4ONOA

Cd1c in complex with pm (phosphomycoketide)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
395
structure length
374
Chain Sequence
PIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHQWSKGQFSNEELSDLELLFRFYLFGLTREIQDHASYPFEVQVKAGCELHSGGSPEGFFQVAFNGLDLLSFQQTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNAQGTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin/T-cell surface glycoprotein CD1c/T-cell
publication title Molecular basis of mycobacterial lipid antigen presentation by CD1c and its recognition by alpha beta T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 374
sequence length 395
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onoA03
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4onoA02
4F33B 4P23C 4HWEH 4YO0B 1RJYA 4PBWD 5HGBA 2Y9RT 3GJEB 4DN4H 2B5IC 1DQLL 1OF2A 5I17A 3VFSA 4RGND 3FHQA 4YHYC 3PHOB 3FCTB 1DBJH 1F8TH 4D0DA 5CD5D 2AXHA 3LKPA 4MXWL 1DZBA 3SE4C 2BY2A 2DQDH 1T20B 4PJHB 1L0XA 1QFUL 2HG5A 3O3EB 5L2KE 1FG2B 3MRRA 1J1OL 2OZ4L 3ULSA 5GGUB 3HCVB 4L9DA 2EICA 5CWSA 4PIRF 4OFKA 4LRNH 4JG1L 2IPUK 1N8ZB 2XACC 5FO7A 1J0IA 1KLGB 5EUOB 2NY7H 3BPLC 5HYQA 4F7EB 3O8XA 3UZEA 4K7PL 5CD3B 1T3FB 3GSNL 3MOBL 1NGQL 1HILB 5AWNL 5D2NE 2FX9L 1YJDL 4XNQB 1RUAL 2P5WA 1JZ4A 5KANI 2VDMH 5F6HJ 5JDJA 1FC2D 3OF6A 1MFDL 1JPSH 4NZTH 1NGYA 4ONGL 1J11A 1BVZA 1TPXC 3ZKMD 4DVRH 5AZEL 1I7ZB 2Q3ZA 4Y4KB 3GFUA 2C1OA 1XIWB 4ZSOB 4XC3H 3VXRD 2AJUH 5D7KD 3PNWB 3B9KA 3VXOB 3QBTB 1MUJA 3ELAT 3QIWD 3RWIA 3LQAL 4P3CL 1FIEA 2EH7L 1MCLA 2JK5A 1AQKH 4TPRL 3SKUD 5FECA 5DJXA 1VSCA 5CEXB 1LO2H 1U3ZA 1SJVA 1UM6L 4PB0L 1S7QA 3GIVB 1ZHBB 4RAVA 5JZ7C 3MX0A 5C86A 3NA9H 4F15B 32C2B 1E6JH 3RTQD 3MRNA 2BOBA 2V2WA 5FYJU 3WUWG 2DJSA 3ALXA 1R5WB 4MB5A 2EEDA 1FFPA 4JRWA 1G9NL 5LCVH 3W82A 4D0CA 2APBA 3MYJB 3IETA 3WKML 1IRAY 1MPAL 4S11A 5CJOL 1ERNA 1ZLVH 3TM6A 3HHRB 5A2LH 2O5XL 4IBLT 4S2SA 3NH7H 2B4CH 3DRTB 1N5AB 1OAYL 1NDGB 3QR2A 1IGIL 1KXTB 3RL2B 1MREL 4C58B 1MVUA 4HK0A 4Y1AE 4ZPVB 3VGAB 2BERA 1LD9B 4D9RE 1BEYH 2YUVA 3D69A 4NKDB 4JREC 5E6ZA 2NZ9C 2O5ZL 1VADA 1BVLB 2XZAH 4KY1L 4ZXBB 1EVTC 1S9XB 1PD6A 2APTA 3QDHA 4HMCA 3RIAK 5EDXA 4BH8B 1MLCB 2ADJA 5IEKA 2J12B 1PEWA 4PJ7E 4Y5VB 2Q6WA 1TJIH 3WFBH 4Q0XH 2WLZA 4JKPH 3MSPA 2Z9TA 2IH1B 4PLJD 2H26B 5DURD 4PJDA 1K5NA 1FO0L 2RAMA 5E94B 2HJLA 3ZE2E 1KN2H 2FO1A 3CCHA 5KTEH 1ES0B 1U93B 3AFLA 3WJLA 5EZJA 4FHBD 4KMTH 2IBGA 2X6MA 2JCCA 1Y6KR 3FRPA 4Z18A 1YY9D 1HNGA 2Q76B 1ZV5A 2BCKA 4X9GA 5AG9A 4HPOL 3L1OH 3ULUL 4IJ3C 1LO0H 2H3NA 2VYRE 1X4YA 3ARVA 3NIGE 2XRAH 3EYSH 2YBRA 1XGTB 4HKXA 3BZ4A 4RA0C 3EYUL 4Y5XC 4FXGA 1MHHB 1UWEH 5B38B 3ZYJA 2V7NB 4PGBB 3UTSE 1TXKA 1D9KD 4AEEA 2DM2A 5FB8A 4MCYA 1BAFH 1G7IB 3GSOA 3S5LG 1FNHA 1NGZA 2FYYB 3OGCB 4OLZL 4QHLA 4WDIA 5D5MB 2X05A 1NKOA 1W0WA 4HIXH 1NDMA 3CFIC 5SV3A 4NBZB 3ZDZF 1DBAH 2V5TA 2UZYB 4HGWB 1AGCA 1WWWX 5B8CC 5FK9B 4MDJA 3LHPH 8FABA 3N1GC 4JR9L 1KCUH 2QSCH 3MV8E 4ONHA 1QLEL 1KELL 4R2GD 3RPKA 4ZOEA 4D8PA 4P23B 3KPQA 3CSGA 1U8OB 4Y16A 3ULUD 1QLFA 1BIHA 1YNTA 3CVHB 2W60B 5BZDB 3DUUB 4R4FH 2AQ2A 3SCMD 2B5IB 2QEJA 1BQHG 3HNSH 4JDTH 4YHYB 3BQUC 1HSAB 3QIBD 1UA6H 4MLIA 4PJEB 3HN3A 5GPRA 1G9ML 2K7PA 3W11D 1KJ3L 2VDNH 4HJJH 2CLZB 3WLWD 4YGVA 5D7LA 4J3SA 1OAQL 3I3EA 1CIUA 1U8QB 4TSCL 4D94A 4P46D 1PGRB 3TNNB 5IW1B 4ZODA 3RAJH 5E1AB 4V2CB 1MHPL 3BPLB 2HTKC 2Y6SD 3MV7E 3CFKA 5FGRA 4XVJL 3O9WA 4BK4A 5C6WH 5KVEL 4ODSH 4PJAB 1P69B 3THMH 4CMMA 3IU3B 1EIBA 4LASH 4HWZB 2AEPH 2B4CC 3GGWB 1QZ1A 3BP6A 4LPCA 1OGTB 1R3LB 3MV01 4GO6B 3GMLB 5EU6D 3ZHDA 1TPXB 1CD9B 4HMDA 1B6DA 1WZKA 5BMFL 3HUJB 4QO1A 4R7DB 5D1XC 5DLMH 4PY7B 4L3EA 3LPWA 1RU9H 4ZG1A 1XGRB 3V0AC 5CHNA 3GUTB 3H8NA 2XFXA 4K3EL 2DLGA 4BZ2H 1MJ8L 4XGZA 4ZQKA 5T3XL 1X5XA 4BKLB 1JGUL 5E99L 1FC1A 1QRNA 5FHAH 5FO8B 4LLVB 4PJXA 1RULH 3DVNA 4W4NA 4X7DC 4XHQA 5EBGA 1OSZB 5EO9B 3D6GA 4ZOAA 5I76A 2R56L 3QISA 1FVCB 3GK8H 1NUDA 4UBDD 1DR9A 2FATL 1FFNA 5F6HI 1F3RB 1QO3A 4WY7H 3GJFK 4HWUA 3RGVA 3JXAA 1D7FA 4AEFA 4OZIA 3RX8A 1AKJA 1FORL 2HVJA 3WV0A 5BV7C 5DJ2B 3RVWD 4MNQA 5EBMB 4Z7VF 1HXMB 1Q8MA 4PJ5D 3VFOA 3QCTH 1D6EA 2Y7QB 1HHIA 4YX2H 4V2BA 4HULB 5JNYB 4XI5D 4YNYB 4P9HL 5LG1A 1N59A 1A0QH 4PGDB 3O6KH 1KCSL 3FO1B 4KTDH 3ARED 2LU3A 5LVEA 4ONFH 1A7BA 4OCSL 1LQVA 1KEML 5SWSB 3KYKL 3TVMA 2ITDB 5T3XD 5J6HB 3IDIB 1DFBL 4GSDH 5I1HL 3MJ8A 1U58B 5IBLD 1GOFA 4RMQA 4JREB 4LSPH 1OAUH 3HG1E 1RUPH 1JGEA 5E6YA 4PS4L 3PJSA 2R4RH 4GMSH 2UWEA 2D7PA 5FYKE 5F9AC 2R0WL 3LKNB 1JWSB 2HFFB 5HHOE 4X4YB 5D96B 43C9A 1WT5A 4PRPA 2D7OA 2GITB 1G7JA 3AXLB 1S8DA 4XCYA 1MJ7H 4F2MB 4U1JB 2F53D 5L0QC 5D1QD 4YJZL 3H3BC 2CDFB 3UDWC 1NFDA 4QRUB 3S36X 1EZVY 4KMLB 1GGCL 2BNQD 1CFQB 1TZHB 4L4VD 2MCPH 3FN0H 4IJ3B 2XZQH 5EU7C 3ZYZA 3FO9A 4JZNA 5J9PB 1AGFA 1FIGH 4XPBL 1WK0A 2R1WB 2P5EB 4Y5XB 4NQCD 2VXVL 2BNRD 4G6AC 3LKRB 4A2MA 3H7BB 4AEIL 1TTUA 3BUYA 4GBXC 1KIRB 2JLLA 2YA0A 5I0ZA 5A16B 2I26N 3B2UD 3C5SB 3SO5A 5F7KC 4F33A 3D48R 4YO0A 1DCLA 3KPLB 3QFJD 4JPIA 3U7YL 2WINB 1XGPB 2LV4A 5B8CB 5I75C 4OF3A 4JRXE 2GJ6D 3PHOA 4FQXB 4PJFE 4PRIB 3TJEH 4RZCA 1NEZB 3VXUA 3CUPB 3P4MA 4TSAH 5BXFA 5L2KB 1YEJH 