4F7TA

Crystal structure of hla-a*2402 complexed with a newly identified peptide from 2009 h1n1 pb1 (498-505)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Cross-Allele Cytotoxic T Lymphocyte Responses against 2009 Pandemic H1N1 Influenza A Virus among HLA-A24 and HLA-A3 Supertype-Positive Individuals.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7tA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4f7tA01
1DZBA 1XCQA 1K6QL 4LL9A 3QCUH 4PY8J 3DWTA 2ENYA 2IFGA 2Y5EA 4O2EA 5F6IB 4JJHA 4HBCH 3W82A 1FYTB 3G04A 3GMMA 5F3BB 1A6UH 5F7WC 3QEHA 4L8DB 5D1XB 1HHHA 4NM4H 1ZLWH 2YHGA 3GMOB 1MFEH 4P46A 3SO5A 3MACH 1NCNA 3MA7B 4K8RC 2V7NA 1XGYH 1R24A 1ZEAH 5C9JB 1BBDL 3HI5L 1GH7A 1JTTA 3S98A 4YDLC 5I1KL 1U6AL 3OKYA 4EEEA 5L88H 1O5DT 2R9HC 3MRHA 3DVGB 1F3DH 4JFXA 2VDLL 4TN9A 5LAXA 3EYVA 3SE3A 3TVMC 2QQNL 4ISVA 1NFDA 5I0DA 2J8HA 4RRPG 1ACZA 4H0IA 1NCAH 3C5SA 1ZK9A 3P73B 3DX7B 3D2UD 3LV3A 1REIA 1HI6B 4Y16C 5F7KC 4Z78B 3DYPA 5IBTH 1QHOA 4LHUA 3D25A 3FT3A 3QUZA 1UCBL 5ALCL 1TETL 1BQHG 3AY4C 5SWZE 2HH0H 3BPNB 2PETA 4QOKA 5HHOE 4GJTB 2HTLC 3ZDXE 4HUNB 4BZ2H 1CZ8H 2Z31D 4XNZC 5J1SC 1GGIH 4LCWD 5I30H 1L0QA 1GAFL 1Q38A 2CLZB 4R96A 5IWLA 1HIML 3LRHA 1DQJB 2LTQB 4QHNB 3V5DA 4LCCB 1BAFH 1NDGB 4GAFB 1I1AC 3TIDA 5JORB 4FQIL 3MRNA 1NJ9B 3O4LA 3BD5A 4S2SB 3QIBC 4X9BA 2PCPA 3CFJB 3SPVB 4YNYA 2FATH 2NW3B 4MX7A 3JVGC 4JM2F 1S8DB 1AKJD 1JV5A 5HJ3B 2PXYD 2YRPA 4JO2L 5HYSG 4PJ7A 5LBSH 4XNYH 1E4WH 2DQHH 1FNFA 2Y36L 1FE8L 1VEPA 3TF7C 4MCYB 4PJ9B 4MQSB 4P9ML 1O0VA 5EFIB 1OB1B 3T04D 4W6XB 3VGBA 1NGWB 4K9EL 4EOWL 4UBDD 2HRLA 2YWZA 3VGAB 4TNVF 2E27H 2VQTA 5J3HC 4KK6C 2BCKB 2APBA 3LKQA 5KVFL 5DHXB 5D93C 3KHOA 4XCNB 1B0GB 2X6MA 2W1NA 3HR5B 43CAA 3NIGF 4B0MM 4NZTL 4JM4L 1MJUH 1UB5A 3HZKB 3U4EB 3TC9A 2P5EE 1FFOB 1QFWI 1KSRA 4F37K 3O3DB 5DD0H 4R7DB 2C3WA 4XVJL 1NUNB 5DR5L 2P8MA 3DHJA 1BJ8A 4K3JL 1HZHL 3TZVD 5EBLA 3D3VB 4HS3A 4EUPG 3B9KD 5T3ZH 1LDSA 1FAIH 4MJ5B 5EU6B 1DVFC 5JUEH 1AGEA 3CC5B 4XVTL 3KPRB 5J12B 4Y4FC 1D5ZA 3OX8B 1J0KA 3RKDD 2AQ1A 2YMXH 4N5ED 1K4DA 3BZDA 2NXYB 3DIFA 1ZLVH 4JG0L 1MFEL 3LKOB 4TUOA 1YY9C 3GSVA 3HMXA 2YD5A 4KKLD 2DM3A 5D5MA 1BIIB 2AV7B 4YDJB 3S36H 4QGYA 3ARZA 3JTSB 4KQ3H 5E8DL 5JHLL 1B4RA 4P4KC 5FO8B 3OKNB 5SX5K 1NKRA 5F6HI 1JK8B 2VL4A 4V1DD 4OZHE 2NX5E 5E8PA 3QQ9C 3WSQH 2ZJSH 4HJ0D 5D71H 4OAWB 4CN1A 1GPOH 4I0PB 3VXTB 1H15A 1LE5B 5GJSL 5HHMD 3MXVL 1MCJA 3KYMA 1FLRL 2N1KA 1IQWH 1M4KA 1NAKL 1V3JA 2JLLA 4RAUA 2EYSA 1FVEB 1HXYA 2L0DA 4EBQL 3MODL 4KY1H 1PG7L 3FB8B 3KPQB 4AT6B 1KN4H 2CUIA 5KOVC 2DYPB 5KN5B 4CNIB 1KLUA 4Y19B 2EXWD 4OGYL 1J0ZA 4W68A 1K8IA 1WBXA 3J7HA 1G1CA 5IEHB 1AXTL 2UZXB 1IGTB 2OR7A 4H8WH 4LPXA 2R1YB 5ANMB 4DTGH 4X7FC 4DGIL 4P2RB 2HT2D 4PGDA 4AEFA 4QGTA 4FXKB 2CJUL 1KIRA 5HGAA 3U36B 5IB2B 4Y4HC 5F89B 5CS7A 2EO1A 2EXYD 4PJBA 1T5XA 2WUCL 1ZS8A 4NQDB 2NTFA 2G60H 4HUWA 4LRNL 5MENB 2D03H 3DO7B 5IJKC 5T1LB 4Y7MA 5IIEA 1OCWL 1TCMA 4JN1H 4X8XA 5E6IC 3CDGA 4HK0A 3QG6B 5CINH 3FRPA 3O3AA 3HE7A 4LOUC 1HYRC 3BVNA 2HFFB 1DBBL 5HPMB 5ISZE 1U36A 2H45A 1B6UA 3MLYH 3BSZH 1FGNL 5JW4N 3TN0C 2R0KL 4Y5YA 4TPRL 5INDB 4JFPB 2ORBH 1F97A 1TZIB 2Y07L 4X6EB 4LVEA 1LD9A 1ZAGA 4K94C 1T4KB 3LZFL 4M9OA 1OTTD 4N0YL 2WZPD 3MBEA 4HMCA 3LKRA 1LNUB 3VMNA 3CZFA 4ZFOA 2CKBA 2IEPA 5FF6A 4G6JH 1Z6JT 4P23B 4FFVD 4XP4L 4NN5B 2OJZH 4OCXL 5LGHL 2XV6B 4XPBH 5AG8A 5A2KH 1LP9B 4JDZA 2FBOJ 4NKQB 4ZNEA 4HIIB 2I5YH 4EN3A 3FONB 5DHVA 4QRRA 4PB9L 1YEDA 3VRJB 1FNAA 3R06B 4UNVA 1MJUL 1LO2L 1YDPB 1TTGA 3WKNA 2YZ8A 4I0CC 3OJDA 4LBEA 3ARFD 5B8CB 4H1LA 1J5OL 3RL2B 2BP3A 1FZMA 1QFUH 3I6GB 1JGEA 3BKYL 3E6HA 4RAHA 4PPTA 4RZCA 1ZGLB 4Z7VA 3KPOB 2P47B 3VWJB 2W0PA 1CFQB 3O3EB 5GRJL 5IFJB 1FAIL 2HTKC 1VSCA 1HQRB 3WFHA 2DRUA 2DQFA 2BXYA 4X5XB 1XCQB 5EC1B 3VD7A 2YXMA 1MFCL 2A74B 4LDOB 2DLGA 2R2EA 2EC8A 3L3IA 4P3WA 5DFVC 2VLLB 3WS6A 4L3ED 4AIOA 2Q8AL 2ESVA 5F7LB 4KI5E 3WUWG 5DJAA 2MWCA 4GAJL 3MLRH 1CDYA 1LEKB 3KJ6H 4HKBA 1RMFL 2V7NB 