4APQA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
290
structure length
290
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4apqA01
5FDWA 2FHCA 3DECA 5CZVL 4Y4HA 1VFBA 1EFXB 1JZ8A 3PP4L 3JV6B 4YQXL 5IHZA 1YUHB 4TSCL 3FJTA 2ZUYA 3I6KB 4LVEA 4E41D 1IC1A 2DLTA 2FO1A 2AEPH 3X3FH 5D6DC 4ZAKA 3GSQA 2COQA 2R1XA 1CDJA 5EUKB 5FOJA 3EDJA 3ZYOA 1HQ4B 1AGDB 2NY6C 4MNGE 2VISB 4ELMF 5F1NA 4MJ5B 5A2FA 2B1HH 4WU5A 2AK4A 5F7KC 2ENSA 3ZSTA 3MFFB 3RPIA 4KQ4L 3WDJA 2MPAL 1RVFH 3EHBC 3HRPA 5GS1C 4L8CA 1D5BB 1SYSA 1OTTD 5HYSB 3ULVF 4MAYB 2VLJE 3F58L 4MQXC 4WV1C 5FUOL 5CD3B 5KVMC 1H3WM 1U2CA 4N0YH 3GSRB 1GAFL 3C5SB 1T66D 4GRWE 2XTLA 4X6CF 2QSTA 1HQRA 3FQWB 2FB4H 1JBJA 2F5BL 5F6HJ 3KYKH 3GMNA 3NABL 3B9KD 1EEYA 1PZ5A 5ID0B 5H35A 2VMFA 3MRCA 1RAMA 3FQXB 1INQB 1U42A 3B2UD 5JNYA 4OV6F 5GS0D 1ETZA 4ODSL 2RFXB 4KI1A 2YD6A 1BBJB 4YWGL 1IT9L 1QLEH 3LEXB 3K0WA 1H3TA 4K7PH 2MQ3A 1S9XB 4NZUL 4WNQB 2DDQH 3O4OB 5FYJE 1XF3A 1B3JA 1IGMH 4JPWH 4BSJA 4KPHL 4LDLB 2ZNXA 1ERNA 1FZKA 3QG7L 1RIHH 4LBEB 3BN3B 4RQQB 3ULVH 1K3IA 2VDLH 2X44D 5E70A 4X0KA 4HIJA 2IFFH 4M1DL 2FGWL 3BGFB 2EDRA 1VFAA 1OARL 5CZXD 4P4KB 5K9JL 3JV6A 1MCWW 2ENYA 2O5XL 3I6KA 4X4YA 3ILPA 1I7TA 2PXYC 4M6OH 1MEXH 1IC7L 2DLHA 2LAGB 2JCCB 4J7RA 5D2NB 4IHOB 3E2HB 1RURH 4HXBL 2CQVA 5BZWA 2OSLA 4Y1AB 4PGBA 3RVVD 3QO1B 5EUKA 4K8RH 1TDQA 1GPOL 3T0WA 2Z31C 3W2DH 2VOTA 1QVOA 2DQEH 4HWBH 4LLDB 4G6FD 3S96A 1AGDA 1YMMD 3SCMD 4NZTH 4KAQH 1FCCA 4TQEL 4MJ5A 4S1SH 4EQ3A 3BO8A 3QFJB 5C08B 1CGVA 2XIDA 4OF5A 1BIHA 3HPJA 1R0AL 3P0VH 3IFNL 3P77B 4S10A 3PL6A 4KJQC 5E8PB 4Z7WF 4JVUA 5EU6A 1YY9C 2XI9A 4XCFL 1D5BA 4MAYA 3RY6A 2VDNL 1NFIA 4P2OB 4GAFB 2XQBH 1T0MB 1ZANH 2V2WB 4JRXB 1X5YA 1UWXH 4OF3A 4PRPB 4U1HB 2XTJB 3C5SA 4YZFE 4Z8FL 1XF1A 4Q9QH 5EORL 4R90L 4NRYA 5MEOB 2GUOB 3PWVA 3GMQA 5HDLA 4MAUL 3CC5B 5DJ0B 2AEIT 1G7JB 2DOCA 1INQA 2H9GB 2QR0A 4JO2L 1FIGH 1Z6JT 4I77L 3U4BL 3D39D 4N0CD 4YEFA 2ATPB 1MCRA 4G6ML 4JFYB 1S9XA 4PLJD 4GKSA 3G08A 2OXGA 3QXWA 1G9NH 3MRDB 1AFVH 1ZT4B 4XP5H 1U41A 3CU7A 4YBHA 4LBEA 4JN1H 1JE6A 3C8DA 2E9WA 5MI0C 1OLLA 1RUMH 2YUXA 4X99A 3SDXA 5DO2D 4OAWB 5EIIB 4YDIH 1E28A 3W39B 2ERJC 4WI5A 5IUSA 2DQIH 4POZC 1YN7B 4R0LA 4FN0A 3CFJA 4KV5E 3OX8A 4IS6A 5T1DL 4KZEH 4PJ9B 1Z2KA 3EYQC 1WCBB 2FJGB 2Y72A 4U6HB 5EC1B 4CJ1A 4IHOA 1KT2B 1EGJL 4GG8A 4P5MA 3BISA 4Y1AA 3QRGH 2QKIB 2ZP0T 3OAUL 4RMSA 3U0TB 1RFDH 2GAZB 4LLDA 4NHUE 1SMOA 4FQCL 3OF6D 2PNDA 3O45B 5HGDA 1YMME 4MHHG 5J06A 3IFPA 2X89D 2WWKO 4DN4L 3UO1L 3NFNA 4NPYB 1GCFA 3OKLA 3HG1B 1NDGA 1NGXA 4PJ8A 2YD2A 2E5EA 4JR9L 1OWRM 4GXUN 1QFHA 1E6JL 4P2OA 1T0MA 2FO4B 2VRAA 4IOSD 2F74A 4JRXA 4HFUL 4IMLB 4KK5D 3RIAK 2PUQT 2JJVA 4XPTL 4LAQL 2VR4A 4NSKA 4WFFD 1BX2A 3MGOA 3S35X 1QSFD 1Y6NR 3MCG1 1IFHL 2JLLA 2E6PA 4P5TA 3C87A 4MQTB 3E8UL 1BEYL 3CLFH 3T4AB 5HI3D 1X4YA 1J88A 3FT3A 1LD9B 5IV2A 1PSKL 4FHBD 1CE1L 4O02H 2Y9RT 1QHPA 4JFYA 3D39E 4FQXD 4DFIA 2VDRH 3GI9L 4M5YL 4YHPB 2V17L 4O9HH 2ZJSH 3MRDA 1ZT4A 4HIIB 1DBKL 3HS0B 3W11C 5EU4B 4BSVA 3F7QA 3CSYB 1VEMA 4JZOB 1TZGH 3U82B 1MCDA 5E6IB 2HH0L 3GBML 4MAYC 3E6FA 4PB0L 5EIIA 3HUJA 1U3JA 1IGJB 3T0DA 5GRVL 3QUKB 4OSUL 3IRPX 4MXVE 1BOYA 1IGTB 4XNMB 3VMNA 4ZXBB 1WCBA 2DYPD 4JFEB 1KT2A 4LPWA 1X3DA 4PLKC 2QKIA 1KN2H 4YBQC 4DKEL 4PJAA 1IAIM 3VCLB 2F15A 4JFZL 5I73B 2GAZA 2HLAB 4PBVC 1T7VA 3O4OC 1RIUH 4N0RA 5FGRA 3TIEA 5CD5C 1JHLL 4QXUL 2P8PB 5CIPH 1L0QA 1T2QL 3Q5TA 1YEGH 1FL6B 4G8FA 4NQVB 1CGYA 4Y7MA 5C8JB 1P4LA 5SV4A 2VLLB 1XGUB 3U83A 4UIMB 2IGFH 1ITBB 1MJ7L 2PR4L 5DMGC 3S3PA 1I8MA 4Y16A 3BGFC 2HP4A 1CXFA 1HIMH 4HJGB 3V79C 4P4KC 4PFEA 4RFEB 5TF1L 4KXZH 4Y2DA 1P7QB 5LWYL 4FFZL 1HE7A 4LF3B 5K9QI 1EX0A 5I16B 4M48H 1QRNA 4IMLA 3NCYP 4J1UA 5J1SC 1X44A 4L3AA 5D2NC 5GRXG 3E2HC 2P42B 5HI4C 1Y6MR 4F3FB 1I3UA 1K6QH 4J23A 1J1PH 1QSFE 3MUGB 2N7BA 2PW2B 3QDJD 1UM6H 4YPGB 5T5FH 1RY7B 3BEWB 2YK1L 1MFEL 3TJEH 1LD9A 4MJIB 3ZDYE 5I8CB 3AMLA 4QWWD 2HJKB 5DJXB 2P49B 1R5WB 1SJEA 1W0VB 4X9GA 1WT5A 3V0WL 3HE7D 3SKUD 2X7LA 4EJ1C 4HIIA 1LK3L 4PJ8C 2WIMA 3EFFB 4JZOA 5CGTA 5LBSH 2X4SA 1JGDB 4WFHD 3O0RL 5EBMB 2E7LE 4NQDD 4P2OC 4UZGA 3S37X 1JMXA 3VGEA 2NYYC 1IGJA 3L5WB 3G5XB 3QUKA 5EU6E 4ZS6C 1PKQE 2XTJC 3GI8H 2L7UA 2D7TL 4ZXBA 2BRRL 4JM2B 5ISZD 3GK8H 1BZ9B 1XF2B 2EXWD 3D0LB 2B0SL 4OLUH 4YH6A 3RPKA 5K9QG 2JB6A 5I18L 4JB9L 2BOBB 4PGEB 4JO1H 5T1LA 1NBVL 2HWZH 3QIUB 2AEQH 2HLAA 5D7SL 4U6VL 5C0IA 2Z35B 2DD8H 4ZDHA 4PJGF 3NN8A 1NCUA 3BXNA 1FL6A 2D9QB 2VLLA 15C8H 4QOKD 4R4BA 4QEGA 1QKZH 1ZVSA 3K74B 4HJGA 1HNGA 3GB7B 3KLSA 4PJCB 3R8BB 1MCKA 4RFEA 3O6MH 3QUML 2YWYA 2GT9A 4LSQH 3S4SB 4MXWH 1BAFL 2QTEA 5CSGA 1H8NA 1UM4H 3SDXE 3MV8A 3TBYA 5JW3L 1FZOA 4M1CD 4XWGH 4XVJL 1E6OL 1OSZB 2DQGH 4UNTA 1VFOA 2VZUA 2PW2A 4PP1C 5SWZA 1K4DA 1CFTB 5HHOB 4Y5XB 3ARRA 2AJUL 4D0DB 5HHMB 3BEWA 3EJZD 3L7FB 4KQ3H 4QXWA 4MJIA 5I8CA 3QULB 3KVQA 4EIGB 3CZFB 5KS9B 4OCSH 5GJSL 4OF0A 1W0VA 4HIXL 1LQVA 4WVRA 1EUTA 5HPOA 5D7KD 4ODXB 5ILTH 5F7YC 2BXYA 2H1PL 4GBXD 1ZHBA 3RWFA 5L2KB 2VDPL 5FFLA 8FABA 4WFHE 4HXAH 1FYTD 3G6DH 3MNWA 4OLXH 4NQDE 4TUOA 3L5WA 