2FO4A

Enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Enhanced major histocompatibility complex class I binding and immune responses through anchor modification of the non-canonical tumour-associated mucin 1-8 peptide
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fo4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2fo4A01
1CN4A 1D5BB 2IGFH 4WWKD 4IRSD 5L7XL 2EDXA 1T7WA 3KLSA 3WIHL 3WCYA 3JV0A 5BQ7B 1AO7D 2JB6A 4DK3A 3TFKC 1KLUB 1XF5A 1YEIL 2XPGA 2EDEA 3PWLA 3U36B 2OTWA 4K94H 3EFFB 8CGTA 3SDXE 1XCQA 1H3VA 4PJ7E 3QH3A 4GBXB 4JJ5A 2AKRA 4GW4B 4WHYG 1RJYB 1NC4D 2CKBA 1IGIH 3DURB 3U30B 1MCLA 4HZLA 4PTTA 1C5CH 2R2EB 5J1TC 3ARDD 5FV1L 1HK6A 1H15A 3P73B 4S0TD 1EXUB 1INDH 1B4RA 4MCZB 1ZTXH 3MRNA 4JZNA 3ZYOA 3NACH 4OZHA 2V2WA 4HPOL 4N5UA 1I9JH 4KDTC 3CDGA 1MI5E 3LB6C 5DLMH 5EBLA 3GMRB 5LGHL 3JV6B 4MJ6B 1E27A 4QHKI 1NFDE 4YHPA 4QXUH 3WSQH 4M03A 4PYHA 3SBWC 1N59A 3CVHB 2W91A 5DJ8A 4GG8A 2IAMB 4HK0B 3IDXH 5ITFA 3WFDL 1A7OL 4M7LL 4DZ8B 5FUZH 5JMOC 2EKJA 1SY6H 5HHME 3QHZH 4PJBA 4WIQA 2HVJA 5D7IE 2NMSA 3MXWL 1SYVB 4TRPH 4OUOA 1MWAL 4G7VL 2Y23A 5K59F 3C5SB 5IOPB 4LVEA 1YJDL 1TQBC 4M1GL 5CBAA 4L3CA 3NCMA 1KF9B 3EYFA 1U91B 2V7NB 2I27N 4LRIC 1ZVSA 4I0PA 4IRJD 2BY0A 3OZ9L 1RHHA 4OCXH 3VGDA 5L0QB 3CU7A 3HPLB 1IT9L 1CK0L 2ED8A 1S7WB 3BSZL 1BIIB 5F7KC 3WXWH 4DJMA 2WMPA 1E4XH 2VZTA 5D1XA 5E9DB 1JWMB 1FV1A 1HQ4A 4HQQL 4YGVB 2YN5A 3ARBB 5SX5K 4PV9A 5E99L 2PYEA 4KUZH 4ISVB 1R5VA 3SGDI 2OP4L 1A64A 4BH8B 5MEOA 3BZEB 2DMCA 5GRUL 5DK2B 3I6KA 4AEFA 1SVZA 1W8NA 2YUVA 1JF5A 5GSRB 4JKWA 3DX8B 1MFCL 1BVLB 4KKCC 3WO4C 3HC3L 4WDIA 4MNHA 4WV1B 1QFWL 4RAVB 4EOWL 2R2BB 4NHCH 4L29A 5IP4A 3CC5A 5H37H 1NUGA 2YA1A 3IDGA 1XR8B 3BDYH 3CDYA 3DNKA 3QUXA 2X05A 1I3RA 3ARGB 1CU4L 3ARPA 3GSXA 1KPVB 2RJMA 4ZAKD 3KLHC 1QSFA 1XR9A 5I75B 4Y4FC 1KYOK 1DEDA 4PBVC 2BNQE 4WUUD 1G0YR 4X7SL 5CSGA 3C60B 5EBMB 1IQDB 3MNZB 1MCEA 4EI5B 1XZ0A 2UWEA 5DFWH 3MRBA 3X14B 1KIUA 3GJFK 2ZKHL 3E3QE 4PP2B 4RBPH 1MQKL 4NNYB 2DD8H 1N26A 4HGMA 5T5FH 3WKML 1INQB 1U3HC 1OAQL 3S96A 2ZCLH 1D5MA 4MZ2A 5D1ZD 4P2RA 3STZB 4JG1H 5IBLC 3FB8B 2HLAB 1DVFB 4Q6IA 4PY7B 3VI3F 1LGVA 3BN9C 1Z9LA 5EOTA 3QZWB 1JWSB 5GRXG 3ARRA 4HS6A 1IQWL 4M6AA 1GHFL 4NRYB 4W4OC 1ZLVH 5EUKA 1T0PB 1Y18B 2R4SL 3WL9A 2CDFB 4NDMA 4P5TB 1MUJB 4JRYD 1OGAA 3L7EA 2UZIH 2XY2A 4GSDL 3L5HA 1OSPL 3DWTA 5EOCL 4A6YA 1WF5A 1AD9B 5HHQB 4YDIH 3QDGA 4MA8H 1X5JA 3CPLB 3S4SB 1I4FA 1J7VR 3D85A 3DYPA 4RSVA 1ED3B 3MRIB 1BD2A 2AJYL 3G6JF 5ESVA 4AMKH 3MBEC 5DSCB 1V05A 4FMFA 4FQ2L 1OHQA 4LLVB 5I8KH 3JXAA 3QEQE 3EO1B 4MD4B 4A2MA 3FQUA 1K8DA 2UZXB 3RWGB 3MRQB 2COQA 5DMIH 2Y9RT 1HQRB 2G60L 2XKNA 4AQOA 5CSBA 3FHQA 4L8SB 4PLJD 5FFLA 5DYOA 1MFEH 4JFFA 1B6UA 3PNWB 4NRXB 5F1KC 4Z7OE 1NCUA 4X98B 5DUPL 1A9BB 1KPUA 4F58H 1J18A 3CMOL 3QPQD 5CLWA 4O58H 4CDGC 1UH4A 5EFIB 1WBYB 1BREA 2J8UA 4X8XA 4XP9L 3QEUA 3R1GL 4AEHH 4OKDA 5KOVC 4EJ1C 1OQXA 3H3PH 2C3XA 4R7NB 1DSFH 5FA4B 4PRIE 1JFMA 4OZGF 2HT2D 4V1DE 5D96C 1J10A 4GLRI 1DN0A 4H5SB 4X6EB 2OXGA 3MRPA 3IDYB 1C1EH 2XN9D 3HZYB 2HLFC 5C0RL 5C0IB 5INCB 1S9VB 35C8H 5CLTA 1QR1A 3WFZA 3N9GL 1U8KB 1K5NB 1TZHA 3N1FC 3VXQA 2E8ZA 1AJ7H 5IESL 2AXHA 5AZEH 3U7WL 3PWPB 4ONFH 1U9KA 2G75A 4MMZC 3BKCL 1FYTD 3MLYL 4OSUL 1P4IH 2FD6H 2EE9A 3I3EA 5SWQA 4IS6A 5C0AD 4OKVA 5C0BA 5BO1L 2NY1B 1PQZA 3QYCA 5F72S 4ONHA 5CJQH 4QRSB 1FLRL 1MFAL 3ZE2E 4GJTB 1W72L 1F3DH 3GSOA 3NH7H 1PYWA 1A4JB 3ESVF 3A6CL 4WI9A 1ZLWK 4JFPB 3PWVB 2V2TA 2E8YA 4P99A 2A77L 5FCUH 3WEXA 2VZUA 4JHWH 4LRNL 4IM8A 3OGCB 1NJ9A 3RWHA 1YNLH 1BECA 4XNYL 1NCCH 3OL2A 4JVWA 4D3CH 5JXEA 5J4MA 1KT2B 2SEBA 1TJHL 1F8TL 4F37F 1UH2A 4NRZB 5EO9A 4QHLA 3HG1B 1YJDC 3ZHDA 2R0ZL 1J8HE 5HVWA 3D25B 2HTLC 3LEXA 2YD5A 4GOSA 1QBBA 3BD3A 4CBPA 5GRWA 1NBQA 3VH8A 2F74A 2XWJB 5F93C 3BPOC 3S35X 3F8UB 3QI9C 1NLBL 3V2AR 5LXGH 4HUWB 2NTFB 2ZPKL 2VDLH 4QCIB 4C59B 5FGSA 4PJ8A 1C8PA 3G6JB 5H8DA 3T1WA 4CVZB 3C5JB 1DBBH 1F45A 2O61B 1KB5B 3MV8B 4WTZG 4XAWH 4M6MH 1PX4A 1I7ZA 4DW2L 5JHDB 5F9OH 1HEZB 3I2CH 4HBCL 3RWFA 5C70A 3WIFB 2V9QA 5GGUB 5AUMB 3VGFA 2JIXB 1OP3K 1ONQB 3RGVA 1I85C 3WYRA 1J1XH 1RUAH 3O2VH 2XI9A 4KK5D 4KK9D 4RCAA 3LRGA 4HAFA 3FT3A 4RFOH 1JNNL 2DLTA 4P9HH 3BKMH 4YDJA 1IMHC 4HS8H 4XNUL 4GAYA 1BFOB 3U6RB 1FGNH 5SWSB 5C0FB 3D3VD 3DO3A 4MSWA 3ALWA 4OZGB 4OGXH 5EC2A 5GISL 1EAJA 5FOBA 4ODVH 3SKOB 4NKMA 2FNBA 5FECA 2P5WB 2NY5H 2BVOB 5FM5O 1EHNA 5L88L 3SQOL 4RWYL 4HH8A 4H1LH 1BOGB 1AXTL 1JNLL 5EORL 4ODUA 2Z31A 3MA9L 4M7ZC 5FYKE 3UTZA 3HI1A 1QLFA 4XGZB 4ODTH 1F4HA 4XCEB 3STLB 4I3RH 2VLKE 4EBQL 2HWZL 3HZKB 1ZT1B 3TBYA 1BJ8A 9CGTA 4XVJL 1E28A 1QBLL 3DV6A 4PRAB 1UJ3C 4PJCE 2VLJD 4Y4KD 4L8CB 5CS7A 1JPST 1YEEH 3NCYS 4V3DB 1C12A 3RVTD 4WEBH 2AXGB 1PZ5A 1HHGB 3VW3H 1MVUB 4S1QH 2DLEA 3A6BH 3TT1H 3VXOB 1QFWI 2DKMA 2DJUA 2AJ3B 2M26A 4RAUA 5DD6B 5KVFH 4M43L 3PUCA 3GSNB 1IBGH 3RWDB 2EZ0C 2BRRH 3QO1B 1FVDA 3WFEH 3MGOA 4I4WA 1M05A 4PRHB 2XZCL 3MR9A 1T22B 3D39E 3INUL 3MYJB 3PGDB 4P3DA 2NX5E 3UTTD 4YX2H 1I1AA 1HIML 4JZOA 3Q6GL 1RVFL 2N7BA 1HI6A 1XAUA 1CZ8H 2CKBL 1RUMH 4PJ9C 2FJHB 5DMJB 2NW3A 