2O93L 2X40A 1N5AA 3C6LC 1AI1L 4HIHA 5FGCE 4JO4H 2E7BA 4ZFZB 3MV7A 5D71L 1G9MC 3MRHB 5JXEC 3BEVB 4NUGH 5LAXB 3S4SA 5FYLE 4HLZG 2IH3A 4ZPVA 3C8HA 2HAZA 4ERSH 3FOMA 4KY1L 1EFXB 4QXGL 1VENA 4KI5D 3LV3B 2JIXD 4N0UE 3RWJB 4DGYH 1D5XA 3FQUA 3CXDL 1I3GL 3O11B 1T1ZB 2ADIA 1W8OA 4H8WL 4IRJD 5HHVL 1E4XI 1U3JA 4QOKB 4L9LC 1GL4B 2UWEE 3LCYA 1MQ8A 4UTBH 4JKLA 4ELKA 5FYLD 5BO1L 4NO5A 1S9YA 3QIWD 4XNUH 3IJYB 4TSCH 5LG1A 2R56L 3SDXE 1NDMA 4R3SB 1B2WH 4MD4B 1X4ZA 3KLAA 2M2DA 3ARQA 1X5GA 5TE7L 3LD8B 1T1XA 2X7LA 1TJIL 4HJGB 3K2MC 2HG5B 1K9TA 1YMMB 4JO1H 5IV2A 3K1DA 4M43L 1IGFH 1WIUA 4P57A 4X4YA 3WIFB 4WI7A 4ESKA 2KUTA 3FMGL 1S78C 2FIKB 3HUJE 5HI3D 4F8TA 5HD8D 2EDOA 4JN2B 5I6XC 1QLEH 4YNYB 4NO0B 3LMJL 4Z7WF 3BUYB 2J6EL 4MX7B 5JTWA 2AJSH 2R2CA 3H3PH 3PDOA 4Y4KB 3EJYC 1VFMA 2XWJA 1AR2A 2L7JA 5EO9A 3VJ6B 2B20A 2IBZX 5E2VH 4QXWA 1I1FA 3D48R 5CJXA 3U1SL 5DUML 3IETA 1MFBL 4M48L 4WO4C 5HVGB 3BD4A 4DOHE 1XF2A 4GKZB 4WFHD 5KW9L 4XPBL 1BZ7B 2GSGA 2FJGB 1OP3K 4E41D 3IDGB 5I1HL 2HLAA 1GIGL 5IB4A 3P0GB 4KMTH 2H9GB 4H20H 1IGCL 3MV8E 5H37G 5EZLA 1D5IH 5GRYA 1UB5B 2C3HA 4ZXBC 4X7EC 3EYOA 4CKVX 3C60D 2YK1H 4PY8I 2BJML 1JGDA 4IOFD 1CLCA 4GXVL 5CLTA 5F7EH 1NANI 3G6JF 5D7LE 5F7HA 4P5TA 2BERA 4R2GD 1IGMH 5SWQB 3OKDA 5DMKA 1D5BA 2ARWA 5BRZD 5K33A 2DWDB 5CD5C 5J6HA 1QYGH 2XXCB 4BK5A 3WIHA 2I07A 4PJEA 4XMKL 2Y6SC 1FRGH 2Q76A 5FOJA 3WXWH 2X1WL 4KHTL 1J88A 5DEZA 2XQYG 3NH7H 5LWYL 1ZLUH 1AGEB 3UYRH 4OFYA 1P6FA 3VXUD 4UZGA 5I17A 1G9ML 4I5BA 4MNHB 5JOPD 3QEGH 3DIFB 2DMKA 4P3CH 5D7LD 1GCFA 2ENSA 3DMMA 2VZTA 5DFTA 4J12A 1H3VA 2VISB 4ZS7L 5CZVH 1KJ2A 1JWSA 1CG9A 5LCVH 4NUGL 1ZHNA 1U8QA 2AEWA 4X6FA 3TIEB 4WFEE 3OXRB 2KH2B 1EHXA 4MNQA 1AD0A 1ZVSB 4GW4B 2X5PA 5CJ5A 4NBZB 3GBMH 3KYMB 2O5ZH 2OCFD 3FB5A 3VDAA 3QQ3B 4JHWH 4RAUB 4YDVA 1FFNB 2Y06L 5JXAH 4ODWA 3HC0B 4JFZL 1BD2B 1QR1A 2WY3A 3RTQC 5CUSH 1EHLL 1YEJL 2IG2H 2WINA 4ODTH 1I1YB 1WJ3A 5J8OA 1OARH 1R3IL 1MHHA 1DUYB 2GFBB 1NGQL 1RVFH 3RI5K 5MERB 2RR3A 2CH8A 5L2KA 2WWMC 4N0RA 2VLRA 3UROR 1IZJA 1CI5A 3WO3B 2IH1A 2A6IA 2F54D 1ZANH 5KVGL 4PGDB 4ZUUB 5FUZL 3WXVH 1B2WL 1P7KB 2R69L 3QWOB 3L3KB 1KFAL 3DVFA 1JZ6A 3QRGL 5EUOB 4QTIH 5AUMA 3OR7A 4M5YH 4PJBB 1HNFA 1NAMH 4HV8A 4NQEB 4P2QB 2X4PB 3HFMH 4L4VE 1UWXK 12E8L 4O9HH 4OD2A 4HUWB 4JO1L 4M7LH 4YHMH 1FG2B 3CFBA 2C9AA 5BS0E 3BUTA 3MREB 3B5HA 4G9FA 1DDHA 4RGMB 2AEPL 3HE7B 3GRWA 2D3VA 5JQHC 5F1KC 1QLEL 4YR6A 4K8RD 4M4PA 4GG6F 2VDPH 4UIKH 4NN7C 4MVBC 3VXSA 3RGVA 3H3PL 1DL7H 4LASL 2X9YA 2EYRA 4QRPB 1CIDA 5FGRA 1INDH 4OT1H 3TVMD 5AEAA 4L4VD 4M3JA 3NIGE 5FFLA 3IDIA 5C2UB 3K2UL 1GGBH 1NC2D 1D5MA 3TBWA 1G84A 1CXHA 5D70L 3MRMA 3MNVB 3BZEA 3MRIA 4Y2DA 3B4NA 5MEPA 3CZFB 1KT2A 3TBYA 5GS1A 3LIZL 3P11H 3MRDA 5FF6B 1HINH 2XNAB 1G7PA 4MZ2A 5FA4A 4KV5F 3O2VL 3FFDA 2Q3ZA 4C56D 35C8H 4JDZB 4RNRB 3NCBB 3QUYA 3L5WB 3IJSA 4EN3B 5DHVB 3UO1H 1A1MB 1YEDB 1GSMA 4OIIL 1P69B 2HYMA 2HTLD 1OSZB 2Z93B 4ONHA 1ZWIA 2DLTA 2XI9A 3U79A 3ZSTA 3OJDB 4F7TA 5ILTH 3QHTC 1YEIL 5IB1B 3P30L 1QG3A 2MQCA 1UH2A 5GGTL 2EDBA 4XBGA 5JIHA 2NLJB 3NCYS 4RCAA 3HCVA 4JRYB 1ZLSL 5MEQB 1I1AD 3H42H 3G9AB 1FZMB 1JGEB 1RK0A 1KULA 1CICC 4X7DC 3SDAC 4WWKB 3KG5A 4JHZA 5D7IF 3ZYZA 2D7QA 1YPZE 1G7HA 5BV7B 2DQFB 3QHFH 2CRYA 3MA9L 2R0WL 2C4XA 3F7YA 1RULL 3QEGL 3UTSD 2OQJA 3O3BA 4PYGA 1I8KB 4O2FB 1ZTXL 1AJ7H 4V2CB 4PJDB 1FGVH 4IOIA 1UM6L 3C2SA 3QEQA 4M93B 4D94A 1IKNC 4ODBD 3IS0X 3F6IA 1OPGL 1MF2H 1BWMA 4XRCB 1F4YL 1CDHA 4YXLH 1N5AB 4WV1C 1U8PA 5FUCC 5BZDA 1A7NL 2E5EA 4MJ2A 2NY2B 4FRWA 4P2OB 1ZSDB 5JO5A 4F33A 4OI8A 4ZAKC 5GPRA 1V7NL 2IH3B 2OI9C 5J3HD 4GXUN 1KB5B 5EN2B 2FSEA 5JXAL 4KK6D 4X4XB 1J18A 1A6VH 1TLKA 1CFBA 3C08H 1F3JB 4IRSC 1Z0MA 2D31B 3BMWA 4R97B 1OARL 4JQIH 1INEL 1D5XB 3OB8A 4ODUB 1MNUH 5D6CA 1AO7A 2DI8A 5B38G 5F96L 4M6MH 1YYLH 5CEZL 4EDXB 3UYPA 4DVRL 3IKCA 4N8CL 4HGMA 3KXFA 4NO5B 3GUTA 3O8XA 5DDHA 2C3VB 2VQ1A 1A9BA 3VD4A 1DVFD 2X7LB 2J12B 4Y4FD 1NL0L 2CXGA 1CK0H 1IGYA 1TQCC 4FZEL 1F6FB 