5MHSD 2XA8L 4P59L 5D7IB 3G5XA 3OAZH 2BVUA 5TDNA 4JM2A 2DJ4A 3AVEA 5A1AA 5HHQB 2D31B 4F58L 1J0HA 4X6EB 1NBYB 2H32A 5B4MD 3GGWA 4JO3H 3D0LA 1U92B 5E2VH 4ZFOL 5ISZE 1P4IH 4P3CH 4JO4H 5EOTB 4PBXA 4HF5H 4NQCD 3HC4L 4F7MB 2WQ8A 2WSKA 3GBNL 3MRHB 5F9JA 1TCRB 4MS8D 1NL0H 2YPLD 4G5ZH 4PGEA 3O3EA 3BH8B 1HOCA 2YA1A 5E8DH 2FD6H 2FNBA 5DDHA 4FQ2L 1KLGA 1UM5L 3VFNB 1WWWX 1X7QB 2HN7B 3TPKA 5DHYA 4A6YL 1CFSB 1IEAB 4OCYH 3IAPA 1EJ6A 3W5MA 2PTTA 4ZD3H 3PXHA 5E6IC 4HPYH 1SY6L 4WDIB 4YZFF 4QOKE 4WI2A 5SWSB 4FNLL 3KJ6L 3QDMD 4TSAH 4V1DA 3W9EB 4FZ8L 3WO4B 1FVCB 3S4SA 4ZNEE 4ZXBC 3NZ8B 3MSPA 5F70A 1YEEL 3O3DA 2WUBL 5TE4H 5AAWA 3P11H 5KVFL 3HUJE 4DGVL 3OJ2C 3SDDD 3QEQB 5LGHH 4OZIB 1FNAA 4EUPA 5JUEL 3CFEB 3ZYIA 1YMHB 1DR9A 5HHOA 5KN5B 3U30B 3QIWD 4ODUA 4RRPG 5I73C 1QOKA 3JBG7 5DR5L 4FQHA 1U8HB 2DICA 2W1NA 1H3UA 3R1GL 2BSTB 3JV5A 4K94H 3ZKNC 1UCBL 4OM0H 3E0GA 4YXLH 4HGMA 3AB0B 1D5ZB 2CDFA 4RGNE 4PJAE 4U1MA 1C1EL 2R0ZL 1JGVH 6FABL 1Z3GH 4KV5F 1RU9L 4BUHA 3QUMB 5D7KE 1QTYT 4RCAA 3OZ9L 3QCTL 1R3IH 5L2KA 1LO0L 1A4KA 3K4DA 4UU9A 5IFAH 3DX8A 2Z9TA 3ARSA 1M7DB 3V6FB 4CVXB 2I27N 1RZ8A 3QZWG 5EZOL 5F7MC 1A64A 2AXFB 4NQUA 2BVPB 4HGWA 5HHQA 2D31A 4X6EA 5ALCH 4RAVB 5SWQB 5D7LA 1KXVC 5DZNA 1QRNE 4AK1A 3KAAA 1GH7A 1DZBA 3D18B 1R5IB 4AH2A 1TCRA 2C1PB 3U4EB 5IGXH 5SX5H 4X80H 1F4AA 1NCNA 4JRWA 4D8PB 5L6YH 4DUWA 3P4MB 5SWZD 4JRYD 4NFBA 3G6AA 5KSUB 3I50H 4OF6A 2MTPA 3EBAA 4N0FB 3BSZL 1EERB 4TVPD 4XVUD 2ZCKL 3QPQD 1I8LA 5GS0L 2R56L 4F7CB 1CFSA 3CFCL 2APFA 3MC0A 5I76B 4OCNC 5FKAB 2VR5A 4DK3A 3HAEG 3O3BA 2HG5B 1EDQA 4HWZB 1Q9WA 4WDIA 3OGOE 3VE0B 9CGTA 5FYLH 1L4IA 4HCRH 5E8EB 3MCLL 3IFOA 1GL4B 1ZKAA 3W9EA 2DLGA 1P4BH 3DURB 4RMWA 3DVIA 3DXAD 5C6TH 1I3GL 4E42B 3STLB 4MWFB 4JM2C 4LEOB 1DTUA 1XF4A 2MWCA 3JTTA 2EKSA 4ZPTA 4MLSA 4TSBL 1ZHKA 3CSGA 3LEYL 3CPLB 5IVXA 3QEQA 4OZIA 3VFSB 1Q9OA 3N50A 4HKJA 3CFEA 5JPMA 3S9DB 2CXGA 1ZGLB 4FQ1L 4JAMA 1VKXB 2VLRD 4GRLB 1N59B 5GZND 4NUJB 4A6YB 3QIUC 4F2MB 3C6SB 3BH9B 4D9LL 2XZAL 4OB5L 5HXMA 1PZUB 2A1WH 3O8XD 3PQYA 3TT3H 2I26N 2NQCA 4AIXA 3VXSA 3MA7B 2VXUH 5E2TL 3BRGC 2OQJB 4X5XB 1SEBA 3NCFB 4TULL 3WFDL 1A7QH 1G6RH 4KK9D 2R0LL 3AS0A 2PTVA 2VXVL 3OJVC 1KIUA 1AGEA 5D2LB 4OCXH 1XCTA 3DUSB 2EYTB 2D03H 3AM8C 1NGYB 4APQD 5CEZE 4WI9A 1TCMA 1M7DA 1VCAA 4BKLB 1RHFA 4CVXA 2DQJH 1HHGB 2P7TB 3WLWD 2BVPA 3L95B 2ADIA 4E41B 3QT2A 5SWQA 1OAQL 4Y5XC 5HGAB 1T2JA 4BSWB 5IB2B 5ALBL 2HFGL 3MV8E 3OWEA 4XPAH 3CD4A 3P4MA 5GRVK 1JF1B 4O2CA 5SWZE 3WL9A 4JVWA 1QNZL 4LIQL 4TVPE 1N5YH 5D1XD 5I76A 2J4WL 2Q86A 4AL8H 1HHKA 5FYKD 3X12A 4ETQB 3TFKC 3K3QA 2X4OB 2Z92B 5C2BH 2AABL 3CGTA 3GNML 5E8EA 2AKRB 4C56A 5I30L 4I5BB 4JLRB 3DURA 1IAOB 4E42A 3U7WH 4Z95L 2OCFD 1CR9L 1JNNL 1P2CB 5HDOA 4QGTA 3ZDYF 4JN2A 4NQED 2C7UB 3CPLA 2ZOLB 3HPLB 1CE6A 1F4YL 4S2SB 3S3SA 3J8F7 3MJ6A 3GRWH 3L3JB 1AXTH 3B9KB 4MLIA 1GGIH 4I0PA 1K4CB 3LKPA 4WI8A 5C7XH 5GZOC 5H8DA 2Q6WA 5CZKA 4GKNA 1FC1A 4N1EA 2NX5A 1LO5A 1QYGL 2YWZA 3QEUB 2BSRA 1MRCH 3LV3A 4UT7H 1I8LC 1AKJB 1FRGL 4BZ2L 1KG0A 4KVNL 5DVOA 4JFPB 5FV2A 4M5ZL 3MA7A 4Q7DA 1IKFL 1CZ8H 2OQJA 3BWAA 3IU4H 4X5XA 5GRJH 5LQBL 1EHXA 3QA3B 3ARDD 4XP6H 3PWPB 3V7MA 5DURD 5D2LA 3WO4C 3DUSA 1NGYA 3QXVA 2WAHA 5BJTA 5HY9A 1LEIA 3RVWD 3LMJH 1HHGA 3GHEL 3LRSA 2FIKB 3OHXB 4V1DE 3OG4B 1DDHB 2F54A 5IIEB 5DD3L 4XMLH 2BNQD 1MNUH 2IPTL 3U30C 1UJTA 3TWCL 1LEKA 3VXNB 3Q1SH 1T04B 2WIIB 3SE4C 5CUSH 1C5CL 3S37L 4U4BA 2JJWA 2Q3AA 3BW9B 3AB0C 5DC9B 1K2DB 4YEEA 4FFWC 3WIIL 4PJHA 2B1AH 5HHVH 2IPUK 5DQ9A 4BZYA 2GJ6A 3I6GA 4KY1L 2ADFL 2PYFB 5IT2L 4RNRA 4UQ3A 4LLYA 2AV1A 1UT9A 2X4OA 3SDXF 3IKCB 5FYKE 3HE6D 2ADJA 2VKWA 4K9EL 3RL1B 3TLRA 3ARPA 4UOW1 2V9RA 2L0DA 3FHAA 1U2HA 1IAOA 1RULH 1Y0LB 4WUKL 3C09B 1QFWM 2VUYA 4ZTOH 1A7OL 2DLEA 3KPSB 3DVNA 1NLBL 2P8LB 3TZVA 4A2MA 2C7UA 1WWBX 3HPLA 5BMFL 1INEL 3WUZA 2X4NB 4HFWA 4L8BB 2BFVH 4LNRB 3WNMA 3KR3L 2CJUL 1K4CA 3BD4A 4XC1H 1PLGL 4CU7A 2ADGB 5D7LE 1CXEA 4JFFD 3MRKB 1JPTH 1KCRH 2QSQA 4KK8C 3CVIL 3ISWA 2X40A 3K7UA 4U05A 1CCZA 1CLOH 1EMTL 3QA3A 3A67L 3PWPA 1L7IL 5GGQL 1IEBB 3T2PA 3KLDA 4LGPB 4KRPD 1Q94A 2AJSL 5AD0B 3FZUD 5GSRA 4PBWD 3LKNA 4NOFA 3MGTB 3RZWA 4YHMH 2FIKA 3MA9L 3V52L 1DLFL 1CGUA 1HILA 3MRGA 5IIEA 1OD7A 2VDKL 1XCQB 4GRLC 1NMBL 1RJYB 4L29B 2AQ3A 4G42A 1SJVA 3DJ9A 1KFAL 3VXNA 5IVXE 5CZVH 5AUMB 4OUOA 1EVUA 4KROD 4CVZB 2X42A 4ZO7A 1EEZB 3S88L 3G5YA 5C0JB 25C8L 3PP4H 4YQXH 3K1KC 1MIML 4TSCH 3VFOB 1QLRA 4FA8A 1QP1A 2DMCA 3PQYE 4Y5VA 3IKCA 3VXSE 3HUJF 1CLCA 2V5RA 1KGCD 2P46B 1NCCH 1D5XA 4UILL 4RDQG 1S7WB 1DVFB 1OP5H 4W6WB 4ERSL 3RGVB 1HN1A 5HYFA 1IQDB 1YYML 1Y0LA 3TO4B 2AXGA 1FNGB 3O6FA 5DEZA 3OAYH 3GMPA 1KB9J 3KPSA 3WIHA 3S8WA 3EIFA 4XC3L 5KANI 4KU1A 4WW2B 4KQ4H 2ED8A 2V5TA 4PJAF 5IW6B 4NYLB 3UBXG 3NIGE 4AQOA 4ODTL 4X7EC 2XPGB 3BQUD 1MCHA 3HR6A 1KPVA 2ADGA 4G7VL 3FRUA 4M7JL 3MRKA 3F58H 1EZVY 4HUXB 3HFML 3DRTB 3ZT5A 1B88A 5ESAB 2FJHB 4FQXB 2G5BB 3M8OL 1UKQA 1XR9B 2CO7B 5HDQH 5H37G 1G7HA 1GAFH 1QLFB 4U1NB 3TF7A 1EHAA 1M4KA 1F13A 3KYMA 2F5BH 4C4KO 5EBLA 1QSZA 3NABH 4CJ0A 3KXFB 5F3HB 2K1MA 1NEUA 