2FO4A

Enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Enhanced major histocompatibility complex class I binding and immune responses through anchor modification of the non-canonical tumour-associated mucin 1-8 peptide
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fo4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2fo4A01
3THMH 5J9PB 4IIQB 2YWZA 2JIXA 5IM7B 3UTOA 1R3KB 2R23A 1G7JB 4GMTL 4JKWA 4KVNL 3ARDB 3FRPA 1YEKH 5I1AB 4LSTH 1FFOA 2DWEB 4Z7QF 1BBJB 4YUEH 2Q8BH 4GBXB 4RISH 4NCDA 1JNHB 3VFPB 2P8PB 1WCQA 3BQUC 4GO6B 4X9HA 4K8RL 4GMSL 5HYJA 1JPFB 1CU4L 3BP6B 1MAMH 4AQ1B 3GKWH 4AIZB 2AK1H 4I0KA 4L1HA 5DURB 1QRNA 3DUUB 1F4AA 2EIZA 3SKUD 1P9MA 3VXNB 1TJIH 4ODXA 5IF0A 2VABA 4PJ7B 1GRWA 1CLYH 1RK1B 2Q7YA 2NXZD 2DIAA 5DHVB 3LKPB 1NC4D 5DJDA 1QNZL 1TQBC 1CK0H 4DK6A 4NDMA 3MLVH 1FZOA 3T0EA 1SYVA 2EO1A 3MV7E 4KRPC 3RNKB 5J6GA 2AEQH 3MA9H 4LEOA 3TVMA 1BQHA 2R29L 2R0WH 3C5SB 1OP5H 4FFZH 3VFGH 3STZB 5EU6E 5TDOB 3E2HC 1QUNA 3G5XB 3GSVA 3BO8A 5FOBA 5EPMB 2IH1B 1KJ2H 4ZQKB 4X6DA 4CMHB 3DXAB 3SQBA 1MHHB 4YNYB 5L8JB 5BS0B 2G5BA 3VFOB 4XZUB 1SEBA 2XPGA 4C55A 2VWEC 4F7CA 4JRXD 2HN7B 5EB9A 4S2SB 2P43B 5F93C 4AIOA 1UVQA 5DQDL 4QNPE 2W65A 2VDOL 4JPIA 4KGLA 4KQ4L 5MERA 1IGTA 1MY7A 3HMXH 5SWZE 3ULVF 4QHKI 3FB6B 4WUUE 2R56H 1C8PA 1OGAD 4EI6B 4KKAC 1WSST 1KJMB 3BIKB 3TPUA 1KG0A 5GS1B 3LRSB 3LVEA 2X7LA 3EYOB 9CGTA 5C0IA 1G6VK 3CCHA 1A47A 4OGAD 4HPYH 3TZVD 3C8KB 1BAFL 1MFBH 2ATKB 3OV6A 2FIRT 4MA1B 3ARDD 4I4WA 5HYJE 3G5VB 5I19H 5I1LA 5D6CA 1R5VA 2GSIB 2QQNL 5IMMA 4RAUA 1AGEA 1TTGA 4GBXD 5EUOA 5K9OA 3NH7H 2NTSP 5J1AA 1HI6A 1QRNE 3MRPB 4O58H 3KR3L 5HHPA 5IFJB 1Z6JT 1FJ1B 2X4PA 5I16A 4AEEA 3RX5A 2EH7H 5KSVB 4NGHL 3E8UL 3MNWA 1DQJA 1P5UA 1OW0A 2Z0BA 5DURD 3DMMC 5D5MB 5C08A 3T0EE 4U1HB 1U95B 1XR8A 4YHOL 2F54E 2UUDK 3IFPA 1FVEB 2V17L 1BPVA 2A9NL 3Q48A 3AS2A 4P5TC 4LSRL 3HRPA 2V2XA 2XZCH 4M8VA 3SDXF 2NX5A 4JZOB 4ZTOL 1MFAL 4GRLA 5ILTL 1MHPL 4X6DE 5IVXB 2ICWA 1MCPL 1XF5B 3H0TA 4PJGB 2WSKA 4X80H 5DLMH 5AWNH 1LO3L 1MNUH 4O2CA 4DKEL 3OKEA 5TQ2H 3H6JA 3QUMH 1LP9F 5H37G 1A1MB 2R2EA 4QF1B 3DXAD 4HXBH 3ZDZE 1JHKH 1I1RA 4U1GB 2OXGA 1KLFA 4DN3H 4NBYB 1RJYB 3OXRA 5IT2L 2E7CA 2B2XL 1KXVC 1FYTB 4HS3A 1R5IB 1LEGA 3S34H 1HCVA 3V9FA 4FXLA 1KIQA 3R06B 1JZ5A 2OL3A 4EIGB 1KULA 3T3PF 3P4NB 1AQDA 3MLSH 3BKML 5D93B 3TPUE 4NUGH 3U0PA 4JDTH 5F1NB 2ARWA 1CZ8L 5CZXD 4F58L 4LDEB 5LXGL 3C5ZD 1GZPB 5KVDH 3FZUC 5EU3A 1K8IA 5D1XB 2CIIA 5T1MB 5A2IH 3QPXL 4QXUL 3RWDA 4O2FA 1TCMA 1QVOA 3FO9A 3VI3F 3NZ8B 5DEFA 3ESUF 1NJ9B 4JFOA 1M4KA 1JRHH 4JPVL 3EO1B 4L9LA 1F97A 3C6LD 5EUOE 1JPGA 1ZMYA 1DQLL 4Z7VB 2XWJB 1JYWA 5SX5H 3HAEH 4JQVC 1CGSL 5ACMA 1CTOA 5IR1A 2BY2A 3AU1A 1UA6H 4BQCA 1IKNC 5ICZA 1QOKA 4IDLA 1F4YH 1FFNB 2HT4C 4Y4FA 5DMKB 4P2RB 1ZHLA 3KJ4C 3L6FA 5C08E 3SQOL 1JWUB 3OQ3B 3B8YA 1NUDA 1NMAH 2FO4B 5C0CA 3TBSA 4MQXC 2NY1B 3HLAB 4NHUB 1V05A 2GSGB 3OR7A 1QLFB 2NX5E 5I8OL 5IB2B 4I0PC 4BSWB 1TVHA 2ZSWB 2XWTA 3L3GA 3ZT6A 5F1IA 5JXEA 1J0HA 1ZS8B 3NFSH 2FR4B 1I3RA 4TSAH 1YEIL 2NZIA 4GRWF 2F74B 1B90A 3FB5A 4R96A 3PXHA 4TN9A 4K3JH 3B43A 4RA3A 4ZAKA 1DDHA 3CLEH 4HF5H 2VDKL 3FQXB 1YEGL 2QR0A 3INUH 4ZYKA 3BZ4A 5DRWB 5D7KD 5EC1A 1L8JA 3NFPB 5GZOC 1TETH 5CUSL 4OQTA 3L7FA 1BOGA 1G6RA 5JW4N 4PG9A 1UEMA 5GZND 3QI9B 2JJWA 3QQ4B 4YAQA 1MREH 2YKLL 2KKQA 5DRXA 5E56A 1U8LB 1CL7I 4DFIA 4DUVA 1FYTD 5C0JB 4YX2L 3KHOA 1NBVL 4PJHA 3D1MC 4G43A 4LGPB 3D3VB 2D7OA 3HNSL 5EZIL 4DJMA 4WFEE 2Z4QB 3BPNB 1RK0A 2XNAA 4NKMB 4FQLL 5DJZB 3NOIA 2OR9L 2QQLH 4PGJA 3X14B 4CW1B 3VW3H 1HH6A 1RZFL 4NO0D 5B8CB 5D1XD 3HR5A 4QGYA 3IJYB 4JB9H 4BUHA 2N7AA 2WLZA 3MRRA 1T1ZA 2YSSB 4OZHB 3CLFH 3BHBA 3FO1B 4MMXC 2XFXB 2FLRT 4L8BA 5CJ5A 4H8WC 1A1OA 1NLDL 4PJCF 5LAXA 4LVHB 5TE6H 1U36A 4XMPH 5SWSB 1FNFA 3L9RA 1EGJH 1MQKH 1D5ZA 1IC5H 3U7WL 2Z31A 4YPJA 3IFLL 5C0CE 1KELL 3CC5B 1ZA6A 4FQIL 3DECA 1KYOK 3W9EA 4K7PH 1L7TH 4PP8C 1TCRA 5MENA 4X4XA 4DW2L 4HWBA 3DX9A 5L8KB 3C60C 3QIBB 4JPKL 4X7SL 5KOMC 2NXZC 2Y5TA 3R0NA 4OLUH 4Z77A 2YMXH 4NZDA 1CWVA 4TUKL 5LCVL 1CTNA 4X7FC 5J57B 5C0BB 1N8ZA 2NY1D 5GXBB 2ZG2A 1S5IH 3U9PH 3WDIA 4AMKL 3QEUA 3VFNA 4JFQA 3TN0D 3MLWL 4L3CA 4M5ZL 1PJ9A 1AQKH 5JOFA 1Z9MA 5MP6H 4JVUA 1W8OA 4H1LH 3C5ZA 2BRQA 2Y07L 3LD8B 32C2A 1MCOH 4PP2B 4PTTB 3FONB 5HYSG 2EDDA 1U8JB 1S7UB 2AP2A 4G6KH 1CF8H 2IFFL 4PGDA 2ORBL 3PABA 1J7VR 3EO0A 4Y19B 4PJIF 1FNSH 1WFOA 5EUKB 2E7HA 1NGZA 2X09A 1QQDB 4PJHE 1N64H 4B7LA 3QI9D 1KB5H 3IU3B 1PSKH 3VG9C 2H6PB 3W81A 3AB0C 1W72A 2BVPB 3PL6B 1ZT7A 3KVQA 3BZDA 4AQOA 1J8KA 4UT6L 1OAYL 3VWKB 3UBXG 4J2XA 3ARRA 4MNQB 2GTWB 4XBEH 3F8UB 5CWSB 4HG4J 3C87A 1I7TB 5D6DC 1SY6A 1I9JH 3LKSB 3D3VD 4PLOB 2PW1B 3FMGL 1HHIA 1N5YH 1YPZB 4OGAC 4OZ4B 3TZVC 5KSBF 2HFTA 1N0XL 3MJ9H 1SBSL 3DVNA 4IIQC 3UTZA 1J0JA 3DARA 1XIWB 2P7TB 3ARDC 5DMGC 1PKQB 2DQGH 3CDYA 4Z7WB 5EZJA 4W6YB 3N50A 1J86A 1UJ3A 4GBXC 1BJMA 3MNVA 5EU7E 3I6GB 4LSUL 1OOAA 4LCWD 4UB0L 1FFRA 2BDNL 3GSXA 3LS5H 5EO0A 2RFXA 2XKUA 5MENE 4M5YL 1ACYH 1IARB 4QT5A 4N9GA 5CKGA 3VRJB 4DGVH 3T0WA 2WZPD 4JGJA 1AGDB 4JO1H 5ECJE 4E0RA 1EAJA 3SDDB 