1HCVA 1T20A 4PJHA 3X12B 3OZ9L 3O3EA 2ZUSA 1FG2A 4ZUWB 3W0WD 3KPMB 4YXHL 3HCVA 1CD1B 5KSBF 5HHVL 1CYGA 5CJQH 3ARSA 2GIYA 1N8ZA 1MH5A 1VGEH 1KLGA 1EEYB 4J12A 5EUOA 5CEZL 5JW5B 3BQUB 4QYOB 5D6CB 5JPNB 5CKGA 4FQQB 3Q48A 1P6AB 3FT4A 1T2QL 5CD3A 1T3FA 3R06B 5LBSH 1HILA 2PYFB 3C5JB 1KTLB 4P5TD 4N8CH 5D7IA 1I4FB 4JQIH 5ESAB 2A6IA 4HWNA 4XWOC 4Z9KB 4DQOH 4QRPB 3QWRA 3HFMH 4M6OL 5JW4M 5F7FA 2X40A 1I7ZA 3TFKD 1YEKL 4IRJD 4Y4KA 3ZT6A 2BXYA 2W0FB 1QG3A 2VXTL 4ZSOA 1KJ2H 2MOVA 2RIKA 5F9JA 4XZUA 2ERJB 2FJGB 3Q5YA 4HJ0D 1KB9K 3VXOA 1T2XA 4JFEE 2IJ0C 4TUKH 4M8VA 1OCWH 5KS9A 4NZUH 2HH0H 1QEWA 4YC2C 4GRWF 3DYOA 2DQEL 3G6JF 4ZOBA 1LK2B 1OT2A 5I1CH 5CEZD 3BIKA 1PG7X 4ODHL 5DJDB 5CEXA 1LE5A 1ZT7A 5D1XB 4M5ZH 3GIVA 1NH6A 1F4WL 4WUKH 3MLUH 1ZHBA 2RQ8A 3MLWL 3RWGB 4KV5E 4Z95L 2RHEA 1KGCE 1MQKL 3HNVH 4APQA 4ZFFB 3BRDA 4OIIL 2ZJSH 1KYOK 3HMXH 4GKSA 4N8VG 3SDDB 1R5WA 4XCNA 1K4DB 5I19L 3UPCA 2NW3B 4M3JA 3QUZD 3VFTA 2D2OA 4MX7B 3EKCA 4HZLB 3QDJE 4CBPA 4QRSB 3DRTA 3LB6C 5BV7B 3D0LB 2KUTA 4NPYB 3RL2A 3P4NB 1F4YL 5L8LB 1JK8B 2DMKA 1JGVL 1LD9A 4NKDA 3WN5C 2Q8BH 3N1PC 4ZUUB 1J8HD 1FBIL 3EO9H 1J0ZA 4PJ7B 1BVLA 3ARYA 1S9XA 3GO1L 4BH8A 2FHBA 5FDWB 3TJHA 4WTZG 2PKDA 3VGGA 5EUOF 1G7QB 2IH1A 2ARJQ 1N3NA 3TF7A 1REIA 3VDBA 5IB4B 4MXQC 3SE3C 1OTSD 2LE9A 1EBPA 4KXZI 1T7VA 5AZ2H 1ES0A 5BRZE 1AHWC 5KVDH 5C92A 1JNNL 1H0DB 1EPFA 5CSGA 2UYLA 2DDQL 5EOQL 1DQLH 1P7KA 2RGSA 1XGTA 3RNQA 3TBSA 2EKJA 4MXWH 5DO2C 4NQDE 5I8EA 3OKNB 1MHHA 2VLJD 4PGBA 4JO2L 5L0QB 1QFUH 5DHVH 3ABZA 3SDCD 4NUJA 1J1OH 2OZ4H 2ED9A 1NGPL 1NCDL 3TWCL 3QEQA 1SBBA 1G7IA 3P0VL 3DI2B 5D5MA 4J3XA 4JG1H 2H6PA 5I2IB 2AP2A 3NABL 1KG0B 2KDGA 3DYPA 1RIVL 1A1OB 3MPCA 4TNVK 1EV2E 4HGWA 3BH9B 4OZGA 2NXZD 2KKQA 3MV8B 4K7PH 1AH1A 3GSNH 3TO4D 3MOBH 1NGQH 5AWNH 2FX9H 1YJDH 2C26A 1QQDB 2DQJL 4N90D 5EIQA 3MRDB 4P23A 1U8OA 1MFDH 2FEDD 4ONGH 3S35L 1ZHLB 1WCBB 5BZDA 3DUUA 5DZNA 5E9DD 5AZEH 5I75B 1HE7A 2MJWA 1SEBB 3O2DA 3FQXB 4XTRD 2V2XB 5ICYB 4PJEA 3G5XB 3SE4A 1CD8A 2AW2A 4U3CA 3ZTJH 2DLEA 3CNKA 3MJ6A 3MUHL 1BP3B 1I7UA 3P9LB 3RDTA 4P3CH 4U1MB 3RVUD 4WUUE 1U8QA 2EH7H 1I8KB 4TPRH 2W0LA 3MV7B 2I24N 4ESKA 1UM6H 4PB0H 3TNNA 3QT2A 2Q7YB 1YN6B 3T3PF 5E1AA 4HWBL 1PZ5B 5C3LD 3P11L 5HHQB 1QFPA 4PJAA 5ANME 1J0HA 1IAIL 3AROA 4RGNC 1JHLL 1Q0XL 4HWZA 4NQUA 3DUHA 5HVHC 3GGWA 3LEXA 1OGTA 2E7CA 4OFYA 3GMLA 3G5ZB 1GOGA 1G9NH 3MOAL 2A83B 4UIMB 1MPAH 1I9JL 5CJOH 1I1YA 1F4AA 3HUJA 4R7DA 4N0CD 3MJ9A 3RWFB 1I8LC 2O5XH 4PY7A 1IKNC 4Y2DD 4GXVL 1CL7I 3Q1SL 4OLWL 2YA2A 5F7EL 1OAYH 4EI5A 3GUTA 3ARQA 1FNGA 1CWVA 1M7DB 3I84A 1Q9KB 3VGEA 4QWWC 1IGIH 1DEEB 2P8PB 1MREH 1BHGA 3ESUF 4YC2B 4BKLA 2O5ZH 5EO9A 4KY1H 1N26A 3D2UD 3QXAA 3LCYA 4PBVC 4ERSL 4L29B 2V7HB 1FVCA 4YHIB 1CLYL 1QSFB 3V8CA 3VJ6B 2BFVL 3U4AA 2B20A 1B0GB 4MS8D 5TDOB 3ZKMC 1MY7A 2N4IA 3ZO0A 5I73C 4LKXB 2RB8A 4EXPX 4NQTA 2BDNL 5EBWB 3QRGL 1RIHL 3LS5L 2XV6B 3GM8A 3OBAA 5DJ2A 5IFHL 5IHBA 4XBPB 1V5JA 3EOBB 1HXMA 1Z3GL 2PF6A 3WHE1 1Q72L 5CINL 5F1NA 2Y7QA 1ZHNA 5F44A 5JNYA 3OKYA 1G6VK 3VI3E 4HPOH 3U7WL 4LMQI 4RRPG 4QHMB 3ULUH 5CZVL 1IM9B 1EZVX 2OCFD 4PGDA 5E4EC 1FGVL 1U42A 1U8NB 2E6JA 4LCYB 3FO1A 3U83A 5JPMA 3BXNB 3EYUH 4BSWB 4QRRA 3DHJA 5SWSA 3VWJC 2ITDA 3WUWB 2AV7B 3QDGE 3IDIA 3DRQA 1I1RA 3HG1B 2WQRA 2NZIA 4P2RD 5C9KA 1YJDC 3QAZB 4OLZH 3WN5B 1BF2A 3KS0H 3WKNA 3U0TA 5HHOB 4FQ2L 5BQ7A 4HQQH 2YS4A 4Z0XB 5E8OB 3LKNA 1PKQA 1LO5A 2HFFA 4GXUM 2D0HA 4JR9H 4PJBE 2OTWB 1YMMB 3AAZB 4OV5B 1F00I 3AXLA 5HTSA 1GZPB 3OHXB 3P30L 1OLZA 4U1JA 4F2MA 1QLEH 2CDFA 4GMTL 1KELH 3QHFL 4PD4J 1CFQA 4M1GL 4NNXA 3LQAC 1EBAA 1EGJL 1TZHA 3CLFL 1Z6JT 3QI9D 3LIZL 4OGYL 1AD0A 3C5ZB 4KROD 3H42L 2R1WA 4Y5XA 2P5EA 4YUEL 1G9MH 1KJ3H 4TVPD 1EAJA 4IRSB 4LP4A 1MFNA 3CFCL 3UO1L 3FN3A 4U6HB 4N1HB 2X4TB 2BY0A 1NAMB 2LVEA 4LLWB 5GGSB 1OAQH 4ZDHB 3G9VA 3MRGB 5A16A 3JWOC 3C5SA 4TSCH 3PGCA 4GQ9L 1KB5B 5EO0A 1A21A 5DA4A 4FFZL 4HX1B 3VWKB 1OTUD 5ID0B 3KPLA 1SY6L 2E7BA 1G9NC 4PJFB 4KI5E 1MHPH 4K94C 4RFEB 1YY9C 1XGPA 1FHGA 2WV3A 4LNVA 5B8CA 4XVJH 5IMMA 5DJZA 4PRIA 4MD5A 2FRGP 2FLBT 1NEZA 2ZPKL 3CUPA 4U49A 3MRCB 2X1XR 1EFQA 5LKNA 2GY5A 3S5LB 5L2KA 2VLRE 4YDJB 3I9GL 3X12A 1LMKA 4NFBA 5F88B 2V5RA 1D9KC 1TJHL 3KPMA 4B7IA 1CD1A 5CUSL 4OI8A 4OFDA 4JE4B 2B2XL 5BMFH 4OF7A 3IXTB 3UJJL 3RI5F 1EEYA 1FLTX 3N9GL 2IPTL 4MQXD 5D6CA 5JPNA 3N06B 4FQQA 2AXFB 3ZDYF 4K3EH 1MJ8H 4PRHE 3ZTNL 4QOKD 5T3XH 4B50A 3FFCA 3PL6C 4P57A 4WI9A 4QTHA 1JGUH 1KTLA 4Y19B 3T4AB 5I71C 1BQHB 3BH8B 4HFUL 3UTPD 1MEXL 5MERB 2PO6C 2P7TB 3CFJB 4QRPA 4UUJB 1ZLWK 2R56H 5C71A 2OYPA 4G9FE 3VXMA 2FATH 5IVXA 2WBJD 1CBVL 5J0BA 3LDBC 5CCKL 1DBBL 4X4MA 3SCMC 2GEEA 2QQLL 5MENE 3KPSE 1FORH 1ORSB 2HWZL 2W0FA 4RGNB 3QIBC 5HGDB 1X4XA 4HCRL 5HVHB 3W11C 1RZJL 3WLWC 4NFCA 5D1ZD 2VLLA 1P1ZB 1LNUB 4KZDL 1F3DJ 1S3KL 5DJDA 5IBUG 5HBBA 1WAAE 5D1XA 1KCSH 1Q9OB 4P46C 3RWGA 4OCSH 1KEMH 4JDZB 3KYKH 2Y6SC 4JM2D 5FM8A 4EVNB 1DFBH 4NO2B 5EA0L 4RIRA 5I1HH 4O2CB 2LTQC 4ZFFA 1BM3L 5D93B 5AD0B 3SY0A 3LKSB 4PS4H 1K4DA 1BREA 4G3YL 3TCLA 3EGSB 1VA9A 2NW3A 2VLKD 5T5FL 2R0WH 3QDJB 2J3SA 5C0EB 1MNUL 5GSVB 1M7XA 4NKOA 4N1EA 1TETL 1S7RA 4NKQB 5I73B 2F8XC 