1I1AD 3QQ3B 1LE9A 4O2EB 1A9BB 1T03L 4JDZA 1XGYL 4NKMB 5AD0A 4YWGH 1IT9H 3UTZB 3B8YA 4UMGA 1MCPL 4U1JB 3LKSA 4NZUH 2OTWB 1T66C 1LO4L 2G9HB 4IOFD 1GGTA 5DGRA 4BFIB 4C56E 5ITFA 3ECBA 2WY3A 3ZE2E 1R3KB 3O9WD 4KRLB 3OR7B 3FQUB 3DUHA 3B9KC 3EYSL 3FFCD 3QG7H 1XCQA 4G43B 1V5JA 3AY4A 1EAPB 3B2UC 3WFHB 2CK0L 3T77B 4QHLA 2FEDD 3SKNB 1OQXA 2BC4B 4M1DH 1ZXQA 2FGWH 3QUYA 4NUGL 1EEZA 1N64L 3T0AA 5C0JA 5IB5B 5DD6B 2CKNA 1RUKL 3VI3E 2NX5E 2HTLD 4M7KL 4EI6A 5B3JE 4GMSL 5IM7B 3BDXA 3GMLB 4OZGA 3O4LA 3B2VL 3VFVB 4CBPA 1GPOH 3BGAA 4FFEX 2ZCLL 2AI0L 2BHYA 1DVFA 3RGVA 3TO4A 4WEBH 4JM4L 1O7VA 3C8HA 1NGQL 1MJJA 1NC2B 3N1GC 3SOBL 1S9KC 4F8QA 4TQEH 4LGSB 5DEFB 4JGUA 3KPQB 4L8SB 1HHJB 2KBGA 1ZLWK 3RVVC 1BD2B 1R0AH 3IFNH 3QDJB 5F93C 4CKVX 1V3MA 4NYLA 4OIIL 3L5HA 4U1LA 5I9QB 2X4UB 3VGBA 5K9OB 2F54E 4DN3H 2HJFA 2RHEA 3TN0A 4XVSL 2VDNH 2IQAB 1IGYB 4PGDB 1JJUA 4HUXA 1ZLUH 4RGMB 4U1KA 2G5BA 1F6AA 1HINL 1U8OB 2B2XL 4M8VA 1WICA 4U1NA 2FYYB 4Z8FH 1HKLL 4KZDH 5EORH 4PJHE 1FFNA 3QDHA 4DVBB 5H2BA 4X6BB 5T3ZE 1TTUA 2Y5EA 4MAUH 2BXZA 5T1KD 2GJ6E 4ZYKB 3KXFA 1J86A 1CXIA 2DQHL 4KJPD 5T3XD 3KYNA 4KTYA 4O2EA 3O6FC 4JO2H 3C09C 4EKXA 3LH2L 4G7YH 4I77H 5BW7C 4Q9BA 4G6MH 5IB4B 4NRXA 2EDTA 1MUJB 4UIKL 3SJVD 3KS0J 4ORGA 1AO7D 5IMKB 5DMIL 4OFDA 3FFCE 1BJ1H 1HWHB 3VXMB 1EAJA 4QRPD 4XXDB 3WO3B 3WFHA 3T2OA 5CSZA 5GGVY 3SKNA 4GXUM 2BC4A 4PLJC 1EXUA 1EIBA 4D0BB 4JQIH 2EO9A 5DD6A 3RI5F 1TNNA 1FH5L 3TF7C 4QTHB 1OAUH 5T1DH 3LN4B 7CGTA 4Q0XL 1NCWL 4OZHB 2R2BA 4XNYL 1EGJH 1KB9K 1ZHLA 3RVTD 4PIRF 4QRQA 1NJ9B 2EDHA 5IM7A 1PX3A 1CD8A 3MJ9L 3EOBB 43CAB 3OAUH 2VXSL 2YUZA 4R6UA 1W8NA 3VXQA 3PWPE 4FQCH 1JYWA 4LMQI 3T1WA 1MRFL 3QHTC 3WIFB 1KUMA 1ZS8B 1NC2A 2FBOJ 3KJ4C 4DN4H 5DEFA 3UO1H 2BY0A 1G7LB 3KPQA 3O41A 3VFUA 4L8SA 1HHJA 5D96B 3VXRB 1BD2A 4LPCA 3BN9C 1F90L 4DW2L 3RTQA 2EEAA 4ZO6A 5FCUL 3QUYC 4LARL 4JR9H 4JG0L 4L4JA 4Y4KB 4LVOB 3O6LL 1E6JH 4FFVD 2IQAA 5JZ7D 1OT2A 3MROA 1TVHA 3QG6B 4HFUH 3L5XL 4LAQH 5F96L 3P9LB 4JFDA 2XZQL 3FRPA 4JFHE 1ADQA 2DMKA 3A0OA 5DRNB 4P46A 4TVPL 4GBXB 2UZIL 3F7VB 4X6BA 3E8UH 1BEYH 5DEGB 2WW8A 1DVFC 3SKMA 1FYTB 3HNSL 3RGVC 1FO0L 4Z7UB 3VXPB 3TO4C 3I6LD 4HZAA 1KSRA 3DIFB 5T3XE 4F7TB 2VLKA 2H8PB 5IB4A 1JPSH 4NBYB 2FIRT 1JCKA 3GI9H 4M5YH 4LSUL 2V17H 1R3JB 2AJYL 4WW2C 1QEWB 4PTTB 1H8OA 2W0FB 4PRBB 1A6ZB 1CBVL 5IMKA 3FOMB 3PE9A 2ZG2A 1DBKH 5E99L 4H1LG 5JPNB 1X5FA 5HI3C 2BVOA 4NQCB 1UA6H 1MCSA 3VXMA 3NFPB 1HI6A 4I4WB 2YD9A 4ZODA 2HH0H 5EOQL 1MCLA 2YPLB 5E7FA 2HTKD 4K23L 4PB0H 3ARQA 1T4KB 4FQXC 1S5IL 1T5WB 5EIVA 2E6QA 5IEHB 1DBBL 2VZSA 4MD5A 4XAKE 4N0UB 5E03A 5DJCA 5E9DD 4PRHD 1MPAL 4PJBB 5CMAA 3PWUA 2V2XB 3VRJB 4GW1B 4CDHA 1VFMA 3BUYB 2J7LA 1UQSA 1WAAA 1PD6A 2CKBL 1UH4A 3P4OB 1FV1B 1MI5D 3QIBD 1VACB 5IF0B 1HWGB 4DKEH 3QDMB 1JFQH 4QY8A 2APXA 5MERB 1JHLH 3MODH 4BZ1L 1ZS8A 4QXUH 3UEZA 4DCQB 3HRZA 1AI1L 4FZEL 2BVQA 3D85B 4NZDA 3SDDB 5JXED 1G7LA 1QO3A 3HI6L 1T20B 2DJUA 3VXRA 1AY1L 5HVHB 3F65A 4QYOB 3IDJB 4QCIA 3QIWB 4FTVD 4Y4KA 5TF1H 4Z0XB 3EYUL 1A8JH 4UDUA 5LWYH 2HKHH 4FFZH 4PJFB 3QG6A 3IDYB 5E95B 3QXAB 1JZ7A 3CDGA 4RAUB 1EEQA 3P9LA 2LVEA 3LKRA 4NZRL 3QZWB 4KUZL 4HDIB 4JPIA 2R1WA 3H0TA 3O3UN 1DQJB 4X8JB 3F7VA 4LEXL 3NPSB 3O6KL 1X5ZA 5KVDL 5F71A 4K7PY 4Z7UA 5FYKL 2YK1H 3EZ8A 1MFEH 2VWEE 4LMQE 4R7NB 4ACPA 5HBBA 1AHWB 1U8NB 3DIFA 4UB0H 5F7LB 4OZGE 5IVXF 3O4LE 3S3JA 3JTCA 3V0WH 5M7QA 4L8SC 1A6ZA 1XT5A 3FOMA 4HWEH 5JDJA 1LK3H 5I9QC 1P9MA 3ARFA 3HAEB 3NFPA 3V4PH 3O0RH 2WLYA 4YR6A 4NT6B 5BO1H 4YJZL 2A6KB 4MDJA 3MLYL 5ICYB 3JWDL 4H0GA 4RGMC 4JRYB 5HPMB 2EC8A 2QQLL 1Q9LB 1T7YA 4PD4J 4F7PB 4M43L 5EU5B 3IS0X 5DHVB 2FX9L 4X5WB 2C3WA 2BRRH 3FB7B 4KMLB 2J8OA 2V2XA 4GW1A 2B0SH 3U9PH 1UZ6E 2Q3ZA 2A0LD 2I9TA 1E4KC 1CWVA 5I18H 3P4OA 4JB9H 1FV1A 3BP4B 1J11A 2P47B 3K2UL 1ONQA 1NBVH 4TUKL 5C6WH 1T21B 5EUOA 2R23A 3NIGF 3DXAB 4LLAA 2XG5A 4U6VH 4OLVL 5JW4R 1G0DA 4CUCA 3FT2A 4XBEL 4DCQA 3RWEB 2CRZA 2EDNA 4KKBC 3MJGX 2FDBP 1KJ2A 5GPRA 5MENA 4MA3B 4QHMA 4ORZC 1FFPB 1T20A 2OX5A 3TNMB 2ED9A 3SGKC 2VLRB 2VR9A 2IPKB 4JY6B 1N6QH 2ARWA 1T22A 3IU3B 4CAGA 4LP4A 4KJYB 1F3JB 4YDJB 4RX4D 3OJMB 3QUMH 1PGRB 3TVMB 4RGOL 4PJFA 2IANB 3KPRB 3O8XB 3QXAA 1BAFH 2P5WA 3GJEA 4JPVL 4G8IA 3B83A 4ZPVB 3UCRA 1A6UH 4P9ML 3B8SA 5JW3H 3QZWA 1T1ZA 3REWB 1BOGA 3DI2B 3QI9A 4HDIA 5TDOB 3ZTJH 2V5MA 4XVJH 4O58H 2Q8BH 3IDGB 4QRRD 3R06B 1J5OL 1U3HD 2BY3A 2AJUH 4WJ5A 5FF6A 3FT4B 3RWHB 3WS3B 5DMJB 4APQB 4M02A 1S7RB 1UH2A 4ZUUB 5GJSH 3KLAB 3QEHB 2FEEI 4HIXH 5EN2A 5C0EB 4Q9RL 3U46B 3W82A 5D96C 5IOPB 4XI5D 4N5UA 4HZLB 2PCPB 3CMGA 5KJRL 1AGCA 3VI3F 1Q9KA 2H1PH 2WUCL 4LHQB 2C1OB 2W92A 4Y4KC 1T89C 1ZEAL 4OCWL 5B3JF 1P84J 4LVOC 3NCMA 2VDPH 5JOEA 5E0QA 2XA8H 2IBGA 4IIQB 3VGGA 3ES6A 4OKVB 5D5MA 4A2LA 4XB8A 3MV7D 3FB7A 2HVJB 2ARJB 1CF8H 4GBXC 2ICCA 3M17A 2YSSB 5D2LF 1KNOA 4GRWH 3SY0A 3HC4H 4JFDE 1RZ7L 3GBNH 4XHJC 1BQSA 1C12B 4UT6H 2MFNA 1J18A 3H42L 3L3HB 1DE4B 1KJVB 1T21A 5C0FB 5GS2H 5GIRA 2RCSL 2PO6A 1FZJB 3OXRB 1O0VA 3SDCD 4KUCF 3RWEA 4A6YH 4F57L 4NQEB 3PDDA 5LGKA 4MA3A 3GSWB 1EUUA 2X1XR 1P9MC 