4APQA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
290
structure length
290
Chain Sequence
b'KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4apqA01
1RJCA 1BQHG 2YD1A 3V4VL 5FA3A 3DHJA 2HKFH 3ULVE 2APBA 4ODHH 3BPNB 3V5DB 3IRZA 3OWEA 5F72S 3HC4L 5D7KE 2X4TB 5EB9A 3V4PL 4QLRA 2XA8H 1CLZL 5LXGH 4I9WE 5ADOL 4UU9A 1W0VB 1VA9A 5BXFB 3PG2A 5J13B 5FOBB 4LVHB 2VXTH 4JFFA 4UAOB 3TESA 1ULVA 4K7PH 1QEWB 4JHAL 3CFDB 1UM6H 4Y88A 2JB6B 4NPYA 2C4FT 4JFXA 1T7ZA 2ITDA 1SM3H 5K93A 3RDTB 1DVFB 4MVBA 3LN9A 3ZKXB 1ZT1B 4G8GB 4YPGA 3IFPA 1YPZF 4I4WB 2BOCB 3VFMA 4UQ2A 5ACMA 5HHXL 1KXVC 4OGAD 3QDJB 3QQ3A 1QBLL 3GRWH 4PR5A 3SKNB 2YRLA 2AEQH 3PP3K 5LBSL 1IZJA 2CPCA 5FGBC 2EDTA 3Q48A 5GIRB 4MAUH 4Z9KB 4TN9A 3MPCA 2D3VA 3SE3C 4O51B 4HX1A 4IRJD 5EU6E 5CFHA 2JIXA 4FG6C 4HS8H 5GPRA 3HRZA 1YEGH 4OCWH 5F7FA 5SWZD 4XNYH 2HKFL 3M07A 1PBYA 5D6CA 1J9CT 4ZXBD 3DMMB 2EXYC 4ODHL 2BVQA 4NO0D 4XHJC 4DEPC 4NNXB 3GSWA 4OZIB 1N8ZB 4FQCH 3RVWD 4WEUD 1AGFA 5MHSD 5ISZA 1HZHL 4XPAH 4HUWA 2Y5EA 2XA8L 2JJSC 3E0GA 5EUOF 5GS3A 4KMLB 1DBAH 1ORSB 3ULUC 4IHOB 3LKOB 4EI5B 4N0FB 1JZ8A 4JO2L 1Z9SA 4WW2C 4PGBB 1EERB 3K80A 1KV3A 3NCJL 4K7PL 4M8QA 5BZWA 5C0BD 3ZTJH 3IDMA 2GSIB 1UM6L 4LVNC 1XGPA 4YDVA 1U8JA 2VLJD 3BP5A 2XZZA 1MCFA 1R3KB 4P48A 4OCXH 1XR8B 3C6LA 4YC2C 2YD5A 2Z35B 3OKDA 5D1XA 4ELMF 5DJYA 4LL9A 1UXSA 3IU3A 2ZOLA 4K8RD 4WGVB 1X4ZA 4P2OD 5L88L 1OARH 3GRWL 1UH4A 4PJDF 3CSGA 3F5WB 5DZOA 1C16A 1QLRA 1KIUA 1FQ9C 2E7MA 1FZMB 4TNVK 3L5JA 5KSVB 4WHTB 1WZLA 5MP6H 3QXAB 1JGVH 4MAUL 3FQWB 4CVZA 4PJGF 4HFWA 2QHLA 3RU8L 5I15L 5AZEH 1YEGL 3MQIA 4XNYL 4JFPB 2DICA 1LO5A 3MA7B 3O2WH 1I1YA 4XCYA 4ZUSA 2PUQT 3AMLA 4TPRH 3CFKA 5HGDA 4FHBD 4RCAA 4FQCL 2J4WL 5IR1A 3QUYA 3LS4H 4FQJL 1SJEA 4XPAL 4LLDA 3KPSA 3D18A 4FTVB 4RWYL 3EKCA 1P1ZA 3MRJA 3ZSTA 1QR1B 2A73B 3BGMA 4NZTL 1HIML 2VSDA 4M61B 5D7LB 3ZHKA 3Q6FA 3CMGA 2GK0B 5D71H 4Z7VA 4U6TA 2H41A 2BSTB 4K3DL 4MNGA 4XX1G 5DMGD 5MEPA 3BIBX 1CI5A 4JPVH 3D5OF 4FMFA 1FZOA 5F6HI 5KSBA 3CXDL 1BF2A 4WGWB 5C3TA 1KELL 3PGCB 1F2XK 4G43A 4KAQH 4HBCH 2B1AH 2BDNH 3D3VD 4LVOC 3RNQB 3ARED 2NY2D 4NQED 5ILTL 4OZGE 4X9GA 3T3PF 2NYYD 2P8LB 3W9EA 2FL5A 3MODH 1ZLUK 1OARL 1A6WH 2X1PA 1BQLH 3LN5A 1SJHB 2DLFL 1I7RB 5BV7L 3QA3B 4Y4HB 4MQ7A 3IYLW 3MNVA 5EIVA 1IM3B 1JGVL 3K2UL 1BZ7A 4PV9B 1DQLH 1IKNC 3IFOB 1A14H 1QQDA 2Z0BA 5DMIH 4IMLA 4N0CA 4IIQC 4KJQD 5FF6B 5AZEL 6FABL 3WHXB 1F58H 3ARGB 4ORGA 3V5KA 4Q9BA 3UPCA 4QYOB 3O2WL 4UV7H 1C5CH 5H94A 3UCRA 1JTTA 1JYNA 3BIAX 3QDHA 3MYJA 1MIEH 2FGWL 3VFGH 1TETH 4JEGB 3NFPB 1NCDL 1NDGA 1NCTA 3KJ6L 1INEH 1PAMA 5CS7A 3S35X 5J1TC 4QRRB 3MRQA 4J7RA 1IT9H 1NFDF 2VKXA 4FQLL 5D71L 4XP6H 2FHFA 3VD5A 5ELIA 4Z0BL 2IH1A 4FQ1L 1BWMA 5BMFH 4D0CA 4L4VB 3U36B 4X4ME 1BIIA 4KAQL 4WUUD 4ODUA 2BDNL 4NQDA 1PQZA 3EDEA 3X12B 1NAMH 4LSVH 4DKDC 1CIUA 1T5XB 3O4OC 3NIFE 2CKBH 1F3JA 1EO8L 1A6WL 1BQLL 4J3WA 1A7NL 4S2SA 3EJZC 43C9B 3HCVB 3GMPA 3MOQA 1Y0LA 3SE4C 1CDYA 1TCRA 5FGBA 3P30H 3ZKMD 3O6FD 1EAPA 2AJXL 1T0NA 2YUZA 4OM0L 1YNLH 4X9BA 1A14L 1I7ZA 3SE3A 4FP8L 2NY5H 4XMLH 2NY1B 3V4UH 2EIBA 4GRLB 2ERJC 1WEJH 3SDCB 1BZ9B 3H7LA 4UV7L 2EIDA 2XTLA 5HDQL 2ZUQC 3QDJE 2WQRA 4OZFG 2CGRL 4P9MH 2L0DA 5BS0D 1J1PL 3IKKA 3W0WB 4M1CC 3ARDB 3PQYD 3CFEB 5E4IA 2JJSA 1AKJA 5D8JH 1INEL 2VYRE 4J8RA 4TOYH 1ZA6B 1IT9L 3PHOA 4GKNB 4N9GB 2VE6A 1AD9B 4WW2A 4OZIE 2VQ1A 1NCUA 5IB1B 1RK0B 5BMFL 3LKPB 2MPAH 4KRLB 4RAUA 2IQ9L 5BW7C 4Y1AE 2LFGA 4P23C 5JOFA 1D9KB 1NAML 3QJFB 4NN5C 5K9JH 1BEYH 3ZLQC 2R56L 2DQJH 1KBGH 5EUKB 3DVNB 1FC2D 2X1XR 3TBTA 4JPKH 1S5IL 1I7UA 4V1DB 3P30L 1I3RA 3EYUL 1YNLL 1RJLA 2GJZA 5E4EB 2HYMA 1NJ9A 3MGAA 3PIQA 1V7MH 4Y0GA 3WS6C 2VZVA 1WEJL 3ARXA 1YQ2A 3VXOA 4D94A 5F70A 1CDJA 4WO4B 4KV5F 5JIPA 1VKXA 1GGCH 1A5FH 1OAQH 2QHRL 4YAQA 3V6OE 4QT5B 1G7LB 2A74B 4XTRD 5D8JL 5I6XC 1UVQA 4OD2B 4TOYL 5ALCH 1QNZL 4M9OA 1KPVA 1JGLH 4AEFA 5F71A 4YFLF 3UJIH 1RZKC 3MJ6A 1NSNH 3VFSA 2WIMA 3B2VH 1ZSDA 2FO4A 1TXKA 1U93A 5KSUB 1N6QL 1EXUB 3G5VB 5FYLE 5CBEB 4FTVE 1G7MA 2OXHA 1AY1H 2JCCA 1UWEL 5D2NB 5H8DA 4PJCB 2P5WA 1V3LA 2E3VA 4G6JH 5K9JL 3FOMB 4GQ9H 4P2CG 1KBGL 3VXQB 4W6XB 3KPPB 2VNCA 1R5IB 1D5XA 4JPKL 4NN7B 4QTHA 3P77B 2OJEA 3MMEB 2Z31C 3C9NA 2PN5A 4JAMB 1IKNA 1V7ML 3JV6A 5K33A 4F8QA 1CT8A 4IIQA 1W8NA 1IC7H 1KACB 3HE7D 4WWKD 3GK8H 2CLVA 2DQDH 4R8WH 3Q1SH 2X4OB 2IAMD 5SX4H 3EOAB 1HNFA 4U1NA 5ALBH 4PYHA 2CLZB 4FQQA 4D8PA 2YWYA 3P11L 4NC2B 4DFHA 2IAND 2UZIH 2F8XC 2DQFB 2DL2A 4MJIB 3HZVB 1Y6MR 2GEEA 3NAAL 4NQXB 4DCQA 2BFVH 5B22A 3HUJB 4XCEA 3UJIL 3D25B 2BRQA 5DGRA 3B2VL 3BFOA 1FO0B 1YNTA 4XI5C 1HILB 2KL6A 3MYZA 3CX5K 4PJ5A 3ZYJA 1CU4H 4XPGH 3GSNA 3S34H 4UOW0 3BPLC 1L6ZA 4QRRE 3C5JB 4G6JL 2L7UA 3UZEA 2PW2B 4Q0XH 1U42A 2VN4A 2WLYA 3HR5B 4KXZI 2YPLB 3AAZA 4OLEA 5IM7B 4JHWH 1RZFL 2WWMD 3SE4A 3SO3B 4L4VE 5JR1H 1NMAL 4TNWK 5C07A 1LNUA 3SGJC 4J1UB 4JJHA 1MI5B 2B4CH 4HWZB 5CMAA 1IC7L 1Q0XH 1MCWM 5K59F 3H8NA 1BFVL 4MS8D 4R8WL 3VCLA 2RGSA 1AO7E 4WY7H 5A2IH 2UYLA 3KGRA 1A6AA 1FNEA 1TLKA 5ALBL 4EVNA 1MHEA 2XPGB 2E6QA 1ZK9A 4WDIA 2A83A 4WJ5A 1MWAL 5E9DB 