3MV8A 1LO4H 2IC2A 1UXSB 3CUPA 5F9JA 4PV9B 7CGTA 4OB5L 1EHLH 3QIBD 2DM3A 3O6MH 1IEBB 4YHZL 3MACH 4HIXL 3IB4A 4Q9BA 2GJZB 3ROOA 2ZCLL 2DOCA 2RCSH 3DX8A 3O2DH 5CZVH 3WXVH 4DTGL 5C0BD 2AKRA 1C1EL 4PRBA 3JXAA 2W9EL 1EV2E 1RFDL 4ZODA 2X4TB 4OCRL 2X4NA 3K46A 4ZFGH 4X9FA 4P5MA 4PJDB 3AFLA 4NQCA 2BSTB 4H5SA 3FCTA 3WEXA 2H2PC 4HKXB 1KPVA 4ONFL 5JO5A 1WWWX 3BDYH 5E1AA 1DQQB 4CMHC 1MCIA 1AR1C 1SEQL 2OQJB 4Z0BH 1JHLH 1B6UA 2XG5A 4NN6B 1NEZG 1O0VA 3NA9H 2ZUSA 4OLZH 5TPWL 1KN4L 2OS7A 4HUVB 5ESAB 3VXSB 3WJLC 2UZYB 3SY0B 4GW4B 4Y19D 4Y16D 2HMID 1YQVL 2DN7A 1BD2A 3GSNB 4DVRL 4MHHG 1BM3L 3QUYD 2NY4B 5IQ7L 4FQXB 5CZXC 3H9HA 1SM3L 4MD4A 4HPOH 3GM0A 4M7JL 3KPSA 1MCNA 5E2WL 5GRVL 3VWKD 5L2JA 3QEQB 4LLQB 2YWYA 5F7DB 1YYMH 3SGKC 1A9EA 4K94C 5HHVL 3BJ91 1H15B 4MDIA 3FO2A 3CMGA 3GBLA 1MCWW 3MFFA 4K7FB 2DIBA 3L7EB 4FQHB 4XPAH 5D7JD 3DYMA 2P5WB 4F9LC 1P4IL 2MSPA 4D0BA 4HWEH 5IV2A 3TN0A 3ZTNH 2VRAA 1NAMB 4HJJH 2FB4L 3G6AB 5E8OB 5F71A 3L3KB 2A6JB 1B0RA 1KC5H 3B9AA 4OSUH 4XPBL 3ILQC 2MPAL 3MOQA 4MZ3A 1YEHH 2JK5A 1B0GB 3MV8E 5GSVA 1OSPH 4QTHA 4A6YB 1BHGA 1RZKH 5C71A 3TA3A 4IRJD 4O2EA 3Q6FB 4TQEL 2X4OB 4AK1A 4XPHH 4AM0A 5L6YL 4FFYH 4IOFD 2PUQT 2QV2A 3MREB 3VD4A 3LSOA 1A22B 1IMHC 5EWIL 4NQCE 5EORL 4HZLB 1AGFA 4DFHA 3NCYP 3IAGC 3V6ZA 4XCFH 5C9JB 5DS8A 1IC7H 4WVRA 3WXWL 2ZOLB 4ETQB 3KYKL 3LN4B 3D25A 5FV1L 4AYFA 5CBAA 4Z9KB 4APQB 1KTRL 5MEOA 2NZ9C 1X4ZA 3QDGA 5ENWB 1PZUB 3MX0A 3TT1H 1NUGA 2VUYA 5KW9H 5GIRB 3B6SB 1TJGH 3QEGL 3PWLB 4QTIL 1BD2E 5GZNC 4U1GC 3KYNA 1DL7L 4GQ9H 2OM5A 1NCDL 2FWOA 3GI9L 4FA8A 3KXFA 1HK6A 4PJFA 5CIPH 2BNQB 4PRIB 1JFQH 1REIA 3O3DA 3MRCA 4O4YL 4MCZA 3KPSE 1NC2B 4HHAB 1U3HA 4JKMA 4LBEB 1VDGA 2ARJA 5HI5D 1IGMH 5D93C 3S37H 3GKZA 2E6PA 1BQLH 1S3KH 1CGVA 2ITDB 4NQDA 4WI9A 2YA0A 3S35H 4D3CL 5D1XC 1FZKB 3CVHB 4QHUA 3QEQD 1IGFL 3DGCR 3V7MA 5ADOL 5T3XH 5GGUB 4GLRH 4KKLD 2R9HD 3TYGL 4P49A 3CSPA 3EYFA 5E0QA 3GHEL 5F3BB 1IAMA 5IVZB 1A7BA 2P5WD 4N8VA 4LF3B 5KSUA 2MQ3A 2DQTH 12E8H 4GXUM 2YPKB 2PTTA 1N4XL 4Z7UF 4W4OA 4Z5RB 3MRLB 3O2WL 4HLZH 1MFEL 2HT2D 5IB4B 2FD6H 4YGAB 4I5BB 4GOSA 1RHFA 1EPFA 5C92A 1I1FA 4JG0H 1CL7L 1MAKA 5EO9A 3QWRD 4M1GL 1A6VL 2KZ1B 1FVDA 2NY1C 4NRYB 4LRNH 3V0AC 3H42L 4Y16A 4BH7A 4OGYL 1KB9K 5BVPH 3L3DA 4QHMA 4ODTH 5ABDE 2J5LC 3EIFA 2DICA 4GT7A 4PJ7F 1YDPB 1OP9A 2F8XC 5J4MA 4OCWL 5FXCH 4MJ6B 3QDGE 1EEZA 4OAWB 4Z0XA 1T89C 2VDMH 4S1QL 1CBVH 5E6IB 1NGWB 1V3MA 1KT2B 3QXAA 1FL6A 2KPNA 5F9OL 4EXKA 4APQD 4CVUA 3CFBB 1IVLA 4WV1B 2IEPA 3KXFE 4MVBA 3C08L 1MSPA 5K9QG 2CDEA 5GGQH 2XKNB 3G04B 1UB6A 4WHDA 4KUZH 3F12B 1OB1A 4PJEB 5HI3D 3QI9C 1Y0LA 5KS9E 1D6VH 1ND0A 4HIEB 2AQ3A 3QIUA 2BNQD 1XGRB 4ZOCA 1TDQA 2DBLH 3G5YB 4PRID 5DR5L 4HSQA 5IHZA 4NQDE 2QBWA 3TM6A 4YXKL 3NIDF 3K4ZA 4D9RE 3ZKSD 3BKYH 2V7NA 3KPLA 3D39B 3UJIL 3HE7D 1H8OA 4X7TB 5F7UA 4TTDD 4OCYL 4Z7QE 3BPNC 3QNYA 2IFGA 5F7FA 3F6LA 4S1SL 3VI4E 5KOVC 2ZOKB 5FUZH 5B8CC 2QHRH 4LARL 4PJ9B 1OTSD 1AGBA 1UM5L 2VIRB 2VLRB 2I9TB 1LO2H 1AE6L 2IANA 4R8WL 5GGVH 3WFDL 1W0WA 4S11A 1ZLSH 4LVHC 5SX4I 3U0WL 1PZ5B 4GRMB 1CLOH 4LSVL 2VR4A 5C0AA 4MJ5B 5F7MC 3DIFA 1LILA 2E7LA 1F8TL 4M61B 2R2BA 5EA0H 5IK3A 5AYQA 3BN9D 2J4WH 2DTSA 2I24N 4P59L 3C09B 3CXDL 3BKJL 5DD3H 4Z7NE 5HDQL 3QIBC 2O5YL 4C57C 2R0LL 3P73A 2WY3A 1RZ8B 3REWA 5IJKA 2VLLB 5KVEH 4WI6A 3NCCB 4GAJL 3G6DL 4R97B 4X9IA 2RAMA 3TO4B 2BP3A 1Q9LA 2E3VA 2FH8A 2VLKB 5GJTL 2R8SL 1G9MC 5B4MC 3LHPL 4GMTH 5D5MF 4KVNH 1QHPA 2FGWL 4X0KB 2WQ8A 4NO3B 1U8HB 4XVTH 4UQ3B 2NCMA 3BH9A 5FYLE 2Q86A 3TF7C 4G6ML 5ICYB 3WIHL 3PV6A 1J0ZA 3CFEB 3LD8C 4MAUL 2OZ4A 5HHMD 4K8RH 4GMSH 4F33A 1U93B 5E6ID 1CU4H 2WANA 5IVXF 2IQAA 3ULVE 4P2OD 4R9HA 5H94B 3E0GA 4PJGF 5DJAB 2NY6B 4PGBA 5CEZD 3OPZL 1A3LL 5J7CC 1WBZB 2HMIC 4ZXBB 2O5XL 4NM8L 1DBBL 5JW3L 3QUYC 1CFTB 4X6BB 3I2CL 1NANI 4XGZB 2OP4H 2GITB 1MLCA 4R4FL 1E4WL 2VB5A 3OX8A 4PB0L 3VWKC 1KCKA 4WWID 1K5NA 2R29H 4HK0A 4NFBA 1E4JA 3GMQB 4ALAL 4OKVA 5EIVA 1CCZA 5HGAB 4O51B 5GRXG 2VZUA 3QUXA 5D7JC 4J3SA 3TFKA 2D3VA 3TEUA 4MXQD 2IANE 1LD9B 4H25B 1IAOA 3RL2A 2P1YA 4P0DA 1YMHB 1EO8L 3U0TA 4NZJA 4YDKL 1W0VB 1BFTA 1KPRB 2FSEA 2JB5L 5TDPB 5KN5B 1KIPB 1JNNL 2VLRD 2PN5A 1GOHA 3MOBL 4QEGA 5KG9B 3E3QA 4G9FA 5C0AE 3QULA 3OR6A 5DEGA 2H8PA 1BFSA 2E7LE 4YR6B 5DQDH 2VDOH 3W11D 5DJXB 4KQ4H 2OL3H 1FO0L 1ZWIA 5TE4L 2XTJB 2UWEA 1U8NB 3RVWD 2X1QA 2YBRA 4Z7VF 4XNQB 3HMWL 4KK6D 4ZDHB 1ZLUH 3PWJB 4D9LL 2WBWB 4JFHD 2ZSVB 2A2QT 3MRQB 4PY7A 1Y18B 2EYRA 1GZQA 3SDDC 2DD8L 1MIML 5ITBL 4GSDL 3WO3B 5JIPA 1I3GL 2EYSA 2NY3D 4XBPA 3RQ3A 3OB0K 3ECBB 4GXUN 4JE4B 1NAKH 4NQSB 4NZTL 4ORZC 1BAFH 4JFFA 2ADJA 4GAFB 1ZHKA 1S9XB 3TO4D 3FB7A 2XWBA 2VLKD 3VGDA 1INQB 2XZAL 5EDXA 4ZG1A 2ATPA 1HEZB 3HE7A 1BIIA 4HJGA 5LGJA 4ZNCD 2FATL 1PD6A 4BFEA 2QQNH 4OLWL 4GG8B 4XP5H 3WKMH 3MNZA 4HAGA 4XCEA 3I02A 3NCJL 2VZ3A 2XZZA 3QWOB 4NN6C 4OZFA 3T3PE 3RAJL 5E2VL 3KR3H 3EOTL 2XY2A 3LEVL 3SO3C 3LB6D 3BT2H 3FQWB 4LKXB 1J0KA 4UZGA 2NY6D 4NGHH 3O2VL 1FLTX 1ZLWH 4OCNC 3UJTL 4WGWB 2N56A 3O3BB 1ZSDA 1CFBA 4ZXBD 4EN3A 5IMOB 4KI5C 5D72L 5HI5C 4YHOH 4PGEB 1KEGL 2NY4C 1T0PB 5TGBB 4Y88A 