4YHZL 5DF0A 3UAJD 3ZO0A 4DK6A 3G5ZA 2VLKE 3RY4A 3TNMA 3D25B 1CLZL 1TZIB 2NMSA 1F11B 1RV6X 2F53B 4N8VG 1AE6L 2XT1B 3Q6FB 5F97E 2IPKA 3DETD 5HDBE 3VWKA 1QQDB 3KJ6H 1IQWH 4IEFB 4LAJH 3IU3A 4PJHF 2OS7A 3ARFD 2R29L 1F3JA 1K9TA 3S98A 2Z0BA 4FZ8H 3TVMA 5FM8A 2IANA 4AEHH 2FX8H 3KPRA 1JF5A 1YEEH 4XNQA 2WUBH 2R2HA 1LP9B 5KVFH 1GGBL 4DGVH 4YFLF 1U8LB 2VDOH 3ARDB 3CX5J 2LTQB 3R06A 3IDUA 1DL7L 2FATL 4OV5B 3D87B 5DURB 1FN4B 3PHQB 1A6TB 2C3XA 3QDGB 5TGBA 4RZCB 5DR5H 3RWHA 3WS3A 4O5LL 4F8TA 1S7RA 4WFED 1UCBH 3I3DA 3LSOA 1WAAE 3LKQB 2UVEA 3KLAA 3SDDC 1RZJL 4FQQB 3QEHA 5C0EA 2NW2A 5KVEL 1S9VB 2A38A 1C1EH 2R0ZH 3CIQA 4P23D 4UBDD 5HVHC 1KLUA 2YRZA 4HZLA 4PD4K 2PCPA 6FABH 4X4ZA 2BNQB 1CDHA 4NWUL 3AGVA 1CDYA 2NNAA 3QIWC 1RU9H 3R4DA 5DC0A 5F21B 2C1OA 4GKZA 3OZ9H 4U3XA 4XXCA 3QCTH 5ESVB 2FL5A 1LO0H 2OZ4A 1GGCL 5L9DL 5FO9B 2MMXA 1BVLB 3IDYC 1S3KL 1IAIH 4ODHH 2ESVA 4D9QE 3IXTB 1H15A 5EZOH 4FFYL 4OKVA 3VH8G 1C5BL 2HVJA 3LEVL 1OAYL 1UG9A 5I0ZA 1OGTA 5J1AB 1JWUB 4OZ4A 3MV7E 5GSVB 2YD5A 3NPSC 2DIAA 5DJ6A 3HE6B 3QI9D 4BQ9A 1YNTA 1B6DA 1OAXL 3MJ7A 5T1MB 1BREA 3S36X 3SE3A 3TNNA 1AGFB 1DE4A 4ISVB 4YXKL 1KJVA 5IQ7H 5C0FA 3OKDA 3C60A 3EDKA 5L8KB 1MFBL 1FZJA 1I9RL 2ZCKH 4U2YA 4MDIB 2JJTA 1I1RA 4MNQA 5GS0H 2R56H 1NSNH 3GSWA 2UWEE 3CFCH 2AERT 4DAGL 4M9PA 2C4XA 4LGRB 2N56A 3HZVB 3MZTA 5CFHA 2F53A 1RUPL 4JFFB 1MAML 2PETA 4E0RB 1KTDB 3RHWF 3QPQC 4HIHB 1I3GH 4HIEB 5C0ND 2NTFA 1MCNA 3TBSA 3PDOA 3OKMA 1LP9A 3RWJB 4TSBH 5EG6C 4TRPL 4FABL 3EO1B 3LEYH 1F5WA 4Z5RB 1A6VL 1U8LA 1AR2A 1OM3H 4TVSa 2D9CA 4FQ1H 1NCAL 3CLEH 4MNHB 3BRFA 2WWKT 3WXVL 3QDGA 1KPRA 2A73A 4D9LH 3HC0A 4RISL 4GLRH 2PO6C 4KRPB 4OB5H 1JNLL 3VFMA 2XNAB 4MD4B 1P84K 1H3VA 1L6XA 2WINA 4FQQA 4DOHB 1WFTA 4UTBH 1S9VA 1CXKA 3RZCA 5EUOE 3BHBB 3AS3A 3WMSA 4TULH 3WFDH 2GIYA 4LPVA 5F7UA 5B38G 2R0LH 4KHTH 4HAFA 5GZNC 2BMKB 3D3VD 5ESVA 4R4ND 1DANT 5MENE 3QUXA 2ZUTA 4G80B 2BK8A 4WHYG 3TVMC 4KROB 1VEPA 5B8CB 3RP1A 1BVLA 3O8XC 4GUPB 2P5ED 3RI5K 4WHDA 1B4JL 3NZHL 1BFSA 4KK6D 1NDMA 3G04A 3NVQA 4NHCL 1MQ8A 3BESR 4YBLB 5C0GA 4AIZB 4LPXA 2GEEA 3NCEB 1OAQH 1T80A 1NAKH 1M7IB 12E8L 1NBZA 4UUJB 5DTFB 2P5WE 4NNXA 5ALBH 2HFGH 3UBXB 1JWSA 3FFDB 4APQC 3IF1B 3LS5H 2OTUB 1RK1B 1T1YA 1T2XA 4ISVA 4GQ9L 3IXAA 3O2VL 5DFVD 4F15C 1M6OA 4KJWD 5T3XL 1QNZH 4LIQH 1UH3A 3TBWB 1PY4A 3FOLB 4NP4L 1BECA 2J4WH 3V5HB 2PTUA 4GJTB 4PJEA 3HZVA 4PB9L 3WNNA 2AXJA 3A6OA 4MJ6A 4ETYA 4QRTB 4NQSB 3BQUB 4YDKL 2AABH 2IJ0C 3GNMH 3WIHL 2E27L 2EYRA 4IIQC 1KTDA 1U95B 4H25A 5DJZB 4HUVB 4M7ZB 3DX9B 4N90D 4J3OC 5IB1B 1S9WA 2AEWA 4Z95H 4LLWB 1CR9H 1JNNH 5TJWK 1IM3B 2CGRL 3RWJA 3S6CA 5FHAH 4FQPA 3EO1A 3HR5A 2ZSWA 1OAZL 4OZGF 4IBLT 3FB8B 1F4YH 4L3EB 5GS3A 4YHLL 1YEIL 1MRDL 1HSBB 1T5XA 1A7NL 5HGHA 3SE3C 5D5ME 3SDYL 5J56B 1FL3B 5BV7L 3EOAA 1I1AB 1KCUL 1KENL 5DFTA 2C9AA 3WYRA 2XNAA 2JJTC 1FRGH 4BZ2H 2QADD 4X9IA 2HT3D 5FK9A 3PGCA 5D9SA 3JWDC 1IKFH 3BHBA 1OPGL 5LQBH 4OD3H 4PS4L 1U8JB 1FP5A 4PJDA 5C07D 3QWQB 1WV7T 4OLEA 4QHUA 2OTPA 5JA9A 5TE6L 1YPZB 3D3VE 3IFLL 2EDFA 1AD0B 5K93A 2EDXA 2N1KA 5CJXC 2VE6B 4PV8B 3ZTNL 4GKOA 1EJOL 3NIDE 3WLBB 4NN6B 3ARDC 4PTUA 2EE2A 4AIZA 3TH4T 2LTQC 2DRUA 4UUJA 4Z7VB 3QH3A 3TWCH 1D5MB 2DI8A 1YJDC 3UBXA 2LU3A 3VW3L 1N2RB 1C5CH 2VQTA 1CGXA 1NMCB 1NFDB 3RVWC 3T0EA 3G5VA 3SDAA 3WIIH 1XZ0B 2IH3A 3D5OF 3P0GB 1AQDB 3MNZB 2XRAL 3D9AL 4KY1H 3TBWA 4F33B 5TH2A 5IT2H 3FOLA 4G8GA 1OTSC 1V8HA 2OBGA 4JFQB 1JRHH 4MXQD 4QRTA 1UKSA 3MOAH 4MA8L 4WUUB 5KG9B 4M6ML 3I84A 3LN5A 4HQQL 3UYPA 3NCYS 2J88L 2W65B 3DX9A 1B2WL 5IB1A 4WUKH 1UGNA 2O5ZH 3E6HA 4WEMB 5IROA 1A7OH 4DEPB 1NLBH 5KVGL 4W6XB 4UAOB 3HE6C 4XCNB 3GSUB 4L3EA 5BMFH 3TYGL 2ESVE 1EZVX 2EEBA 5GISH 1HSBA 5T1KB 5H94B 3KR3H 1PDKA 2CJUH 3M45A 3KS0H 2D0GA 3N85L 1J1OH 4WI7A 3QWOB 4KC3B 5DD5L 3P0YH 3MLTA 2X2YA 3HI5H 3KPPB 5IQ9B 3CVIH 4UDTB 3TBTB 3SJVB 2V7HB 1AO7B 1OP3K 2F5AL 5SV3A 2YD4A 1EMTH 2J6EA 5BZDA 3OXSB 1MCOL 1D5IL 3A67H 5DRZA 1L7IH 4MNQE 5CJQL 4QRPB 5GGQH 1JPST 4R9HA 2X4PA 4NC0B 5I1LB 4IRSA 4U1IA 4XX1E 2VIRA 1CL7I 5EO9A 1ZLSL 1AD0A 3VFPA 1XH3A 1U58B 1IVLA 2VE6A 3D2UA 4PV8A 4OD1L 3ROLB 3VA2C 2IQ9L 4HEME 2VERN 4GXVL 4XB7A 3LY6A 4HX1B 3UTPD 3WLBA 2KPNA 3QHZL 3MA9H 3D6GA 1DLFH 4MX7B 4YXHL 3V52H 5BV7B 5I8EB 4Y0GA 1HHIA 2VDKH 4NNPL 1I85A 3RUGE 4Z7VA 1W2KT 1NLDL 4HV8B 1NMBH 5F1KC 5KSBB 1KFAH 1ZWIA 4PJ5A 4KRPC 4M3KB 4BELD 5T5NG 1IZKA 1FNFA 1KXQE 3VI4E 2MHAA 3VU2A 4Z7QE 5BOPA 3S88H 25C8H 5HDBF 3I9GL 5J57B 3U2SB 2VXTL 1MIMH 4YFDB 2P43B 2A6JA 4LSRL 3FAWA 3OB0K 1SJHA 4S0UC 5EPMB 2GSGA 4RMTA 3GO1L 4P5KA 4X9BA 1JN6B 3MMEB 3IRZA 5IMMA 2ZUVA 4HULB 1ZVHA 1YNLL 2PF6A 3KPNB 4HWBA 4WO4D 4JFQA 3TV3L 5B8CC 4WUUA 1KB5B 5KG9A 3FQNA 1NC4A 4UILH 5C86A 4N8CH 1L0YA 4O2FB 4ERSH 1KIQA 5D1ZD 2P8MB 3LIZL 3M07A 4JKWA 3RVXD 3HCVA 4YBLC 5TDPA 3H9SD 1JK8A 3FKUS 1WAAF 2YKLL 4XC3H 5IFHL 4B7LA 3GMOA 4LSPL 4H1LB 1RZJC 3UTOA 5H94A 2X9YA 1YEKL 4L3CB 4ODTH 4MA7L 3C8KA 4N68A 5MEQB 2BJML 1P1ZB 5CWSB 4G7VH 5C0CB 3NAAH 4LLQA 4L9LB 2F58L 1Q72L 3HFMH 2A83B 3P73B 4QGYA 3M8OH 5I17A 4PRNB 2VZTA 5IMLB 3SGEH 4NKOB 2H45A 