4APQA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
290
structure length
290
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
total genus 79
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4apqA01
3SDXF 4JGJA 2Y5TA 1MPAH 4JO3L 4O4YH 4AT6B 1M05B 1N0LA 2BNQA 2NY5L 3VXTA 2V17L 4L8BA 4G3YH 8FABB 1BBDH 1S7TA 4KH2A 4U3CA 2WIMA 3CFDA 1D7FA 2Z92B 1A6AA 4N0FA 4RGND 4S2SA 4XP9H 3UBXG 1KENL 2OR7A 5L2KA 5FO8B 3P9LB 5GS2H 4JB9H 1R3JB 3IKCB 1A14L 4L1HA 1D6VL 1LO0L 1XMWA 4X6FA 4XVTH 2G9HA 1H15A 4WHDA 4AMKH 5L9DH 5E2VH 1KIPA 2DQDL 4OQTL 2GITB 1INQB 4PJCF 3FTGB 4H8WL 5F7FA 5CD3A 4X99B 4WGWB 3VWJB 5DHYA 2OL3A 4WI8A 3S3JA 1MJUL 4XGZB 2YUWA 2YC1B 1FZMA 3WO4C 1ZA6A 2VWEC 2HJKB 4G6FB 4NQCD 5CILH 4L8DB 2X05A 3QHTC 4ODSL 5H37G 4LPVA 3ARVA 1I9JH 3ZE1F 4ZFFA 5E6IA 4CN4A 5GJSL 3OAUH 1HXYB 4IMKA 4H0HB 1BD2B 3D69B 1D5BA 3I75A 1EMTH 2ICEA 3U46B 5DUPL 1FFOA 3K74B 1G7QB 4TUKL 3RWIA 2YS4A 3Q5TA 2XA3A 5LWYL 3B9EA 4HXAL 5FFLA 1BIHA 4PGCB 3F7VA 3LOWA 3LQAH 4JY6B 4XNUH 4GRWE 2F74A 3K8KA 3FFCA 4M6ML 1VKXA 4ACPA 3JUYA 4LEOB 3U36B 5TDOB 4OGXL 3TA3C 3SPVB 1T03L 1CE6B 1M71A 1FGNH 3RVWC 4W6YB 3MNZA 4HX1A 3G9VA 2D3VA 1E4KA 4KKCC 3VMNA 1HHJA 1OAXH 1J0KA 4OLZL 5ICZA 5TPWL 1AC0A 3UTTD 3PWNB 2E9BA 3WIFB 5I19H 4NFBA 2BVEA 5HYJD 2E9WA 4PGDB 2QHRH 3Q5YA 3SDAD 4PJXA 3OJDB 4XPTL 3RIFF 2NY1B 1ZAGA 5D2NB 5IW6A 4P46A 4NQEA 1V7NL 2HTLC 3QO0A 1H3XA 2Q7YA 1A1OA 4XNYH 3SGEH 3EW3B 5TE7L 1VGEH 5A2KH 2ERJC 1X5IA 3FQRA 3LD8C 4N8PA 2YXMA 4FFYL 3H9SB 1UEMA 3WHE1 2P5WD 3OBAA 3X12A 5GS0C 4K7PX 4D0BB 4PJIE 1BVKA 2VYRE 1N3NA 1JWUB 2VOTA 3H0TB 4IHOB 3CGTA 4M7LL 3IXAA 1FG9C 1C08A 3MJ8B 1G9ML 3RY6A 4C4KO 1KLGA 5I0ZA 5H35A 3CVHA 3Q5OA 2HT4C 4HSQA 5AD0A 5EZOH 2HVJB 4Q9QL 4U1LB 4HKXA 4BZ2L 4HLJA 4O2CA 4OFYA 2QKIA 1B0GB 1TMCA 3C2AH 3PG2A 2R2EA 4CKVX 2GJ6D 2EEBA 2N4IA 3GNML 1TJHL 1RUAH 3RTQB 3EOYG 4QRSA 1FZKB 3QDGD 3DYPA 2HYMA 2LVEA 3H8NA 1TZGL 2VKWA 5IK3A 1QFWI 4DVBB 1MJJA 5E8DH 4QGTA 1IM3A 3TYFA 4PJBB 3QDMA 3WBDA 1IGML 4HWBH 4OD2B 4F7MB 4LSVH 2YN3A 3TH3T 5HVHC 5IEKB 1CS6A 5DEGA 3SDYL 4YQXH 4JZNA 2R0WL 4AH2B 3IS1X 4NFDA 4FFVC 2H1PL 4H1LB 4ODBD 1VEMA 2X4QA 4WU5A 2E7CA 4EUPB 5HHMD 5INCA 5LQBH 4PGEA 4BFGA 4J6RL 4LCUA 2YPLB 2EO9A 4OTXH 4Z78B 4QXGL 1QSED 1HQ4B 4OZIB 4ELMF 1UYWL 3BKYH 2B2XH 3OAYH 5LGJA 1NCBL 3BRDA 3V52H 3W11C 4QRUB 3HC3L 2DQFB 3VI4F 4RWHA 3QBTB 3QCUH 1I8IB 4POZD 4GW4B 2XT1B 3HG1B 4K8RH 5D5MF 5J12C 1NGWA 1F8TH 3VGFA 3MCKA 1LEKA 4ZS6D 3MOBH 1CXFA 5IJKC 2CRIA 3QG7H 5GGVH 1RZJC 1UZ8B 3HPJA 1IQWH 2ITCA 2ZCKL 4HC1A 3T2OA 4PP8C 1JZ4A 4Y16D 5JORA 1S9VB 3QNZB 2CMRL 2NNAA 1FSKC 4TTDD 1CL7H 3SEPA 5DS8B 2PNDA 2ZOKA 4LLAA 4UTAL 1GSMA 1I1YA 4HG4K 1QBML 1LEIA 1OB1A 2JB5H 1YJDC 3IU4H 4U6VH 4F8QA 4JG0L 4LCWA 3O2VL 4Y5YA 3IS0X 1IAIM 3DNKA 2Z31A 3RVXC 1I7ZA 1P6FA 4OZHF 2CRMA 5CHNA 2A1WL 4YJZL 5E5RB 2EYSA 1TQBC 3S4SB 1A7OH 5DURD 4JRYE 4Q9RH 3QDME 4CMMB 1T22B 4JHAL 3SJVD 1YMMA 4PP2B 3K8MA 3FQNA 2Y1VA 3HNTL 1A7NH 2NTSP 3K0WA 3BGFB 4RGMB 1CLZH 3W2DL 1WF5A 3CFIC 4JRXB 4YO0B 1A0QL 3BPCB 4NQXB 4CVZB 5K9OA 5MERA 4NC2B 1C8PA 5FF6B 1AP2B 5GSVA 5F9AC 1HHIA 3EDEA 1OVZA 3KPSB 2XWBA 3O6LL 3UCRA 1T7WA 3OAZH 1ODAA 3IDYB 2YEZA 4FQLL 3MV8D 2V7NA 1W8OA 1HYSC 5C0RL 1YEHH 1FORL 2OR8A 1NLDL 1MFBH 3L6FB 3GO1H 4KK8D 1S7QB 1EX0A 3DXAA 3PHOB 1J1XL 1RY7B 4ZD3H 1I9IH 1FYTA 3SQOL 4GOSA 5JXAH 4JZJB 1RSFA 5KSAD 1HKLL 1BBJA 1JRHL 1W0YT 1WC7B 3HMWL 1LD9A 4ZSOB 2CLRA 1ZT1A 5GHWL 5C0BA 3MLWH 1QTYT 4QXWA 2QQLH 4QT5A 5EZIH 4D94A 1UACH 1M1SA 5CJXA 1FL5A 1P53A 2FATH 3MZTA 5D2LB 1GGTA 4NO2B 2NLJA 4LF3A 1P84J 4N0UE 3HCVA 3L3HA 1J0IA 2IMNA 5HHXH 3DO7B 1MY5A 1UG9A 5TFSL 1AGCB 3MLUL 4DGVL 3EJZD 1WJ3A 4C58B 1HXMA 3MLYH 3TFKA 1NEUA 1NGPH 3LDBB 1CLYH 4PRBB 4LHUG 4TNVF 3OG4B 5ISZE 1XGTA 3ULVF 4YHIB 4XPGL 4ORGA 3T3PE 1BVLB 4OJFL 3KJ6L 3TBVA 1MRDL 1PG7L 1DDHB 5HD8D 2JE8A 1HHHB 1FNLA 1I7TA 4D8PA 2A2QT 1L8JA 2EH7L 4Z7UB 5C0JB 3IU3A 3MJ7B 4JPVL 5E6ZA 2RIKA 4PJXF 5SWZB 4AENA 1N64H 1IAMA 3TVMA 2V5TA 1NCCH 1KBGL 2DYPD 2GJZB 1QA9B 3MACH 4OLVL 3O3DA 4JQVA 2HLAB 5J13B 3BZEB 1EO8H 4GG6A 3DUUB 4GRLD 1QR1B 3OXSA 3PXHA 2DQCH 2NQCA 5C0AA 1T21B 1O7SA 4NM4H 3U2SA 1ONQB 3WLBB 4RAHA 5EO0B 4MCYA 1U8HA 2IADB 3DVNA 4RNRB 5FAAA 4UDUA 4M7JL 1K3ZA 1AXSA 4G9FE 2W9DL 5DC0A 3UJTH 1IJ9A 1JF1A 2DAVA 2G75B 4PJ9B 5DD6B 3S36L 2NTFB 3RWCA 1GAFL 3MA9H 4D0CB 3FFDA 2ENSA 4P3DB 1IEAB 1X6LA 5GXBB 4UIKL 4K94L 1EHLL 4P3WA 4NKOB 1IGIH 1MEXL 1XIWA 4IM8A 2NY0C 4N9GB 2I26N 3S3SA 1LO2L 2R0LL 4HV8B 4R3SB 3VRLE 1LE9A 4NKMA 2HP4A 4GKOA 2R9HD 2MQ3A 5IF0B 2YSSA 3G6JA 4PJ8D 4OGYH 4R97B 4NC1E 5IJVA 3RL1A 2BSSB 3F12A 5DWUH 5ABDE 4Y4HC 1W72L 3H9YA 1RK1B 1U8KA 3VJ6A 2OL3H 2D7QA 2J1KA 2M8XA 5IMLB 1IFHL 2N7AA 4S1QL 1G9EA 3CSPA 2IAMA 2GIYA 2GSGB 5GS1B 2A74B 1U93A 5MENB 1KCSL 3MV7B 4ZUSA 1KJ3H 4PRID 1T0MA 1X5ZA 4F7PA 5E56A 1QVOA 3V4PL 4XCNA 2D7PA 3U9PL 2VLJB 4ODXA 4O58L 5HGGS 1I4FA 4I0CC 3TO2B 4WO4A 1PX3A 1ZGLB 4JZOA 3T0VA 3WNPA 1NCTA 1N2RA 2Q6WA 1QSFD 4HT1L 2X1OA 4Q0XH 1KPRA 3RNKA 3ULVH 3GK8L 4FTVE 3UJJH 1YEFL 5I1HL 4D9QE 5IVOA 3QPQC 3MV01 5C0AE 4CBPA 3IKKA 