1K8DB 2HKHH 2I26N 3V4VH 4P57B 1CD0A 1YY9D 4YDIL 2J8UA 2FWOB 4S1RL 2AAVA 5F1NB 1Q8MA 1RFDL 4KZEL 3DXAA 4P4KD 4GLRH 1X7QA 4JY6B 5D8JH 3QQ9D 4HT1L 1L7TH 4RDQF 3FQXB 4JPWH 4EUPB 4MB4A 4J3XA 4JO3H 1WBZB 2DL2A 4ODHH 2PTUA 1GOGA 1GGBL 3VXMA 5HYJE 2XRAH 1ROWA 4CL7A 1QSEE 3JUYA 2IGFH 1A6PA 2CDEA 3NBNA 1Q0YH 4L3AA 3IETB 5FYLH 2VAAA 1JWUA 5KS9E 5IG7B 3GSUA 2Y72A 1JPTL 2HFGL 2EE6A 1HHIB 2YKLL 5GS0L 5TDPA 3WUZA 2VLJB 1MCWW 5C07A 3ELAT 4KDVA 5IB4B 3MGAA 4LLVA 3STLA 2ZOLB 3EBAA 5AAWA 4CN4A 1VGEL 4DKAA 5DQDH 1AFVL 5HYJD 4K7FA 3EYOB 4F58H 1LDPL 3O2DA 1LEGA 5BVJA 5DUBA 3TJHA 1DEEA 3JV6A 4Y4HD 4HGKC 4JZJB 3S6CA 2DQIL 4P5TB 4PRAA 5DMKB 4S0TD 1GHFH 1NKOA 4POYA 4JPIA 3VFSA 3C5JB 5A2JH 1KIQA 4R7NB 4MCZA 4NJAL 3JWDH 2Q76B 5E6ID 3BOVA 1U58B 4NHUA 2BSTA 4LOUD 2V5MA 4IMKC 4JGMA 2HJKA 4OLYL 3Q6GL 4QTHA 1C5CL 1DQLH 1HH9A 1T21A 4I5BB 1T22A 5D6DC 4OF7A 1C16A 3TN0D 3VFTA 1F6AB 1CFTA 3LS4H 1XIWC 1ZE3C 3KPLB 3G5VB 2E8ZA 1SMOA 4YXLL 8CGTA 1Y0LB 3DMMB 2IC2A 5IJVA 5DYOA 2ZKHH 1RZKC 4TSBH 1JWSB 5E2UH 1CG9B 5F71A 1ZHNB 3VWKB 4X6FB 2F53D 1BEYH 3PWPA 4MS8A 1OWWA 2AJYH 4PUBL 2Z8VC 4G7VL 2P4AB 5JHDE 1PW3A 1SYSB 3PE9A 2H41A 2LQRA 1TZHA 1MRDL 2JJWA 4K7PH 4G59A 1I8MB 3FN3A 1KJMB 4IBLT 4NRZB 2LU7A 5EZIH 5EBMA 3THML 1TNNA 3DSFL 1BJMA 1TFHA 4X5WA 43C9B 1WFTA 1MHHB 3BPOC 2PYEE 1T2QL 4E5XA 4PRHD 1E4XH 1EEZA 4JANA 1YECH 5C0IB 2EIZA 5L9DL 1YC8A 3AREC 2VLRB 5DD1H 2A6IB 4D0CA 4J6RL 4GKSB 3C2AH 2HJFB 3BQUC 2DQGL 5KTEL 3MLUL 1XFPA 2B5IB 1CLOL 5AUMB 5E4EC 5IMMB 1AQKL 3O9WA 4IDJL 1BGXH 4OLXL 3KPSA 4LPUA 5DFVD 1Q9WA 3ARSA 4KHXH 3CFBB 4BQCA 2XIDA 5CP3H 4Z18A 2VDML 2VC2H 2VSDA 5ACMA 3MR9A 2DICA 4GAYA 1G7JA 4LKCB 1RZ7H 4HUVB 2AK4A 5D2NE 3C6LD 3DUUA 4X4ZA 1YYMH 4GBXA 3K0WA 2NZIA 3GSXB 1CF8L 4URTB 3LQMA 4PRNA 4X98B 4JDTL 2XRAL 1WCBA 4OV5B 2EIDA 3D85B 3MV01 3IDIB 1MSPA 1RSFA 3FQTA 3IFNL 4QRQA 4LNRA 4N8PA 3MRMB 1U3HB 3BZEB 3VRIA 3MRIB 4Y2DB 5GS1B 3TBYB 1EEYA 2WV3A 3G6JE 5CSGA 3FFDB 1YY8B 4BH7A 1S7XB 2OX5A 3F65A 3FT4A 1DBMH 4G6FD 4YAQA 1V5JA 2PTTA 4P46C 3QSKB 2PR4L 2V2WA 3QUYB 3HPLA 4XZUB 1N5YH 5B39A 1BJ1H 3L5HA 3NCCB 5GHWH 2ADJA 3RY6A 4HWBH 4G8GB 1ORQB 1ZWIB 1AGCA 5E9DA 4CVZA 3CGTA 3Q5TA 5I8CA 1QRNE 5T1MB 3SE3C 4FQQA 4K8RH 3RZCA 2PYFA 5C0AB 3DI2B 5ALBH 1U0QA 5HHPB 3PHQB 4XVUC 5D7JB 4RDQG 1R0AH 4TULL 2BOBA 5EOTA 3PGCA 3V0WL 1DBKL 1NCDH 3Q6FA 1RK0B 2IQ9L 4U1LA 3U4AA 1DCLA 3BEWB 4XBPB 3L95A 5DJXA 5HVHC 3BESR 1SVZA 4G8IA 3ULUC 5EBWB 3UTZA 4OLWL 4WFGE 5E95B 3QUXB 3QUZC 1S78D 1DQLL 7CGTA 5D72L 1FFPA 1EUTA 4MLIA 4HWEL 1IC1A 1QBMH 2CR3A 4BQBA 4DN3H 2OQJB 4ZDHB 3O3BB 1P7HL 4PJGF 4XNXH 2P8PA 1ZHLB 3RBSA 2AJVL 5F97E 3WFCL 4IOIB 3EJYD 1VFBB 3BW9B 4KUZL 2DKSA 5IWLC 3QJFA 1XH3B 1NSNH 3BP7A 3I3DA 5TFSL 3HNSH 1CQKA 2BVYA 3BWUC 5E5MA 5DMGC 3QCVH 4WO4D 4WTZG 3TEUA 3EW3B 1UACH 2Z8RA 2VABB 1CE1H 2AJYL 3IAPA 5KVMC 4NQCB 4Q9QL 1PZUB 1LO3L 5JOFA 2FSEB 3AU1B 4QT5A 4K7PL 4X9IA 2VDOH 1HSAA 1MPAL 1QNZH 3VI4F 3NTCH 3MRBA 3MSPA 4ODSL 2QSVA 4ZXBD 2ZSWB 3BI9X 2QKIA 5SWZA 1ZVHA 5HHOA 5F7DB 3UP1A 3QNZB 4W81A 4NQVB 4DWHA 5CD5D 1NC4B 2YPKA 1M7IA 4HZLA 4L4TD 4R26L 4GG6E 3V0VA 1OOAA 3IKKA 4FNLL 1WZKA 1JZ8A 3WNKA 4CGTA 3NFNB 3MRGA 3S97C 4UQ2A 4RWYL 4LEOA 5IB5A 1KCSL 5DD3L 3M07A 5A1AA 3WL9A 2A73B 1W72H 2DIBA 2R4RL 2ADGA 2CK2A 1MIMH 1FN4A 1ODAA 1WFOA 2J8UB 3G5XB 2CGRL 2XTJD 4LSVL 4YHYC 2VDRL 1RK1A 1GXEA 4CJ0A 5JA8B 3IU3B 1T2XA 1QFHA 1PDKA 4OCWH 5C0CB 2D7PA 1GGCH 1IMHC 4NFDA 3FRUA 1M6OB 5EIQA 2X70A 2FBJH 4NM8L 3QUML 4X6DB 2VAAB 3GSNH 5FECA 3IRPX 3SGJC 2W9EL 3P77A 4M1DL 3GSUB 3WLBA 4JFDE 3RTQD 1F4HA 1LK2A 2VB5A 5TH2B 4KRNA 3BE1H 5KANI 4OB5H 4HEPG 5CEZE 2M26A 4O58L 2CRZA 1EXUA 4XPTH 4Y5XB 4IMLB 3SGEH 3GIVA 4LLVB 2DD8H 4WENB 3FQNB 4JGJA 4OJFH 4XXCA 2WWMD 4U4BA 1QUNA 1IRAY 2P5EA 1VCAA 3WN5C 4WCYH 1Q0XH 3OSKA 4UAOB 5C0GA 3VGHA 1R5VB 4F3FA 1CTNA 3G6DH 5FV1L 1DN0A 3BH8B 3I02A 5MI0C 3SE4A 3DECA 3ET9F 2HKFH 5BVJB 4JY5L 2QADB 3I3EA 3TBTA 4PRAB 4I77H 4NT6A 5K9JH 1RURL 4FQXB 3W0WD 3PV6A 