J2ZA 2DQFA 2VITA 4JQIL 1JYXA 2Z93B 4QXWA 1ZHNA 2R56H 3F7VB 3KDMA 2X1OA 5SX5K 3BP7B 3MBXL 1CLYH 1HZHL 4ZTPH 1ZS8B 3FQXA 2NY4C 2HKHH 1RUQH 4LSRH 5IF0B 1LE5B 1YQVL 4GQPH 3CVHA 4LCCB 4YDVA 1AO7B 5CZVH 1MFCH 2QEJA 4OFPA 2YPVL 3ZYOA 3IJSB 2YD8A 2YMXL 2OS7A 4R90H 4MCYB 1ZTXH 3T77B 2BNRE 2W65B 4RRPA 4XNXH 3MRNB 4MMZC 3RVVD 1BZ7B 1FPTH 1A6UH 3N9GH 3CAFA 5D6DA 1Q72H 2D7TL 3BPOC 3KWWB 3D1MC 1YMME 1RZFH 3WFCL 4D9LH 1RURH 4AH2B 3C6SA 4XP4L 1SEQH 5TFSL 3O6LH 3FJTA 4TPRH 2BSTA 5D1QC 4X9IA 1IGFL 1U8PB 3OSKA 2CIIB 3O4OB 4WV1A 5F3BA 1IT9H 1BQHA 1KPRB 1MH5B 2G60L 1F2QA 1AGCB 3HG1A 2FL5B 1WWAX 5JXED 5DRZA 4OGXL 3V0WH 3EYQD 5E8EB 2CK2A 4YHOL 1PSKH 3NCFB 1BVKB 3IDYB 3KPSB 4LVHB 3IGAB 4G8EB 1KB5L 3MGTA 5F7MC 3G5XA 3C5SB 4ODSL 4CVXB 5C9JB 3WFBL 1J1XL 1FAIL 1G6VK 5F89A 2YUWA 2G75B 2N7AA 2VSDA 5IFHH 4JM2C 5IHZA 4HCRL 2EDYA 2FO4B 4WEUD 5DK3A 5IQ7H 3G9AB 2ZSVA 1RIVH 3PQYA 5EORH 2AJSH 3BEWB 2ZG1A 3QDMB 3RWGA 3O9WA 4LDEB 4YBQC 3QDGE 2X4TB 5HYSG 2YSSA 4U31A 5IFAH 4NCDA 3BD3A 3INUL 3TBVA 1H3XA 1I8LC 3C8KB 4M6AA 3R0MA 4Z0BL 3MLZL 3OR6B 3HB3C 3MRMA 5CWSB 4D2NA 2HKFL 1KIRB 3VI4E 2I9TA 3U0TA 4RGNC 5A1AA 2WK2A 3DX6A 4G80B 3BH8B 5AZ2L 3SGDI 2VC2L 4RAUA 4TUJA 4KU1A 35C8L 3E1F1 5MEPB 3TWCH 1KC5L 1BFSA 4OLUL 3P73A 5CSZB 4OF0A 3RHWK 4M48H 4LEXH 1NEZA 1CXKA 2MJWA 2OR8A 1ZEAH 3LPFA 3O2WL 4Z7OE 2Y07H 2BNQE 1A1OB 1MLCA 4EJ1C 5KVGL 4Y1AA 5TDNB 1JWMA 2YA2A 3LIZL 4AEIL 2VN7A 4PGEA 3B8YA 5JNYA 5E9DB 3GBMH 4KK9D 5MENB 4YDJB 1BBJB 1R3HA 3ILQD 2YRPA 1UZ6E 1CQYA 2FIKA 1AD0A 4OZIF 1JTPA 1P9MC 5IQ9A 3CSGA 3LQAH 4TSCL 1I8IB 4CAGA 4X4XB 3VI3F 2W9EL 4HK3N 4HT1L 3ESVF 2WM0A 1MFEL 1TLKA 4FXLA 2DQDL 3QIBD 1BIHA 1LK2B 4K3JL 4YR6B 5C0FA 4G8GE 4RMWA 1P84K 3WJJA 1AH1A 5ISZE 3MJ8B 4JEGB 5FK9A 5F8RC 3OKMB 2E27H 3SOBL 1QRND 4OCSH 3T04D 3IETB 4AY0A 2P24A 3RGVC 4HMEA 1U6AL 2I24N 3LV3A 1QZ1A 3J8F7 5HHPA 1AQDA 1QYGH 4XH2A 2ICWB 5GSVA 1RU9H 1WT5C 4H5SB 3TPKA 3NH7H 5KSBF 3OKLB 1QSED 1OARH 2QSTA 2WUBH 1ZHKB 3JWDH 1OAYL 2ATKB 4N8CL 5GSRB 5HY9A 3V4PL 4N9GB 4XVSL 1FL6A 5BXFA 1P5UA 1JGVL 4GKOA 3ZKND 3CU7A 1WEJL 5CKGA 3V6BR 4N0CC 4WTWA 3K8MA 1GGUA 1U2CA 3E8UH 2ZCKH 4XNYH 5AWNL 1MJUL 3QIUB 5J9PB 1CD9B 1FORL 1Z9LA 3C8HA 4MA1C 3WEXB 4C54A 1OF2A 1WLHA 1MEXL 3SE4A 3RWJB 1G7PB 1WZMA 3GO1H 3OXRB 4YHNA 2EIZB 4M43H 3W39A 2XWTA 5DJ2B 3VFSA 2A6JA 2GQHA 1BOYA 3U0PA 1TXKA 4JJHA 4OGAD 3FN9A 3TEUA 2AI0L 2BSSA 4ORGA 4F58H 3VFPB 2GJZB 3I3EA 3ULVE 1JWSA 2DICA 4DKFL 4LNRA 3MOAH 2L7JA 3B3IA 2VH5H 1N4XH 3SE8H 1E6JL 4ZPTA 3CK0H 4Q6IB 3HNVL 5GS1C 3TO4A 4JQXA 4UINH 4ZFOB 2VE6A 1D9KB 4NBYB