4R4NC 1F58L 3SDDD 3O2WH 1EHLH 2OM5A 3D48R 4CU7A 2YBRA 3CXDH 3MUHL 4KJWC 3ZDXF 2M1KA 3PJSB 1OLLA 1RIHL 4HWBH 4MXQA 1M71B 3WN5A 3HI6L 4ZUSA 1KG0B 4XZUB 3VMOA 4N68A 1XH3A 1A14L 1OWWA 2PN5A 2R29H 4GRLC 5FYLL 4I77L 3BO8A 1TTFA 1KELL 2JCCE 1X5YA 5I1LA 5D2NE 4KUCD 5CINL 1IEAA 1CVRA 3KHQA 1HXMB 1CFNA 4N0YL 2VXSL 4JKLA 3RPIB 4OIAA 4KRPC 1BQHB 2Y5TB 3LKOB 2CR3A 3S37X 2FIRT 4XP1L 1QBAA 3T4AA 4X6CE 4PS4H 5IVXE 2DMBA 4RGND 3AB0B 2YEZB 3D0VA 5DRNA 3TNNA 5T1KD 1KLUA 1S7TB 3T0DA 2G9HB 1BZ7B 4QRPE 1FIGH 4Q97A 4FQ1H 4F9PA 5KSAA 5KVMC 2YMXH 2CD0A 4WUKH 3HRZB 3UJTH 4HIJB 4HBQA 4MNQE 4E5XA 2BY3A 4HKJB 3MRDB 4ZFOB 5SV4A 3VFWB 2GEEA 1LHZA 1CE6B 4X5XB 1G6RB 4XWOD 3VI4F 5BV7B 4S1DD 2Q6WB 2BNUA 3TBTB 3LIZH 2XZAH 4LCWA 1WTGT 3O6LH 1JGUL 5HHMD 4NP4H 4XMPH 3UTSD 4OLXH 5IMKA 1BF8A 4DVRL 2NY6D 3BP4B 1I1YB 1YPZF 1FLTX 2ICEB 4KI5C 4C4KO 1G7MA 2EYRA 4CMMB 3WHXB 5MEQA 4HG4K 1FNSL 4G9DB 5CKGA 3HNSH 2BSRB 2DAVA 3GMRA 1IFHL 3BKYH 4DKEL 3C6LC 1JGLH 3DXAB 2W9EH 3MV7B 3CVHA 1U8QA 3AMLA 3O8XA 1KLGA 3QCVH 4HLZH 4ZFZA 2IAMA 4LK4A 5EZIL 1NC2B 4MJIA 3TWCL 3KLAB 4DZ8A 1FJ1A 2VL5B 3KJ4C 3S36X 3V4VL 5BVJB 5L6YH 3QG6A 1ZGLB 1OT1A 3QUYD 4AZ8A 4P23A 2XY1A 2PYFB 2XZQH 3FB6B 5DS8B 4U0QB 2MHAA 1SYVA 5IB4B 1T1XB 1Q94A 5JHLH 4Y4HC 1HCVA 3O3EA 5IOPA 5AYUH 3NIFF 4DQOL 4QXGL 3ARED 4YE4L 4NQEA 4ELMF 3T0EC 3L95B 4TQEH 1NGPH 4R97C 2IBBA 3FRUB 1MJ7L 5EN2B 1ZK9A 4BFGA 2X9WA 3UJJH 3KJ6H 4Z7UE 1BIIA 5I1KH 5A2FA 5D7SL 4O2EA 2WY3A 1EUUA 3EW3B 4YBQD 1YN7A 5FUOH 3ZKMC 1JWMA 3GZKA 3IDNA 4WI4A 1ND0B 1Y6NR 3LKNA 5FYKH 4TVPE 5HGAB 4M62L 4U1LA 2E6PA 1FG2B 1XF3A 4JDVA 1JPSH 4P2OC 1I7RB 3DLQR 2P43B 5IW1B 5A2LH 1U58A 4ISVA 3KXFB 1UC6A 2X4OB 3BGFB 3BZEA 4LSDA 5I8EB 1G0XA 2JJTA 1FAIH 1DBMH 3VFPA 1BVLA 3TNMA 1JUFA 5JORA 1NDMA 4K23H 4YR6A 3EOAB 1S7SA 5ACZA 3RIFK 3SKJL 2YR3A 1BM3H 5C7XL 4OCRH 4A6YL 4L4TD 1UZ8B 4PRNB 2BNRE 3R0NA 3GRWA 4O5LL 4Y2DB 1H3WM 3PHOA 3C8KB 5ICZB 3BWAB 2AJSH 3LEVL 3WFBH 1CLYH 1FP5A 3IETA 1CDHA 1NUFA 1R5WA 2Y6SC 3MPCA 4PG9B 3W9EB 2AEQL 3EUUA 1IC5H 4M6NL 2G5BA 1YN6B 4FXKB 1WBXA 1DQQA 1BFTA 4R3SA 1EJOH 2EYTB 5HBBA 1UCBL 1UGNA 1ZS8A 5LGJB 1B3JA 1NCDH 3KPLA 4XXDA 4DEPB 1H9VA 4GMSH 2D4FA 5F1OB 3B83A 1YPZB 4UILH 4LCYA 3RZCD 5F6IB 5ESQB 2HLAA 1WQVT 3ARSA 1SBBA 4XH2B 3RNQB 2BY2A 4WU5A 4J1UA 1NCAL 3SDXF 4PJ7F 4TULL 4ODSL 5BVPL 3F58L 3C5ZD 5E8DL 2VLRE 4X7EC 4WO4B 1GZPA 3GHEL 4QXWA 3VFGH 3TPKA 4KDVA 4NRYA 3UP1A 1WZ1H 4N90D 2GK2A 3O4LA 3LHPL 1ZWIB 4CNIA 5IMLA 3TBWA 2WWKO 5TQ2H 3VCLB 4QF1B 4GXVH 5HYJE 2H32A 1A6WL 2P46B 3HB3C 3MRGA 3B9AA 5HHQA 1CFSA 3GNML 3S4SA 4FFYH 5MEND 4LKXB 4U3XA 2I25N 2NLJA 1F90L 4RGMB 1TZGH 3DHMA 4DN3L 4V1DD 5H94B 3VXRE 1PSKL 1BF2A 1NFDF 2WIIB 3BP7B 4UQ3B 5C8JB 4JLRB 3D69B 1NDGA 4NOFA 2FB4L 1Y0LB 4F7PB 4K7PX 2BVUA 3L9RA 2Z4QB 5FXCH 1NFIB 2FZ3B 1CT8A 3CVIH 5BW7A 1YQ2A 2X10A 1VGKA 1A9BA 2X9YA 1EAPA 4WFHE 1AR2A 4JDTL 2DQHL 2ZG1A 4PR5B 1P7QA 5D7IF 1WBYA 4PJAA 1QSEA 1HYSC 2H8PB 4GS7C 3WXVH 3MLTA 4R7NA 1L6XA 4NN7C 3TH2T 5I76B 1ADQL 3N1QC 2ARJA 1F4YH 5IVOA 3NAAH 4HMDA 4Y5VB 1ZLSL 4LSTL 2HRPL 4WW1B 5AZ2H 4NWTH 5FM4A 4OCSH 2I60L 1KXQE 2DQUH 2A0LC 3V5KB 1VFAB 2X7LB 1J1PH 3MLVL 3ARGD 1E4JA 2FRGP 1BBDL 1PY4A 1N5AA 3X13A 3CFBB 2OJEA 3PWPA 3TEUA 5D1XC 3BXNA 4LCUA 2IANA 2LABA 3EO9L 1QA9A 2QQKL 4IHOA 2IG2L 4R4FL 4HUUB 5GS3A 2GFBA 2VITB 3MRRA 5B22A 3VWKB 4QRSA 1J8HD 3V6OA 1MREH 4G6KH 3QAZC 4DGIL 1AHWA 1YECH 3QNZA 3NABH 3SDAC 2WWMC 3ULUL 2F54B 5DJAB 2CIKA 4M7JL 1HE7A 2AGJL 4KK8D 3ZKND 4XX1E 2KQNA 5INDB 4C57C 3H9ZA 1CE1L 1C5DB 2XXCB 2DYPA 1KCKA 1OL0A 3CSGA 1J05B 4Y19D 4H20H 4MXWH 5HI4C 4AK1A 1UEMA 5F71A 4Z95H 4DKFH 1ZAGA 3S34H 3G6AB 3QDME 5MEPB 3DROA 4PD4K 4BK4A 5I30L 1M6OA 2YWYA 4TVPH 3K8LA 4TVSa 2DLFH 5ALBL 4G43B 4ZFFA 3MNVA 3ARFA 3D25A 4MQXD 3L3KB 3V7AG 5DHVB 3NFSH 3I02A 2Z9TA 3RVUD 3TVMA 1KENH 1VFBB 4Z7WE 3BP6B 2RQ8A 1A1MA 3WFHA 4WWKA 3DTXB 1NBZA 1I9IL 1UA6H 1EH9A 2OS7A 4RIRA 4H88L 3O6MH 1U6AH 5BXFB 1IAOB 4QCIA 3O45B 1BOYA 3WLBB 3OJDB 3MV9E 4CVZA 4P9ML 4ZS7H 1HSAA 3MV8A 1OSZB 1MI5B 1RZ7L 3O2DA 4F15C 5D70L 2KPNA 1NFDB 4YWGL 1TIUA 3MLSH 5DQDH 3QQ9C 4EVNA 1LO0L 3HMXH 1NC4A 1T7ZA 5GSVA 5GGRA 4OFKA 5E56A 1AKJD 5AUMA 1ZVYA 2JIXA 3ECBB 1SJHB 4G8EA 5FYKD 2LVCA 2A6KA 5CD3A 5C0NC 3VMPA 5EU5A 5FK9B 5KSBA 2AXFB 2VLKD 4CN4A 1EVUA 2OMNA 4GLRH 5C0EB 5SWSA 2NTSP 2QKIA 5D7IB 4ZDHB 1ZLUH 5C0FA 5HYSA 1B2WH 2W9LA 5E94B 2HJLA 3DX7A 4NWUH 3BH8B 1P6AB 5LJYH 5FGCE 4MB4A 4XVUD 4OZGA 3ZTNH 4LAQH 5B39B 1Q0YL 5DUMH 5DWUH 1T7XA 1XGRB 2CMRL 1H3UA 1FIEA 4BYHA 1CGUA 2BVOA 4X6BB 4P3CH 4ZPTB 4QKXB 1DBJL 3N85H 1IRAY 2AI0H 1SMAA 3LS4L 5IB3B 2D7QA 5EZOL 3UTOA 3CFCH 5JOPD 4R7DA 4Z7OF 4NC1E 3STLA 1PKQE 5EA0L 2EE2A 2XNAB 2YPVL 3D39D 3LKQB 2NX5D 4FZ8H 4NNXA 5J12C 4JJHA 3NCEB 5D7LE 3LCYA 3L5XL 1MQ8A 2NR6D 5HYIA 2BJMH 2H2SD 3MLXH 1XF4A 1MFBH 4JKKA 1MELA 2EIZA 3WDJA 1CGTA 2VRAA 4LU5L 4RA0C 3ALPA 5IGXH 5C0GB 2O5ZL 2R39A 1T21A 1JF1B 4CMHB 5B8CB 1EEYB 1MVUA 2X41A 5DK0B 2PXYB 2AEWA 5EUOA 3BPCB 2YD2A 2GK0B 4IRJA 3QCTH 1E6OH 2BVYA 2F9BT 2F53E 3G5YB 3FO1B 1AXSA 1MAML 3A0OA 5DJ2B 3UBXA 4MB5A 3MJ6A 3QO1A 2R0LL 