3WBDA 1DP0A 3QPXH 1MHEB 1S5IL 1NCBH 3O6LH 1KIQB 4KC3B 1E6JL 3T65A 4MCZB 2VR4A 4NBYB 4XP5L 5I71B 2IFFL 2KBGA 1KOAA 1Q1JL 2VLKD 2UZIH 2CDFA 3X13A 5J6GA 4MJ6A 4D9LL 1T22B 1C16B 5JPNA 1DBAH 3VFTB 4ZNCD 1U91A 1RUMH 5AWNH 1NSNL 3T2NL 4BUGA 3DI3B 4ALAL 3AUVA 5JDSB 3KYKL 2CDGA 1RJLB 5FKPA 4Z7OF 5IJVB 4OZHA 2NX5A 1D6VL 4YQXH 2A6KB 1P4LA 4PY7B 1T6WA 4H26B 1G9NC 3JWOC 4OLUL 5LXGL 4NFBA 4PJIF 1IC5H 4AL8L 1JRHH 1AP2B 4HGWB 2PW1A 2LVEA 5I1AA 4WFFE 2NY0B 5L2JB 2VDNH 4JREB 3DUHA 4NBXB 3B2UC 1TZHB 4L3CB 4NNPL 1MRFL 2J3SA 3GSRA 1K4CB 4JRXD 4PJXF 3ZL4H 3L3DB 4CDGC 3S36X 2V5TA 4Y5YC 4G6KH 4X5WB 1FZOA 2E9IA 4U6YA 5GRZA 4E5XB 3VFOA 4RAVA 2JB5L 3NOIA 3TJEL 4LCYB 3RDTA 3MBEC 5ID0B 3AGVA 5C6TL 1FZKA 3R4DA 2YWYA 5JW3H 4LIQL 3NFPA 1BX2B 4KRLB 1CICD 4N1EA 2YUXA 4D2NA 4WRLA 2BNRD 5E24E 2Q7YA 3UBXI 2V2XB 4K7PY 2Q87A 2VSCA 4K94H 3FJTA 5FV2A 3DROA 2YPLE 4LPWA 4ZUSB 1B4JH 3MUZ1 4U1IB 3U7AA 3V5HB 3BP4A 3K74B 3KPSB 4OZFA 4HKZB 3B6SA 4NO2A 1JCKA 1MELA 1H3PL 3WKML 4S1SH 5GRWA 4KROB 5ISZA 3WJJA 4W4NA 4JFED 4GUPA 2KZWA 4S0SD 1T89C 1JHKH 3MR9B 1NCTA 4P5MB 1NMAH 4N1CA 4WU7A 1BFOA 4GBXB 1P2CA 3MQIA 2R4SH 1RZJL 4A6YH 1PYWB 2B1AH 2FX8H 4FTVE 4PRNB 2W91A 3C09C 4YDKL 1XF4B 3RBGA 4ZO9A 4OQTH 4Z0BL 3FQTB 3D18B 1X5ZA 4WW2F 1JI1A 4GKOA 2GJ6E 4QCIA 5IHUH 3VFWA 3SY0A 1JWMA 2BRRH 2GIYA 1HKFA 1SY6H 3NPSB 4OB5L 4BH7B 1AXSA 3UTTD 5HY9A 3R1GH 1H5BB 5D2LF 4LPCA 4AIZA 4YHZH 1DSFH 4F9PC 3HPLB 2SEBB 4OJFL 2JB6A 1BF2A 3W39A 2LU4A 5F8QC 1E27B 2X4UA 4C83B 2ZUSA 3G6DL 3ZE2F 1MRCL 1FNGB 1AGCB 2A9MH 4J3UA 1KGCE 3EHBC 5I8CB 1BQHA 2AS5M 1IARB 4FQQB 4WW1A 3NACL 4QYOB 5CJBA 1HE7A 4OBRA 2R2HA 4OFIA 1WWBX 3SDCA 1FPTH 4L8CB 4OUUA 2BOBB 5EOTB 1A6TB 3Q6FB 3QPXL 4K3DL 1A2YA 1N64H 2Y1VA 1NMBL 4Z7UF 3BHBA 3L95B 2ED9A 4G8IB 5I19H 1UEMA 1QVOB 1RHHA 2X4NA 4PB0L 4PREB 1OW0C 1FFPB 2F74A 3SO3C 2X09A 3ALXA 2COQA 1HH6B 1JBJA 5DJCA 1OAQH 2P8PB 3HS0B 2M8XA 3CFEA 1DLHA 5ACZA 1UADC 5IFHH 3B83A 4M7LT 3BP7B 4YQXL 2RQ8A 2WP3O 5K93A 4X80L 1QBLH 1MJ8H 1X6NA 5D1ZA 5IBUG 3KPRD 5CSZB 3I2CL 1JHTA 4WI9A 2Z31B 1MCLA 5HYSA 4LCWB 5F93C 3UPCA 2HLFD 3OF6A 4LKXA 4OCNC 1F02I 5I76A 1Q72H 3OKLA 4X6BA 2ADFL 5JOFB 5FUOL 4R0LA 4N0UA 1MCRA 1TZGH 4JFOA 5HDOA 1SHMA 1QACA 2J8OA 2OM5A 3RNKB 1T2JA 3MRBB 3HG1E 1R5IA 4PRPD 4PBWD 1JYVA 2QKIB 5TQ2L 5DQJA 1Z5LA 5HSFA 2UWEA 4XMPL 5EIVA 3KGRA 5TQ0H 4OM1L 4XTRC 5CJXC 3P0VH 4X7TB 1EERB 3SDXA 1J12A 4M62L 2JK5B 4LVNC 2XKUA 1F58L 4BELD 3IB4A 4OLVL 4NN6C 4PJHF 1MWAH 3MFGB 1B4JL 1QR4A 2JCCF 1H3UA 1IAII 1QFOA 4HS8L 4ONFL 5DS8A 3W2DH 4I3SL 3RWGB 2FECI 4YE4L 5MEOA 3HUJA 4Q9CA 4E42B 1XIWD 2AEQL 1JHKL 4PD4J 4RA0C 3BGMB 2ADGB 5DEFA 3I9GH 1KTRL 1OLZA 3VXRD 3K4DA 3EKCA 2OL3H 2YOCA 4DZBA 2R4SL 1BVKA 4PP2B 4NQDD 1A8JH 4U1JA 4TNVK 5DMYA 1A6WL 3BKMH 1INQB 1XMWA 2YSSB 3V79C 2YRZA 3VXNA 2FDBP 4OF0A 3FRUB 3NABH 5E2TH 3Q3GB 5IBLC 3RJDA 4LSTH 3V2AR 4XPHH 3C5ZA 4B7LA 4S1DC 3HN3A 3P77B 3ALWA 1PBYA 3K1KC 3U9PH 4UB0H 1UKSA 4PR5B 3FO0H 3PWLA 4DCQA 4KTDH 1BLNA 5EZJA 5IB3A 4MGXA 3B9KB 4YHZL 1DSFL 3OL2A 3WNPA 1EXUB 2FNBA 3N9GL 2P48B 5EOCL 1UKTA 2YD8A 4QWWC 1LO4H 2DQCH 3MV8A 2FX9H 2FJHB 1D6EA 1DQDH 1N6UA 4HWZA 3UJTH 1ZA6A 2X89D 4DFHA 2VWEE 4OFKA 2Z35B 1RUAL 3HNVL 3LQZA 5AG9A 4AM0B 3I02B 3MROA 1NCUA 5D7LA 4EI5A 5DJ0A 5BVPL 5IQ7H 1HDMB 4NZDA 3BQUD 5JNYB 4PJGE 3TT3H 4GAGH 1OGAD 1MI5E 4PGBB 4BSJA 3EO0A 4UT6H 1NAMB 3TFKA 3EAKA 4AK1A 5HHXL 1A3QA 1NMCB 2X4SB 4AMKH 1WVZA 2A0LC 2YA2A 5C0RH 5HHMB 15C8L 4WTXA 3SDDC 3N1FC 5CP3A 4HQQL 4CMMA 2F19H 4QHLB 2F5AH 2CDFB 1A5FL 1N4XH 5FKAA 3CD4A 5GGVL 5J6GB 1GJIA 2ATPA 4N9GB 1GYAA 1MCPH 4NOFA 3QCTH 2GSIA 4PGZA 1FFQA 4BM7A 3LEXA 1JL8A 4Q74A 3VI4E 4EXKA 1EO7A 2CDGB 3LS5H 3DX6A 4OSUH 2NX5B 5F9WC 3REVA 5IROC 3RL1B 1S7VA 4LP5A 5DJ6B 1MUJA 4NZUH 1UZ6F 4KJYA 3TO4A 4OF5A 3SQOH 4KMLB 4LCUB 2X1QA 1GGYA 5K9QI 1A7PL 1JE6A 3RHWK 2GAZA 2CRIA 5DC9B 4IS6A 3FO9B 3GEWB 4P46D 5CGMA 4HXAH 1UJ3C 3EOYG 5I8EA 4NUJA 3GMQB 2XQBH 5A40E 1G1YA 1CT8A 1TTUA 3LEVH 5H94A 1MCHA 