3RRQA 1ZTXL 3OBAA 2ZCKL 3LKNA 2J6EH 2HH0H 1DUZA 3HNTH 4CW1A 1RIUH 2D7QA 3T04D 4MJ6B 1S78D 1S5HB 4ZS7H 4NQVB 4PTUA 4O58H 4YZFE 1S7RB 2H2SD 5I2IB 1DE4B 1A9BB 4TVPE 3WHE0 2CIIB 1B88A 3SJVB 5JHLH 3NA9L 4I48A 3GSUB 4FABH 1KN4L 5DHVH 5D1ZB 3MLZL 5BW7A 3HE6C 1R5VB 5TDNB 3MXWL 5TE7H 2I07B 4P23A 1H3UA 5B8CB 2OI9B 1OF2B 4JN2A 3QJHB 3N06B 4MJ2A 1TVBB 1NUNB 1SBSL 3QXWA 5C0EA 1P4IH 1E4WH 2G2RA 1F11B 2NQCA 4XPHH 5JR1L 4M5ZL 3ULVD 1ZHBA 1BQHA 4G6AC 2AK1L 2B4CL 3WS6A 2Q3ZA 3CNKA 2D4DA 4KQ3H 4JREC 1UKSA 4F2MB 5D7KD 5IQ9B 4LCWA 5CAYB 4P59H 5I8CB 4I9WD 3OPZH 1MEXH 4H25A 4WY7L 1KYOK 4NRZA 1NBZA 2ATPA 2XN9E 5EBLA 4ZQKB 2ZUTA 3VDCA 5KZCD 2R0ZH 3THML 5JA8B 1GZQA 4V1DE 2QADB 2BNRA 4AIZB 1N2RB 4QY8B 4PJHF 1NKRA 2X1QA 5DXWA 2HH0L 3WXVH 1U8NB 1I1AC 1XAUA 1HWGB 2DYPA 1RIUL 2FCBA 5SWSA 3RWGB 4E41E 3H9YA 3NCBB 3GIVA 2Q76A 1BREA 1MQKH 1VFMA 1VSCA 3U6RA 2C1PB 4L3EB 3ZDYE 1OM3H 2CXKA 4H8WH 4HKBA 1JUFB 1WUNT 5KSAC 1NFIA 3DOSA 4X7SH 2EDOA 4OAWA 2ZUYA 5CJ8A 4MXWH 3BP4B 4Z8FL 2R2HB 1N0XH 1WIPA 2NLJB 4YNYB 2BERA 1I8IA 4IOSD 3IXAA 3IETB 5EU6D 2EKSB 4OQTH 1YEFL 3KLDA 1TJIL 1P4IL 3MLTA 1K8DB 3TBSB 1E4WL 4YWGH 3IU4H 1UXWA 2EXWC 2NCMA 2Z31A 5KANG 1D5BB 1HSAB 4PJCE 2PYFB 3DX9B 4KQ3L 1WZMA 3BT2H 5D5MB 5E1AB 3RVUC 4ZOEA 2VLRA 5AYUL 3RIAF 1JHTA 1R5WA 4HSQA 4P59L 5I16B 2L7JA 3O8XB 1R0AH 3X3GL 3OPZL 4LK4A 3NZHL 4XPBH 4P5MB 1BFSA 4O2CA 2E8ZA 1MJUH 4NQSA 2R0ZL 4L4TA 3DYPA 4OGZA 1R3LB 5FYKE 1AXSB 3U4EA 3S36H 3QPQC 4PP2B 5CJQH 1W72B 3D39B 4LCCC 2MCPL 1F3RB 1NCBH 3F7VB 3V52H 3RWIB 43CAB 4X7FC 3GSVB 4DW2L 3GMNB 4Q9RL 3IDNA 3FB7A 1HEZA 3H9SA 4ZNEA 3CSPA 3EYOB 2WWKT 1YNKH 4HH9B 4X7SL 4Y4KD 4DUVA 3QULA 4MAYC 4MXWL 5DEGB 5DK0A 1S7QB 3KXFA 4M3KB 3WYRA 2ZKHL 1NGWA 1U91B 5F96L 1CG9B 3HUJE 4QXWA 2DLGA 5KTEL 1BLNB 1DDHA 4OQTL 5ESAB 4WEBL 4NKOA 2EYTA 1XGTB 3N1GC 4PJ8C 3IU4L 3QI9C 1IRAY 1JWMB 1PG7L 1WBXA 4AH2A 4HJJH 1CDBA 3SGJA 3PWLA 1UYWH 4OM1H 3BT2L 4K9EL 4PLJC 3VXRA 1XF3B 3MLRH 4KKAC 2HJLA 5IB2B 5J8OA 4LLYB 4PRNB 1HXYB 1EFXA 2X42A 5C2BL 3KG5A 4TUKH 3VGAC 3WD5L 3KPRB 4L29B 4JFQA 5D1QC 4NCDA 1UQSA 4LLWA 5T1MA 3DGGA 5F7DB 1MI5E 4JFYB 3B9KB 5CEXA 4BFIA 5J12B 3BGFC 2I9TA 4MXVE 5IJVB 3D85B 3BEWB 4NP4H 2Q86A 3ES6B 1AGCA 1ZGLP 1ZLSL 3V52L 2R1YA 1CTNA 1T83C 4JO3H 1MCOH 3CVHL 3P9MB 4FXGA 1WT5C 2N7BA 2NX5A 3CUPB 5E9DE 5CIPA 5EDXA 3T2OA 5IBUG 1BJ1H 2C3VA 3FOLA 4Z76B 5HHPB 3HE6A 3P4MB 1KPRB 5EBGA 3MO1B 5E94A 4N0RA 1U8OA 3FO9A 3NGBC 4A6YB 2IMMA 3DV6B 4UUJA 4BQBA 4MSWA 2ITCB 4Y8DC 4OLXH 1MLCB 4NT6A 1AQDB 3W9DB 1LWRA 4CU6A 2AXFA 2NY6B 5IKCB 5F97E 2V17H 2CLRA 4P2YA 2AP2A 4AEIH 1ZEAL 4D0DB 4UTBH 1NCCH 1M71A 5DVLA 1INQA 2HLFD 3MLRL 4OZ4A 1MAML 3VG0L 2GJJA 2VDLH 5IQ7H 4K3JH 1JNHA 3ISWA 3T3ME 4TUKL 5ICZA 3TV3H 3DX6B 1MCRA 1RJZB 2YOCA 1F6LL 3EYSL 4ZUUA 2A2QT 4X9FA 4NKDB 5TE4H 4APQC 3HTLX 1GSMA 2N1KA 4Y2DB 4Q7DA 5F93C 1G6RL 1I1AA 5AD0B 1BJMA 2RFXB 2OL3H 5FUOL 5DUBB 3AB0B 1KJVA 5T5NG 1XIWC 3BVNA 1MCOL 4JHZA 4F7MA 2AJ3B 3WFBH 1E6JH 3O3BB 5D7JC 5GGSY 4XVUD 2X41A 2GCYB 3GJFB 5KSAA 1KCRL 1ONQA 4MQSB 3QDGB 2I60H 3UPRA 1NAKH 4OD1H 1XCTA 1YY9C 3ESUF 3OHXA 3RDTD 4Z7VF 1DVFD 3PGDA 5BO1L 3I84A 3WNKA 5IT2L 2JJUA 1IGJB 3RWEB 4F37K 4PRIA 2FHBA 2OS7A 2V17L 1RZGA 4U1HB 4P3CL 1A21A 3QDJD 4PREB 3MNWB 3EJJX 4UTBL 3TBWB 2FWOB 1NCCL 2OP4H 2VABA 1ZLWH 3N1QC 1DN0A 5I1DA 5IQ7L 2EDKA 4OZFA 1RI8A 2XXMB 1LEKA 5DD5H 1A7OH 3HG1A 4MHHI 2AABH 4LRNL 4MDIB 5TE4L 2Z8RA 1BOGA 4GAFB 3OGOE 4IOFD 3FZUD 5HVGB 1F13A 3R0NA 4G7VH 2OL3L 3LH2L 5D5ME 3ROLB 5IHBA 4LCCA 3UTSE 3CFJB 1CGSH 1FPTH 5I8EA 4PGDA 4X5WB 4R96A 2W9EL 4Y1AD 1TQBB 5KAQG 1JGEB 4BSWB 3CFCL 4EI5D 4JGUA 2I5YL 3S36X 1QO3A 1WWBX 1KJ3H 3EOBB 2I60L 3O41B 1I9JL 2XYCA 4OD1L 4CU7A 5D7IA 2VZUA 4MAYA 3QNYB 2P5EA 1NANH 5ESQA 2HKHL 1RVFH 5F3BA 3S96A 5I8KH 5D9SB 2Z8VC 2J12B 3FO2A 5H35B 3NIDF 4P49A 3T77B 3V0WL 4XAKE 2H8PA 5DSCA 1MSPA 2X4PB 5EFIB 5GRJH 4PJ8A 3QUMA 1P7QD 3QI9A 3V0VB 1FNSH 3UC0H 5IV2A 3T8XB 1X5JA 3UJJL 3WS3A 1BQSA 5I1AA 5C0AB 3IFLL 1TZIB 5ACLA 2EICA 4HLJA 4EI6A 1MF2H 4I0PB 3REWA 1C5BL 2V2WB 3H42L 4X7DC 2HVKA 1A7OL 4Y5VB 1XF1A 4HWUA 1C1EH 4NN6B 5E8OB 3FKUS 4KROC 3U30C 3DXAB 5D1QA 3WFDH 4JRWA 5JW4R 3J8F7 2Y7QA 2YD3A 3RTQB 5EOTB 5DFVC 4G7VL 3K1KC 4NO2A 2OMNA 5F7UA 1UH2A 1CGSL 1FPTL 4O9HH 4NRXB 4L4JA 3O3AB 4Y89A 5FYLD 4FTVD 1MH5B 3MLYL 1TNNA 1E27A 4HXBH 1T83A 3SDXB 1CDIA 5DDHA 3FQXA 4XVSL 4Q2ZB 1F5WA 1NC2D 1WT5A 1YY8A 1CZ8H 2CQVA 3D9AL 2IADA 1IARB 2ZNWA 1DSFH 1KJ3L 4KHXH 2LABA 4LOUC 5F8QC 3TBVB 4RRPG 4H26A 5FUCC 5I66B 4GXUM 1RVFL 3TVMC 1Q9WA 4YDLB 5IWLC 1URLA 4HGWB 4CGTA 3TPUA 5I8KL 1UA6H 5C08A 4IEFB 4PS4H 1JPGA 3R8QA 4L9LB 4QXGH 2FJFB 4WW2F 4YHOH 5JDSA 3GMLA 5GRJL 5F7YC 2ATKB 1JGUL 4Z7OE 3FHQA 5CBAA 3EGSA 4P5KA 4X7EC 5HVHB 2YA0A 1J1OL 5CJ5A 4TTDD 4H1LH 3AUVA 5JDJA 3OKEA 3T1FB 4Y4HD 3G5YA 5D96C 1MF2L 5E95B 2HTKD 4MQXD 2MJWA 4N8VG 1GC1L 3PNWB 3ARGD 3RP1A 3OXRA 4OCYL 2V7HA 1GL4B 3LMJH 4NKMB 3WFDL 4APQA 4QF1A 5DFTA 1WAAA 1TTUA 4LASH 3TT1H 4OF7A 1MLBA 5D93C 3FFCA 3G6JB 4RWHA 4O9HL 4MDJB 3GBLA 2DM4A 1T20A 4OJFH 1XIWA 1I4FA 1HQRB 2YD2A 4RDQF 4QRRD 