1GZQB 4LPUA 5F3BA 1MRCH 3C08L 5DJYB 4WEUD 5GRJL 5EIIB 3MLRL 1D5XA 4ZOCA 2B0SL 2EDTA 4P46B 1A6UL 3L1OL 4HKBB 1G9NL 5FGBA 3O6FB 1LK3H 3KPRB 1LE5A 2DTMH 1SJEB 3EYQC 4L4VD 4ODHH 1A22B 4P4KD 2FJHA 2OTUA 5FAAA 5MI0B 2BNQB 3C9NB 3SCMD 5F9JA 1JYWA 1KYOJ 4WFED 1IM3A 4HPOH 3TP4A 1K4DA 3ZE2F 2E7LA 4LSQL 5E24E 1U0QA 2YN3A 4ZSOA 1PW3A 4P59L 5CMAA 5D1QC 3P4NA 4WCYL 1UKQA 1SJVA 1KJMB 2IPTH 2VH5L 4K7PY 4OLZL 3NOIA 4HV8B 4KVCH 3RL1B 4ZUUA 4BA8A 3QJFA 4TN9A 4OM0H 3CVHL 4N1HB 3VGAC 4QT5A 4ZAKA 5L9DH 1KEGH 1VESA 2WQ8A 2QQQA 2CUIA 2P5EA 3RPIA 1H5BC 2DWEA 3QFJD 4YPGB 4H1LB 1BQHA 1RZKC 3PDGA 1UACL 3ZTJH 2EDLA 1NGQH 1N6QH 3B2UD 4KQ4H 2A73B 5E2VL 5C08B 3OB0H 4X8JB 1BZ7A 4NQVB 1AR1C 4R2GD 1SBSH 2VXVL 3CH1A 5H2BA 3DI3B 1FFQA 3LD8C 5C9JA 4WTWA 4XNQB 1G7LB 3DETD 5DURD 5B3JE 4ZNEE 5T5NG 5ISZD 5D1ZA 2RBLA 2LAAA 4IRZL 4LLMB 2ZCHL 5IM7B 4RMQA 2MMXA 3O9WB 1T6WA 3VFWA 4ZFOA 4P48A 1CE6A 3V95A 1TVBB 4FFWD 1DQML 2CXKA 3QEQB 4HQQH 3NVQA 1NGYA 2JK5B 4B5EA 2ICWA 1S5HB 2WBJD 4ZMAT 1ZHKB 3BUTA 5E99H 5FO9B 2QR0B 5AG9A 3A67H 4TOYH 4W68A 1LEGB 2NY3B 1ODAA 4JKPL 4JRYA 3OX8B 2ICEA 2QQLL 4XNZB 2BX5A 2K1MA 3F62A 3IRPX 5CGTA 3H0TA 2V5SA 3IXTB 3W39B 5E5MB 3S3SA 2VJXA 5HY9B 4OD1H 4NBXB 5GJSH 2W0FA 3E1F1 1N7MH 4QYOB 4PRIB 5IJKA 1A9EA 4BZ1H 1IGCH 4UIKL 1RULH 4TTDC 1NC2A 3OTTA 4OLWL 4LGPB 4TSBL 5ID1B 3KLAA 5GRYA 2VL5A 2ATPA 3ROLA 5BVJA 1KN4H 3KYMA 3G9AB 5D7JC 1RUQL 1MRFH 1VB9A 3PP3H 3S9DB 4NQDE 1U8HA 4LLUA 4PRDB 1AI1H 4OGYL 1DEEA 4U1GC 3GRWL 1T1XA 4I48A 5D93C 4TVPD 4ZO7A 4EN3A 2GIYA 4PJDE 4PREA 4E9LA 5HI3D 4Z78B 1GOFA 3IGAB 3WDHA 5DT1L 2C3VB 4XXCA 5TFSH 4H25A 4MA1C 3LQZA 5C6TH 2DQFA 4PJCF 1Y6MR 1QOKA 5L2JB 3FRUA 1T7YA 3EDJA 1V7NH 2EC9T 5I1JH 3EO0B 5DMYA 4NC0B 2F5AL 1DFBL 5GQBA 3GBNL 1A2YB 1V3LA 2XN9A 3DRTB 1F6AB 1R5IB 4MAYB 1HWHB 3EIFA 2J12B 3ZDYE 3ULVE 4QHKJ 4XPBH 3G08B 4UV4H 2AV1B 2O5YH 1SYSB 1A7QH 3VWJC 2FBJH 1IAIL 1GHFH 5BRZE 5E6YA 1OTSC 1KIPB 2P1YA 3VFRA 5IW1A 3KXFA 2APTA 1SEQH 3EHBC 1KJ3L 1FYTA 4YNYA 3GMMB 4YIQB 5IJVB 1Z5LB 3D1MC 5HDQH 5C0AA 5KVEL 3GM8A 3WNOA 4TNWF 1XIWB 4Y1AE 3ILQD 1KV3A 2OI9C 3ZHKA 4B41A 4WU7A 5BJTA 3GMOB 2AAVA 3IRZA 1B0RB 5FHBL 1JGVH 2UUDH 3BAEH 4MS8C 1CLZL 4LGSB 3SOBL 1H0DB 1J5OH 4XAKE 4FQ2H 4YHOL 1JYNA 3THML 2VDNL 1CXIA 4PRNA 1TENA 1K9TA 5CP3H 2EH7H 2OLDA 1IKNA 1OPGL 2W65B 3OKNA 3ES6B 5CZKA 5ICZA 3BWAA 4X4ME 2JCCF 1MHHB 2OL3H 2W0KA 1T5XB 2VUOA 3RVWD 5IBUG 4E41D 1I8MA 3P11H 3W9EA 2AK1H 3SGKA 5EO0B 1FCGA 1JMXA 1B4JH 4PRPD 3SKUD 2VZSA 1UKSA 3OXSB 1QYGL 2P8MB 4TUOB 4XP9H 1AGEA 1SY6A 5F6HI 3GMLB 3E6FB 4M9OA 1J1OH 1SEBA 4O51B 4HPYL 4X6CF 4HJ0C 3LKRB 3AAZB 5IVXF 3U7YL 2X40A 2MQ3A 1IJ9A 2J3SA 1D6VH 4LPVA 5FDWA 3DXAD 4Q9BA 5F7WC 5K9JH 4LSUH 2NY4B 2P48B 4I3GA 2G2RB 2EDBA 2NY0B 1CDGA 4U1MA 1JZ3A 5JDSA 3I75B 1R3JB 2OZ4H 3IFNL 1NLDL 4OZHE 2Y36L 3N9GH 4F9PC 4L1HA 5KSAC 3BDXA 3V5DB 4GBXC 5IESH 1KTLA 1R3LA 2BSTA 4XVSL 1AD0A 1EBPA 3U30C 4OSUH 2FYYB 3MRCA 1HH9B 3PQYE 4ALAL 1RI8A 4WFHD 4K3JH 1DN2A 3EYOB 5I74B 1YMHB 3WDIA 4LKXA 4YXHH 4FXGB 1YY9C 1MPAH 5C0CB 1FPTL 2EDOA 4NKIH 1EFXD 4U1IA 4HS3A 5GGQL 4K8RL 5H94A 3TYGH 3D3VA 2IQAA 2HVKB 5C92A 3SPVA 5JIPA 4ELMA 3GIZL 5IB5B 3QIUB 3AS3A 1S8DB 3QWRD 2F58H 3OR7B 4LKCA 3MA7A 1V3JA 1A7PL 3QSKB 3TCLA 4LSSL 4L9LA 5JNYA 1NFIA 5SX4H 1ERNA 4XNYH 4BKLB 1J0IA 3FT4B 5F9WB 2IAMC 4PTUA 3DBXA 1CR9H 3RU8L 1TJHH 4OFPA 1UWEH 4HJGA 3S4SG 4P23C 4GKSA 4IOSD 2H8PA 4MJ5A 1VKXB 3DUUA 3RP1A 3UAJD 3LRSB 3ROOB 2XQBH 1NMBH 1A1NB 2PYEE 1IKFL 3KS0H 4XMKH 4Y4KA 1AH1A 3KPSE 4QXTA 3RGHA 5HHXL 3V5KA 1JGDA 5FYJU 3TIEA 4Z7UF 4YO0A 3DRQB 4ZUVA 4NQCD 2RHEA 4LSPL 1E0OB 1CLOL 5DEGA 4KAQL 1WLHA 1KIRB 1CICB 5IEKB 1G7IB 1SM3L 4NCC1 3IS1X 4EUPB 3O2DL 5HHVH 2JCCB 4D94A 1Q72L 1XCTA 4HUUA 5D2NB 4NKDA 3LSOA 5ERWA 3FO0L 2HFEB 4FTVE 3ARBC 4IIQB 3UTTA 2R4RL 2FH6A 1X5IA 1QSFE 4LSRH 4KZDH 2BDNL 1RMFH 4LLDB 2PF6A 4FG6C 1FFNB 3ULSB 2FX7L 4HC1A 5HI5D 2DQDH 1EO8L 2VTFA 1CIUA 2OBGA 3T77B 3STBA 3P4MB 3SDDA 4ELKB 4R26L 3FFCD 4G8FB 3GJEA 5CEYA 5J3HD 1I75A 2JJTC 3DMMB 4X6CB 1HH6B 4WW2A 3N1PC 2AS5M 4WV1C 3EJZD 3GMQA 3CX2A 3ULVH 1A4KB 4P2RE 4JFHE 2X1PA 3G6AA 4DN4L 2I26N 3SDXA 1JNLH 4PJ7A 5EORH 2BMKB 3V8CA 4MNQB 2EH8H 2N7AA 4QOKE 1J0JA 2X70B 1YYML 1BPVA 3C60C 2UVEA 2EDJA 4G6MH 2A2QT 3TYFA 4EI5C 1Q9LA 3SE9L 5I6XB 3V5HB 1NGXA 2X09A 4OUUA 3GGWA 1UB6A 1OGAE 1UQSA 2FEDC 4KGJA 5T1KA 3GUTB 1IAKA 3I6LE 4RFEB 5D6CB 2Q7NA 3QDGE 4I18A 2P24A 2EDQA 5GJTL 1IAMA 2MJWA 2CIIA 4M1CC 2ZOKB 4J6RH 1DVFC 1M7DB 1BFVL 3BD5A 3R4DA 4HG4J 4UT9H 3MRHA 5KTEH 3MJ9A 1WK0A 4QEGA 4ZS6D 4ETQB 1CFVL 3REWB 5TDNA 3ECBA 3KHOA 3OKEA 2YZ8A 1KSRA 4H0HB 2BOBB 4YHKH 4WI8A 4TNVK 5FK9A 4JFFE 4X83A 3WD5L 5GGVH 3TA3D 5MHSD 1JBJA 2V6HA 1I3UA 3B2VH 4P5TC 5C1MB 5HHMA 1G7JB 4ZDHA 3UTSA 1GGYA 1IC7H 3BIAX 4NYLB 3GI9H 5I1AB 4I2XE 2DLIA 5EOQH 2MOVA 3SKMA 5KS9A 3KNBA 2DBJA 5T1DH 3HI6H 4OB5H 4H8WC 1XGRA 1DQDL 4MWFB 3F7VB 1OT2A 2J4WL 4I77H 4EI6B 2F53D 3V9FA 1LP9E 3O6KH 3RDTB 4Z7UB 2GUOA 4Q2ZB 4MDJB 5MP6H 1AP2B 2CJUL 1CGYA 2BHZA 4L8SC 4HWEH 3QUYA 2B4CL 3TO2A 4YAQB 3JWDH 4L8BB 3UYPA 3LKQA 4LASL 2EE6A 5BW7C 2VLME 4LF3B 4F9LC 