4FQXC 3VI3E 2V17H 1A7NL 4H1LB 2DB8A 2A9NH 5L88L 4LSRH 3VE0A 3T2QA 4TTGA 4ZTOH 8CGTA 5ILTH 1KJVB 2X4QA 5TE7L 2R4SH 3O6KL 4U6YA 2QADD 1MIEL 3V6FB 4LLUA 4OUOA 4J3TA 2BOCB 3KLSA 1IEAB 1DE4B 3E3QE 4G9FE 1WITA 5M7QA 4HS6A 3EFFB 2EDRA 3UZEA 4C59B 2UWEE 5IT2H 3ARFA 3VCLA 2B2XH 4MS8D 4OZHF 2W9DH 1P4LA 2VH5H 4LCYA 3U30B 1T80A 1G7LA 2X4UB 3T09A 1YNTA 1CT8A 1X5AA 2HKFL 1KLUA 4Y5YA 1EJOL 2YPLB 3U48A 4OLXH 5C0NC 1ORSB 1ADQL 3I50L 3DO7B 1YEJL 3HNVL 3BKMH 4YFLF 4LQFH 3QR2A 1IAIM 1A3RL 1TZIB 5DHXB 5LQBL 1CZ8H 5I73B 4F58H 1FBIL 3BE1L 3OMZA 5LXGH 1KBGL 3BH8B 4K3DL 1CLCA 3HPJA 4X8XA 4JFFE 2HH0L 3IS1X 5DHYB 3TESA 3MFGB 4JFXB 4UINL 1DUZA 2Z92A 3NFNB 2PXYB 1T5WB 3EYVB 1RZGA 4PRNB 4C54A 3BXNA 1HXMA 3GSQA 3VFVA 3GMPB 4JPVH 2Y6SD 4AEFA 1KTLB 3NN8B 4P3DA 1JGEA 4MAYB 4XVJL 1OWWA 5DRZB 4RAVB 4PLNC 4U6XB 2Q7NA 3D85B 1MQ8A 1CGSH 3HC4L 5LJYH 2DRUA 3LIZL 4APQC 5C8JB 1JTOA 1ZHNB 2VWEE 1RI8A 2JELL 3MLRH 1LDSA 1C7SA 1U92B 5A43C 1OQXA 5DVLA 4MX7B 2HKHL 4ONOA 1Y6MR 4WFFD 1QR1B 4XXCC 3BMVA 2BERA 6FABL 5AD0B 5HI3C 3SOBL 3WE6A 5LKNA 2NYYD 5DVNA 1LE9B 5AYUH 4HUWA 3RX7A 1HSBA 3GMRB 2B1HH 2CUIA 4EDXA 1AH1A 3QXDB 3ZE1F 5JMRA 5DUPL 5I8OH 4LL9A 2DMCA 4TTDC 2R1WB 3UC0L 4E42A 1YEIH 2JJSC 4OIIH 1V7NL 5SV3A 4Y5VA 1OT1A 4KDTA 4FZEL 1DBJL 1OTSC 3TV3L 3HRZA 3WNKA 3DI3B 2A6IA 3QQ9D 3C8DA 1Z9SA 2AV1A 1XF1A 3MXVL 4DCQA 2OTPA 2VDKH 4MA8L 1UWGH 1YEGH 1YPZF 1OF2A 1QEWA 1U6AL 4BZ1L 1V3LA 4H8WL 4BM7A 5CUSH 3BVNA 3GJFH 4L4JA 1ZT1B 3MODL 5EU5A 2F19L 1JZ7A 3W0WD 3S5LB 2M8XA 2EIEA 3CSGA 2J6EA 3MRMA 2YKLH 1DP0A 4Z7WF 3BN9C 3T2PA 3DWTA 1SQ2N 1VFUA 1MEXL 2V9TA 3QQ3A 4YX2H 2FJGB 4U0RB 2WUBL 1NBVH 3SE4A 5JR1L 4GW5A 2YPLD 4ONHB 2Y1VA 4NFDA 3HG1A 3HNSH 5EZIH 2Z8WC 3OKNB 4QRPA 1H5BC 1DQML 3FTGB 2KQMA 4FQLH 1K8DA 1CD1A 2OR9H 4I0CC 1RZFH 1S9YB 3O4LD 4PJ8B 1EERB 2PNDA 3PJSA 4PJAB 4HMCA 3RY4A 3T1WA 3WSQH 4LSQL 2O61A 2PXYD 3QJFA 1TVDA 3VRLF 3UEZA 4EQ2A 3GRWL 4HH9B 4D9QE 4KI1A 4U2YA 1P1ZB 1QBML 5CGYC 3O81A 4AH2B 1NLDH 3WYRA 5E6IC 4E5XB 4QHNB 1GL4B 4P2OC 4PJDF 2FL5B 4WUKL 3D85D 3QG6A 3EGSA 3U7WH 4YFLI 4WV1C 3A6BL 3IFLH 3KPRD 2DBJA 4HQQL 4FQIH 3PHQA 1PDKA 1S7QA 5BVJA 1LE5A 4BFIB 4KJQD 1GCFA 2R2HB 1IAKA 4JPKH 4HXAL 2LV4A 2EDWA 4C4KT 3S3PA 4TUKH 3QDJD 5I2IA 4MNHB 1A6AA 4CN6A 3FJTA 4FP8H 4GKOA 4R90L 4G59A 4P9ML 4TNVF 4I3GA 1BLNB 1N59A 3U36A 1KUMA 4AMKH 3O11A 4KI5F 4NRZA 4MNGB 4X6EB 2GFBA 1AO7A 1BREA 4KMLB 4M5ZH 5J06A 4ZUVA 1RUKL 3ULUE 4MHHI 2C1OB 2W59A 2CLRA 4X5WA 4MXQC 1WBYB 4ODBD 2Y07H 2CJUL 1G6RL 1I85A 3EYSL 4UAOB 3JVGC 3F5WB 4PJ9C 1JGVH 2AV7B 5IB1B 4IHOB 2FDBP 4CUCA 1A1NA 1HOCB 4WDIB 4JHBA 3I75A 4Z7OE 2NNAA 2ORBH 3LPWA 1IM9A 1M71B 1U8IB 1X5FA 1A14L 5HHNA 3W11C 4ODUA 2OK0L 4YWGL 4ZMAT 4DVBA 4X4ZA 2F58L 4WW2B 1RIUL 4YBQC 1PVHA 4KK6C 4FG6C 3ZSTA 3HG1E 2QEJA 4RMRA 4PG2A 4R4ND 5DK0A 4F9PC 4YDVA 1X7QB 4QRPE 4UT6H 3M17A 2HTKD 2CUHA 3T0BA 3C09C 3DRTB 3C60A 4WFGE 2J8UF 5ISZB 4F8QA 2FX9H 3QHFL 3ALWA 3RZCB 4NBZB 1JZ8A 3J7HA 3FMGH 4UUJA 4M7KH 3CAFA 1C5CL 3ARTA 3GJEB 1A4KA 1S8DA 1K4CA 3TO4C 4NQEA 1SBSH 3JTTA 1DVFB 3RDTB 2EDJA 1YMMD 3MYJA 1JZ3A 3HZVA 4MDJB 3RWJA 3STLA 3FRUB 4R3SA 3GSUA 4X6CB 1FLRL 1V8HA 4EBQL 3MBEB 1CDGA 4LSUH 2BMKB 3WLWD 4UB0H 2BDNH 5MEPA 1C7TA 2ICEA 5IEHB 3BZEA 2E9IA 5FO7A 1K3ZA 4RMSA 3LB6C 3GBNH 3FT2B 3LOWA 4HCRA 5D2NB 2NY6C 2OR8A 5FHBL 2QSTA 5TH2A 3ARGD 4QRTA 4ZXBC 3T77B 4L4TB 1NCCH 4K71B 2VE6B 2YRLA 4OB5H 3LDBB 1KJ3L 4PV8B 4QRSB 4YHZH 3W0WA 1J10A 3Q5YA 2BXZA 3V5DA 1LNUA 1AO7E 3DETC 1W0YT 4M8QA 2BVQA 2ZCLH 4UDUB 4DTGH 5I1HL 1C1EH 2W9EH 1RFDH 4OCRH 4DZ8B 4K94L 4L8SA 2FX8L 4OGXL 3LKOA 2BZDA 1BFOB 3OJVC 1M6OA 5DD6A 5FDYA 3TBVA 4KHXH 4HWNA 5J9PA 1RUPH 3P4OB 1SEQH 2V7HA 4LPCA 3O4LA 5E95B 4EXPX 3HC0B 1W2KT 2EECA 2KH2B 3QUZB 1JGUL 4RFOL 2ZNWA 5TPWH 1KN4H 4I3SH 1M1SA 2DWEA 4MS8C 3FB8A 3P3YA 1JNHA 2DL2A 2OJZL 4M6AA 1E4KC 4QXTB 1YQVH 5IFAL 3VFPA 2JTDA 4DVRH 5BJTA 1BM3H 4WFFE 5F6HI 1BZ7B 2DMKA 1KACB 3BP6A 3D0LB 1SM3H 4DKDC 1B9ZA 1T20B 4M7JH 3DTXB 1KXQE 3DUUA 5E2WH 3OKOB 1AHWB 4NQEE 1EXUB 5J11B 5HHVH 5ISZD 3QO1A 4RQQA 5GRUL 4LLAA 4ZFOA 2H26B 3RZCD 4LHUA 3BP4A 3QDJA 2Y6SC 1DANT 2XT1B 4UT7L 1A6WL 1DBKH 1U9KA 2HLAB 1D7FA 4DAGL 1QSFA 3KNBB 2QSVA 5FFLA 4IS6B 3ALXA 4DOHE 1CG9A 1HDMA 3RTQB 2FB4H 4F7TB 2CKBA 3HUJA 5SX5K 5JMOC 5C07B 4RFEB 5EPMA 3S96B 2NW3A 3NZHL 1KENH 1MHHA 4WWKB 4XPBH 1I1AA 5T3ZE 2MPAH 1C5BL 4XNMB 5BS0A 2NYYC 5F6IB 5DT1L 4XZUA 1OGTB 1MFCH 4MB3A 1Q94A 5KSAD 2HN7A 4S2SA 1KCSL 5DJ6B 3DRQA 2B0SL 3D0VB 4TQEH 2OI9C 4I2XA 1P7KA 2BVYA 1LK2A 4KJWD 1JJUA 1TXKA 3JWDC 5K9QI 2XRAL 5EWIH 4EDWH 3H9YA 4Q0XL 1NCAL 1A0QL 4PJEF 3ZSSA 3SKOB 3FB6A 1AFVH 1U58B 4FFWD 1M7XA 4ZUUA 4MJID 2DJSA 1F6FB 4EI6A 3WXWH 1MUJA 4HKJB 1T66C 3R1GL 3KYKH 3VFSA 4I9WE 2D4DA 5GS1A 3LRSA 1Q9WB 5D7IB 1QFHA 1S7VB 5LGKA 4MQ7A 4KY1H 3S98A 1SYSB 4U0QB 1ED3B 4NYLA 1J12A 3BWAA 4HH8A 3FFDB 1MHCB 5FKAB 3QEGH 1JV5B 5DTFB 5BXFB 4QTIH 4CBPA 3OKKA 3ULVH 1DL7H 1ES0B 5KZCB 1NCDH 5GGRB 2X9WA 3G5VA 3QT2A 3QUZD 2YC1B 3T1FB 2GSIA 4HULB 2MOVA 3U30C 5AUMB 4O4YH 5FUOH 1BJ8A 1WZLA 1VFBB 3WN5B 1OTTD 1FJ1A 1N5AB 3EYQD 2OJEB 1A3QA 4OFYA 4OFDA 