4E41D 1NEZG 4I0PA 1CDBA 3CLEH 1EPFA 3VD3A 5I66B 3ZO0A 1NCWH 2VJXA 3IRZA 3O3BB 2VDOL 3QDAA 5DXWA 2GQHA 3PL6D 4KI5C 1ND0B 2NCMA 4WDIB 5LXGH 4WUKL 3BYTA 3VMOA 3P0GB 3B2UC 1T20A 5CSGA 1MH5B 1AR2A 4GQ9H 1NSNL 4UINL 5C9JB 1A2YA 5JOEA 3DUHA 4M7ZC 3KHQA 4AIXA 1TCRB 3G04B 1OP3K 4GG8B 3HZVA 3QEHB 4LVEA 4Y5XB 1ZA3A 2P5EA 1I1AC 4LRNL 4JPIB 2AEPL 1Y18A 3HUJE 5KW9L 1OSZB 2XACC 2FEDD 2VR5A 3CJJA 2EIZA 1I7UB 1LK2B 3O4LA 1AD9B 2IMMA 4H0GA 1AI1L 5FOJA 2ZG1A 4OZGE 1K5NB 4NWTH 3ZTNL 1MQ8A 2VXQH 4MLSA 1NMAL 3NFPB 2YXFA 1BAFL 2OZ4A 1FJ1B 4HPOH 3S5LG 3QXAB 3TT1L 1T6WA 4L5FH 5HXMA 5FUCC 2F19L 4YWGL 3X3GL 4KV5E 4XNMB 3RAJL 4M5ZL 2YHGA 1SYSA 3EFDH 1WFUA 1T04A 4HK3N 2ZZUT 4PV8B 3F6IA 2PTUA 4PJ5E 1KNOB 2DBLL 4MVBA 3VDCA 4QCIB 3MBEA 5IVXB 5AYQA 4M93C 3AREC 1HSAB 1WCBA 4Z95H 1VGKA 4JPWL 2CXGA 1PX4A 3GSRA 3D2UD 3WN5C 1CXHA 4KK9D 3U83A 1L0QA 3C9NA 2WBJC 3SCMA 2CSPA 1I9RH 5T3XE 4ZOCA 2J8HA 1RZIA 5IQ7L 3BRFA 2BDNL 1T5XA 4UI2A 3GMOB 2X4UB 3T09A 4JREB 4NSKB 1UWGH 3ZT6A 1NGQH 3VFSB 4KRPB 4AT6A 1M05A 1RZFL 2W1NA 3O3UN 1NJ9B 8FABA 2OSLB 2V9RA 4BSJA 1YN7B 2Z92A 3BWAB 1W72B 2FHCA 2VB5A 3NZHH 3OX8B 3P9LA 1EBPA 3QAZB 5FO8A 5C08B 1R3JA 3IKCA 3ARFD 4LDLB 5E2WH 4EDWH 1M7XA 3O41B 4NUJB 4TVPH 2P5EE 4K71B 4UZGA 2XXMB 2GITA 2JELH 1INQA 1JNLH 3ZKMC 3FTGA 2WWMC 4WWKB 1RJYB 4X99A 1WT5C 1PEWA 5FM8A 3VD4A 4XGZA 2YC1A 4NZTL 4LFHG 5I8OL 3HE6B 2HJKA 4L8DA 4Y4KB 1DQTA 4RMUA 4JFED 3QXDB 2FX8H 1HXYA 4GBXB 1BD2A 1MCWM 1OT2A 2HG5A 3D69A 3U46A 5SV4A 3R1GL 1G7QA 1G1YA 4GG6F 4FQJH 4PD4K 1I3RB 4AL8L 4PGCA 3CIQA 1NL0L 4HQQH 2J7LA 4UIMB 2FX7H 1H8OA 3ARDD 2NXZB 4LSQH 4LEOA 4B7IA 5TDOA 2CDGB 3SPVA 1ADQA 4RSVA 3TEUA 1CE6A 4NZUL 1YEEH 1O7VA 4IOSD 1J1PH 1T2QL 4PS4H 4U1JB 3KXFB 5B3NA 3ULSB 3PWNA 3WIFA 4KZDH 3ISWA 4XPFL 5MI0B 1N26A 2DM4A 2FEEI 1DBAL 4PGDA 1A7BA 2E9JA 5F3HB 3OJDA 1F3RB 4Y2DD 5D2NA 3RZCB 2F5BH 4XVJH 4KQ4H 3WS6A 4N5ED 4RCAA 5CSBA 1EXUB 3G6JF 1OLLA 3CFJB 3QO1B 4LSSH 4ZOAA 2HWZH 3IJHB 4KROB 5EBWB 2CGRH 4D0BA 5I2IB 3H0TA 4IHOA 1JWUA 3DETC 4EOWH 5C8JB 3UDWC 3BZ4A 5C6WH 3KLAB 4HIXH 3RI5K 2EC9T 2X10A 5MHSD 2HRPL 4M61B 1ZOXA 5MEQB 2HVJA 2D7OA 3KYKL 3GMLB 3TJEH 2Q7NA 4KVCL 1C16B 4U1LA 1WLHA 5JXEC 3DVIA 1OTUC 3ARXA 5F93C 3TPUE 3V9FA 1B0GA 1J7VR 2VXVH 3UTZB 1YYMH 5GGRY 2WSKA 3MLZH 3WSQL 2EDBA 5D71L 4Q74A 2NY4B 1F4XH 2W60A 3RTQA 2YD9A 4HF5L 1IAII 1FZKA 1P2CA 2ICWA 5KOVC 4MXWH 4DVBA 2IPTL 5D93B 1KN4H 5F1OB 4AEHH 2QR0B 3E2HC 3JV0A 2MJWA 4PJBA 4OD2A 2EE6A 4F7MA 3VXRB 1JI1A 4ERSL 5BZDB 1EFQA 4OF6A 5IEKA 3DGGB 2VH5L 3ILQC 1ES0B 2XN9B 4P2OA 1RZ7H 4LASH 4AH2A 2IGFL 4U2ZA 3AY4C 3EDDA 5D70H 4H1LA 1MCQA 3ETBF 1XZ0B 4YUEL 4D0DB 4EUPA 5DRWB 3MRPA 3BE1L 1I9EA 4Z0XB 2YPLA 1KIQB 4RAVB 3QDJD 2QL1A 1GHFL 4Z78A 5BS0D 1HQ4A 1RHHB 1TJIH 1SM3L 3K2MC 1OGAB 4OZIA 4WFFE 1S7RB 1GGCH 4NC0B 2CLZB 1JTTA 3FJTA 1DLHB 3JV6B 1P69B 3WO4B 4YDJB 4G5ZL 1D9KB 5CS7A 4XP4L 4OQTA 4QRUA 1CGWA 3UBXI 2DQFA 2Q76A 3C5ZC 2CR3A 1NDGB 2MOVA 5KJRL 3KPRB 4GW4A 3EAKA 4P2QD 4JN2B 2XFXB 2AXHA 2ITDB 3UTPE 2PXYB 1UB5B 2DI9A 4DKAA 1UZ8A 4U2YA 1FCGA 2UVFA 2EC9U 3H42H 3FOLB 5IFHH 1S9VA 3QNZA 3EJJX 4FG6C 2W38A 5DS8A 4PRHD 2LQRA 2EECA 1KPUB 4OCSL 1GIGL 3BKML 4YHPB 1L7TL 2B0SH 3DMMC 3ZMRA 3MRLB 2CIKB 5I1GH 2A9ML 4U1IA 4NKIH 3BPLB 4HGKC 1WZ1H 3L9RB 3C6LD 4MCZB 3P0YL 2J88L 1QRNB 3HNSH 4G8GE 1YNKL 5CD5C 3BKJL 4C83B 3MRCB 3S4SA 3TA3D 3VD5A 1KV3A 2UZYB 4CMMA 3RVWD 1TVHB 2AABH 1T22A 4UAOB 3LKQB 4PP2A 4KKCD 4JQXC 1YEGH 4GKZB 1QFPA 1CGXA 3D0LB 2B1HH 1E4XH 3GUTB 3L7EB 5ILTL 3EYQD 4L9DA 4JRXA 1EUTA 4YO0A 5M94B 3BPCA 4NQXA 3NAAL 3QXWA 2ZKHH 1YYLH 1KB5H 5FF6A 1RZKH 1JK8B 2P7TA 2Z35B 1LNUB 2HTLD 4X9IA 5E2TH 3KPSA 2YPLE 3MA7B 2VSDA 4YX2L 2LU4A 1QFUL 1RIUL 3MMEA 1QBLH 3B8SA 3MFFB 4HUKB 3MJ6A 4XVSL 5K9JL 4FQXB 3BH8B 1DZBA 5IROA 5SWSD 3T4AB 3L6FA 5GS0D 5FV1L 5CP3A 3QEUB 4LPWA 3U79A 1S7QA 3QHFL 2AJYL 2FX9L 2Q86B 1OQXA 4U1GC 3PHOA 4LLMB 1QUNA 5KSVB 1JI2A 5M7QA 4JZJA 3BRGC 5IB1B 1JV5B 4TNWK 3GHEH 4ZSOA 2HT4D 4S1DD 5E08H 2H2PC 2QTEA 1MFEH 3LEYH 4EN3D 1K9TA 4PJDE 5TE6H 3VXUB 3BEVB 5D2LA 4NO2A 4R7DB 1MCPL 2BHYA 1DE4B 5GISL 3DO7A 1AGCA 1S9YB 4WW2B 4O9HL 4OSUL 3EBAA 1CFBA 3BP5B 4OV6F 4TULH 2DWEB 5B22A 4DN4H 1YQ2A 5CEYA 4PRBA 1UQSB 1IEHA 1QRKA 4DQOH 5E2UH 4LPCA 2JIXD 5CJ8A 4YHIA 2MFNA 5K9KB 1K6QL 4FFZL 1BVLA 5I71C 4LBEA 35C8H 3ZTJH 5CIPB 2JJSA 4IIQB 1DDHA 1T66C 3DSFH 1HHHA 2F53A 2BZDA 3MROB 43C9A 4Y19E 2FJHA 3M1BB 4Z7UA 3SDDC 2I60L 5C0JA 5SWZA 1N59B 1RIVH 4Y0GA 3VI3E 4NCDA 3RHWF 2GJZA 1QA9A 3FONB 3BZEA 3P11H 1U3YA 3B2VL 3OKKB 4XNZB 4JN1H 5EU6D 1QR1A 2QJDA 2YD6A 5LBSH 3AAZA 3PDGA 1T21A 1IVLA 4RMVA 4OT1H 3EYOB 3W11D 3KR3L 4P4KD 4V1DD 2MSPA 1MY7A 4W81A 5KVFL 1HHGB 4LSPH 5EO0A 3TNNB 3FQUA 4LGRB 1NC2B 2IADA 4RNRA 2EDQA 4XAWH 1DQJB 1CVSC 4Z0BL 2G75A 4PJ9A 5DD6A 2NTFA 2P47B 2X1WL 3VXQA 1HINH 4U7KA 5CEZD 2XKSA 4JJHA 4KK6C 1LILA 3LKPB 1IEAA 2D7TH 3RGVC 2ADFL 3GSNL 4NKOA 3PGFL 5JUEL 4GAGH 1I8LC 2WWKO 4HXBH 2MKLC 1TQBB 4JFFB 4N9GA 5GPRA 4F9PC 4HV8A 1EJOL 3P40A 4R3SA 4MAUL 3RDTB 5IF0A 5D7KE 1A47A 1MHEB 4MAYC 3L3JB 4R26L 2DWDB 1V05A 4PJBF 3IDIB 5DFVD 