3TIDB 5FUCC 1AGBA 1ZT7B 4LBEB 5TJWK 2F54D 2YSSB 5EO1A 4H26B 1A21A 1DBKH 4PBXA 1D9KB 1QFPA 2ICCA 5KN5A 3AREA 3RNKB 3CSYB 1EO5A 3I3BA 4ODXB 3IKCB 5TE6H 1EEYA 5DK0A 3P0GB 1MOEA 4M48L 4ZO8A 1NUDA 2DQGH 2GK0A 4Y5YB 4X4XA 2R1WA 2D0FA 3IDYC 2ZSVA 2YUXA 4G3YL 1QACA 3TO4B 4ZFGH 1JHTB 2X4UB 4IMLA 5CZVL 4CADA 3NGBB 2FDBP 5JXAL 3UEZA 1EEZA 2BNRB 2GKIA 3QXWA 4ESKA 3JTTB 5SX5H 4ZFOL 1JZ4A 3QEGL 3U79A 1PG7L 3O0RH 5LAXA 1RZGA 1OM3H 2F19L 2PKDA 3I50H 1JPTL 5DHYA 4OJFH 1JZ8A 1KIQA 2N1KA 1QR4A 5HD8C 1JRHH 2Z93B 4K8RC 2NY1C 3LEYH 4GT7A 1FNSH 3SY0B 3UBXG 1IGML 3VFSB 3LS5L 5L2KE 3E3QA 5DVOA 4ZXBD 5ILTL 3B6SA 1F4WL 1BQLH 3DVNB 3EOTL 5T1LD 2FX8H 1PKOA 1MY5A 3B9KD 4L4TA 5JOEA 4HIHA 1RZ8B 5JW4M 1A3RH 5J57B 4NPYB 4Z9KB 1NGZB 5F3HB 3BEVB 5AD0A 3RWJA 4IOFC 1OAUL 2GITA 4OI7A 2V7HB 2VLRB 5IFAL 4FQLL 2VDML 4H1LA 1IC4L 3F5WB 2W9DL 3GJFH 3NFNB 1F4AA 1MH5B 5HYJB 3FFDA 4NQVA 4TUJB 3SDCB 3FCTB 3TVMC 1FL3A 3VXTA 4XPAH 1WIUA 4QWWD 3MZTA 1F3JB 3VXNB 2K7PA 3WUZA 4UINL 2DB8A 3RZCA 4OZIA 1MCQA 5KW9H 4G8GD 3VXRB 4CW1B 3MNWA 1RJZB 4G6JH 1BQHG 1TVBA 4PFEA 4U1SB 5J9PA 3C5ZA 3IJSB 1ES0B 3CFEA 5DJCA 5HYQB 1S7VA 2GQHA 2DQCL 2PO6B 4NO0B 2CLVA 4MVBD 2ZUXA 4LSVL 3S3PA 4TTGA 4GXUN 3IDMA 5EU6D 1LEGA 1WFTA 2Q8BH 3OX8A 4KJPC 4WI7A 1YYLH 4GKZB 4PUBH 2GSIA 1KCRL 1IGIL 1VEPA 1R0AH 3WE6B 1C5CL 3S5LB 4LEOB 2VXUH 5MENA 1R3IH 3QIBB 5C7XH 3QULA 1CFQB 4PRIA 4JRXD 5DJZA 1INDL 4V1DA 5EOCJ 5JIHA 5F9DC 4YUEH 1ZTXL 3ZL4L 3L7FA 2BHUA 3M45A 4O5LH 4NZTL 1PBYA 3NACL 4D9RE 5DJXB 1AQDB 1I9JL 3B5TA 3LPWA 3SE4C 5T3ZE 2Q76B 1QVOB 4LARL 3D87B 3KPRD 1HHKB 3W11D 3W0WE 4OM1H 3ZT5A 3WSQL 3SE3C 2MFNA 4JM2F 3FTGB 3QXTA 1UCBH 4YXLH 1PEZA 4PJXA 4Y5XB 3IDXL 2EDHA 1MWAB 1PX3A 2C4FU 5FUZL 2GT9B 4QHUA 5GS0D 4Y1AD 4NO5A 4TSAL 1SY6L 4G80A 4C55A 3MRJA 5HYFA 1NCBL 4M1DL 4TRPL 4XAKD 1F6AA 4CRPA 4D8PA 1GC1L 4TULH 4ODSH 3F58H 1VFOA 3O3AA 4EIZC 1GRWA 3PV6B 4NFCA 2FIKB 1A6AA 1KIPA 3RHWF 2XTJE 4OCXL 5HGGS 4PJIA 2HJFA 4CVXB 1LD9A 3WV0A 3F6LA 3O41A 4Y16B 2D31B 3IT8D 1A6WH 3QDMB 4YIQA 4RDQF 4W4NA 5FHAH 4FQXD 3WXWL 5C08D 3VRLE 1A02N 1E4XL 1P84K 3QDAA 1YA5A 4GQPH 3SJVD 5J8OA 5FKPB 1J8HA 2DN7A 3GMOA 2FWOB 4U6YB 5FA3A 4P2QE 3VFVA 3LDBB 3PHQB 4Q6YA 2ZP0T 1LO5A 1F00I 3D2UB 43C9A 3O9WD 1ZLWH 2IFGA 3B9VA 2FB4H 3P9LB 4FQQB 3KVQA 3E2HA 4D0DB 4Y19A 2OXHA 5F7EL 4KGLA 1DL7H 1S9YB 1KACB 1T5XA 3MV9B 2IC2A 2FJGB 4QRUB 4S1RH 1IGTB 1TJGL 2BRQA 3AXLB 2AV7A 1YY8B 5CGYD 3UROR 4YHIB 1MHCB 4U6HB 4JDTH 1AIFA 4NHCL 3U0PB 3S98A 3UBXI 5AYQA 4TUOA 2GJ6D 4UUJA 3E6FA 3H7LA 2KZ1B 3BE1L 3BDYL 4JFEE 5FKAA 5J6GB 1BMGA 5DI8A 1BIHA 3T09A 1FVEA 2YD8A 4LSTH 2G2RA 2R1YB 1X3DA 5FF6A 4N1EA 1FSKB 3VXUB 1HOCB 2B2XL 2W07A 1AGDA 1X5HA 1RQ5A 3MOBH 5B3JF 5JW5A 1IZKA 5J7CC 5FGCB 1BBDH 5SWZE 5F9AC 5K93A 2DD8L 5T5FL 4X80H 3HR6A 5JIKA 4DVBB 3TBVA 5L8JB 3RTQD 3MROB 2ZCLL 4C83B 4YBLB 2CLZB 3O3BB 5C86A 1HKFA 2IH3B 4JG1L 5ICXB 5BV7C 1OP3H 2PW2A 3JWOC 2HT3C 1AKJA 5DJ6B 2X5PA 2LU4A 4G9FB 5HGBA 3S6CA 1GPOL 5CWSA 5JPMA 3FB7A 3QUZD 4OFIA 4DGIH 4FXGA 4APQD 1PKQB 1QQDA 4M7KL 4L5FH 2VLKA 6FABH 4KKLC 2IPUG 4B53A 5D7LB 4JM2B 4URTB 3SEPA 4JG0H 3H2WA 4Y2OA 2XG5A 2C3WA 4FN0A 3H9SD 4HC1L 4PJCA 4M9PA 2A6JB 3KPSD 4NQEE 5DD1H 4OGAD 3HE7D 4PLKD 2UZIL 3IFOB 2Z35A 3V6FB 4F7EA 1VA9A 4YDIL 4MA8L 3QA3A 2FGZA 5TE7L 1TMCA 5GZOC 1JWUB 4F7MA 3Q5TA 3BEWA 3FZUD 4U49A 4G6AC 4AMKL 1PD6A 1H3TA 1J9CT 5FB8B 3HLAB 3TJHC 4PJHA 2OSLA 3BISA 4PJDF 2NY7H 4YDVB 3D39A 2NX5A 3NFPB 3NCFB 3ROOA 5DMIL 4EN3C 2X4NA 2X1OA 1WTLA 1RFDL 2ICWI 2X4RA 3OBAA 32C2A 4X9IA 2EYSB 3WJLA 1OAYL 5KSVA 3FB5B 5H37G 2VR4A 3HCVB 5CUSL 4XVTH 4LOUD 4O58L 2HT2C 8FABB 4MGXA 3RWEA 4KK6D 1JZ5A 4AEHL 2AQ3A 3AU1A 1T0MB 3IU3A 3ZDYF 1P1ZA 3GSUB 3ULVF 1BP3B 1DSFL 4GW5B 2NYYD 5I71C 1KIRA 4B7LA 5IEKA 3CK0H 1G7IA 4WNQB 4XP6H 5T3ZH 3CUPB 2ZCKH 5FM5M 4K94C 2VC2H 1C1EL 3L5WA 4QOKD 1NQBA 2HFEA 1TVHB 1OARH 1MCPH 4MQTB 2QHRH 35C8L 1FFNA 4DAGH 4GRMA 4L4VA 4OFYD 4P4KA 4YHZH 2PUQT 3BGFC 1S7RA 1URLA 2CPCA 2GTZA 3SCMA 3LN9A 3G5ZA 1AJ7L 1W0WB 4ONFL 4M61B 4RISH 3HMWH 1DUZA 3ALXA 3HNTH 5F7DB 4O4YH 2HKHH 1LK2B 5IVXA 3C2AH 2FD6L 2WIMA 1W72B 4J3UA 1V8HA 2CMRH 2R15A 2BFVH 3QXDA 3N1MC 4QRPA 2EXYC 1UM6L 1KGCD 4LHUD 2BMKA 4MNQA 4Y2DC 5I1IH 3MRFA 2HTKD 4WFFD 5CJXC 4KFZC 2ENSA 1JV5A 3NH7L 3TZVB 2AJVH 5IB1B 3RY6A 3L6FB 4CVWA 1L0QA 2HG5B 2HMIC 3K4DA 3Q5OA 2A9NH 5DUBA 3SGKC 5IQ9B 5FCUL 1CDJA 3BP5B 3O4LE 4JHWL 5IBTH 3U0WL 2Z8RA 2Y7QB 1ZVHA 4M6OH 2GSGB 1NCCL 4O2FB 4U6XA 3BRFA 1OAKH 4Z7VB 3CDFA 1RK0B 5E6ID 1ACYH 2QQNH 1G1CA 4S10A 1O5DT 5F7YC 5TQ0H 2FR4A 1B0GA 2GTWA 2CDGB 5JIIA 2DQEH 1NEZB 1GXEA 4OZHF 5DMGC 4J7RA 5F6IC 1LEIB 1NANH 3CZFB 1M7DA 1MAMH 4HH9B 4UT6H 5ISZA 3T0EB 5I73B 3CFKA 1KB9J 4XCYA 4Z0XB 4LQFH 4G5ZL 2LE9A 3CFIC 5IKCB 5HGDB 1A7BA 1WCQA 3UPRB 3GB7A 3MX0A 4WO4C 4ETQA 2X44D 4R6UA 1GGBH 4HXAL 2B0SH 5TGBB 4JPKH 2XTLA 3VFTA 1KLFA 1A6UH 1J88A 2VDLL 5DRXB 5JO5A 2NY2B 2XWTA 4KROB 1QHPA 1OTUD 4NQDB 3DSFH 1DBBL 2DI7A 4J23A 1OTTC 1U95B 5GGSB 4NYLA 2YXFA 1ITCA 3PL6B 4LSQH 4PJDB 3W2DH 2G5RA 4QHMA 4PJAE 3I2CL 4P2OB 2EIBA 5JOFB 3PWNA 4P59H 4ODWA 1P7KA 2H6PA 1J1XL 