3G6DL 4DQOH 1CZ8L 5D7JA 1PSKL 1ADQH 2ENSA 1DSFL 1DQDH 5IB5A 1YMMB 3CPLA 4KU1A 1SBBA 4N0YL 4M62H 5C2UB 4BZ2L 4XNXL 1FRGL 4I5BA 3QEUB 3TNMA 1UA6L 4L4VD 1WIOA 1U3HC 1TTGA 4GKZA 3GZKA 2NW2A 1KCLA 3SKOA 2KKQA 3MJ7B 5ETUB 4PJ9C 2HFFB 4PGCA 4P5TC 5IMLB 2OCFD 3QDGE 1A47A 2Y1VA 1AO7D 3KJ4B 2JCCF 4NHUA 1KLFA 4TSCH 5I76A 5C0FA 4E5XA 1P4BL 3BISA 3TO4C 2IPKB 3BRGC 4P4RB 2OTWA 1MOEA 5AUMA 4K71C 4GG6A 5DJZA 5DQJB 4F58L 2AEPL 4YXLH 1MAJA 5DA4A 3T1WA 2MFNA 4NYLB 5C9JB 2C9AA 1KLUA 3BXNB 2H32A 1RFDL 5JIIA 4TVPD 5INDA 2NY4D 5JXAL 4HJGA 1T3FB 1UM5H 3QQ9D 1S8DA 1G6VK 1AJ7H 3ARDD 5DK2A 5IBLC 1CGVA 4PLKC 4PLNC 1N59A 4DQOL 4XRCA 2YS4A 1FCGA 5EO0A 1UEYA 2FJHB 2Z92A 3NABL 1ADQL 1E4JA 5FO8A 1M7IA 4ELKA 1HYSC 4G6FB 4OV6F 4DZBB 1DQDL 4EQ2A 2CK0H 3NCYP 4JQIH 3BOVA 4CVWA 1A1MB 1JPTL 1CGUA 1H0DA 3B9DA 1RZ7L 4DKAA 3T2QA 4JM2B 3CCHA 5TQ2L 3P9LB 3V0AC 1QBML 5FB8A 5TJWK 5IBTH 5IW1A 4JR9H 4S1DD 1I7TB 3RNKA 3ARVA 2R2BA 4J3TA 2XZCH 3JWOH 2CDEA 2XWBA 2XN9D 5LG1A 5KVDH 1UACL 4UT6L 4G42A 5F1NA 4FFYH 1JE6A 5ID1A 4QHNA 1PYWA 2AS5M 4P2RB 5CP7A 3D6GA 3F6IA 3F58H 1D5ZB 1GGBH 4E41D 1ZLVK 5K9OA 2W59A 4ZOBA 2ESVA 3TJHA 1LDPL 1QPXA 1UM5L 1DBMH 5C0AE 3A6OA 4JPWH 1A9EA 4HXAH 4YX2H 1U6AH 5EO9A 1B2WH 2EYSB 4M6AA 3KNBA 2X4NB 4N68A 4WRLA 4MXQC 1K8IB 1MCHA 1CD1B 3MCKA 4GSDL 3QAZC 4D3CL 1BAFL 3OR7A 5BVPH 1M4KA 5DHYA 3DXAE 1IM9A 4G59A 3W81A 2CK0L 4G9FA 1ERNA 3I50H 3O11B 1S7WA 2X09A 5IWLA 5GJSL 4JPIA 5IBTL 1LHZA 5DO2C 4KKCC 3LPGA 3B6SB 1IL1A 4TVPL 5I18H 2NY0B 3RWCA 3IDGA 5HHMB 3RZCC 2XZCL 1H3VA 25C8H 4G80B 1ZOXA 1MIML 2R1XB 2E8YA 1R3JB 4C4KO 1HQ4A 1LEGA 1RUAL 2FLRT 1I1FB 2CDFA 1H5BB 3GSRA 4F15C 2HMID 2E5EA 5DQ9B 3T2PA 2A6KA 1P4LB 4HPOH 1DFBL 3CC5A 2RR3A 1IGCH 1Y18A 2KPNA 3SDXF 1TIUA 5DWUH 3WFCH 3VXSA 4HXAL 4YX2L 2A6JA 1DUYB 1K2DB 3MZTA 4GBXC 2DQCL 2E7HA 1TVHB 5GRUH 2ZOKB 5IW6B 1A1OB 3P4NB 5I1EL 2CD0A 1LP9F 2ORBH 3HPJB 3TCLA 1Q38A 4IOIA 2DI9A 4ENEC 4GW4A 4YHZH 2KZWA 1D3CA 2GQHA 3I50L 1IQDB 3OKKB 4U1MB 1FDLH 2CRIA 1YYML 2ILLA 2YK1H 3H0TB 4XNUL 3C5SA 2DTML 4HGMA 2I24N 3MBEB 1U3HA 2AJSL 4EUPB 4OLVH 4PYGA 4X99B 3S7GA 1UB6A 2W38A 2EDRA 1PJ9A 2VDQH 5JORA 1CLOL 2OZ4H 4PJ9A 1MELA 2BVPA 4P5TA 1DL7L 1X44A 5E8PB 25C8L 4L8SC 1OPGH 4LPTA 4JFEB 4PD4J 3DIFB 2VR5A 4M5YL 4HUXA 4DZ8B 4KK5C 3TO4A 1ZVYA 1C12A 4OB5H 1FNFA 5EORH 3HS0A 1HXMA 1T66D 4U1LA 3G6JF 1AGDA 3D2UB 1H3TA 4HJ0C 4HPOL 4QHMB 1IGCL 4JANA 4DVBA 1OP3H 2GFBA 3S3JA 5IVXA 3BP7A 3WFEH 1JMXA 2QKIA 5DWUL 5FUZH 5GSRA 3WFCL 5ACZB 4HUVB 1KTLB 4EIGB 2YHGA 4JY6A 5E9DD 5HJ3A 3MUJA 4KHTL 4RFNC 3DURB 1YN7A 4CDHA 1Q9KB 1CD0A 3ETBF 3IDJA 4S1RL 1JNNH 1CLCA 2WUBH 2H9GB 2HT4C 4OKVB 1U8KA 4YHZL 3GMRA 3NN8B 3RVWC 3VD3A 2AQ3A 1YMHB 5BV7C 4IS6A 5FYKL 1YJDL 3B9VA 3TP4A 3CXHJ 2H1PH 1UH3A 5F9WC 4NO5B 3VMPA 4OLVL 1PEZA 5DYOA 3UTQB 3RHWF 4HIHB 2VDQL 5FHBH 4GAYA 1Z2KA 4YBQD 2OZ4L 4S0TD 5FM4A 1F3DJ 4HUUA 1ES0A 4GRMB 2YPKB 1KFAH 5FKPA 3HC3H 1W0WB 4S0UC 3WLBB 1HHHB 2WP3O 1XGQA 2DQGH 5SWQB 2XG4A 5EORL 5IMKA 3WIFA 3O45B 1UZ6F 2BCKA 3QQ4A 4K8RC 1TJHL 3BN9D 3N1MC 4P2OC 3DRQB 2XWTB 2VXUL 3PWJA 3C8KA 3WFEL 1FO0L 5EU4A 5FUZL 2F8VA 4WI7A 3L7FB 4YDJB 1FNHA 1FN4B 2QADD 3NFNA 3HAEB 3HI1A 3JV0A 4EEEA 1UM4H 4P2RE 3UYRH 5IEKA 4LLUA 1A6TA 1M7DB 4MXQA 2PYEA 1KF9B 5GGQH 3JTTB 2BVTA 4JM2F 1ZMYA 4ONOA 1NMCB 4O4YH 2ZUWA 1P2CA 2YKLH 1BBJA 2C3GA 3FAWA 1XCQA 4PBVC 4QXTB 4H88L 5ITBL 1T22A 1I9RL 4XNQA 3GGWA 5CINH 3NPSB 5FHBL 1U8MB 1RK1B 5DMGC 4MX7B 1PY4A 1SEQH 3RZCA 3DROB 3HC3L 1FLRL 3BKYH 1EEYB 4K3HA 2CH8A 3TFKC 5TH2A 1F3DH 2HJFB 4JFDA 1J05B 5I1CL 5KW9H 2DQGL 1U3YA 3MRMB 5MI0B 4F7EA 3T0VA 4D9QE 3MV9B 3O6LL 1OOAA 3E2HC 3UTSD 5TDPA 2YEZA 2NXYC 1WWAX 4X8JA 5HHME 4XWOC 3T0EC 2HT3D 2YUXA 1KPUA 4UIKH 4WV1C 3OZ9H 1NUGA 4UBDD 1UB5A 4GBXA 5C7XL 5FKAB 1YZZA 4OFYA 1K5NB 4IRSC 1MNUL 1QA9A 4LSRL 4PJEA 1UEMA 5I71B 4HF5L 4YEFA 1CL7H 1G7QB 1MQ8A 3E3QE 2VXVL 5GS0H 2YKLL 3GRWA 4XAKD 4Z0XB 4LLVA 4QKXB 5B4MC 3KLAA 5A1AA 1GPOH 4KJWC 3QCVH 2ITDB 2OXGA 2RJMA 5CINL 2COQA 4Z7UF 2FEDC 2WK2A 4XMPL 1QACA 3LN4A 4CMMB 1RHFA 2P4AB 3MV8A 3DV4A 4S1SH 1NFKA 2XACC 1AFVL 3OKNA 4L8SA 5CWSA 4OV5B 3O4LA 3MV11 3OKMA 2CO7B 4UOW1 5KW9L 1VDGA 4NNPH 1XMWA 5GSVA 4R6UA 1IAII 3CMOH 2WMPA 4WUKH 4PIRF 5ERWA 5F89A 2HRPH 4G8FA 4QHKI 4F57H 1ND0A 2EO9A 1G9EA 3C60C 2XQYK 3QCTL 3WL9B 4JY4B 2VL4A 4JRYA 1PD6A 3OZ9L 4FQHB 1EA9C 2KZ1B 4DGIH 5MEOB 3DSFH 4JZNB 3L3GA 4HUWB 2IFFH 4OCSH 3IGAA 3B9KD 5DJAB 3BDYH 4XCFL 1NLDL 3D85D 5GRXG 4UDUA 3BAEH 4XCNB 4NO0A 5E8DH 3BZEA 1N4XH 5GS0L 3K8MA 5J9PB 5ITFA 3MA9L 2UVFA 4Y5YC 2X7LA 1UADC 5L8LB 3WIIL 4X4YA 1Z0NA 1OTTC 3C6LB 2RQ8A 3OKDB 3RGVC 5E2TH 4GO6B 2J8UA 5DJYB 1ZHKA 1UXSB 3BUYB 3IU3B 4AEHL 5EIIB 2XT1B 4O02L 4S1SL 1DR9A 1GGIH 3T08A 4K7PY 4I3SL 5C0BA 5HYJB 4LCYA 2J88L 1C16B 1QLRB 3H3PH 4JLRA 4RA0C 2NMSA 1WBYA 2YPVH 4NNPL 4WTWA 4N8VA 3VXNB 3G08A 1W72L 2PW1B 2MHAA 3G5XA 1NBQA 1JHKH 1K3IA 4FMKA 3PWNB 2HRPL 3GSXB 1QTYT 1DBBH 3BE1H 5T1LB 4DTGL 2R69L 4P2OA 5I75B 1I1YB 3O3UN 4ZUSB 4P57B 4GQPH 3CFKB 5E2VL 5GZOD 1FZJB 4HWBL 3MREA 4KDTC 4M02A 4ALAH 4DGIL 3TBYB 5IR1B 3QUYB 1B0RB 