2AJYL 2R15A 4QRSA 1BWMA 1G9MC 5J4MA 1CFNB 5HYJD 1GGCH 3OJDB 3P4NA 1KXQE 3CX5J 4WJ5B 1JK8A 4Z8FL 4XVTL 3VDAA 3PQYD 2I9LB 4CADB 1CFBA 2DIBA 1OAXL 3IDNB 4CDGC 1LP9F 5E4EB 4GW1B 1A6UL 3MRPA 3MRQA 4Q6YA 3QUML 4XPBH 1AXSB 1XR9B 3G04A 2HTLD 1KPUB 2VXVH 3HZKB 1G7QA 5C1MB 4M02A 2KBGA 3VWJB 1CG9A 5FYLE 5BVJA 1I9IL 4U1NA 1WEJL 3ARFD 5DQ9B 5IB4A 5BRZB 4AEIH 2XY1A 4LRIA 2VIRA 4HUXB 4N0YL 3GSNB 2A6JB 1RJZB 2W59A 3CFEA 4HK3N 3DX6B 4B53A 1GCFA 1IEBA 4LLMB 5DTFB 4FABL 2DQHL 2D31B 4HUUA 1PYWB 3RVWC 4UTAL 2IBZX 2WLYA 2G5RA 3K2MC 1LEIB 5FAAA 2FB4L 4BQ6A 3IS0X 4NQDB 5I18L 5DFVD 4CU8A 1MFEL 4OUUA 2GT9A 2X41A 4PDCE 4JPKH 1DJSA 2IAMD 5ISZE 3OZ9H 2DB8A 2ZNWA 4OGXL 3UDWA 2P47B 1VFOA 3TO2A 3DBXB 4YXHH 4HUNB 5HHVH 2PYED 2WM0A 4KI5C 5I2IA 5JHDE 3WFHA 1KG0A 1F90L 5CEZH 1A1OA 4RMWA 5IMOB 1JGDB 1OM3L 3A67L 3GKZA 3BH9A 3IKKA 2GTZB 1T2QH 5I0DA 3MV8A 2I25N 2EYSB 4Y4HD 1JIBA 2DOCA 3O2VL 4GBXA 3HB3D 5B4MC 4I2XB 1QQDA 2XWJA 1H3VA 4JB9L 5DJCB 3MRDA 5D1QC 3A6OA 4BJLA 2FBJL 1WCBA 4YXLL 4M6OH 2DYPD 4P9HC 1RUKL 4D0BA 4F7CB 1TQBC 1YEKH 1SEBA 2G9HA 1TNMA 3LZFL 3FQXA 3JUZA 3NCCB 4XP9L 2V2XA 1JV5B 5ICYA 2VXTH 3G5XA 3ESVF 2DF3A 4UTBL 4GRLB 1L7TL 2G75B 4OZHB 1D9KB 5KVGL 1M6OB 4U1MA 1QYGL 3DX9B 4XMLL 2DQEH 1NUFA 2Y06L 2CLVA 2PXYD 2EXWD 1X5LA 1I8KA 4ODHH 5ADOL 1S7XA 2J6EL 3ZYOA 2Q7YA 5C0GA 1YDPB 1YN6A 4YZFE 1F4WH 4P2OD 4PJ7F 4DKDC 3MLWH 5ANMB 1A3RL 5E8EB 3DWTA 3X11B 1HOCA 1XGUA 4Z95H 2E3VA 4HKJA 3KDMA 3QNYB 5GSRB 5GZOD 2GYSA 1MCNA 1MQKH 3PL6B 3ZE2F 1FO0B 1KBGL 5C09E 1TDQA 4XH2B 4YHKL 4OIIH 5I71B 2QADD 1A6WL 1HI6A 3AVEA 2PO6B 5I19H 4OCRL 5GRUL 4LGSB 2BVEA 2A83A 1G7PB 4U1LB 4UIMA 5I1KL 3NIGF 3LDBB 3FN9A 2B1HL 3IFPB 3RWFA 3SCMB 4D9QE 4J4PC 4OCLC 1F3DH 2M26A 2Q8AL 2VISB 4S10A 4JY6A 2NTFA 5ENWA 2P8PA 2A9NL 3DETD 3ES6B 4X8JB 1F4YH 3TH3T 1C8PA 1JGVH 1CVRA 2HAZA 3LSOA 2I60L 3NFNB 3OB0K 4M93B 2ZCLH 2Z31D 4WI3A 3TA3C 3AMLA 4BK5A 1FBIH 4PG2C 3QP3A 3IDXL 4O58L 3UP1A 3V6FB 4P5TC 3GO1H 1NFIB 4L29A 3OG6B 4GAYB 1QSFA 3QO0A 1T83C 2F5BL 4P46B 5DWUL 3RUGE 4G8GD 2IEPA 4IMLB 2Z0BA 1WWAX 4LKXA 5DJ6B 3TFKC 3QH3B 4IRJC 3E2HC 2LTQB 2ATPB 1W72B 3GB7B 1JMZA 4MB3A 4O2FA 3EOBA 1JNNH 4JLRA 1BWWA 4HC1L 4JFZL 1KV3A 4MWFB 4LHQB 2AK4E 1L0YA 2DDQH 4QHMA 5DMJB 5EOQH 5T1MB 2G2RA 2OL3B 1FPTH 3QEUA 4LCYA 3MRMB 4K7FA 3QDGB 1IAKB 1Q94A 4BSWA 3LS4L 1U95A 3V6BR 2KPNA 4JO2H 2VN4A 3WUWA 1S9VB 5K9JL 5T1LD 3PG2A 5H2BB 1AI1L 1NGPH 1NCDH 3HG1A 3TWCH 3IFOB 2A9ML 3P0VH 2C4FU 2QQNL 4NRXB 3WDJA 3WN5A 4U7SA 3NABH 1Z0NA 1QACA 1RIVH 2J8OA 2EIBA 5DVKA 4XB8A 4Z0XA 3K4DA 2C1PA 3RZCD 2C7UB 1AC6A 1A2YA 1AE6L 1WVZA 3QUZC 2VJXA 3P9MB 2OTWA 1YMMA 4MXQA 3SE3A 4OV5A 3OHXA 2DWEB 3PDOB 2CH8A 2DQJH 2ZKHL 1PBYA 1AHWA 1XH3B 3BEVB 3S37H 2BSSB 3P0GB 3QZWA 3S35H 4O9HL 1AO7E 3KLDA 3MCG1 3D1MC 2GSGB 3K0WA 4WIQA 5ALBL 1MAML 1F6AB 2ID5A 2C3HA 1X5YA 4M7KL 5IOPB 5DS8B 3OXSA 4BH7B 2EEBA 3F7VB 1I8MB 4YH6A 3PV6A 1QRKA 2FLRT 4U6HA 5SWQA 5C0BE 3INUL 2X4TA 3LRSA 3BZFB 4KRNA 4LLWA 1YNLL 5GGSA 4ZDHA 1YEFL 4XCCL 4RGMB 3FKUS 2VDPH 5LWYL 3MA7B 5DD1H 4HX1A 5KZCD 3MLPA 4JQXC 5ID0A 1IZKA 3NCYS 3L9RB 4XRCB 1HXYB 3QUYD 1OT1A 2EDKA 1CXKA 2ZOLB 4HWBH 2NYYD 3WHE0 4L1HA 1WSST 3MRCA 1JHLH 1Q0XH 3S5LA 2E5EA 4LLUB 2JF1A 4KPHL 1KJ2A 4LSQL 5F88A 5LQBL 5D1QB 5C07E 3SDCC 5M95B 4LHUA 4ZYKB 1I9JH 5C9JB 3IXTA 4ZS6C 5KG9A 5F3BB 4L4VB 3MGOA 1G0DA 1AP2B 4GXVH 3Q1SH 4LCWA 3GBML 4OLWH 5F7EH 4YBQC 2VDOL 3MBED 3KHQA 2D03L 3IRZA 3K8KA 4YE4L 3S88L 3DARA 3VFMB 2NXZC 2DAVA 4Y19A 3T4AA 1Z9LA 4OCNC 4G9FB 4XAWL 4NWUL 5MERA 5K59E 4NQED 3HMXA 4ERSH 2P7TA 1LEGB 1LQSR 4UUJA 1INQA 1J1PH 1CLYH 3FZUD 2FEDC 2BFVH 4DZBB 5SWZE 4NRYB 4XNXL 1DDHA 2H32H 1HSBB 5AAMA 4RX4D 4LEOB 1IAII 3DXAD 1ORSA 1RIHH 2BDNH 2GJ6B 3QRGH 3LS5H 3AC0A 4HT1L 5HGDA 1C12A 5K33A 2HN7B 5IFHH 1GZQB 1Z3GH 4M7JL 4XNUL 3ARGC 1Q72H 3MNZB 5CINH 5HVGB 1CDGA 4HKBB 1FAIL 3O4LD 5FCSH 1J7VR 3RVXC 3U7WH 4XPGL 1PG7W 4GFTB 3RVUC 5CZVH 2G5BB 1NC4D 3K46A 4QXWA 5H37G 1FGVH 3T0EE 1E4KC 3DO7B 4PTUA 2NX5E 3MUGA 2FIRT 1Q9OA 3CU7A 1JMXA 4DCQB 1IKNA 3CPLB 1DEDA 4H0GA 4KKNA 4TVPH 4EVNA 3MV9D 3PP3K 4RSVA 4ODXB 1OSPL 5CBAB 4NO2A 4OZ4B 2YC1B 4O2CA 3UYPA 4U2ZA 4WHYG 5AD0A 3TA3B 3QCUH 1NCCL 4P5TB 4FQ2H 3F8UB 4FG6C 5EC2A 5CEYB 4BSJA 5ESVB 1A1MB 5GSVA 1JPST 1CDUA 4Q97A 4PJFF 2WANA 4LFHD 4N0CC 2Q87A 3VG9C 3P30H 2VDLL 1OVZA 2OXHA 3E2HB 3I2CL 4GMTH 3QHFH 3ZL4H 2ICWJ 3HRZB 2WWKT 1FJ1A 4R26L 5DHVA 3VFWB 3KPPB 4WJ5A 2P5WD 3EYQD 4ELME 2AQ3A 4M1GH 4PRBB 3QXTA 4ZNCD 1EGJH 2MMXA 2I9LA 3ARWA 4MQSB 4CADA 5IQ7L 4MCZB 3IYLW 3CLFH 3GSRA 3QIWA 2ZNXA 3IDNA 3LIZH 2FHFA 1FNFA 1E4XI 3H42H 2GJJA 1AXSA 1QTYT 1XR9A 1AY1L 2HJFB 4YUEH 2XA3A 1XF4B 2YRZA 5D8JL 3VWJA 2WBKA 2X1WL 3CFCH 3UO1H 3QG6B 2OQJB 5DQ9A 2P24B 5FM5M 4K71C 4HUXA 3C8KB 3GSNA 4UAOB 4C4KT 1SJHB 1RJZA 2BSTB 1SYVB 3DX6A 4GQ9H 4LLMA 5DK3A 1AIFB 4FFZH 1JL8A 5CP7B 4HPYL 1OGAB 4Q74A 1SY6H 3SPVB 4FQ1L 1MVFA 35C8L 4YDIL 4BZ1L 4LAJH 3TN0D 2R2HB 3QUZB 4MDIB 3FT3A 4WENB 2ZPKH 3HTLX 5ISZB 3EYOA 1CN4A 2VABB 1A6ZB 3I9GH 3VFRB 3UJTL 4N5UA 2XG4A 3ILQD 1BD2E 3TPUA 1U91B 3JV6B 1TJHH 1A4KB 4PREB 3FL7A 3MCKB 3DBXA 2QQQA 5JHDB 4JKMA 4KVCL 5CUSH 5FUOL 2B2XH 1ND0A 