3GSRB 3RGVC 3FFCE 1A7BA 4HKJB 1MHPL 5HXMA 5IUSA 2EH8H 3VA6A 3DPBA 1FZOB 4GW5A 3QDJE 3OJ2C 4U6YB 3Q5YA 3CVIL 3VFOB 2XN9E 2CLRB 5E4IA 2XFXA 4KKBC 1T83C 2GUOA 4GRWF 1A7OH 1C08A 5J06A 2H32A 5JIKA 1KENL 1XT5A 3U7WL 1QSFE 3SOBL 3S88H 1E28B 2VL5A 3NFPB 3PIQB 2X1OA 2V7HA 1I1CA 2GT9A 2DS4A 4RGNC 1K5NA 3ULUD 2VZ1A 1GZQA 4XC1H 3CDFA 3MRPA 4EVNA 4L4VA 3DX9A 4LHUD 3O2WH 3HZMA 3QUZD 3KLHC 2CRMA 1K3IA 3VW3H 4NQSB 1TJGH 2V5RA 4QOKD 2ZUYA 5BS0A 1Z3GL 2VXQH 4NO2B 4B41A 1EEQA 2NW2B 3I75A 3QZWG 5IF0B 3TNNA 4AG4H 3OQ3B 4Y16A 5IR1A 1J1OL 4RA3A 4G5ZL 3NCYP 3SKOB 2ZSVB 3CNKA 3I9GL 4GUPB 1W0WA 5IESH 2R8SH 1NBVH 4JR9H 4ONGL 5HHNA 1IGJB 4B5EA 4NJ9H 1NFIA 2XQYK 1BFOB 1WZLA 3MRQA 1U93A 2G75B 5DMGD 1P2CB 3WUWA 4MDJB 4XB8A 5CHNB 1WZ1H 4QRUB 3O4LD 2FGZA 3ROOB 1A7QH 3ARFB 3KYOA 3O6FC 4LSTL 3BKCH 4YGAB 4CN6A 5ACLA 3PABB 4LSPH 5FYKL 4M00A 1WV7T 3OKMA 2ZG2A 5IVZA 4EI6B 1JWMB 2V9QA 4L9DA 3P9MA 1I3RA 1VERA 3P4MB 2K9UA 4FZ8H 3BRFA 3RNQB 2EE3A 3MJ7A 4GRLC 2X4OA 1TTFA 3DTXB 3QIBA 1T1WA 1YEKL 4PG9B 4LIQE 3W39B 2B39A 4XP6H 3ALPA 3OBAA 4Q6IA 4WEBH 4MQ7A 3MOAL 3RU8L 5I74C 3BX7C 5C0FA 1WEJH 2Q6WA 3SJVE 2NY5C 2R2HB 4OUUB 4UT6L 1Y6KR 1EK3A 4MXVF 1I9IL 1U8OA 3X14B 4AMKL 1YPZA 3CLEL 1MFDL 4R90L 1D9KA 5CILH 5DI8A 3QIUA 4APQA 1RQ5A 4RISH 1RHHB 2X4NB 3BRDA 2FX7L 1W72A 5DO2C 4PJIE 3HRZA 3OGCB 5EUKA 3WDIA 4PJ5E 2A1WH 3DVNA 4FQ1H 1QQDB 1L8JA 5ICXA 2Z0BA 4WJ5A 3UX9B 4M7KH 3CFEB 3MCG1 5F70A 2J5LC 4NRXA 2DKUA 1L9NA 2W0FA 3SHSA 1GZPA 4N90D 3U83A 3O8XC 5C7XL 5FDWA 4BZYA 3MO1A 1BFVL 4NC1E 5BOZG 3O45A 2BSRB 4IRJB 4ODVL 1YNTA 1MIEH 1A6AB 8FABA 2APTA 3JV4B 1P4IL 4LAQH 3BGFC 1I7RB 3EYUL 4AENB 4HMEA 4KH2A 1MAML 1JYXA 1JGLL 5J89A 3BFOA 2FGWL 3GSOA 4EZMA 3QIWB 1RUQH 3OKLB 1OAZH 3NVQA 3GSWA 1EJ6A 4HXAL 3M1BA 3QXVA 3R0NA 4B53A 4JY4B 4JHAH 4JFOB 4I3GA 4ENEC 2PKDA 4TNWF 3AAZA 2HA1A 1R5IB 4M8QB 1HXMA 1KG0A 4D0DB 3TBSB 4ZQKA 3NN8A 4BSWA 4AH2A 3IFLL 1F4XH 1YQVL 5GS3A 1FL6A 1ZA3B 3X3FL 3ROLB 3NCJH 2IQAA 4ZUTA 5T3XL 5EU5A 5HDLA 4NKOA 1A47A 4MDIA 1ITBB 2KL6A 3UJJH 1M7DB 1EFQA 1EHAA 1RJZA 2WW8A 1N0XL 4XX1E 1IAKA 4FABH 2ERJB 1YN6B 2QQKL 3S96A 1PX4A 3ZYOA 1K85A 3VFVA 4FXGA 1I7TA 1CBVL 5E1AA 1RIUH 3HAEG 5CJQL 5AZEL 1OTUD 1ND0A 2A6DA 3BIBX 3NMEA 4QY8B 1PKQE 4JZOA 4TQEH 3IGAB 2HMIC 5MEOB 5LQBH 3DHMA 1X5LA 4PRIE 2JELL 5D9SB 3UJIL 3RVWD 4E41B 2XKSA 3QNYB 3TJHC 3GZKA 1RZ8A 5J11B 4X7SH 3VG0L 4FQCL 1S9VB 3NIFE 2FEEL 1B0RA 1BVKB 3RGHA 2X4TA 1CFNA 1BM3H 1WZ1L 5C08E 2DJSA 1IL1B 5HYJA 1C1EH 1QSEA 3BDYH 3BKCL 5T33H 2E7LE 4LSPL 1JP5A 3FOLA 1G7MA 1RU9H 3B2UD 5KS9A 1FNSH 1XGTA 4G7YH 4R2GB 4BZ1H 1NGZA 3HE6A 1C7SA 5BRZB 2B4CL 1EMTH 4MAYA 3S5LG 2C5DC 4KTEL 2N56A 2J4WL 4DCQB 5IJKA 3GO1H 3HC3L 3BT2H 2EDXA 3MFFA 4OZGB 5GISH 4YK4C 4Z7UE 1OY3B 2Y7QB 3MLZL 3RX5A 4PS4H 4XPGL 3VRLF 2I25N 4ZUVA 5ID1B 3C6SA 3MBED 2N4IA 4OD3L 4GMTH 1T03L 3PGFL 4HH9A 1N59A 1N8ZA 1EH9A 1CIUA 2CSPA 5D7LB 3RAJL 5DJ0B 4MS8C 3VFGH 2ILLA 5C2BH 4WNQA 1KN2H 1OQXA 1RZKH 1RIVH 4QRRD 3LHPH 1CD8A 3S3JA 1AY1L 1ZGLP 5L8KB 3HA0A 1G6RH 2AXGB 4RISL 4J3TA 2J6EA 5DMJB 3WNNA 2DQJL 4WUKL 1T0NB 2B2XH 1I8IA 3X3GL 4U1GB 4FQ1L 5FKAB 4Q97A 4N0CC 3PWNB 4LVOB 2Z92B 5LGJB 2FLRT 1A21A 2GSIB 4OCRL 5K9KA 1S7WA 1CU4H 1F90H 4A6YA 5DMIH 5CEXA 4K23H 1WQVT 5K9OA 1G0YR 5L0QC 5ADPH 1VADA 4HF5H 4KKNA 1HWHB 1TVBB 3BN9C 1RZFL 2VO5A 1BQLH 4QHKJ 3REVB 5EIIA 4GS7C 1J1PL 3O9WC 1MUJB 1RZIB 4U6VH 1MCNA 2EYTA 2F54B 2QHRL 4OUOA 5JHDA 1RUQL 2G9HB 5IOPA 4XC3H 4MAUL 2GAZB 2BY3A 2ESVD 1DQML 4IS6B 2IADB 4XAKE 2DAVA 2H3NA 2UYLA 2QHLA 3M8OL 1E6OH 5JMRA 1FORH 1SEQH 4PJHE 2ZCKH 2NY2D 2PYEA 3MV7D 4NCC2 3W9EB 3EHBD 4AEHL 1M71B 3ZTJG 1G0DA 5DHYB 2XY2A 2GUOB 1YJDC 2YUWA 4JKMA 2DQEL 4YDLB 3DGGB 1N2RA 2H1PH 4LAJH 3LRSA 3TBVB 4W70A 5AYUH 5JXEA 5CGYC 3UJJL 3CXHJ 3VXQB 3TVMB 2NY4C 2QQQA 4L4VB 1KNOA 4KZDL 1NC2B 3HZMB 3O6KH 4NGHL 3ZTNH 3O6MH 4YFDB 4BJLA 3LH2L 3RY6C 5I73C 1EPFA 5IT2L 1WAAF 1MHCB 3IXTA 1ES0A 1PFCA 4Y16B 5FA3A 1BOGA 3FTGA 2C26A 4C56B 3SE8H 5D2NA 1A22B 