3OJVC 1RUAL 3O2VL 4O2CB 5DQ9A 3TFKD 1LVEA 4KTYA 1N2RB 2HAZA 2PNDA 4RFOL 2VQTA 4P9HL 3BKML 1Q9WA 4HS8L 4K55A 4NJAH 5FV2A 3FT2B 1EFQA 4Z7UA 4Q2ZA 2VQ1A 1Q9OB 4MDJA 4ZUWA 4UTAH 1ZA3A 5EWIH 2DL9A 2Z8WC 4PB9L 3KPPA 1KBGH 5J1AB 3KYOA 4L8BA 1DBAH 4ODVL 4L3AA 3D6GA 3SDYH 2VIRB 2BOCB 3FQWA 5EU7C 1ZT7A 3A6OA 1VGEH 2NY5L 4LBEA 1EA9C 2IANE 3OKKA 2XA8H 5GS1A 1D9KA 1ZHBA 1KTDA 1BJ1J 3C8HA 2X4SA 3RNKA 2NXZC 1E4XI 4NO2A 4E42B 5A40E 1MCWW 4JHAH 3G04B 1CTOA 4UBDC 3HFMH 5EU3B 1FORH 5B38A 3V6OE 5L2KD 4I3RL 4Y5VC 5DMKA 3JV4B 1TNNA 4OV5A 2DF3A 2DI8A 3LB6D 5LQBH 3AUVA 3WHE0 4HK3J 5IT2H 5FO8B 2AK4B 4RFNB 3UTPE 1EV2E 2BNRA 1GGIH 2JB6B 4OTXH 1YEEL 4X0KA 5LCVH 1XF5B 5ESAB 4WEBL 2XPGB 3VW3L 4S1QL 3PWLB 2VB5A 2PTUA 3A6BL 2OTWB 3TT1L 5HVFB 2MKLC 2ZOLB 5FOJA 3EYVA 1XCQB 1BWMA 4UT7H 2YA2A 3QH3B 4JJ5B 5KVFL 2AKRB 1QO3A 1IBGL 3IAQA 2BRRL 3Q1SH 4FQHA 3VWKC 4HZLB 4UOW1 3HE6D 2UWEF 1QG3A 3V52H 3NA9H 5M95B 1H15B 2BVPA 2DLHA 2AP2A 4ZOAA 1U92B 2C9AA 1IGYA 2MSPA 3V0WH 1CZ8L 4PV8B 3T0AA 1RUML 4JEGB 5I1CH 2CR6A 2XZZA 3MRNB 3O2WL 1EHLL 1AO7E 2DM2A 1PFCA 4OZHB 1Q9KA 5F3HA 2EC8A 3EOBB 4OGYH 3GSWB 3GMPA 5EBLB 3CDGB 3IFLH 2V7HA 2VLRA 3KR3L 1E27B 4YHPB 4ENEC 1IGJA 2CH8A 3SGJC 1N59B 2R29L 4KHXH 5GGSY 4PRPA 3PDOA 5DT1H 5DJ8B 1K2DA 2ESVD 1U93A 2FSEA 2BY1A 2MNUA 3PQYB 2O26U 5ITFB 1MJUH 2Q86A 4BFIA 1N0XH 1DQJA 4YEFA 2F15A 5KSBE 3PABA 1U8JA 1F3JA 2R0KL 4C4KT 1T04B 1DUYA 4OLEA 3H8NA 2DM3A 4KKCD 5AWNH 2Z0BA 4OD2A 4H1LG 5EBWA 4M00A 4PS4L 4JO4H 4MZ3A 2JELL 4L3CB 5CBAB 3RRQA 3EYFB 5FM8A 1ZVSB 1CGXA 2IPKB 4D9RD 1WJ3A 4I0PB 1FIGL 4BELD 1RHHB 3KLHD 4FQ1L 5D72H 2HFTA 2YMXL 4WUKL 4CGTA 3UJTL 4Y4FD 5CHNA 4JQXC 5JA9A 4GKZA 3WNMA 3RX8A 2AABH 5D1XB 3TT3H 3PIQA 2H32H 1FV1B 1A3QA 3QIBA 4KJQC 4X6DE 4FRWA 1HQ4B 1EFXA 3UYOD 1IM9D 4YHOH 4PV9B 3LIZL 1K4CB 3O6LL 1U3HD 2PYEB 2HYMA 4NP4L 1R5VB 4OLXL 4PGDA 1N5YH 4HFWA 5MEOB 3T3PE 3U1SH 4Z0BH 3I6KB 5IBLD 5EUOE 1RIUH 2B7DT 4MNGE 1T89A 1QVOA 3HNSL 3JV5A 4F2MA 3F7RA 3BKYL 3BN9D 2YD3A 4JFYB 1KCVH 4MNHB 1E4KC 1JGLL 1AGCA 5IV2A 2W9EL 3NIDE 4MAUH 3CC5B 1EHXA 3QCVL 4K3DH 1DP0A 1Q38A 5IHLB 2PW1B 4MD0A 3IDGB 5T1MB 3GSRA 3QUXB 4N9GB 2ERJB 3MRKB 5L6YL 4FTVB 4QO1A 2P42B 5IR1A 1QSFB 3VDBA 2IFFH 4JHBA 2XZQL 4LLQA 1RU9L 4P2QD 1X4YA 1OWRM 5JHLL 4CMHC 5B8CC 1OW0A 1NUNB 1XZ0B 2I9LA 2UWEB 2PXYC 2YOCA 5AYUL 3MBED 1O0VA 3QDJD 5GRZA 1X5ZA 3QHFH 4XVSH 3PV6A 4V2CB 5EDXA 4QHNA 3C09B 4TQEL 3S96B 1NBYA 1NGPL 2L7UA 3RVVC 1D5MB 4P2RB 3FKUS 3QDMA 5CIPA 3UJJL 1FNGA 4P46C 4Q6IB 1HXYB 5I1KL 3O6FC 1I9EA 3Q2CA 2ITCA 1CIDA 5EOTB 5FUOL 3RL2A 5TF1H 1FL6A 4JFED 1FPTH 2FWOA 4U3HA 5MI0C 5I0DA 4WUUE 4HS6B 4OZFH 1RZIA 4JFDD 5FYKL 3WFCH 1HZHH 3D2UA 4L3EE 5E8OB 3GIZH 2VABA 4Z7WA 5EUKB 5C07D 1ZKAA 3WL9B 4P9HC 4NDMB 1OGAB 1X7QA 3L7EB 5E7FA 3MCLH 5KZCD 1T4KA 4U0RB 2CDEA 4A6YB 5E0QA 1T0NB 2HLFD 3OAYK 3QDGB 4YHLL 1AQKH 3MV9A 1FAIL 1DBML 1I4FB 3D85B 3MJ8B 1ZANH 2FJGA 4HIXH 2Y07H 4QRUA 4N5EC 4HCRA 4K23L 5CEZE 1BD2B 3HPJA 5ESVB 2VUYA 1BM3L 2IPUK 1LDSA 4D0CA 4MMXC 4OCRL 5D9SA 4GAFB 4OV6F 4XPHH 1F13A 4NJ9H 3T1FA 1L9MA 3FQUB 1K8DB 1R24A 1P7HL 2LTQB 1PLGH 5J6GA 3K4AA 5F1IB 2XKNB 3BVNA 2AJSL 4QRTA 1WICA 3WFBL 4WVRA 3ULUF 1CLYL 4JFFB 5F7FA 4OCLC 4AYFA 3OGOE 4JRYE 3T2PA 1IC5L 2EDFA 4KRLB 4HLZG 2QEJA 4LPTA 1EJOL 4Z18A 3QEUB 4PJFE 1BJMA 5KSUA 2VR9A 4Y0GA 5EZLA 1WFUA 1NCDL 1MCKA 2X2YA 1DN0B 4HSQA 4GMSL 2IH3A 5ICXA 4JR9H 1H8NA 2NQCA 5IROA 4KRNA 5HTSA 2ADJA 3K8KA 5C0JA 2VWEE 1QR1B 2ID5A 5D5ME 4CDHA 2WUCH 4BZ2H 2NY3C 3TA3A 1TZHB 3UDWA 5K33A 3VFGL 4JCLA 3ZLQC 4LPWA 5D7LA 3VXQB 1U36A 1WZ1L 4KY1H 4GG6E 2G75B 1T1ZB 4IOIB 1RURL 5TQ2L 4GXVL 3X3FH 5SWQB 4OCWH 3QI9D 5EIQA 5IVZA 1HHHA 4LDEB 3LQAL 4OKVB 5C0BB 1U8IA 4YDKL 4KXZH 3E8UH 4ONHB 4K9EC 4DWHA 4FFYL 1H3XA 1NMAH 4GMTH 1JWUA 4HD9A 2F53A 2BVEA 4G8IB 5L8KB 2XN9E 1YEGH 3GSOB 5HDBE 4KHTL 1PYWB 2OL3A 3BWUC 3VFMB 2E9BA 4GKNA 2V2TB 3NFPA 1V7MH 2GHWB 4RMWA 3WEXB 1ETZA 3RWHB 2AVGA 3VU2A 1U3YA 3V4UH 1XT5A 3CVIL 4N0RA 2SEBB 4BFEA 5EO9B 5DD5L 3TPUA 1DLHB 4QHLB 5GJTH 3T2NH 1JP5A 5GRVK 3WXVL 1S5IH 2CK2A 3LEXB 1JI2A 3PGCB 2APFA 3GSQA 4CU6A 1LE9A 4P5KA 2OZ4A 1FBIL 1XGYL 3LD8B 3VH8B 5T33L 2F74B 5GXBB 5JW3L 1F4YL 4G6FD 3CUPA 3LN5B 3NAAL 3D9AL 4XHJC 4HT1H 5AZ2L 4M02A 1X9QA 4X4YA 1TVHA 4OCMC 4RMTA 2DQUL 2MQ0A 2YRZA 1J1PL 4PJ8B 3U9UA 3DOSA 3H7BA 3GHBH 3VFUA 3IF1A 2E5EA 4JANA 4XB8A 5CD5C 3UZEA 4Z6AT 3VRLF 2VOTA 1TJIH 3U4BL 1P4LB 1I7ZB 2VQUA 4KTDL 3AS0A 3VXUD 3I3DA 4FQJL 3RWFB 1Z9SA 1XIWC 4R0LA 1LK2A 4PBWD 1RUPL 4ZXBA 1DQDH 4YFDB 3QO0A 3RGVB 1CF8H 3FO2A 1GGTA 3FT3B 4RAHA 5T1LA 4YDJB 3B9KA 1MREL 4G6KL 4LCIH 3UC0H 4GAYB 4ZNEA 1YECL 4N0UA 4JM4H 3NABL 1RV6X 1K3IA 2CJUH 1CWVA 3TZVA 43CAA 5CAYB 4MSWB 5IHUH 2EZ0D 4LASH 5EC2B 4G9FD 2VZOA 4ZYKB 3U2SA 5B4MC 4U4BA 5FO7A 5FECB 4H20L 4MXWL 1TFHA 2Z92B 5EBGA 2AEIT 1DE4A 4YFLI 4HMEA 2ZNWA 1W0VA 4Z95L 3L5JA 4DKFL 1CD0A 2GSGA 3S34L 1FC2D 2RGSA 1Q8MA 4PJ9D 4ODUB 2Z31B 4R4ND 4TVPL 5I16A 2DLFL 3UTZB 1G9ML 2FO4A 1QLFB 3AM8A 1NEZA 5IFJA 2NY4C 4KJWD 1S9XA 2NY0C 1WIOA 4HH9A 3S35L 1LNUA 3NFSL 3D3VE 3TBYB 3DVGA 1E28B 2DS4A 4U1HB 3REVB 3DV6B 