4TUJB 3UJJH 2ZUUA 3QXVA 3N9GH 3E1F1 3PF2A 2IPTH 4DEPC 1F3JB 1F6LL 5IMOA 5DHYA 4EI6B 5I9QC 4KK5C 4P2QD 3R0NA 4WI8A 4NZRL 1KLUB 3NFSL 1P5UA 3ZTNH 2EYSA 3GMRB 4GAFB 1J12A 5ITFB 1U3HD 3GMMA 3GJFH 3BP7A 3P2TA 4I2XA 1OQOA 5HI3D 1ZVSB 3RI5K 2VXQL 4JFDD 3MQIA 1Y0LB 3JWDL 4HFUH 1MEXH 1T1WB 4PV8A 4AM0B 2XKNA 1J0YA 3BD5A 1CD0A 5HHMD 5KOVC 5IEHB 1CBVH 4HS8L 5EU5A 3DMMD 4DW2H 1DBBH 3QDME 5CCKH 2QQLH 1EK3A 1JWMB 2HWZH 1UVQB 4KHTL 5F93C 4RDQG 4HCRH 3V7AG 3T0AA 2X1OA 3H0TB 5I30L 1RURL 1QOKA 3CX2A 5F9OL 2VLJB 1BGXH 1RZJH 1HH9B 3BPOC 1T1XA 3D3VE 1D9KA 4OZHA 1OOAA 5JW4N 3HR5B 1HHJB 3SDCB 4EDWL 1ITBB 4KZDH 5GHWH 1JYWA 1S3KH 3HC3L 1QSED 1KCLA 1QSVA 3NCYP 1YDPA 5GQBA 2C3WA 4JFPB 4KKCC 4PTTB 3CZFB 3KXFE 5GSRA 3QNYA 5C09B 5EA0H 3PL6A 5CJBA 1FO0A 2NXZB 3H9SE 3MFFA 4Z5RB 1BM3H 4JDVA 2AABL 1FN4B 4G3YH 1DQQB 3T0EC 4U1HA 5T5FH 1NQBA 1G7PA 4HH9B 1MNUH 3UBXG 1K2DB 3IFPA 1TETH 2IMNA 4N0RA 2WBWB 5DQDL 3SCMA 1YN7A 1BZ9B 2AJYH 5E9DB 2EIZB 2VISA 4MQXC 2HMIC 3QIBA 1CGVA 4JHWL 1A6VL 5T33H 1JZ7A 3ES6A 4P2CG 4X8JA 3ARGB 1W8OA 2N7AA 3CVIL 2PR4L 4Z8FH 4XVTH 3F7PC 3TCXA 3HA0A 4YHNA 1F02I 1OAXH 2OS7A 1A6UH 1NFIA 3QUMH 4GAYA 4P46A 1P4IL 2YPLD 2CK0H 1KCGC 1KACB 4IMLA 5IR1B 1PVHA 1K8DA 4N0UE 1I9IH 1WEJH 1IMHC 5DJ6A 4N0YH 4QGTA 3QH3A 3RWJB 2EIEA 2ATPA 1U3JA 2DIJA 1W72A 4PJ8D 4FABH 4HIJB 3JTSB 4RNRB 2DQHH 1K3ZA 2BNUA 2ZG1A 2AK4B 5IBUB 2DQUL 5ACMA 4UTAH 4J2XA 2NNAA 4P4KD 4MWFA 5EU6A 2YUXA 2D9CA 2FB4H 2HT2D 5D1ZC 5T1MA 2OL3A 5I18H 3ROOA 2XQYG 4ZUSB 1MFEH 3MRMA 3QDGA 3O9WD 3VG9B 3OR7A 1YY8B 4OGXH 2A6KB 4HHAA 4JN1L 5IWLC 4OM1L 4MXVF 1D5IL 2CDGB 3IFOA 5FO9A 2MPAL 5E00B 4X4ZA 1IC7L 1Q9WB 3GSVB 4X6CE 4LIQL 5HI5D 4NOFA 1F90H 4XNYL 4AH2B 1QBAA 1OM3H 3WL9B 3A67H 1MJJB 1RZIB 4L3ED 4MSWB 2C5DC 1X5IA 1JF1A 3NCMA 5KN5A 5MEQB 2BZDA 5DMGD 1A9BB 3NBNA 3O2VH 4K71B 4POZD 4NQXB 2DWEA 3PDOA 4HIEA 1OTTC 1AJ7L 4JB9H 1AO7B 5FUCC 1XH3A 3IFLL 4L3CB 3BEVA 2BSSA 2C4FT 1GGTA 3VXTB 3B3IB 1RZJC 2GUOB 1VERA 3RX5A 2FBJH 3IJHB 2GSGA 2NR6D 2AGJL 1II4E 5IFJA 2OJEB 1RUKH 1F6AA 2ICWI 4NO5A 4M03A 1FNEB 3FOLA 2DQGL 1NJ9B 1EXUB 5DJ8B 5DRXB 1NBQA 5IOPA 3FQTB 3LZFH 5DS8A 2AJSL 4XP9H 3OKDA 4JAMA 4BH7A 2V17L 3FO2B 1KFAL 3F7VA 3RGVD 3TZVD 5BS0E 5C0BB 3BOVA 4WEMB 4FN0A 3GDBA 2Z4QB 4K23L 4UTBH 1G7HA 3WNMA 1L7TH 4M5YL 3N50A 2NMSA 5KVGH 4XMLH 1QYGH 4MAUL 1KJVB 2Y06H 4EEEA 3W2DL 5FEBA 3MA7A 3B5TA 5H94B 2J6EH 2VN7A 3L9RA 4DEPB 4XRCA 1HXYA 1A3RH 2ICEA 5DYOA 1EX0A 2ZOLA 3G5VB 2BRQA 5DDHB 1UENA 4KJPC 5D2LE 3QO1A 1KBGH 2NY1D 4P3DB 3S3SA 4YHKH 4LLUA 3F7QA 3CH8A 5C07B 5KAQG 2YA1A 4QGYA 1CXHA 3RHWK 5ICZB 4ZO6A 2F53A 2IAMC 1A6WH 1IGML 2YD7A 5D1QA 1T6VN 1OP3K 3P77B 4OCRH 5GRUH 3VI3F 2ZWLT 3UTTD 1T5XB 2MSPA 2BNQA 5F7NC 4ZYKA 5I1KH 2B1HH 4PGCB 4HG4K 4L4VA 4TQEL 1KTRL 5E5UB 1ACYL 2Q8AH 1UCBL 1D5BB 4MNGB 4L4TE 5DA0B 3IGAB 2A9NH 5CGTA 1B4RA 4HV8B 2BNRA 3BPOB 4NKMB 2I60H 4Y4HC 1GGBL 4S1DC 3DTXB 3OAYH 2GW5A 3IDXH 4O58H 2BOCB 2BVOB 5DWUH 2F5BH 1S9KC 4DZBA 5F6IC 2C9AA 4NRYA 5GGRB 3QFJA 3DVIA 4L9LC 1BLNA 2YD1A 4C56E 1MHEA 1JRHL 4PJBF 3V7AE 3UTZA 5E8PB 2GJ6A 3VW3L 1RMFL 3OKLB 1VFUA 1U0QA 2F9BT 4HKBA 1TZGL 4HC1H 4JFZH 5I1EL 4UQ2B 1GL4B 1WAAA 2HT3D 3T0EB 3W0WA 2OR7A 4J3VA 2NX5B 5ABDE 5ID1A 2G5BA 1F2XK 2PXYC 2EXWC 3DO7A 4PJCE 1I1CA 4KDWA 2G60L 4J4PA 3LS4H 3ZZ1A 3CPLA 2MHAB 2QV2A 5K9JH 3AGVA 4BA8A 4P0DA 2VQTA 4ODXA 5L88H 1S9WA 4XCEB 3RKDD 5D72L 4OZ4A 2AJVH 1ZT4B 2YC1A 1PQZB 4X4XB 5GZOC 4Y0GA 2QQNH 3TA3A 4PG2A 3VXQB 4H26B 3HZYB 4P5TA 1EJOL 2XKSA 1MCFA 4KI5F 2QADC 2VZVA 3LEYH 1A1MA 1T83A 5F3HB 1AE6H 1PG7L 3PWJB 1TFHA 3ZMRA 1I7TB 2PETA 1XR8B 5IROC 3EAKA 3TFKA 4FFVC 4IRJA 2ZKHH 3E2HA 4KJWD 4ELMB 3IAGC 4R90L 4JFOB 5JOFB 3VE0B 4AL8L 3VFWA 3KPPA 3WCYA 4O9HH 1INEL 4KUCD 3REWB 4PRBA 2BVYA 5ALBH 5EZIL 1UCTA 1MAMH 4LEXL 4XXDA 3QWRD 2FX7L 4Y5YA 4G80B 2W9LA 4M7KH 4CUCA 4ZMAT 2WSKA 5F9WC 3L3KA 4JEGB 4R4BB 2HJFA 4WEUD 4YPGA 1N0XL 5I1AB 4YAQA 1EAPB 4H25A 1XIWD 3VD5A 2OQJA 4PLKC 3VMNA 2P24A 3B9VA 1YNLH 1YEFH 4XCCH 1H8OA 2P1YA 4RRPA 1MI5D 2OJZL 3W39B 4CNIB 5LWYH 4OFVA 3MRJA 4GT7A 1OD9A 3JV4B 4MYWB 1AIFA 2AJXL 5CP7A 1K3IA 4ZFOB 1OGAA 5F7YC 3RU8L 1T1ZA 3EYVB 1HH6A 3FB5B 1Z9SA 4QNPE 2VLKB 2R2HA 3QUZA 3MO1B 3O6ML 3EFDL 1W0VB 4ORGB 2YEZB 2Z8WC 2OR8A 2VABA 1Z5LB 2A2QT 4KPHH 4WU5B 3VFRA 4RQQA 1JWUB 4LSQH 5TDPA 5LQBH 3JV6A 1A4KA 4JG0L 4PREA 3MCKA 4PJIA 2AV1B 4LPUA 4XPHL 3V4PH 3MZTA 4TUJA 3V4VL 1QHPA 1WAAF 4PJGB 2HJKB 1J8HA 2B1AL 3GBMH 3H3PL 2E9JA 3UCRA 4Z7OE 2D03H 1KLUA 4HLZH 4I3RL 4YE4H 2CIIB 4KWUA 3RZCC 3GMRA 5ITFA 4M9PA 3QHTC 1CDIA 2VOTA 1V7NL 4NGHL 5E6IC 1SEQL 3UBXI 2DQCL 1Y0LA 2WAHA 4X6FB 4WGVB 4XAWH 1T1WA 2VZ1A 4M62L 4NWUH 3WIIL 1LWRA 1MWAL 4AM0A 2ARWA 3K4ZA 5IJVA 5CP3H 3QDMB 1KCKA 4JJHA 1H9VA 4ZXBD 4LHJB 4XNXH 1MFCL 5IEHA 2FGWL 4WFFD 4CL7A 5TE4L 2ZCKL 3TJHD 4G42B 1N2RB 3JTCA 1UVQA 1GGYA 1EEZB 1KIUA 3WIHL 5C08E 4NC2B 3OJVC 4X7TB 5TQ0L 4E0RB 3FB8A 4M7JH 4HW6A 4XNUH 4G8FA 2VLJA 1HH9A 2IAMB 1FAIH 2ED8A 3BZEB 3SDCA 5C0AE 4XPGH 4JFFE 3ZYIA 3L3OA 2CJUL 2Y5TA 3ZDXE 2PYEB 3CVHL 4K9EL 2A74B 4KQ3L 2NY4B 2E6PA 2NY0B 3QUMB 1U9KA 4PTTA 4PG9B 1J8KA 1IAOB 4M6NL 3QUYC 1H8NA 2H8PA 3IF1A 4OUOA 4LCIL 