3IDIA 1MJ8H 1SJEB 1YC7A 3DRTA 2IFFL 4OCSL 4Y2DD 1RUKL 5DJXB 5A2FA 3MACL 4S1QL 1KN2H 1OAYH 4JDVA 4YGVB 3BGMB 3DX7B 4LHUG 4FRWA 3EO0A 4U6YA 1IILE 3RKDD 3K4AA 5E8DL 4L8CB 2QQLL 5IMMA 1WWWX 4MNGB 1WF5A 5C6WH 1C08B 2EDEA 3QQNA 1BVLA 4U3CA 1I1RA 4YIQA 5TE6H 3VFOB 1FZOB 3BW9A 4ODTH 2R1WB 3P2TA 4N0UA 1CFVH 3QDGD 4Z7WA 5E2TL 3AS2A 3GMMA 1J18A 1YQVH 2ED8A 3DUSB 4ONFH 1ZANH 5LWYH 2HVJA 4JKLA 4L5FH 3C09B 3K2MC 1FZKA 4PPTA 1GGIL 1ZVSA 1OQOA 2C1OB 2FL5B 2XOTA 1S3KH 1FNLA 1JTPA 1K6QH 5EIQA 4LARH 3T0AA 4GUPA 3TFKA 5DD3L 4C55A 4JRXA 4X7CC 4PJFA 4NNYB 4MQ7B 5DJ0A 3C6SA 1AD0B 3V95A 2DBLL 1JF5A 3QO0B 4HD9A 1JHKL 2H2PC 3IDUA 2VDKL 1ZHLA 2GITA 4NQEA 4BUGA 4PGEA 2O5YH 3E2HA 2B2XH 4Y4FB 1DBBL 3BE1L 4G8IA 4ORGB 4R97C 5H94B 4Y19E 1IGYA 3T0EA 4WV1A 1K4DA 1BFTA 4HKZB 4ALAL 5A16A 1HHIA 1MJ8L 1LK3H 1FJ1A 4Y8AA 1JRHI 4LHQB 1K4CA 4G6KH 1MJ7H 4IRSA 1FBIL 3CX2A 2ICWI 4ZTOH 1KN2L 3ROOB 2IMNA 3MV9E 5EU7E 3HE7C 4WWKC 1DQQB 2XA3A 4LCUB 4A6YL 4KJYB 5HXMA 4KI5E 3OB0K 1NAMA 4HZLA 4E9LA 2EDXA 3PJSB 2PTTA 4CMHC 1EV2E 4JDZA 4EN3D 3K81A 5CEZE 1YDPA 2ID5A 4P99A 1OGTB 1YQVL 2VB5A 1KXTB 3QG7H 4QRQA 1NEUA 5IVZA 4ONFL 1ZANL 1CCZA 1PQZB 4L5FL 3RGHA 3L5XH 5HI3D 1Y6NR 2B7DT 4XP4H 5C0CA 3RWFB 1P84J 1F3JB 3GSNH 3U2SB 1FE8H 2X89A 3OAZH 4QTIH 3NCEB 1C5DB 3UTZA 1WZ1H 2VIRB 4BH8B 1Y0LB 4X6BB 3RX7A 5EZJA 4WUUA 1T7YA 3V6FA 5KG9A 1I7ZB 5C0AD 5CEYB 2VLME 5DVKA 4WFEE 4DAGH 1IE5A 1JF1A 2B2XL 1V3KA 4JO4H 5FO7A 4K3EH 5IFHH 1ITCA 4WI6A 4U0RB 5GGTA 4MA7H 2Q87A 5DEFA 3SOBH 1FFOA 1XF5A 2ZSVA 4U1GC 1WC7A 2FEEI 2AKRA 4WIQA 2YWZA 2AV1B 2FZ3A 3DXAD 2JK5A 2O5XL 1VADA 5BJTB 1MJ7L 1JFQH 3RTQD 3OKLB 1AKJB 2B0SL 3P4OB 4Y5XC 1KEGH 3BYTA 2FH6A 3PHOB 3R06A 1JPST 3QG6B 4KK6D 2VE6B 4X7TB 2VDOH 3VXMA 4HKXA 4U05A 3FB5A 2VQ1B 3RVTD 5BS0A 4LVNB 4Y2OA 5KVEH 4HIEA 5L6YH 4Y5YA 4YBLC 2DQHL 3FT4B 2UWEA 1U8PA 3RA7L 2X4QB 4ZNCD 4ETQA 1FH5L 4R2GC 1KC5H 3RGVA 2LAAA 1DEDA 1AGBA 3QG7L 5DJ6B 4WFGE 3QH3A 2VQUA 1MY7A 4XP4L 3FB6A 1U8HA 3UMTA 3NVQA 5KS9A 3A67H 3DBXB 2GIYA 1I7UB 1KJ2B 1RURH 1FVDA 1UCTA 1MHHA 1I3RB 4HMCA 1RJLB 5EA0L 1NJ9B 4Z7QE 5CGMA 3P9WB 4DAGL 4ZFOB 1JPSH 2EDYA 4KMTH 4JO4L 3NPZB 4K3EL 1EUTA 3QRGL 5HYJE 1HYRC 5DRZB 4OFIA 3VFRB 1VKXB 1U92A 3M1BA 2XZAH 1FL3B 2GAZA 4KDTA 5HI5C 3RI5K 5KVMC 4NSKB 5EZIL 1X5KA 1Z5LB 3V2AR 4LDOB 1KEGL 4JJ5B 4HMDA 1T0MB 1QSFB 3BIKA 4Y16B 1CQKA 1SHMA 2YRPA 2DQUH 5F88A 3TA3C 1ZWIA 4GAGL 4RX4D 4PY8J 4MJ5B 3ZE0E 5I9QC 1ZXQA 2YN3A 3H7BA 4UINH 5L6YL 5ICXA 2AJUH 3HZKB 1KB9J 4LDLB 3KPSE 3STZB 4XCCH 2EECA 1ZT7A 3IJSA 1RZKH 5I1GL 1NGYA 2X70B 5JIHA 5B3JE 1D5IL 4LVOB 2DB8A 4K9EC 1ZS8A 4H1LG 2NTFB 2EIZB 4MNGE 4KKLD 1L0YA 4X4XB 2WNGA 1BGXL 1D5XB 2Q8AH 1D7FA 5KSBE 3RZWA 1MRDH 1MWAA 4MB3A 2OJEB 3C9NB 2UY6A 1F6AB 3QZWB 3TNNB 4R4FL 1T0PB 5J1SC 4ONHB 4KMTL 2EEAA 3PF2A 1L8JA 3QYCA 2YR3A 3JTSB 5HGAB 5MEQA 2IGFH 1FORL 5FFLA 3MLPA 2XZAL 3QIUD 4KKBD 3B3IA 7CGTA 4Z95H 4U1NB 2XFXA 1VPOH 5LAXA 3GNMH 4FQQB 2OYPA 2DM7A 1IKFH 4U7MA 1FG2A 4PUBL 3VRJA 5E6ID 1IGMH 3HE7A 4WWKA 2OK0H 1MAKA 1HINL 2DQUL 4KZEH 3WMSA 4U1KB 4XCEB 2R0WH 3QEQB 4MWFA 1WTGT 5FDWB 5IOPA 3IRPX 3F7RA 2F74A 1I3GH 3OAUL 4UINL 3JV4B 4G6FD 4HG4J 4L3AA 5EWIL 3IS0X 1SMAA 4XCCL 4WFHE 1YYLH 1OSZA 3WLWD 2FX7H 4CJ0A 3I6KA 4FS0A 3MXVH 1FAIL 3CLEH 4Z5RA 3C2AH 4KVNH 3N50A 5D70H 5A2KH 2DWEA 3O4OB 1I9IH 3E6FA 2D7NA 1F6FB 5CLTA 1MRDL 5T1KB 3AAZB 1FYTB 4UB0L 3WFHA 5I1LB 3ZMRA 1RIHH 1R3HA 1OTSD 3NCCB 4KK8D 3PDOB 1E6OH 4IMKC 2X4UB 5JW5A 5L2KA 4KRNA 3VW3H 4P2RD 1J8KA 4XZUA 3GKWH 5CZVH 1WCBB 1FNEB 2VLKA 4EVNB 1MHEB 3LSOA 4PJBF 2A83B 2R9HD 3GNML 2VITA 3H2WA 5DHVA 1IKFL 4PBWD 3JV5A 1ZV5A 4F7PA 1IGML 1DUZB 4WWID 4TNVF 1BOYA 4Y5XA 3CVIL 1AC0A 3CSYA 1JIBA 2DWDA 4PTUB 4KZEL 5IF0B 1EEQA 1M1SA 3RPIB 1OD7A 4ZUWA 1I3GL 2LQRA 2R23B 3UAJD 1T21A 3M45A 1RJYB 5E2WH 3U0PB 3SKMA 4LBEB 1EEZB 3KAAA 1YYLL 3BSZL 4GW1A 4QCIA 1S9XA 1II4E 3ULUE 5HHQA 4P23B 5SX4I 2AXGA 5CIPH 1YEIL 5F8RC 1A7PL 2CRMA 4X80H 4P4KC 1QBAA 4PY7A 3GBNL 3OAYH 4D9QD 4Z7NE 5C0EB 1U8IA 3ZKNC 3GSOB 2I26N 3DHMA 5HHMD 2IJ0C 1RIHL 5HGHA 1NGXA 1OHQA 3B4NA 4YHNA 2BSRB 1P9MC 5IK3B 1E6OL 4QRUA 3VRLE 5HYSA 1S7SA 3L5HA 4W81A 2AV7A 1KENH 4FFZH 4NRZB 3FQRA 4PG9B 2ATPB 2P45B 3L6FB 1SEBA 3MLUH 3ZT6A 1T1XA 5IHZA 3KPMA 4JE4B 5T3ZH 3BPCA 1V5JA 3KPQA 1EJ6A 2FIKA 4RMQA 1GXEA 1YPZA 2A6IA 2ED9A 4LNVA 4QHLA 2HLFC 5SWSB 1F4WH 1J0YA 4AL8L 1KSRA 2ADIB 3QHFL 3L7EB 3TA3A 1JWSA 2Q76B 3TZVD 1J7VR 5DS8B 5CSGA 2O5ZH 3D69B 2D7PA 4OQTA 5JO5A 2LU3A 3D3VB 4I3RH 1I1CA 4RGNC 5T3XH 3AREB 3OF6A 3VXUA 3X14B 2NY2B 4OUUB 2OJZH 1NFIB 4KWUA 3INUH 1Z9OA 1DEEA 4HFUH 4ODVL 1X7QA 4WHYH 1QSFE 2EDNA 3HB3C 3MRLA 5GQBA 4OLYH 2O93L 3BHBA 5FO9A 2QSCH 5HI4D 2W0KA 3I3EA 4PP1D 3VD7A 4LVHC 5CHNA 1WICA 3MLTB 2DLEA 4BA8A 4UAOC 4P2QA 4BJLA 3WXWL 1FG9C 1CDHA 2V9TA 4NFDA 2PTUA 3EUUA 5IB3B 3QWOB 3MRPA 1S9YA 1DVFC 2VLRB 1CS6A 3ZKXC 1VFBB 3KHOA 2VR4A 1BPVA 12E8L 1KENL 4O2CB 2APFA 2ADFH 1KIQB 3C87A 4NQSB 3CVHA 3QWRD 4TUJA 3IS1X 2V9QA 1KIPA 3MLUL 5FK9A 4MMXC 1NDMA 3BZFA 4ELMA 3U4EB 5E00A 4UOJA 3G5ZB 2ICES 4ZS6D 2CSPA 1CTOA 3FRUB 2HT2D 2FO1A 