3VE0B 2R29H 5D2LE 4G9DB 2BSSA 2OJZL 3RVXD 1RK1A 5A2LH 3WDHA 5IUSA 1BF2A 5IMLA 1PGRB 4UT6H 1OAYL 1IM9B 2GSGA 3OZ9H 2A74A 1RULL 6FABL 5MENA 4JY5L 5FUZH 4L3EE 3GM0A 1BEYH 4WI3A 1F4YH 2F53E 2EEDA 5FV2A 4XNXL 4OZIF 1UA6L 2VLJA 3DJ9A 2DRUA 1I7RB 1MJ7L 1EZVY 3TO2A 4X4XB 5DSCA 5DF0A 2OLDA 3STZB 4F57L 3W5NA 4MXQC 1RU9H 4Z7QF 3SE9L 2F54E 1CQYA 5FHAL 3QI9B 5BVJA 1HYSD 2DLFH 4ZAKB 1RAMA 5F89B 4XC1H 3MLVL 3PHSA 4K23L 1C5CH 1BJMA 2G60H 1RD6A 5I66A 1HKFA 3MLRH 2J4WH 3W0WD 4R2GB 3O3BA 1JE6A 3WFDL 1AXIB 3L5XH 1ND0A 4WDIA 4CN1A 4P2RD 3ALPA 3CC5B 1FFPB 2R8SH 4R7NB 1MH5A 3I6KB 1DN0B 4OCXH 5D1ZD 2VLKE 1PAMA 3HPLB 4M4RA 1TCRA 3G04A 4ELME 3RJQB 2HT3C 2Y72A 4GG8A 3QEHA 4K7FB 5HYIA 4C56D 4PJGE 1AO7E 4JPIA 5EUKB 3QUXB 1OSZA 5ANME 2NR6D 3MJ9L 4NKDB 4D9LH 4LAQH 1KT2B 1I7UA 1LK2A 4X7TB 1AD9A 3U0WL 4RX4D 5T3ZE 1K5NA 3B5HA 1HDMB 3ARQA 1HNFA 3JUZA 3B5TA 1J8HB 3NFPA 1FCCA 2KZ1B 4U4BA 3PQYB 4KDTA 1CGSH 1FJ1A 2OR9H 4FZ8L 3C8KB 4E9LA 4RMSA 3GIZH 1A6VL 3QXAA 2W9LA 1J5OH 1U3HB 3GSWB 3U1SH 4ONFL 3WDJA 1N6QL 4XNMA 3NZ8A 4X9BA 5CZVH 4I9WD 1U0QA 2XG5A 4V2CB 1H3TA 1Y0LB 5BQ7B 1F2QA 4PV8A 1S3KH 1KNOA 4QCIA 1JTOA 5IVXA 3PXJA 4Q7DA 2AEIT 1HSAA 1TNMA 1T0NA 3NACH 4H1LH 5ERWA 4EUPH 3H7BB 1HILB 4DWHA 4JHZA 1CBVL 3GSNB 3JWOH 3QQNA 3DOSA 3O9WB 1A6TA 2X4UA 3MLSL 5FYKE 1MRFL 4NSKA 3QIBB 1I1FB 1IT9H 4UTBL 5TE4L 3VFSA 5L7XL 1NBZB 1A14H 4KY1H 1D6VH 3O4OB 2HFFB 3E3QC 3O2DH 2NY0D 1R3KB 2DQDH 4OQTH 5ITFB 5ICXA 2OSLA 4QNPE 1YN7A 3HRPA 3BWAA 3ORJA 3A6BH 2BFVL 4JQIH 3PIQA 3BIKB 1MJUH 5C08A 4K2UH 2BNRD 4AQ1B 4GW5B 1CDYA 1YEIH 4HCRL 3O41A 4NUJA 5IESL 3FO0H 3QFJD 5GJSH 4Y4HD 2HVKB 2VLRD 2JKXA 4WWKA 3RWFB 1RJYA 3R0NA 5I1JH 4TUKH 3M45A 5LCVL 1KN2H 3ZKQD 1MLCB 4YEEA 4UU9B 4X6EB 4Z7UF 3K4AA 3X14B 4K3DL 3HE6A 2RB8A 3GJEB 3FQXB 4EZMA 4Y4KA 3MZGB 4WJ5A 4BZ1H 4M6MH 5IHZB 1XGPB 5F7EL 2F8XC 1QO3B 1UXSB 5MEPB 1T03H 1B88A 3OAZK 4PR5B 3CMGA 1VHPA 1I3RA 4CVUA 3FB8A 4L4TB 4TRPL 2BOBB 4YNYB 2OP4L 4OLZH 4UIMA 5TPWH 2VERN 3UC0L 2CR6A 2CDGA 1FL3B 3DYOA 4XPTH 4E42B 3THML 4IDJH 1JPTH 1BQSA 5LAXB 1V7NH 3NIFF 3QPQD 3MLTB 1OCWL 4U1JA 3KXFA 5TE7H 2DQHH 3ULSA 1GC1L 2EDYA 4IRJC 5L6YL 1EHXA 2XTJC 4ZUWB 1UKSA 5KOMC 5F3HA 4MA8H 4KI5D 2AK4E 3RZCA 5HDQL 1BGXL 2VDPH 3UTSB 3QB7C 1NBYB 3WFCL 1EXUA 1G9MH 4P5TC 4XBPB 1F4WH 2C3GA 4ODVL 3CFJA 3QO1A 2Z4QA 2L7JA 4GXVL 5DJYB 2Y06L 3IJHA 5EBWA 2R1WB 3V6OC 1WFNA 4G6JH 4MJID 1Q9LB 1NFKA 1DQLL 5KAQF 1I1AD 3E0GA 1G9NL 5F6HJ 1A3RH 1BOGB 2WUCH 3KLAA 3Q3GB 3HA0A 4YXLL 1H9VA 1YMHA 4HMEA 3TO4C 3GNMH 4M61A 1YA5A 5MEQA 2BCKB 4Y5VB 3GMLA 1C16A 3NCJH 3SOBL 5GGSY 1JWMB 2BY0A 2DICA 3PWJB 4IOFD 5HPMB 1G7MB 1AKJB 3FRUB 3UTZA 1LQVA 3P3YA 5C0EB 1QHOA 1HWGB 1WZLA 3AROA 4KKNA 2RHEA 2FZ3B 3SDYH 4G8EB 4XMPH 5IBLC 2R0WH 4R6UA 1ZHBB 4HS8L 5DJ8B 4N0RA 1V8HA 2QR0A 4KRLB 4QOKE 3VXRA 5BZDA 4IRZL 3DGGA 4QXGH 5GJTL 3RWJB 3ARED 1ES0A 2XN9A 3QIUB 1UYWH 1AH1A 5KSBB 1XZ0A 3OB8A 5AUMB 4K07A 2WBJD 4D0DA 1EHNA 5DRWA 1MI5B 3DRTB 4NT6B 1CU4L 1SYVB 1KYOJ 4JFOB 1KIQA 5JHDB 5IV2B 4PLKC 4XPAL 5HYFA 1RHHA 1UM6L 4M6OL 1OGAA 1FFRA 1S7RA 4RZCB 4XXDB 2CLZA 2E7LE 1DLHA 3JV6A 4YAQB 4NWUH 3BWUC 4YDJA 5EC2A 1JGVL 4M6NL 5JIHA 4IJ3B 3EDJA 1D9KA 2DQIL 2ZCKH 1H0DA 1NDGA 4UT9L 3QCTH 5C0NC 3KPRA 2YRZA 5HVWA 5FK9B 5JMRA 2CMRH 4JN2A 2C1OB 2ITDA 4UTAH 2PXYA 4GAFB 1UB5A 1FRGH 1QBMH 1WZMA 3ZKMD 4KMLB 5EZJA 1U3JA 4TVPE 3O2VH 3FMGL 3BVNB 1JUFB 1A8JH 2AI0H 3S88L 3AB0B 3FOLA 1I3GL 5FDYA 1FBIL 5C07B 3MV9A 1KPUA 1QFWL 3MRHB 1RK0B 3FT3A 4YHPA 5EBLB 2VQ1B 3ARUA 1EEQA 3RVUC 2CIKA 3IFPB 4I2XE 4M7KL 2EDLA 4X7FC 3KNBB 4JHAH 4I1NB 4TNVK 3L9RA 3LQZA 4MCZA 3WUZA 3O0RH 1QRNA 5IMKB 2DTSA 2NX5E 1IC5H 5IVXF 2W92A 1K3IA 5D7IE 1HE7A 2VISB 4OB5L 4JFXB 4NO0A 1VACB 3HZYB 4C83A 5JLZA 3MRCA 2IEPA 2DQTH 3AGVA 4H20L 4G6ML 5J56B 4HIHB 3QZWB 3LKQA 2J5LC 2PN5A 3FT4B 4WI6A 4YC2C 3D0LA 2VAJA 2X4NB 3ZDXF 3GUTA 5DUML 3L7EA 3VRJB 1FORH 2UZIH 5E6IC 1PLGL 5IBUB 2Z35A 4IMKC 1LNUA 4DTGH 3MA7A 3VFUB 1J1XH 2FHFA 2XKNA 2R39A 5T5FH 4YHYC 5E9DD 3SQOH 3V5DA 3ULUL 4Q97A 1T4KB 4FQXA 1HKLH 4HJ0D 4K7PY 1JRHH 3T4AA 4YHKH 3QEUA 2ICWJ 4DW2L 4RWYL 4LLVA 2Q86A 1NUGA 3F6LA 5CJBA 3OXRB 4LLMA 1FAIL 5KSVA 3F7PC 1E4KC 1PSKL 3ULVC 1VADB 5IB1A 4JO1H 1JV5A 3MYJB 4JHBA 2BP3A 4ETYA 1SEQL 4ODHL 5TFSH 5IB5A 2D4DA 3CVIL 5JW4Q 4DGVH 3MOAH 1OTUD 4YHZL 3VXUA 1EEYB 2CD0A 5AYUL 3RUGA 3OKNA 1VERA 4JE4B 4M1DH 4TSCH 3BEVA 4P46C 3SGEI 2AJVL 1UJTA 2AJSH 3UTQB 4LSTH 3ZDYF 4R7DA 5EDXA 3AS1A 5JIIA 1YZZA 1DE4A 4PB0L 3MV9E 1KCVL 3KJ6H 1CFQB 3L1OL 5ETUA 1MCJA 1S9YA 4WW2A 1CFSB 2WY3A 3QG6B 2ATPB 1OTSC 3BP5A 5C0DA 1NCUA 4LVNC 2QSCH 3SKJL 4XT1C 4JPVH 2YZ1A 1UQSA 4QRRB 4AEIL 2HRLA 3QNXB 1F00I 1NCNA 3JV4B 1A6PA 1A4JB 5K9KA 2X4PB 1QRNE 3RY6C 5IT2L 5CIPA 4IIQA 5GGQL 3MC0A 4LLQB 1X5HA 3ILQD 5FYLD 1JHTB 3C60B 3MROA 5HDBF 3M1BA 4NZJA 3U7YH 3C5ZB 3P77B 4DKEL 1N59A 4P23B 2YR3A 1G7HA 4HH9B 3TZVB 1RUPL 2DLTA 4WENB 1R6VA 2BHUA 4PRPB 1H8NA 3FONA 3S37L 1S7XB 4M7JH 4J3XA 1DL7L 4S1SL 1MRCL 3BYYA 2UWEB 3Q6GL 2J8OA 2DIAA 2XPGB 4WFGD 2YWZA 4OD3L 1GAFH 5KVGL 3EYOA 3O45B 4W4NA 3UROR 3PWPD 1HHGA 1KCRH 3N50A 