3MV8A

Crystal structure of the tk3-gln55his tcr in complex with hla-b*3501/hpvg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mv8A01
1TVHB 4GW1B 3EYQD 3ZL4H 3MRPA 1P5VA 4S2SA 3T1FB 3MO1B 1TCMA 2J88L 3X14B 3N1QC 1YEDB 4LPTA 4ISVB 1U3YA 4KH2A 1ZT1A 3K4ZA 4LNRA 5DD5H 4CNIB 3QH3B 1P4LA 4YHLH 2Q3AA 5DRNB 5SWSB 1AQDA 5C0BD 1LMKA 4NN6C 4PV8B 3RL1A 1A1NB 5DJYA 3MV8D 1BFTA 1MRDL 5E8EA 5F7DA 2ZCHH 4P2RE 1A14H 4P2QA 1Q9LA 4J4PD 1YZZA 5B38G 1S9XA 4Q9CA 2HLFD 4EI5D 5DDHB 2VDQL 1CFSB 1WICA 5IB4A 3U4EB 4AENB 2HFGL 3HPJB 3GSOA 5F7EH 1U8KA 4YDJA 4Z5RB 5HHQB 4Y5YB 3FZUD 3W2DL 3FT2A 3TO4B 3O2WH 1BOGB 2C1OB 3MUY1 4EUPA 2NX5E 4ZXBA 1H3UA 1RQ5A 1C5CL 4U1HA 1RZKH 4O02H 4OGXH 5J6HB 4DAGL 4LNVA 2FH8A 4YUEH 2EH7L 2PYFB 1SYVB 2KDGA 1HHHA 3LPFA 4XNZC 1X5XA 1U3HA 5CMAB 4EOWL 3VFRB 5JW5B 3PL6D 4P2OB 2ZWLT 5D1ZB 1QQDA 3ZE1E 1FIGH 2IGFL 4GKZA 2C4FU 3VXNA 2J8UE 2YWZA 3HE7D 3MACL 5FO7A 4YQXL 2HP4A 1U6AH 1AKJA 3TFKA 5AWNH 5KN5B 1C7SA 1U8IB 4NN5B 1I1CA 4HWZA 3S7GA 4FXGA 4G8FB 3WIHH 3CUPA 3MFFA 2X09A 2MFNA 2V2WB 1QFUL 3UTZB 35C8H 4XMLH 1G6VK 2C4XA 3RVWC 3ARWA 2EDNA 5J6GA 1DLHB 5E7FA 4J6RL 1J8HB 3L3OA 2CLVA 3ESUF 1E0OB 3I3EA 3KPMB 1I8MA 1XF5A 1CLZH 2C3VA 4Y4HB 5HGDA 5TDNB 3V5HB 2IFFL 5BJTA 4MYWB 2H6PA 4NFCA 3UZQA 4QHMB 2VN7A 2ZNXA 4NYLA 5GGTL 3GSWA 4RGNC 4G8GD 4WUUD 3ARZA 3A6CH 1CDGA 2CMRL 3OKEA 5SX4H 3TYFB 4Q58C 3EO9L 1CXLA 2VQUA 2FB4L 3ZO0A 4U33A 4Z7OE 4Q74A 4K3DH 3D25A 4I0PC 5DF0A 4P2QE 2IAMA 3KPOA 1WBYA 5C9JB 3UYOD 2J2ZA 1CK0H 5ACZA 3PQYD 1T66C 2EDEA 4ZO6A 5GZOD 1SY6H 3MROB 4FQJH 4Z7WA 3WNNA 3QHZH 2HAZA 1SMOA 1S9YA 3BXNB 1MFDL 1U3ZA 3EJZD 5EU5B 4HFUH 5TQ0L 4QF1A 1BLNA 4WW2A 1GL4B 4AT6A 5B4MC 2G60H 1JWMA 4PTUA 4KKLD 4PDCE 3L5WA 4JKPL 1AE6H 4M03A 4HDIA 4NQDD 3RKPA 4ERSH 3GHEL 3B9DA 3WS3A 1N64L 5E9DB 5J9PB 2EC9U 1EMTH 1HILB 2HWZH 4KDWA 3VRIA 2X70A 1N5AB 5HDQL 2MJWA 1WZ1H 3BUYA 4JFZL 4JN1L 3QSKB 3SCMB 1J8KA 4PJGF 4PS4L 5GGRB 1T7XA 3M1BA 5IT2H 1H3VA 3L7EB 3QUKB 5AZ2H 1K2DB 5DK2A 3LKOB 5K59E 3CU7A 5E00B 3QG6A 2QSQA 5C0CD 1G1YA 3H8NA 4GRLA 2XY2A 3VRJA 3VFOA 4G7YL 4JM2D 3RX7A 3TNMB 2A73B 2Z4QB 3IFPA 4X4YA 4Z76A 1TNNA 1RVFH 3WFZA 3DO7B 3MV7B 4PRIA 4U1MB 2B5IB 2WUCH 3VWJD 1NCUA 5C71A 3HAEA 1XF4A 2BSRA 3QUYC 1OAYL 1TLKA 4MDIB 1DEEB 3KLAB 1RUAH 1LO0L 3JVGA 4XC3H 3JWDH 2UZXB 2B8OT 4LGSB 4FQQB 1MCDA 4MSWA 4DKEL 4MMZC 4FQIL 3O4LD 3VJ6B 5I1IL 4RGMC 1ZA3A 4HIJB 4G42A 2IG2L 5JHDD 4RGOH 2LVCA 1T3FB 4RFEA 5T3ZL 4RAHA 5FB8A 5C7XH 1FNLA 4OBRA 5ECJE 1I1FA 5IROC 5HHOB 1BPVA 5I15H 4HMEA 4RMTA 1J1PL 1JZ4A 3DOSA 1BOYA 2GUOA 3OKOA 1H3PL 4X7TA 1S3KH 3WE6B 2J3SA 1ND0A 4Y2OA 4ENED 3SKMA 4K2UH 1JNHB 5I66A 5KG9A 2GITA 4B7IA 5GS1A 3OR7B 3BIAX 5CZXC 3FB6A 4Z7UA 2I27N 3MV8A 3RWIA 1YECL 4K8RH 4R97B 5CJQL 3HRZB 3D18A 4FP8H 4JDTL 5KANI 4PGDA 4J4PA 2DM4A 4PJCE 2UVFA 4QTHA 5CP7A 5IP4A 4EI5A 4OTXH 1CL7H 1FGVH 4HGKC 4X6EA 1LO2L 4QHNB 3KYKH 1T89C 4PJ9B 5DC0A 1UEMA 4CJ0A 5LG1A 4GXUM 1YNKH 5IFJA 4N8VG 2MQCA 3EYUH 1C08B 3X12B 2HMID 3NFSH 1HQ4A 4KHXH 3RY5A 4NSKA 2ZOLA 3KDMB 1MIEL 1D5XB 4KKAC 1UWXK 3ULVD 3FQRA 4LRIC 4PRIE 1ACYH 4JFQB 3T0XA 2IBBA 2V7HA 5D2NA 1FCGA 1OTSC 1CIUA 1CGYA 5FUCC 3F62A 4QNPF 2F15A 4NKDB 4ZNEA 5BZDB 4H26A 2A6JA 4K94L 1TMCA 2D7NA 3A0OA 3QZWG 3HE7A 1P1ZA 2ADFL 2P24B 3S37L 1TJIL 5EZLA 4LAJH 5KVEL 2J6EL 4MJIA 3ARBB 3LN4A 1UVQA 4AM0B 5LQBH 4OGAD 3LSOB 2YR3A 2R2HB 4GMSL 2RGSA 4EIGB 2FR4B 1JHKL 3MRMB 4I77H 3NAAL 4I4WB 3HPLA 4D0DB 3FHAA 3ALPA 4DGVL 3V6OA 1U8OA 5JOFA 1CDHA 5SWZD 4PJAE 2XWTB 4G8GA 4WUUA 2Q76B 2Y1VA 5C0BE 4OKVA 3WFCH 3FO9A 1MHEB 3VXQB 2PCPA 3FB8B 1CE6B 4Z7UE 3MV8E 4NQSB 3U0TB 5IFHH 5JA8B 5DTFB 1CIDA 3DMMD 5I71B 3T2PA 5DJCA 1LE9B 1J5OL 4R3SA 4ETQA 1UCBL 1G1CA 4H20H 3QXDB 5KOMC 1DCLA 1SYSB 1G7JA 2VYRE 1X5KA 5I76A 2A74B 2XV6B 3PQYA 1I7ZA 4R4FL 5DUPL 2C3HA 1IAKA 4APQC 1XIWB 3B6SA 3P77A 3QI9B 3C5ZB 3QEQD 3RU8L 5I2IA 2PN5A 3SKJL 3T0BA 4XXDA 3OJDA 2JCCB 4GW5A 4QXGH 1HIMH 4QHLA 3PJSA 5D2NE 3NFNB 4Z0XA 4LOUD 4TSAL 5T3XL 4TSBL 5JUEL 5J3HC 1JTTA 3IFOB 3I02B 4YXHL 4ZNEE 1I3RB 4UTAL 4NQDA 2NXYD 4U3HA 5DS8A 3T77A 1U0QA 2JJSC 1OTTC 1OTUD 5HY9A 4D0CB 5EULV 5FYKL 5F71A 1ZMYA 4MLSA 3UYPA 3QNXA 2VQ1A 1E6OL 2YBRB 2FLBT 1IARB 3L3JB 4O51B 5BXFA 3OKLA 1PG7W 5DQ9B 3BW9A 4K8RD 1CF8H 3ZSSA 2O5YH 4HMCA 2IPTH 2GK0B 4TSCL 5C0CA 3DSFL 3V6OE 5A16B 4LIQE 4JM2A 4HH8A 3QCUH 3KR3H 5HHMB 1UM4H 2X4SA 1DZBA 4G8GE 4WUUE 1NFDA 4I0CC 3HZVA 4XHQA 4F57H 3MJ7A 1XGRB 4X6FB 3VWJA 3ZYZA 1S7TB 5B21A 1GOFA 4W4OC 1IEBA 1KIRB 1U8MB 2YKLH 3PGFH 4OLVH 4S1QL 1U95A 5KSAD 4ZUVB 5ESAB 4KV5F 3RI5F 4TVSa 3MJ6A 2DQEL 3HNVL 3EAKA 3EIFA 3HI6L 1EAPA 4LVHB 5GSVA 5ID1A 3O4LA 1FSKC 5LXGH 3QQ4B 3NIFF 4BKLB 1JZ8A 3GB7A 3PQYE 4PLJD 4ZD3L 4FFVC 2NY0B 3LAFA 4MD5B 5JHDA 2AV7B 3QFJD 4H0HB 4P5MA 2O61A 3WIHA 3BHBA 3MUGA 4MQ7A 3HR6A 4OZGA 1T2QH 4L4JA 5IJKC 3BZ4B 4M6ML 4UNVA 3VFSB 2BNUA 2HT2D 5D1QD 4F7TA 3R8QA 4M7JH 1DE4B 4PFEA 4LDOB 3LRSA 4NQDE 4X9FA 3EO0B 1T22B 1UC6A 4XC1H 5GRJL 3SDDC 1RIUH 3EOYG 1SM3L 1NMBL 4I13B 1JE6A 2GY7B 5D7LB 3IFLL 2ITDB 3EJYD 2NTSP 3VDAA 1MCEA 2OZ4L 1OAZL 3WFHA 3U46B 