3IF1B 5FYKD 3QDJE 3LKQB 4D3CH 1VGKA 2D9QB 1VESA 3ERYA 4H20L 4U1HA 5I76B 1QSFE 3TP4A 1LVEA 2PXYC 3DV6A 3T65A 3L5WA 1FVEA 3TYGH 4Y5XB 4AT6A 4LLYB 1RUML 2NY2B 3GHEH 3HUJE 3MUGA 4MAYC 4ZUWB 5CJOH 1NUFA 1U42A 5EIIB 5A16B 5ETUB 2BHZA 1XF5A 1G0XA 3MROA 5BS0E 3UTSB 4XMLL 1VHPA 5E8PB 4NJAL 5KAQF 4IMLB 3NABH 1ZANH 4FTVB 1JE6A 5IW1B 5FDWB 3O2WH 3LY6A 4KJQC 1MFEH 1H3UA 2DQEH 3CFKA 3NIDE 2VL5B 4I2XE 1SVZA 1L4IA 3PIQA 2X70A 4NKQB 3G5ZA 1K2DA 2P24B 1CL7H 4TUOB 3W39B 1IGJB 1EHAA 3HZMB 4OGYH 3CVIH 3O3EA 4CU8A 2VERN 3L5XL 4W6XB 4EUPH 5HDBF 3KPOA 4OCWH 2DYPD 4HS8L 4N90E 3SJVB 5IJVA 4UOW1 4NT6B 2DKMA 1BMGA 5T1KB 4S1QH 3VFWA 5GSRA 5T1MA 1C5DA 5GS0H 1D5BA 4ODWB 3NZ8A 5F9OH 4PRHD 1NJ9A 2E9JA 2VAJA 4PTUB 1U3ZA 3ARSA 4JRYD 2CK0H 3VWJA 2XWJA 5KZCD 4NQVB 4R4NC 4NO2B 4GUPB 1F00I 1YN6B 1HN1A 3WMSA 2HTKC 35C8H 4M02A 1T83A 3RVUD 1K85A 4RIRA 4JHAH 2X41A 4U0RC 4P2RA 2A77L 3PGDA 1VACA 4CKVX 3VXMB 4MXWL 4WO4D 4ZD3L 1LO5B 4OCYH 3BRFA 4JDVA 1MWAA 1A7RL 5DMJB 3B9VA 5H2BB 4FXKA 4NHUA 4MQSB 4ZFZA 3ARVA 4PJ8C 1PW3A 1QLFA 3WJJC 1P6AB 3NCYS 1NCNA 4LARH 4BSWA 1A6TB 1G9ML 1T1YA 5DUBB 1UM5H 1NBQA 4PB9L 5D7SH 4QRRB 3S37X 1BECA 3CDCA 1ZS8A 4JO2L 3RUGB 1LWRA 5H8DA 3TBTA 3WLWC 4R8WH 4PIRF 2NY2D 3WFDH 3DBXB 3S35X 1GOFA 4MJIA 3J8F7 5TF1L 1T89A 3V6OC 2N1KA 3S4SB 3MJ8A 1IQDB 3U0WH 3DURA 3Q6GL 3S36L 3U7YL 4HUMB 5F89B 4LSVH 3UTSD 4N8CH 3I6LD 3H9SA 1KNOB 5DMIL 1T3FA 2K7PA 2NY5C 1F8TH 3FQXA 4QYOB 5FEBA 4FTVD 2HJLB 5IIEB 1OD9A 1NPUA 4P59H 4M6ML 2MMXA 5CP3H 5HDQH 3BKJH 3B5GA 2O5YH 1BZ9B 3MBXL 4NQTA 2R0LH 2B7DT 3LS4L 4JZJB 2CLVB 4GRWH 1RHHA 4X6FB 5C0JA 1GAFL 2VC2L 4OZIB 4R26L 4X5XB 3QIWB 5GJTH 3U9UB 2NY7L 4YHKL 2VZSA 2R8SH 3LHPH 3BPLB 1ZT4A 3DVGB 2FGWH 5BO1L 3L3HB 4OV5B 1NFDA 2Z4QA 3D2UB 3Q5TA 3BPCA 4G6MH 3WIHH 4CW1A 3WUZA 3ZYIA 1AKJB 3ZHKA 1SJXA 4UAOC 2HTLC 4MAUH 4YIQB 1BFVL 4F7EB 4OZFH 1IJ9A 1FL3A 4YK4B 2X42A 4LSPL 2YSSA 3RIFF 1J8HA 3OPZH 1A3LH 1MPAH 5HHOB 4NM8H 4H0HB 2NLJA 2X44D 4WHYG 4WW2C 4X7CC 4P2RE 2ITCB 4RFNB 3M1BA 3I2CH 3OHXA 5CMAB 1AGCB 1HQRB 2IAMB 1EZVX 1S7WB 4R4FH 1E4WH 2GT9B 1AXIB 2KBGA 4PB0H 1F3RB 2DJUA 1MCQA 4NHUE 3L5HA 3PP4L 3IDIB 4RAHA 3RZCC 3VXMD 3PWUB 3NPZB 4RNRB 4L8DB 3IXAB 1WTLA 2FIKB 2HJKB 3CSBA 1EO8H 3RDTC 4MJIE 4YDKH 4WI4A 1D3CA 3DHJA 1Z3GL 5L2KB 4OIBA 2GK2A 1JNNH 2IADA 5CHNB 4UNUA 4NQXA 3MOBH 3MBEC 5H35A 2E8ZA 1S9WB 2D31A 3H9SE 1X9QA 2GAZA 4XCYB 3CPLB 4CN4A 4Y8AA 3VXRD 4H88H 1FVCB 4TVSa 5K59F 1FRGH 5TE4H 2B39A 5KSAC 2W0FA 3HMWH 2VITA 1YEFL 5D2NC 1S9VA 4HAFA 3VFMB 4D9LH 4PRHA 3EHBD 3TWCL 4AY0A 4WI8A 5E2UH 3HE6B 4W68A 4JRYA 3VJ6B 4LMQE 3GSNL 3MSPA 2ZCHL 4PJXB 2VXTL 2DD8H 1T1XB 3ZYOA 3LDBC 4Y1AB 3IGAA 3W82A 1UG9A 5ITBH 3UJJH 1LEIB 1FHGA 1I3GH 3BW9B 5HGHB 2BVPA 2R1XB 3PL6A 4MSWA 1NFDE 4TOYL 4G3YL 1MCHA 3QFDA 4JY4A 2BOBB 1S78D 4NZTH 4IRSB 4EVNA 4OLEA 2G75B 4MNQA 4QRQA 2PYEB 5CILL 2XZAH 4M1CD 5HVHB 4GG6B 3LKSA 4MZ2A 3GK8H 2FATH 5IBLC 1HYSC 4JM2B 4OZ4A 3U4BL 3MMEB 4L8CA 5J13B 1OAXL 3AMKA 5D1ZA 1J8HE 1OARL 4JDZA 2Z8SA 4I77L 3OF6D 3IFNL 1J11A 4Q74A 3IKKA 1XIWA 3RAJH 1OSZB 2VAAB 4WFHD 1MY5A 3EOTH 5E2VH 1NAML 3QUZC 1OY3B 4Y2DA 5EBMA 5IHUL 1MCBA 2ICWJ 3ISWA 2BSRA 2I07A 5CFHA 2PCPB 3OTTA 3NCFB 4KVCL 3O2VH 1KN2L 1WCBA 3NIGE 4OGZA 5HHOD 3X12B 5D72H 4OJFL 1UEYA 2XN9B 4U6HA 3EYQC 1KEGH 4QCIB 3GEWB 25C8L 3U7AA 3FQNB 5I1GL 1A7NH 2IBZX 4UNVA 2IAMD 1DEEA 1D6EA 2VOTA 1ZVSB 3EDKA 4JFDA 5KVFH 1AGDA 2HG5B 1JI2A 2PTVA 4ISVB 1AHWC 3SDDA 1UXSA 5J11C 1DLHB 3O6KH 2HFEB 3X17A 4XNZB 3CX2A 3QPQD 2C1PB 5BRZA 5C2BL 1BX2A 2C3XA 5A2JH 3F7VA 1AC6A 1G7HA 3PV7A 3WFEL 5KVGL 2EKSA 2EDYA 1ZGLB 2CR6A 1TZHB 4LEXH 4PJAF 5L2KD 1IRAY 4MJ4A 2J6EH 2W07A 8FABA 2UY6A 2ADGA 2YPVL 4FABH 2NY0D 1XCQA 2G2RB 4OD1L 5FUCC 2WWKT 1DQQA 5FCUL 4BZ2L 2ZUXA 4WWKC 3ZE1E 2OQJA 1L9NA 4N5UA 5F6IC 4LOUC 2JB6A 3I50H 2FBJL 3HNVH 1LQSR 5AEAA 2V2WB 3GIZL 5LQBH 1A3RH 4HUVA 2Q6WB 3VXSA 5FA3B 1FBIH 3BE1H 5CEYB 3SY0A 4GW4A 1KBGH 4K3DH 1I8IB 3HE6D 4NNPL 3B2VL 1JGLL 1VFOA 2BVEA 3HZYB 1QSVA 4K3GA 3B3IB 5IB5B 2BVOA 3CSYA 4MNQE 4UINH 3VDCA 1IEHA 4OF7A 4FQXA 2B8OT 3G08A 5EN2B 2R4RL 3MRJA 4PJBB 3SGJC 3HZKA 1XCTB 1FN4B 4XCNB 4MJ2A 4JFEB 2HVJA 1EZVY 3CVHL 4XVJH 1Q0XL 3LQZB 4U1JB 4LLQA 5F7DA 3N06B 3OGOE 3ZE0E 1ZTXL 5CLTA 3ZKMD 1A7QL 2GTZA 4I18B 1CE6B 1U0QA 1T22B 1OAKL 2FH6A 4JVWA 4LGRB 4YHPB 2P8LA 3LIZH 2O5ZL 1X5YA 2IALA 4XWGL 1Q9OA 4JM2D 3FOMB 2HKHH 1XF2A 3ARPA 5CZKA 5ITFA 3MRBA 4UU9B 5FGSA 3NPSB 6FABH 5D4QA 3SOBH 2D7TL 1XH3B 2J3SA 5FYJE 3GMNB 3DUHA 1R6VA 1D5MB 3RVUC 2YR3A 2V5MA 3KWWB 1RUAH 4JFDE 5DUPH 3FQRA 5CJQL 5HVGB 1HZHL 3WN5C 1ZXQA 4JQXC 2GIYA 2IBGA 3QXUA 4M6OL 1I7UB 4WW2F 3RGVB 4A6YA 1MELA 2DI9A 3UC0H 3VGHA 5EOCH 1AI1L 1TVBB 2RIKA 5ANMA 4KAQL 3U82B 1RJZA 4Z78A 4HGWA 2VXSL 1V7NH 4QXGL 5IESL 3Q6FA 4PGZA 2X4OA 5BRZE 4FZEH 4I48A 2P46B 2BHYA 1UKSA 5GGVY 5I71B 3QNZA 3HA0A 5C7XL 5I8CA 2HVKB 4Y5XC 4PRAB 1HNFA 5ACZA 1H9VA 2MCG1 3MXVH 4MA8H 2NY2C 3PWPA 3X13A 4CVXA 1U6AH 5I1EH 4BZ1H 2DQCL 4H8WH 4YFDB 2J88L 2ZOLA 5AZ2L 3RJDA 4ETQA 1C08B 3MODH 1BWMA 3VH8B 3SKNB 2PR4L 2UZIL 1CFSB 5CEZL 4X6CF 3WIIH 1PY9A 3ZE2F 3FT4B 4P3WA 