2ZP0T 3TNNA 1EHLH 3KYNB 1NC2A 2BVYA 3ZTJG 1IC7L 1INEL 2EYTA 1DQJA 4LU5H 4LPUA 2BERA 2CKNA 1F4AA 5F8RC 4G80B 1KFAL 2NZIA 3LKPA 1NANH 4KRNA 2IBBA 4KTDL 4JFFA 1S7WB 3IXTB 4FG6D 4LHQB 2R15A 3DLQR 1NUNB 4X6DE 1W72H 2Y36H 3RDTA 4XI5D 1YNLL 1F97A 3VWKB 1JZ7A 3MQIA 5IM7B 1MHEA 1JGLL 3L3JA 4JFPB 3RUGE 1MOEA 4R4NC 2DWDA 3VE0A 3IDIA 4NZRL 4G9DA 4ZDHB 1KCSH 4Z8FH 2XNAB 2QV2A 1X5AA 2OS7A 2E9IA 5E8NA 2XZCL 4NCC1 3DV6B 2IFFL 1LWRA 3U9PH 5CD5D 3B9VA 1MFCL 3B9KB 1M6OB 3HMXL 3HAEG 3VGBA 5CZXC 1P5UA 4PJAA 1CL7I 4HT1H 1LE5B 1S8DB 2VZOA 3CSBA 2X41A 2YKLH 1U6AL 4JFDE 3GK8H 5B3JE 4HGWB 1I7RA 1LDSA 3IDUA 3T2NL 5HYQB 1WBXB 4X4XA 1IMHC 2IALB 4L4VE 3STZA 2LTQC 5DLML 4MYWB 4Y5YC 1AHWB 2VDOH 3QI9A 2Z31C 3FQTB 5BRZB 4ZAKA 3U0PB 5F89A 4Y1AB 3GIVB 1NKOA 4YBHA 1JNHA 5ALBL 3BN3B 4U6YB 1A7QL 1NSNH 5EU5B 2VAAA 5FYJL 4ZNEA 2FIKB 3DO3A 5EIVA 3CC5A 5KW9H 4CMHC 5E4EC 4APQD 2H2PD 5A2IH 1FFPA 2VUOA 4MJ5B 4WW1B 4R7NA 1H3VA 3TYGH 2GKIA 3I6KA 1DN0A 3VXSB 4BQ9A 2G2RB 2XYCA 5DD0L 2E27L 3LEVL 1I85A 3HPLA 4K7FA 3EZJB 1UC6A 1M7IB 5J6GA 5ALCL 5EUKA 3QUXA 1NMAH 3JWDL 4QXUL 4K55A 4D9RE 1U42A 3BN9C 1Q0XH 2AXGB 1DBJL 1KT2A 1MQKL 4M62H 3QJFA 5T1MB 2PYED 3D9AH 4PDCE 4HULB 1WK0A 1HDMA 1REIA 2F19H 3X3GH 4ZOBA 1J8HA 4E0RB 1T66D 2WM0A 4LVOC 3UZVB 3DHJA 2X4TB 2Y6SC 2NY2B 3PQYA 1GPOL 3CX5J 1FVCB 3SDDD 3C8KA 3FCTA 3BPOB 5GRZA 5HYJA 4WUUB 5J6HB 1U3HA 3GSWA 4LPTA 1FNSL 5BO1L 3BI9X 4BFIA 4PJAE 1DJSA 2VZSA 2A9NH 5CJXC 4NC1C 1L0YA 4JDVB 3GSVB 3H9ZA 1ITBB 4YZFE 4XPBL 2FIRT 5E8OB 1CN4A 4L9LB 4N90D 5BQ7A 2BDNH 5DQJB 3LPWA 5FGRA 5F9DC 5I18L 3TFKC 4WFED 3HI6L 3WKML 1KCUL 2I25N 1IRAY 3SDCD 4B50A 1A21A 4RGNE 1RZFH 3H7BA 1HILA 3NMEA 3U6RB 3GSNA 5BVPH 4CGTA 5J1TC 3O9WA 3WIHL 3LN5B 3M07A 2VDML 4KK6D 3QIBA 1I1FA 3KYMB 2CJUL 1G84A 1NBZA 4KUCD 3RGVD 3TVMC 4X5LA 1XH3B 5FA4B 3REWB 3GRWA 2HFFA 1JJUA 2A6KB 5DJCB 1R3KA 5ITFA 4YXHH 1AD0A 4JQVC 4NQCE 4LFHD 4WW2F 1LP9B 2XZAL 4XWGL 4FS0A 4OCNC 3BIKA 4N8CH 4MAYD 4NZTH 3WD5L 5I8OH 1WTLA 4GW5A 3VA6A 5FIEA 3BSZL 4H1LG 3BDYL 4J3WA 3JVGA 5F7HA 4HAFA 4EUPG 2HVKA 1MFDL 2C5DC 3RWFA 3IRPX 3NGBB 2FYYB 1JNJA 1KC5L 5I1EH 5IBTL 1P6AB 1MLCA 4P59L 2AJXL 2XZQH 4UU9A 3T0BA 3X14A 3GJEA 3FQXA 1UEYA 3MRNB 4XHJC 1BIIB 1NL0H 3Q6FB 5CP7B 1XGYL 4PJFA 4J8RB 4YH6A 3G6DH 5I1LA 5IHZA 1XGPA 2GY7B 1QO3A 2HFEB 1UXSA 3X13B 2WANA 1XIWC 2J8UE 4FP8L 2CKBL 4UT7L 4PR5A 4NZUH 3UTTE 1ITCA 5HYJE 4Z7NF 3ZSTA 3T3ME 4DKFH 1V3JA 1DLFL 2I5YH 2HKFH 3IB4A 4YNYA 1OAZL 2Y07L 1IARB 3GGWB 3KYAA 4MXQD 3ZKXB 3LMJH 2PW2A 2WBWB 4XPFH 1RIHL 3C87A 4MDIB 3R8BB 5GS0H 2XQBL 5LAXA 4OCYL 3I9GH 3MLTA 1HOCB 2B39A 2P5WE 5EULV 5L88L 4OI9A 1BFVL 3RWHB 1TQCC 2R69L 2IAMC 4OIBA 2BVQB 5JR1H 4ZUWA 3MRRB 2XTLA 1G7JB 3UTSA 4XBPA 5CEZL 3RPIB 3VG0L 5EU3B 3NA9L 1AQKL 1FNHA 4NN7C 5DJYA 2HRPH 3MJ9A 1WBYB 1Z9MA 5GGVY 4WO4C 2R1WA 3QUZB 2HT3D 5KZCD 1Q9LA 5F7UA 4KVCH 2GJ6E 3BKCH 2PO6D 3Q3GA 1Q1JL 5J06A 3L3IA 1V3KA 3QDGE 3DYMA 1XF3B 3T77B 1NFDA 4I0PC 5D71H 4HFUL 5EORH 3UP1A 2BCKA 3SO5A 3T0EB 4Y5VA 2O5ZL 1IGFL 1VEPA 3CDFA 3FN3A 4HF5H 3D0VB 3PWJA 4LSRH 4WCYL 5HPMA 5GGRB 1G7MA 1AKJA 5I73B 4P99A 3TT3L 5C0EA 2VIRB 5C0FA 4LIQE 4PJFE 3MXWL 4ERSH 4LLUB 4G8EA 1G7LB 4QHMB 5HHME 1ZHBA 3FHQA 5DJ8A 2M2DA 4GRMB 1JHLL 5FHBH 5GGTL 1QSEE 1YUHB 5CIPH 5JZ7C 3QQ3B 1XF2B 3QIUA 1SM3H 1A4KB 2UY7A 4HIEB 5F3BB 4P48A 5KSBA 3VG9C 5AUMA 1MI5A 1GGIL 5GRUL 4EEEA 3DRTA 4NT6A 2DQEL 3MX0A 4CRPA 1RZJH 1SYVA 3CDYA 4JFOA 1UH2A 5JHDA 4N1HB 4NRZA 5IV2A 2AXJA 2XA8L 2EE9A 3CXDL 2IPKB 5KJRH 2VXSL 3DVGB 3IDNB 3HFML 4RZCA 4XXDA 3SHSA 5D8JH 1N4XL 4G6KH 1IAOB 4HCRA 1BMGA 4Y88A 2FGWL 3WS3B 1OAQL 2R1YA 3HR5B 5C71A 4RRPG 3WXWL 2V9TA 2Y25A 2IH3B 3UO1H 5FK9A 4MVBC 4BUGA 2C1OA 3MBEC 4WHYH 2V2WB 3T2PA 2JIXB 5C09B 5IFAH 3VXNB 2FLBT 3BKMH 1L7TH 2FL5A 3NN8B 5E00B 3SCMC 1UCTA 3BVNA 3OR7B 1X4YA 4K8RD 4OCMC 4DEPC 2A9MH 2KH2B 1J11A 1CT8B 1C7TA 5C07A 1IAIL 1NFDE 4W6XB 1IQDB 2WP3O 2OTUB 3MRHA 3SJVE 1KEGL 5GIRB 1R0AL 5EBLA 2A6DB 2VQ1A 1CFNB 3IFPA 1SBSL 2DMBA 2OMBA 3KNBA 4MNGB 2D9CA 4NGHL 3KLSA 5IMKA 3SO3B 5HI4C 1AE6H 3UZQA 1OSPL 2FRGP 1CLOL 2IANB 2VISA 4FQ2H 4JFXA 4EIGB 3P2TA 1VACA 5DQDL 3HZYA 3KPNB 2J12B 4ZXBB 3VA2C 3Q48A 3E8UL 3NAAH 4JG1L 4R8WL 1BJ1H 3ZKNC 2B5IB 3MV8E 4HIHA 3QZWA 4HUUB 5DUBB 1J86A 3RHWK 3HE7D 1QFUH 1RIUH 4MS8D 4XP6H 3QQ9C 4Z76B 5HI3C 4IRJD 4PY7B 2ESVD 1ZEAL 1L4IA 2X4NA 4XVSH 3VRJA 3LKSB 2XTJD 1EO5A 5ADPL 3MRFB 5D7LB 3QHFH 3DUSB 2QQKL 4O02L 2AJYH 2FX9H 1WBZA 3CH1B 3VFUA 4P5TD 3VDBA 1RUML 1UWXK 1T4KA 4PYHA 3EYSL 2JJUA 1UB6B 5EN2B 3RA7L 3C8DA 1FH5H 5F88B 4MWFB 4OFIA 3T4YB 4LMQE 3OXRA 1AGBB 4P0DA 3U4BL 1VADA 4I3RL 4PUBL 2I07B 3VU2A 3MYJA 2ZWLT 2YPVH 3TO4D 1CTNA 2X1QA 3I3BA 3WNNA 4O9HH 1T0PB 3DWTA 2GHWB 1EEYA 4TSBL 1NAKL 5D2NC 1MCOH 2X40A 1KTDB 1BX2B 3UTQA 1CGUA 1JGUL 3T08A 3VGAC 3WS6C 1GOHA 5BXFB 4A6YL 1K6QH 3VGGA 3KJ4C 1CFQA 5HGHB 5LVEA 3X3FH 4XZUB 1CFSA 5IBLD 3QG6A 2Z8SA 3P4MB 2ATPA 4NQVB 3AS2A 4ZO8A 4QRRA 3SKNB 4NP4L 3QNXA 4OLWH 4XMLH 3JV4A 2AJUH 4GRWB 1A4JA 1A6UH 2X4PA 4MNQD 3I50L 3VXMD 4NDMB 2X2YA 2X70B 4OF8A 4E41A 1JHTA 3C60A 4WV1B 4PY8I 1XR8B 