1A6TA 4WI3A 1KENL 1UG9A 1P6FA 4JN1H 3U83A 1KCSH 5CEZH 3HUJE 1CQYA 4GRLD 1C12B 2NZ9C 3VG9B 3O6ML 5DRXA 5JR1H 1U6AL 1PZ5B 3QEGH 3IFPA 4O9HL 1JPTH 4ZS7L 2CRYA 1G9EA 1CLCA 4RAUB 5EU6A 3OXRA 3QHTC 1FVDB 5I74C 3KYNB 3MLSL 2Q8AH 5DQDL 3MGOB 4JZJA 4KRPD 5ITBH 2BSED 1T66C 3HMXL 2YRPA 5D4QA 3U9PH 4I4WB 3MR9B 4OQ1A 4NQSA 4P3DB 1QFOA 3WMSA 2XV6B 2Y1VA 1JNHA 1YEHL 1I1AB 4HHAA 4BUHA 1HI6B 4JRXA 1PVHA 2EKSA 4GAJH 1KJVA 4LVOB 4PJGE 3QIUC 2VLJE 2NW3B 4J8RA 4XP4H 3MUZ1 1Q9OA 4LL9A 2YBRB 4NWUL 4OLVL 5DEFB 3UTPD 3PDDA 1OAUH 5J1AA 4OF0A 1UXWB 5F9WC 1UB5B 1U8NA 2R9HC 4FQLH 5IFAH 2VDMH 3ZTNL 1YEDB 2WINA 1YC8A 4C56E 4LAQL 3WN5B 4ZUSB 5DUML 1NAMA 4PJ5E 5DWUL 2VIRA 5BRZA 2BOCA 5CJOH 1XH3B 4EDXA 5IQ7H 1J0YA 2EEBA 1MCWM 3BO8B 4P3CL 2XTJB 4DCQA 1RY7B 3LRHA 3T4YB 5I1LB 4OT1H 1IEAB 4E42A 3G04A 3UTTE 4XNMB 3CFCL 1CFNB 5GIRA 3RIFF 3FO9A 4JFZH 4KI5D 4Y1AA 1YNTB 1P84J 3WJLC 2AEPH 2V9TA 1L0XA 1FYHB 3C6LD 5F88A 2BJML 3T4AB 3MLXL 3VD3A 1EJ6A 1MFBL 5DJ0A 4DFIA 1MJJB 3D0VB 3P9MA 5IGXL 5DRNB 3TNNB 5J13C 4LP4A 2BK8A 1QRNE 2DQCH 3F12A 4UZGA 5ESAA 3VXMD 4CU8A 5IB2A 1BJ1H 4X4MA 3CLEL 1CICC 4LSVH 5I2IA 3QCTL 2ZOLA 5KSAB 1E6OL 1QKZH 5E8PB 5D2NC 3EFDL 5B38G 4E5XB 3TN0A 2YUZA 4IIQC 4FQXA 5JTWA 1MRCL 1KCRH 4CJ1A 4Y4HD 1AC0A 1EIBA 3BZ4B 4P4KC 3FONA 2BNUB 1U92A 1ZHLA 2GJJA 4LCWB 1LK3L 4Y88A 3T0ED 2DTML 1PAMA 3DMMC 4ODHL 4PV8A 3ZL4H 2CO6B 5IMKB 1T83A 4NZTH 4RGNE 3U7AA 2QADB 3EKCA 1TITA 2DBLL 2YPLE 3B4NA 1G7MB 2BSSA 2EYRB 3EOBA 1LEKA 3RWCB 3GSWA 2VAAA 5MEQB 3AY4C 4LARH 5SWZB 1Q0XH 1F42A 2ZUVA 3ZKMD 2AW2A 2IPTL 3NIGE 1D5IH 2ZWLT 2AQ1A 1U8QB 1WFOA 1KLGB 3O8XB 4ZFZB 5FYJE 2RFXA 2GJ6A 3IVKA 4MJIB 3PQYA 4KVCL 1F5WA 4P2OD 1FJ1B 4L4JA 1OD9A 3QG6B 3HR5A 2DWDA 4P23B 4OM0L 5I6XC 5L9DL 1KEGL 4TSAH 5TDPA 3BOVA 1HINH 2V5TA 1CQKA 1T04A 2MHAB 5HHOD 3UTSE 2HH0L 2R1XA 1YEKH 1NCBH 4M1DH 1Q94B 1DR9A 5E1HB 3O3EB 1C5BH 1GC1H 2ZJSH 4HGWA 4NNPH 4W6WB 4HMCA 4NUJA 1NGQL 2Q1EA 1FCCA 5KS9E 5F89A 1S7XA 2ED7A 1N6QL 5F7MC 3VFOB 4KQ4L 3OR6A 3QR2A 1U3JA 1M7IB 4NQEB 5I9QB 3CH8A 3IAPA 2IPKA 4KKNA 1SBSL 1WAAA 2JF1A 3RTQA 3BESR 1TQCC 4WFGE 4NUGH 2Y6SD 5ALCH 2EICA 2C26A 3ETBF 3R06A 4XPGH 1VFUA 4O2EB 4OF6A 2ORBL 3VRIB 2D7NA 4HK3N 3WNPA 4XCCH 3WJJC 1YN7B 5IFHH 5DRWA 2FJFB 3IDNB 3QUZA 4APQA 4PJAF 4D9QD 3LKNB 3ZT6A 1K4CA 4U1LB 2NXYC 5L8LB 1XF3B 4JDVB 4JCMA 1U58B 3A67L 1LMKA 1M1SA 4TOYL 3H9SA 4LEXH 1M7XA 3KPSA 4ZTPH 5BCAA 5F7EH 5IBUB 3HE7A 5DDHB 2B20A 2ATKA 3VFPB 4DKDC 4PGBA 3TNMB 1JUFB 5JORB 3CD4A 3TF7A 1NDMB 5E1AA 4WEMB 4YR6B 1TJGH 2VXTH 5I8CA 1S7SB 4GH7B 4JFYA 3RDTC 1WC7A 5ACZB 4OD1L 5GJSL 1N7ML 3MQIA 3S5LG 2UY6A 4BZ1L 2HFGH 3S36L 1IGCL 2OX5A 1RULL 2PW1A 1B0WA 3BIKB 4HCRL 3BE1H 5T1MA 2R0WH 4N9GA 3BGMA 1KN4L 3MRKA 1UVQA 1UEYA 3PHOB 4FTVA 5BS0E 1MRFL 3H6JA 5F96H 2WP3T 5GGTH 1KPRA 3IETB 1R5WB 3HB3D 3GJFA 1AI1L 2BC4A 1D9KC 3ZE1E 5C6PB 4J3XA 2UY7A 2B2XH 1T5WA 1OGTA 2G5BB 4L3ED 1WBXB 1DQQB 3RWIA 2A1WL 4R3SB 2L7JA 4Y5YC 3Q0HA 5TFSL 1ZS8B 5E2TH 1CL7I 3TO4C 2A83A 3WUWB 3KPLB 4XXDB 5C6TL 4I3SL 2VKWA 4L4TE 3NGBC 3ARVA 4QY8A 4BJLA 1V7NL 5CEZD 5I1JL 4LCYB 3ZTJG 3GI8H 1HXYA 3R8QA 4WU5B 4QOKA 4J1UB 1GPOH 4C58B 4XPBL 3L3IA 5CGMA 4UV4L 2O5YL 1RZKH 1HILA 4M7KH 4R4BA 1GZPB 1Z2KA 1A7QL 4OFYA 1BQUA 3QQ3A 4XX1G 4HLJA 2FBJL 1HYSD 4YZFE 2IMMA 5E8OA 3O4LB 5DC4B 4CNIB 4BQBA 4HC1H 3VXSD 1U8LB 5IMLB 3TBWB 4PGCB 3UMTA 1SEQL 2H32B 1DANU 1OAZH 3MRGB 5HDQL 3SGEH 1CFSB 1T0NA 1S78C 5TE7H 5IHBA 3MJ8A 1XEDA 1K85A 2A0LD 1J12A 3W82A 2NLJB 4LHUA 4M5YH 3TGXA 5IWLA 4OZIE 1JGVL 3BAEL 4FZEH 1J5OL 3BPLB 5E2JA 3HRPA 1NDGB 2EH7L 1C7SA 1AFVH 2D2OA 3L9RB 5F1IA 2VL4A 2X89D 2OL3L 4N90E 4MXVE 1RFDH 2IH1A 1CT8B 3P11L 4FFZH 2AK1L 1VEOA 1VGKB 1OAYH 5KSBF 5DVLA 1EAPB 3P4OA 3SDCC 5M7QA 1B4JL 3ILPA 5E6IA 4PG2A 5CUSH 3SDAD 2WWMD 1P7QB 4I2XA 4PJAB 2GJZA 2ITDB 1QSEB 2X4QA 3MSPA 3MLTB 3MLWH 4FP8H 5MENE 1J1OL 2OTPA 3O11A 1QSVA 3OKMB 3FAWA 2ARJB 5HI4D 1D6VL 5K9JL 2WZPD 4LSUL 1U8PA 1LP9A 1MCIA 5KVGH 2PO6C 3K1DA 2OZ4L 3OV6A 3VDCA 1VACB 1IGFH 5CP7A 3MJ9H 2E3VA 4NHUE 3VRJA 1A8JH 3WNNA 1R3HA 5FYJH 1VHPA 1X5XA 2EDNA 1N5AB 2N56A 5J1SC 2F8XC 3X13B 4AENB 4IDLA 4EDWL 2I24N 2C1OA 3NBNA 2OJEB 1T1ZA 2BHYA 4X6DF 3BXNB 4LCUB 4IOIA 2IANB 4MCYA 2FH8A 4PJXE 1QA9B 4IHOB 4CL7A 2HRLA 5C2BH 3QIBC 1FRGH 3MBXH 2VLLA 3G9VA 1KULA 5TDOA 2GFBB 3MRRB 4K3JL 2CQVA 2VDQH 2DJSA 1EERB 4G7YH 3KWWA 1UM6H 3QFDB 3T3PF 4TNWK 1AHWB 4YXHL 3QNZB 4RX4A 1MPAL 1OD7A 4G8IA 4NKIL 5EUOF 2J88H 2CIKB 3TYGL 4PDCE 5KAQF 4TUKH 3VFMA 3ARUA 1A6ZB 4AM0B 1WSST 2DYPB 3QQ9D 5TE4H 3NIDF 2F58L 4UTBL 1WIPA 2O5XH 3MGTA 4IDJH 3X12A 4U7KA 3U0WH 1J87A 4PJIE 5C0ND 2QSCH 4Y5XC 2YPKA 3DROB 1CR9L 1KEMH 1UWEL 1M6OB 4PRBB 1DLHA 4OAWA 4Y8AA 4ZFFB 3MNVB 3ARFB 2QSTA 5H35A 5L2KA 3OQ3B 3PGCA 4M93B 3I02B 5JUEL 3TVMB 3N1GC 4G5ZH 2XQBL 1NMBL 2CKNA 5CFHA 2H45A 1RUKH 3JBG7 3LN5A 5D71H 1A1MB 3WFHB 4HXAH 4WWKB 4IRSB 3SBWA 1NBZB 4XMKL 1ITBB 2XIDA 4RIRB 4RDQG 3U4EA 1AO7B 4Y19E 4D9LH 1BGXH 3MMEA 2PTTA 5HHNA 1HSAB 4Y16C 3F7QA 5HHPB 1P4LA 5BZWA 4EQ2A 3X3GL 2M8XA 4QRRD 4QRQA 4EVNB 3R0MA 4LCCA 4PPTA 4HIEA 2YD6A 1NC4B 5GSVB 1N0LA 5GGRB 