3VXSE 3WNMA 3QEHA 1MEXH 2V9QA 2WUBH 5JR1H 4KI5E 1HHHB 3IU4L 4OV6F 1YJDC 3CMOL 4LCCB 1X5XA 4WJ5A 4XRCB 5HJ3A 4XPTL 3AS0A 3CH1B 1DQMH 1K4DB 5DF0A 4LNRA 1I3UA 3CXHJ 1RULL 1H3XA 1YUHB 1X5GA 2ADIA 1YC8A 4LSQH 1MHEB 4S1DD 1KJ2A 1J18A 3MA7A 2EKJA 3GRWH 4I8DA 5CP7B 5DJ0B 2IBZY 1QBMH 4HIIA 5FHAL 5DJCB 5KJRH 3P77A 2F53B 4YHLL 3QWQB 1DZBA 4L3EA 3EZJB 4NRXB 4BFGA 5CGMA 4Q6IB 4WUKH 4EI5D 5BV7B 1KPUB 1QBAA 5CBEA 5SX4H 5F3BA 4HQQH 1BVLA 1E6OL 4U1MB 1CFVL 3G6JB 2AJVL 5D1QB 4BJLA 3HMXA 1I8LC 1A64A 2AQ2A 4OM0L 4DEPB 3C9NB 2E5EA 5HD8D 1S7TB 2DQHL 5JPMA 3IETB 2EXWD 2DQIL 3PUCA 4XVSL 4U1LA 1UZ6F 5ANME 4D8PA 2VXVL 4R90H 5IB4A 1FNGB 4P9MH 1INDH 3GSRB 1T21A 3TC9A 4UI2A 3PHOB 4WHTB 3RGVD 4MA7L 1G7IA 4L1DA 1RUKH 5BZDB 4OZGA 3SHSA 4KXZI 2VQ1A 1H0DB 1QFWI 3PWPE 4LKCA 2CJUH 2C7UA 3RVTD 3NIFE 3TH2T 1IT9L 3IS0X 1BVKA 1B0WA 5E8EA 5IHBA 1UB5B 4MJ6A 2BK8A 5I18H 4G8GB 4DZBB 2OK0H 1UWXH 4YWGH 2Z35A 4K23L 4OBRA 3T4AA 4OD3H 2F58H 1DN0A 1RIUH 1DUYA 1KT2A 3CIQA 3GM8A 2E8YA 3EHBC 3TNMB 1VFAB 3OL2A 3DUSB 4MQTB 1ZLUK 5H37H 5I1JH 1I8MA 2DMBA 1F42A 1F2QA 1NANH 4NM4L 4MA3B 1A4JB 2HJFA 4JFYA 3QZWB 1IGCH 3H3KA 3QHFH 5K9JH 5JORA 1SJHB 2AJXL 5DHVH 4HIEA 5LWYH 1YEEL 1S78C 5DD0H 3QAZB 5LGHL 1C5CH 2IGFH 4PS4L 3VA6A 1X3DA 2DDQH 2ZJSL 4AENA 4ZO7A 1MLBA 5E5RB 5CLWA 1WIOA 3BPLC 4HIHB 3WUWG 3O9WB 4L3EE 1FLRH 1LEKB 4EBQH 3QUMA 3I6KB 3M45A 3PHSA 1HHJB 1TJHH 4XC1L 2V2TA 4YHNA 2APFA 5JPNB 2E7BA 1JGDA 4J6RL 1JZ4A 1I7RB 4OFIA 1MCJA 3CFJA 3BD5A 5JHDD 2DLTA 1U8MA 4R4BB 1IC4L 1QKZL 2CXKA 5FHBH 5M94B 2J8HA 5D7IF 3RWHB 3LV3A 3PDOA 1FZMA 4C56A 4P2QD 5F96L 3V5HA 1R24A 3OAZH 2AJ3B 4LFHD 1DBAH 5D1QD 1ZLWK 4GRMA 2E9WA 3CZFB 1WT5C 1CDUA 2CR3A 4RFNC 1RVFL 43CAA 5CJBA 2EZ0D 3ILPB 5F88A 3ZDXE 1C12A 2IAMC 2X4RA 3DNKA 4M61A 2ZUVA 4OZGE 3S88L 5I1HH 4YGVB 3MGTB 2JJTC 3MV01 1NGXB 4K94H 5C3LD 2FX8H 4OGXH 1WEJL 3KPNA 5BZWB 1FG2B 1RZ8A 4RGNE 3SDYH 2ESVB 3QPQC 4FNLL 2AABL 5MHSE 1RJCA 2CKNA 3P9LB 3UTPE 2P49B 4LFHG 1PFCA 3HAEA 2APBA 2D03L 1GJIA 1X6LA 1U8HA 4RFOH 3RWGB 1JGUH 2L7UA 4ESKA 4UQ3A 1GHFL 2NY0C 1ITBB 1SJEA 2A74A 2GUOB 1U8OB 2OJZH 2YRPA 5IFAH 5I8EA 2CRYA 4G8GD 5IOPB 1HKLL 4OCMC 5K33A 4IOIA 1QLRB 2BSSA 1R3JB 5H94A 3SDCB 4B5EA 4F2MB 5SV4A 2YZ1A 3HE6C 4KJYB 2Z93B 3VXOB 5B39B 3CDGB 3JWDL 1DLFL 4YJZL 3QUKA 3H3PL 4U1SB 1F02I 1YY9D 5IB3A 3ARWA 1YN7A 3PG2A 4UT7H 1A6WH 2GY5A 3VFUA 3BQUB 4IRSC 3JTCA 3VD7A 4DAGH 1D9KB 3C2AH 1GGBL 4NFCA 1UJTA 2BHUA 1FNEB 3P9WB 1ZOXA 3OB8A 5ALBL 2NW2B 4P4KA 5CINL 3CDFA 2FYYA 4JM2C 1AIFB 5J13C 1I8KB 2EYTB 2WIIB 4G6AD 4PJ5B 5BW7A 5ACLA 3H9ZA 1T4KA 2DLIA 3NZHH 4H25A 4C56E 1C5BH 3L1OH 1W0VA 2UYLB 1KPRA 1QSZA 4PY8J 1KIPA 4KQ3H 2ICES 5C09D 5KG9A 1HILB 1N2RA 2PO6A 1KCSH 2B0SH 3KDMB 2WINB 4LCIL 5BCAA 3TNNB 3NCEB 4J4PA 4L4VD 4GAYB 3RI5F 2XRAH 3I3DA 4R0LB 4Q0XH 1NCAH 1A0QH 1Z2KA 3KYMB 3WUWA 3MUZ1 1PGRB 1RSFA 3OJMB 2BCKA 4ZO9A 3MRQA 3O6FB 2OYPA 4Q58C 3QRGL 1S5HB 3R1GH 2OSLA 2XICA 4BSVA 3K8MA 4R7NB 1KEML 4XNZC 2ESVD 3ECBA 4P46D 4N0CA 1D5IH 5GS3A 4NQSA 4XP1L 4XPFL 3GSWA 1EGJA 2CMRL 1INQA 1RUQL 3X3GL 1ONQB 2R0ZH 2YEZA 1CXKA 1RZ7L 3MV7B 3MPCA 3OGCB 3GJFK 2CLZA 2BNRB 5A2KH 1VGEL 1CIDA 2MQ0A 3EOAB 3N1QC 5DQ9B 4JANB 2WMPA 1U3YA 3UCRA 4ZFOL 3IDNA 4YO0B 1L0XA 3FL7A 4OQ1A 5FO9B 5JHDA 4PJCB 5C0DA 2NQCA 4LKXA 4U05A 3ULSB 1XR9A 2D7PA 3O3BA 4P2QA 4BH8B 4H20H 3BDXA 4TNWK 2A83B 4PGEA 4MCYB 4NOBA 5DYOA 5TGBA 4R2GB 3X11A 5EU4B 2FJFA 4H1LA 3L3JB 1B88A 2X10A 4CDHA 5E1HB 1RUMH 1VEOA 1GGIL 1HQ4A 2FNBA 1FO0B 1Z0MA 4WUUB 1PYWB 2E27L 5DI8B 1FFPB 4Z8FH 3V7AE 1D9KD 3UO1H 4AEIL 2FO1A 1FG9C 2X9YA 2JE8A 3VFTA 5KTEH 4OZIF 4PREB 1KCUH 4I18C 4F8TA 4QY8A 4GJTB 3IJHA 4NJAH 2VLJD 1CGWA 2JIXB 3AY4C 2R23B 1IEAA 3ROLA 3EFFA 1FFOB 2O93L 4JJ5B 1IL1A 1KB5A 3NPSC 5HD8C 1QRKA 2YHGA 4P5TB 2XTJE 3MRKA 2EXWC 3JTSA 3FFCA 1EDQA 3WIFA 3AC0A 3VDBA 5JXAL 5HYJB 2VO5A 2X4UA 5HDLA 5HVFB 3CFDA 1QZ1A 2EDQA 5GGSY 3SDAB 4XB8A 1JVKA 1ORSA 3GB7A 3DO7A 1UQSA 3RGVC 1QRNB 3L5XH 4AL8L 3BPOB 4RMQA 1IBGL 2EIZB 3CD4A 4HW6A 3MJ9A 4Y4HD 4ODXB 5IF0B 2VABB 4HS8H 3V5KB 4XNUL 5JIKA 4U7SA 2Q7YB 4GKSA 3RVTC 5I71C 1M7IA 3T0EB 1SYVB 4PRNA 5J6GB 4LEOB 1BQHB 3JWOC 3GMPA 3NN8A 1R5WB 1ULVA 3GSVB 3BO8B 5FOBB 1EFXA 2Y36H 3CFIC 4YBHA 2QSCL 4ACPA 4N5EA 2NXYB 3MV7D 1E27B 4G42A 4X6DB 1U8PA 5JHDE 2NY5L 3D9AL 1U92A 5EU6D 3GMOB 3ZKND 1SEBB 2XPGB 3MXWL 4MX7A 3QNXA 4F7CB 5B3NA 4CAGA 3BGAA 2AW2A 2A77H 5AD0A 4CJ1A 1UVQB 5EIQA 2G5RA 4ZD3H 4LCCC 4JPIB 5C09A 4OCXL 1A7RH 5MERB 2CGRH 4J3OC 3SCMA 5K93A 2ZUTA 1G9MH 3GO1L 4L4VA 4HUNB 1TLKA 4PJXF 1QFWL 4M03A 4R2GD 3FN0H 4JO2H 2GEEA 4ENED 3I3EA 4ONGH 1ZHBA 4NNXB 1RURL 5DRNA 3AREA 3TPUB 1KG0B 3KJ4B 1P53A 5SWZD 5TF1H 2X7LB 4WUUD 5C0IB 3CCHB 4ODHL 3SPVA 3S36H 3E6FA 3KPQA 5DVKA 3QB7C 2BVTA 5F6HJ 2CH8A 3QO0A 5FGBA 4GG6F 5BV7C 1RMFL 2GCYA 1KGCE 5DMIH 2JIXD 3VGAB 3FFCE 3ZLQC 4Z76A 4JM2F 3BX7C 3RVXD 2Y06H 3VXPB 4BQ9A 5D1QC 3RIAK 3ZT7A 3PWNB 5I1LB 4Y0GA 2YD5A 3MBXH 5IMMB 4RAUB 2EZ0C 3S5LA 4GAGL 5EUOB 3P9MB 5K9OB 5J1AB 4RWYL 1HI6B 4FQ2L 1UENA 2MTPA 3GSOA 3RWIB 5HHPB 5HYJD 3UROR 5I16B 1GAFH 1P7QA 1T6VN 2IJ0C 2VC2H 4R26H 4UTBL 