1KPVB 3RZCC 3GI9L 4KTYA 2GW5A 2JJSC 1I9JL 4NO3A 3ARGC 4L9LA 1FDLL 5F9OH 4OCSH 4Q0XH 3FB7A 4XNZB 4Y5VC 2EH7L 1HOCB 3M17B 4HH8A 4NSKA 3V5KB 1RU9L 5L6YL 3LQAC 2D7MA 4QXTB 1FNSL 3BH9A 1U8NA 3G6JA 5IMKB 1I1AB 2VRAA 3QR2A 4GW1A 4XNMA 5B3JE 1JZ3A 2YD3A 4EJ1C 2P5WE 3ULUH 2OTUA 4YBLC 3X11A 3D1MC 1JGUL 2HFEB 3MYJA 1OAKL 1LP9F 3BT2L 2Q7NA 3REWA 3T0EE 3FCTA 3MJ7B 1VB9A 4PS4L 2X4OB 4K3EH 3QIBB 2F8VA 4I18C 3QRFM 4HKXA 4LLUB 4XTRD 4Z95L 4HIXL 5TDOB 1JMXA 3IVKA 1HKLL 3UTSB 1QRNA 4MQ7B 3MUGB 4MJIE 3MRRB 1CDCA 4JQVA 5CIPH 1FVDB 2Q6WB 5FYJL 5B38A 2VDQH 4JPVH 5C2BL 3OXSA 5GRVL 5KVDL 3WE6A 1EJOH 4LQFH 3GMLA 5I1GH 1UA6L 4NRYA 3LHPL 4JLRA 4RIRA 1N6QH 3HMWL 4ZPTA 3PDDA 4R6UA 3QDME 1YPZB 1WCQA 3P9LA 4OKDA 3I6LE 1IEHA 3QDHA 4P3DA 5DRNB 2WP3T 3W9DA 1WZMA 3ZDZE 4R4FL 4UQ3B 1W72B 4JCMA 3HRZB 1UZ6E 3DRQA 3TGXA 4UT7H 2DLFL 1EUUA 4P5TD 3BAEL 5D93B 1HEZA 5DQ9B 3KYNA 2DM7A 4PJFB 4TVPD 4HFUL 4NKIH 5FYKE 4L8BA 5EORH 2IANE 2W0FB 4NNYA 3RWIB 5I1DB 5FDWB 1I1RA 4D9RD 3O45B 1TMCA 1YNTB 3EO9L 5IBLD 1ACYL 8FABB 1UEYA 5C09E 3ZE0F 3L3HA 4U6VL 4OFYD 1V3KA 4I9WD 3MLPA 4ZO7A 4S1DD 3GSNB 4RGOH 3GSOB 3TA3A 1LWRA 4NZRH 2NXZC 2F8OA 25C8H 1UH4A 3GSWB 2DDQL 4QF1B 3H9HA 4U1MB 4I3RL 5BJTA 5GGSA 1DVFB 5KSBE 4QWWD 3MXWH 1NBZA 1EDQA 3MLXL 3MOQA 4Y4FB 2YS4A 4OI9A 2VKWA 4PRDA 2BOCB 2ITDA 5FXCH 1Y18B 4XBEH 1KG0B 2C1PA 2HT3C 3B8YA 4MNQD 4RMTA 1IEAB 3CMOH 1UYWH 3FB6B 1ZT4A 4U7KA 4UU9A 4AH2B 3RWFB 4RFEB 4BSVB 3LDBC 5E7BA 3GMPA 1FL6B 4X83A 5F1SA 4P4KB 4GG6A 4NKDB 5HYQA 2IQAB 4WEMB 4ZUTB 4E0RA 1P4BL 5DSCA 5F3HB 3GI8H 2O5XL 4JZNB 5CP7A 4MDIB 1HNGA 1PX3A 3L7FB 2A0LD 1RJZB 4H0GA 1P1ZA 1I85A 3SDDD 5DWUH 3MCKA 3RWHA 4EIGB 1T3FA 1AGFA 1XCTA 1BWWA 3VFVB 2MTPA 1NGPH 4FXGB 5AD0B 3S3PA 3JTTA 3WD5L 2GY5A 5E1AB 2MHAA 5L2KD 4H25B 4XXCC 2AJZA 4ZTPL 7FABL 2EEDA 3K7UA 1C7TA 1ND0B 1XZ0A 4FN0A 4JZOB 4QHMB 2F15A 5ADOL 3CLFH 5CBEB 3HMXH 3U7YH 3SE4C 4PIRF 1QKZL 5KSVA 1RZ8B 1MCQA 1FG9C 1QLRA 2EE9A 3CU1A 2LFGA 4Q0XL 1MFAL 2X4TB 4XH2A 4QNPF 3S35X 3BO8B 3DVIA 5HYJB 4J23A 2J88L 3WNOA 4Z77B 4Y4HB 4X8JB 3L5XL 1G7MB 4G9FD 5DURD 5CSBA 1YNKH 2XZAH 4RGNE 5D2LB 4JFDA 3DV6B 4P48A 3W0WA 3GBLA 3VXSD 1HSBA 3RGVD 3NGBC 1I7ZA 3LPGA 5E6IB 3MFFB 4MXVE 5C6PB 4NFCA 4PRBA 5T3XE 4ZOCA 1MEXL 4KKBD 4OZ4B 1M05B 5DTFA 1YA5A 3C6SB 1Q9KA 5J1TC 5FHAL 4Y2DD 4MVBA 5FCUL 4YIQA 3TN0B 4HG4J 1N59B 1N8ZB 5INCA 3T1FA 4OCYH 3PG2A 4HC1H 2MNUA 3DV4A 1FYTE 3U4BL 5BMFL 2APXA 2ZCLH 3RPKA 4XWGH 4YJZL 3MMEA 4P2CG 4WNQB 3QB7C 1CS6A 2YD7A 4G6MH 1FBIH 1ULVA 4X6CB 5HVFB 1IAOA 3QUYD 3KLHD 3RVUD 3JWOH 5HBBA 1JF1A 3OB0H 5B3NA 4Q9RH 2IPTH 1F42A 4WY7H 4OZIB 2GJZB 3LRGA 3VXPA 2F53B 1KEGH 1PG7W 3AFLA 2X1PA 3VCLA 3MZTA 3OHXB 3LN9A 1TPXC 3CFDA 1I4FB 3TYFA 1PQZB 2EDEA 3P0YH 4YC2C 5BOPA 3MLSH 4OIAA 4YUEH 3ARTA 3RDTC 1MQKH 1QLFA 4MA7H 5TPWH 1AHWA 1GOFA 5JLZB 4UT9H 5F1OB 3L6FA 5K9KB 4ORGA 2EDYA 4A6YB 2B1HH 5K9OB 3NCFB 4R4BB 1VADB 4PTUA 3O6FD 4PRHB 1LO0H 4YXKH 4PJCA 3MRFA 4HUXB 2WBJA 4KWUA 2CKBH 4DW2H 1YNLL 5IW1A 4IJ3B 1JZ7A 3GJFK 3HLAB 4XP1H 4FQJH 5C1MB 3IDJA 3PL6C 4HFWA 3SDAA 5IOPB 3H2WA 3BIKB 2E6JA 2XWBB 4HDIA 1PEZA 3MJ9L 3QEQD 2MPAL 4LNVA 5DHVH 4RFNC 2H3NB 3PP4L 4RBPK 4G43A 3ES6A 1KELH 1TQBC 4DEPC 1JVKA 1CFSA 2CMRH 5DRXA 4YHOL 4XBEL 5ICZB 2OSLB 1N3NB 5CFHA 2VAJA 4F7PA 2NY7H 3CFKA 4FP8L 4H1LH 2XG4A 3QG7H 3EOBA 1IKNA 5D1QA 5EB9A 3CDCA 4LSSL 2OBGA 4WDIB 2PO6C 3C6LB 4K07A 1JNJA 1QEWA 1N2RB 3EYSH 4ELME 4AEIL 3IDXL 4JDVA 2C7UB 2VITB 2YPLA 4XAWH 1A1NB 4ZAKA 2WUBH 2MQ0A 3ARDC 5DZOA 1UQSA 5EUOF 4PJBF 3RRQA 1HHGA 5DO2D 3A6CH 1AO7D 1X4XA 4DKEL 3F5WB 3ZMRA 3QYCA 1BZ9A 5EU7C 3LN4A 1MLCA 4O2CB 1A7RH 4IRSA 2A9NL 4QO1A 1ES0B 3KXFD 3CLFL 2P8LA 3HMXL 5SX5H 2VJXA 3QPQC 2HFTA 1BOGB 3FTGB 3F8UB 5I2IA 3O8XD 4NWUH 1EA9C 4G8FA 1RHFA 1EAPA 3V6ZA 3P4OA 2DIJA 2IBZY 4LGSB 3SDCC 1YEFL 2X4RA 4L9LB 4FTVA 5I8OH 4FHBD 1Y6NR 3RUGE 3N06B 1J0IA 4KVNL 1A9EA 3U82B 2AJ3A 5I1JL 4DK3A 3VRLE 2A2QT 3V6OE 2FJFA 4HIEA 3RVTC 3IF1A 3MBXH 2DBJA 2GJ6A 4HPOL 