3NVQA 4XCFL 5I74C 4JVWA 5DMGC 3S96B 1CIDA 1SEBB 3F58L 4P23A 3S9DB 4HH9A 1T3FB 3TZVA 5KN5B 3BD4A 2R0KH 2D2OA 4XRCB 5T1LB 3KR3H 4BM7A 3LEXA 5KVFH 4HEME 4PLKD 4PRPA 4LQFL 1S7XA 4PY8J 4BELD 3TF7A 4J3VA 1BZ7B 3RTQC 2UWEA 2IJ0C 5TDNB 2XPGA 5EO1B 3I84A 4QHKJ 4ONGH 4P9HL 3HI5L 2GK2A 1ZHLB 4ZQKB 3O45A 4BSWB 4I3SH 4G8FB 2JCCE 4IRSB 2V2XB 4NQDD 3KYNA 2ADFH 3V0WL 5C0ND 5JUEH 4PJIB 3LN9A 1EUUA 1EJOH 1E4WL 5KSUA 4MAUH 3INUL 4P2OC 4JGMA 4G80A 4S2SB 2DM2A 3LY6A 5BV7C 5T1DL 4HUNB 3KPQB 4JHWL 2WLYA 2NY5C 3EYUH 1S7WA 3IXTA 2OJZH 1A9BB 4LCYA 5C1MB 3TIEB 2MMXA 3OPZL 4KVNH 3VWKA 2BNQD 5IM7A 1A9EA 2D4FA 4JFPA 4PRIE 1FZMB 2F58L 2P48B 1OAYH 3RVUD 4GXUN 6FABH 1MAKA 5I1IL 1CIUA 3V6FB 3GBMH 4HC1L 4GAJL 4H8WC 5L2KD 4XCYB 3KPPB 3DV6A 1FFOB 2C4XA 5EWIL 4G7VH 2FDBP 5EOCJ 1QPPA 1BOYA 4YHYB 2LV4A 1QSFE 5KSBF 3F7VB 4Z7WE 4K9EL 3D2UA 3K4ZA 1UVQB 3B9KA 2F74B 1M6OA 4NOBA 3KS0H 4YIQB 1LE5A 3LQMA 4E41E 2NY3B 5FHAH 4OM1L 5JHLH 4BSVB 1EBAA 3O3AB 1EEUA 4HGWA 3MNZB 2EIEA 2J2ZA 2WZPD 5HYQA 1WBXA 5E6ID 4K23H 4PTUB 2IALA 1AHWA 5TGBB 1MCSA 1MCKA 3B3IB 3FQTA 5BRZA 4EI5B 1RZ8B 1QSVA 4F58L 4QRQB 5IW6B 3U0PA 4LCCB 4Y1AA 3V2AR 3GIVA 4S1RL 3FFCD 2NZ9C 5LGKA 4LLDB 4U6YA 5EU5A 1LGVA 4UV7L 4PYGA 2FIKA 1CK0L 3L95A 4LVNB 2P42B 3X12B 3ULVD 1N3NB 1FGVL 1E4XI 1QLEL 4D2NA 4RAUB 4A6YB 4MJ5A 4PRNA 1OAKL 2NXYB 4WW1A 4RGMC 2B1AL 2ZCHH 1RV6X 3MJ9H 5D7JB 3VXSA 1JTPA 3QEGL 1KLUB 4OZFB 5D72L 4YFLF 4NQED 3U0WH 4ONOA 5J11B 3IFOB 4GW1B 3P4NB 1M7IA 3IDYC 4M00A 1G9MC 5F6IB 4Y8AA 3F7YB 1OTSD 2AXGA 1TMCB 5IROC 3D85B 4DGIL 4FZ8H 3ARDA 3NOIA 5T1MA 2FO4B 3BZFB 4JRWA 1AGFB 5FUOL 4MJ4A 5KTEH 4ONFH 3ARTA 3PHQB 4QRSB 4HS6B 3ARPA 1N6QH 4YDIL 2NY7L 1Q9KA 4E0RA 4JZJC 1T2JA 4JKPL 2X4TA 3QXUA 1FVCA 4JRYB 1L6ZA 3QDMB 4WUUA 5J6HA 3QEQD 4Y2DA 1VCAA 4WWID 5F71A 4OFYD 4Y2OA 4JDVA 3GSVA 2VDQH 4JM4H 1INDL 3BZDA 3CK0H 5E8OA 2O93L 4L9LA 1X9QA 2H32A 3RY5A 3WIIL 5DR5L 4WI4A 5DQJA 1B2WL 3MLSH 1MRFH 1KPVB 3J8F7 4JPKH 4QRPD 4AIZB 4PJEE 2YD1A 3U6RA 4BA8A 5HGAB 5LGJB 3WLWD 5CJOL 2JJSC 2PYFA 1Q9WB 4V2BA 3LN5A 4MMXC 1BQLL 1N8ZB 3KYMA 3GBNH 2W91A 3REWA 4KHXH 5FA4A 1ZGLM 4L8CB 2C3XA 2A6KA 5DJCA 2JF1A 1WIUA 2IQ9H 1LP9A 4RA0C 5LCVH 4B7LA 2BVPB 4JFEE 4HD9A 2EDHA 5DVOA 5C0CD 25C8L 4R4ND 3ZDZE 4N0UB 2VDNL 4ZTOL 5EO9B 3HMXA 3TBTA 3TP4A 4I18B 4RQQB 5I30L 3O6MH 4RIRA 5C9KA 2F5AH 4OUUB 4Y5YB 5HDLA 3WFZA 2CIIA 1ZWIB 1NAMH 3GB7B 1J18A 1CXKA 4PJ9C 4YPGB 5ISZB 3MRNA 1BIIA 5CP7A 3Q6FA 5FDWB 4J8RA 5CGMA 5CZXD 1K2DA 3UC0H 2EYSB 5F7KC 1NMBL 2UYLB 1OARH 2AJZB 2UWEF 3TBYB 4BQ6A 4O2EB 2YUZA 2Q3AA 4H5SB 5ID0B 1OCWH 4KXZH 4R97C 4LCWD 3F65A 5E4EB 4BK4A 1QQDB 1FG2B 3LS5H 5L6YH 5F7LB 4U0RB 1S9KC 4MDIA 4XBEL 2Z31D 2Y5EA 4LCIH 1NMCB 4GT7A 3MXVH 2GY5A 2XWBB 3WFCH 3NIDE 4AIOA 3QUYB 1WIPA 1LMKA 1PQZB 3A6OA 1B90A 4GXVH 2BVQA 4G9FB 2DKSA 1K8IB 3R0MA 2FB4L 5MP6L 1YMMD 4GMTL 3MRRA 1KB9K 5MHSE 5I76B 1G7JA 4GH7B 4YLQT 5GSRB 3Q1SL 5IG7B 3RPIA 5IHLB 4OFVA 3CFCL 4OD1H 5T3XL 4LVOB 1WBYA 3QUZA 3PJSA 3ES6A 4L8SB 4DN3H 3C6LA 4CVXB 1LP9E 1KTLB 2OTWB 3BN9D 3ABZA 2KKQA 2BHZA 43CAB 1XF3A 3T77A 1E6JH 1UZ6E 5JW4M 1F58L 2NLJB 4LF3B 3HCVB 3T0EA 2BVTA 3QPXH 1CFVL 3DXAD 5SWQB 3D0VA 1CDIA 1FYTD 5DRZB 5FYLH 3U0TA 4HS8H 2MHAB 4PGBB 5GGRA 4PPTA 5AWNL 3AUVA 2APFA 1HIMH 5C6TL 1T1YB 5TF1H 3ULUF 1ZKAA 5IGXL 4KKLC 5T5NF 3MLPA 3RU8L 1XGTB 4WHCA 2VIRA 5C0BD 2DJUA 5IEHB 1GOGA 4IRZH 4LLUA 1DTUA 3B6SA 1D5XB 4OIAA 1G7LA 1QZ1A 4JO4H 4QHMA 1OP9A 2OMNA 3NPZB 5TQ0L 4D8PB 3QCVH 4GRMA 2WIIB 2QADB 1WEJL 2XXCB 4OKVB 3QDJE 1MJ8L 4S0SD 5BS0E 2J6EL 1XF4B 4XH2B 1YUHA 4HZAA 3TVMB 5CZKA 1P7KB 5EB9A 2L7UA 3CNKA 4XPAH 1BM3L 3R8QA 1XF2A 1UM6H 3WIHA 7FABL 4NKQB 5IHBA 1A4KA 4HIEA 4FTVB 4ELKB 2NW3B 4RFNC 5F3BA 5AAWA 1ACYL 5C0AB 4KAQH 4JR9L 1JGVH 4FZEH 5E94A 4P2QE 2VO5A 3LRGA 2DQIH 1IKFL 5EC1B 1A6WH 2RJMA 2VL4A 2YZ8A 4KDTC 4OLYL 4UT9H 2IPKA 1U8HB 5JW3L 3DVGA 3IDNA 5JA9A 1PG7W 4EN3A 4S11A 4LHUB 4C54A 2CK0L 1L7IH 1QKZL 1A1NB 1IAOA 3TH2T 3RWCB 2BMKB 1SJVA 2E3VA 3CU7A 2VWEE 3QA3B 3HR5A 3FFDB 4PRHE 4RDQF 3ARYA 3FT2B 2IH3A 2R56H 1FBIH 3U7WL 5C92A 4KQ3H 1FFNB 5T1KB 2HKHL 2IWGA 3BJLA 4FXGA 2V2WA 2MCG1 3S34L 2BOCB 3HUJB 2MPAL 2YSSB 2JIXA 5C09A 2EDNA 4WEUD 3VXNA 4LARL 4K94C 3NN8A 5E00A 1KELL 3OR7A 1RUKL 4DK6A 5IJVB 2YD3A 3O2WL 4M7KH 1NH6A 2CKBA 1FLTX 1H5BB 1CT8A 4GFTB 4OZGB 3G5YB 4J4PA 4XHJD 1IQDA 5EOTB 4O5LL 4JREC 1U8KB 2OTUA 3IAGC 4KRPC 4M7LT 2HFGL 2MWCA 5GIRA 3DRQB 3N85L 2A6DA 4ZPTB 5K9QI 3OV6A 1XIWD 3UXFA 2ZJSH 4H20H 2IAMB 3VXPB 3HN3A 4G6MH 5EU6A 5LGHL 5F96L 4MNGA 3D48R 1T0MB 3IAQA 4HH8A 4F7PB 2QQNL 1AFVH 2IANA 3QAZC 4PBWD 5MEOA 4WHYG 3QWRA 4P4KA 5DUMH 1HWHB 4V1DA 3KPNA 3TNMA 1ZK9A 4ZXBA 1RUQH 2UY6A 5FGSA 1PLGH 4PJ5B 1OWRM 4HUUA 4WWKC 5DUBA 5SWSE 4HMCA 5IQ9A 4HJGB 1EFXB 3D3VD 1H3PH 5TH2B 4F7TA 3GJFB 4Z76A 2UV3A 4Z7OE 3ULUH 3HE6C 3LRSB 4Y4KC 3LKSA 4KU1A 5JMOC 5E2JA 4HUWB 1BECA 3MRFA 2QHLA 5D7LA 3TCXA 1AY1L 1SVCP 1F13A 3DUSA 1D5ZB 4DW2H 4I0PB 4Q9BA 4OGZA 2OX5A 2QEJA 5DTFB 3CH1A 3TBSB 3IVKB 3CAFA 5C0GB 2VZ3A 1FE8L 1RJLB 1PSKH 5J89A 1UB6A 5EN2A 4WO4D 3MODH 1F42A 1SEQH 1HZHL 3PF2A 4OFPA 