1OSPH 3TNMA 3PABB 5TF1L 2DQFB 2NYYC 2RBLA 3ECBA 3Q3GB 5CKAA 3TO4A 4Y4HB 4UINL 5CZXD 1NCCH 3QEHB 5EULV 3CIQA 4FXKB 1DQQA 5KSVB 1OAZL 4V1DE 2YZ1A 4HH9A 5J6GA 5F6IB 2ICWB 4RMTA 1YUHB 2B0SL 4W6YB 5E9DA 2WMPA 1C1EL 1RI8A 2HKHL 3DYMA 1I1AD 2FECL 1JUFB 2EIZA 2VDLH 4J1UA 4L5FL 4HIHB 4OGAC 2NLJB 3I2CH 3MNVA 1LK3H 4R26H 3MBEC 1PY4A 3UZVB 4Z7UA 4IMKC 4I5BB 4AIZA 4P23D 1BJMA 3B5HA 3T09A 2JB6A 2EZ0D 1E4KA 2MQ0A 1AY1H 5DRWB 5IR1A 5D8JH 1DN0B 1WIPA 4MZ2A 3MJ9L 3PDGA 3VA6A 4U7MA 1J0KA 1U8PB 4GAGL 3RWJA 2WIIB 3TESA 2QQKL 5J1AB 5IHUL 3F7YB 4HS6A 4HIJA 4RNRA 2RFXB 3MFGB 4H88L 4OKVA 2J5LB 3W9EA 1UB6B 5HDLA 4HPYH 25C8L 3BDBA 3V79C 2DQTL 3CMGA 3K3QA 4FQ1H 35C8H 1F58L 4BZ1H 3RY4A 4U7KA 4N68A 3I6KB 1VGKB 1W8NA 1ZT1B 4N0CA 3VRLE 2UZXB 1YY8A 3UJTH 2A6KA 5JO5B 2X4OB 4X99A 3SQOL 4X6CB 2CDGA 4KVCH 1G0XA 5FUOH 4TVSa 2ZG3A 1Q9WA 4WCYL 4CU6A 1X4ZA 3HPJB 1U92B 3FQNB 2XIDA 4MA7L 2DWDB 5F9WB 4YZFF 3BUTA 3VXPB 3L7EB 3WL9A 2D7QA 2MWCA 2R69L 1RZIA 3L5IA 4NZRH 3PWPE 1ZLWH 1MLBB 4KRPC 3NFSH 4MSWA 2HFTA 4TYUA 4HWBA 5MEQA 1A9BA 1IC5L 3GMQB 3PWUB 2Q86B 4NQXA 5BZWB 2XN9E 4N9OB 1AO7A 3JWDH 1QR4A 3V5DB 2GUOA 5T3ZL 1A14L 4NT6A 3LPGA 2OJEA 4LVNC 5K9OB 3AM8C 2FO4A 4HS8H 4R9HA 1FNEA 5C0FB 5DJ8A 1E0OB 5DRXA 4MJ4A 3O3AB 2F54E 3HS0B 1QBBA 3U1SL 5MI0C 3WFZA 4KHTH 5JZ7D 3M17B 2X4QB 2DTSA 3OMZA 2Z4QA 1RZKL 1T6WA 3CMOL 4K7PY 1RURH 5FHBL 5F9OH 5ADPL 1WQVT 1A47A 1DVFC 3UTQB 2YD2A 3OX8B 3L3IB 1KJVA 4EDWH 4NBXB 5FOJA 2VWEC 1MF2L 3HC3H 4UOJA 1AGEA 1V05A 3RUGF 1EHNA 1UM5L 2H32A 2X4RB 1AR2A 5SWSD 1Z9MA 4YHLL 3TN0C 2IANE 3WSQL 5CSZB 2AABH 3U46A 5E6IB 5ICZA 3G08B 4KKBD 5T3ZD 3O11A 1I3RA 3P77A 3UJIL 4M4RA 3QFDB 1T5XA 2Z8SA 3QUXD 3BD4A 3C9NA 4PGCA 5DQDH 3MUZ1 2R2BA 5DUBA 3PWNB 2R9HC 1D5BA 4MNGA 4WTXA 3SKMA 4JHWH 5GISL 4M7LL 1A6VH 3IGAA 1UG9A 3IDMA 4GKOA 4WFEE 5JOPE 4HV8A 3RWHB 4WWKB 2Q20A 3CVIH 2PR4H 3V0WL 4NKMA 1PDKA 4LP5A 4W6XB 3WIFB 1U3HC 2YPKB 1A7NL 1KENL 1ZS8B 3DTXA 5DGQA 3SQBA 5HI3C 2WUCL 3HRPA 3VFPB 5C0RH 3DV4B 1P4IH 3B4NA 2ARJB 4S0TD 4JKLA 3QUYB 2P5ED 3DMMC 3QWQB 1NBZB 3OKLA 2ESVE 2R29L 2DQUH 2Y36L 1CFVL 3SJVE 1KIQB 4OIBA 3T0EA 3GSWB 1WWBX 4PJCB 1U6AL 3RKPA 1EGJA 3QJHA 1GPOL 4AMKL 2CUMA 2VLME 2W91A 4HK3J 3LV3B 3TYFA 4FQXD 4LLYB 4PP2B 5FM5O 1RQ5A 5J1TC 5L2KD 3I3BA 2EDDA 4JN1H 2VERN 4OM1H 1A7OL 1D5IH 1ZT4A 2MPAH 4X4XA 5F1IB 3ZT5A 4ZO9A 4QOKA 3MUY1 1IC7H 4ZPTA 1N6QL 4LIQH 3UBXB 3BGMA 2IBBA 4XWGL 4H26A 4XNYH 3HZYA 3JWDC 3VXQA 5C8JB 4RAUB 1KTDB 3BDYL 3L95A 4R0LA 2DBLL 1T03L 3DROB 1A4JB 3BQUD 43CAA 1R24B 2X7LB 5D7JD 4KKLC 2GTWB 1I7TA 2F5AL 3LPFA 1XR8A 2J8UA 5TFSL 1VEOA 3SGKC 1AJ7H 2VH5L 4ELMA 5CIPH 4C59B 5JOFA 3P40A 3IFLH 3BEWB 4J7RA 5FCUL 3BIBX 1LDPL 1SMOA 3REWA 2E7LC 2DJUA 2AGJH 2HFGL 3B83A 3KJ6H 3VA2C 1FVDB 4QRPD 5DRZB 5D1ZA 4R7NB 2DQGH 2AJSH 5DEFA 3DSNA 1KFAH 4GLRH 1CDBA 4R4BA 2BJML 4RFOL 3E6FB 1EAPA 3QEGL 3IDYC 2VMFA 4M5YH 5IWLA 1CLOL 1K9TA 2YRPA 4MAUH 4JM2A 4QHKJ 3TBTB 4GRWH 5BV7L 5J3HD 4XPAL 3W2DH 4AY0A 4CNIA 3JV4A 1D5XB 4PJ8C 5K59F 4ZFOA 3SGEH 5DUPL 5D1XD 3EJYD 3DV6A 3ZKNC 2DM4A 2VLKA 3QA3B 4KRPB 1B2WL 3H9HA 3MO1A 5GGQH 4ORGA 1W0VA 4MAYD 5CGMA 3I6LD 1CZ8L 3D87B 1Z5LA 2Z8RA 3NPSC 2HLAB 1WBYB 2GQHA 2CK2A 1PX4A 5B39B 1KLFA 5KSUB 5MEOB 1IGMH 1U2CA 4P49A 2AV1A 3SDDD 2IFFL 1MCWM 5INDB 4F7TB 5DI8A 5EFIA 1U8MB 1H3WM 1HHHA 4LVNB 2FHCA 2VNCA 3PQYA 4PJGA 2HJKA 3OB0H 4H1LG 4TQEH 3U30B 1KNOB 1ACYH 2GFBB 5MI0B 1UCBH 4GLRI 1R5IB 1HHGB 5FA3B 4Y1AD 2GAZB 1DVFB 4D9RD 4UT6L 1LEKB 1MRFL 3ARFA 5HYSG 5DMGC 4ODWA 1GGBH 4POZC 2FJHA 1NLDL 4X6FA 3F5WB 5GS2D 3MLRL 3WD5L 3TIDB 3SGEI 5HDBE 3TBYB 4RCAA 3GBNH 4B5EA 2NR6C 3S34L 4G42A 5C08B 1BJ1J 3T1FB 5L2JB 1JRHH 1MIEH 2V9QA 1N2RA 4J3UA 3C60C 1WBZB 5D6DC 1ZK9A 4X7TA 5FOBB 1RMFH 3VW3H 1RK0B 2YRLA 1FZMA 2PW1B 4JFFB 5GGTA 2IAMA 1TZGH 4FNLL 5I1EH 4ELMF 5DEGB 4I0CC 1DQTA 1I75A 5DUML 4Q2ZA 2PYEA 1AQDB 2JELL 1YYML 4ODBD 2BVPB 4F58H 1T0NA 3QUMA 4PR5A 4EN3C 4GUPB 4PG9A 4TVPE 1V3JA 4WW2B 3UTSD 3V9FA 4GQPH 4E41E 3E8UL 5CJXC 2OSLB 3RL1B 4P2QB 5ACZA 5IHZA 4I4WB 3PABA 5D72H 2DQFA 2EXYC 4GRMB 2IG2L 2XZZA 3Q3GA 4J3WA 1IGCL 4Y4HA 4PRAB 2NY1C 1M7IB 2PTVA 4V1DB 5KSAC 3CSYB 4JFDB 1EJOH 2CIKA 3WXWL 5HGAB 5KSVA 5B3JF 3O4OC 2F58L 2QHLA 3KPNA 2ICWA 3ARZA 3Q6FB 1RY7B 2DYPA 4L9LA 5JDSA 1JYVA 1I7RB 3S8WA 3DMMB 1JUFA 3MV8D 3UROR 1URLA 2NLJA 4R90H 4WNQB 2H1PL 3F7RA 1DN2A 1INEH 1CI5A 1N4XL 4I5BA 4U1IB 1LO4L 5EZIH 2UUDK 4LEXH 1N7ML 2FX7H 3OSKA 2CRIA 3RFZC 2PXYA 5I1LB 1TENA 3B43A 3QUKA 2D7TL 1QSEB 1XF3B 2XWTB 4LF3A 1N0XH 5DRWA 1DN0A 1LDSA 3K81A 5LGJA 1HQ4B 4N5ED 4NCDA 1U8PA 3LEVH 5EBLB 4FQJL 2OJZH 5J1AA 4HDIB 2RFXA 4OAWB 2AJXH 3SKOA 1YQVL 1YEEL 1ETZB 3LY6A 3AS2A 4MHHG 4A6YB 3MV7D 3RU8H 2HT3C 5FUZL 1ZT1A 5IROA 4OTXH 3NACL 3FTGB 3L5HA 3LVEA 5IMKB 4LSVL 5JO5A 4JG0H 4X6CA 3T0DA 4Z7VB 2DI7A 3EFFB 3RKDC 4FTVE 3G6DL 4XPHH 1T7WA 1JHTB 3S96B 3UEZA 3V4VH 3HPJA 3T8XB 2M8XA 2Z91B 3FQNA 3PWPB 5IKCA 2J6EA 3VXPA 2W0PA 5F7WC 3VFNB 2B1AH 2CDEB 3H3PH 3RVVC 1HKLL 2ATKA 1MLBA 3S97C 4I3RH 1B90A 5IB2A 1OPGL 3IDYB 3U2SB 3BISA 1QP1A 3CXDL 3GMQA 3PWUA 4JJ5B 1ACZA 2R8SL 1V7NH 2EDFA 4NGHH 1SEQH 1ZSDA 3HZVB 1NCBL 4M62H 4KJWC 1MWAH 1A7RL 