4QT5A 1W0WB 1WITA 2FWOB 2C3VA 2EDYA 3BQUC 4NCDA 5IJVB 1G7QA 2HMIC 3WNPA 1LNUB 3G6JB 5DRXA 1S7VB 1WUNT 1Z5LB 2EDLA 4M7ZC 3QQ4B 4TOYL 5I1LA 4GRMA 4PJEE 2BNRA 1T03H 1MHEB 4OBRA 1XGYH 5IROC 1SYVB 5ERWB 1MCPH 3ULUD 5F7DB 4OQTL 4CL7A 2VSDA 1LO4H 2XKNB 4ENED 5E9DB 1B0RA 1CN4A 1CU4L 3IKKA 4PRHB 1CLYH 4X8XA 3MNVA 3UTPE 5A16A 3EYSH 4Z7UF 4GMTL 3LZFL 5KSBA 1FL5A 3DVGB 3ZKSD 1MI5B 3QIBB 2CK0H 4L4VA 3BKCH 1TJGL 1T3FB 4KVCL 4I0CC 4NUGH 1N64H 5GQBA 3QR2A 3ZL4L 4K3GA 1FPTL 1U8PB 4BUGA 4JG1L 3BIKB 1R5VA 2A74A 4OZFG 4M7KH 4XBPB 5GGRY 3MMEA 1JN6A 1II4E 4Z7NE 1FORL 1TIUA 3KPNA 3MV9D 4LKCB 2HFFB 2FEDC 4FTVB 3EO0B 4IRSC 3B2VH 3D0VB 3TIDA 2J8UA 3H8NA 3AREA 4IDLA 3ALXA 1I4FB 3S36L 2AI0H 1FNLA 4P3DA 4PJDE 5CGYC 3BP5A 1AC6A 3GMMB 2ITDB 4JM4H 1KJMB 4NN6C 1NGQH 1BQLL 3GSNL 3SOBH 4F9PA 5JHLH 5BRZD 4EDWH 1X5HA 2AJVL 4WWID 1I85C 3VFTB 3FN3A 1UENA 3HMXH 2YOCA 1U6AL 3ULVD 3H9SE 3Q5YA 5CKGA 5K9KB 4H1LA 5DVMA 2HJLB 2RAMA 4P57B 5EUOF 2YEZB 2PYED 1NMCC 3IDMA 1P1ZA 5CWSA 4ZUTA 5C70A 1IE5A 5C0CA 1TVDA 4WI3A 4TN9A 1CICA 3PDGA 5I1DB 4I18B 5FIEA 4EVNA 5IJKA 1HINH 2OL3B 2FEEL 2ILLA 3H3PH 3BUTA 3QCVL 3RY5A 4QRSB 3GBLA 4U6YA 1HKLH 4I8DA 3T0EE 4HC1L 3ZE0F 2O61B 1PY9A 4NKOA 4AZ8A 1W0WA 5KSAA 2FWOA 4AM0B 3ZYJA 1OOAA 4NN7B 4JZJA 1DBJL 1Z5LA 4ZQKB 1OF2B 3SPVA 4PJFF 2DQHH 4G8GE 3K8KA 5GGTL 1D6EB 3LH2H 4QXGL 5JXAH 1SYVA 5DD1L 4DEPC 1MY5A 1NC4D 5F7DA 3QRFM 1MCFA 2R9HD 4UAOC 1FCGA 4M61B 4NDMA 5D72L 2FH6A 4ONHA 5HHXL 2BVTA 1A1MA 5FUZL 5DS8B 3FMGL 4OIBA 5DMIH 2R2EB 5FXCH 1U36A 2WANA 3CFDB 4PJIA 4JPKH 1T3FA 1UXSA 4WWKA 3ESUF 5CP7A 2Z4QA 4CN4A 4TPRL 1P7KB 3ARGD 5I2IB 2DKUA 1A21A 5F7FA 1FH5H 2MCPL 1U8PA 1QFWH 4R96B 1LDPL 5JW4Q 3OKEA 4Q0XH 1NCWH 1MFNA 4XBPA 1RZKL 3VGAB 2W60B 4XNYH 3VG0L 2JIXB 4HK3J 5CLWA 4RAHA 1CFQB 4LKCA 3MJ9H 2HFFA 1DLHB 5FO8A 5C9KA 2IEPA 3MV9E 5IW1A 2VXSH 4GG6A 3RHWK 5TE7L 1NAML 2ZWLT 1RHHA 4ONGL 4ZOCA 5INDB 4NNYA 5CIPA 4HMEA 1OAKL 3MLWH 5C3TA 5D5MF 3GUTB 3P2TA 3GMMA 2ITDA 3WN5A 4Q97A 2IMMA 2GTZB 4MCYA 1G7MB 1T7WA 5BV7C 1MCBA 2IALB 2R69H 5DVKA 1RZGA 2X10A 4KDTA 4LCWA 5BRZE 1I1FA 4LCUB 4QRRB 1F90H 4DW2H 5I8KH 1L8JA 4X4XB 3ULVE 1XMWA 5LVEA 5FCUH 4LARH 5HYQA 4H8WL 4JG0H 2I9LB 5F44A 1LEGB 2AGJL 3H9HB 3O6LH 4QHNB 3LQZB 3SKJL 3HAEH 1V7ML 2MQCA 3FB6A 4PJ5E 3L5XH 1CIDA 5F96H 4I18A 2OL3A 2XZQH 5ESQB 1RI8A 4U1SB 4AYFA 3EFDL 4L8DA 4ALAL 2DWEA 4S1DC 2VZ3A 4HSQA 3V8OA 4AM0A 3NIDF 5HVGB 3KYOA 2UZIH 4MCZA 5DHVH 4GAGH 3H7LA 3WFEL 4DKFH 3GSNB 5JZ7C 3HNSH 1FO0H 3AAZB 3V6OA 1I1YA 3T8XB 3VXOA 2RB8A 5F7EL 3JWOL 3DBXB 1UJ3A 1DBML 4F9PC 4NKDB 4Y8AA 2XFXA 1CFBA 4XP1H 3FO0L 1EBAA 4D0CB 1FAKT 2YA0A 3C6LD 1OL0A 4LSUH 2AJYH 4GAYB 4J3SA 4MD0B 4IRJA 3CXHJ 5CLTA 5AZEL 1CBVH 5CINH 4ZS7H 5E99H 4IRZL 3J7HA 5E08L 3EYOB 4I3SL 4E9LA 2ORBL 5EOQH 5D7JA 3ALWA 3BZ4B 5KW9L 2X4QB 4K23H 3NACH 3GSXB 1DEEA 1J9CT 2C3GA 3RWIA 3MLRL 1S5IH 1DQML 2I60L 1P7KA 4Z0BL 3SDCB 1XIWB 3DGGA 3OPZL 1I7UA 3QAZB 1MPAH 2AJ3A 4OLZL 3VFRA 2BSED 2JIXA 1IC4L 5C0BD 4AENA 3C5ZB 1CFQA 4QNPE 4WW1A 4XPFL 4CVWA 1JPFA 2Q76A 3FQRB 3ILQD 3ARWA 3QNZB 3CFKB 2GTZA 1G7IB 4BZ1H 1YN6B 5TFSL 1AI1H 4FZEH 3JV4A 2IALA 2BNRE 3LQMA 4POYA 4Y4FD 1BZQK 3HI6H 1G9ML 3LQAL 2DQDL 3QHFH 2K9UA 3BE1L 3DLQR 1AY1H 1JGLL 1JWMA 1S7QA 4Y19D 4X4XA 4Z78B 3F5WB 4OT1L 3QQ9D 5HI5C 1RIVL 3ARBB 2IAMA 3K4AA 4EN3D 8CGTA 3EYUH 3EJYD 3HC3L 5SX4I 2CDEA 1BIIB 2CLZB 1YZZA 1YEJL 3EYVB 4HW6A 5I1AB 3L3GB 3VXTA 4KXZI 3E1F1 4C83B 2BOCB 4L4VE 2OZ4H 4NZRH 4L4TB 4P23B 2PN5A 4KUZH 3VH8B 4KRNA 3VXUB 1FNSL 1L7TL 1J8HA 4XWOC 3VFWB 1KCSL 3SHSA 2CO6B 3RVUD 3MRIA 3LD8C 3O6KH 5KVDH 2FR4A 1A02N 2FECI 5DGQA 3AS1A 3RUGF 5FYKH 1U9KA 1LP9F 5IG7B 1CK0L 1F3DH 1IC5L 1NGZA 3DBXA 2G75B 3MRRB 3B9EA 3KDMA 1R24A 4NKDA 3F6IA 2J8UE 4KDTC 1UWEL 4K3JL 3LS4L 4ZSOB 4Z7QF 3VI4F 2EH8L 4L1HA 1ACYH 4MD0A 5BS0A 5LAXA 3EYOA 4IMKC 3TO2B 4ZFFB 1ZK9A 2NY5L 3CCHB 1U8MB 3Q6GL 4TUJB 1J0JA 3U1SL 3U36B 32C2A 3S5LG 3JWDH 1TQBB 4DTGL 1IM9A 2QQLH 4I18C 2PW1A 1HYSC 1MREL 4PREA 2KUTA 2IBBA 3MX0A 1NMAL 1XIWA 2FGZA 1BF2A 3BKYL 4Z18A 2FX9H 3GEWB 3LKOB 3MLVH 1A5FL 4M8QB 3SGJC 1MLBA 4PRID 5F7NC 2FZ3B 3I02B 4NN7C 3QJFA 4OUUA 3WKML 2M2DA 2XN9A 3C5ZA 4DGIL 1QRKA 2Y1VA 3V6OC 1CT8B 1IAKA 3OKNB 5C0BE 1TITA 5D1QA 2X70A 3H9ZA 1UB5B 4OM1L 2C4FT 3K2UH 4PUBL 4TUKH 1UJ3C 5EU3B 3RWDB 4WHCA 4BYHA 2O93L 2VLME 3DRQB 5IMOA 5LGJA 2WLZA 4QF1B 2R8SL 4DJMA 2N7AA 3CFKA 4XBEH 1BZ7A 4GT7A 4M93B 3MBED 4CW1B 4JGJA 4NO5A 3MBXL 3CAFA 3X11A 4AY0A 5FGCE 1QR1A 3RDTB 4CADA 5DJDB 1TFHA 3AU1B 2W91A 1AH1A 2ICEA 3F5WA 5B38B 3GJFB 3T04D 3C2AH 4YHIA 1YEDA 3PV6B 3MRMA 5J9PB 5I1CH 1FBIL 4PJXE 1HH9A 4RGOH 2ICWA 2Z91A 1E4XI 3KPMA 3KPOB 1F02I 4PJIE 3L9RA 5AWNL 4PJEF 3FQTB 1VERA 3AMKA 4JPVH 3VGAC 4P9MH 2NW3A 4L4TA 1I8KB 5IK3A 1F4XL 2IMNA 3VXUA 3UZQA 5JHDA 1RQ5A 1U3ZA 3QO0B 3W5NA 3VFWA 3ZKXB 2H2PD 3ARUA 4MB4A 2WV3A 4H0HB 1J5OH 4U33A 5AAMA 5FAAA 3VGDA 2MNUA 2BRQA 2P5EB 5IG7A 1EO8L 2G75A 4XGZB 2NY3D 4JZNB 1QSEA 4PJ7A 5EB9A 4GG6E 2H2SD 4WV1A 3GSVB 3JVGA 3SQOH 1MH5B 4Z9KB 2DL9A 1AQKL 3TO2A 5C0RL 4ZFFA 3I85A 4HPOL 1KBGH 3CCHA 5CHNB 1ZEAH 