1U91A 4QOKB 1MVFA 4YHKH 4ONHA 3BP7A 3VRIA 3MNWB 1DQJB 3I9GL 1YECL 5C08B 3ME0A 3FTGA 4K9EL 1XR8B 1J05B 4HBCL 1FPTH 4PJ8A 3WJJA 1BFVH 4P9HC 3WLBA 3BOVA 2QTEA 2EXYD 4LSPH 3VFRA 2NX5B 4GRLB 3T0ED 2F54D 1DBML 2ICWB 4N0YL 5GGTA 3TVMD 3H0TB 4LDLB 1S7RA 1P1ZA 4WCYL 2VISB 4BA8A 1ZEAL 4G7VL 3HKFA 4O2CB 4GXVH 4P5KA 3RL1A 4E5XA 4NZRL 1QFWM 1MWAL 2R0KL 2R2EB 2VLJA 5T5NG 2VN7A 1TZGL 3OXRB 2GQHA 2RR3A 4UIMB 3PP4H 4PLKC 1J1OL 3HI1A 4U1KB 4HS3B 5FO8B 1A9BA 1YY9C 5DSCA 1KIQB 3I3BA 3QAZC 4EEEA 1MRCL 3BD3A 1F4WL 1Y6KR 1AQDB 5FM5O 4X9GA 3U0PB 1BLNA 1P4BL 4V3EB 2NTFA 3PQYA 5DUML 2GKIA 1Z3GH 4MNGA 1ZA3A 1WTGT 5CS7A 1JWSB 5JQHC 4G6AC 3RWDB 1PG7L 4PJBF 4HWZA 4D2NA 2H32B 4O2FB 1WAAA 2UZXB 5FGCB 4J12A 3MZGB 1XF4A 2ENYA 2AV7A 5CIPA 2YXMA 4KDWA 5I1DA 1WGOA 1XGTA 1HOCA 5HY9B 1YEFH 4L9LB 4DN4L 3TWCH 1M71A 2BFVL 2OTWA 3A67L 3GSNH 4LVEA 2I5YL 2VXTH 4WW2A 3AU1B 3IJSB 5TFSL 5CCKL 4Y4FB 5FYKL 2WIMA 4TOYH 4G3YH 1ZHLB 3L6FB 3MGOA 1G9NL 4N0FA 5CILH 3TBSB 3FKUS 3OR7B 3U4BH 3OKMB 3O6LL 1OAXH 1TVHB 3BUTA 3VXTA 1OARH 4RMUA 2Z8VC 1DVFA 1CDJA 3IFNH 4HT1L 3AB0B 4MDJA 4NSKA 2D0GA 1NAMH 1QTYT 1KTDA 4OTXH 2NX5D 3L5JA 2D7MA 4GRLD 3FB5B 5JNYA 4HLJA 1KN2H 4YDJA 1S9KC 3L3OA 4ZAKB 1DDHB 4G80B 3TJHA 5AG9A 2EE2A 2AGJL 4YXHL 1EVTC 2QR0B 4NWUL 25C8H 3BZ4B 4A6YH 5EC1B 4MXVF 3MGAA 1PX3A 2VSCA 3LN9A 5L7XL 5I30L 1G6RB 3ARQA 2YA2A 2XKSA 4PG9B 4Z7UB 4D94A 4YAQB 4JLRA 5D2LA 4XNXH 1R0AL 1FNAA 4PV8A 4QRSA 1DR9A 3PQYE 4MNGE 3RY6C 4F7PA 4MWFA 5C2BH 2R39A 5IKCA 3UP1A 1D9KC 4S1RL 4FOMA 3WFEH 5KVGH 1RK0B 1WAAE 2JF1A 3BESR 2IQ9L 2NR6D 3VMNA 3DGGA 1NGPL 3HR5B 1GC1C 2V5YA 5F7EL 4WFED 5FCUH 1CVSC 3QFJA 2R15A 1XMWA 2H9GA 3BHBB 4MYWB 5F70A 3OG4B 4MD0B 2FBJH 5JW4M 2DWDA 3GIZH 1A1OB 2VZ1A 5LAXB 2F54A 4CVZA 2X05A 4UV7L 4HC1L 3L9RB 4QXTA 1IM3A 1T5XA 1D5ZB 1FV1A 1JGLH 1V5JA 3BUYB 2Z31B 1J1PL 5T3XE 2M1KA 2Y23A 3G6JF 3QXWA 4PBWD 3IAPA 4R0LC 3W9EB 1OPGL 2R4RH 1TCRB 5MENB 4X4XB 4Y4HC 4LLWB 3DX9B 4J1UA 1L0YA 4L3AA 4Y4FD 4PLJD 1RZIA 1X5ZA 3DTXA 3O6FC 2CRZA 2UVEA 2F15A 1VENA 2ZG1A 3CVHH 4WEBL 4Z77B 1Q0XH 3GHBL 5ICXA 3FOLA 5T5FL 5C0CD 1N8ZB 1A7QH 2H26A 1OAKH 4IMKA 4JQIL 4OLVL 4XWGH 1QPXA 3QEUB 2A1WL 4JFQB 4L3CB 2HP4A 5JW5A 3KNBA 5JXED 4JVPA 3QP3A 2ED8A 5JOFB 1A7PL 3RY5A 3C5ZB 4LLVA 3RTQA 1HSAB 4JO4L 32C2B 2JCCA 3B9DA 3ZKNC 3JUYA 5C07A 1P7HL 5HBBA 4F37F 1DTUA 1VEMA 4ZAKD 4XNMA 5CD3A 4L4TE 4PGDB 1HZHH 4KKNA 1F3DJ 3PABB 3EO0B 5D2LE 3IDJA 3WS6C 1OGTA 4J3UA 3AM8C 1UH4A 3D69A 4M6OH 1YJDL 3VXQB 1KYOJ 1AI1H 3C6LB 1JYXA 2GJJA 4KAQH 2D7QA 3AXLA 5GQBA 2VXSH 5DJ6A 5HDOA 4QXGH 3PP3H 5IESH 1BGXL 2AJYL 4NCC1 5I66B 1FE8L 3SE8H 1W72B 5HI4D 4R2GC 4KTDH 5IFHL 2APVA 4ENEC 2DLFL 3GMLA 1U58A 1FZJB 5A2FA 3P40A 2AXFA 1HHIB 3ABZA 2J88H 3MLYH 5AZ2H 4HKJA 3QFJE 3ZZ1A 2PR4H 2UZIH 2MCPL 3UTZB 1S7VA 2G60L 5CEZH 4WTZG 3T4YB 1SYSA 4QRUA 3RVXC 2IBBA 3QXTA 1MCRA 3MYZA 4X98A 5EZJB 1WC7A 3BI9X 1UJ3B 2FECI 3MNVB 4YXLH 1M7DB 3FHAA 5I9QB 5EO0B 3GSXB 3IU4H 4HBQA 3GMMB 5GGRA 2RFXB 3CMOH 2YC1A 1A2YA 2XACC 5B38G 4XPTH 3P4MA 4JG1L 3ZO0A 3QG7L 5AUMA 2VDPL 4M4RA 3IKCA 4QT5B 4KWUA 1SVCP 4ELKB 3C5JA 5E5MA 3SDAC 2Z31D 1F90H 4XP4L 1N5AA 1QFOA 4HEPG 3BPOC 4E0RB 3MV8B 5MEND 3CUPB 5F9JB 3WO4C 4B53A 4AG4L 4YHML 2RQ8A 2AJUL 1G7QB 1HHKA 5DJ8A 2GHWB 1NFIB 4YHLH 3T08A 5I76A 3ROOB 2JJUA 4TULL 1H8NA 3DX8B 3HB3D 4ZPTA 1VEPA 2AKRB 1E4XI 3T0EC 1K6QH 5E24E 1I3VA 4JCMA 2X4NB 3TVMC 4P5MB 4HMEA 2FHFA 1MJ7L 1UC6A 5I1KL 4ZUWA 2JCCE 1E6OH 5C07E 1CFVH 5J56B 2AJVH 3FCTB 5L8LB 2WBKA 5DFTA 1KPVB 4OM0H 5JO5B 3DX6B 2NXYC 4NO0B 1YA5A 3LQAC 5E00B 2DQIH 4IMLA 3UZQA 4XVSH 2G9HA 4JAMA 2GJ6A 5FDWA 1A21A 2VXVH 1JP5A 4F57L 2I26N 4YUEL 2Q8BL 3BEWA 3KS0J 4Q9RL 3MCLL 1CLZL 4MA7H 4MB5A 1BD2B 1TMCA 1IGJA 2M2DA 1NBYA 4ODVL 2W92A 5HVWA 4L9DA 4KPHL 3QBTB 3H9HB 1MF2L 2F5AL 1KIRA 4FQ1L 1T04B 4MD4B 4YEFA 2AK1L 2X89A 3QXVA 5IMLA 1CD0A 5FYKU 2WAHA 3CK0L 4CVWA 2DI7A 5L2JB 1IT9H 4F7MA 1TJIL 4OCSL 2AI0L 4MDIB 3SJVA 5HYSB 1X5HA 2WM0A 4NT6A 3FO2B 5T1KA 4K23H 2WW8A 3ZYJA 1CK0L 1A5FH 1KTKE 1ZVHA 3ARBD 3BAEL 4ODWA 1IKFL 3VGAC 4D0BB 3FQUA 2EDLA 3TN0B 3G9AB 2J5LB 1KF9B 5I6XB 1GIGL 2BNUA 2BC4B 1B0RB 5FECA 4XB7A 3NCMA 4BKLA 3FO0L 5I15H 5ESQA 4XT1C 1CGYA 2AJXH 3HPLA 1EAPA 4NO2A 3UBXB 1YEEH 4GUPA 5LGHH 1YN6A 5GSVB 1H3PL 3K7UA 2OXHA 5F1SA 3SKMA 4LSDA 3U6RA 1OW0C 4O2EB 5F7YC 1Q1JL 1LO5A 5IQ9A 4AM0B 1RZJC 3MV8D 1L9MA 3LCYA 4WTZA 4XC1H 3SO5A 3GUTA 4HKBA 2KUTA 4ELMA 4LAQH 4S10A 3IFOB 4JZNB 5E5UB 1AGFB 1A6TA 3V6ZB 2EE9A 4J6RH 5DUBA 1YQ2A 4WW1A 5DS8B 3BIAX 4QRRA 5HPMA 4GRLC 3IVKA 4LSSL 4S0UC 3RUGA 2DM2A 1QKZH 3EOBB 3KLAB 4NQCD 4CL7A 5B38A 2LAAA 5CBAB 4HUUA 5DVMA 2GJ6E 3DROA 5MEOB 1OAQH 4DKAA 3T2NL 1WFNA 2VQUA 1RVFH 4V1DA 4NNYA 1JK8A 4UIKL 1MH5A 3DSFH 5JHLH 2MHAA 3KYNB 3S88H 3TH3T 1MCDA 5IIEA 5TJWK 1SHMA 3D18B 3KXFB 1F4HA 4PJFB 2RHEA 3MRNA 3O3DB 3MRCB 4LCWB 4MCZB 4JZJA 3IT8D 1U3HB 1BD2D 4FNLH 2AABH 4ORGA 4U6TA 4NUJA 1UT9A 3SJVE 5LG1A 3QIWA 4O9HL 4HV8B 4YH6A 3JWNC 2VDNL 4NQDB 2D03H 2R69H 3MOAH 4KC3B 3DVGA 3KPSD 2ZWLT 3L3HA 4QNPF 3D2UA 1T2QL 1ORQB 4QHUB 1GHFH 4KGJA 4I13B 5DVOA 2R2CA 3HCVA 1NEZB 2LTQB 