5HHVL 3HE6A 3HS0A 3LDBC 3PP4H 3ARDB 4G8EB 3SQBA 2HN7A 5CD3B 2A6KB 1UM5H 4JFOA 4LSRL 2HP4A 5EU5B 2NNAA 4KZDL 1RMFL 5KSBB 1CG9A 1JE6A 3KPNA 5DFVC 4WHTA 1EEQA 3JVGC 2DQDL 3MO1A 4WY7H 1CD9B 2QKIB 5HYSB 1DDHA 3QJHA 3E6HA 4U05A 2HJLB 3DX7B 4NGHH 4PB9H 1X4XA 4ZYKA 3MXVL 4P5MA 2Z92A 4MHHG 4A2LA 1SHMA 4WGVB 1SMOA 3BGAA 3ULVL 1FDLH 2Q3AA 3W9DB 1PG7X 3OKYA 4N8PA 3VDAA 3MLZL 3EYQD 2C4FT 3E0GA 4JHZA 2ESVA 4ONGL 1NAML 3DI2B 2EH8L 5A2IH 3BQUA 4R7DB 5DQJA 4XC3H 5A3IC 3QISA 3I9GH 4NQTA 4IMKC 2GYSA 1P2CA 1FSKC 4NNXB 2C3GA 4X6DB 4G6ML 2HKFH 4PJFF 3REVA 4U1HA 5D1QD 3TCXA 1NL0H 1OP5K 1XF4B 12E8H 4BQ6A 5GS0L 2EIZB 4BQ9A 1T21B 4XC1H 3ZO0A 1L6ZA 2YS4A 2UYLA 3I6GA 3PGFH 4YK4B 5CSZA 2GI7A 4YBLC 1CCZA 3JUZA 4XTRC 5EUOB 4IRJB 5CCKH 1YDPA 4XNXH 2R56L 4JQIH 4C56D 1TCRA 4J6RL 4PJ5D 5IROC 1AXSB 3UBXB 3W0WA 1NEZG 5D5MF 1MIMH 3L3DA 5F3BB 4UT9L 3KYNA 3RJQB 4CKVX 5JOPE 1JFQH 5ID0A 4PGJA 4PJHE 5KTEL 2QBWA 1D5XB 4GG6F 3RBGA 4QGYA 2XICA 2KDGA 4JM2C 3JZ7A 1LE5B 1NKOA 2DRUA 4YHKL 1IM9A 1A6PA 1AR1D 2VSCA 2AJUH 1OVZA 5GGVL 4N0CC 2OTUB 1U3HA 5DVNA 3B2VL 2A6IB 1VSCA 5F9JB 4JVPA 2FX9H 5HJ3A 1IC7L 4OQTA 1IM3B 4Z7QE 1K4DB 3GI9L 5DEFA 2D03L 4Z8FH 5EOQL 4ZSOB 4Q9QH 1UXWA 4KZEH 1UB5A 4RNRB 3KR3H 3CCHA 5HDBF 5CMAB 1QRND 3S88L 1YEDA 5T1DL 3P4NB 4YJZL 4OB5L 3H9YA 3LMJH 1E6JH 3T65A 3HAEH 1QEWB 2ZUTA 3KPMA 3T4YA 2EECA 4W4OA 4ZUUB 3O6KL 1LDPH 1PEWA 4LVHB 5GGRY 4F7CA 5HVGB 5MP6L 3QJFB 4XNMA 4HZAA 3HZMB 4QT5B 4ZAKB 4HWEL 4KKBC 3T0BA 4L4VE 2R0KH 1GGCH 1YNTA 3IDJA 3JWDL 3MV01 2NCMA 2P5EB 1MFDH 2DWEB 1J0ZA 4P2QA 5DTFA 1N4XL 4WUUB 3T3ME 4WFEE 3LV3B 4HUKB 4W81A 2VE6A 4WI6A 2EDDA 1ZLUK 1DBKL 1JHLL 1FZOB 1MJJA 1V3MA 2JELH 2ZUQB 3MBEA 4N1CA 3QDJA 3LN4A 1VDGA 4TTDD 2YPLD 3P77A 3CH1B 5H2BB 5TE6L 3QUKA 5C9JB 1MLBA 1ULVA 5D7JD 1FO0A 2DQGL 4F80A 4HEME 5HGHA 3AMKA 5D1ZB 4BSJA 5E8PA 4AJ0A 3NZHH 3ELAT 4ZFGL 4JGMA 2EDRA 5FYJD 4FABH 2FGWH 2A9MH 3BZ4A 4JQVC 4U6VH 2BVQA 4N8VA 3H42H 4JFEA 3VD4A 3B8SA 3QFJE 1NGYB 1JVKA 2ICWB 1CD8A 4HKXA 1L7TH 1W0YT 1PDKA 3O0RL 4J4PC 4RMSA 1OM3L 3I50L 1CBVH 4XCNB 4OJFL 4X99A 3OAUH 1A47A 2DJ4A 1XGPA 4LPXA 4JRYB 5ADPL 1JRHL 5B21A 3LEYL 2XFXA 3RWCA 3H0TB 2WUBH 1X5AA 5SWZA 2X4TA 2P5WE 3IXAB 3L3GA 4X7TA 5ISZE 2W0FB 1BQLL 1JPGA 4HEPG 1A9EB 1G7HA 2FX8L 3VWJD 2B1HL 3TZVC 3G5XA 4YH6A 4WFGD 4Q0XL 1OTSD 1MVFA 1A3RL 1N3NB 2ATPB 3ROLB 3QP3A 3KYMB 3EHBD 5DFTA 4AIZA 1U8HB 3QIWA 4LLUB 1RU9H 1DEEB 2VDPH 3U0TA 1LO2L 4I48B 3O3UN 2ADIA 3CMGA 4EN3B 4PREB 1JF6A 3V8OA 4MS8D 1T20A 4H8WH 3X11A 4AH2B 1T6VN 3VFOA 5C09D 4XWGH 1M7IA 1K3ZA 5D8JH 1YMMD 4H25B 5I73C 3LQZB 2DQFB 4MHHI 2VERN 1TNMA 1CGSH 3HUJF 3VD9A 3IJHA 4XPAL 4I5BA 3KPQA 3RQ3A 4P4RA 3BHBA 2Q20A 2NY2C 2PTVA 2XN9B 4UIMB 4KROC 5HYEA 5I71B 4F3FA 5KW9L 4PLNC 3M07A 3VRIA 2GCYB 3Q3GA 3OKOA 4G6JL 2FJFA 3P30H 3MV11 1ZT4A 5SX4I 5BS0D 3PL6C 3W81A 4HJ0D 3VFRB 5F7NC 2J6EH 1T80A 4JZJC 1WZLA 1UM4L 4YNYB 1FYTB 1ORSA 1H3GA 2Q8BL 4JY4A 3OKLA 2CUHA 3OKDA 4PJGF 3QI9A 5E2UH 4YHLH 5C0AB 1YYLL 4PUBL 5DDHA 3TM6A 5DVKA 3OB0K 4D2NA 3QPXH 1WUNT 1R0AL 1EDQA 1RAMA 4WU7B 3M8OL 5BJTB 2VXUL 4PY8I 1R3IL 2VKXA 2AQ2A 5KSAD 3EYUH 4MYWB 3ULVC 3BW9B 3L3JA 4GBXD 3ARYA 4YUEL 3BIKA 4U33A 4YEEA 3OKNB 4WHDA 5I8OH 3PHSA 4WI5A 5GS2H 5E6ZA 5IIEA 3MREA 4HWZA 3MCG1 3DGGB 1I85A 1I8MB 4LCWD 1ZGLM 3EYSL 3TBSA 2Y25A 4OM1L 1YY9D 4XP5L 2NW2A 4JN2A 1AXIB 1AGEB 3FQXA 2XKUA 4YXLL 1SEBB 4HWUA 3WUWA 4WW2F 2X1WL 1CYGA 4DGVH 5FDWB 4RFNC 5IW3A 3B9EA 2V17L 3RX5A 3BI9X 4U1MB 5JDSB 1XF2A 1P5UA 2IAMD 5DJDA 4KTEH 3V4PH 4AQ1B 4KUCF 4JFXA 3RIAK 4P23D 4E41E 4GO6B 3WS3A 4B7IA 3TN0C 1KTLB 1R3LB 2BSTB 5GHWH 1AD0B 5I1DB 4HF5H 4PRPE 4NBZB 1U8LA 1RURH 3G6DL 3MRCB 4PGCA 1JYVA 3O4OB 5FHAL 3LQAH 3DX6A 4YDKH 1UJ3A 4Z77A 5DF0A 3DXAE 1T83C 1YEJH 3MV7E 1MCNA 2VN4A 4U1IB 4HS3B 1YC7A 4KHTH 1KB5H 2YZ1A 3D3VB 2IQAB 3SPVB 4HUXA 4ELMB 5E8EA 4BQCA 3NIGF 3HUJB 5E9DD 4LKCB 4AL8H 4TNVF 3MA7B 3TCLB 1U8MB 4FFVC 1R3KA 3HNVH 3JUYA 1YUHA 4L9LB 5JNYB 1DL7L 2RCSH 5DRZB 4F7TA 3ARBD 3OG4B 4PTUB 3DBXB 1QD0A 4FG6D 4S1RL 4KJYA 4HJGB 4Z5RA 5IK3B 5DD5H 1DLFH 1A3LL 4PJ9A 4GKSB 2WM0A 4LHUG 2ITDA 4MJ5B 1BX2A 1YQVL 1MHPL 1WGOA 2NXZB 3C6SA 3DUUB 5KS9F 1FBIH 1XGYH 3OKMA 4POZC 5T33H 1XGTA 3QNYA 5JW3H 3QB7C 3D9AH 4PJGB 3DV4A 2VLJB 4Y4KB 2OMBA 4GRLA 3FN3A 5I18H 4QXTB 5JPNA 5GPRA 3MOBL 2OK0L 2DM4A 2KZWA 1JGDB 1VACA 4I0PC 3TIEB 3LKPA 2XOTA 4YO0B 1BLNA 5I19L 1PGRB 1N8ZA 4ZUVB 3U4BH 4AENA 3RKDC 1HSBB 4KTDH 1JTTA 4X80L 3UJIH 2B5IB 5DEGB 3C60D 1FNEA 4FQJH 2AJZA 1Z6JT 1FGVH 1ZE3C 3OAZK 4M8QA 4EI5D 1L0YA 1N64H 1MCHA 1RUPH 4M3KB 1XCTB 2VMFA 4NKDB 3LSOB 1ZA6A 5ERWB 3UTTB 2FL5A 4OZFA 1CL7H 5DGRA 2R23B 2FEDD 3QFDA 5C71A 5IUSA 3QQ4B 4PGEA 4L5FL 6FABL 3SDDB 3B43A 3GDBA 4M1CD 3VJ6A 3B8YA 4UU9A 2RAMA 1DVFD 4JG0L 3GJEB 4GQ9L 5CEYB 2VZ3A 1Z9MA 1A6ZA 1Q1JL 3AS1A 1DTUA 4WW2B 3IKKA 4HWNA 4AM0A 4PP1C 3TF7C 4JPIB 4NQCE 5DD1L 4XT1C 3GMQB 1RK1B 1DJSA 4OLYH 1ACZA 2JLLA 3I84A 3QUXC 3SDXB 4PJ7B 1ORQB 2ERJC 4KMLB 5LWYL 4PRBA 1O7VA 4P5TD 3ZE1F 1G9MH 1JIBA 3DUSA 4GFTB 5BMFH 5F1SA 2NY7L 3DGCR 2EXWC 3S35H 3D18A 3CGTA 3TYFB 1A0QH 1Q9LB 1I1CA 1YPZE 5LKNA 3FFCE 