4HAFA 5F7UA 1RUML 1BQSA 5C0CE 1NJ9A 4KGLA 2DQDL 4D9LH 4QCIA 2VDPH 1PX4A 4FRWA 5FHAL 2Z31D 1SY6A 2VJXA 4R8WL 4GLRH 5C0RL 2VWEC 1S9VB 5IKCA 4MB5A 4MX7B 1NFDE 1KUMA 4O5LH 2NY2C 1DFBL 2WZPD 1UJ3B 1VCAA 2QTEA 1ORSA 3RGHA 5TE7L 4O4YH 3SDXF 1DDHA 4P9HL 3UPRB 1QBLL 3LKQB 4MNQB 3VG9B 2DMBA 5TQ2H 1YN7A 1I9RH 2VSDA 2YD2A 3HC3L 3GSNH 5KVGH 5B3NA 1GZPB 1GGUA 1JRHH 3O4LE 2WW8A 3RPIA 4OZHF 4X4MA 5DVLA 5D1XB 2NNAA 5I0DA 4DW2L 4JEGB 2BC4A 1N0LA 4XVTL 5HBBA 4MJ5B 1Q9KA 4PTTB 5D6CB 5JHDE 3A6BL 8FABB 2ZCLL 1FNGA 5E6ID 5ICXA 4OZGE 3B2UC 3V0AC 2F53E 4QWWD 4UT6L 1S7WB 2I9TA 1CICC 4WUKH 5IESH 2GJZB 3IS1X 5SWZA 4DZ8B 5IV2A 1I7RA 4NBXB 3RWDB 1U41A 2DJUA 5CSZA 1IEHA 5KVMC 1V7MH 2BSED 2W9EH 3GBML 4L3AA 1EEUA 4UV7L 1DUZB 1B0GA 4DVRH 4POUB 4YHOL 4WU5A 3UO1H 3ME0A 3S36X 3DMMA 4ZFOA 5IMOA 2R0ZL 4LSPH 3N1GC 5FM4A 4YJZL 3MOAL 4WI4A 4AH2B 4DWHA 3K2UH 2Y5EA 3WD5L 1WBZA 3CIQA 4EVNB 1IL1B 4WWKB 1IT9H 1PG7L 1KCLA 5GJSH 1GVIA 1NAKH 4YBHA 4J1UA 2EYRA 3TN0B 3QEQA 2P1YA 1B4JH 3QUZC 1KLGA 1AY1H 1AXSB 3MCG1 4G80A 1S5IL 3QNZB 2F8VA 4NUJB 5IVXA 3ULVE 1FGNL 2CSPA 1X4YA 3S96B 2DQJH 3ULUF 1T7ZA 4BFIB 5I6XC 3DBXA 3GIZH 1IGYB 4ZPVA 1QEWB 2XI9A 4XPTL 2NXZD 1J0HA 3TO2B 4U0RC 2BNRD 1NGPL 5FK9B 3IKCA 3PNWB 5L6YH 4JQXC 3NIGE 4JO2L 1NC4A 2ICWA 1JHTA 3N50A 5D93C 2CLRA 5D5MB 4FQXC 4S1RL 4X4ME 2PR4L 5ETUB 4JY5L 4P5TC 4PRDB 2ZPKL 2DQFA 4GBXC 1D6EA 4NC1C 4ONFH 3SJVD 1F90L 5MERB 5MEOB 1KG0A 1H5BB 3S34L 5A43C 1HSBB 3KPSD 4H25B 1LO4L 2XT1B 2VIRB 5ITBL 1QRKA 2IPKB 2R23B 3D6GA 4P46C 2X4NA 1NMCB 2EXWC 3RGVC 2QQKL 3LH2H 4LSQL 4RAVB 4U7MA 5SWZE 2Z92A 5DD1H 4LLQB 5IVOA 3U7YL 5C09B 2HKHH 3GSRA 1U8JA 2FX9H 2NX5B 2QL1A 3QQ3B 1NCBL 1S7UA 5ELIA 3E0GA 1UA6L 4KQ3L 3OKMA 2FBOJ 4LEOA 4FZEH 4MA7L 5F70A 1BVKA 2EKJA 1CBVL 3QDJD 4NJAL 4NO2A 4P4KB 3BX7C 4HMDA 3HZYB 4ZAKD 3GEWB 3B9VA 4X6DF 1WQVT 2BVOB 5HGHB 1M71A 1KNOB 3I6KB 3QCVH 4K9EC 1T1ZA 2EEBA 2CGRH 2J8OA 1YNLH 1OP9A 1HXYA 1A6AB 1B3JA 2J8UB 3CDFA 3MNZB 3QEQE 4KUCD 5BRZB 3QFJA 3JTTA 5CGYC 1EK3A 1V8HA 1ACZA 4R2GD 5IVXE 2K7PA 3ZTNH 4JZJB 4KKNA 1R3KA 5EA0L 2B7DT 5F1NB 1Y0LB 3VD9A 2W1NA 5D1QA 5LBSH 2DRUA 4S2SB 1UM5H 1NGQL 3U9PL 1E28A 3CSYB 4OCWH 2COQA 1DVFC 2BNQD 4LVEA 1BWMA 1ZT1B 3L95A 5GS0L 4IIQB 4LNRB 5E8PB 2ICWJ 3OKNB 3E3QC 3TVMD 3AM8C 3I9GH 3M8OH 1P4LB 3DGGA 5JW3L 1AQDB 2K3TA 5FYJH 4GUPB 4OD2A 2PTTA 5SWQA 3CX5J 5DR5H 5DJYB 4YLQT 5EU3A 5E8EB 5F7DB 1MJ7H 3ZDZE 4WI3A 2R4SL 4P23D 2W0PA 3QIWB 2BDNL 1Q9LB 3O8XC 5EZOH 1CXEA 2EDRA 5HHXL 3VG0L 3CX2A 3VXTB 3DSNA 5IB4B 5JO5B 2Z31A 3GSOB 2YRPA 1CI5A 2KBGA 4V1DD 3FT2B 5T5NG 3SHSA 3V0WL 4U1HB 3HB3D 2HRPH 4H8WL 2OTPA 5HDLA 5ADOH 5I19H 4LCCA 1A5FH 2PO6C 3QEUB 2ZG1A 2OP4H 4GAGL 4YBQC 1U3HB 4U6TA 5I8CA 1Y6KR 1A8JH 3VXNB 5FO7B 1JPFA 3QFJE 3DWTA 2A6DA 5E6IA 5E94A 4FXGB 5KW9L 3Q5YA 5DJ8A 1H0DA 2ICEA 5B8CC 3FRPA 2B0SH 3D39A 4JY4B 1ZXQA 3I6GB 1CZ8L 2A9ML 2FWOB 4YDLB 1ZHLA 4O00A 4QRPD 5J6GB 3BFOA 2CDEA 3L3OB 2CLVB 2OCFD 4KJQC 1I8MB 2EDBA 1XF5B 4Y0GA 3G6JA 5HGDB 4NWUL 4WEBH 2OI9C 1T1YA 5E2VL 2GJ6D 4JGUA 4QY8A 4NYLB 1T5WA 3GSWB 3IT8D 3QEHA 3H7LA 4G6MH 3I2CH 2PW2A 2W07A 5CZKA 5D7JB 3BQUB 1IE5A 4XB8A 4FABL 1UXSA 5AZEL 3RVTC 4X4ZA 3MRKA 2OR7A 4PJXA 5FA3A 3SDAC 2R29L 4X7SH 3D25B 2HJFA 4KQ4H 3SKOA 4LAQH 3WKNA 1S7XA 2FDBP 3BPNB 4RISH 2IAMB 4KDTC 1WBYB 4Y7MA 4PRNB 2F5BL 4RDQG 4Y4KB 1CG9B 1P5UA 2P45B 1LO3L 3NA9H 1GXEA 1A1MA 4X0KB 1HXMA 2B20A 4Z7WB 4G6JL 1S9YB 3IDXH 3HI5L 2F19L 5IB3B 4QF1B 2BNRA 4FXKA 1BLNB 3QPQD 4WW2B 4AT6B 5BOZG 5ACLA 3UBXA 1JWMB 2P7TA 4PTUB 4R7NA 3NIDF 1RUQH 3L5WB 3ZYJA 1NUDA 5CLTA 4MQXD 4HDIB 2B39A 4JB9L 3WS3B 1YEHL 2W0FA 2HT4D 3RAJL 3VRIB 1EEZB 2X70B 3N06B 4YO0A 3EO1A 3O4OB 3SJVA 4YXKH 3OZ9H 3BUYB 3MJ8A 3P30H 3KPSA 3NTCL 5FYJD 3QWOB 4KJYB 2LQRA 4WI6A 4LASH 3M1BB 5I16B 4N0YL 4U1NB 4JR9L 2NY1B 3LEYL 5DK2B 3QG6B 4YZFF 1YQ2A 1WV7T 2DQHH 3HKFA 1F97A 4GRLB 5FFLA 5L2JA 4KROD 3WDIA 3SDXA 3M45A 2HT3C 3G6JE 3Q48A 5A2FA 3MCLH 1KULA 1I8IA 4UUJA 3ZDXE 1F00I 5E2WL 5LWYH 4K7PH 3IFPB 1VFMA 4Z76B 3C9NB 4OCSL 1QSED 1UB5A 2AK1H 4NNXB 3K3QA 3NIFE 4UILL 3MBEA 1GC1H 3HAEB 1XF4B 2IALA 3QDJA 1VKXA 2CXGA 3GJEB 1I9JH 2E9IA 4ZAKA 4OLEA 4PJXE 1HYSC 3IJHB 4MSWB 3GSNA 4IOFC 5KJRL 2APTA 3GJFB 1PZUB 4RNRA 3TT1H 4L5FH 3B5GA 1MELA 4C59B 3LN9A 4G42B 5EU7E 3BMVA 3RKDC 3QFDA 4JJ5A 4KJWD 3U7WL 2XN9D 4RFEB 3U4BH 5FB8B 4WTZA 3MRLB 5E5UB 1I1FB 3KNBA 3GSVA 3QIUA 2AEQH 3EZ8A 5INDA 4DFHA 2BNRE 5F3BA 1UXWA 3NACL 5DHYA 1BX2B 3OAYH 1IGTB 2BNQA 2VITA 1DANT 4X7TB 5FYLH 1EX0A 1KCSH 3OXSB 1ND0B 5GRXG 3TVMA 5I66B 3O2VH 2GITB 3QA3A 1MCQA 4UDUA 1VHPA 4RBPH 5CBAB 1X44A 3SJVE 4LARH 1UZ8B 4D0BA 2KQMA 3CFCH 1VPOL 3KPSE 1FBIL 1VEOA 2XZQL 3L5HA 4DEPC 2X05A 4P23A 4PGDB 1XR8A 3VH8A 3GMMB 1HKFA 1ZVYA 5CP7B 5I1JL 4EI5B 3W11D 2V5RA 2NW2A 5EIIB 5CJOH 4X6EB 1CYGA 2HYMA 1ZANL 2BY0A 4K71C 4WFHD 1FFQA 1T0PB 2V7NB 3WEXA 5AD0A 4X8JA 4TN9A 4V1DA 2VXTH 3QUXD 3CK0L 1HQ4B 3RUGA 4JO1H 2ZOLB 5EOCH 4CVXA 4PJBB 4DCQA 5GGQH 3IS0X 5I1HH 1YYLL 5EBLA 4JFFB 4ZFGH 2XACC 2V7HB 4H5SA 3GKZA 2P46B 3QDJE 3QDGD 4TRPL 5IFAH 2YOCA 4BZ2L 4H26B 3VFNB 3ZYIA 