2DN7A 2VLLB 3MRKA 4OF8A 1MCEA 4XGZA 2ZCLH 4DN4H 1QFWL 4L8DA 2AK4A 1IMHC 2P8MA 1A6ZB 1OAZL 5DJ8B 3DMMC 1T1YB 5EC1A 4A2MA 1IAOB 4IOFC 4PJGA 4DGYL 3MJGX 4XP1H 4YHKL 3INUL 4ERSH 3LZFL 4X6CB 2DBJA 4HFUL 2E7LE 3BPLB 5E6ZA 3WN5B 1IEHA 3TYFB 2QSCL 3D0LB 4YXHH 4HLZG 3QEQE 5HPMA 5F6IC 5CGYC 2AEIT 1DDHB 1GC1C 2BOBA 2BNUB 1J0JA 1WJ3A 3S4SB 4NKOB 2EYTB 3QDMA 3GEWB 4Z18A 4PJ5E 3Q6GL 2HLAA 5GGSB 1G6RA 1WBXB 2NNAA 3S37X 4KFZC 3PWVB 3SPVA 5D72L 4AH2B 1RUQL 2X05A 4GW5B 1BJ8A 2CXGA 2OR9L 1EPFA 1QSZA 1ZLWK 3QUMH 2AW2A 4IMKA 4MCYB 4XP9H 4CNIB 2AXJA 1FIEA 1CF8H 2QR0B 3PQYB 1PVHA 4KUCD 2FLBT 1XH3A 3C5ZD 3QFDB 4RIRA 2H26A 4LSQH 3Q5TA 3VFPA 1JGDA 3RFZC 1FYTE 1JNLL 1KIRA 4JFQB 4K07A 2V7NA 3JSSA 5C07E 4LLWB 1MFEH 3O81A 5M7QA 2BNQA 3AXLA 1OW0C 5CEXB 5IFJA 5EH1A 5CJOH 1AGCB 3RL2A 2ZCLL 2ZSWB 4OF6A 4PJXB 4GFTB 2LVEA 3ZE1E 1QFOA 1YUHA 3C08H 3OJDA 4FXGB 4JN1H 1MRCL 2NX5B 1SMOA 4LAQH 2NXZB 4WU7B 2YUVA 2CIKA 2ZCHL 5F1IA 4XP1L 3TC9A 4BM7A 1IAKA 2C3VB 3JUZA 3FOLB 5FGCE 1ED3A 1MREL 2HRLA 3WFZA 5E94B 1JZ7A 1QR4A 3QUZD 2A77H 5TPWH 3W11D 3FO9B 4XVJL 1L6XA 4XPFL 3BD3A 3LV3B 4P4KA 2MNUA 3KWWA 3MRBA 2GSGA 5C8JA 5HDBF 4NT6B 3OR6A 4LFHD 1A8JH 2FECL 1AXTH 1A1NB 1H8SA 2AXFB 4U4BA 3ZO0A 3O3DA 1OAXL 4PRAA 3QUXD 4UT7H 2JE8A 2MCG1 1TQCC 1XGRA 2CLRB 3R4DA 4Y19D 5SV4A 3DI2B 1YECL 2VAAB 1NFDA 2OL3A 4BZ1L 2WANA 4OZ4B 1CF8L 2AQ1A 3GBMH 4BH7A 2GK2A 4FZ8L 4XH2A 3MV9D 2Y5TB 2X9YA 1G7PA 5A3ID 4WTZG 4KI5D 1XF2A 1A6UH 1MFEL 3MJ8A 5DMKA 1QD0A 1I1AB 2JELH 5KOMC 3DVGA 3EDDA 5C1MB 3U9UA 2E27H 5CEZD 2HTKC 2P7TA 2DJUA 1KJVB 4PTTA 4MQXC 3GO1L 1L9NA 5GS2D 4J3OC 1OTUC 1U36A 3LPFA 5SV3A 4BKLB 3RBGA 1G0DA 1Q9OB 1WCQA 3V5DA 1F4HA 3P73B 1ONQB 3BGAA 2DD8H 3ZDZE 3UPRB 5SWSE 2DLHA 3ILPB 4X9HA 4WU5B 4U6XB 2JLLA 2A77L 3HMXL 4PJIB 4GRWF 2IALB 5BXFA 2VLMD 4WFED 2Y25A 1NCAH 2AERT 4JVWA 1I85C 1SVZA 1OAKH 2A0LC 1QEWA 1CFSB 1SYSB 4CN1A 3MV7B 3CFDA 1RQ5A 3WNNA 2IAMB 4MD5A 5I1DB 1DVFA 3HI5H 2VISA 4OZFB 3ECBA 3GBML 1TPXB 1ZT1A 4G8GA 4AYFA 3X3FL 2Y6SC 1LEKB 2IANB 2BOCA 3LS5H 3HFMH 3HG1B 1GZPB 3ZTNL 1NCNA 4ZO6A 3TIDB 1A6UL 5DJDB 4M48H 1IEBA 4PJFF 3LKSA 2A9NL 2RB8A 1AR1D 1IJ9A 2VZOA 4KDWA 1SYVB 4NBXB 2YA1A 5GIRA 4PJ7F 2VLRE 2H32H 3O9WB 1WBZB 3WKML 2NY1C 3VGEA 4GRLC 4UT9H 2IQAA 3SDCC 4MB5A 3GIZL 3QHZL 3AROA 3MRIB 4L4TE 4WFGD 3L3IB 1NEZB 3DMMA 1OAUL 5F7EL 5FHAL 4NNXA 4F9PC 4OZIA 1V8HA 2DD8L 1N8ZA 1UKTA 2HFGH 5D7IB 4MAYB 1NLBL 3ARDC 2J5LB 1OL0A 3ARBB 3C6LD 4F3FB 3FB8A 3MCLH 3NFSH 3S96B 3FO2B 4C59B 4IHOA 3LKOA 4DK6A 3H9SE 4X5XB 2H8PB 4ZNEE 4UIMB 4ZTPH 1OAKL 1HH9B 5HYJD 3EAKA 1Q8MA 3FL7A 2GSIA 4MNHB 5IFAL 3PV6B 4ZFZB 1B4RA 1R3KA 3OX8B 3FAXA 1VGEH 1XR8A 2Z35A 4HK3N 2WUCH 3HI5L 5J3HD 3REWB 5EPMB 4GXVL 4LNRA 3LS5L 3MBXH 1D9KC 3HFML 1JWUB 1JHLH 3S98A 4V3EB 1L7IH 1EMTH 4M6OL 4LRIC 4I18C 4ZO7A 1S7UA 1QKZH 5D1QB 1XGUB 2Y7QB 1HOCA 3F5WA 1BZQK 2AJZB 4HIXL 1NMBH 3UO1L 2VAJA 1OW0A 5KSVA 4WHTA 2R4RH 3BGFB 2VTFA 4QRSA 3QUYD 3DGCR 3QNZA 4NO2B 4AIXA 4KJPC 4BSVB 1A4JA 3KPSD 4LSPH 3U83A 4YR6B 4LSSL 5K9KA 5EOQL 4PRPB 4X6CF 5DF0A 5HHVL 2UVEA 3FQXB 4EXKA 1NGZB 3MA7A 1YY8B 2X4RB 4F80A 4WO4C 5JZ7D 2IADB 3OJMB 4NUGH 1CE1H 4H1LA 3BKJL 5INCB 4XX1E 1Q9WB 4FTVA 3PXHA 5CGTA 4PJXE 3TPUB 2VZ3A 1D6EA 1QR1A 2A73A 3PV7A 3WEXB 1JPGB 4M61A 5D7LA 2GK0A 2NX5E 2J8HA 5IIEA 3QBTB 4ZTPL 1CDGA 3QFJB 1DBJH 5BOPA 1GGTA 1BP3B 4Q9QH 4K2UL 2BRRL 3OKOB 4RQQB 2JB5H 4J3XA 5C0NC 3OKEB 5KZCB 3PGCA 3S3SA 5D2NC 2HFTA 1PY9A 1L7TL 1OQXA 3RNQA 3MBXL 4N0CD 3V5HB 1L7IL 1NANI 4RDQG 2IBGA 2P8LA 2Z8SA 4Y4FD 3OXRB 1ADQA 1PX4A 2CJUL 2P42B 2M1KA 2IG2H 3RPKA 1SJHA 4NN7C 1NMBL 1I7RA 1F8TL 5J57B 3SQOH 3QXVA 3QXDB 2R4RL 3TF7C 1MLBB 1FC1A 3FFCB 1YJDC 4P9HL 5FV2A 3QUKB 4RFOL 4YHPB 3ZE2E 1T20B 2AI0H 1VHPA 1XIWB 4WFHD 1W2KT 1JPFA 4QYOA 4UQ3B 5HDOA 1EUUA 1GAFH 5D7JB 4NUGL 3MFFB 1CE1L 1I8KA 2BP3A 3UYPA 3GFUA 5IB5B 1AGEB 1ORQA 4ZDHA 5ANMA 2D0HA 5EU6B 2OTUA 3MRHB 4QRTA 5T3XE 3NFPA 3TNMB 3GMOB 1S7VB 3IVKB 4KKNA 2PR4L 4X9IA 5F9DC 2NY3C 1MFCL 1IFHH 3IFNH 1I85A 3SKOB 1DLHB 3WDIA 4PGCB 2R8SH 1DBJL 2V5RA 4Z78A 4NZUH 4RAVB 2F5BL 4YXKL 4FQ2H 5C0FB 4E5XB 4PJIE 3U36A 1EEUA 1UG9A 2WW8A 1EDQA 4RNRB 1MUJA 2WQ8A 2VXQH 3U46B 4GG6B 2R4SL 5E70A 1T5XA 4LPUA 4KDVA 4NKIH 4PRIE 3VA2C 2W1NA 2IG2L 1Z0MA 2DMBA 3VFNB 2EXYD 2FRGP 1TZGL 3MV7E 4XHJD 43C9A 3HCVA 4LU5L 3SQOL 5FEBA 3SO3C 3TT3H 1F4XH 2GI7A 4Y4KB 4GRLA 1AKJD 3SDCA 1ITBB 1BZ9A 1IGFL 5E5MB 3HG1E 5DR5H 3ULUD 5TGBA 4XRCB 1GAFL 5EO0B 2ZUSA 2Z92B 4X98B 4F9PA 2IPUK 2WBJC 4OLUL 4DN3L 2XKUA 2F54B 3MR9A 4B7LA 3W0WA 3ARDA 2WAHA 3UBXG 4HEPG 4NC1C 1U58B 3CFEA 1A7RL 5FIEA 1QFUL 3DTXA 3U4BH 1F45A 1ZA6A 1U95B 5IW1B 4GKNA 4N9GA 5HBBA 3RAJH 2W9LA 4PJHA 4LIQE 3RNKB 2R8SL 2QQKL 4YHMH 1AI1H 1SJVA 4NZUL 2CDEB 3GSQB 5D7IE 5IB1A 2XWBB 2P5EE 3V4VH 1KULA 4G42B 3LKPA 5D1ZC 3L1OH 1PYWB 4HS6B 1TITA 2DKSA 1N7MH 3GDBA 5CP7B 5B8CC 2OI9C 4YBQC 1D9KA 3QJFA 3HC4H 4NKIL 1OP5H 4LRIA 3U30B 4I18A 5EUKA 3DVNA 2ESVB 3V4PH 3F8UB 1ZGLB 3TGXA 1CLZH 1OP3K 1RU9H 5FCUL 5ADOH 4V1DA 3TT3L 2XTJC 1A9EB 5D7SL 5E5UB 3HC0B 1RZIB 4GAJH 4YE4L 2GHWB 4WI3A 4JHAH 3BN9C 1FGNL 