5A43C 1H3PL 3KPTA 3C6LA 4P57A 1NGXB 1JRHI 3M1BA 1UWGL 3DX9B 1UB6B 3GGWB 4IRSA 1UQSB 4OUUB 1QLEH 4RGNB 5CEXA 4CN1A 1AO7A 5E70A 5T1KB 3C09C 3VXMA 1FVCA 1IAKB 3HC0B 4I18B 4O9HH 2P24B 4XVTL 4HFUH 1TZIA 2C7UA 2Y06H 3FQTB 3VA2C 7FABL 2CIIB 5HHPA 4L8DA 1CD1A 4Q6IC 3GO1L 5AEAA 3V6ZB 3K2UH 3BJLA 1Y6KR 2FBOJ 3MRHB 3CK0L 3VD5A 5T3ZL 1KTRL 4XP6L 1D6EA 4KI1A 2ZCKL 2IBZX 4Y4HA 3VH8G 5TDNB 4I9WD 2VC2L 5JDJA 4DOHE 3OKEB 1QSED 1YEHH 2XXMB 1QNZH 3ARDA 3IJYB 1OARL 1MCPL 3VE0B 2Y5EA 2QHRL 5F21B 4X9BA 4DAGL 5HHMB 4YHZL 3UTSB 3RI5F 4HKZB 4HUVB 4OF5A 4OLVH 4U0RC 2NY6B 4RISL 3HMWL 3HNTL 3SKMB 5KS9B 4OZIF 4O4YL 2HKHL 3KNBB 3TH3T 4RMVA 3C2AL 2DL2A 3NCJH 4XBGA 4OQTL 2BFVL 2DDQH 5BV7H 3W9DA 2MCPH 2YC1A 1GVIA 3S7GA 5TF0A 3PWPD 4FMKA 5EU7E 4NN5B 2IALA 5C0DB 2LTQC 4MXVF 2GUOB 5GS2D 5I1IL 2FLRT 3NZ8B 3G5VA 4NT6A 5SV3A 3B3IA 3QUYB 5HD8D 2AJVL 1FZMA 3MJGX 4K8RD 3TO2B 2NY1D 5MHSE 3QWOA 2LU3A 3RAJH 4X6DA 5HHOA 2A9NL 4EEEA 1AGBB 4PG2C 5IBTL 1JPFA 5EO1B 3UCRA 5EG6C 5KN5B 4M6OL 1YEFH 1BFSA 3QG7H 3AREB 2ZSWA 1OAKL 2LQRA 1ACYL 2QQNL 4BFBD 2DYPD 1T03L 3CLEH 4CJ0A 5TQ0L 2E27H 5CBEA 4LLYB 4MNGA 5IHZA 2DQEL 4X4XB 2R1WB 4WWID 2ZSVB 3EFDH 4BSWA 4UT6L 4IOFD 2WW8A 4IMLB 4KVNH 4LQFL 4CADB 1HHIA 1FO0L 5M94B 1EEZB 3HG1D 1GGBL 1I9RH 1S7UA 4JPKL 4UDTA 5HPOA 1RJLA 4MQ7B 4PJXF 5LAXB 1T3FA 3P2TA 2F54E 1RZGB 3DSFL 5DHYB 1BZ9A 2A6IA 5I1EH 1KIQB 2DBLH 3TPUE 1NBVH 3BKJH 3PE9A 3W2DL 1CI5A 4BM7A 1CDBA 4GW1A 4RNRA 2JB5H 4AIOA 5LVEA 1U41A 3B6SB 1QLRB 3MV8D 4DGYH 4YFLF 4L4TB 5JHDD 4HIHB 1QEWA 4ERSH 3GK8H 3Q6FA 2XKSA 4NJAL 5CJ5A 3TV3H 5IG7A 3DO7A 5JZ7C 4PJIF 4UTAL 4POUB 4S2SB 2P7TB 4K07A 5EWIL 2LAGB 3HZMA 2JIXD 4DUVA 4KJPD 3P0YH 2XYCA 5AD0B 3RWJB 3S37H 1KBGL 2GITB 1G7PA 2V5MA 2EIEA 2HH0H 3MJ7A 4JO3H 5JXEC 1DBAL 4OD3H 5DR5L 4WUUA 3SDYL 4QNPE 3LV3A 2J5LB 5SWSD 3K81A 1LQVA 1VGEL 1J0KA 4L3EA 1RZFH 2XA8L 1FZOA 1FFOA 1G7QA 4TSCL 4POYA 3OF6D 3WS6A 1XGQA 1S9WA 4YHNA 2H2PC 3FFDB 2Q87A 4JHAL 1FL3B 3HFML 1FORL 3VXTB 2P5WD 3MACH 4JY6A 2Z8VC 3KPOA 4N0UE 3P0VH 3RZCB 4DZBB 4OZIB 5T3XD 5LQBL 5ICYA 1S7QA 2ORBH 4J3VA 3MNWB 1Z3GH 3K1KC 1MNUH 4PJ8C 4Z76A 5IT2L 5CIPH 5J9PB 3GMNA 1VPOH 3C5ZB 1GGIL 4N8CH 4OTXL 3CFEB 5DJCB 5LCVL 1S7VB 3BZFA 2CLVB 2JJVA 4K3GA 2DQTL 5D7KE 4MD5A 4NQXA 4LCCC 2A6DB 4XCNA 3VXSA 3IDMB 5DZLA 3HE6C 4UT7L 6CGTA 1MSPA 3RGVC 3ULUC 2ADFH 4E0RA 3OAYH 1UYWH 2H1PH 1KJ2H 3Q1SL 1IARB 1JK8A 2GSIB 4KKAC 1KB9K 3CU1A 1MEXH 4PJFA 3IXAA 5MENB 3V52L 3NA9L 4CUCA 3AGVA 3FQRA 3QULB 4QTIH 2FECL 5DJZB 4N8VG 4V1DB 3S36H 4G8GE 4WI2A 1K6QH 2HJKA 3V0WL 3BRGC 4HCRH 3L7FB 4JPWH 1BAFH 5I1CL 3IU4H 4BH7A 1N3NA 2JTDA 4X7CC 4RQQA 4P2YA 4Q9RL 4PRHD 5F7HA 1I3GH 2OQJB 2IQ9H 1EGJH 2X89A 4HDIA 4NHUB 5D5MA 3HAEB 3IFLL 5EU6E 4RGOH 2Z31C 2V2XA 3BQUC 3FOMA 4GG6A 4B50A 1D7FA 2A1WH 4KHXL 1UADC 3SDAA 4AH2A 1HHJA 2UZYB 4PJXB 1QTYT 1SQ2N 1MJUL 4UQ2A 3GIVA 4I3SH 1N0XL 4JRXE 4QHUB 2E7MA 3BFOA 4NO5B 4OZ4A 2LU7A 1XMWA 4G80B 1CDUA 4IJ3B 4NZJA 5JA8B 3MRJB 1X5LA 3VG9C 1KNOA 3D5OF 4UOJA 4UIMA 5AWNL 4OCYH 4D8PB 1NH6A 3MRLA 3OHXA 2GCYA 3DARA 2EE3A 1UKTA 2FATH 3MLUL 3BPNB 3O3AB 1JI1A 3LKSA 1K8IB 4JO4L 4LFHG 3KPRE 2IBZY 2D7OA 4PJHF 5ECJE 2P5ED 2XA3A 1A6AB 4NFDA 1WVZA 3UTQA 1C16B 4PJIB 2HJFB 1N6UA 1G0DA 1LD9B 5D72L 1HKLH 3O41B 2WP3O 1U42A 1I1AC 1UXSA 4NZRH 1QFUH 2D7TH 2AABL 3GBLA 2JKXA 4LVOC 3TT3L 4Z7QF 1WWBX 1J8HB 3FN0H 1NFKA 5FA3B 1P53A 3VFVB 5EZJB 5IF0B 1MLCB 1LO5B 3RVXC 1PJ9A 3BW9A 3QXAA 43C9B 4WENB 5K9KB 3MODL 2D9QB 2PETA 4MXQC 1I7TA 3WN5C 3E2HB 1N5YL 1S3KL 4JFQA 2EO9A 4PJEE 4Y19B 1CGVA 4GUPA 3U1SL 4Z0BL 4KMTH 1NKRA 3HI5H 3DGGA 2HT3D 1RIUL 3IDIA 4ZQKB 3S3JA 2XTJC 3CLFL 2EDKA 3AROA 2AV7B 5KG9B 1KCVL 1OB1A 4KKLD 5C08E 2YA0A 1AIFB 4MAUL 1FZKA 2FCBA 5CZXC 5IEHB 4UUJB 4K3DL 2AJXH 5DD0H 3SJVE 4FHBD 3T3MF 2D0GA 1NCNA 2R69H 1U8OA 5FKAB 5DI8B 2B1AH 1BEYH 2IFFL 4MA3A 4C54A 3S97C 1FVEB 3MV7D 5FF6B 2I9TA 2A74A 1AGDB 5GZOD 4ZUTA 4GXUM 1NC2D 5JW5B 1Z0MA 4X5WA 4G6AD 3L3OA 5E5UB 1F6FB 4ZD3H 4LNVA 1MCDA 2KH2B 3T08A 1FNHA 4EDWH 3TJHD 1JGEA 3QHFL 3TBVB 5I1DA 3MOQA 1JCKA 1G9NC 3FOLB 5DHVH 3WUWG 3ET9F 2W0PA 4EN3D 4QRRA 1B9ZA 2GJ6E 2ZZUT 2B39A 4I8DA 3ORJA 2PW2B 1AKJB 3U46B 1ZEAH 5HGBB 5CWSB 5JPMB 3H9HA 1LQSR 3FB7B 2C1PA 1QQDB 4ZPVA 3BT2L 5TF1L 2VLKB 1YNKL 2QADC 3M17A 3ARTA 3WFCL 3QNXA 1HZHL 1KCUH 4K7PH 1ZHNA 4PJCB 3HUJA 4UTBH 1SJXA 1U8MA 4JY5H 3HN3A 2Z35B 3QEHA 3MCLL 4F7EB 1UZ6E 1F3RB 1WAAE 4U1JA 5DRZA 1AQKL 4PGZA 3O8XC 1NANI 3QA3B 4U7MA 4AEIL 1TMCB 3CFJA 1ZANL 4HIXL 2Y07L 1GOHA 4F7MB 4XPFH 3BEWB 3K4ZA 3KXFD 4FQPA 5IK3A 1WEJH 1QUNA 3KDMA 5DXWA 5GGTA 5CJBA 3QIWC 4KU1A 2C5DC 4PJHB 1A1OA 2OSLB 3MYZA 4XPHL 1CFTA 4NJ9L 3D39B 2NX5B 1PLGL 5JUEH 1NAKH 3NCBB 4S0SD 1KN2H 4MDIB 4FXLA 2X4NB 1DZBA 1D5ZA 5D1QA 3FQNA 4PJGA 2HT4C 2X4RB 3BH9A 32C2B 3H9SE 4KWUA 2VLJA 2EXYD 5I9QC 2H3NA 2KUTA 2Z91A 5KSVB 5I1HH 2DQJH 2VDRH 4YHMH 4LHQB 4Y2DD 5JMRA 2RB8A 1RZJH 3QBTB 5E8NA 5IMOA 4YBHA 3RWEB 5CKAA 1NSNH 4U1KB 3AU1B 4JDZA 3IU3B 1P1ZB 1HSBA 5J13B 4C56A 3VXPA 4PJ5A 3X3GH 2HMID 4ZTOH 1L7IH 4BK5A 1GSMA 1H5BA 5K9OB 2J8OA 5HDLA 4JR9L 1ADQA 4PIRF 3L5WB 4UV7H 1IVLA