3U1SH 1OY3B 1TMCB 1KPVA 3IDYB 3CFIC 1NBYA 1A7NH 4KZEL 3HE7B 3VXMB 4OB5H 4XCCL 1HQRA 2A9NL 2R1YA 2AS5M 5C6WH 4MJIB 3LN4B 1UVQB 2G5BA 1DR9A 5K93A 4KRPD 3MRBA 1AJ7L 3QDAA 3RDTD 1N5YL 2OK0H 4LDLB 1O0VA 4MS8C 4AJ0A 2LE9A 3DX9A 1RY7B 2CDGA 4QRPA 3GMNB 3S88H 4I3RH 3CLFH 3ARVA 4BQBA 4LIQL 3J8F7 1T7WA 2QADD 1VGEL 3V0VA 4Y5VA 4X7DC 2HN7A 2BNQE 1TIUA 5JOFB 2GJ6A 3VMOA 2YUWA 1S7RA 2H32H 3OTTA 5HSFA 5B38A 2UUDH 4G8GB 4ODWA 4WUUB 5DEGA 1CFVH 1FNSH 2PNDA 3WBDA 4ZS7L 2ZCKL 3RIFK 4OKVB 1I7UA 2IQ9L 2XQYK 1O5DT 4RWYL 4NC2B 1D3CA 3P73A 2VDMH 3E8UL 2ITCB 1LDSA 3ZKMD 3DETD 4OT1L 2FL5B 3EYOA 1KN2H 4NP4H 4WDIA 2VL5A 3MRDA 5DJCB 4R3SB 4ETQB 4LMQE 2BSSA 3C8KA 1YEFH 1CLCA 1Z3GL 1YJDL 1I7ZB 2AJ3B 4UI2A 1BQUA 1MFEH 3P77B 3SE9L 4V1DE 3TJEL 5CGMA 4LSUL 1A4JA 3RUGE 5D70L 3VWKD 4DOHE 3CFEB 4XXDB 5DFVD 2MPAH 4DK6A 1EA9C 3ZL4L 3U30C 4JCMA 4QHLB 3PJSB 4Z0XB 1VFOA 3GBNH 1XCTA 4NKOB 3LQAH 2IC2A 3FN0H 2JE8A 4ZUTA 4R4ND 4NQDB 3BD4A 3ILPA 3T77B 4YR6A 5DD5L 4IRJA 4NQXA 5FYLD 3O41A 5LGKA 3U7AA 4DN3H 4YHLL 4PY7B 5F7YC 4DVBA 3QNXB 2JJVA 4J3UA 3GHBH 2VQ1B 2F9BT 4I48A 1SJVA 3L5JA 3T04D 3B4NA 2ZCHL 5BXFB 4U6HA 2NTFA 2DAVA 5E99H 4S11A 2EDXA 3CFJA 1A14L 3BW9B 2MCPH 3CZJA 4TQEH 4ELMF 3QJFA 4QRPE 4XP6H 3V4VH 3BH8A 4KY1H 3P11H 3T09A 1X7QA 1RMFH 3VD5A 4YWGH 4Z95H 5JA9A 1I1YB 4FQPA 3VMNA 4JM2B 4MVBD 5F7EL 43C9A 2O93L 2GJ6E 3O2WL 4MHHI 5FA4A 2BVPA 5DO2D 4XH2B 2VLMD 2F8XC 1QSEA 2DJ4A 1RZKL 3G5YA 4O02L 1ZWIB 3EKCA 4OGXL 4NQVA 4Z7QF 3TBTA 2VLLA 1IEBB 4YUEL 1U95B 3B5TA 3Q6GH 3FN9A 4M9OA 5C0JA 1EXUA 4JVPA 4HBCH 3ZZ1A 2Q87A 7FABH 1LDPH 1FIGL 4JFOA 4YEEA 1EAPB 5GSVB 3WNLA 3O4LB 3MZGB 4Z77A 2EZ0C 4NCDA 2R1XA 3GB7B 1U6AL 5E56A 5AWNL 3H3KA 3QHTC 3WIHL 1HNFA 1PDKA 2XN9A 5CJXA 3G6DH 4S1SH 1NANH 1OARH 3BHBB 1QBBA 4MQ7B 35C8L 2WLZA 4HHAB 2BNUB 2WY3A 1CLZL 3DVGA 3TA3C 1FZMA 3LRSB 3U9UA 1LP9F 1AR1D 3VXSD 4HS8H 4N9OB 3VFMA 4JVUA 4M6OH 2V6HA 4L9LA 1H3GA 5TDOA 1MPAH 2Z91B 3A6CL 2MQ3A 2HJLA 1OSZA 5FYJE 3FO0L 5CEYA 5FV1L 4JFYB 4K3DL 3FHQA 3H2WA 1EERB 2NY3C 4MWFA 2ADIA 1WTLA 2IBGA 4J3WA 4E0RA 3GIVB 4G6AC 3WXWH 1NJ9B 5I1AA 1NLDH 3G08A 1CK0L 4N8CH 4NQEB 5KAQG 3QUXA 1SY6L 4ZOBA 4QCIB 4Z6AT 3UTTD 4FQJL 3QHZL 3HNSH 1QSEE 5IKCB 2YD3A 5I1GH 2WBJC 4ZUUA 5CFHA 4HFUL 1ORSB 3OKDA 3IU3A 1YY8A 3QDGA 3TZVC 3ARED 4M6AA 5EOTA 3MV01 2G60L 3TWCH 3MRFA 3V6BR 1EEQA 2UYLA 4PG2A 2DWDB 3AVEA 2YPLD 4BJLA 1YN7B 1F3DH 1AE6L 4NUGL 4XVJH 2WUBH 3S35X 3BO8A 2JLLA 4PJGB 4ERSL 4F7EA 3WV0A 1EMTL 4LCWD 2BC4B 3BPCA 5JXED 2AABH 1WZ1L 4JDVA 3J7HA 3RIAF 5JR1H 1Q9KB 3RDTA 4P0DA 1RJZA 3NBNA 2XN9E 5CSBA 5FM8A 1F3RB 5MEPA 1OGAB 5IT2L 1FNGB 5AZ2L 1KTKE 4XPFH 5I1CH 4XP5H 2I9TB 3PL6C 4RZCB 5D6DC 1KXQE 3SKNA 4L8SC 2V5YA 2WBWB 5SWZB 2P49B 2Y7QA 3MYZA 3T4AA 1BZQK 5IV2B 3LEXB 2VZ3A 1CGVA 1F4XH 1B4RA 2AI0H 4FFYH 5ERWA 4K3GA 2WUCL 3O6KH 4N8VA 3HG1B 4G9DB 1B0GB 4ZFOL 1UENA 4WU5B 3WJLC 4ZFOB 3QAZB 3DO3A 1RUAL 4PPTA 4XC3L 4PY8I 3JWDL 3N0PB 5E8OA 4ZO8A 3SGEH 1D5MA 4PGCB 4WFHE 3V4UH 5F1OB 4J1UB 4EN3B 2FJHA 2EYRB 2F54D 2FX7H 2VAAA 3QEQB 1KLGB 2NYYD 1RZFH 3QIBD 1SJEA 2QKIA 4IRZH 4RGOL 3VWKA 3QZWA 1P9MA 3CXHJ 2ZG3A 5C7XL 1QFHA 4ZTOL 1P4BH 1KSRA 4OZIA 4PP1C 3W39A 3WNPA 3QDGE 4CMMA 3C8DA 1S3KL 1MCKA 2A6KA 2H45A 2NXYB 1KCGC 3IKCB 4K2UL 1O7SA 1NC4B 2ICWB 1JHTB 2CDFA 3GGWA 4QOKD 3ZYOA 3KJ6H 3LS4H 1MUJA 5I9QC 3OJVC 4X9BA 4HUMB 4K8RL 4FP8L 1KG0B 4Q0XH 4WHTA 3O9WD 3GO1H 4OTXL 4GAFB 5D1ZC 1CL7L 4ODXB 1FGVL 3KYKL 2X4NB 5DRZA 2E7CA 3V6ZA 1YNKL 4MVBA 2OQJA 2AXFA 3EYUL 3G5ZA 3NFSL 3U2SB 4KHXL 1R3IH 1U8PA 1J1OH 3P9MA 1G7MA 3GBLA 3GSRB 4ZFFA 1U8JB 3MJ9H 4NZUH 2VABB 1ACYL 2DIJA 2Z8VC 1G9NC 3OKMB 5EG6C 1NCAL 1N6QH 3T2OA 4LQFH 3DROB 5F9OH 3K8MA 4I2XA 1BVKB 3EOAA 3OB8A 4LP4A 5F9DC 4Y5XA 3TBYA 4I18A 4NO2B 5CS7A 4F37K 3BP4A 2M26A 4N0CC 1M71B 1B0WA 3O6FD 1T1ZB 5IWLA 5T5NF 1HXYB 3KJ4C 2P5EA 3QFJB 1FPTH 3JTTB 4LK4A 5LQBL 5C0NC 1AXIB 1TZHA 4PJFF 3P4OB 3W0WD 5CD5C 2BY1A 2CIIB 1F3JA 3C09C 4OCLC 5IIEA 4OZIE 4LCYA 5D1QB 5DEZA 3IJYB 4GXVH 5FXCH 1E28B 2DM3A 3H42H 5T1LA 1ITBB 4Q2ZA 3VXSA 3FT3A 3BPOB 4CADB 2XNAB 5DJ2A 3L95B 3H9SB 2H32A 3E2HC 3JWNC 1L7IH 3V6FA 3WFCL 3DGGB 1T7VA 3F58H 4OD2B 2PTTB 5SWQB 4AQ1B 2AJZB 3REWB 1H8SA 3BP6B 4U7KA 4JQVC 1PQZA 2ID5A 4OI7A 3Q3GB 4H20L 5ILTH 3DYMA 12E8H 3VI4F 2YUZA 5ALCH 1X5LA 5I18L 4KRNA 4Q6IA 1MJ8H 4QYOB 3P40A 4MJ4A 1AHWA 4NQUA 3UTTA 3OX8A 2Z31B 1QFWH 1MLCA 5JIIA 3SCMC 4KMTH 2VLME 3DIFA 3MRRA 3WXVH 2GSIA 3ZKXC 4JLRA 1J18A 3OV6A 1TTGA 2VDNH 1P7QB 3BOVA 5DJ0A 1FQ9C 4QXGL 1HIML 1SBBA 5JTWA 3AREA 4UMGA 1JGUH 1SVCP 4IJ3C 4U4BA 4HWNA 4LCCB 2DTSA 1TZIA 4I2XE 2DMCA 2YPLA 3PHQB 4LSRH 1JFQH 4QXUH 1KYOK 3IETA 5I8CB 2FEDC 4U6VH 4LCWA 2AKRA 1UZ6F 2YEZB 4ELMA 5JXEA 1S5HA 2APBA 3ULVC 1KJMA 3GJFK 4LVOB 5F6HI 1JPFB 1CD8A 3RVWD 3QJHA 5E6IB 1C8PA 1H0DB 1CF8L 1CVRA 5JNYB 2ICEB 2O5YL 1J0ZA 3D39B 3VGBA 4CVZB 2IPTL 1CDJA 4OZFG 1GOHA 1ZHLB 3OKKB 3RNQB 2CDEB 3I50H 3EHBD 4RGND 2R69H 3KGRA 2V5MA 1PAMA 5EC2B 2HG5A 3QCUL 3KR3L 3VXSE 1QHPA 1UM4L 1T1YB 4M7LT 1JGDA 4U1GB 5J1AA 1T5WB 1A6TA 4F57L 5CHNA 3QEHB 1FH5H 3K8LA 1C1EH 4IS6A 