5F88A 4MWFA 4CJ1A 2NXZC 3T4YA 5FKAB 2AGJH 4Z77B 5JQHC 4YDLB 1UWEL 1AGBA 5AYUH 1MPAL 2X4SB 2AJVH 4O4YL 3HZVB 4NIKB 3C09B 2P5EB 4G3YL 4RBPH 4PLOB 4HLZH 4JO2H 1U3ZA 3DX9B 5HHOD 1CDCA 3VFPB 2K3TA 3BUTA 1JPGA 2YK1L 1QPXA 5DJ6B 3RZCC 1KTDA 4WNQB 5GGTA 4X80L 3ZKSD 3OSKA 3MV11 3BH9B 1UM4H 5BXFA 1NEZB 4XVTL 4AMKL 2P43B 5IT2H 5HGHA 3VFRB 5DJDB 5E2VL 4XZUA 1DCLA 3P4MA 4TPRH 3RBGA 4ZFZA 1KCLA 4KROC 5DMIL 3UTOA 4MJ6B 3UJIL 3SKNA 4BZYA 2IQAB 5EU6E 2W0LA 1RUPH 5CILL 3TH4T 1WISA 1F11A 4M5YH 5JZ7D 3WFEH 1I9JL 4NDMA 2X70A 1J1OL 4R4FH 3SY0B 1QFHA 4P5MA 3O4LD 4WV1A 1MRCH 4V1DE 2AK1L 1XR8A 1MHCB 3S96A 3TGXA 3T0AA 1SEBA 3L5IA 4N8VB 4OD3H 4QTIL 1T3FA 1SY6H 3MBEB 3LQAL 4XRCA 5T1LA 5KVGH 1JZ2A 3F7RA 4M03A 5D1QD 4XNUL 3IFNL 1WCBB 2EH8L 1ZLVH 3WFHA 5CEZE 2FH8A 5B4MC 3RY4A 1BZ7A 2NY4C 1INEH 5D1ZA 4EQ3A 5TDNA 3BQUD 4P4RB 5EO1A 1FGNL 1V5JA 5C0IB 1ZHLA 4ZQKA 4BSWA 1KFAH 5D93C 1OAXL 4NYLB 5BV7L 4G8FA 4WI2A 1KG0B 1WITA 4IRSA 4NQTA 2V2XA 4LQ1A 4OBSA 3GDBA 1QNZL 1V7ML 2X09A 4PJIA 4MVBD 1FZJB 1ZS8B 1YC7A 2VL5B 3NH7L 1YNLH 1MWAL 1WAAE 4XNYL 3KPQA 4CADB 3IJYB 1VGEL 4JFHD 1I3UA 3ROLB 2R2HB 3SCMD 1ACZA 3DX6B 3FRPG 3SE4A 1IZJA 3BO8A 1A9BA 4LL9A 3MJGX 3VH8A 3CLFH 3TIEA 2X9YA 4HIJB 3TPUB 1X7QB 3H9HA 1HQRA 1D9KC 3EOBB 3KGRA 4Y4FB 3JV5A 4MXVE 4EVNB 3V6FA 5EZOL 5GRYA 1RMFH 2HG5B 4XCYA 3KPPA 1MF2L 3NIGE 2R23B 2XWTB 3HS0B 2PXYC 3SDCB 1KEMH 3ZKND 5HVGB 1UVQA 3LAFA 4W6WB 4UMGA 5DLMH 5D6DA 1RUAL 5DI8B 4R90L 4LNVA 4WEBH 3UBXA 1KIRB 3VWJD 5IB4B 4YIQA 3WV0A 3QQ9D 4X7EC 5HI3D 4BSVA 4G6FD 3O3AA 1F02I 5E8DL 3W0WE 4QHNB 4NJAH 1BFOB 1MCNA 1UM5L 3D18B 4PTUA 4HWBL 5HHVL 1BD2D 2Q3ZA 1Z6JT 1A7QH 5F1SA 4YBLC 2EZ0C 4KJYA 4P2RE 5FYJH 5FCUH 5TGBA 4HJJH 3WNLA 4YQXL 4HUVA 2JLLA 1IEBA 4X4ME 1A02N 3B3IA 2CRZA 3BPLC 2V2TB 4EI5A 1RZ8A 1E6OL 4QRQA 2GW5A 1T83A 4LCCA 2H3NB 1YPZE 4NN6B 3RWEB 5D96B 3VGAB 2EDFA 5LQBL 2LE9A 1NFIB 4C56E 4LLDA 2R4RH 3KJ4B 3QFJA 3JWNC 3LB6C 3PWVB 4G6AC 5DD0H 2NY6B 3BXNB 4I77H 4UAOC 3BKYL 3ZE2F 4BH8B 2B2XL 5DMKB 5ALCH 1CLCA 1IL1B 4RAUA 4A6YA 2Y9RT 3BZ4B 3V52L 2BY2A 2N7BA 2PR4L 5D7JA 1GGUA 3QCUL 1JMXA 1G0YR 1KLUA 2NY1D 4OZFA 2XV6B 2HMIC 4XP1H 4DGYH 4MNHB 5I74B 3OGOE 1F8TL 3IFOA 1Z3GH 3P4NA 4GW1A 1TETL 3MOBL 2WUBH 4TVSa 5CSZB 1JF6A 1JRHI 3QG7L 3U30B 5DRXB 4FQXC 3F7YA 3H9SD 4XBGA 4XWOC 3CD4A 3D85A 4NFCA 2FO4A 3BZFA 1LHZA 3V8CA 4I9WE 1AGFA 2W60B 4G8GB 1P2CB 3PHQA 4HS6A 2ICWB 2Z0BA 1XCQA 1EGJL 4X8XA 3GI8H 5I16B 4XPBH 1NCAL 4KTEH 2IC2A 4JRYA 5DMGD 3ARGB 2ICES 1MLBB 1F6FB 4F9LA 1Z5LB 3HI6H 2KZWA 4P2OB 1KCUH 3OKOA 3RGHA 1VA9A 2X5PA 5BV7B 2DJ4A 3RTQD 3NCMA 3FO1B 3MRPB 1TXKA 4UBDD 4Q9RL 4WW2C 5EZLA 2UUDK 5EUOA 1KPVA 1A7NL 3RQ3A 1MWAB 1JHKL 4FQQB 3WL9B 4AIZA 5HGAA 1CXLA 4IIQC 2BNRE 2GTWB 1DSFL 1Q9WA 2GT9B 4M8VA 5GRVL 2Q76B 3U4AA 4XWGH 2BNUB 3QFJE 1N8ZA 3JXAA 3WD5H 4JGUA 2VLRE 4HKZB 3OKDB 4ODTL 4NO5A 4L8CA 1DBKH 1YEHL 3BSZH 3BDYH 4JFQB 4LEXH 3NFNB 1MFBL 2HN7B 4XNZC 4PJDB 1KC5H 3SDXB 2BVPA 5IBTH 1T2XA 2FLRT 4P59H 4Z6AT 2AJXH 1I9IL 1N5YH 5JQ6H 2CDEB 3ARBD 3R06B 4W68A 3LVEA 4N0UA 4NO3B 1H8SA 4NJ9L 3BEWB 4GRWF 5EO9A 1E27B 4I18A 3DROB 2VDRL 4RQQA 4F15B 3HG1D 3MLWL 4KDWA 2I24N 2EDWA 4HBQA 3BT2L 2QQLL 4OUUA 5TJWK 3O8XB 4BKLB 1UACL 1ZWIA 3FAWA 4ZFOL 3GB7A 5A1AA 4U1IB 4YPGA 1GGBL 5ISZA 4Q6IB 1DLFH 5FDWA 2FATL 1A5FL 3N1GC 4PBVC 2Y07H 1HCFX 4PJCB 3NA4A 4Y19B 3M8OH 3RPKA 2UYLA 2A77H 5T3ZL 2XQBH 3R4DA 4U3HA 1NGPL 2AJZA 4YK4B 1CLYL 3TBYA 1PJ9A 4O2EA 2IG2H 3RDTC 2BXYA 3CSYB 5L88H 5T33H 4H5SA 5ID0A 1BFVH 4XP5L 4KI5E 2ZUVA 2OTPA 1QQDA 1FG2A 1OTTC 4PGZA 4JLRB 5INDB 4PJIF 2P7TB 3IFLH 1N64L 1MIMH 2X7LB 2NZ9D 1R24A 1NCCL 4MJIE 3ZLQC 3QUYA 5EUOE 3MMEB 1AQKH 1PQZA 3OMZA 4YDVB 1CF8H 4G9FA 1EO8L 1K8IA 4P9ML 4MA3A 2GUOB 1U41A 3MRIB 1F45A 4U6HB 5I76A 1CZ8L 2DQCL 5ENWB 3UPCA 4Z7VE 5GSRA 4NM4L 1T7YA 2FNBA 2ZUWA 4DUXA 5IG7A 1Q1JH 5DJXB 3CXHK 4JRXD 1NPUA 4TUJB 1ZE3C 4HFUH 4KRMB 3KPSD 5FYKL 2BSTB 1B0RA 3UJTL 4L8SA 9CGTA 5E99H 3QZWG 4WCYH 4CVXA 4RGNC 3QI9C 4JY4B 2R4SH 1KTLA 2OTWA 3H3KA 2CUMA 3G9AB 4ZAKC 43CAA 2BXZA 5FUCE 3AC0A 5I1CH 3GMPA 3VFGL 2DTML 2VTFA 2IPUK 4R2GC 5IBUG 5SWQA 5DRZA 4PGBA 2MHAA 4POUB 3EKCA 2ED8A 1JHLH 3IDMB 5CEYB 1T1YA 4OGYL 4PJ7E 4XAKD 5C3TA 3OKLB 5IEHA 1A3QA 4TUOB 4CU8A 4L3EB 5E7FA 1I1CA 1D5XA 4LBEB 2F53B 1I85C 4J23A 43C9B 2FJHB 3LZFH 2NPLX 2WIIA 4OKVA 4NNPL 5I75C 4XH2A 1XF4A 3QUXC 2DQEH 1P7KA 1FFQA 3W9DB 2MKWA 1NC4B 3CXDH 2F54B 3HFMH 4FTVA 4ELKA 2NW3A 3AAZB 3EGSB 1U9KA 1N4XH 4Q2ZB 2K7PA 4YBQD 1WCQA 1X5XA 3VGHA 2YBRB 3VFTB 1OAQH 3C6SB 4G7YH 3WXWH 3O11B 5EC1A 3QUKB 3NCCB 3N1PC 1OHQA 3FQUB 3W39B 1N6VA 5I15H 3N9GL 2OK0H 2ZUQB 5SWZD 5AG9A 4LHUA 5D1XB 3W81A 4IDLA 4Q0XL 3ARSA 1U3HC 1MFAL 1A1NA 3UJJL 5HYSB 3VXQB 1OF2B 2BMKA 3QA3A 2GFBB 2F15A 3QIWD 2VLKB 5J1AB 3FT2A 4H25B 4UQ2B 1NCWL 5EFIB 4ELMB 1FN4B 4NHUE 4WFHD 3LV3B 1IAIH 4PJGB 1FFNA 4ZUVB 5T1KA 1U36A 4ZFOB 1AO7B 2BOCA 2DDQL 3HUJA 3JTTA 4RMRA 1FV1B 4ZO7A 3RNQA 4QY8A 5ANMB 3OF6A 2QSQA 5CWSA 3K4DA 4ORZC 1H5BA 4PJ9D 3QISA 3O9WC 4IEFB 4OZGA 3G5YA 5EOTA 4EBQH 5BMFL 1QLRB 3QIBC 4PV9B 1OSPH 3FQWA 2FWOB 1U92B 3DRQA 