3GDBA 4OCWH 4TUJA 3RNQA 1T0PB 4LCWE 4Z7NF 1KYOJ 4F80A 5CEXB 2GHWB 4C4KT 1JZ5A 5I8OL 1NGWB 4E5XB 3EZJB 1NEZG 2VITB 4G9FB 1VADB 3V6ZB 3T09A 4XI5C 2KQNA 1CTOA 4PJDF 3ZE1E 5HHNA 3OB0H 3I02A 4XRCB 2NZ9C 3DMMD 5C09B 4PRIE 4F9LC 3P4NA 5GXBB 4LHUD 1MHCA 3OKNA 1BGXL 2H3NA 1UB5A 1J8HD 3V0VB 1GZQB 2HT4C 5EU3A 1S8DB 2VLJD 4M4RA 1H0DB 1I9IL 3RJQB 2RCSH 4ZFZB 4F7EB 3FONB 5B3NA 4YUEL 5DT1L 5ECJE 2A9MH 5ANMA 4F57H 3V6OE 4O00A 1JUFB 5BXFA 1WC7B 3RDTA 4YHZH 4LHUG 1CLZH 2EDKA 4KI5C 3RWGB 1AE6H 5B38A 1LE5B 1PG7X 1DEDA 1K8IB 3PV6A 1E27B 3U9UB 1E4JA 1SJXA 4HUKB 5J9PA 2R29H 4NC1E 3SDCC 1EHLL 4G9DB 2I5YL 1XIWC 4Q6IB 4P2RA 2QADB 3ROOB 1C16B 5FYJD 1JHTA 2OJZH 2Z31A 3QAZC 5KZCD 1FVDB 3FQTA 1I7ZA 3UAJC 1E4WL 1CGTA 1I8KA 2V7NA 4ELKB 2XACC 3C5ZC 2YMXH 5L2JB 3QO0A 4AEIL 5C07B 2BDNH 4W4OC 2ICWI 1DL7H 2FATH 4BQCA 1W72L 2G60L 4AEFA 5IESL 2W9LA 3KHQA 2C5DC 5LJYH 1DUZB 4O5LH 4KKAC 1CL7L 4XZUB 4QTIH 1SM3L 3JWNC 4XGZA 3IJYB 2V2TB 5J6GA 4J8RB 1G6RA 2WBJD 1RZJH 1BF8A 5KVEH 3QUZD 3GSVA 1RZIA 1HEZA 1A9EB 5HHPB 3RAJL 3MUJA 1CFVH 3MRPB 1J10A 4HMDA 3QYCA 4NWUH 1A3QA 1UWGL 3Q2CA 3WHE0 3UTSA 3GMRB 4NO0D 3F6LA 3ARBC 2OR9L 4UV7H 2OP4H 5H37H 3P30L 2DQFA 1GGCH 1RZKC 5L9DH 5CEXA 4DZ8A 5TPWL 3PWJA 1WIOA 5BVJA 3MRNA 1S3KH 1JZ2A 1EPFA 2E7BA 2VUOA 4G9FA 1VADA 2GY7B 5JQHC 4Q6YA 3V6ZA 4P23C 4UBDC 4Z6AT 4FFYH 1C5BH 1WWCA 1ZT1A 3OKYA 1BFOB 3LEVH 1I3VA 1OAYH 4LKXB 4M9OA 1UADC 4K94C 1OTUD 2NY6D 1U8KB 5C09A 4JHAL 4OFYA 5FV1L 3DV4B 3QCUL 1KIPB 4YGVA 1OAXH 3CFBB 3T4YB 2B7DT 4FQLL 1A4JB 1S8DA 4YXKH 3UTTB 1J8HE 4PJGE 1MLCA 3FO2B 2BNUA 3EHBD 3JVGC 1I9RH 3V2AR 2DL2A 4Z7VF 3X3GL 5HYJB 5GGRA 1WC7A 1D9KD 4POUB 3ULUL 1CFNA 4MQXD 3WNKA 4PGCB 1BM3L 1YY8B 3RWGA 5DK2B 4BA8A 1LE5A 1TQBC 4YDVA 1RUPH 1K8IA 5BS0E 1E27A 1HXYB 1TMCB 1RVFL 4HS3A 1MAMH 1AXSB 2J6EH 5IWLA 1ES0A 1JZ3A 2R4SL 5MEPA 4Q6IA 1HHHA 1G0XA 1JVKA 1C16A 4XPBH 2LQRA 3WHXB 5DJ8B 3GRWA 1FVDA 1M1SA 2DI7A 4FABH 4TRPH 2OJEA 3MRLA 5KBNC 2ZPKL 4ELKA 3BZEB 3EDFA 1A6VH 3JWOC 5CEYA 5EO1A 5IBTL 3NH7L 3X17A 3WXVH 2FB4L 3KYKL 5DZOA 1DUZA 4RISH 5KTEL 3MGAA 5C0NC 2XN9E 4XZUA 1EFXA 3H9YA 1JNLH 3NMEA 4M93C 3FHQA 2HRPL 2Y06L 1KTLB 1INDL 1KYOK 4L9DA 1YUHA 2EICA 3RDTC 4Q74A 4XMPL 2MJWA 3TJHD 1N5AB 3MRPA 5DK0B 3WV0A 1SVZA 1T1WB 5B39G 2Q7YB 4JPWL 1A3LH 4FS0A 4MSWB 1OCWL 3AFLA 2PXYD 1N4XL 2CIKB 3DUUB 2GTWB 3ULVL 3WUWG 2X4TB 4HK0B 4QNPF 1HQ4A 1B4JH 3NZHH 4LL9A 2VISA 2IG2H 2IFFL 4HH8A 3THMH 5T33L 4NHCH 1W72B 2R1YB 1BQHG 3ABZA 4EI5B 3ZKXC 12E8H 5E00B 3MFFA 4MVBD 3VWJB 4WO4B 3DV4A 2NLJB 1XF5B 2NY1B 3CFBA 3T4YA 1M7XA 5JHDE 3LQAC 2D7QA 4GQ9H 4HUUB 3UTTA 5HYSA 4KK6C 2Y36L 3O2VH 6CGTA 5DVLA 5J4MA 3B9VA 4WFGD 3GJFK 5CD3A 4XP9L 1HKFA 3W2DL 4Y4HD 1S7XB 1YY9D 3DROB 3GSRA 5HYJA 2W9EL 4X98B 3OR6B 4NP4H 5KSBF 4XNUL 2QBWA 4M62H 5DJYB 4PGCA 1QSEE 1OP9A 1YY8A 3FQWA 4IJ3B 4PJ7E 5CJOL 4S1SL 1WZMA 3T0BA 4YDKH 5DFVC 4ZAKD 3P0VL 4HLJA 5ID0A 3FQXA 2E27H 2FBJL 5J3HD 2UY7A 2VAAB 2RFXA 3TA3B 1N6VA 1BBJA 1DSFL 3LEXA 3WHXA 3GKWL 3WSQL 2AJXH 4WNQA 3IJHB 4FP8L 1DQLL 4JREB 4L1DA 2CGRH 3SGDH 4WGVB 2BCKB 5F9DC 2LFGA 3QWRA 1I9JL 2J8UF 4GQPH 1YEIH 1MRDH 2D4FA 4RQQA 3L3DB 4HG4J 2AK4D 5FA4B 5BV7H 4F37F 1KCUH 3P9MB 1KENH 3QDAA 4PRDB 5DUMH 4HKXB 4UQ2B 1NCDL 1MHHB 4P4KA 5I1IH 2Y25A 1KTLA 4WTWA 3I2CL 1FIGL 2DKSA 3HZYB 1N5AA 5FGSA 3O2DL 1OPGH 4OZFB 1T1WA 4PS4H 4X7SL 1QR4A 2JCCA 4HKZB 3V9FA 1WTLA 5D2NA 3E2HA 2DBJA 3TCXA 5ANME 1AFVL 5IWLC 3EYQD 3QO1A 3GIVB 5FYLE 3FN0L 2GTWA 4Q6IC 2QADC 4NM8L 2X4TA 1DQQB 4HK0A 5E2UL 2E7CA 1RUML 3F12B 1KB5H 3WDHA 3UJTL 1TTGA 2VABB 1A0QL 3JSSA 5JIKA 2VQUA 3B3IB 2GSIB 2KDGA 3TCLB 5EOCJ 4EI5A 3WFBH 4P2RE 5FECB 3QFJA 5EBGA 4XH2B 5C08A 4S1RL 4KZEL 2DKMA 3VWJA 1IKNA 3P77A 4PY7B 2NLJA 4ELMB 5E8PA 3VW3H 5JOFB 3V5KB 2JTDA 4HUUA 1OGAB 1ZGLM 3FO1B 4H1LH 1URLA 4X83A 3MRBB 2V2WA 5F9WB 4V3DB 4U7SA 4B50A 3DROA 3MJ8B 4WFGE 4KKCD 4PJXF 4PRPA 5I1HL 1ODAA 4U1HA 2XRAH 3D9AH 2HKFL 1PYWB 4PJIF 3H3BC 3PGDB 4YAQB 1M05B 2EDJA 5MEOA 2VB5A 2GUOA 3CVHL 2DM4A 2VDML 4MA8H 2PYEB 1TNMA 3CC5A 5DJ0A 2QEJA 1G7JA 4M6MH 4CRPA 4HQQH 2H9GA 1WBZB 4X6CB 2J88H 3UTSE 3TA3A 2ATPA 4OLWH 5KVGH 4HKBB 2GK0B 4P2QB 5L7XL 2R0WL 1TTFA 1AR1C 3BP6B 4G8EB 4J3XA 1NUDA 4GG6F 4TNWF 3TYGH 1LK2B 4S0SD 3L3DA 4W70A 1X4XA 3PP3H 1I3RB 1GC1L 3N85H 2AK4E 3B5GA 5DD5H 3PL6D 3LOWA 3I75B 4PRDA 1LO3L 1VEOA 3JTSB 4OAWA 5EU6D 3W11D 3W39A 3UZVB 2VH5L 4CMMB 3ARVA 1YN7A 1ZA3B 2DQCL 4MAYD 5CSBA 5CBEB 3HZYA 4PJ9A 5GGUB 2F5AH 5GRWA 2F9BT 1FSKB 2FJGA 4U6HA 5EC1A 2VDRL 1MCOH 1A3RH 3ZE1F 1HDMB 5CJQH 1AD9B 3LVEA 1MCJA 3EW3B 1TZHB 2DLFH 1CI5A 3RNKB 1ZLSH 1ZHNB 3U0TA 5JR1L 4OD1H 4PLKD 2ITCB 2IQ9H 4FMKA 4GXVH 3S97C 5GGSY 1YECH 3O45A 3UDWC 1I75A 3MV11 4YBQD 1ZLVK 1H5BB 5EZJB 2GSIA 4YXHH 3DV6B 5FECA 1WZ1L 4N5EA 4NNPH 4NPYA 1BP3B 3VRLE 5CD5D 1NLDH 2E9BA 3HG1A 1MHPL 2G2RB 4JFXB 1X6NA 4Q9CA 5FKPB 3QISA 1QA9B 2Y07L 3BVNB 3MTRA 2B20A 4O51B 3I9GH 2FO4A 1KEML 5DMGD 3QEGL 3MJ8A 4Z7WB 4OCRL 1RIUL 2YD7A 3GO1H 1XAUA 4OCMC 1YNLH 1IEHA 5C0AB 1MVFA 1VGEL 1YEGL 2OL3H 1JL8A 3PWNB 3L3KB 3T4AA 4ODBD 2IGFL 5JQ6L 2MCG1 4Y1AD 4HG4K 