1BREA 2PW2B 2D0HA 2YKLL 1XH3B 3HR5A 3PGFL 4I0PD 4OLVL 1TITA 3DVNA 1WFTA 2YPKA 5TH2B 1VGKA 4YGVB 3B8YA 3MV9D 3T0EB 4OFIA 5MHSD 1IKFH 1OT2A 1T66D 5FA3B 4M4PA 4U1LA 5LXGL 3QISA 2F54A 2HFTA 1AGBB 1LE5A 3QIBA 3H3PH 3UTTE 1IAIH 1EDQA 5GGUA 3QO1A 4W6WB 1ZEAH 1A1MB 4R97C 3HZKB 1HXMB 1ZGLA 3EYSH 5B4MD 2PW1A 1W72H 2NY6C 1GRWA 1T2QL 3BD3A 2WBKA 4HS3A 4PRHB 4KVNH 2NXZB 4YFLI 2BNRB 3K2MC 4FXKB 5KSUA 4M7JL 3D48R 4X6CA 2YPLE 1N8ZA 3W2DH 4E42A 3UBXB 1HCFX 5HHNB 3PV6A 5GZND 4XC1L 4QOKA 5JW4M 4JVWA 2C26A 4LCWE 3SGJA 2YUXA 4XNMA 5T1DH 2W0FB 3RVUC 1NUNB 5T33L 2G75A 4G43B 5INCA 1ZK9A 3ZHDA 3EO1B 4LPUA 1OOAA 3BH9B 3KPSB 3O9WA 4ZQKA 2QHRH 5D96B 4YNYA 1ZHKA 1RV6X 1U8LA 3DYPA 2FJGB 4ELKB 1KIQA 2DKMA 4PJDF 1PJ9A 4GSDH 5HI5C 4D9LL 2VDPL 3HMXH 5FOJA 5L2JB 3SDXB 1D5BA 2HVJA 3C60C 1C5DA 1I8IB 4UUJB 1MCBA 2YPVH 1IZJA 4F7MA 1RZJC 2FIRT 3QUYD 4O5LL 1IC7H 5TGBA 1UB5B 4O4YL 5MP6L 4OZHB 3GNMH 4OQ1A 4F2MA 4JPWH 4R4BA 2CRIA 3MBEB 4NRXA 2IALB 1FNEB 1EBPA 1QLRA 4ZAKB 5TQ2L 9CGTA 1I9RL 1L9NA 3GSNL 5KVGL 1JRHL 1H3WM 1B2WH 2A6IA 3O6FA 3GSNB 2F54E 4HEME 2I07B 4UU9B 3N9GH 4RNRB 5BMFH 4NO3A 1EJ6A 5FM5O 3ROOA 2VQTA 4R2GB 1X3DA 4OF5A 1J87A 3QFDB 4JJ5B 3W0WA 1HWHB 1HN1A 4PJ5D 1UFUA 3TIDA 3GSVB 2FD6H 3QIUB 4WUKL 3RWEA 5INDB 4XB7A 1UXWB 5DHYB 1XIWC 4X6CE 2CK2A 5CZXD 5IW6B 2CPCA 2VITB 1G9MC 1CDCA 3QI9C 3MRHA 3O2DH 5BCAA 3JV5A 4QOKE 3TVMB 4WIQA 1V7ML 2F5AH 1T0NA 2W9EL 2CLZB 2GW5A 3SGDI 4OLYH 1JPSH 4A6YB 1QP1A 4UDUB 3CSBA 4LGPB 4UINH 3OGOE 3UO1L 2W92A 2BSTA 3QPXH 4LSPL 2WP3T 4P23B 3K2UL 3D3VD 3HNTH 1XR8B 4AYFA 3PWJA 3VXRD 3EDDA 3OB0H 3MYJA 3UJJL 4FQHA 1IT9L 1NAKL 4V3DB 2NW2B 5TPWH 5IMMA 1J05B 5J1TC 4KKAD 1B4JL 1AY1L 2XTJC 4RIRB 5FGSA 4X8JB 3BESR 5C70A 2QV2A 1K5NA 4RMUA 3RUGB 1OTSD 5I1DA 2EH8H 4CVXB 2DQJL 3M17A 1SQ2N 3WUWG 5L0QB 2X1XR 5EBLB 3GIZL 5EC1A 1XGTA 5F8QC 5CIPH 4H5SB 4RAUA 2A1WH 5L6YL 4PJHF 2ZUTA 1L9MA 2XA8H 1RZIB 3O3AB 1KPVB 4U49A 1NBYB 5F72S 1AH1A 4HUUA 1JYVA 2DLEA 1OM3H 1TETH 4ONFL 3ARFB 2G5BB 1UACH 3MRBB 3W0WE 4DK3A 3DX9B 4WVRA 2CDGB 4QRPB 2J4WH 5HJ3B 2KKQA 3KVQA 3LH2L 1MCWW 1V3LA 2NY0C 5DD1L 2HN7B 4F9LC 3MREA 1WCBB 2GJ6B 2HKHL 5B38B 1FRGH 3GFUA 2FX9L 4Y19D 4ODWB 5DEGB 3L9RA 1FFOA 4M8VA 4X6DB 4I0PA 3VGHA 1I7UB 3MJ9A 4FZEL 3EFDH 2UWEF 4QWWC 3C6LB 4TNWF 1IC5H 4LPXA 3MV9A 1P7KB 3EYOB 4NRYB 1IM3B 2VL5B 3MRDB 1MIMH 5K9QI 3QCVL 2BSSB 3C8KB 5HVWA 4PJFA 2CGRL 4X7EC 5I1EH 4MXWH 3IJSA 5JIHA 4RMRA 4AZ8A 1A4JB 3ZTNL 1UG9A 3BJ91 3MRIA 2EDHA 1J7VR 2RFXA 5J3HD 1B6DA 3KG5A 3RVXC 4BFEA 5AAWA 5LBSL 1MCSA 3UPAA 1UM5L 3E6HA 1OTTD 3G6AA 1IGMH 1NCTA 1XCTB 1T4KA 2X4RA 4JANB 4OCWL 3UTQA 5JQHC 3EOTL 3LHPH 1L0YA 1IAOA 4KK5C 4ZUTB 4G6KH 1J0YA 2V9QA 4YR6B 3NZ8A 3DHJA 1IC4H 4IRJB 3D0VA 4NQXB 2NY5C 5FGBC 5GS2H 3I9GL 3M8OL 1ZLSH 1ZT7A 1MOEA 1UJ3C 3GDBA 4DVBB 3BDXA 3BWAA 5FYJL 1WZKA 4LHJB 4I48B 5DR5L 2OR9H 4GO6B 1OLLA 1XF2A 2YMXH 1MJ7L 4U6HB 2NTFB 2IH3A 3CFJB 1AGCA 1U58B 5EZOL 3BH8B 1MI5B 2AEWA 3DARA 1KOAA 1AO7B 4RGNE 1X7QB 4HFWA 2SEBA 4DN4H 4RQQB 5JW4Q 4PIRF 43C9B 4NNYA 1HWGB 2EYTA 4CU6A 2DDQL 5FA4B 3QUYA 1QRND 3REVA 1QSEB 2E9BA 5J06A 2HRPL 3G5YB 3EZJB 3TBTB 2VLLB 3QO0A 5ADOL 1F02I 3K74B 5I19L 3RPKA 1MFAH 1A5FL 2AQ3A 3MRJB 2OP4L 3PIQA 5L9DL 3MV9E 5C0JB 1RIVH 5MHSE 1OF2A 4FFVD 2AQ1A 1OW0C 4JFOB 5FKPA 4NM4H 3T0WA 4PJFE 1T2XA 2R1XB 2FEEL 2VE6A 2AK4A 2XN9B 1UCBH 1S9WA 3FAWA 4PJ5A 2B0SL 3CFDA 1P7HL 1ZA6A 1JZ5A 1T83C 4Y88A 2JB6B 4R4FH 3CCHB 3SY0A 3FB5B 3TC9A 4TNVF 4KKBC 3SDDD 1DQLH 3TN0C 4HJ0C 4CVWA 4ZNCD 1TDQA 1G0XA 3IB4A 3DVGB 1FZMB 4WEBL 4UIMA 3U9UB 3SDYH 1IGJB 4AIOA 4LRNH 3PWUA 4G6ML 3VFMB 1OSPH 3I2CL 3MXWH 3VA6A 3LKSB 4L9LB 2KZWA 2Q8BH 3ERYA 5TDOB 3QNYA 1KLFA 5B39G 2ILLA 2N7AA 2HJLB 3WDHA 1T89A 4K55A 5DFWH 3D3VA 3CX5K 1U8NB 1FLTX 2DLGA 2VC2H 4KQ4L 4X7SL 4Y1AD 1MJUH 4LAQL 4Z7NE 1J11A 4JKLA 4MWFB 4RISL 5GRUH 5DMYA 4XWOC 2ADIB 1QSFD 5FO8A 3P4NA 3VGAC 1Q9OA 2HA1A 1D5IH 1X5GA 4LRIA 4EKXA 5I1AB 4FQ2H 5GGSA 1CQKA 3QUXB 2NY2D 3NA9L 4C56D 2D9QB 5C6TH 3NZHH 5E0QA 1UYWH 2GJJA 4HCRH 3TH3T 2W59A 1D9KC 5DI8B 4NNPH 2XZCH 3IDXL 2HVKB 4LSTH 4RFNB 1W72A 4K9EH 4ZUUB 1UZ6E 1FJ1A 2L7JA 3IU3B 4JHWH 1NMCC 1YY8B 3LDBB 1CVSC 2QQLL 1JK8A 3MRFB 5JOPD 1FORH 2UYLB 3MLVH 4NKIH 1JPST 1RUQL 5DWUH 3VE0B 4HQQH 1BZ9A 1HHKA 4ODUA 3P3YA 4UBDC 4JO3H 4X9IA 4F7EB 3FO1A 4JG0H 1N59A 1T1XA 2ZUQB 3VXOB 1QKZL 5H35A 2IH1A 3GUTB 4ODHL 3B2UD 4YXKL 5GS2D 3OZ9L 3B5HA 2N7BA 1N6UA 2VZ1A 2YS4A 3P30L 4HZLA 4PJDA 3RDTB 1CICD 4XAWH 1RJZB 4YEFA 3QXTA 1XFPA 1RHFA 4LASL 4P4KC 4PJ5E 1UH4A 5MEPB 3K8KA 4U6XA 5CEXA 3W9DA 3KS0H 5TJWK 2QADB 2DQHL 3SKNB 3WMSA 4PV9A 5DVNA 3THMH 3LQZA 4QGYA 3PGDA 2Y7QB 3X3GH 3T4AB 3IAPA 3MCLL 3HMXA 2DJSA 4Y19A 3BN3B 5LWYL 4K7PL 4JRXB 2BP3A 3VFTA 2VR5A 2AK1L 3UJIH 4U0QB 4HXBH 3IU4H 4N8VB 5DRXA 1CU4H 1GC1L 1X5ZA 2AVGA 1I9JL 1V05A 1PW3A 4APQA 3D3VE 4JFXA 4QRRD 5DD6A 4AEIL 4IOIB 1YMMB 2W0LA 4M8QB 4TULH 3VXRE 3QUZD 3N1MC 4TTGA 2JELH 4UV4H 4IIQC 5D2LA 1NMBH 1D5MB 4LLAA 4U1KA 4Q9QH 3TT1L 1Z9SA 4L5FL 3SE3C 3V9FA 1SJEB 3ES6B 2QKIB 2YZ8A 5DURD 2GFBA 3QZWB 3U4BL 1T20A 4CN1A 3M07A 1FE8H 