2VZTA 3O4OC 5EPMB 3ROOB 4ZPTA 5CCKH 3VXPA 3QUML 5DJ0B 1MCHA 5K59E 1JNNH 2DLIA 4OLXL 2CO7B 2VXQL 4LHJB 5JOFB 3HNVL 1F3JB 1DUZB 3WUWB 1TJGH 3ESUF 5E9DE 3TPKA 3JVGC 4PJ5A 2WP3T 4P2YA 5DSCB 2QQKH 1L6XA 1OY3B 4HJGA 5DD3H 1RUMH 1EFXA 5TH2A 1VSCA 3GJFA 2RAMA 3LRSA 5BVJB 4P5KB 5A16B 1E0OB 2ED9A 4RFOH 5DVKA 3RA7H 2VNCA 4HUWA 4ZNCD 5MEND 1U8QB 3MV7D 5I1DB 1D5ZA 5DTFA 4ZFGL 3ELAT 3GEWB 3TBSA 3IVKA 5C0GA 3TN0B 2VLJD 1RJLA 5CJQH 5ESQB 5I8EB 4I3RH 4CU7A 5H37H 3LPGA 2C1PB 4HUMB 1U2CA 4Q9CA 5FKAA 4Z77A 3L3OB 2Y4SA 4MSWB 3S8WA 3S6CA 1G7PB 1NAKH 1UWGL 1NGQL 2X4SA 2X4OB 2RFXB 3BGAA 2VXTH 4LKCB 4TOYL 5F72S 1JGUH 2X4RB 1D5MB 12E8L 1WGOA 2BJMH 4AEFA 3T3PF 4HZLB 5J3HD 3HRZB 3GKWL 3AVEA 4KI1A 1A7RL 4RMWA 3LS4H 3DX9A 3V95A 4K3EH 4OZFH 3VFPA 5LJYH 4MD5B 3CVHH 5IVNA 4JVUA 1FLRH 5DJ6A 2E6JA 5FYLE 4WNQA 1LVEA 4WTXA 1L9MA 4RFNB 3BH9A 2J6EA 1NEZA 5E2WL 4EDWL 3I50H 3QRGL 4POYA 4TVPL 3VFRA 5DJDA 4EQ2A 3V8OA 4WVRA 1MCCA 4XCFH 2VRAA 4MJ6A 5TDPB 1XEDA 3GSOB 2IQAA 3IYLW 1MAMH 5FM5O 1VPOH 1TTGA 4WFGE 4PG9A 4ZTPL 4WTZG 5JO5B 1DQMH 1NBVL 2C4FT 3NZ8B 3SY0A 4LQFH 4HLZG 5B39B 3PWPE 1MHCA 4Y5VC 4N8VA 4FQJL 2ZG2A 4P9HH 3HI5H 1VFUA 2ATKB 4HQQL 4NNYB 5F7WC 3FOMB 1T0NB 5EOQL 5F9WB 5ERWB 4APQA 4N0CD 3V0WH 5D6CB 3DIFB 2AK4B 4P4RA 1E4WH 5D4QA 3VRLF 4BYHA 1YEEL 5C0IA 1A6TB 2ORBL 1J1PL 3ZT5A 1AIFB 4NYLA 4PS4L 1KULA 1KG0A 5JNYB 2VE6B 3OWEA 3PP4H 4JHWH 3PDDA 4KZDL 1FZJA 1P4IL 1ZS8A 5AZEH 1K4CB 5ICXB 2VL5A 1CGTA 5GZNC 4CJ0A 2F5BL 3QIUC 4XVJL 3EYFB 2AEWA 3PIQB 4CADA 3IJYA 2F58H 3ROLA 2R2HA 2VDKL 3DX6A 5F7NC 5DHXB 4LSSL 3VCLA 5I1IH 3QUMB 4HC1H 4GAJH 4MD0A 4U1KB 5FGCE 1UJ3A 5F7YC 1ZLWH 4HIJA 4KRPD 3TPUA 5EWIH 1X7QA 5F7DB 1H3WM 3SE8L 5DJZB 3NCEB 5F1NB 4IJ3C 4S0TD 3EOBA 2O61B 4Y4FA 4WJ5B 3DGCR 4EVNA 4XB7A 4NN5B 3CFEB 3TJEL 5C08D 3UYRH 2R23A 2XWTA 3HS0A 4QOKB 2VXVL 1YYML 3FB8B 3SDCA 1SMOA 2CUHA 5E0QA 3VFWB 5DA4A 4M4PA 3MLZL 1JGDB 4Z9KB 4C55A 1RI8A 4WWKD 1A7PH 5DI8A 1OOAA 5F1IB 1KIRA 2C4FU 5IB4A 2YA1A 3AB0C 5HDOA 4AEEA 5HBBA 1WFOA 4QHNA 3OKEA 1BFOA 3D18A 5GRJH 1JZ8A 3OTTA 4GBXD 2JB6B 1C1EH 4PFEA 1DQDH 1PFCA 2OQJB 5FB8B 5I1KL 4GS7B 1CK0H 2V2TA 4KHTL 1PY4A 2EDKA 4ZOEA 5D70L 2H3NA 3U7AA 2ARJQ 3RWEA 3HUJF 5H2BA 3KPMB 2P24B 1NFIA 2NXZD 2P4AB 5IP4A 2YD2A 1GC1C 3PWVA 3QHZH 1FNGA 5CUSH 3EOTL 1GZPA 2Z4QB 3QEGH 1TJIL 3WE6B 4M48H 3BXNA 5D72H 4TSAL 4E5XB 4XC3H 1GGCL 2F9BT 3DI3B 4B53A 1U58B 4OZGF 4BH8A 4HG4J 2X89D 5DMKA 4A2MA 2YUVA 3KXFD 2PYEE 1IL1A 1SBBA 4OFKA 1QD0A 3IT8D 2D31B 1MHHB 4FNLH 2QQQA 5EOCL 4DGIH 3ARZA 1YMHB 4URTB 4F37F 4QWWD 3RZCD 1DVFB 5FUOH 3LH2H 4MNHA 4U1MB 5BOPA 5CSZA 1G9NC 4KV5F 2Q20A 5DRXA 2AAVA 5HI5C 4KDVA 4KROD 4I2XB 4Z5RA 2DN7A 5KS9E 1P7QB 4HS3B 4LK4A 4G8GA 4OLUL 2NX5B 1YQVL 5D7IB 4N90E 4NUGH 4S10A 2VC2L 2O5XL 5I16A 1INDH 4WFEE 3D6GA 2NMSA 3ARGA 2YOCA 1MLBA 4NKIL 4PJHE 1NGYA 2MNUA 1GVIA 1QYGH 3GMMB 5DJAB 1Z5LA 3HNSL 1CXEA 4DUWA 3N0PB 1J0YA 3IDXH 4MQ7A 5D9SB 1C5BL 5B4MD 2NY4D 4KFZC 5CJOH 3S7GA 1WFTA 3FO1A 2BRRH 4M43L 1X5YA 1FNEB 1EZVX 3I2CH 2ZCLH 1CR9H 4IMLB 1YEGL 3TV3L 5DZOA 1RZGB 4L29B 1MWAA 4FQQA 1V3LA 3C5JB 3WL9A 3VXRD 2B1HL 1E4XL 2C7UA 3EYVB 5EC2B 4MB3A 2GTWA 1MCLA 2GT9A 1KB5L 2ZKHL 1RZKL 4MA7L 2XN9D 4IS6B 3C60C 1WIOA 1H0DB 3PP3K 2BNUA 4YE4H 4AY0A 2ZPKL 5HSFA 1F3DJ 4P23C 4HKZA 3OKDA 2H2SC 3TZVC 4GKNB 2VDNH 3GI9H 4JFQA 4LPXA 3NFNA 3NTCL 3EO1B 2BSRB 2B7DT 2HN7A 3G08B 2OXHA 1EDQA 2E8ZA 2DD8L 3TF7C 4PJDA 5EZJB 1OGAD 3SDXA 3ZE0E 4G43B 3DECA 3RVTC 3FO9A 2CDEA 3HC4H 3PDOB 3R06A 3STBA 1EV2E 2VKXA 4NO3A 3MV9B 1D9KD 3BEWA 3BAEH 3GHEL 2MTPA 4XVUC 5E08L 1E27A 1MFEL 2VLLB 3DROA 3KPRD 3FT3B 3T1WA 1NMBH 4YBLB 3P4LA 1SHMA 4BKLA 3O8XA 1O5DT 4WEMB 5BCAA 2PXYD 3H7LA 4Q6IA 2JJVA 3LQZB 4UB0H 4PJCA 4HWBA 3M17B 4RA3A 4KWUA 4NO0B 4Y19A 3E6FB 5JLZB 2FECL 1W8NA 2CPCA 4HBCL 3K80A 3CSYA 4B5EA 3KPOB 3MOQA 5E2UL 3FKUS 4GLRH 3VWKC 1WV7T 4W4OA 1BREA 3OR6B 2R2BA 1WWBX 2CK2A 3P73A 35C8L 2EZ0D 3QQ4B 2WLZA 4JLRA 5MP6H 5INDA 4GMTH 1QRND 4KJWC 1TZHA 4X6CE 1RIVL 4XPHL 5DK2B 3GJFH 2X7LA 3SN6N 1EJ6A 3Q1SH 2XKNB 4RBPK 3GHBL 3CFCH 3V5DB 3LB6D 1XGRB 4YDVA 3U4EB 1GXEA 3TJHA 3B9KC 4JN1L 4KK9C 2GUOA 3MRIA 4H88H 5LBSL 4U6HA 1AGDB 2W9EH 4J3OC 4Y8DC 5ENWA 2VXUH 4LLVB 5K93A 1TPXC 1J0JA 4OT1L 1UT9A 4HPYL 5DJXA 1XGQB 3ULUC 1P4BL 4TUJA 4LSPL 5AZ2H 5B38B 4HWNA 3L7FB 1X6NA 2HMID 4XAWL 4X6DB 5JA8B 2BSTA 3L5HA 1TITA 5ACZB 4GMSH 1AHWC 4GUPB 5IB5B 3MNVB 1HINL 4JY4A 5IB2B 5DEZA 4X9HA 3SDXE 3RUGB 3OKNB 4FQXD 4TTGA 1AQDA 1EGJA 2DMKA 3RU8H 1R3HB 3QSKB 4KMTL 2PF6A 3CU1A 2P44B 4HXBL 2VSCA 1OWWA 5ETUB 2CH8A 3V7AG 1ZVHA 5TQ0H 5C0DB 4TYUA 1MJ8H 3HE7A 3IDMA 3U9UB 5ADOH 4MS8A 2J6EH 4AQOA 1HK6A 1CICB 3BPNB 1ZLVK 3OKLA 4IOIB 4TUOA 1FIGL 4L3EA 1N6UA 2R29L 1P84K 2R0ZH 4JM2B 1GJIA 3VXUD 4PJCE 3CDCA 2OZ4H 2PCPB 1LK3H 4DZ8B 4N1CA 4JFDB 4FFVD 2CXKA 5EBMB 5I6XC 1ACYH 2DKMA 4UV4H 4JR9H 1G7HB 1JPFB 4L4VB 3W9DA 4JFYB 3ZE1E 5FUZL 3E3QE 1NC4A 3K2UH 2F54A 3ARDC 1BEYL 4OQ1A 4CDHA 3EGSA 2G5RA 4LVHB 1QKZH 2PTVA 2BY3A 4Q2ZA 3KG5A 2YBRA 3O6FB 3VFTA 3C6SA 3V5HB 3BMVA 3O11A 2NY2C 3QUKA 1OM3H 5DDHB 5SX4H 1RU9L 3W39A 3H2WA 3BPOC 