4YGVA 3BH9B 2H8PA 4WTZA 3WLWD 3FHQA 3QWRD 4KKAD 5M7QA 1P6AB 4Y1AE 3HI1A 4GW1B 3DXAD 3QQ4B 5T5FH 4ENED 3G5ZA 4X9HA 1KPUA 4NIKB 1S7QA 1L6ZA 4JG1H 3TT1L 2AXFA 3TYGL 3D3VE 4ZD3L 3VXMD 3MNWB 1CL7L 2EDLA 3ORJA 4GRMA 4OI7A 4ZSOE 5ETUA 5I6XB 5EU6E 4F37F 1XR8A 3RA7H 4ETQA 3DUSA 5D1ZC 4ACPA 3U0TA 1QRNB 1H0DB 1AQDB 1IQDA 2Q8BL 3GMNA 1PEWA 3EOTL 3L1OL 2VZVA 4XWGL 3UTQA 2WIMA 4Y1AD 4YHNA 3WE6B 4KK9C 3GMLB 4PGCB 5C07D 5C0BE 2YEZA 3UBXA 4RMSA 1MWAB 4GSDH 2IPTL 4RIRB 4WHTA 4R0LC 1V3LA 3AM8A 3MCLH 4ZPTB 1F45A 4J1UB 4WO4B 4PP8C 4AQOA 2CD0A 1OAXH 4Z5RA 4QHKI 2HMID 1ZHBB 4HCRA 4HS6A 1IM9A 4J3VA 4ZYKB 4PJ8A 2AKRA 1UVQA 3TJHD 4ORZC 5HYEA 3MLWL 2R0LH 1FIGL 1MQKL 1GC1C 5TPWL 1UXWB 3KYNB 4U1SB 4PJDF 2OL3B 3DNKA 4ZXBB 4L8BB 5TDNB 2GTWA 4NNYB 3OKOA 4YXKL 3QUKA 1MCOL 1MJJA 3RWCA 4Y19E 3GJFA 4QRSB 3L3HB 5E08L 2WQRA 3N1PC 5HHQB 4U2YA 4O51A 1EGJL 5FM4A 2FIRT 5ANME 2HRPL 5SWSE 3EFDH 3R8QA 3P9WB 3QHZL 2AK1H 4IRZH 5FM8A 3X17A 4UIMB 4IMKA 4JFQA 3HG1A 5FYJE 4U0RC 2BFVL 4LDEB 3UAJC 3EYQC 4DK6A 4CU6A 3H7BA 3DBXB 4JFYB 2AV1A 2NY7L 2BHYA 5EC2B 1FO0A 1QZ1A 4LSRH 5MP6H 4DN4L 4JAMB 4OGXH 4Z0XA 1XIWA 3PWPD 4MS8D 1ZT4B 1CFVL 3A6BH 4KVCH 5MENE 4KQ4H 1WAAE 2G2RA 1QBBA 3GMPB 5J9PB 3C5ZC 1QO3A 2D7TL 4NP4H 4TVPH 5HYQB 4E0RB 3WIHH 1CE6A 2BHUA 5IP4A 5C8JB 4HX1B 4XAWL 4KXZI 5BV7L 2IBGA 4OF3A 4ZTOH 3HRPA 3NZ8B 1DBJH 3D69A 4KPHH 1P1ZB 3MCKB 1ZVYA 1DE4A 2DI7A 4N0CD 5DD6B 5GGRA 1ADQL 3U0PA 3RTQB 4OM0H 2EECA 4CW1A 3W11C 5ENWB 4EI5C 4WWID 4PP1C 5CJ8A 1NLBL 2GCYA 5B4MC 2GK0B 2H6PA 1JPGB 3LOWA 3T3ME 4C59B 1QLRB 3WIIH 4TRPH 3BN9D 1LP9E 3DX8B 3PWJA 1KJ2H 3EOAA 3AREA 3O9WD 4XH2B 1SJXA 3KPSD 4D9QE 4FMFA 1FL5A 2WMPA 5KBNC 1KB5L 1DANU 4Z8FL 3QDGE 1F8TL 4X9FA 2OZ4L 5JQ6L 3SDYH 4EQ2A 3KWWA 1R3LA 1SJEA 2HVJA 5ELIA 2CIIB 5EZOH 5CAYB 1QA9A 2DJUA 3EZJB 2AK4D 1TDQA 3W0WB 3VFUA 4GBXD 3N1GC 1HSBB 4HUMB 3UPRB 4UDUA 1JNLH 1SEBB 2XZQL 4PFEA 2ZUXA 1LO5A 4ZFFA 3MV9E 3CVHA 3E3QE 4K9EC 4PRBB 4UV7L 3Q2CA 4JQXA 1NCCL 1A3RH 1AR1C 4MA8H 1Q9KB 2P42B 4NN7B 4I4WA 3P3YA 5KVEL 3TO4C 1J10A 2C1OB 3MJ8A 4PJGA 4ZO6A 5CGYD 1MI5A 3IJHA 4JB9H 4QHUA 2NY4D 2D7NA 2LV4A 1IAOB 1JF1B 4DGVL 4J4PA 1VKXA 1OAXL 1C5DB 4GG8A 4Q2ZA 2DBLH 5EU4A 1Q9OB 1AGDA 3VCLB 5E9DD 3ZE0E 2FR4B 3CFDB 3GRWH 3TYFB 3QXUA 3RZCD 3F7QA 5I1IL 4OTXL 4F57H 4PV9B 4OLEA 5FO9A 4UOW0 4JRXB 3QUMA 3KAAA 3FL7A 5CKGA 4LSQH 3H9SE 5I1LA 3L6FB 4IDLA 5HYIA 1MREH 4JM2C 5HDQH 3KNBA 3GMRA 4M3KB 1XR9B 3NFSH 4PTUB 3UC0H 3WFEH 4PJCB 4JKKA 2ZOKB 1ZKAA 4RFOH 1OP3H 3U6RA 1IC4H 1FVCA 2GTZA 2VXTH 1VEOA 1J1XL 2DM4A 3RY5A 5IW1B 4YXHH 5CKAA 2OK0L 1CICB 3EFDL 3SDAB 2QJDA 2BNRB 5IVXB 3SCMA 4LEXH 2I60L 2D7OA 1CGYA 1KC5H 3FFCA 5ABDE 3H9SD 2CK0H 4MA3B 2V6HA 3ULVF 2IPKA 4P4RA 5DRXB 4YX2L 3TH4T 2E7CA 3QDJA 5BW7C 4OD1L 2XN9A 1TCRA 4F7PB 1UM5H 1TXKA 3CFKB 4C58B 3GJEA 5HGHA 1YMME 2RCSH 3EOBB 1NBQA 1SBBA 3HPJB 2FD6H 4FQLL 4JFEB 5CIPA 3WFDH 5ITFA 1QSFA 1I9RH 5DK3A 3G08A 5IFAH 5DRZA 3V4PH 1VA9A 3OZ9H 4WV1B 4UUJA 3WIHL 1KIPA 4HLJA 4L5FH 1JNHB 5H2BB 2AJXH 1IBGH 3O41A 4ZAKB 2XKNA 4LF3A 1AC0A 5SX4I 1UQSB 3W81A 2EO9A 4M6OH 5SWZD 4PJAB 2C4FU 4FQHB 2OI9B 5HHOD 3OB0K 4OGZA 3PWUB 4KJWC 5BQ7B 1BZ9B 5E03A 3VXOA 5IKCB 4Q6IC 4IRSB 3QNXA 2P8LB 2HN7A 5TF0A 3WV0A 3UTTB 2ZWLT 4G3YL 5I2IB 1JF6A 2WM0A 3FZUC 5CEYB 1EAPB 3KVQA 3SKMA 5IHZB 1AIFA 5FHBL 3V6ZB 3P4OB 3GBNH 1R3KA 5E56A 4HHAA 5E99H 1GOHA 4WI2A 2ZPKH 1OP5K 1JFQL 4DKFL 1FCGA 4NWTH 4KK5D 4X99A 2VXUH 4FFZH 1D9KC 4XGZA 2NXZD 1CLZL 3QIUC 4TUKL 2FJFB 2D4FA 4HIEB 2NY5H 3MOBL 4WHYG 4APQC 1L7IL 1KJ3L 1OAUL 3ZKXC 3U46A 3BP5B 4PBXA 4CBPA 1CL7I 4NYLA 2VIRA 2YD9A 3MRJB 4NC0B 1YEGL 3ULVL 3GNMH 2Q86B 3HZVA 4O5LL 5H35A 5DUPH 3B3IA 1JNLL 1UWEH 4UDTA 1DQQA 1TQCB 2VH5H 1KPUB 1CXFA 4NKMB 2HT3D 1EO8H 2FZ3A 3VFMB 4HZAA 3F58H 1A14H 1U8MA 2GI7A 2DIAA 1NGYA 1U3ZA 4GRMB 2BC4A 4IHOA 5ETUB 4P9HL 4RQQA 3FN0H 3QA3A 5DJ2B 1T20A 5EDXA 5EU3B 5TE4H 1A1OA 2CIKB 1KV3A 4BYHA 5A16B 3SJVA 3IFOA 4LLYB 3CFCH 2WLZA 5HTSA 1UWXH 3I84A 3BWAA 3WCYA 