3VW3H 3QIWC 2JJSA 2EDFA 4OZIB 2AEQL 3C08H 1BQHG 5ESQA 4FQXD 4N9GA 3TBSA 5C0AD 3MJGX 5FYLL 2A6KB 1KCSL 3DV6A 4P5TD 5C0RH 4JGMA 4HWBH 4GBXD 4C4KT 3O2DA 3O2VL 1CS6A 3GGWB 4ZSOA 4XHJC 5MI0B 3OKYA 3OHXA 5TFSH 1FC1A 1NLBH 4P9HH 1WBXB 3UP1A 1F42A 4LARL 5EZJB 3MR9A 4P46D 3VFWA 1RZ8A 3CFCL 4G7VH 5E1HB 4G8EA 2EXWD 3RGVD 4PYGA 3RHWF 3GMLA 3EYFA 5CJOL 2Z8SA 1Z0MA 2I24N 2CKBB 4YPGA 1LWRA 3V6ZB 4W4OA 2OQJB 3QQ9C 4M4RA 2VXTL 3AS1A 3G5ZB 2DD8H 2EE9A 3Q2CA 1HNGA 1U8PB 4JO1L 4TUKH 4Y19E 1TQCB 4A2MA 5EOCL 2LTQC 1JF1A 1G7MB 3FOMB 4UT6H 5GGQL 1W0WA 4ZFFB 1JNNH 2D3VA 2MTPA 5I1HL 4CU8A 3DX8A 5BVJA 5IEKB 4UDTB 2FBJH 4ZFGL 1MCCA 3BP7A 3RI5K 2OR8A 2UV3A 4NCC2 4I2XB 2QQNH 1XZ0B 5CIPA 1OD9A 5IFAL 4Y5XB 3TBYB 3U1SL 4RA3A 3UTSA 2VLJA 1BJ1H 5CGYD 1ULVA 3BP4B 5D2LE 1FHGA 4NZRH 1A7NL 3R0NA 4M00A 2VZOA 4LF3A 4Q9BA 4OB5L 1ADQH 2XG4A 1SJHA 3HS0B 5IJKA 2Z93A 5D7JC 2XWJB 3BQUC 2P5EB 1A6WH 4XCEB 1A1OA 4JFDB 3DXAD 4PB0H 4OLWH 2R2BB 3LKPA 2OK0L 5GRZA 4M7ZB 1TZHB 2APFA 1BVZA 4OI9A 1IQWH 1KLUA 3S88L 4JZNA 4I3RL 3CLFL 1DVFD 2JJUA 5E08H 3SDDA 1F3JB 3BPNC 2DLIA 1DBKH 2IADA 4JN2A 2WWKO 1P84J 2ZUYA 4OM0H 3WIIH 4Y8AA 4Y4KC 1HHJB 5T1LB 4OZFH 4Q2ZB 3VXSB 3FT3B 3DHMA 4GG8A 2LU3A 5DJ2B 3FT4A 5IMLA 5C0IA 1RUKH 3MCKB 3S5LG 2H32B 4ZSOE 1CFVL 1FNSL 1H8NA 5CGTA 4WHYG 3V6FB 1KCVH 3KPLA 4HULB 1ZHNA 4PJ7F 2A83A 1KJ2B 2VDML 3O8XD 1CFTA 1DQDH 4R7DA 4MD0A 3UMTA 5IHLB 4ONOA 4Y1AA 4NP4L 1PQZB 3UZEA 1HSAA 1QSFA 2WQ8A 3GKWH 5F93C 1YEFL 3H9YA 4Q6IB 1AHWB 4GRWH 4C56A 1TQBB 3NH7H 1MFEL 2BVEA 3G5XA 4HWUA 3PF2A 1JJUA 2MKLC 4GG6A 1INDH 1QRNE 1MLCB 5IEHB 3DIFB 3MRRB 2PO6D 2MPAL 2GSIB 4DKDC 3MGOB 5DJ0B 1RHHA 4YBQD 4N0FA 3AREB 4NO0D 3GBNL 4FS0A 3LQAL 1TZIB 4PBXA 2YPLB 1MLBA 1JP5A 3FN0L 1U2HA 1OCWH 3IETB 3BGMB 2NMSA 2W65A 2PUQT 4JZOA 4W70A 4LCWB 2AKRB 1M7IA 2Y9RT 4DN3L 4MAUH 3T0AA 4ELMB 1S5HB 5EN2A 3FQXA 3GHBL 4OCMC 5CJ5A 5EDXA 3FONA 1R3JB 1CICA 1KJMB 1I9EA 4HH9A 3VFPB 3BRDA 1U92A 5E99L 2DN7A 4PGBA 2YA2A 4TQEL 2E6PA 2MCPL 4KJQD 4L3ED 2VB5A 4XP6L 1AFVH 3V4VL 1FCCA 3BSZH 4KY1L 3P11L 3AB0B 2CRMA 3QXUA 1RMFL 5DRWA 4YWGL 4Z95L 1P2CA 2Y23A 3QEGH 5E95B 4OM1H 5E8NB 1M05A 2HG5B 3SEPA 1FVCA 2J8UF 3IRZA 1JGDB 2OLDA 3FAXA 3TBWA 5J1AB 3RVTD 1A6TB 5T1KB 1J1XH 4IS6B 1AGDA 4YK4B 1RZ7L 3HR5B 3SDAD 3DVNB 3Q6GL 4QRRA 4HV8A 3QUZA 2D7PA 1MH5A 2OXHA 2YPKB 4HBCL 4YE4H 4HKJA 4Y1AE 4C54A 3NPSB 3LV3A 7FABL 3GMPA 1BVLA 1AQKH 1LDPL 1QSFE 4POZC 4MXVE 5C08D 4U1LB 3RWJA 2VWEE 2EE6A 3I6LD 2F54B 1KEMH 4YBLC 4C56E 1LE5B 4HJJH 3PDDA 1A3LH 1BQLH 4NZTH 1NQBA 1DTUA 1R5IA 3NFPA 4GS7B 5GGUB 4GG6E 2E3VA 3G6DL 1OARL 2V2XA 1ZGLB 1Q0YH 1UWXH 4JQXA 1LP9B 2EEAA 2C3WA 4FQXA 5FV2A 5C0AA 5JOPE 5JDSA 4NWTH 4P5TA 4H1LB 5ADPL 1N8ZB 4GBXA 4E42B 3AAZA 3PV6B 1R6VA 2FYYB 4HS8L 2XFXA 3P4MA 4X5LA 1II4E 3HUJA 4M6OL 4XNMB 1MFCH 2DYPD 1AD9A 1MPAL 1A3RH 1PLGL 2G75B 4P46A 1ZVHA 5INCB 1N2RA 3BMWA 1LD9A 2WAHA 3RGVA 1JMZA 3O9WB 4ZOEA 4AEHH 3QDHA 1UH2A 4L29A 4YNYB 1ZHKB 2HT3D 1N0XH 3AS2A 4CW1A 2YXMA 1E4XH 3WXWL 1NLDL 3I85A 5JORA 4KRLB 2AJXH 3BKMH 3MGTA 2CR6A 1MHHA 1NKRA 1D5BB 5JOEA 1DJSA 5FO9A 1C5DB 2NY7H 4HUXA 2P5WD 4OFDA 1MVFA 3HNSL 4N1HB 1YC7A 4F7MB 3NCYS 4HCRA 5I1GL 5D9SA 2FO1A 4XP1H 2RAMA 4PP2B 5TGBB 3FN3A 1HYSD 1BAFH 2ZJSH 2B1AH 4Q9RH 3BKCH 4CKVX 4QRQA 3TWCL 4QRRE 4IOFD 5IQ9A 3RZWA 1S7SA 1HH6A 1NGXA 4XVJL 1LO5A 2WUBL 4LL9A 4GAYA 2WV3A 4ZUSA 1FC2D 2A6IB 3HFMH 4JFEB 3RKDD 1RU9H 3GZKA 5ID0B 2AABL 2X4QA 2V9TA 2GIYA 3DXAA 5JR1L 5DGRA 4NO3B 3F6IA 4WFFD 3ROOB 4OD1H 2M1KA 2Q1EA 1DVFA 4WEUD 3K0WA 4XPFL 5I1CL 1JVKA 3TIDB 4XP5L 1VFBA 4OLXH 5I8OH 4I1NB 5F7HA 3AM8A 5C0AE 5IMKA 1LO3H 1OWWA 3A6OA 4FTVD 2G2RA 3MRGA 4OGZA 5DSCA 3RWFA 3SDCB 3H0TA 4NN6B 3MRHB 4NC1E 1F4XL 2A77H 5KANG 5MEQA 3PWVA 3K1DA 2AI0L 4FFYL 2E6JA 4BZYA 4PJIF 3HUJE 5F7MC 3O6KL 4C58B 4M7KH 1DP0A 5H94A 2FECL 4ZUWB 1DN0A 2BSTB 1KJ3H 3CFBB 5JZ7C 3VD7A 2VRAA 4NRZB 4WW2F 3WHE0 3V4UL 4WCYL 4WGWB 5IMMB 2FX7L 1I8KB 3DV4A 3KYNA 4YHIA 4MAYC 1GGBH 4PRAA 1RZFL 1TCRA 3EYVB 4WRLA 1AGEA 2VXQH 2X1OA 4IRZL 4YC2C 3WN5C 2PO6A 1K5NB 2XQYG 4MQTB 3CPLA 3CDCA 5KZCB 4P3DB 2IFGA 1QTYT 1RK1A 4XNZB 1LEGB 4OCNC 1P4BL 5IB5A 3LS5L 3VGEA 2VZSA 2ICCA 4LVNB 1XT5A 5BV7C 1QLFA 5EC1B 1UJTA 4PJCF 1KENH 4RAUB 2IANB 3FB7A 4HUWA 5I0ZA 2DQIH 3W81A 1MJJB 4L4VA 4HWBA 3KJ6L 3LS4L 5B8CA 1JYNA 1G9EA 1E4JA 1AI1H 2YN3A 4FQLH 3DXAE 4MD4B 5IM7B 1EHLH 4Q0XL 4L3EA 3GO1L 2OI9A 5HDBE 1OB1A 3JZ7A 1MCOH 1MHPH 3E3QE 4RGNB 3QDMB 5E70A 1I9IH 3C2SA 3KS0J 3QBTB 4FHBD 1R3IL 4V2CB 1UQSA 1JGLH 1J1OL 4JM4H 3IDMA 1NC2B 3F7RA 1KV3A 1WAAA 2UY7A 3MJ9L 4NZUL 1DL7H 5DZOA 2AEPH 3L9RB 3SDAA 1FFOB 4I0PB 1XF1A 5I73C 5IHZA 1N6QL 5F9OL 3VCLB 1J0JA 4KJPC 4Y4FB 4KDTA 3BISA 1R24B 5IVZB 3L6FA 1IFHH 2FLRT 1GHFH 3DVFA 2Z35A 5C08A 2OBGA 1C16B 3ARGB 4QHUA 4LLVA 3MLSH 4PJFB 4PJAF 5HGGS 5CBEA 1G7PA 4ONHA 4NDMA 5FDWA 1ADQA 4Z9KB 1ROWA 1FPTL 3FO2A 3IJSB 3AFLA 5DA4A 4WWID 3MRIB 2ESVD 5SX5H 6FABH 4Z7UF 1FV1B 2D31A 1VFAA 4NHUA 1ZKAA 2R9HC 4HIEB 2Y06H 4GXVL 2DKUA 4MB3A 2ARJA 2VOTA 2EC9T 1Q0XH 1T4KB 3H42L 4KI5C 2HJKB 2X4RB 3UTQB 4BELD 1I3VA 4PLKC 