3ALPA 3LIZH 3W0WB 1HSAB 1HIML 4WU7B 4HJ0C 1PQZB 3D69B 4EI5C 1GGYA 4HKBA 2H6PB 4P2QA 2GITB 4LSTL 4YHPA 3NFSL 2YKLH 3VWJC 1LDSA 5IFHH 1IKNC 3RX7A 4WENB 5ACZB 2NY1C 1TETL 3RFZC 3HS0A 5EU4A 1LGVA 3OSKA 3CSYA 3QP3A 5E6IA 4PRAB 1PG7L 2FECL 3NOIA 3RVXC 1UM6L 1NUNB 3I75A 2F19H 2F58H 4PJ8D 2GI7A 3F7YB 4HGKC 3C6LB 1IGTA 4XNMA 4P2OD 1VA9A 2BHZA 2NYYD 2VC2L 4IJ3C 4JRXD 3UYRL 3WXWL 1QBMH 5LKNA 2AVGA 4JFEA 5TQ0H 5EZIL 2XTJD 5ICXB 1Q0YH 1KULA 1MFDL 4G6KL 4LSSL 4LVHB 4TOYH 3TA3C 3RNKA 1ZHNA 4P5TD 2YD1A 3VCLA 4LQFL 4JREC 2ITCA 3HA0A 2P8PA 3LDBB 3X14B 1CU4H 1TPXB 4UINL 5JOPE 2IADB 3DV6A 1J1XL 3GI8L 4NQVA 5C8JA 1RJLB 1BFTA 1XGUA 4NQTA 4UIMA 1HXMB 2Q87A 5IFJB 5HYIA 1B0WA 1BBDL 1IBGH 4IDJL 1TJGH 3ULUC 4KVCH 5FUCC 1QA9A 3BVNA 1NUGA 1P7QA 1SMAA 2J8HA 4O51A 3ZL4H 4JO1L 2OK0L 4LF3A 5L0QB 1EGJA 5I16A 1FPTH 1ZAGA 4PJ9C 3VD7A 4RSVA 4JG1H 4I2XB 2A6IB 3FCTB 4Y4FB 3T2NL 4F3FA 3HLAB 3S7GA 1FORH 3MUGA 1VSCA 3DGCR 5C0AA 4Y19B 1H3GA 1WCQA 3ARYA 3ERYA 3WFZA 3N1QC 4PG9B 4YPGA 3S36H 5HJ3B 3DWTA 1MAKA 2JCCE 4DKDC 5D2NE 3T2QA 3OG6B 3W0WA 1HSAA 2CMRL 3IJSB 4IOIB 3MUZ1 4PP1D 4Y1AE 1E4XL 2HJKA 4RGND 3D69A 4W81A 5DJXA 3GSNH 3WKNA 5JORB 1R5WA 4NRZB 2GITA 2AJVH 4LSQL 4N5EC 4NCC2 3UJJL 2EE3A 1U6AH 5IR1B 5E8OB 1KJ3L 1MSPA 3EFFA 1UB6B 1JGDA 4PRAA 5EBMA 3DX6B 3QFJE 4PPTA 5C08E 3S5LB 1MWAL 4FXKB 3F7YA 3UXFA 3TPUB 4Y16D 2BHUA 3K46A 4Y2DD 3QCVH 3QXDB 5F72S 2DF3A 4G59A 2YUVA 3TT1L 4UV4H 1BZ9A 4HC1H 1XF2A 1QRND 5DQDL 3GSOB 2Z93B 4JRXE 5ICXA 3KPLB 4PRPE 1A2YB 1DBJH 3O11B 3BIBX 2ZUUA 2XTJE 3GIZH 5ILTL 3N1FC 2BOBA 1UVQB 4WI4A 5GGTH 3REVB 1G1YA 4QXGH 3QIUA 5DD1H 4QXTB 1UZ8B 5IB3B 3EOTH 4HXAL 4B7IA 3V4UL 5D72H 5F6IB 3Q0HA 2Z35A 5HHXH 2APBA 2IADA 5FUZH 1LMKA 5FYJL 4C54A 5A2JH 1P53A 1HXMA 3GB7A 2BERA 4J3UA 4PJCA 4PJ7F 3CXDL 2C26A 3LPWA 4TPRH 1NL0L 3HMWL 3VFGL 3VG9B 5IBLD 3VDAA 3AM8A 3K4ZA 2MCPH 3MBEB 5E8DL 1E0OB 1LDPH 1FSKC 3NGBB 3HHRB 4DFHA 1RZKH 3HLAA 4XPHL 3VG0H 3SBWA 5ELIA 1N8ZB 2QLVB 2DQUL 4ZXBD 3MYJB 1OSZA 2W07A 3MOBL 4U0RB 3KNBB 3LN9A 1LQSR 4XPGL 3U6RB 1CFTA 4Y5XA 5D8JL 5E1AB 5TQ2H 4D0DA 1NAMH 4HPYL 4ONGH 4TTDD 5HHMA 1GOGA 5AZ2L 1OAKH 3L7FA 1QBAA 3B43A 3CDCA 3QULA 2F8XC 3IJSA 1H5BC 1WFOA 3QB7C 3CZFA 5KS9A 5T1LD 1JIBA 5D6CB 4NRZA 2APTA 1JTOA 3Q3GB 4HH9B 2QQNH 43C9B 3VD4A 4BM7A 3ELAT 5TE4L 4ODXA 3ZKND 5E8OA 1YDPB 2FJFB 4H88H 4HBCH 1UB6A 1S7SB 3P40A 3TFKA 1BVZA 4H8WH 4U1GB 3DX6A 5CEZD 2AGJH 1UXWB 3WJJC 4HT1H 2NY3B 3TPUA 3HG1E 3SKJH 1DUYB 5D7IA 4KKLC 1NEZB 2QHLA 1JZ4A 1S78C 4YIQB 2NY2D 3EFDH 4OM0L 1QBLH 4ALAH 4BQBA 1NBYA 4OJFH 5FA3B 2ED7A 1U92A 2QHRL 2EECA 3IDNB 3MV8D 5EOTA 4AQ1B 5DSCB 1A2YA 4YO0B 3WFEH 4F7MA 3MRHA 2P24B 3DYOA 2D0FA 4I9WE 2DBLL 1UVQA 5F1SA 2IF7A 4MNGB 3BH8A 1KXTB 5F7EH 2QSCH 3JWOH 1TQCB 2OI9B 3EOYG 3JV0A 5IFAL 3FO0H 3VFNA 3WEXB 1X7QA 2HN7A 1A1NB 4MJID 4CMHB 5DC4B 1ZVYA 1IEAA 2IH1B 4LRIC 1BLNB 3DMMB 4IRZH 5E08H 5F8QC 4I3SH 1MWAB 2ORBH 1C08B 1GXEA 4LHUB 3CK0L 5ALCL 4MJ4A 3PHOB 1FNEB 4WTXA 5KW9H 5SWSA 2VLJB 2CR6A 3RKDC 5IVNA 1HH6B 1TENA 5DMKB 1QSVA 3SO5A 3MLRH 4MA1B 1DQMH 3C6LC 4ZFOB 3C5JB 1FVCA 2HFEB 4X80L 4Z0BH 5L6YL 3V5DB 3QFDB 3GJFH 3NZ8A 1J05B 2IWGA 3OPZH 4OFIA 4GRWB 4WHYH 4OLZH 5IBUG 2VZVA 1N8ZA 1IC4H 3MYJA 4JM2D 3E3QC 3NIFF 1YMHA 2SEBB 5KN5A 4XPFH 1CVSC 4G3YL 4JFEE 1F97A 1SVCP 1U8HA 2X5PA 2BSTA 3MREB 4HCRL 3LDBC 3SE4A 2NY7L 1TPXC 5TFSH 5GRZA 1D5ZA 5F9OL 2Q20A 3S35L 2L7JA 3LQAH 2DQDH 1OB1B 3BE1H 1EVTC 1OQOA 1JGLH 1YDPA 2FJFA 5GJTL 3QUMA 3ILQC 1I7RB 3L3OB 1P69B 2YC1B 3HC3H 5L0QC 4LLVB 3T65B 4GSDH 3U48A 3JZ7A 1DUYA 2E7HA 4LDEB 2WBJB 1NEZA 3DO3A 5HGBB 3V6FA 4EOWL 4EBQL 4Y4FC 5CGMA 4V1DD 3HZMB 2AXFA 4KH2A 3SBWC 4HS8H 4LRNL 1Y6KR 5FA3A 5HVWA 1L7TH 4RAVA 5DZLA 2YPVH 3IDNA 5DSCA 1MJUL 5I66B 2NZIA 3ME0A 5DI8B 5GRYA 4YO0A 3D18A 1GZPB 1JTPA 1R5IA 3EJYC 2C1PA 3U4EA 5J0BA 1JGEB 4ZOEA 4D8PA 3VRLF 2CLRB 1CK0H 5HHOD 1IC5H 1RMFL 4NJAH 3WJLA 5ETUB 4YDLB 3BAEH 5IEKB 4OCXL 5KSUA 3PIQB 2ZOKB 2OMNA 4N0FA 2D03L 1UWEH 1YYLH 3LS4H 3S4SG 2EH8H 4F7CA 1XGRB 4MJIE 2DQJL 4NCC1 2Q7NA 3L7EB 4PYGA 2NY5H 3FO9B 4ODWB 4XCYB 5FKAA 2HG5A 1GIGL 4HWZA 4Y89A 3Q6GH 5LG1A 3U1SH 3PHOA 1JHKL 1FNEA 3VE0A 4EUPG 4DTGH 5DMKA 2D7MA 4M7LL 1Y18B 4ZFOA 5L2KD 2WP3T 4XPAL 1MREH 2HFEA 5C9JB 5GGSB 1NMAH 3V5DA 2QJDA 4MWFA 3STLA 1J05A 2DTMH 4LEOA 5EC2B 3EKCA 4MQ7B 4J4PA 1D9KB 2NXZD 4RMQA 1GOFA 1Z9MA 3WKMH 4J6RL 4DGIH 3VFSA 5MP6L 1FG2B 4D3CL 2SEBA 1ZGLA 3ZSSA 4AL8L 1VKXA 5D7LD 4GRLA 4OM1H 1N59A 4EDXB 4NUJA 4PUBH 4A6YA 4F2MA 3C6SA 5DUPL 3BH9A 4FXGB 2WZPD 5F6IC 3MREA 1LILA 4B5EA 2BSSB 3KGRA 3UP1A 1T7XA 2XWJB 1FG9C 1U0QA 3MBXH 5IKCB 4PR5B 1ZT7B 5HD8D 2X4RB 1OB1A 2AAVA 5B39B 5FO7B 2VJXA 5LXGL 3K2MC 3NCCB 2E9IA 4R4FH 2EYTA 3VG9C 1FBIH 4LLVA 4KTDL 3MBEC 4OFVA 4BKLA 3CFIC 3VMPA 2HLFD 4UNUA 5AWNH 4YK4B 3NGBC 4BH7B 3ZDZF 4PJCE 2P7TA 4UT7L 1FFOB 5ENWB 3L95A 1EEUA 4E41A 4U0RC 1BQHB 2CDGB 4XTRC 3WD5H 4U6XB 3CUPB 1ZSDB 2HT2D 4L5FL 1CZ8L 3IU4L 2JE8A 5HGAA 1ND0B 3V95A 3MR9B 1ZMYA 4BSWA 1GZPA 3QEQD 5IB2A 1JNHB 4Y8DC 3G9VA 4NHUB 5DQJB 1U93B 2RBLA 1EO8H 4G6FB 1JF1A 3B4NA 1KIRB 1ED3B 2R15A 