4M6ML 1QSFD 3OR7B 4WO4A 1TTFA 1EAJA 4RFEA 1QOKA 2J2ZA 3GM0A 5IW3A 5EU5B 3VRIB 4QT5A 3TVMB 4H0IA 2A74A 3B5HA 4PRPE 5HHXH 4OD2A 2P5WD 1CQYA 3OGCA 3BRFA 2D7OA 3QEHA 1IL1B 3T0DA 5DVOA 3RWCB 3IDGB 1JZ2A 2G5RA 3U7AA 4YDIH 5KSUA 2H45A 1EXUA 3PHSA 2W65B 1MHPH 3L1OL 5B38G 3TPUE 1HQ4B 1LEGB 3GMQB 5D2NA 4M8VA 2CDFB 1N7ML 4RGOL 3GSRB 3HLAA 2A6KB 1XFPA 3VXQA 1HZHH 3IJHA 3KPPA 4ZFFA 1A4KB 3QFJE 1Y18B 2VH5H 5GS0C 1RU9L 1PG7W 2C4XA 3TF7A 2A6JB 2OLDA 3GM8A 4F37F 4JAMA 4EXPX 5JHDB 4GAJL 4JO2H 5I74B 3STBA 3NCJH 3TH3T 5CSBA 3LEXA 3VU2A 1KB5B 5FYJH 2W0FB 2ZUVA 3O8XC 2ZNXA 2OZ4A 2HAZA 3TCLB 3ULVF 2W60B 2HT3C 4IOIB 1WAAE 2X4OA 3QEQD 3VJ6B 2VERN 1O0VA 3EOAA 3L3DB 1CFQA 1KJ2L 2CLZA 2X6MA 3FFCE 5C0IA 4HT1L 4PJ5D 1UZ8B 4NUJA 1X5LA 2DQFA 1RZJH 2YC1A 3LVEA 3MOBL 3MUZ1 3QT2A 4MJIA 5L88H 4OZHB 1BWWA 1UB6B 3HZVA 3HN3A 4NQXA 3DVFA 5HYQB 4ZPVB 5JORB 3D25A 4PJ9B 3RWDA 1MJJA 4YHYB 3WO4C 4P5TB 1X4YA 3VD4A 3EYFB 1FO0A 4YDIL 1A6PA 1HILA 1B0GB 3BQUC 5FXCH 3RU8H 3ZKSD 1MHPL 5I15H 5T1KD 2Z93B 1FYTD 4HUXB 2AAVA 1C12B 1U8LB 5C07D 1WIUA 2QSQA 4K71B 1HXMB 5M95B 2F9BT 1H3PL 2J4WH 1AGDB 3BD4A 5ESVB 3IKCB 3QCUL 4XXDA 4FQJH 5LGJB 2VH5L 4RWYH 2YPLA 4NRYA 2QKIB 4NHUE 4Y1AB 1W0YT 2NW3A 4NZTH 1HIMH 3NZ8B 5J1AA 4JY6B 4M43L 4RBPH 4J1UA 1MI5A 4K3DH 3P0YH 4X6DB 4GG6E 5C0GB 4LPCA 2BSSA 2IPTL 1LVEA 2DOCA 5FYJL 3CXDH 4ZODA 1KELH 1MCIA 2WBJA 3N1PC 4JKMA 3GMRB 4C83B 4ZYKA 2XPGA 3BI9X 2QQNL 2XXCB 3FTGB 4JKWA 4IS6B 4OF0A 5I1HL 5ILTH 1P7QB 5DQDL 5DJCA 1RZJL 1VESA 2DLFH 3L5WB 4M1DH 4P23D 3VGBA 2CMRL 5BV7H 1S7RA 3CX5J 1DANU 5I2IA 1DE4A 4PFEA 1MFBL 3K2UH 4KZDH 2CIIA 3SJVA 3EJYC 3GSUA 1CXFA 5JLZB 2F54E 2Q7YB 6FABH 2Y07L 3I6GB 5D1ZA 2EEBA 4CL7A 5EO1B 4F7CB 4IDJH 2I07A 4D0BA 4WTZA 4OIIL 5B8CA 2OI9A 1OF2A 2FGWH 1CFTA 2BCKB 1S7XB 3PWUB 1E4XI 5IB4B 4QNPE 1EH9A 3QJHA 1TVBA 1NCDH 1PZ5A 3C8KB 2NY6C 3BO8B 3E6HB 3KJ6H 4XC1L 1CVSC 1NC2B 3FRPG 2BNRD 4I1NB 4K8RH 2NZ9D 4FQLH 3NFNB 4YHLL 3P0YL 2EYRB 3CSBA 4XBPB 5BRZB 4Z0BH 5SWSD 5IEKB 4F2MA 2PYEB 3QAZB 4FQ1H 4LCIL 4O2FA 4B7IA 5I8CA 1T6WA 2ESVE 4ZQKA 3VFUA 4LPYA 1P2CB 1BBJB 4AIZA 1MCPL 4QY8A 2XWJA 5C0DB 1XCQB 4GRWH 1YC8A 1EHLL 5DVMA 1RIVL 1IGTA 1VGKA 2K7QA 1CVRA 4MLIA 3RWGA 1EO8H 3AB0C 4M1DL 4DFIA 1A7NH 4POYA 1CE6B 3I02B 4AQ1B 5FAAA 4KZDL 2C1PA 4L3EA 2AJXH 5IEHB 4OM0H 2G5BB 3EO1B 5GISL 4NM4H 5F9JB 4FP8H 1TJGH 5I8OL 2ARJA 2GT9B 1JUFA 3B2UC 5TH2B 3SDAC 4ZMAT 2Z31D 4IDJL 3U7YH 3EYVA 4XPTH 1DCLA 3LIZH 5HDQH 3VXPB 1A3RH 2NLJA 2CGRH 1BX2B 1Z9LA 2VXSL 5TDPB 2VLRD 4OZGF 3ZHDA 3B8YA 1J1PH 3IETA 2EKSA 2DM3A 1K8DA 3TBSA 3STLB 1KPUB 1OWWA 3M8OL 4L4TD 3L3OA 3UX9B 2M2DA 1UB5B 4JZJC 4K8RL 2VUYA 5FM5O 1HK6A 2PYFA 1GJIA 4XC3L 2ED7A 1KYOJ 5D5MA 4OFKA 5CZKA 3VI3E 4CVXA 5I16A 3O8XA 2X5PA 1X5YA 4OGYL 4WHYG 5DFWH 2IQ9H 3VXSE 1TMCB 3H9SD 4K55A 5TFSH 1EBAA 1R3LA 4XI5D 4LLVB 5IHUL 4OQ1A 1AXSA 4NQCA 5JHDE 4K7PX 2AGJL 3T4AB 2R56H 1E28A 3LEYL 1W72A 1YEJH 3D39A 2A1WL 3BJLA 4AMKL 1AO7B 5F3HA 3F7VA 1S5IH 43CAA 2OSLA 1VEMA 3GSVA 4KY1H 4TRPL 4CRPA 4C57C 3DV4B 3EYUH 1MCCA 1GGUA 1TQBC 3VDAA 4NM4L 4ODSH 3WDHA 5CWSB 1TJGL 3BQUA 2LVCA 3ALWA 3EYOA 5DUPH 4HV8A 4HWBA 5E8NB 3OKMB 4LEOB 3L3KB 4HH9A 1J0ZA 3U7YL 4XPTL 4TULH 5DEGA 3LIZL 2FR4B 4HHAB 1A3RL 2NY4B 4OZHE 5ERWB 1U91A 2UY7A 4K7FA 1FFNB 1CG9A 1ND0B 2QHRH 5ADPL 1J8HA 1OP9A 1OD9A 3FT2B 3SGEI 3NIFF 5ESAA 1EFXD 4JRYB 1QRNA 3HNSH 1XGTA 3FN9A 1A3LH 4KVCL 3CK0L 2IFGA 1PW3A 3T2NL 1JWMA 1QNZH 2BHZA 4MNQA 1N6VA 3L3GB 1KCGC 5GGTH 3JWDL 5JPNB 1CXKA 1XF3A 2DMCA 5EZLA 4I0PC 5IB2A 2GTZB 5CILH 4WVRA 4LLYA 1N6QH 4PRNA 4GXUN 4Y5VC 5IVXE 1OCWL 1UWEH 5JUEL 2ICWB 3KYAA 3KPRA 4L29A 5TFSL 2NX5D 2NXZD 1NBYB 3NIGE 2X7LB 5F7DA 4JFYA 3RTQC 4X6DE 2N7AA 1YEJL 5F9WB 2YZ8A 3HE6D 1KCSL 3BEWA 3ES6A 2XN9B 4B0MM 3LRSA 2J8UB 3U0TA 4KY1L 3VGGA 7FABH 1M05A 4ODSL 4OZIF 4LCYB 5DUPL 5MERB 3OAZK 4E41B 4JLRB 2HG5B 1CL7I 5HHNA 1JI1A 1T6VN 4N8VB 4Z76A 5HYIA 4G6AD 5HHPA 4TULL 2MQ3A 1OSPL 3MO1A 5CD3B 3G5XB 4YDLC 4LMQE 2GTWB 1EK3A 1VFAB 3NACL 4A6YA 5T3ZD 3HNVH 1AE6L 3W9DA 1AQDA 3P11H 2R15A 5JXEC 3HNSL 4F7TB 2PXYB 3DETC 5LKNA 1A3LL 2UZXB 2W9DH 5IKCA 3VI4E 3TJEL 3MLSH 4YO0B 5HVHC 2XRAL 3IDIB 5GGTL 3DRTB 3NAAH 3MUHL 3LQZB 1I1AD 4WHCA 1EHNA 1RUMH 3VFVB 3KVQA 3IXTB 3MRRA 5CILL 5T3XD 2JF1A 3EO0B 4DJMA 4U6HB 1XR9B 2MOVA 3KYMB 3DX6A 3D87B 1RJZA 4H5SB 4R3SB 2V2XB 4YIQB 3PP4L 5EC2B 4UNTA 4C56A 3HZMB 5KVFH 3BW9B 5BVJA 2QJDA 4JKKA 5KSAD 3FN0L 5BRZE 4Z7WB 2RFXA 5M94B 2EZ0C 3Q3GA 1TDQA 4M93B 2PYEE 1CDUA 5GHWH 1RZFH 3U7WL 4QHUB 1WZKA 3GJEB 7FABL 1NMAH 3HAEG 2AJ3A 2BJML 3O3BA 3FQNB 1F90H 4X4ZA 3VWJB 4PJAB 2GCYA 3GJFA 1CGXA 4PRID 4JRXB 3SDAA 1PX3A 3ZL4L 5ICYA 2EXWD 3DX8B 4J4PC 1MVUA 1P84K 4MD0B 5FA4B 1BFVH 3MV7D 4IJ3B 3SCMB 1CDCA 5D2LB 2R0LL 1MWAH 1ZTXH 4E0RA 2NXYB 3HNVL 2ZCKH 2VWEC 4V3DB 1IGJA 3DVIA 2W9DL 4KRPC 3HG1D 4WV1B 4I0KA 4U1HA 4JZOA 3MLSL 4O5LH 5A16B 4JZJA 5HHOB 1FJ1B 2A6DB 3KJ4C 1T4KB 4PREA 3TBWA 1CXEA 1KTDB 2FWOA 4IRSB 3RUGB 1GHFL 1BQUA 1RUML 3QPQD 3WIHL 1JNJA 3NA9H 4OCMC 3QXUA 5KJRH 3MGOA 3O9WD 1KN4H 1NAMB 4HZLB 1MFDH 2VR9A 3HPLA 2CKBB 2PTTB 3MLZH 