3WDJA 3BZEA 3P2TA 4QXWA 4OZFA 1OT1A 4K07A 3D0VB 1L7IL 1CFQA 1B6UA 1ZT7B 5DMIH 3F58L 5B3JF 1AP2A 3BWAB 2VLKB 1K4CA 3L3GA 1D5ZA 2MMXA 3TCLA 3VI3E 5CJBA 4EBQH 4L3EE 2H26A 2IH3B 4O2EA 4XBGA 5ILTL 12E8L 5ALCL 4X9HA 1MJ8L 4O2CA 4HFWB 5FGCB 5HYSB 1MWAA 4N0UE 1QFWL 1W2KT 2P5WA 2JJTC 4KMTL 3DTXA 1KXVC 2EYTB 3U36A 5KS9E 3WXVL 2YA0A 1WAAE 3QUYB 4LSDA 3PXHA 2Q6WA 4ODBD 2VDNL 3REVB 5BZWA 4Y2DB 4IRSC 2LAAA 1JGUL 5BS0D 2EZ0D 4LSRL 4QXUL 4RGMB 4YDKH 1K3ZA 2QJDA 4U6VL 1JI1A 5AYUH 1OWRM 3I6LE 2IQ9H 2BERA 1BJ1J 2H9GA 2B4CC 5CSGA 2VE6B 3ZKNC 4YX2H 1YNTA 3MA7A 2AK4B 3ECBA 5CEZD 3ZLQC 4WI7A 2ZZUT 4L8CA 1EUTA 5SV3A 3S4SB 1CCZA 4PJ5B 4MZ3A 3FOLA 3CFDB 1ZA6B 4XGZA 3T65A 3TA3D 4ETYA 4NHUE 4N0RA 1YJDH 4XP9H 3SY0B 1B0RA 4PJEE 4FTVA 3I50L 4EN3C 1MCLA 2Y6SC 2R69L 2HTLC 5E8DL 3WCYA 5BVPH 5D70H 4B5EA 5EO1B 4WO4C 2ARWA 2FZ3A 1HE7A 3N1PC 1FH5L 4QRSA 1C1EL 3PHOA 1BBJA 2NY4C 2V9RA 1QYGH 5L8JB 4HK3J 2NY3D 1A22B 5GGRY 4G6AD 4IDJH 4WY7L 1IKFL 3JTSA 1NBZA 4ZO9A 4BSWA 5AEAA 3P4NB 4Z7VA 1G9NH 3L3KA 1HDMA 2C3GA 3H3PL 5GGSB 5FCSH 3HZMA 1IAIL 4NKMA 4GRWE 4X99A 4IMKC 2L0DA 2WBJD 3U79A 1ZEAL 2P5WE 5JPMA 3B9KA 5EWIH 4X6BA 3DUSB 3TZVD 3EYSL 1U93A 4OV5A 1W72L 4WU7A 1FNAA 1W72B 4KVNL 2IMNA 4QTIH 2E7BA 3TPKA 2E8YA 3D1MC 1FJ1B 2H3NA 1EO5A 2EIZA 3RZCC 2EDOA 1FZOA 3I3BA 4B53A 1BZ9B 1HHKB 2ENSA 5F9AC 1WF5A 3IF1A 5T1DL 4JM2F 4MS8A 2QSTA 1KJVB 3ALWA 1M1SA 2IH1B 4WFFE 3TBVB 2FIKA 1NFDF 4HZLB 4PJDB 5J8OA 3RFZC 3WLWC 2QHRL 4LCUA 1ZHBA 5K9OA 1I4FB 1U36A 2VO5A 4X80H 1KIPA 2Q8AH 3S37X 4L8DA 1QSZA 3P9LA 3W9DB 3TYGH 1JPGA 1GGIH 4GSDL 2EKSA 4FTVE 2V2TA 1AR2A 1KACB 1RJCA 4JPIA 3LQZB 3VFGH 3HMXL 3PGDB 1X9QA 4ZYKA 3BAEH 4CDGC 3NN8B 3LRHA 4U1SA 1L8JA 4Y19B 2YPVL 1F8TL 1U91A 4MJ6B 5IK3A 4F33A 1Q9WB 1IC7L 4JY6A 3GNML 1S7QA 4UT9L 4JPWL 2E7LC 1K3IA 4OZGF 1KFAH 1S7VB 1WIUA 5CCKH 4GOSA 4APQB 4RFOH 4JFXB 5DD6B 3EHBC 3WUWA 4E41B 3HN3A 3IKKA 2ENYA 1TXKA 1N6VA 1B2WL 5IG7A 4YAQB 2BHYA 5J13C 2PF6A 4NZDA 4Z7VE 4OI8A 3N9GL 5BMFL 4CDHA 1DEDA 3FO0H 3GM0A 2ESVA 4PP1D 1NGWA 1M7DA 1CDBA 3R0MA 2GFBB 4I3SH 3RNKA 1MEXH 3GMRA 5DYOB 2FD6L 1NUFA 1I85C 4PJIA 1FAIH 3TF7C 4BH7A 3ULVH 5ESQB 4N9GB 1UKTA 4HUVB 4G59A 3O2DL 3DV6B 3PP3K 3B9AA 4HF5H 4L1HA 4P59H 4RA0C 2F5AL 1EJOH 2MHAA 4ZSOB 4OLYL 1JPSL 3QYCA 4UINL 5L8LB 3ULVF 1YEKH 1V3MA 4UOJA 5D1ZD 3MR9B 3QPXL 4FQCL 4NUGH 1SEQH 2P4AB 4G8EB 4MGXA 3HNTL 3D2UD 3TNNA 3H7BB 5BOPA 4JHAH 3GMLB 5GZNC 4XCFH 4OFVA 3OF6D 4RRPG 5TPWL 5EUKB 4ZTPH 4HIXH 3NIGF 4EXPX 2RB8A 4YPGB 2AJUH 3O0RH 3TV3H 3MFGB 3F7PC 4KDVA 5C3LD 4PJCA 4C55A 1KCRH 2EH8L 5L7XH 4XI5C 1J8HD 4PJHB 3BPLB 4LKCA 5F96H 1W0WB 4OLUH 4FFWC 5KBNC 1EH9A 5MENB 3DX8B 5BVJB 4U1IA 1CXIA 5ISZD 4F3FA 1KC5H 5BS0A 2NW3A 1FSKB 3BP7B 4N0CD 1A4KA 5D7IF 2A1WL 4GW4A 2GTWA 5I74C 1Z5LA 3NCCB 3UTPD 3WLBA 3UTSB 2VLJB 2XA8L 1RIHH 4YFEA 4KMQA 4U1GC 5C0ND 1VEPA 4G3YH 2ATPB 4LF3B 4HPYH 1OM3L 5KVFH 3LOWA 1TETL 1DQQA 1SJHB 3O3EA 1VESA 2Z93B 1I1AC 5CD5D 6CGTA 5CILH 1F4WH 1A1OB 1RD6A 1UACL 2ESVE 1HHGA 3FFCD 1WEJH 4F7PA 3TA3A 3T0EC 5DK3A 1KLUB 4JZNB 2J4WL 3V8OA 4S1DC 1KBGH 4PJIE 3ARDB 4F8TA 4JN2B 1ZLUK 5JPNA 2UWEB 4KUZH 3MLYH 4U3CA 4X4XB 4F9PC 1TVBA 5E1AA 3T3PE 1FRGL 5IMLB 3FT4B 5C0IB 4ZTOH 3LY6A 2F53D 1JGEB 4XBEH 3PUCA 5GIRA 5ICZB 2ZP0T 2I60H 2HTKC 5IF0A 3EFDL 5IQ7H 3KPLB 5IVXF 1IC5L 4PJAA 1CFTB 4EDWH 3O11A 4MD0B 2Z9TA 5E9DD 4GRMA 3CMGA 5FAAA 4UZGA 1MSPA 3X13A 5IB1A 1MIML 5C0BA 4K3JH 1HSAB 3L3IB 3ISWA 5EH1A 1RZJH 1INQA 3SCMD 4BFGA 4WJ5A 4WFGD 2NY2B 5I1EL 4MXWL 2GTZA 3TZVA 4GG6B 4AG4H 1Z6JT 5HHPA 5GRVL 2H1PH 1RHHB 4TOYH 2FEDD 5BS0E 1IGML 1YMHB 4D8PA 3ZDZF 3MRCA 4BA8A 3L3DA 1P69B 1ZLWK 3WO4B 3LHPL 2UZYB 5LGJB 3MV7D 3WUZA 5HGBA 2OTWA 4G6KL 3LKNA 2NZ9C 5F7FA 5EB9A 3RIAK 1IC4L 2PKDA 3ZE0E 1ZLSL 1QHOA 4R0LC 4YHYC 1NCAH 5J56B 1K8IA 5EN2B 4BH8A 1NCDH 5CEZE 3FONB 2OR9L 3PL6A 1J0KA 5D6DA 4HH9B 4L8SA 2YMXL 1G9MH 1U92B 3RWHB 4PG9A 4PGBB 4N1EA 1K6QH 1NGYB 4P4RA 3H9HB 3RVVC 5B39A 3CH1A 1TTUA 5DRWB 3NCYP 4DN4L 5GGVY 1CGWA 4OAWA 5L2KB 1P2CB 4GW1A 1G0YR 1WUNT 3GMOB 2D4DA 3MO1A 3MLXH 1FVCB 3WJLA 1KTDA 1MCIA 1JYWA 4WFED 3X14A 3TBWB 4HK0A 3C8HA 4ISVA 3GMQA 3GI8H 1JL8A 3F7QA 2CO6B 4J3VA 4D9QD 1AGDB 1A0QH 4RSVA 1PKOA 1MFAL 1ERNA 4CNIA 1RI8A 5GSRB 2X4OA 4QRRB 2DOCA 1RIVL 5DRNA 1T5XB 3AMKA 4MNGE 2FHBA 3LV3B 1A1NA 3DJ9A 4W4NA 4Y8DC 4XNYH 4NM4L 3X11B 3WL9B 4AK1A 1HHIB 2E9WA 2NY6D 5I6XB 3BGAA 4U05A 1F2XK 1BF2A 1CTOA 1WWCA 1QLEH 1PG7X 3RL2A 2V2XB 3HPJA 5I18H 2FGWH 1U8QA 1BD2D 1T21A 1BOGA 5I17A 4FQXB 1HH9B 5E2UH 1DQLL 4UOW1 4HX1B 5LJYH 5CZVH 3ULUC 1WIPA 1IQDA 5C07D 5B3JE 5FIEA 2MOVA 4AEFA 5JDSB 4D9RD 2P47B 3RVUD 4GBXB 1KPUA 2PYFA 1SYVA 3SDYL 5J11C 2DBJA 4LRNL 2XFXB 3P4MB 1OSPL 3MXWL 3HUJB 3JUYA 2AV1A 2Q8BL 1AD9B 5FOBA 5D1ZA 1XGPA 3I3DA 1N2RB 1Q1JH 4W6YB 5HI5D 3D2UA 2VC2L 1MJUL 1U8IA 1VADA 2XG5A 5GRUL 4KXZI 1E4KC 3C60D 4R6UA 4DUWA 1D5IL 1RFDH 4NKQB 4FQ2L 5IBUB 4HAGA 2ED8A 2DLTA 1DLHA 1J8HA 3ARFC 5C6TL 3NZHL 1UYWL 5GGVH 4HCRL 3ARRA 5C3TA 4NNPL 2XZCL 5ISZA 4LSTL 3V5HA 2KQNA 4K9EL 4FNLH 5D9SB 4N0CA 4JHWL 3ZE2E 4M62H 2CH8A 1MCWM 4QRQB 