2KZ1B 1JNLL 3NVQA 1IE5A 2F54B 5FYKL 1MFCH 2FGWH 4LGRB 5JUEL 5TE4H 2ZCKH 4CN6A 3O3DA 3U0PB 3O3AA 3HS0A 2BX5A 4X98B 3V4UL 3WIHH 2X4QA 3K8MA 2LAAA 2DKUA 5TQ0H 3NPSB 4I0PC 2XTJE 3QPQC 2NCMA 3QULB 1XIWC 3MOQA 5T1LA 3L3IA 1H3PL 4NRZB 4EDXB 4OLEA 1VB9A 4R4NC 1DLHB 5TPWL 3LMJL 4K9EH 3CVHH 1NL0L 1ITCA 4KQ3H 4QHKI 1IM9D 1A6TB 4JO3L 3LOWA 4M6NH 3O2DH 4R3SB 3N1QC 2IANB 2X4RA 1FP5A 4LCIH 5TF1H 3RZCA 1ZGLB 3E3QE 2YD4A 1A9EA 3CD4A 5CSZA 1BJ1H 1FQ9C 1CGSL 5E6IA 4UINH 3HG1D 2CUHA 1R3JA 2XNAB 1NAML 5HSFA 1HCFX 5IV2B 5FYKD 1H3XA 1OAZH 4HC1A 3QFDA 5SX4H 1KB5L 5HHOD 1FFRA 3BN9D 4JKWA 4YFEA 2WP3T 4XP1L 3L3DB 3H9YA 2B0SH 3W9DB 1C1EH 4GAJL 2HKHH 4K3JL 3PWNA 3C60B 4L5FH 5C0CE 4FFYL 4MXQD 4NNPL 3SDAC 3V6OA 1Z9OA 4X5WB 4JPVL 4ZUVB 1KUMA 3RWHA 2XT1B 2EDQA 3WIFA 1DLFL 1ZS8A 4XMKL 4G8IB 5I66A 4P2YA 1N5YL 2IF7A 2VZSA 3ET9F 3VGAC 1UACL 1HK6A 1S7WB 3HMWL 2FZ3B 3DV4A 3C5ZD 4EN3B 4JZOA 4EUPG 3MJ9H 4X7CC 4PLNC 3QUYA 3WEXA 3RIFF 5EPMB 4IRSD 4XCFL 4BYHA 4Y5VC 1ZTXL 4GAGH 2LFGA 3Q5TA 1NBZA 2QQKH 3M8OL 5IHUH 5JXED 3CJJA 4H88H 1OARL 5A2KH 3HLAA 25C8H 5KSAB 3WHXB 2DQTH 2JJUA 2P8MB 1KIQA 3GSWA 3VWKD 1F58H 1FL5B 5SX4I 1HWGB 3D39E 3LQZA 4JRXD 1UEYA 1WFUA 4HBCL 4ISVA 3LV3A 1VFAA 3T77B 3C09B 4MQTB 1UWGL 3AS0A 3TBWA 1S7SA 2CR6A 3MBEA 4QCIB 3SQOH 3DX8B 4IMKA 5F1IA 2XWBA 3UYRL 4S1QL 3QYCA 2P46B 4WCYH 4ZNEE 3IVKA 4YPJA 2F74B 5C8JA 3FHAA 4MA7H 4U6XB 4YHOH 1A4JA 3QHZL 4NQEA 2R69H 2AI0L 2ICES 4XVUD 1IQDA 4MZ3A 1R24A 4QT5B 2X7LA 4IOFC 1IGYB 4MQ7A 2GTWA 4CW1B 3LKOB 5D2LF 4IS6A 4RX4A 1BX2B 3ZHKA 1I1AC 3DXAA 4MA8H 1WV7T 3D9AL 4HUVB 4TUOB 4RGOL 3OQ3B 3BEWA 5C0JB 2JIXB 5T3ZH 1A14H 1FVDA 3MXWL 3O4LA 5DRZA 4YHPA 1DTUA 2CKBB 1IGJB 3MRIB 4HG4J 1EFXD 3FQRB 2HA1A 2WQ8A 4K9EC 3U1SH 1NC4A 2EZ0C 4HSQA 4LSTL 1ZANL 3E6FA 1RZKH 1L6XA 4JFED 4G6KL 2VQUA 3CMOH 1QUNA 5FHBH 5ADPH 3BRFA 1FYTE 4P48A 4WFHE 2OI9C 2Z92B 2JE8A 2VL4A 4X6BB 3MV9A 4JANB 1MF2H 1INDH 4NSKA 3FB7B 3V5KB 3CX5K 3GI8L 1NAKL 4EBQL 1S7UB 5I8KL 5CP3A 4CJ0A 4OZFG 3LN5B 4LL9A 1OB1B 3WXVL 1LP9E 1CS6A 1KGCD 1R3KB 4RDQF 1L7IL 2VQ1B 2XTJC 4YHLH 1SBSL 1QPPA 2KL6A 3ZE1E 4QWWD 1FFOA 3N85L 1WBYA 5B39A 5KSUA 3IJYB 3OL2A 4AQ1B 3ULUF 3HAEG 5C70A 5HVFB 5GIRA 3UJIH 1T04A 3GHBL 4ZUTA 1T4KB 4XBEL 1T89C 1S9YB 4JFYB 4F7TA 4KRMB 3AM8A 5IM7B 2YOCA 3QDJD 4PJCF 1CICD 3GSXB 2FWOA 1KNOA 2GFBA 3RWCB 3E3QC 5TDNB 3EJZD 5GISH 4M7LH 1OHQA 3V7MA 4NO3A 4I0PB 3S4SA 5INCB 4KKAC 5FA3A 3L3HB 1E4JA 1CIDA 1CL7L 1DVFA 1ORQB 2GAZA 3STZB 3V0WH 1LEKA 1T80A 4UV4L 1A7NH 1KENH 1JZ3A 2WUCH 1WZMA 4ELKA 3F5WA 5HYFA 4QHUB 1MI5B 1YPZE 4JRYE 3V52L 1MCDA 3CK0L 5IGXL 1UQSB 3TIDA 4KK9C 4L1DA 1BFOA 1YC8A 3SDXE 5C08A 3EO1B 5L2JA 3TT1L 5DJYB 4LSUL 4UT9L 3BWAA 3VWJD 4NP4L 3TN0A 1N6VA 4JN2B 2FCBA 3WS6C 3T4YA 5DQJB 5BRZD 5ALCL 1RK0A 2PW1A 1BIIB 2R29H 4JFFA 4M00A 2Y36H 1CFVH 3JWOL 5DEGA 3UXFA 5ICXA 1U6AH 1TJGL 1F42A 1GPOH 4AMKH 1FGNL 4EZMA 2CD0A 3P4LA 1HQRA 4E41B 4K94L 4NQDD 4GUPA 5M7QA 2JJVA 4ZFZA 4KAQL 3SDAB 2OSLA 4P2QA 4ZOCA 4I4WA 4UDUB 1A7OH 4LU5L 3F6IA 3KJ4C 4GRMA 2XY2A 2YKLL 1U3HA 1CGWA 1GAFL 1M7IA 1FZKB 4U3HA 4V1DA 3FRPG 4XWGH 5TJWK 3BDYH 3CSYA 4JFDA 2DBLH 3TYGL 1T03H 4KKBC 4QRQB 4JY4B 4UQ3B 4LPVA 4ZTPH 4QNPF 4GW5B 1GH7A 3BE1L 3BWUC 3L6FB 5HHMA 3QUXC 2EDJA 2F5AH 1I7RA 3DMMA 5F71A 5TFSH 3RWEB 1A6PA 2VH5H 5IBTL 4CVXB 4OF0A 4ORZC 3IDGB 1KC5L 5D96C 4JM4L 1RZKC 2NY2D 2FL5B 2CQVA 5FCUH 1LDPH 2NXYC 4U1IA 5E1HB 3C87A 2HFGH 2QLVB 4H20L 2OTUB 1E6OL 1PAMA 3STLB 1F45A 3KWWB 1TCMA 4J8RB 1QSEA 1XF3A 2BJMH 2XWTA 4P5MB 4DUVA 4Z7OF 1CVSC 5EOTB 1HQ4A 3QEGH 4URTB 3EUUA 3OPZL 1LE9B 1OW0C 1CLOH 4GRLD 2X5PA 2V9TA 5BV7H 4XPAH 4KJYA 3EYFA 2YD9A 4NC0B 4OAWA 4PV9B 2WNGA 3Q0HA 5HYEA 3MRLA 1C5BL 5DUPH 3RJQB 5GS2H 1MWAB 1MRDL 1OP3H 1OL0A 4UOW0 3FAWA 4FZEL 2JJSC 1CZ8H 5EZLA 1U8IA 3SGKA 3PL6D 4FQXC 4NQVB 3FTGA 1I1AB 3HZMB 4IHOB 4OD1L 5IMKA 5JA9A 4Z7VA 1W72L 1YEGL 2W38A 2IFFH 1J88A 2E7LA 4OSUH 5GRWA 3C6LB 2PO6D 3RA7L 3EOAA 3KPRE 3SE8L 3T8XA 2Z91A 3ZDXF 5TGBB 2OL3L 1UJ3C 2YPLA 4OCMC 4ONOA 5EIIB 2HT4D 4TRPL 3U2SA 4WW2F 4JJ5A 5FYJE 5KAQF 2OI9B 2X70A 1KPRA 1MRFH 5D7JC 2W9DL 5D2NC 1YZZA 1T0PB 1H15B 1NLDH 3HZVA 4E42B 4HKZB 3LH2L 4BQ9A 3MLRH 4PJ8A 2HFEB 2DMCA 5T5NF 3WD5H 4HEME 3WBDA 3FFDA 4P4RB 1P84J 2F54A 4LARL 4P4KA 4AYFA 1VHPA 1VEPA 3S34H 3T0XA 2DS4A 2XTJB 2ZZUT 1MCSA 3HE7C 3HKFA 5DFTA 1C7TA 1ZLUK 1O7SA 4UDTB 4ODUA 2IWGA 3Q6GL 4FNLH 2ERJC 3QPXL 4NRZA 3VU2A 2RJMA 1FAKT 5DUMH 1U8HA 5J3HC 1X9QA 3LAFA 3V8OA 3VRJB 1NKRA 2JELH 1DE4B 1YYMH 4DZ8A 1AD9B 1A6TA 1UM4L 2ZSVB 4NDMB 3QDGD 3E8UH 4R3SA 2E9IA 4ZFGL 3EJYC 3MRBA 1ZGLA 1CLZL 2IG2H 1EHAA 4L8SB 4MAYC 4XC1H 1YQ2A 1B0RB 4RBPH 4G6FB 4YR6B 4DVBA 2XOTA 2XNAA 2QBWA 1QBLL 4BQ8A 3WXWH 5IV2A 2X9WA 2HLFD 1X7QB 2F58H 2DL2A 3SDDC 1G7LB 4OLXL 5C0CB 3W9DA 1ONQB 1YYLL 3C60A 3VRLF 4X5LA 5HYSB 2AXGA 4MD0A 5E56A 5D6DA 5D70L 4X5WA 3TZVA 5HGHB 3T2PA 5E2UL 2ENSA 2H1PH 3BKJL 1XCQA 3BGFC 4DGIL 1N4XH 1WBXB 2X89D 4KGJA 3O6LL 4LSDA 1N7MH 5KSBA 4QRTA 4DUWA 1V8HA 2FZ3A 2D7TH 4CN4A 4EN3A 4JFQB 1MSPA 3TEUA 1XGQB 5C3TA 2UVEA 4G5ZL 5I74C 4DFIA 5E70A 5EPMA 4GKZB 4KGLA 1YEIH 4FA8A 3KJ4B 5F8RC 1RFDL 4FQJH 1UGNA 2O61B 3BP5A 4RISL 