4G9DB 2A6KB 4NKIL 1HKLH 4ZUTA 1J0YA 5FM5M 4XP9L 4ZS7H 2VQTA 4L9LC 4N8VB 1MJUL 4RBPH 3ET9F 1OTUD 1K3IA 3IDMB 1V3KA 5DLML 4U3XA 1PBYA 3JWDH 1HINL 1DLFH 4OIAA 3OJDA 4FQPA 2ITCA 4N0UA 4Y4KA 4QHLA 3H3PH 1YEDB 1AGCA 4Y4FC 5HGDB 1S7WA 4PLJC 5E8NA 2P5EA 1JHKL 2KQNA 1BEYH 1I1FB 5EO9B 4ELME 3U2SA 3T3MF 4W4NA 1GGBH 4QLRA 1EX0A 3TA3D 3S34L 1U41A 4LQ1A 4XTRD 4Y16B 1HKFA 4BH7B 3FAWA 1ZK9A 4QRRE 1NCWL 3L3DB 3RUGE 4HEME 5ID1A 3GJFA 3O0RL 3QUYB 4L8DA 4UQ2A 3IXAA 4NUGL 5JXEC 2JKXA 4P57B 4TVPL 5KVDL 4LPTA 4Z0XB 3GZKA 4V1DE 1S9WA 4OF8A 2P45B 4HKZB 4PYHA 2PKDA 4UDTA 4ZAKC 4LCIH 1CE1L 1FL6B 4KROB 1FVCA 3VG0L 4RZCB 3V4VL 3KPTA 3QDGD 3ARBA 5D7JB 4KV5E 5F1KC 1NBZA 3NVQA 3VFMA 1JYNA 4X6DF 1JN6B 2BRRL 4K3EL 1Y0LB 4XVUD 3QRGH 1BQUA 5HI4C 3KXFD 1T1XA 4OZIE 3ZMRA 1CYGA 4Y1AA 5DDHA 5IHZB 1NCBH 1WF5A 1S7XA 1YNKL 3ZDZF 1U3HD 2R1XA 1KB9J 2V7NB 3SKJL 3KLDA 4LASL 4IRSA 1R3IL 5F1OB 1CS6A 3V0VA 4XP1H 3QNYB 2CMRH 2PYEA 1RUQH 3BEVA 3X3GH 5BOPA 1UZ8A 4NQDD 1RZ7H 1BIHA 4IRJB 2PYFB 2C3GA 2ZUWA 2ZCKL 4D9RD 3MMEA 3EDFA 3ZHLA 3WFCL 1VGEH 4XX1G 4XWOD 5JA9A 3NFSL 3C8HA 1N3NA 4TSAL 1XGUA 1X4YA 1JPTL 2VAAA 2IANB 1W0WB 4YEEA 4N0UE 2PF6A 4TSCH 5IEKB 2WUCL 1ZAGA 4LPUA 2XOTA 2P5EE 4XAWL 5C0AB 3X12A 3CLEL 4G8FB 5EU7C 3GNML 2Z31C 3DIFB 2XN9A 1U8KB 4PRDA 2R2BB 3INUL 3K80A 4KKCD 5EFIA 5GGSA 5BMFL 1U2CA 2DQFA 3MLTA 5EUOF 1R3LA 4LIQL 3P73B 1GGIH 1OP3H 5D9SB 2E27H 3REWB 3SBWA 4AEIH 5E4EB 3BKCH 3SO3B 3KYOA 2I9LB 3B9KA 3HNTL 3VGGA 2CXGA 4N8VG 4WRLA 4DQOL 3JWOL 2C1PA 5DO2D 1MCKA 4J3XA 3GFUA 4D0DB 3VD3A 2I60L 2CQVA 4LVNB 1TZHA 3C5ZC 3QCTL 3PV6B 1X5IA 4X8JA 4P3CH 3OKDB 2FECL 4F33B 5JXAH 1J0IA 1CR9L 3VD5A 5FYLD 5IWLA 5B3JF 4KROD 4PGBB 1UKQA 3AS1A 4MVBD 3OKLB 4Y1AE 2V2WA 1IBGH 5C6TL 1FL5B 3C6LC 2Q6WA 3ETBF 1EO7A 3ULVD 1MQKL 3K3QA 1IC5L 3PWVA 5JOPE 3B3IA 3FAXA 1BBDL 1MLCB 4D0CA 3QIUD 2PYEE 1WK0A 1XEDA 4K7PL 5EN2A 1L7TL 5GISL 4TSBL 3LPGA 3TGXA 2J8UB 5GGTH 4L29B 5JA8B 1K5NB 4XCNA 4JFEA 4HK0B 4OKVB 1E4XL 2A73A 3Q1SH 3QCUL 1VADA 2QSCH 1MOEA 4OI7A 4GKZA 4I18A 1UWXK 1CFNA 3RL2B 1KCVH 5BV7L 3U0TB 4HUXA 4HIJA 2NY5H 3D9AH 4H26A 1QA9A 3MXWH 3LKRA 2FSEB 4NKOA 3UDWA 5IROA 1UJ3C 4G9FB 1AQKL 2WBJA 3OR6B 5DEGB 1RAMA 2H8PB 5I9QC 5I75B 2XN9E 2IAND 3QQNA 3L3IA 5L0QB 1JZ2A 4RGOL 3GMNA 2F5BL 4CNIB 4OCXH 2V9RA 2W60A 5BQ7A 4G6KL 2LU3A 2YBRB 1CF8L 5C0AD 5FF6A 2BY1A 2OMBA 4KXZH 4PY7B 1QFWH 1XGYL 1TVBA 2XZQL 3RWFA 4XXDB 4PD4K 4ZTPL 3RWCA 4B50A 5T1LD 4Y7MA 3RWEA 1MFNA 2Y7QA 3ZDYE 3REVA 1XF3A 5IVOA 2IPTL 2EYSB 4XBPB 2VXQH 4FS0A 4P9HL 3EW3B 2EH8L 3P11L 4TVPE 2ADJB 1ZHKB 4LPXA 4HDIA 1RMFH 4XBEL 2Y5EA 2Y72A 4HJGB 3HE7B 1BIIB 4TRPH 5LGJB 5KS9A 4ZUSA 1C08A 4GH7B 2QJDA 4GAGH 5HHXL 1E6JH 3OAZK 1SBBA 1AC0A 4N68A 2ED7A 4XCEB 4RWYH 3I02B 5F7WC 4FQ2H 3FT4A 5F9DC 5JZ7D 1F11B 5F7NC 4FXGB 5GS0D 3O41A 4RGMB 4UTBH 1YY8A 3EOYG 1PG7W 1G7PB 3LN5B 4M7LL 1WWBX 1ZSDB 3I9GH 4EN3B 1YECH 3TBYA 3CH1A 4X9BA 1DQTA 4AEHL 3U1SL 5CAYB 5IMKA 4DGVL 4HBCH 4EUPG 4K55A 4JFEE 3VXUA 3T0XA 1JZ6A 1YUHA 3VE0B 4JO1L 3CU7A 4TPRH 5LVEA 2X4QB 1DBMH 4N0YH 5GRZA 4U6YB 1RJLA 3O6ML 1U8QA 5DJ0A 4PJHF 1EHNA 1FC1A 2F53A 4WCYH 3S8WA 2ICWI 4G7VH 4LLUB 1HIMH 2YK1L 3QUXD 4NZRH 3O2DL 1H5BB 2Q3AA 4OUUA 3MRGA 3TFKD 3PGFL 4G8EA 4Q6IA 2R0KH 4HS6B 4XCCL 4KMTL 2AXGB 1OTUC 3TN0C 5JDSA 1PQZA 5EC2A 1I4FB 1TZGH 5I6XC 3MJ7A 3VCLB 1J1OH 4G9FD 2YZ8A 3BDYL 1P4LB 4LCYB 1G7LB 2APTA 1QSEA 1YNTB 1CT8B 2ZG3A 3IETA 4Y5YB 4POZD 5HHMB 5INCA 5T33L 1MRCH 1F4WH 2VR9A 4WGVB 4U4BA 3MC0A 4P2OB 2A6DA 4LCUA 1EVUA 1P4BH 5GHWL 2CDGA 1MI5A 5DUMH 3TA3C 4XX1E 4XTRC 3HPJB 2Q3ZA 5DD1L 3KAAA 1GGCL 2YUWA 1PG7H 5HSFA 1H0DA 4YBLB 3QA3A 1UM4L 4JY6A 2ZUQB 3BXNB 5MI0B 1HXMB 3VFVB 4WY7H 4P3DB 1JGEB 1OD7A 4MXVE 2Y9RT 3SN6N 4JFFD 4FQJH 1CICA 4DN4H 5A40E 2BFVH 3A67H 2I5YH 3S36X 5D7LA 4HGKC 1EBAA 5IBTH 1OAZL 1P69B 4HJ0D 5CCKH 3N0PB 3N1FC 3TNMA 5FYKH 1JUFA 5CJXA 5JDJA 3ZTNL 4XVUC 1A4JA 4HUWB 3QZWA 3VXUE 1YZZA 5E94B 5C6WH 2LU7A 4K2UL 1D5XB 1RIHH 4AIXA 2XQBL 1U3HC 3B8SA 1FQ9C 4EN3D 1T7VA 2WP3T 1NMCB 2W0LA 1P2CB 4HT1H 1NLBL 2F53E 5K9KA 3O9WA 4Y5VB 3EJYD 5HYQA 4FFYL 1GC1L 4OZFG 1HHJA 3UTQA 3HRZB 5T1LA 5EBWA 1I9RL 4XWOC 2AV1B 5JPNA 2LTQC 5D71L 2NY3B 4DCQB 4YXHH 3BFOA 3SDXA 1JMXA 1DN2A 1OF2B 2EDTA 4TNWF 4R4BA 4MD5A 5L7XH 2ERJB 1QSEE 3BVNB 3RWHA 3MR9A 4JKPL 3O8XA 1LO0L 4EUPA 1VKXA 3MRMB 1R0AH 3ARFD 3BWUC 1LP9A 1A6ZB 1MI5E 4LRIA 1JL8A 3ILPA 1T0MA 1CFQA 2AJSL 4GW5B 4NIKB 4JREB 3ZYZA 4GQ9L 3HG1B 5FKPA 4YGVA 3MGTA 4S1RH 4PGCA 1NGXA 4QRPB 1IGIL 4G7YL 2IQ9H 3R8BB 1K8DB 1CD1B 1EMTL 3E1F1 1WBXB 4Y16C 1CGTA 5DO2C 5C3TA 1NGPH 2EE3A 3PJSB 4G8IB 5F7EH 3JV4A 1BOYA 2O61B 3QJFB 1BQLL 1DFBL 3PNWB 1S3KL 5HGBB 5AZEL 3FN3A 1QNZH 2QKIB 4H0IA 5D7LE 3TPKA 2I27N 5F3HB 4UV7H 3MRDA 4HC1H 2QADB 3EGSB 4KROC 2X4SA 4P23A 1J1PH 3GI8L 4GW1A 2MKWA 4D9QD 4MVBC 1XGPA 1S7QB 5BVJB 1LE5B 1R3JA 3SDCA 4PR5B 1P84K 3GBML 1IAKB 2VZOA 6CGTA 12E8L 3N1MC 4KJYA 2Z93A 1OCWL 3IXTA 3UPRA 4WEBH 2EIBA 4BK5A 3KPMA 5T5FH 5I2IB 1A6AB 1AD9B 3GIVA 4OT1L 4B7IA 4JQIH 1N59B 1BJ1J 2A1WH 5E7FA 3BQUA 1FGVL 4NRZB 5DK3A 4KZDL 4JG0L 2Z91A 2DF3A 5HXMA 2CLRB 2GY7B 4P99A 