2NYYC 4KJQC 5D1XA 2EYTB 3F62A 4Y2DC 4M6AA 3S34H 5HYSA 1UH3A 1OF2A 5DD1H 3ECBB 4ZS7H 4XC1L 2GFBA 1NGXA 4LARH 2G60L 2VLKA 5J1AA 1KELH 1U8MB 4H25A 4L9LC 4BQ8A 4KTYA 1RUKH 3MLRL 4UQ2A 2J4WL 4WY7L 5EFIA 4ELMA 1FN4A 3IJSB 5L2JB 3LV3A 3BFOA 4PJGA 4ZUVA 3L5XL 4ZFOA 1AO7A 1FV1A 1CE1L 2XIDA 1TLKA 5ANMA 1XR9B 4HWUA 1NC2D 4YFEA 3N85H 2R8SL 1SVZA 3GRWL 3VXMA 1JL8A 5LGHH 3QWQB 3STLB 1UGNA 2QQNH 3KWWB 1QLRA 4PV9A 4ESKA 5C2BH 5E8NB 4HMDA 2FWOA 4ODUA 1BZ9B 1U92A 5EPMA 3ROOA 2RCSH 1NUFA 4JFFD 4D9LL 4FXLA 5DJ0A 1N7ML 1S78C 1IGJB 3T8XB 2C3WA 2ESVE 5I8CA 2F8VA 3DHMA 4I4WB 3RDTD 2XTJE 4KJPC 4PJAB 1OW0A 3QP3A 5JOFA 1OTTD 1ZANL 4F80A 1F3JA 4LIQL 1DUZA 3WUWA 4DOHE 4EDXA 4GQPH 4PRAB 1AY1H 2OR9L 3LSOB 1BWMA 3NGBC 1N5AB 4MJ2A 3QT2A 5HY9B 2MQCA 3V6OE 1ADQH 3CMOL 5BZWB 3BP7B 4RGNB 4YHOL 4Y89A 4P5KA 4J1UA 5A16A 1IM9D 5CZVL 4OIIL 1ZMYA 1U8QA 5DRNB 4OCLC 1HZHH 2M1KA 5I1DA 1CTOA 3SBWA 1S3KL 1JNHB 1OPGH 1UWEH 2FD6H 1MCIA 3TN0A 2VAAB 4PJDF 1JZ5A 5ESQA 1C7SA 5I8EA 2Y23A 3NACL 3T1FB 3KHOA 2C1PA 4KXZI 1HHKB 5EU7C 4CW1B 1GYAA 2BC4B 3HAEB 2YWYA 3ZKXC 4F8TA 1G6VK 4NQCB 2ID5A 4CUCA 3JWOL 5GZOC 3L3OA 4MSWA 3QI9D 3HZMA 1G7PA 15C8H 1U8NB 2YK1H 1S9XB 5DEFB 1IT9L 2X4OA 4ZAKD 2RFXA 2Q8BL 4LKCA 5KVDH 4JDTL 4X80H 2X4RA 4KY1L 1D5MA 5I75B 4TQEL 1TTFA 1UWXH 4M1GL 3O2DL 4HZLA 5J6GB 1YC8A 2AQ2A 3HRZA 4O51B 5KBNC 4R2GD 2CLVB 3A6BL 5DMIH 3VI4E 4MD5A 4MNQE 3ERYA 3I02B 4PD4J 3I6GB 3VXME 3QJFB 4JQIL 3UJIH 2I9LB 5D5ME 4K2UL 5J9PB 2DJSA 3VI3F 1YEIL 3FO0L 1CWVA 1J1OH 3JWDC 3ALWA 2J8UB 3LHPH 4OM0H 3RJDA 3QUZC 2AK1H 3PABB 5I1JL 3UTTB 1KSRA 1KN2L 2LAGB 3C08H 5TDPA 1VFOA 3FCTB 5HYJB 3GSOA 3KVQA 4QTIH 3QUXD 3C6LC 3SDAB 2VDLL 3IFNH 2YUXA 4BFIB 1DQQB 5JO5A 4Q58C 2EH8H 4BZ1L 1PZ5B 4ONHB 2EKSB 2V6HA 2BRQA 5B39A 1P7HL 3T0EC 5L0QB 4NQDE 4OZFG 4HK0B 2DI7A 2P5WB 2ATKA 4NNYA 1J8HD 4KGJA 4ZYKB 1OP5H 3FOMA 4OZHE 5I73C 5BV7H 1QG3A 4BK5A 3PQYD 4OBRA 4JO3H 4G42A 4Z18A 5D6CA 2NY5H 1QNZH 3DIFA 1V7MH 2V17H 1PVHA 3EYQC 3RIFK 2AK4A 1U3HD 1CD1B 3ARWA 2VZ1A 3ESVF 4IDJL 1JPTL 3NH7H 1K85A 1AIFA 1KENH 1MWAH 1WSST 2VE6A 5JNYA 1UH4A 3UYPA 5HGBB 2DQHL 1R5WB 3VRIB 1LO0H 3RFZC 2BNQE 5D2LF 2L4OA 1K4CA 1MVUA 1AD0B 3WXVL 2GJ6B 4MA8L 2FCBA 4H8WH 4M3KB 2VDPL 1B6DA 3EYFA 5KG9A 3QDGB 3GBLA 1F4WL 2APVA 4KK5C 2X1PA 5L2KE 5F70A 3DBXB 3WO3B 4HFWB 1X5LA 1I1RA 3O9WD 4ODSH 3QUMA 4S1DC 2DQJL 1QEWB 4G6JL 4U1KA 3KLHC 2B4CL 3SKMA 5KVMC 3QIBD 3GMQB 4JKWA 1CD9B 1MF2H 5DUPH 3FN9A 3QEQA 4KC3B 4EN3C 4JKKA 2JK5A 2KBGA 5F7DA 5HYEA 1A3RL 2WUCL 3NPSC 5LWYH 4HXAH 5DJZA 5F1NA 3EO9L 1MSPA 4PJFB 1ORQA 2O61A 4JANB 4R90H 3F7QA 5HHMB 5I1LB 1VENA 3CFEA 1JYNA 4HWEL 3NCJL 4OGXH 2A0LC 1QSEB 2ZSWA 4QOKA 4PGJA 1JCKA 2LAAA 1UM5H 3VFWA 4QRPA 1JGDA 5HHVH 2FBJL 1Z0MA 1T89A 5F1IA 3FO2B 5JOPD 4X0KB 2PW2B 4XMPL 2CO6B 3FFCE 4J4PC 3FB5B 1E6OH 2W07A 2JB6A 2WBKA 3ULVE 1G6RL 2OQJA 3NABL 5FB8A 1ZT7A 2DM7A 4FFYH 3E1F1 1IGCL 2KUTA 4L4TD 2E7LA 4HHAB 2WINB 4D3CL 4Y16B 3TBWB 3SO3C 4PJGF 1WUNT 4PJXE 5C0CA 3HKFA 4M7LH 4M1CC 3ZHLA 3ZYIA 3ARBB 1JFMA 3KPMA 4NQEE 2P24A 3B2UD 4P4KC 2PR4H 4K3HA 4ZXBC 1T1WB 4MA1B 2B5IC 3WE6A 5CP3H 4E5XA 4GJTB 1U58A 4N1EA 4Q9QH 5E24E 1TETH 4NWUL 1ORSA 1AGEB 4BZ2H 1EEZB 2D31A 3L3IB 1MHHA 7CGTA 1S9WA 1Q94B 3QCTL 1TJHH 1DVFA 1NFDB 2LU3A 4U1MA 1HSBB 5DURB 3UTSD 5B8CA 3HTLX 1RPQA 2YRPA 1TZGH 1FRGL 3SJVB 2I9TB 1EGJH 3QEQE 4NQUA 2C3VA 1NCAH 1IGYB 2VMFA 4I2XA 5I0DA 2KPNA 1IGMH 4LKXB 1F90L 2AI0L 5DFVC 5C0FB 1R3IL 6CGTA 1WZKA 1P7QA 4HS3A 4XMKL 1JZ6A 2NX5A 5D7IA 3V6BR 2H6PB 1DANT 3H6JA 3AFLA 5ESVB 1GOFA 3I6LD 1MCBA 2H1PH 2OCFD 3MV8B 3WFBL 3HLAB 4J6RH 4QRPE 3GMMA 1RJCA 5DJAA 1FQ9C 3O0RL 1AKJD 1DBML 3AMLA 1IC5L 4UUJB 1C12B 2ARWA 5F44A 1JHKH 2WNGA 5FM5M 4RMTA 5D9SA 4R0LA 1OL0A 4CAGA 1T7VA 4LLWB 2KQMA 4F7CA 2DQTL 1NCBH 5C86A 5KSAB 1B4JL 1FNEA 1DSFH 1Z9OA 4QNPF 4NRZB 3HC3H 2VR9A 1BHGA 4IMLA 4MD4A 4FOMA 1RZGA 4L29A 3C5JA 4ODTH 5DJ2B 3EYVA 2UZIL 5C0CE 2APXA 4HK3J 5GZND 2R1YB 4IS6A 3N1FC 3QIUD 3VW3L 4HAGA 4DTGL 4WV1C 1YECL 2W65B 1GH7A 5T5FL 5CINL 1MI5D 4GKNA 4L4JA 3V6ZB 4NJ9H 5JHDD 4YHKL 3EO1A 2BSRA 3G08A 2WWMD 2VDRH 4JG0H 2FL5B 3BT2H 5D1ZC 5CBEB 4G43A 1KF9B 1GGBH 2XRAL 1V3MA 3PDOA 4QKXB 4JO1L 4S0UC 3WDIA 1A5FH 3IAPA 1LDPL 2A1WH 1U91B 4IRSC 3SGDH 4X4YB 2VLLA 2NR6C 2DYPB 3MOAL 2EXYC 4LCWE 5T3ZH 4M1DL 4TSCL 2V5RA 4JJ5B 4GRLB 5JPNB 1O0VA 2AJSL 4U1HB 4LSTL 3HNTH 4XP5H 1DANU 4QHLB 3M17A 1G6RB 3E6FA 3W2DH 2D7MA 4X7SL 5F9OL 3SE4C 1A0QH 5C07D 3T0WA 2QSCL 3MGOB 4AG4L 5DZNA 2ARJA 1G0XA 3KPOA 3ME0A 3O6LH 4YPJA 1OGTB 1YMME 4G8IB 1DFBL 3OR6A 4FQLH 4RMQA 3BUYB 2P46B 3QQ4A 4PIRF 3SGJA 5C0RH 4P9MH 2H45A 3QIWB 3UX9B 3U7YL 1NLDH 2PTTB 1OAUL 3OJ2C 1CZ8H 3ALXA 5DK2A 1WBZB 2YD8A 2EDJA 2JCCB 4YGAB 2IBZX 1XGRA 3FAXA 4PG2A 3U4EA 4PJ8B 3MRGB 3CH8A 3HMWH 1ZHNB 5D6DC 5FYKH 1AGDA 5GHWH 3LKRA 3DETD 3IDJB 2NY3C 1URLA 4DKDC 5EH1A 1XGQA 3DXAE 1KCRL 3CFKB 3TLRA 5B38A 2P49B 1FYTE 3DI2B 2X44D 3L7FA 3VFGH 4X6DA 1Q38A 2DTMH 1PKOA 5ACZA 1S7UB 4LU5L 4GUPA 1LO5A 1ZT4B 3MNVA 5GRXG 3MLUH 5C0BE 5JXED 5IB2A 1J12A 2VABA 4EI5C 4PRIB 1TTUA 3TIDB 3I85A 5HI5D 5FYJU 1UCBL 1T83C