1FORL 3DURA 4HIIB 5C0GB 3MLVL 4NKIL 5DWUL 5TF1H 3TYFA 4HQQL 1S7SB 1HH6B 1LO5B 2M8XA 4JO3L 3IDGB 4ZUSB 1WT5C 1BQHA 4JG0L 3G6JF 1RUPH 2X1PA 3RTQC 2X4QB 4WI2A 3ZDXF 5DHVH 3C6LC 1U8HA 5C9JA 1NEZG 3FFCA 2BMKA 4XAWL 3RP1A 5FF6A 3VFUB 3U83A 3E6FA 3F5WA 2VR4A 1DVFB 1XIWD 3QI9D 2NY5H 4OCYH 3RWCA 1QG3A 5TF0A 3V52H 3E2HA 2X10A 1HYRC 1QVOA 3THML 4PJXF 5IMKB 3TP4A 3WKMH 1C12A 4XP4H 5EU5A 4JCLA 2OJEA 3X3GL 3MRGB 3RWFB 5DSCB 3H0TB 1ZT4B 5H37G 3V5KA 2F53A 2KPNA 4ZFZB 5EPMB 1FL5A 3MNWA 3PWVB 4HKBA 1TVDA 3KLSA 4JQVA 4RMSA 3UJIL 4HXBL 1LNUA 3IU4L 1CU4L 4LLDA 5H94B 2VTFA 1DN0B 1HILA 4GH7B 4EDXA 4TULL 1JBJA 2XTJD 2JELL 4HT1H 4UV4L 4CN4A 4I5BB 1S8DA 5T33H 4HKXB 3BIKA 2VAJA 4Q9QL 2YC1A 1YN6A 3DX7A 3KYNB 4GKNA 4MCZA 1QA9A 4PRAB 1NUGA 4HUNB 1TCRB 1J8HE 2CRZA 1IMHC 3MZTA 3K80A 4M43H 3G04A 1OP3H 1FE8L 4KK9C 3VW3L 1T6VN 5ISZE 4XPHH 1L7TH 5EFIB 4M48H 3C08L 3TNMA 4P3CH 2Z4QA 5HHMD 4MA3B 3UTPE 4U1MA 2CJUH 4EQ2A 3VGGA 4HWBL 1BECA 2XXMB 4HUWB 5I8EA 3KLDA 4Z78A 4JKWA 2FX8H 4L4VB 1DEEA 3KLAA 4BQ9A 5TFSL 5MP6H 5IR1A 5B8CB 4OSUH 1NLBL 2E6QA 4F15B 1KB5H 4FQQA 1BIHA 4FFZH 4G7VL 1EO8H 3FFCE 5DEFA 5DLMH 3S5LA 3SGKA 5HHVH 2ED9A 4L3EB 1GPOH 2NY0D 2BVYA 2OI9B 1OB1B 1T3FA 3OAZH 3STLA 3WYRA 4EJ1C 1UADC 2DD8L 3GRWH 2Y07H 1XF3A 4KUCF 4TUKL 5D7IA 3ZSTA 3IDMB 3T2QA 4X98B 3VGDA 1G6RH 2D4FA 1HEZA 1JNNL 1NCCH 4LDEB 4B41A 4LGRB 2FBJL 3K4DA 5F3HA 5IHZB 5E9DE 1R3HA 2QQNL 1J10A 4IDLA 5LGHH 3L6FB 4K3HA 1MAKA 5C08B 4QHUB 5D7LD 3HRZA 4NZRL 1H3XA 4LLVB 4WFGE 3OJMB 1UCTA 4BM7A 1ADQL 4X5XA 5CBEB 2VDOH 1G7PB 2VSCA 3JV6A 1A6WL 3RVXD 3FO2B 4PB0L 4OLWL 4M3JA 1A9EA 4QHNA 1GJIA 4CN6A 3UJJH 1IQWL 1E4XI 1BD2A 3X12A 5C0FA 1VFAB 4NHUB 5E08L 5DMGC 4GQ9H 4KK5D 3FQWB 1DBKL 2WNGA 1D5XA 3NA4A 5C07A 4DJMA 1DBAH 3MV7E 4OM0L 3WIIL 4PJ7B 5TE6H 1YEIH 5IW3A 4KKCC 3VD4A 3BZEB 4OQTH 4ESKA 5T5FH 1RUKL 4OZFB 5FEBA 2EDJA 4NKDA 5BZDA 3CDYA 3AXLB 4X7CC 1CFQB 5E5MA 4F58H 1KCVL 3RUGF 4BYHA 1AP2B 3U0PA 3OGCA 1DQDL 2P24A 1D5ZB 5E4EB 1QFOA 4LPVA 3TCLB 1OVZA 1WC7A 3BGFC 8CGTA 4MHHG 1AIFB 4PRPD 4XBGB 4AM0A 3C60A 5FECA 1F4AA 3GKWL 5DJAB 1F4HA 1A02N 3LSOA 3D69B 1MWAL 4UB0H 4O2CB 3NH7L 2FJFB 1PEWA 3MRMA 4GRWB 1JPTH 2HFEB 4OJFH 4I4WA 1F45A 1INDL 4P2RB 4X5WA 3HA0A 4WFEE 5D7IE 3DTXB 4PYHA 3HTLX 3U36B 1QZ1A 4CL7A 5JMRA 1GYAA 2BJMH 3P9WB 4D9QE 2Q6WB 4JDZB 5EBMB 2XWTA 5M95B 2FRGP 3ZTJG 2BRRH 4DZBA 2Q76A 3S3PA 3ZT5A 4L8BB 1MHEA 1OCWL 2A0LC 5DTFA 4MAUL 4P57A 5KSAA 4M93B 4MLIA 1SYSA 3OR6A 1YNTB 3MA7B 1F6AA 4L8CB 2A74A 1HOCB 4HGWA 4KKBD 1XIWA 3TM6A 3TN0D 4HJ0D 3QI9A 1BD2E 1AFVL 3FOLB 2BOBB 3BSZL 3T65B 5F44A 3O3BB 1B0RB 3EOBB 5C07E 1I7TA 4OF8A 3QEGL 4PJ8B 4D9RE 2NCMA 4OM1L 2P43B 5D72H 1P84K 4KRMB 2DL9A 3GK8H 4WEMB 2ERJC 2I25N 4CU7A 2CXKA 2BY3A 1DBJH 2FZ3B 1JGVH 4HZAA 3IFOA 1UKSA 3I02A 1J1XL 3MRPB 5F88A 2RJMA 4KGJA 2DM7A 3EOTH 4XWOD 1PKQA 4UAOC 4K71B 4YE4L 4PB9H 1QPXA 1AQKL 3CNKA 3PG2A 3L3JA 1A6UH 4BSWB 3LD8B 4FXLA 1KEML 4Z7VB 1ODAA 2DB8A 4LHUG 3RL1B 3W82A 1HDMB 1D9KD 4HJJL 1A3LL 1BQLL 4NZTL 3HZMB 4OF7A 4NKMB 3UROR 2H2SC 4X99B 2GK0A 2JTDA 2C1PA 5JPMB 1WITA 3B9KB 4ZG1A 1NFIA 4P2QB 4X6BB 1Q0YL 1JF5A 1S9XB 1U93B 5D7SH 4OV5B 2X7LA 4WU7B 3EDJA 3HI1A 1A64A 1ZGLM 3KXFD 4HS6A 3PDOA 4UBDD 1U8KB 4YDJB 4JRWA 4NWTL 4X6FA 1S7TA 1OP5K 4G6FD 2H3NB 1KIRA 1U8MA 2B2XH 2DDQH 3ZHKA 3WO3B 4BQ8A 4EUPB 1KCUH 3GM8A 4ZXBB 4DFIA 5GS3A 2W60A 2KH2B 3IF1B 5ESAA 1MFCL 1UEYA 3S36H 3TT3H 1A3RL 1H15A 4P4KD 4KAQL 5L9DH 1HHHB 4J7RA 1F11A 3QQ4A 2FIKB 4BKLA 3VDCA 4OFKA 4AEHL 5JW4N 2P8LA 2XWBA 4QO1A 5JHLH 5K9OB 1QQDB 4F9LA 1KIPB 4GKZB 4L8DB 1N0XL 5BRZD 1E4XL 3P9LB 1AKJB 1N7MH 2EECA 2XQBH 5CAYB 2EKSB 2AJXL 2APXA 4HWZB 3BKML 4JPIB 1BIIA 2JCCE 3BZ4A 3CUPB 4LLMA 4ZYKB 2XICA 3MFFB 1FYTD 3NCJH 2NY7L 3QP3A 4U1SB 4TNWK 3PV7A 4PRBA 2ZUSA 4F33B 4LPYA 4X7FC 1KTLA 4XP1L 3EO0A 4JY6B 3NMEA 1BAFL 1A7QH 2IF7A 2ZJSL 3UC0H 3MUHL 2B1AL 4Q9RL 3BKCL 1T04A 2C3VB 2MCG1 2ATKA 5BJTB 1PKQE 2H6PB 4PD4J 1B90A 2XTJE 4JQIH 5GHWH 4CBPA 4GMTH 3U6RA 1CD1A 3HFML 4YIQA 3ABZA 3OKEB 1RU9L 5DJDA 2LV4A 2VN4A 3U30B 1R5WA 3QIWD 3QRFM 4OD1L 5DHVA 1RSFA 3RNKB 3KPOB 5HHME 3OL2A 4OLXL 1MREH 1U2CA 5I8OL 5ACZB 1S9VA 4ORGA 1FFPA 2E27H 4UT7H 5FGBA 4PJIB 4XPAH 4HC1H 3KPRD 4XHJD 1I3UA 1TQBC 1UJ3A 3DNKA 3S9DB 2A77L 4N5EC 2OS7A 5CINH 2VL4A 5F89A 2D0FA 3AU1A 2MHAB 3QCTH 1JZ3A 1OQXA 1MQKH 1IEAA 4M7KL 3LIZH 2QQLH 3GJFH 2XZZA 2P42B 1KJ3L 4PRPA 4MJ5A 3LQAC 4DGYH 3FQUA 3QQ9D 2VUOA 2R2EA 3TNNB 1QKZH 4MA8H 3SN6N 1CLYH 4ODHH 1JF6A 1CFNA 1GGBL 1S7WA 2DBLH 2IWGA 2VXQL 4NFDA 5FYKU 3BRGC 1S9KC 3QUMH 4PJCB 5J12C 4HLZG 3RX5A 1KPRA 3T3ME 4W6XB 4C83A 5DD0H 2DQCH 4LKCB 3HC0A 3TGXA 1NL0H 2C7UA 3BYTA 1OW0A 4U1IB 5C0EA 4F3FB 3STZA 3BWUC 2NW3B 4CMHC 3VRJB 1A4KB 1KENL 3PABA 3VFOB 1NSNH 4GW4B 2GTWB 4Q7DA 1Z5LB 2XYCA 3EFFA 2DQIL 5D7LE 1CDUA 4X4YB 5AUMA 5D7JD 3BQUD 4PRIB 4FZ8H 3HMWH 1DLFH 1G7IA 5IGXH 5CEZL 1T83A 3LKRA 2W9DH 1AI1L 4FQLL 3SO5A 4KTDH 1DQQB 2V5SA 2BSRB 3UXFA 3O3EB 4EVNA 1IL1A 1KB5A 3RWGA 4AEIH 3TN0A 1EHLL 3E1F1 4TNVK 4MZ2A 4W81A 4HK3N 4R90H 4NPYA 2YD5A 4F7PB 1AXSA 4M61A 3TA3B 3NPSC 1MCOL 