4IRJC 1A7PH 1FNEA 5KANG 2NW2A 3SDXE 2HWZL 2WLYA 3LKNA 4JO4H 4IOFC 2WIIA 4PJ5A 1TNNA 5CP3A 4WU5A 5DA4A 1A1NB 3ULUD 4WU7A 3I75B 2UYLA 3TT3L 2NNAB 1QBBA 5E9DA 1LP9E 1YJDH 2EDOA 4ODUB 1ZKAA 3IDGB 1AP2B 4UOW0 4UILL 3RBGA 4Z6AT 1NKOA 4DVBB 2FGZA 3V8OA 4C83B 4F3FA 1BGXH 2D9CA 1FE8H 1JCKA 3E2HA 4M3KB 2E7LC 2AQ1A 5C0FB 5DK0B 4GAYA 3QDMA 4POYA 3M17B 3ZT5A 5IFHH 3WIHA 3O6FA 5DJYB 2D4FA 4Q6YA 4XC3L 4ZO6A 3HG1D 1KLGA 5E4EC 4UUJB 2YD1A 1KXTB 4QRPD 3I84A 4R7NA 2FX7L 4FQQA 5GPRA 3E8UH 1A4KB 3RIAF 4BSJA 1S8DB 3U46B 2OI9B 4WFGD 3A0OA 3BKYL 2QQQA 4YDLB 3RWJB 4R3SB 1ETZA 3UTTA 1JF1A 3V4PL 4LVNC 2IPKA 1ONQA 3P2TA 2ICEB 3OGCA 4NKDA 5FUZL 3LQAL 4DOHB 3O45A 5DC0A 1MFAH 1F4XL 2BNRA 2QQKL 5JZ7C 3RU8L 3BZEB 1MHPH 4JG1H 3QG7H 1MCPH 2VDPH 5E6YA 4KKLC 2R9HC 2HFFA 1LO3H 4DKEH 5ID0A 4XP4H 4QRTB 3AM8A 4PJCA 1ZLSL 4YHMH 2AJUH 3O3AB 3W0WB 4XAKE 3V5DB 1LNUB 1XFPA 5F8QC 4YPGB 3JV5A 4TULH 2BVQB 2C3VA 4PJFF 1RY7B 1MJJB 2HT2C 4L8SB 2XTLA 3P0YL 4FQCL 4M48L 5I1KH 3L95B 1FO0A 5JIIA 4PJ5E 1AO7D 5DD6B 2VLME 4PREA 3TBVB 3TFKC 3MV9A 5A2LH 2I25N 4GRWE 1WWCA 2OCFD 2V7HB 1TQCB 3O4LB 5E9DE 4W70A 3DMMA 5DEZA 1EEYA 3QPXH 4N0RA 4QXUH 1EIBA 4XVTL 4F57H 4JJ5A 3D5OF 3E3QC 3FB8B 3KG5A 4MMZC 5I75C 1IM9D 4Q9RH 3MCLH 1CLZH 4P5TA 3VI4F 5L0QC 3QDME 5CSBA 4POZC 5BJTB 4ODVH 5EO1B 4JFPA 1DQLH 2J1KA 1T2JA 4KPHH 1MF2H 2F5AH 4FQ1H 5E4IA 3SDAA 4PJIA 5SWQA 3KPRB 3RX8A 4YC2C 3CK0H 3F7YB 1CDBA 2KDGA 1RZJL 2YN5A 1MRFL 4OCSH 2AI0H 3V5KA 3C60D 3QO1B 4RQQB 4ZFOB 2OP4L 3SQOH 3TYFB 1BQSA 4LHUB 4IBLT 3UTTE 3DX7A 3BP4B 4FMFA 3QDJB 3BAEH 1G7MA 1QSFB 2WWMD 3MUY1 4NQED 1IKFH 3PGCA 4GKNB 4Z7NF 3R8QA 3HE7C 3RHWF 1R5WA 2BNRE 1WFTA 1CG9B 3EAKA 5J12B 3EJZD 1GIGH 1HDMB 3TIEB 5KSBA 2CKBB 3HUJB 4TNVK 4X4YA 1CXFA 4KTYA 1BF2A 2J8OA 4HJ0C 3FO0H 1E27A 2NW3B 3NAAL 1J1XL 2VDQL 1I1AB 1I7ZA 2AK4A 4HK3J 4PJCE 3DVFA 5IBUG 3GGWA 3GMOA 5IW6A 1H3PH 1Q94B 1KCLA 4GFTB 4RGMC 4YHIA 3UBXI 4BZYA 3DRQB 1BP3B 2HRPL 1Q1JH 4I2XB 1P7KB 4EN3C 5T3ZD 1LK2B 1GYAA 4M43L 2OL3L 4WNQA 2DKUA 5DJ2A 3FT3A 3TIDA 4RX4A 4X99A 3ARUA 2YRZA 4CGTA 3V4UL 4JQVA 3WNOA 2LU4A 3K2MC 3WL9B 4ZUUB 1A02N 4E41A 1IKNA 3EJYC 3MV9E 1JWMA 4LSSH 1UACL 5C1MB 4NNXA 1MUJB 3VFSB 2B4CC 1ADQA 2COQA 4PY8I 4HX1A 5I0DA 1I1YA 4FZ8L 4MQ7B 5IGXL 3ZL4L 1NAKL 3T2NH 4CDGC 1NMBL 2KZWA 5IG7A 1KFAL 4GS7B 3N9GL 4NYLB 4U3HA 2XA8L 3BWAB 5DK2B 4UIKH 5F8RC 4C58B 3JV6A 4I9WD 1YMMB 3OKKB 4I0PA 3FQTB 3V79C 5DMGD 3VXPA 3PWNA 3T3ME 3ARFC 1XZ0A 2IWGA 2EDEA 4XP5L 4NPYB 3WKML 4PJIE 4U1IA 3P9MA 2EC9U 4LK4A 3VD9A 4Y5YC 4JCLA 3RWIA 5BOZG 2LAGB 1JHTA 2C3WA 4TUJA 3BT2L 4O9HH 4QOKA 4FFVD 2VDNH 2AJZB 4JY5L 3H7BA 4M3JA 5ESVA 3ARGB 1VGKB 1KELH 1T2QH 3Q3GA 5F7LB 1WVZA 4DW2H 2AXHA 1J05A 2DQJL 1MCSA 3DV6B 3T65B 3QH3A 4X7SH 3BD4A 4YBLC 3L5WB 1JIBA 4P4RA 5FK9A 2ZUQC 4LHUD 4PRPA 5MI0C 3K8LA 4NKIH 4AT6B 5KSBE 4HFWA 5LCVH 4NJ9L 1TFHA 4PFEA 1O7VA 3QDHA 3MUGB 4XP9H 4LDOB 1JTPA 1QSFD 4UBDD 1MJUH 3UPCA 2R4SL 2AK4E 1CDCA 3MROB 3MLWH 1EA9C 2VISA 3CX5K 1HINH 2H2PD 1OP5K 1EEQA 3EDJA 3CFKB 4NO5A 1AR1D 4OQTL 1I1AD 1N6VA 1Q9KA 3PIQB 4ODSL 2X70B 5BS0D 3G5ZB 1K2DB 5JUEL 4KJPD 4LHUG 2DS4A 3IDYB 4UIMA 5I17A 3WHXA 1NGYA 2IFFH 2W9DL 2VH5L 4U1KA 2EDBA 5FO8A 3TBWB 4E41E 1NCWH 4XH2A 4OLXL 1NMCC 3O3EB 1VPOL 1QBLL 3O0RH 3TO2A 3MCKB 5E70A 3RVWC 4LQFL 1QO3A 2XI9A 3KPOB 4TVPH 4JPWL 1FIGL 5IJVB 4Y5VC 4KDTC 5FM4A 1OAYH 1JWSA 3MRFA 3VFWB 5GSRB 3VU2A 1C5DB 2YD2A 2H32A 3ULUC 1D5BB 2BJML 3V95A 1CE1H 1MVUA 2NY3C 3VG0H 1NC4A 4N90D 3V4VH 5TF0A 2YA1A 5HY9A 2JJVA 3U4EB 1N0XH 2ERJC 3AGVA 2ZNXA 3VWJB 2BRRH 3RPIB 4K3EH 3MRHA 1KOAA 1PLGL 5TDNA 5EBGA 3MLRL 3PP3K 3W2DL 4QOKE 4LLDA 3GRWA 3IJSA 2W38A 4RIRB 1NGQL 1YNKH 4HWBL 3SE4C 1FIEA 3ILQD 3PGDB 1VACB 5DFWH 3SKJH 4XI5D 1MCCA 4JREC 4LASH 2IPUK 4LLMA 1KIUA 1R3IH 4M5YH 4OFYD 5KSAB 1UXWB 2UWEF 5AYUL 4JDVB 1MWAB 4J23A 4JRXA 3WFHA 1ODAA 4PRPE 4FXKB 2B1HL 3OKYA 4CADA 1LDPL 4ZFZB 2ZCKH 1NDMB 5EOTB 3OKMA 2OTUA 5J6HA 3WDJA 1KSRA 1T1YB 4CMMB 3WFCH 4XNYL 3AMLA 4OD2B 3ZTJG 5B3JE 4HIXH 1DSFL 3QYCA 4OIIL 5EG6C 3TBTB 1JPTH 1AR2A 1FAIL 3MV11 4MJIB 1OGAA 1Q72L 2W91A 3MJ8B 3MO1A 1WJ3A 3DURB 2WUCH 1T0NA 2FLBT 3N85L 4U7MA 2QADC 4XAWH 5D6DA 2D0HA 1XGQB 4G80A 3QHTC 3H9SB 3GNMH 1T3FB 1UWGL 2O26U 2NZ9D 3K2UL 5C0GA 3TZVA 2H3NB 4M6NL 3LZFL 4ONFH 1JPSL 5CJ8A 2IH3A 5BMFH 4IIQA 4XHQA 5IM7A 4LIQH 1R3KA 1G7JA 2YS4A 3ARDA 4Z7UA 1N0LA 5DQJB 5I1AA 1W72L 3HR6A 1RHHB 1BBJA 3HNTH 1ZLVH 2ICCA 1WICA 4GBXA 3MCG1 1IQWL 5GS2D 4DQOH 3JWOH 2P8PA 1SY6L 1ZT4B 5IQ7H 1JPFA 4Y2OA 1NFDB 1RQ5A 1SJVA 2I60H 3BPCB 5FGCE 2VR5A 4NC2B 4AIZA 3QCTH 5CEXB 4KRLB 1I85C 3A6CL 1MAJA 3VXNA 1FL3B 3WSQL 5ERWB 2V5RA 4KZEL 1CR9H 4PJ7A 1RK1A 4NWTL 1TIUA 1J8HB 5DHVA 3LKPA 4MD0A 4LP5A 1TPXB 2NLJB 5C6TH 3RNKA 2BSED 4P2CG 1P4IH 2ARJQ 3VWJD 3C5SA 3M1BB 3OHXB 4XMKL 4U1NB 3STZA 5TDOA 3BUYA 4OM1L 3CNKA 3G5XA 4PG2C 5B21A 1BBDH 2KL6A 4JRXE 3BGMB 5GISH 4TSBH 2IH1A 4ZQKA 4LLWA 1VA9A 3DXAA 4YNYA 1H3TA 4P2RD 4K07A 3DSNA 1UYWL 3VFOA 1JNJA 2J7LA 1E4XH 1WV7T 1Z9LA 3QCUH 3QSKB 4FP8L 4LP4A 3WJLA 2WWMC 1PEZA 5BV7H 1OGAE 5L6YH 4YDLC 3EJZC 2IADB 5EORH 4NQXB 5H35B 4R7DB