3UBXA 4L1DA 3MXWH 4MDIA 5KVFL 4JDZB 1NL0L 3RVVC 3U0WL 3P0VH 2HFEB 1YDPB 1RULH 1PLGH 3ROLA 4PJEE 4C4KT 4MAYD 1SBSH 4QRQB 2P46B 2P5ED 1HHGB 2PETA 5IVZB 3ARBD 5IGXL 4Z77A 4X5WA 5GHWL 3M17B 4M5ZH 5GGUB 1MCBA 5C0CB 2QEJA 5BZDB 2KQMA 2AK1H 1JGEA 2IH3B 2LE9A 5TDOA 1F90L 2F53A 4H20L 2HN7A 1T1WA 5EZJB 2D7MA 5KG9B 3BESR 3PABB 5CJBA 2I9LA 4JM2C 1GCFA 1X5FA 1U8QA 3THMH 4IM8A 5D9SA 5KVGL 2J8OA 5H35A 3C60B 3GI9L 2VJXA 3KLHD 4LDEB 2FIRT 4Q6IB 3IAGC 4KQ4H 2LV4A 3S88L 3BP6A 1FFOB 4FFVC 3O4LE 2X4PA 5EFIA 3V0VA 4O5LL 1ZE3C 2AKRB 3GI8L 4NOBA 4RMSA 1LDSA 5D1QD 3T8XA 1IC5H 3WE6B 4NJ9H 1OTSC 1TZIA 4CKVX 3AU1B 4HQQH 4I0PA 3IT8D 1GH7A 1CFBA 2V2WA 5T1DL 3WJLC 5KJRL 2ZJSH 4Y5VA 5J56B 1MFDL 4FQXC 3PHQA 2FSEB 4PRPD 1DTUA 4JRYE 1Q9LB 3FB5B 1JK8B 2EDDA 4Z8FH 2P43B 2R9HC 3DXAA 2YMXH 2HWZH 5GRVK 3P0VL 1ETZB 1RULL 2QLVB 3RTQA 2UWEB 1QYGL 1PLGL 2YUWA 1G1CA 4OIAA 4PRBB 3RHWK 2V6HA 1D6VL 4NRXA 2QV2A 1YEFH 3O3AA 1TJIH 1E0OB 3FFDB 1X5XA 5C08D 3SBWC 3SDXA 4YZFF 1U41A 4AK1A 4MZ2A 1KTRL 4Q2ZA 3UAJC 4YK4B 5B38A 5HVWA 5ID0A 3LKRB 2B8OT 5AYUH 1LO2L 3QFJD 3TBVA 3X3GH 5I66A 2G9HB 3NZHH 4DGVL 4KK9D 4DK3A 1L9MA 3KR3H 1LP9A 2J8UE 2PF6A 4KQ4L 5B39G 5JXEA 4F33B 3RL1B 1U92B 1RPQA 2X1WL 4HS3B 2NY0C 4XBEL 2MCPH 1J5OH 1IC5L 4OIBA 4APQD 4NJ9L 5J11C 5F7KC 4DW2H 2O61B 4Q9RH 3T1FA 1Y6KR 3FFCD 4HQQL 1JP5A 1JV5B 2ZJSL 3ULVH 3QEGH 4PB9H 2LAGB 4XHQA 4LPXA 1XIWD 1ZWIB 3PNWA 1BECA 2G75A 4HC1L 1QLEL 4LKCA 4WENB 5J6GA 3F7YB 2YMXL 2HWZL 5D7JD 2R0KL 5AWNH 1N3NB 2ZKHH 3P0GB 5F96H 3O0RL 1CR9H 5KTEH 3IJSB 3G6JA 2WP3T 1YY9D 3QPXH 3V7MA 4WEBH 4P46C 4HG4K 3ELAT 4CAGA 1QFWM 2EKJA 5DRWB 4HCRL 1HQRA 3IDYC 3ARPA 1R24B 2YD4A 1PG7H 3FONB 2DIJA 2AJYL 4W4NA 1WITA 3ZDYF 4HKJB 4K9EH 3UTSB 4EDWH 3T0WA 5F1SA 3H3KA 1YMMA 4J4PA 4WCYH 4Z7WE 3CGTA 3SGDI 4M7LL 2J3SA 3FO1A 5C2BH 3QEUA 3KR3L 3MBEC 5HI4C 1FV1B 4G3YL 3WD5H 3WBDA 1MCQA 4PP1C 4R97B 2VL5A 5MEQB 3W39B 4GKOA 3MJ7A 5ETUA 3DECA 4PJAE 5CUSL 4JCLA 2EH8H 2BC4B 5IMLA 4JRXE 1J5OL 5K9QI 1ZLSH 5LAXB 4CBPA 3ZDXE 3BJ91 1JYVA 5CCKH 2WM0A 4PJCF 2E9JA 5D2LE 2ADGA 3CVHH 3REVB 2IPKA 3ULVL 4B41A 1LE5B 3QEGL 4OF3A 4PB9L 4P4RA 3PWPB 1QSEB 2MMXA 5DQJA 2JJVA 3QISA 3T0EE 3RIFK 5C9JA 4NYLA 5IOPB 2MQ0A 3N9GL 5LQBL 3BXNA 5CSZA 5AWNL 3G04B 4OBSA 1G9MC 5HHOE 8FABB 2RCSH 1CR9L 3MROA 3RUGE 2HT2C 3QPXL 2F54D 3UZQA 4HIJA 4NFCA 4W6WB 1CWVA 3N85L 4EIZC 3E6FB 1NC4B 1ZEAH 4HDIB 2FJHA 5C3LD 4FNLH 2PO6C 3I75B 4EDWL 3VGHA 1MAMH 3VG0H 4WW1A 3CDGB 4WCYL 1A1MA 1KCUL 4OCRL 2DF3A 3LRHA 1R3HB 1YEEH 3U9PH 3K0WA 4JM2A 3EYSH 3P9LA 5DI8B 5C0CE 1TVDA 4NGHL 3HUJF 5L2KB 2D7TL 1JZ4A 1G6RH 4J3SA 3FRPA 1S9KC 1I7TA 1HNGA 4U1GB 2EH8L 5LGHH 5FUOH 4KROD 5E99L 5HGBB 1SY6H 5DHVB 5C86A 2ESVD 2ICEA 3EOTL 5DRNA 5CCKL 3OSKA 3FCTB 3EFDL 2K7PA 1A0QH 5DFVD 4BUHA 4EBQH 3WJLA 4ZUTB 4P2RA 3MRDA 1KCRH 1RD6A 3I3DA 4FQXA 1J10A 1CICC 1D5ZA 1RAMA 5CZXC 5C0JB 1IM9D 4XP5H 1DANT 4YBLB 4YEEA 4QOKA 4A2LA 2RCSL 4LOUD 5BO1H 2LTQB 5JMOC 4GW1B 5IT2H 4QCIB 4MXVF 4DOHB 4HIIB 1QHPA 3TVMD 4NJAH 5HHQB 3MC0A 4KH2A 1AIFB 3SBWA 4M1GL 2R2CA 1T04B 4P3CH 1KT2B 1HDMB 1K8IA 3R0MA 3T09A 4FNLL 4N90E 5F9OH 4GG8B 1A64A 1U8IB 3NMEA 3KPLA 3EDKA 3KPNB 4U1IA 2UWEE 1X5ZA 4O2EB 5HGHB 1YEEL 3U9PL 4QWWD 4LRNH 4TVSa 4YUEH 4QRUB 4OGXH 5FM5M 3V7AG 3NPSC 1DBKL 4POZC 5DD1H 4ZAKC 5KS9E 5C09B 4KMQA 3FQRB 4GLRI 3LH2H 5LGHL 4HULB 1SY6L 3KPMB 3BPCB 2P24B 4G80A 4Z7UA 3BKCL 1YPZB 1DN2A 2A6IB 3VXSD 1A0QL 3VXTB 2W9EH 1R3JA 4QHLB 4EBQL 1K3ZA 3CFCH 4R26L 3QB7C 1I1FA 4MZ3A 4R7NA 4E42A 5JHDD 2I5YH 4XNMB 5MI0C 3RVXC 4MA3A 5EU7C 1I9JH 1P4LA 3T3MF 2B39A 5JO5B 4KI5C 2ZG1A 5I9QB 3MTRA 1OGAA 2HKHH 4XP5L 4HK0B 4XBGB 3IJYA 3WUWG 3OB8A 4ONGL 4ISVB 3WCYA 3T4YA 3P40A 1K2DA 2KH2B 3QIBC 3V0WH 4NJAL 4P46A 1X7QB 4B5EA 5FO9B 4JVUA 1KCKA 5IW6A 5CD5D 1A7QH 1U3HD 4JB9L 3MNZB 3UJJH 2ZPKH 5F9OL 3IFLH 3HPJA 5CHNB 3FQTA 4PJ9D 3CLFL 5F9AC 1C5BH 4P5TD 3H42H 5EUOB 4P2QB 1IQDA 1KOAA 4U1MA 1U2CA 3QIWB 4UI2A 1CD8A 4PGJA 3H0TA 1N0LA 2YBRB 4ODWB 5C6TL 3MBEA 4YUEL 2WSKA 4OGXL 3FT3B 4GKSA 4X99A 3PL6C 4NCC1 4XVTL 3S97C 5DD1L 1AHWC 1B4JL 1FGVL 3VH8G 4LHJB 5FK9B 4DKEH 2B20A 2APWA 4X83A 3MUGA 5E8PA 3MLYH 3BZFB 3O2DL 4JFEA 1BD2B 1F4AA 3ALXA 4XVSH 4DZ8A 3NTCL 2CR6A 2EE9A 3MRKB 4HWEL 4EN3B 1GYAA 5IBLD 2G60L 4XGZB 3D9AH 2W0PA 4L8DB 1N6UA 4PLKD 2JTDA 4KTEL 4PJDB 5GJTL 1ZLVH 3D2UA 5IROC 3QZWG 4N5ED 2P8MB 1SVCP 2EC8A 1HYSD 4PJGB 2BXYA 5ACZA 1KTLA 4X0KB 5DZNA 2D0GA 2LU4A 5D5MF 3PWPE 1QSEE 1R3IL 2Q8BL 4R90L 2F19L 1A7QL 1JGUH 4JY5L 4U3HA 1Q72H 1J1OH 2DQTL 2ZPKL 5HPMB 1ACYH 2BOBB 2VZSA 2PO6A 2H9GA 4OKVA 5EZOL 4QHKJ 3S5LG 4ZPTB 3NN8A 3ERYA 3ULSA 1YMHA 4FQPA 2NNAB 3SPVB 1OB1B 3RJDA 1GC1H 1G84A 4P9HC 4OCYH 2CDGB 3TJHC 3UTQA 1VACB 1KB5L 1MFAL 2E9IA 1H15A 3VE0B 1JGDB 4PRHB 5C0RL 4DKEL 2VDNL 4GRMA 2YPKA 1KIRB 1WFUA 1O5DT 2V7NB 4LHUB 3WLBA 2H6PB 3AXLB 2XKNA 3AS3A 1HHHA 2W07A 3G6DH 5F7LB 5SWQA 1PSKH 3HMXA 3MRGA 3RL2B 4PDCE 5L2KE 1IC4H 1YEKL 5BRZD 1UGNA 2M8XA 1CICA 4KUZL 5EBWA 4MXQD 4N0YH 2VLKE 2PYED 4BZ2H 4XNXH 1FRGH 2E7BA 5I75C 5E7BA 2XWTA 3DO7A 1LE9B 2CIKB 3L95A 1FN4A 1IZKA 4MD4A 3RI5F 