5CIPA 1YQVH 4KDVA 1YEEH 3NIFE 2VAAB 3D39B 3WHXA 4KI5D 5L8KB 4LNRB 2VDKL 3ROLB 1E27B 3UTTA 1BQLL 2J4WL 2FR4B 4I9WE 3QUXB 1H3TA 3BPCB 3T77A 3B6SB 4PJDE 2VLRD 2CLRA 3NACH 2PN5A 4LVEA 4NNYB 4LSVH 5B4MD 3BP4B 2Y07L 3DX8A 4C57C 1ZMYA 2NXYB 1HHKA 3X14B 3G6DH 5EORL 5JHLL 5F1KC 3G6JA 2F74A 1T1YB 1TCRB 3QNXA 1JHKL 3RNKA 4O00A 4U6XA 3IKCA 4HIIA 4EIZC 3MLXL 3MNWB 3S37X 3NTCL 4PRHD 3VMOA 4YDVB 1OPGH 3WMSA 1IGYA 3CXDH 3DGGB 3VH8G 2R8SH 4DOHE 5K9KB 3PIQB 2MTPA 1NCBH 1P4LB 4LSRL 4TUOA 4HUVA 5E5MA 4L8CB 5C0JA 1A7RH 2XPGB 2A6DA 1JNLH 4G9FD 4AT6A 5FYKH 3MR9B 4OM0L 1OP9A 3HPLB 5JUEH 3BSZL 1IGJA 1FYHB 3FQRA 2QTEA 3GJEA 1CT8B 1ULVA 2NQCA 3V4UH 1FYTB 2YWYA 1Y18B 1I8IB 2R39A 4FZ8L 2YK1L 3FCTA 2GK2A 4H8WC 2VL5B 4N5EC 3BGAA 4JANA 1H3PH 3CLEL 3V5KA 1NL0H 1NBVL 4OCWL 5GGUA 1S7UA 1LP9B 5BVPL 5E2JA 4JO3H 4J4PD 1R3KA 1UJ3B 5FYLL 5FKAB 2VQ1A 4CVUA 1JYNA 1QLRB 3KHOA 2PTUA 5D7LE 4F7EA 1Q1JH 5D7JB 4CJ1A 1CGSH 3RP1A 5D2NB 1TTGA 1NAMH 1JNJA 3TA3D 4DN4L 1T4KA 1KT2B 4LLAA 4XNQA 3L5JA 1BFTA 1KB5H 1S9YA 4DK6A 1NFKA 4LSSL 5IM7A 4XP1H 1DBJL 4OCYL 4X0KB 2VR4A 3GSXA 4L3AA 4WFGE 4GAJH 2QR0B 2C3VB 4K3JH 3AY4C 3IJSB 3HE7B 5TDNA 4FFYH 4NNPH 5HXMA 4JPVH 5DK2B 4H5SB 5GRYA 3L3HA 3UPRB 1XIWA 3O81A 1LO3H 4X6DE 1YPZB 4LRNL 2H9GB 2K1MA 4XMKH 3PNWA 1N5YH 1MI5A 3JV0A 1UACH 5I1JL 3SDXB 3HMWH 3WFDL 3PHQB 4PGEB 1IGFL 4JVUA 3GI9L 3NN8B 5FYLD 1U8LB 1KIPB 3MROB 4LCUB 3U4EB 2X9XA 4OBSA 5DVOA 3WLBB 1BVKB 1ZTXH 4JN2A 4POYA 3M8OH 4MAYB 4OBRA 2R0KH 1OARH 1RZ7L 1BIIA 32C2A 4P3WA 1QRNE 4KXZH 4PJXE 3RIFK 4PLOB 4DVRL 1NGWB 1OGAD 4HLJA 5FXCH 4HBCH 3MYJA 1HWHB 5ISZD 3SDAA 3VXNB 2AERT 5DSCB 2HVKB 4BSVB 2OM5A 4G7YL 3IT8D 4MNQE 1LGVA 3BGFB 4DTGL 3UYRH 4S1QH 1N5AA 2EYRB 4NQSB 4HZAA 4Y1AB 1NDGA 5I8OL 5JHDD 1FZKA 2YD5A 4L8BB 4ZPVA 4QRQA 4JY4A 4UQ3A 1PJ9A 3QAZC 3QHZH 4Q6IC 2AI0H 4UT7L 5HVWA 1AFVL 3UTOA 3IS1X 4ZXBA 3L6FA 3BN9C 5I74B 1MLCA 4Y5VA 1JP5A 3L5WB 1MCRA 1J18A 2FJFB 3OJ2C 1CDHA 1OP5K 2IH3B 1YNKH 3BMWA 3IDGA 2FL5A 2H26A 3D9AH 4RGOH 5LCVL 1R6VA 3OAYK 4OQTL 5E94A 2E8YA 3OKOB 1U93A 2C3GA 2UWEE 3MXWH 2OTUA 4EUPB 5A40E 3MRKB 3G5YB 1RIUL 4HGMA 5IHLB 3STLA 2Q76A 4JGMA 3R8QA 5C2BL 1J5OL 5CGYC 3KWWA 3RGHA 4J8RA 4LSTH 3RIAF 1ZANH 1ZAGA 4P5MA 2FSEB 4LLQB 4PRPE 4QTIL 1B9ZA 4TOYL 1G7MB 5EOTA 4G6KH 5IVOA 3C5ZC 1EMTL 3BN3B 5CBEB 3UTSB 1WICA 1XFPA 1BZQK 1NFDE 5B38A 4IRSC 2V7NA 2O93L 1ZA6B 4FS0A 5JXEC 3GI8H 1MWAA 1NAKH 2X09A 4ZS6D 5I8KH 4V3DB 5HDBF 2FYYA 3OGCA 3MV11 3DPBA 1CE6B 3VWKC 4QXGL 2W0KA 1Z2KA 4CKVX 2N56A 4YBQD 5HI4C 3OAZK 4Q9QL 5C09D 1F11B 3CDCA 5FK9A 2EC8A 1CF8L 1J1XL 3WIHA 3B9DA 1I1AA 3HZMA 4IHOA 1RJYB 4EQ2A 4I0KA 1QNZL 1SHMA 3T0VA 1NBYB 4OT1L 1GYAA 3GHBH 3KPRB 3ARBD 1OF2B 4XBEH 1RUAH 3C2AL 2DRUA 2H2SD 3QG7L 15C8L 1C16B 1G1YA 4D0DB 4D9QD 2I07B 1BBDL 3CVHA 2MKWA 2W60A 5TGBA 2YD8A 3VXUE 4Q9RL 2HG5B 5JA8B 1UZ6E 3MRRB 4QLRA 1IM3B 4W4OC 2YPVL 4XVUC 5TE6L 4PJHE 4YQXL 1HSAA 3ULSB 1CL7H 2OI9A 4BFEA 5CWSB 4UV4H 3RQ3A 1NMCB 2CLZA 2R2EB 3ARGD 1H15A 4X9HA 1GOHA 4E42A 1EDQA 4WVRA 3RVXD 3V52H 3BZDA 2HFEA 4MXVE 5IGXH 4I18C 1DBAL 1ZEAL 3LQAH 5HYQB 3O8XB 3LHPL 3T0BA 3ALWA 2VZUA 1WC7B 3TT1H 3F58L 4LSUH 5IW1A 4NP4H 5CILL 3O45B 4NN5C 1HN1A 4RWHA 5ALCH 2EE9A 4ENED 4KI1A 4UDTA 3RY5A 2ZCHL 1NGYB 1MJUL 4OI9A 5D7IE 3HC0B 1IARB 3IU3A 5K93A 3JWOH 4YFLF 2AK4D 4FOMA 1TJGH 1T89A 4OZFB 1JJUA 3EOYG 4FG6D 1FGNH 1R3LA 5GRZA 5E2VL 1U3YA 1DE4A 4IIQC 4K94H 1AD9A 1IBGL 2ZSVA 4IRZL 3WKMH 3B9KB 4I77L 4KAQH 4BQCA 1P7QB 3EHBD 1MUJB 5I15L 2XICA 3T2QA 3HAEB 5KS9E 5AYUL 1XGRA 4K3GA 5E8NB 1B0RA 5FECB 2VAJA 5F7MC 5DJXB 2YUZA 3I75B 1GAFH 5DT1L 3TYGH 3VD3A 5D93C 5FO8A 4LLVA 5IW3A 1G7LA 1OSZA 4I3SL 2BOBB 2V2WB 4AQOA 2WUBL 4NJ9L 4NCC1 2AEPL 5BW7C 4XHJC 3WS6A 1CICC 2BY1A 4U4BA 5IBTH 5JTWA 4YLQT 1KC5H 5T1DL 4JM4H 5HGHA 3EJZC 1FFPB 1FO0H 3CFDB 4D0CB 2XQYK 4FQHB 1AO7D 1WBXA 3K8LA 3IETB 1P4BL 2K9UA 4H20H 4ACPA 5EBMA 3ARUA 1E6OH 3JBG7 1A22B 4CVWA 2QL1A 3TC9A 1QFWM 2W1NA 3TVMC 4YNYA 4JFQA 5C0BD 1E4XL 5DHXB 1MVUB 3OPZH 5C0DB 5ITBL 3D69B 3SKNB 3T2OA 1RULL 4U0QB 5J6HA 3A6CL 3FQUB 1C5BH 2ADJB 3GK8L 5GS0C 1MRDH 1WIOA 3BPNC 5L7XL 1JFMA 1U58A 4LNRA 4Q6IB 1SVCP 1G6RL 4PJDB 5CZKA 1K5NB 4OD3L 4KK5D 4FZEH 2HJLB 5DZLA 2YD6A 3QUXA 3CCHB 3K2UL 1JWSA 4X4YA 1DUYB 4OD1H 4NNYA 1JYXA 3BP4A 2GITA 2BCKB 5C07D 1FNLA 1W72H 1YEGH 1NCNA 3O3UN 2YUWA 3X14A 2ED7A 2H3NB 5IB3B 3F6LA 4NZDA 2WY3A 4QRUA 4DKEL 5JIIA 3BZ4B 3SE8H 1T1YA 2FEEL 2DD8L 3HE6C 5KJRL 4FXGB 2GKIA 2OL3H 3T65B 1WCQA 3MNWA 4WI5A 1MFBL 1RJLB 5FB8B 1K8IB 4HH8A 4DOHB 3MLVL 1U2HA 4JHBA 5J9PA 4TRPH 2EE2A 1OW0A 3JTTB 2W9DH 3S3PA 5K9KA 2KZWA 3PIQA 3QEQE 3LKRA 1M4KA 1NDMB 2VKWA 3H7BA 3LH2H 5D5ME 1KF9B 2NY2C 1KIRA 1AGCB 1DP0A 4LARH 2ZG2A 5DC0A 4KKCD 4K2UL 4OZGE 4JRXB 1CT8A 2JJSA 2WINA 3GRWL 5TQ2L 1Y18A 5DJAB 2H2PD 1O5DT 5EO1B 1I8IA 5J56B 3F12B 4D8PB 4FQXA 5KVEH 1UXSB 2VB5A 3BO8B 3Q6GH 1QLFB 4M48L 5EU4B 2FH6A 3BJLA 4TSBL 3QPXH 3O6FC 4GRLC 4ZUWA 3P0YL 3T0ED 2NX5D 3H7LA 3IU4L 1LP9A 1UM4H 1FV1B 1VEMA 4YGVB 4PJEE 3ME0A 1UJ3A 4JFHE 4ZFGH 4F37F 3BQUA 5JW5A 1QLRA 4QYOA 2HMID 1CLZH 3LN4B 2NY5L 4TN9A 5D7JA 1SM3L 4G59A 3ZT7A 5D2NA 3WDHA 1QBLH 3R06A 4GH7B 2PYFA 