4Y4KD 1MHPL 4IM8A 1ZA3B 1BFVH 1I9IL 1ZLVK 5DA0B 5JPNB 4JM4L 1JGLL 1VSCA 4XMPH 4GS7C 1TVBB 3GRWA 3TO2A 5DMJB 2W0KA 1DL7L 5FK9A 1H3TA 1ZSDA 1G6RA 5GIRB 2AEPL 1WISA 5FKAA 4Y16C 5IF0B 1EEYA 1DQMH 5D5MA 2GUOB 3OKOB 3CU1A 4PJAB 1PX3A 3KLHC 1IFHL 3SKMB 1TTFA 1GHFL 2QR0A 4PRPE 5KG9B 4OZIF 2QHLA 2G5RA 3X13B 5GS1B 5IB1B 5C0BB 4QEGA 3MLSL 3FB6B 1HSBA 1TJHH 4Z7UB 3SE4C 1D9KA 3MV8B 3RWIB 2FH6A 4ZPTA 3JV0A 2R23A 3D18B 4QRTA 3EDKA 4X8XA 2GTZB 3TZVB 4TPRH 1EAJA 2GEEA 4QTHB 6FABL 5HHPB 1BEYH 1DSFH 3KXFA 1YEEH 2Y06L 3MV11 2YD1A 1TZGH 5IFJB 3EGSA 1Q0XL 5A40E 1EFXD 5GJTH 3QQ3A 3MRCB 3L3DB 3F8UB 4NSKB 5BW7C 3BEVA 3ET9F 3AS0A 5HGBB 5EO9A 1JTPA 2K9UA 3LKNB 2OTUA 3FQRB 2EEDA 3HE6C 4OQTA 2JB5H 1NGZA 4P4KA 5D2NB 5DMIL 1MAMH 1K8IB 4QGTA 4LKXA 1EFQA 1IGCH 2Z8RA 2A6JB 1YY9C 3PL6B 1EO7A 1JHLH 4UTBH 3MNZA 3MLRH 5BO1H 4EBQL 1MCRA 1A7RH 5BRZA 2RIKA 3LZFH 4JREC 5SX4I 1P1ZB 1XGQA 5EZLB 2E9JA 5B39B 1JI2A 2R56H 3CH1B 1I75A 4QXTA 4LFHD 3V7AG 3WJJC 3ELAT 5F1NA 1Y0LA 3SBWC 1FYTA 4UQ2A 3R1GH 5A2KH 3GI9H 4U3XA 1X6NA 5D8JH 1KTDB 3CSYA 2PXYC 4HK0B 4RCAA 3GMQB 1BWWA 3HPLB 5F9WC 1QFWM 4IIQA 5E8PA 3CSGA 5D5ME 3OKNA 1U8OB 4POZD 3D0LA 1FNHA 2X4OB 3SE3A 4YDKL 3SDCC 4GUPA 1W8OA 5AYUL 5KTEH 3FO9B 4DGIH 1CGSH 2PCPB 4UNTA 1P53A 3I75A 3QHFH 5BV7H 4PREA 4OZ4A 3QIWA 4WV1C 2Y36H 4YX2L 3WNMA 1PBYA 4NOFA 3KPTA 5DZNA 3VXTA 5K9JH 3QG7H 3BJLA 1YDPA 5EBGA 1KIUA 3RL2B 5JO5A 1IGFL 2VDRH 2CD0A 1G7JB 5I76B 2AJYH 2YK1H 3FRUA 3PQYB 3MLZH 1U8QB 3DRQA 3KXFE 4XP9L 1T21B 1IAKB 1V3KA 5C09E 5I17B 3B6SB 3KPRA 1WIOA 1IQDB 1IGIH 5I2IB 5I9QB 5BVPL 4JFFD 1KPUB 3V7MA 1NCWH 3LEVH 3OJDB 5E24E 3QEUA 4GW5B 2BHZA 3PHSA 2AV1B 4LVNC 1QYGL 5H37H 5FOBB 3RHWK 1XGPB 5HTSA 4YHMH 4IDJL 5DS8B 4KK6D 3U4AA 3VXMD 2IJ0C 3D2UB 5F21B 5BRZE 5C9KA 3KWWA 2DL2A 1CGTA 1HI6A 5HY9B 1VADB 2GK2A 4MJID 3OWEA 1G9NL 2QLVB 1QPPA 4JY4A 1P4IH 3I6GA 1RPQA 3HHRB 1G7HA 2FWOA 4M5ZH 3IRPX 3OBAA 4FOMA 1QSVA 4IMLA 2OL3H 3OKLB 1FYTE 2BCKA 3AY4C 1MFBH 1U9KA 5EWIL 4HXAH 4N90D 3CZFA 5ISZB 5C0CB 1IAIM 5HD8C 2RHEA 4QTIL 1G7QA 4WENB 4XAKD 1FNFA 3AS3A 3DURB 2X4SB 3KJ4B 5D7JA 3BQUA 1NFDB 1DBMH 3HZVB 3MJ7B 3VWJB 3RQ3A 1BQHB 1RZ7H 3Q0HA 1PFCA 4NGHH 2ICWI 1PSKH 4G5ZH 3C09B 4Y4FC 5EUOF 1U8HB 2BVUA 3FFCB 4PRNA 2BMKB 4NO5A 5FF6B 5ID1B 4KI1A 4X80L 3L5IA 3E6FB 4Y4KA 1CG9A 3F5WB 2Q8AL 4KFZC 3ARGC 1FZKA 1YUHA 4X0KA 3TYGL 3I84A 3R8BB 1GGIL 3RWCB 5HI4C 1QBMH 3E2HB 3KPRE 5JHDB 3S97C 1QVOB 3VFGL 1C12B 2O61B 4P5MB 2C9AA 4ORZC 4NN7B 1INEH 2OJEB 4KI5F 3BAEL 5IB3A 2J8HA 3MUGB 1CL7I 4ZS6C 4OZGB 3DGCR 3V5KB 2F53B 1MY7A 3RY6C 1FL5B 3MNWB 4RRPA 4HKBB 3QQNA 3BZFA 3WSQH 1AD0A 2DTMH 5JZ7D 1ORQA 1SBSH 5DUMH 4F7TB 1XGYH 1LNUB 4TTDC 4LLDB 5ADPH 2EC8A 1KFAL 4U1JA 5CCKL 3H6JA 4RFOL 1EEZA 3N85H 4EDXB 2D7TH 5F9JA 1RZGA 4MAYD 3MOBH 4AL8H 2KUTA 2EXYC 2AERT 1PLGH 1S8DB 3QWOA 4X6CF 2ZG2A 4KJYA 3BIKB 3ZKXB 5C8JA 5I16A 2YC1B 1YN6B 3DX7B 4U1NA 4MCZB 4GKNB 4BUHA 1QA9B 1ED3A 3VXUD 4IJ3B 3WFHB 2NR6C 4I3SL 1MEXL 4H88H 1FL3A 1FO0H 3G04B 3AMLA 3QXWA 3NGBB 1FFNA 3BE1H 1EFXA 1CN4A 1FAIL 5C0DA 3ULVL 2B4CH 1GIGH 3C9NA 3STBA 4HC1A 4NNXA 4U6YA 4HF5L 4B7LA 5I8EB 2GAZA 4Z78B 4P59L 1EJOL 3D5OF 3GJEA 3CH8A 1FVEA 4M7LH 2HFFA 4UNUA 5IR1B 1DDHB 2O26U 2GQHA 4Y2DC 5DXWA 3IJHA 1YEKL 4J8RA 4KVCH 3DUUA 3JWOC 3GJFA 1FZJA 3FFDA 5DEFB 3S5LB 4ZDHA 4FG6C 1SEQL 4I8DA 3ZDYE 3RPIB 1F4YH 1I3GH 4JHAL 2NNAB 4XCFL 2EDYA 2X4UA 3UAJC 4ZTPL 4HIXL 4Z7WE 3STLB 4XBPA 5ICYA 3BT2H 3MRLA 2AJUL 2X5PA 3O0RL 3TV3L 1EZVX 4L4TD 3UZVB 1O7VA 1KCRL 1XF3B 3X3FH 5ICXB 5D7IB 5L7XL 4KJPD 4M1CC 1BX2A 3QUMA 1HEZB 1IGTA 5F96L 4OLUL 4LU5H 1T1WA 5K9QG 3OXSA 3T4YA 5HYFA 1KC5L 5A2LH 3UPCA 5F3HB 4V2BA 1KEGH 1I7RB 1R3HB 3D9AH 5CSZB 5CBAA 3ZTJH 4OD3H 1RIHL 1C5BH 1UZ8A 2AEIT 4EQ3A 2JIXD 4HEPG 4G3YL 1A7OH 4HPYL 5KVFL 2NY6B 4O2FA 1NKOA 4X5XB 3L5XH 3VDBA 3EJJX 4AQOA 3GMMA 3BDYL 3DMMB 1NEUA 5CILL 5IMOB 3JV6B 4U2YA 5EIIA 1F4WL 2R9HD 3INUH 4NIKB 3ULSA 1A9EB 3RX8A 1WEJL 2V7NA 3MODH 1WBZB 4NQED 2R4RH 3L3HA 4KI5D 1BD2B 5C0FB 4WCYH 4PLKD 1BFOA 4FQ1H 5DK0A 4ODVH 1KBGL 5EORH 4PJBA 4G80B 5C07B 1OAUH 4JFFA 4KUZL 5IVXB 3MLYL 1W0VA 5L88H 4RMQA 4NBYB 3CAFA 3LS5H 4XBEL 3DBXB 1KYOJ 3VFNA 1EHNA 2I60L 4ZPVB 5E5MB 4ZMAT 5IQ7L 1VDGA 5IHBA 1RULH 3U0PB 4JPVH 4EDWL 3OGCB 3VXMA 4Y5YC 3TO4C 2CLRB 5DQDH 1WC7B 4YHNA 1EZVY 4K3JL 4NCC1 5FECB 3C60B 4YDVA 1RZJL 2EE3A 2DQFB 4D3CH 1D6EB 5I30H 1OGAD 4JO4H 5HVHB 3GMNA 3KHQA 4IRSD 3JSSA 4X5WB 4AG4L 1BZ7A 4P2OC 3PE9A 1CT8A 2H1PL 4TOYL 1YEGH 2Z92B 3A67H 4DZBB 4NOBA 4NN5C 1V7NH 1BJMA 1KELH 1CQYA 1E6JH 1Q8MA 1ONQA 1E4WL 3HG1D 4PLNC 3BVNA 3ZKND 1FG9C 2EDQA 4PR5A 1S7UB 4JG1H 2ITCA 2N4IA 3UBXI 4LEOB 2FL5A 5KSBF 4P57B 5KSAB 4ODSH 5IBTH 1NCDL 4RX4D 1EHAA 3MGAA 3OR6B 4Y4HC 1F6AB 1G9ML 4HGWB 2AJ3A 2JJWA 4EN3D 2Y6SD 1K6QL 2HTLD 2VXUH 4WO4D 3CFEA 4PJBE 1I7TB 5HI3C 4U31A 4JFFE 3IVKA 5F7LB 4AIZA 1CDIA 2NY4D 3C2AH 3MLXL 1R3KB 4NKOA 4L1DA 3GI8L 5F88B 2JF1A 1A0QL 3B2VH 4NBZB 1AGFA 1NC4D 4KPHH 4PGZA 4GLRI 5DQJA 5DZLA 3S35H 5I75B 4PY7A 3VXME 2CUHA 1PKQB 4MAYA 4J3XA 4OUUA 2XTJB 2VXVL 4MJIE 4XXCC 1Z2KA 4XNYL 3K1K