1N26A 3HAEA 2KUTA 1ODAA 3LD8C 1V3JA 2RAMA 1FNGA 4I2XA 1Q72L 4P4KB 1ACYL 1WFTA 3JTTA 5DO2D 3OR6B 4KKCD 5FYLH 1CN4A 1P4BH 4PRAB 4N5UA 3MRNB 1G7HB 4EDXB 4QXTA 2OQJB 2AEPH 4DOHE 4F58H 1NFDB 3SEPA 4JFDD 2OL3B 5JQ6L 1RFDH 4HMEA 5DUML 5JXAH 3ALPA 1NUDA 4ZAKA 4KTDL 1RK1A 1KNOB 1G7PB 4MX7A 2Y36L 2OR7A 1XF2B 3DROA 4Z7OF 2BZDA 4PB0H 3O6MH 4RISH 5DMKB 3UDWC 1EEYA 3HMWL 4X6FB 3A6CH 4WI5A 2C7UA 2HJFA 4HW6A 3SDYL 4NBZB 4GBXD 2XY1A 3MRMA 3NABH 3U9UB 3ZSSA 3BH8B 2P7TB 1IC4L 1LO4H 3MZGB 4OFYD 5D4QA 3UTPE 4PTTB 3MV9A 3BZ4B 4OFDA 3EHBC 5DT1H 5C09E 1JPTH 4Y4FC 3T65B 1ZA3B 1RZ7H 4RGNB 4P3DA 3S35H 3CDYA 3RWJB 3ARTA 5TQ2H 4ENED 1YPZE 3O3EB 3B9EA 1QBMH 2GUOB 3QIBA 1UFUA 32C2B 5FKAA 5CJXA 1BM3L 2IC2A 1K5NA 3FQUA 1A7BA 1M6OB 3K1DA 3X17A 1JCKA 1UACH 4UT6H 1G7QA 4CU8A 5FYLL 4GT7A 3VXUE 5L0QC 3MV8D 1IAIL 2V2TB 1JVKA 1ZT4B 3EZ8A 4QO1A 4Z0XA 4LLQB 4PRDA 3O4LD 3QIUB 1W8OA 3UTTA 1AR2A 3L3JA 4MD5B 3UYOD 1I8MB 2ZUUA 4KK5D 1L0XA 2ADJB 5F7HA 2VISB 3ECBB 3O6KH 3PL6A 4ZUVA 1LDPH 4AEEA 1AHWA 3DLQR 5E6IB 2ICWJ 4CMMA 4HJ0D 3GUTB 1KTKE 3LQAL 5FECB 1EJOH 5J6HB 4JGMA 4PB0L 3O6ML 4RISL 4P2QE 5EUOE 4R4BB 1IEBB 3TN0B 4OV5A 3LKSB 4JRYD 3QDAA 3A6CL 1DQJA 5MENA 5L7XL 4GSDH 4D3CH 1BAFH 2BY3A 4ORZC 4ZD3L 1LO4L 3BEVB 4MA8H 4AIOA 1VEOA 1TENA 2IQAB 5DT1L 5IROA 3WL9A 1Q94B 4JY4A 4U0RC 3S35L 1EZVY 2HT4D 5GJSH 1FFRA 4ELME 1BHGA 4JVPA 1X5GA 1BD2E 3SO5A 4FQHA 5JTWA 1T89A 4UZGA 1PFCA 5MEOA 4JZNA 3ARUA 3I85A 4TVPH 5EBMB 5LXGL 5DJAA 3FB8B 2AK4E 4PJDE 3MRFA 4M7ZB 5F6IB 4XCNA 1MIMH 2FYYB 1N5AB 2VXTL 1RUAH 4PJGE 3L9RB 3UJTH 5J9PA 4OTXH 3V8CA 5FCSH 1LO0H 1DFBH 1SM3L 5B39A 3O6KL 5L2JB 1A02N 1FFQA 3MJ9H 1YEDA 4LNRB 2P48B 3BUYA 3Q5OA 3VFTB 4D2NA 5EIIA 3QDME 1EJOL 1JRHH 2RHEA 2RIKA 2DQCH 5HYJA 1S7UB 2NR6D 3KYKH 3ARFC 3BH9B 1HOCB 2PXYD 2X44D 3V6ZA 2AEQL 4JFOA 4M4PA 5IG7B 1G0XA 2FJGA 5I1EH 4QRSB 3VXNA 3S4SG 3QNZB 1E4KC 2PW1A 4MA8L 1A4JB 2K9UA 4Q58C 3PWNA 5K9KB 4HS8L 4OCWL 3GSXA 4C58B 5T1LA 3LEVH 2X4SB 4PRHE 1YYMH 4AJ0A 4XNUH 1KJMB 2DTMH 4P57A 1ZAGA 2AJSH 4WEMB 1FZJA 2BNQE 4CADB 2GJ6A 1FL5B 2ENYA 3TBYA 1WSST 4H1LB 1B0RA 3T3PE 2D31B 1CLOH 1UJ3B 2X9WA 5DJXA 1D6EB 5HD8C 5I19H 1DL7H 4YGVA 1DBAL 3DX7A 4MLSA 3KYOB 3LDBC 4Y16C 5JPMB 1HHJB 5F44A 4L8CA 4M5YH 2Q6WB 3BWUC 1MPAH 2FBJH 4B50A 5IIEB 4MHHG 1C08A 3UJTL 1S7TB 3CJJA 3MUY1 1TQCB 3VFOA 4OTXL 2R1WA 3VWJD 1LO0L 3TFKD 4OCXL 3RWHA 4LP5A 4JRXD 4FXKB 4N1HB 3MJ9L 3SCMD 2W91A 3DUSA 3VWKB 2APTA 1BIHA 1J0HA 3HR6A 1JRHL 2C1OA 4KHTH 2NXYD 4X6EA 2HJKA 3KYKL 1OP5K 4XWOD 2OM5A 3TZVB 3UDWA 3FJTA 3T0ED 1MHCB 1ZHNB 4S1RH 1MFNA 1NFDE 4NNYA 1QLFB 1AD0A 5MP6L 1P7KA 3QNXB 3QO0A 3OXSA 5HHOD 5LGKA 4LKXA 4IRSD 1RZJC 4KI1A 4Y4FA 1HH6A 1JPFB 3KLSA 3LEVL 5FYKH 1T5WB 1YJDH 3S3PA 2FGZA 4TPRL 2YSSB 1I8KB 4HKZA 1ORQB 4ZDHB 2Y4SA 4N9OB 5ANMB 3LS4L 3HA0A 2OTUB 2BY0A 4QRTB 5EU3B 5B4MD 4KJWD 3ROOA 2XY2A 5I73C 5I19L 2E7LC 2VUOA 1DQQA 1AH1A 4LCUA 5C6PB 1VB9A 4KJYA 2XNAB 4HLZH 2FEDD 4PJBA 4RGNE 1GIGH 1MPAL 2FBJL 3NCYS 3PJSA 5C0CD 3F12B 4JPVL 4WNQB 2KDGA 4UDTA 1X6NA 1HHKB 2X89D 4Z78B 4ZSOB 3Q0HA 2P8PB 1DP0A 1FSKB 1TJHH 1D5MB 1OGTA 1YN6A 4OGAC 1UWGH 3CDCA 1MUJB 2VXUH 4HBCL 2B1AL 1FO0H 1IEAA 1H3WM 2FEEL 1LILA 3RWFA 3C60D 3K8KA 3MODL 3U2SA 5ENWA 2QBWA 4IRJC 1BFOB 1C5DA 4LQFH 3LAFA 5E2UH 2OMBA 1LK2B 2VIRA 4BH8A 1KLGB 1MCJA 4X6BA 4ZXBC 1DQLL 4U31A 2QTEA 5H37G 4G8GE 5CEYA 5DMIL 1BMGA 4UNVA 1F58L 3DUUB 4ESKA 5JA9A 2VSCA 5TGBB 5KANI 1C5CL 1FIGH 4H88H 3TO2B 3VXMD 1MIEL 3VFGL 5ITBH 1TETL 3KPTA 1I9RH 4N90D 2AV1A 1HKLH 4AT6B 3MR9B 3X11B 3LQMA 2EDHA 5BJTA 2SEBB 4JQXC 1OTTD 3OKLA 1QG3A 3RGVD 3P4OA 3GHEH 5F21B 3DTXB 1FLRH 5CP3A 5SX5H 4XP6L 3R1GH 1GIGL 3LKQB 4PJHB 3QG6A 5I1CH 1CXLA 4X7TA 2Z4QB 1XZ0A 2GYSA 3B5TA 5HTSA 3C5ZB 1FFPB 3O6LH 3KDMB 3FT4A 1A2YA 5DD6A 1NEZG 2X4QA 3KPOA 1UWGL 4KV5E 4QRPB 2XI9A 5DMYA 1RHHB 2QSVA 5DJ6A 2B1HH 4R7DA 4OUOA 4LSVL 1EO7A 3MRCA 4YFEA 5KN5B 5C7XH 2CKBL 4I18B 4U1SA 1MNUH 3ARFA 4LQFL 4LSRH 5E2UL 3WNPA 3DBXA 5H2BB 3MGTB 1KJ2A 3SDDB 4HF5H 1BVKB 1E4KA 1T7VA 2NY5L 4ZFOA 4RBPK 4XMLL 2VXVH 3V4UL 3SE9H 1X6LA 4OI7A 3WUWA 1FIGL 3QUZB 4XNZC 5DRZA 4QGYA 2QL1A 4IDLA 3VFRA 4RFEB 5DRXB 1RZ8B 1UKQA 1ACZA 1FL3A 2ARJQ 2DQEH 5I0ZA 1HKLL 4P9ML 4NSKA 4XMPH 2NZ9C 4RA3A 3QUXB 4OCNC 1Z5LA 4R0LB 5IMOB 3GHEL 4Y19B 2R2EB 1AFVH 2YD8A 3HRPA 3J7HA 3OB0H 4JJ5A 1T0MA 1QSFA 3OGCB 3AVEA 3I9GH 4Y16A 3R1GL 3CU7A 5JOPE 3CZJA 3QEHB 3RBSA 1RSFA 4MJ5A 1H3GA 1U3ZA 1MCKA 3W5NA 1FCCA 3AREC 3EFFA 2NY2C 4N8PA 2OR8A 2NYYC 3HZKA 5FA3B 2MPAL 3STZA 3QCTH 2X70A 3VH8A 3JWDC 2B1HL 2D9CA 5HYSG 2FDBP 2H2PD 5D7LE 3HLAB 5JOEA 1T7XA 1VFUA 1BEYL 2EIZA 2NTFA 2DQJL 3VMOA 3IJHB 1HI6A 4ZFFB 4X4XA 3D0VA 4KJQC 1JJUA 2WIIA 4XCFH 1NLDH 3BPOB 4UU9B 2ZG3A 4G9DA 3KHQA 1F6AA 3QZWA 3TNNA 2IEPA 4JFFB 4ONHA 3SE9L 3DWTA 4LMQI 3LEXB 3MA9H 3PWPD 3F7PC 4YFDB 4AENA 1QSED 3JTSA 4U49A 5HGAA 1IGIH 5DHXB 4NPYB 1JYXA 3WIIH 3UP1A 4JFXB 3ARWA 3VGDA 1GGCL 3EDFA 3ZYIA 1A5FL 4ZO8A 2DQEL 1OAQL 4YPGB 3IFPB 1CFQB 3CD4A 3VD9A 5C0IB 3NH7H 3VFMB 4AEHH 4O02H 2EC9U 1IBGH 4UQ2B 4NUJB 4I3SH 4U1JA 2E7LA 3S5LA 2K1MA 2YC1B 5ALCL 2