4MJ2A 1Z0MA 2IADB 3C5JA 1UZ8B 4I18B 1KT2A 5E99H 2I27N 2N7BA 1I4FA 4ZFOL 5ESAA 1S5IL 4OLXH 4CMMB 2UUDH 4JVPA 1YYLH 2C3VA 1EFXB 2NY6B 3BP6B 3IJSA 4K8RL 3HE7A 4JCLA 4PJAE 5JLZB 4NN5B 5F7LB 5D70H 4X6DB 5DK2A 2LU4A 4H5SA 5E2UH 5J11C 3BKJH 5HJ3B 4JFEB 4DGIH 4Z7NE 3G9AB 2HT4C 3EZ8A 3O6LH 2FJGA 4R97B 4FQIL 3KPTA 4OIAA 5MHSE 1XF2B 2BSRB 3DJ9A 1K4CB 4U0RC 3HUJE 1EO8L 4IIQB 1H8SA 4M93C 4PGEA 1LK2A 4P9HH 1I3VA 1HDMB 4G5ZH 4LCUA 1BVKA 2ZUTA 1RFDH 2PCPB 1QRNB 3R0MA 2Y72A 4RMSA 4MAYA 4JQIL 4PJXB 3DVNB 4RISH 4YGAB 1A6AB 2D7NA 1DBKL 1FH5L 1F13A 3VCLB 4WEBL 2VDKH 1QO3B 6FABL 1NGWA 1OD7A 3SDDA 1S7TB 1QA9B 1BQLH 1AKJB 2J4WH 2UV3A 2HVJB 4K8RD 2IQAB 3VRIB 1CICB 2I5YL 4MNQB 4MX7A 1ED3B 4I48B 1MCEA 1JCKA 3ULVE 2HH0L 3VFOB 1BD2D 1CFTB 2HVKA 4HZLA 1D6EB 1NLBL 4U1KB 4BSVA 2Y07H 1OTTD 3X3FL 2EYRA 2W9EL 4Y1AA 3D0LA 2DIAA 5JHLH 1CQKA 1J10A 5GGTL 4NPYA 4DGYL 3KYNB 4L8BA 4WI4A 1JHKH 2ZUYA 3WFEL 1DSFL 2DI8A 5FF6B 2XXMB 3TVMB 2ZUQC 4TTGA 3MLXH 3TF7C 3D5OF 4PY8J 4ZUUA 2GY7B 4JVWA 3TGXA 2HLFC 3NTCH 1MCOL 1JN6B 4PJ7A 4QRRE 4WO4C 1BQUA 3MJ8B 4LGPB 5FDWA 5CJ8A 3ZE1F 1CE1L 1JGEB 2E27L 4LSRH 2R23B 3QNZB 2UWEB 4LPWA 5BO1L 3PWVB 4YBLC 3BPNB 3OKOA 4OM0H 3D85D 3BSZH 3G5YA 3QDMD 4PRPB 1PKQE 1H0DA 1MCWW 3ZKXC 4QXTB 4RMUA 4WHTB 3U7YH 2M2DA 2FSEA 3DIFB 4BUGA 1G7MA 1HIML 1NFDB 4FZ8H 4KJPD 2YK1H 5CBEA 1M05B 3D3VD 3UTSA 3OKEB 1F2QA 3BKYL 5JMOC 3OKNA 2P43B 3BKCL 3CLEH 2EDEA 1ZA6A 1YPZF 1TZIB 1NBVH 4XAKE 3HE6B 4OCWH 4RGMC 5BVPH 2RCSL 5IJKC 2L7UA 3M1BB 3SDXF 2NY4D 2NY0D 2QSQA 5DFWH 5FYLH 4Z7QE 3BUYB 3H9SD 4NWTL 1YMHB 4X9BA 4DK3A 4GS7C 1BQSA 3KYOB 3WUZA 2Y23A 4PPTA 2BHYA 3DVGB 5ERWB 4JPIB 1NBYA 2NY2B 4S1DD 3KPRA 4NM8L 5IVZB 4YDLC 1KCVL 4LSSH 2X4UB 4RZCB 4OCYH 1C16A 3VXUB 2I07A 3P4MB 5BXFB 4PRIE 1AGBB 1WITA 3VH8B 1ZHLA 5IP4A 4OF6A 4TNVF 4F9PC 2X42A 1IM3A 3RDTC 3GNML 5GS1C 1EUUA 4N5EA 2R2EA 3O6FB 1MH5B 3FAXA 4WUUB 4S1SL 5I1JH 3P9LA 4AIXA 3WFDH 1LILA 3QXWA 1JPGB 3ETBF 1IGFH 3GI9H 2QHRL 3FT4B 1WC7A 3MV7A 1IZJA 3O45A 4KU1A 2VDQL 2XXCB 3FFCE 5D7IB 4XP4L 2FNBA 1AR1C 1PZ5A 2A6IB 3V5HB 1RZ7H 5HHQA 2APFA 3HC0A 1CDYA 4QRPE 2GSIB 1U8JB 4OZFA 4LOUC 5E03A 3VXME 4MMZC 2GHWB 5IVXE 1Y6NR 3G5ZA 3CC5B 2CGRL 4EI5C 5F9JB 4XZUB 4X4ME 3AY4A 4NKIL 1A7QL 3QQ9D 1P7QA 5EU3B 5KS9B 2FIKB 1QEWB 4FFVD 4G7YH 5JORB 5J11B 3HAEA 4MJIE 4NN7C 3C8HA 1TVDA 2EECA 1DL7L 4DTGH 1KN4L 1FNSL 1B88A 5E8NA 1M7DA 3BIKB 5I8OH 1Q9KA 3I75A 1LE5B 1DEEA 1ZT7B 4U0RB 3EBAA 1O7VA 5ESQB 4NO0B 1YEHL 4WHDA 4UT7H 1AFVH 2PW2B 4EJ1C 2V7HA 3I6LE 4JPWL 4APQB 1TLKA 4YHIA 3ULVC 4HEPG 1UH2A 3VJ6A 1B0GA 3NPZB 4PLKD 4GKSB 5TDOA 3MZGB 1KCRL 4XCNB 5F8QC 5D7SL 3CFDA 4OQTH 4FQHA 1OQXA 5EBWA 2F19L 3P3YA 2VUYA 3VFTB 2FD6L 4XBGB 5GGVL 4JGUA 4XBPA 1RIUH 5C2BH 1J5OH 2PNDA 3J7HA 5J89A 5BS0D 4QTIH 4TOYH 3EOTL 2EO9A 1B3JA 3V0VB 1IM9A 1EMTH 3QWOB 1VFBB 2A73B 1U8NA 5EOCL 5C0DA 1GRWA 4KMQA 3BXNA 3SKNA 1T0MB 2AV7A 4N8VB 2YWZA 3FQUA 3QZWG 4UAOC 1TVHB 5IG7B 4KTYA 5HPOA 1RZ8B 3KVQA 4Q6IA 5F7HA 2ZUQB 1UC6A 3S7GA 1N3NB 1CGUA 4QXGH 2EDOA 1BOGB 4WO4B 5HHOA 3KPOB 4Q9QH 2X1QA 5E8OA 4PJBB 2YXFA 1CF8H 1J1XH 2D4FA 1DUYA 1CDJA 3IAQA 1QNZH 3AAZA 5D9SB 4OT1H 5E6ID 2UYLB 4YBLB 1GZPA 3FO0L 3BX7C 4AENB 5IB3A 4M7ZC 1P7KB 2AEQL 3C2AH 1GIGL 3RNQB 3TBSB 3QG7H 5J06A 15C8H 3NCJL 4PB9L 1BBDH 1ZVYA 4Z0BL 5I8EB 3ZKXB 5IW6B 5FM4A 4L4TD 3T65A 4Q9RH 1RJLA 4NUJB 1K8IA 1XMWA 4ZO7A 3C5ZA 2YPVH 5CFHA 1I3GL 4YQXH 5TE6H 3RZWA 3QEQB 1EH9A 3JTTA 4PY8I 2H6PB 4IRSA 3MCLL 4WWKD 2EH8L 1XF1A 3UAJD 1NAMA 4HQQL 5JXEA 4XB7A 1ZEAH 4TULL 3MRGA 5EU7E 3LQMA 4LHUG 2ICCA 4KJQD 4OZGB 1KB5A 1CCZA 1DQJB 2DM3A 4C56D 3VWKA 3F58H 3QQ3B 4IOSD 1YEDB 5CILH 4JRXA 4PJFA 4RFEA 4PYGA 1I9RL 1X5FA 5DJAA 5EO1A 2BK8A 3F12A 1FL6B 4GS7B 3P11H 2VLRB 5H35B 2ZCHH 1UXSA 3BO8A 1IAIH 1MJUH 4EOWL 2EC9U 5A1AA 5EU4A 1PSKL 5SX5K 4YDJA 3UX9B 5I1GL 2CRMA 4YDLB 4S0SD 2DBJA 4MB4A 5E2WL 5E2VH 1IBGH 1QFHA 3MOAH 5FYKU 2FGZA 4IRZH 4O5LL 4I77H 1FV1A 1JZ6A 3SGDH 2L7JA 5I15H 1KJMB 4W4OA 1I7UB 3RDTB 4OGAD 5DK0B 5IESL 3WS3B 5GS1B 3N1FC 4PRHB 3LN4A 3NMEA 4G43B 2AXFA 2DLFL 5AYUH 4U33A 5E95B 5DT1H 4IM8A 3NIFF 3EDFA 2IADA 3VXSE 1UZ8A 4I18A 3VD4A 4G7VL 4G6JL 4XMPL 1BQHA 3ARBC 3BH8A 1D3CA 4I3SH 3CFJA 5A43C 2CRZA 2H2SC 2WUBH 4NJ9H 3PHSA 4PJDF 1EFXA 4LQFL 3LEXB 5JLZA 5T1DH 5MENB 3KPSB 3X3GL 4X6DA 1X5GA 4OLUL 4U1SB 5HJ3A 3O3BB 4JFEA 5FGCE 2JCCF 1P4BH 1I1YB 2D0GA 2A77L 2A0LC 1WFOA 3HI5L 3GSQB 2BSRA 1XF2A 1K4CA 3NZHL 2Z35B 5TE7L 4IIQA 4EI5B 1P1ZA 3MJ7B 4BQBA 1FNGB 3L7FB 1LNUA 1ZXQA 2OX5A 1HDMA 2FDBP 4O2EB 3SGDI 1E4XH 1I8LA 5ITBH 4NN7B 1NCAL 2PCPA 5DD6B 1IT9L 4JDZA 3PDDA 4XX1G 4PJ9D 4RAHA 3A6CH 3QXAB 1A6AA 4ENEC 5T1KB 3VGFA 3VCLA 5L7XH 3A6BL 1DUZB 2V6HA 4UNVA 1T21B 1SQ2N 1QSFE 4E9LA 4OD2B 1G6RH 4R96B 1ZA3B 1XT5A 1S7TA 3LKSA 1QA9A 4OD3H 3FB6B 3EGSA 5GZNC 4MVBD 3K2UH 4KRPD 3U0WL 2IQAA 1IKFL 5BW7A 3QDJA 3VRIA 2QKIB 1CICA 1JPTL 5C0EA 2CO6B 1ED3A 4I48A 3LN9A 1A8JH 5IB1B 1P5VA 5L8JB 1CFTA 4U1KA 5F1NB 3WNKA 1MCIA 1ZHNB 2DLHA 3EHBC 3MODL 4I8DA 4W70A 4M7LT 1HZHL 6CGTA 5EUKB 4DKEH 1CFNA 3KYNA 3OJDA 5JPMB 2DD8H 5KJRH 4QRRB 5FF6A 3OAUL 1MAKA 4DWHA 1MFBH 1JN6A 4LRIC 4OGYH 3MLVH 4ZAKC 4GW1A 3DRQB