5HHOE 1YMMB 3SCMB 2K7PA 5F88B 5A43C 5HHME 2ICWJ 1PEWA 1ZLVH 1RK0B 5AYUH 2CPCA 5HSFA 1AQKH 3PQYD 4FFWD 3VXSD 4ETQA 5C0RH 4HPOH 5C0DB 2BZDA 5KS9E 1A7PL 1ZTXL 2Z92A 3R0NA 4U1GC 3UPRB 3QQNA 4XMLL 1MNUL 3ETBF 1P5VA 1NANH 2AKRA 3KWWB 2VQ1B 1KTKE 4X9FA 5I8OH 1A22B 1I8IB 2H2SC 4I5BA 4JLRA 5FDWB 5GGSA 5CUSL 1FNHA 4Y4HB 1VFBB 2JCCF 5L2KE 5EC2A 1P2CA 2DM2A 1CGWA 5IHZB 1RSFA 2L4OA 2ZOLA 3QJHB 3O2WL 4S2SA 5D7IE 4ZO9A 3TESA 3L3JA 4XP4H 4M03A 3B9KA 1BGXH 1D6VL 4ZAKB 5CS7A 1TQCC 3WJLC 1YC7A 2NTSP 3GSQB 2OI9C 5FB8B 3F62A 1I9IH 3UYOD 3D39B 3QEUA 4LK4A 4CMHC 1AKJA 4YUEH 5DT1H 5ID1B 1SHMA 4JFPA 3DMMC 5HGGS 4B53A 1WF5A 5IKCA 1WBXB 3P3YA 2R2CA 1RZFL 4KK8D 2B39A 4WU5B 4DVRL 2YS4A 5I1EH 3RPIB 4MA1C 1ZV5A 4EZMA 1EHLH 5JIHA 2O26U 4L8CB 3SE9H 4XHQA 4J4PC 1SYSB 2CR3A 4C56D 5SWSE 3D1MC 5IHLB 1KCKA 1IRAY 1JPTL 5ENWA 1JTTA 4U7KA 5DJAB 3OHXA 1DDHA 3EDDA 5JLZB 4U6XA 3CUPA 1ZSDA 3CSBA 5I75B 3ZKMD 4KDVA 1W72H 1AIFB 2YA2A 1EO5A 3INUH 3FAXA 4KMTL 4MMXC 1T04A 3GMNB 3QEQE 2WIIA 4OZIE 1CL7H 1EEYB 1PZ5B 1SM3H 4I0PD 3BW9A 5H35B 1K2DA 1C7TA 1ED3A 4ODVL 4YX2L 1YMMA 3V7AE 5JNYB 5EFIB 2NX5D 1ETZB 3LAFA 1MCCA 2APVA 2PYFA 1SBSL 1WGOA 2WMPA 1XF3B 1UWGH 4YHML 1FVEB 3HTLX 2FCBA 2OR9H 3RL1A 3P30H 5TPWH 2VQ1A 1P6AB 3MPCA 1I8IA 4HIJB 2EDOA 4XAWL 1VFAB 1IAII 3OAZK 2IFGA 1U91B 5BW7A 1R3HB 1QSFB 2P8LA 4YFLI 3P9WB 3QJHA 3ZDXE 3MLPA 4X4YB 3ILPB 1I7TB 2QSVA 4JHAH 2X4NA 2MPAH 3QCUH 4L8BA 4LNRA 2CRYA 2F54D 5DHXB 4KUCD 3PXJA 4FQLH 5BZWB 1MQKL 2OSLB 4YDLC 4LCYB 5FB8A 4PGBB 1DN2A 3D39A 4N0CA 1NCCL 5FUOH 4YGAB 4BFBD 5ID1A 1QVOB 3X3GH 3S96B 1OTUC 1WBXA 4U31A 4MB5A 3ULUH 1BM3H 5T3ZD 4LHJB 1IAMA 3BO8B 2GJ6D 1X9QA 3CNKA 1OTTC 4P9HL 3HPJB 1YA5A 4OZFH 5JO5B 1IEBA 3PL6B 3EUUA 5EU6B 2R4SH 4ODSH 1PKQB 5LCVL 1FLRL 1D9KC 1RJCA 1NFIB 5EIQA 4X6DB 3MGTA 4LOUD 4X7TB 2ZPKH 5DJAA 1WZLA 2DYPB 2HRLA 4KPHH 5JLZA 1FFQA 5HDQL 3QXUA 3TZVD 3VJ6B 5IBTH 1RJYA 3NH7H 4L29A 1AIFA 5GS0C 4JCMA 4NRYB 2KL6A 4U3CA 5DVNA 3PWVB 3GMQB 5AUMA 5KTEH 1I1CA 1LWRA 4CVZA 1OW0C 5KANG 1OARH 1DFBL 2HRPH 5K9JH 3OF6A 2Y06H 4GLRI 2VNCA 1INDH 2QR0B 5EFIA 5BOZG 3VFOA 2O5XH 4XMPH 4X7FC 2X89A 1AKJD 3BT2L 4GKSB 3G08B 1IC7H 1PBYA 3B9DA 3UMTA 4HXBH 1FVEA 1OCWH 4FQIL 1N4XH 1B0GB 2ZG1A 3PWPD 5CZXC 5M95B 4YK4C 1S7WA 2QQQA 1SEQL 1IQDA 4X99B 3SDXB 1FNGA 3TJHC 1NH6A 2WWMD 5T33H 1E28B 5J1TC 3PABB 5D2LE 1U91A 1R3HA 1QSFA 3BYYA 4R0LB 3CFJB 3OX8B 3BIAX 4IS6B 4WW2A 5IW6A 2GK2A 4GG8B 4P5MB 2XPGA 4E41E 4XCFH 5D93B 1KTRL 4LCYA 2Y36H 5SX5K 3SCMC 3ZMRA 2EYSB 3DRTA 4XP9H 5DJ2B 5ESAA 4JFHD 2FJHA 4FQXA 5FGBC 2EDWA 4X6FB 3HE7B 1XR9A 4WEBL 3ZHKA 2W9EH 4MVBC 4JQVC 1QLFA 4XNUH 5HGDB 1FZMB 4ZTPL 5CJOH 2E7LA 4R90H 3IFPB 3NFNB 4NQDB 5F3HA 3OKLB 5JO5A 3OV6A 4I1NB 1NDGB 1NGXB 2X1OA 2FBJH 2W9DL 3QQ3A 4PJ8B 2F8VA 1A9BA 4Y4HC 1PKQA 3U4BH 4NKMA 1DSFH 3UTZA 3STZB 1FHGA 4U1JA 4DN3L 3GKWH 3WSQH 2OTWA 4FP8H 1DQLH 1KOAA 2G9HA 4X6DA 4X7TA 3IS1X 1D3CA 4BFIA 4CGTA 5ISZB 2F74B 4LCCB 3H6JA 2DYPA 3O6FD 1R3KA 3OR7A 3FQUA 3KPSD 1I9JH 4LSDA 1BX2B 4NSKB 2PKDA 3MGOB 3R0MA 1MVUB 4ZAKC 4G43A 3VJ6A 1EAPA 1EBPA 2E6JA 3DO7B 4KZDL 5J3HC 2V9QA 3T77A 5HVFB 2I07B 4N0CC 4P5TB 3T3PE 1U8QB 1NCDH 1V3LA 4MHHI 4PP8C 5C2UB 1B6UA 5IB5A 4XAKD 3I2CH 3FT3B 5IV2B 4G7YL 4PGJA 4NO3B 5FM5M 3MLUL 1V3KA 3O2DH 3NTCL 4X7SH 1FAIL 4QOKB 5K59E 3SE8L 2AS5M 3GMLA 4RA0C 5DA4A 5DO2C 3VFVA 1PFCA 4BSVB 3FN0H 1NPUA 1B0GA 4NM8H 1TJIL 4P2CG 1F45A 4N9GB 4BH8B 5E2UH 1HYRC 4JM2F 1N6UA 3E6FB 4LVNB 1WFUA 3HUJB 3UJTH 5CEZL 1A0QH 3PABA 1N3NB 4JQIL 5I75C 4GS7B 1OAUL 4S1RH 2I24N 2A9NL 4NWTL 3QDJA 1HZHL 2X4UA 5K9OA 3WNOA 4ZOBA 4H20L 1FGNL 1IGYA 1MIEL 3BN9D 4PGDA 2EYSA 2EH7L 4RGNB 4PJAB 2BVEA 5DJ2A 2YR3A 4XPTH 1LVEA 4X6FA 3QUYD 2X6MA 3HE7A 5I1HH 4FG6D 1U8OA 3TIEB 2HKFH 3PWLB 2FYYA 3RQ3A 1FZMA 3UZEA 1IFHH 5E8NB 4PJCF 4DVBA 3CVHH 2VDMH 4G8FB 2XZCL 1P4LB 4NQDA 2AQ2A 4ZYKA 1JRHI 5A3ID 1E4KA 5KAQF 4KK5C 3RU8L 3O4LD 4U49A 5M94B 4KKCC 1I8MB 4Y16B 1PSKH 3HKFA 1CE1H 3STZA 2YHGA 4Y2DB 2VTFA 1DVFD 5L7XH 1CG9B 2R0WH 4OGAD 5ISZA 3RGVD 3TO4D 1MUJA 4LCCA 5I1KL 1QRNB 3LRGA 4J1UB 2GY5A 4GAJL 1JMZA 1MVUA 3IB4A 3KPSE 1G9EA 4EIZC 4I3RL 3DO7A 1GC1H 3GBMH 4XXDA 5C92A 3SGKA 1RD6A 3MYZA 5KS9F 2I07A 1LHZA 1LO3H 3Q48A 1U8QA 2VH5H 4D0BA 4OSUH 4K9EC 2DQCH 3TN0D 4NO3A 4Z76B 4QTHA 3LN4A 1IGFL 4LIQE 3ZLQC 1O7SA 2E7LC 1JPSL 1SJEB 4OZHA 3V4VL 3AC0A 3DSFL 5D70L 4QOKA 1NJ9A 5J11B 4AJ0A 3EOBA 2X7LB 3PL6C 4RFNB 43CAA 3UX9B 5D7IF 1UA6L 2X4SB 3KYAA 2KZ1B 4N9GA 4ZNEA 4BH8A 4JFZH 5JR1H 3RY6C 3KXFD 2J2ZA 1A1OB 1UKTA 3WIFA 3IAQA 2GQHA 1T2QH 1N3NA 1CGSL 2UY6A 2OYPA 1WZ1H 1OVZA 1Z9LA 3BKJL 1MHPH 1MJ7H 2PR4H 3PGFL 2JB6B 1T89A 1DQDL 3KHOA 2Y07H 1KEMH 5T1LB 5JA8B 1JFQL 3QEGH 4OCRH 3MODL 3PWLA 5F8RC 5C0IB 4ZDHB 5DRNA 3NN8B 5E8NA 1K85A 3EDEA 1VGEH 3BXNB 4GBXA 3S34L 4FMFA 5DEGA 3F7RA 2CUHA 3AXLB 1FYTA 5DD0L 3VXPA 5JQ6H 4R4BB 1ZVSB 5SX4H 4F7TA 1WWAX 3HMXA 5I71B 2H8PA 4R0LC 4OZIF 1X5LA 1CG9A 2GT9B 2HKHL 2NY2B 2YZ1A 4LSTH 1R3JA 1T0NB 3NFSH 1QEWA 4LU5L 4PTTA 2W0FA 1NC2D 4PRBA 1TETH 5JPNA 3MV8B 3TBYB 4LDOB 4WFFE 3CMOL 4NQCA 5D93C 1FZOB 1QPPA 4I4WA