2O61A 4GQ9L 2RAMA 2IJ0C 3MRKB 4LCIH 3UBXB 4U1KA 5FOBA 3K46A 3GK8H 4WI4A 4WHTB 3QCUL 1QOKA 1J0JA 4M7JH 3O81A 2BNUA 4HBCL 3SGJA 2P5ED 1A6UL 4PJIA 3L3GB 4POZC 4NM4L 4CMHC 1YEEH 3GKZA 2ICWB 4PJ5A 3MACL 1B90A 1WLHA 3RWEA 3GSQB 1XGYL 4HSQA 1ZEAL 5JR1H 4PTTA 4G80A 4TSAH 4WVRA 5C0JA 1M1SA 5L88L 1D7FA 3V6BR 3WN5A 4BFIA 5I18H 3V4UH 3LKNB 4ZG1A 5HDQL 4PRPB 1BD2E 5J7CC 2RGSA 1OP9A 4RFOL 5JIPA 3RWCB 2ATKA 3WS3A 3R8BB 2NY3C 3PNWA 4YXHL 3H0TA 1NCAL 2IBBA 5F9JA 5IQ9A 5E70A 4O51B 4BH8B 3D9AH 2UUDH 2NNAB 5IBTL 5CLWA 2WWKT 5I9QC 1FNHA 1CDUA 3MUJA 3U30C 1Q94B 4NHCH 5FB8A 1UKQA 2HH0L 1KTDB 2X4QB 5JPMA 4JFQB 3HG1B 2NX5D 3AXLB 3WO4C 1G9EA 3QEUA 5EUOE 2QSTA 2OMNA 4BZ2L 1CZ8L 4NQEE 3FO1B 4HIJA 4P2QE 1GGIL 3L9RA 4F7MA 2AV1B 3IDYC 1FO0B 5I30L 1LQVA 3O2DH 3HNTH 5CBAA 1XIWB 1UB6B 1S7TB 3LAFA 1KCVH 4N0FB 1BAFL 5JA9A 2G2RB 4HC1A 3OZ9L 5E8OA 1RAMA 4JFFE 3C9NA 5T1DH 3VXRB 3BZFA 5E0QA 1QO3B 1S9WA 3HE6C 4H8WC 1XF3B 4XHQA 1CE6B 1JUFA 4XCYA 2CR6A 4MAYC 3ZKMC 2R0ZH 5TGBA 3X12B 4I48A 2DQUH 1YN7B 9CGTA 3TO2A 4S11A 5GGQH 2VTFA 2DB8A 4QRPE 1G6RB 4NC2B 1N7MH 4P0DA 4IM8A 1MVUB 3EGSB 1X4YA 2X41A 1DE4B 2FATL 1PKQA 3F12A 5DRWA 2Y5TA 1RUKH 3TV3H 3RDTD 2X42A 4PRIA 3VGEA 2ARJA 2DQTH 4CW1B 5JW5B 3CPLB 2F5BH 3BPOB 2J8UF 2ZG1A 4XNYL 5LBSL 1E4WL 3GBNL 2DQHL 2H6PB 2ICES 5FO7B 4QRTA 5C08A 4NWTL 2BVOA 2VXUL 3AREB 3ERYA 4XVSH 3V52H 4MMZC 4Y0GA 2E7LA 3PL6D 3RQ3A 2E27L 2OP4H 3BQUB 5ISZD 4X6DF 5CD3A 3KWWB 2NY1C 1R3LB 2HVJB 1OGAB 5DUPL 1QA9B 5E4EB 5L8LB 4UMGA 4JRYE 5DJZB 4ZOBA 3U9UB 2RFXB 2DTMH 2HWZH 3RX7A 5EU7E 4Z7UA 1S3KH 3CVHB 3VE0A 5F88A 5C0EA 1GVIA 1T89A 5DD0L 5GIRA 3PGDA 3FAXA 3GHEH 5DJYA 3I6KA 2NCMA 1B0WA 4WI8A 2H26B 2HVKB 5CJOH 5GSRB 2XG5A 4G9DA 3QXAA 1J8HE 5T3ZL 4MWFB 5ESAA 3WHXB 4XP9H 1MI5B 3EYFB 4PJDE 3DYMA 1CR9H 3LSOB 5JUEL 4M03A 1I7UA 4PD4K 2JJUA 2F58H 2ZCHH 1FSKC 5E94A 5JW4Q 1WGOA 2YMXL 4GG8B 4F15C 4CVUA 4O2EB 3TCLA 4NQXA 3OG6B 3G04B 3GMMB 3ILQC 3PF2A 3HI6H 4MXWH 1AGDB 5F1IA 1RJYA 1YEEL 3QEHB 2EEBA 3QPQD 4WI3A 1HHHB 1I8LA 3HZYA 1ED3A 2KZ1B 2G5BA 4P46B 3UYOD 4XNQA 3S36L 4F9PA 4KQ3L 2YD4A 1Z9MA 5GZOC 3SDCD 1R24B 3QZWA 4PGEA 1VACA 1OF2A 1J8HD 3GDBA 3V4UL 4DUWA 1R3HA 3Q1SH 2ZJSL 3WSQL 3OR6A 4PDCE 5I1LB 2ICEA 5HI4D 1GPOL 4JVUA 5EOQH 1O7VA 4JFXB 3WHE0 3RVTD 3EYVB 3P4NA 1OL0A 4ISVB 1NFDB 1IQWL 3EIFA 5E00A 2Y9RT 4AZ8A 5B21A 1BFTA 2GTZB 3T2OA 3LKPA 1HYSC 1KIUA 3C5SB 1KN4L 1J0HA 3JSSA 4LLQA 5KSAA 2AI0H 5HVHB 2JE8A 3BKJH 1W0VA 5D2NC 3IDNA 4LHUB 3D25B 3FT3B 1FNEA 3QUZB 1JNNH 4PJHA 1JJUA 1G7QA 1OW0A 3ZKNC 1VEMA 2IPKB 2YXFA 4JKPH 4DTGL 1JHLH 5D1ZD 3IDMA 4DAGH 3O2DL 2FH8A 1WUNT 2D2OA 3GJEB 4MNGE 3OF6D 4R96B 5ITFB 5CIPB 3QULA 4KK9D 2VLME 3V5DB 1MCBA 3G08B 3K8MA 4FA8A 4IIQA 5EBGA 4N1HB 3NA9H 3TIDB 2P44B 2G60L 1EVUA 2I9TA 2D03L 2Z9TA 4KXZH 4NQUA 3O41B 2EDTA 3LQAH 3MRNB 4LF3B 4JN1L 1N7ML 3O4LB 3OWEA 5CINL 1EIBA 2FYYA 3KPNA 5FK9A 5BZWA 4HUUA 2DF3A 2EDQA 2PCPB 4JVWA 4UOJA 1L0YA 3MLYL 3BSZL 2J7LA 1RIHH 2HN7B 1LEIA 3BYYA 1VGKA 1JIBA 4JQVC 2ORBL 1I75A 4FFWD 1EEUA 1U8HA 1JV5B 3UTOA 1F11A 3DO3A 4PJ7B 5LJYH 1CVRA 3GFUA 2VLJE 1W8NA 3CMGA 4LGPB 4LU5H 3H6JA 2AGJH 4G6JL 2MCPH 2OJZL 2VQUA 3IXAA 1EAJA 5ERWA 4MD0A 4XCCH 2I5YL 4NYLB 2P5WA 5C70A 1SYVA 3EFFA 5H35B 3HKFA 2ZUQC 3LKQB 3RFZC 3B3IB 4K3GA 3T0EA 1E4KC 2DMCA 3EYQD 43CAB 3PP3H 3ULSA 2FZ3B 2VDKH 4LHQB 4YO0A 3IU4H 2KQMA 4P59H 1ZT1A 1NGYB 4YZFF 2BC4B 4IHOB 1C5BH 1JI2A 1T20B 3QWQB 4H5SA 4MJIA 3C5ZD 3FAWA 1QFUL 1U8LA 5F9DC 4Z7QF 1KBGH 1RUPH 1FH5H 2P8MB 4YHYB 3TA3C 4XP9L 5I8KH 4FS0A 5EBLB 4HS3B 5AZ2H 4LK4A 1FJ1A 3RZWA 4U1KB 5FOBB 1PSKH 2QSCH 3PHOA 3QDMA 3MV8D 2IMMA 4LFHG 2XZZA 2NZ9C 1D5ZB 4LSDA 2EDFA 1K4DB 2PXYC 3V7AG 3ZZ1A 1PJ9A 1NEZA 1CGWA 3W11D 3MLRL 5E5RB 4EI5D 2A83A 3KJ6L 2D0HA 4PP1D 4PJ5B 2RHEA 1DFBH 4TUOB 3F6LA 4I0KA 5B4MD 3RWEB 3GSVB 4WI6A 4PTTB 5D5MB 2YPVH 4JO4L 1HCFX 2PF6A 3R0MA 3FQRA 3Q1SL 5C0JB 1KCUH 2IANA 2I9LA 3WN5B 1V05A 5E8PB 5DK2A 3TFKD 5IW6A 5KOMC 5GSVA 4HAGA 5MI0B 3ULVE 5C09A 4HPYH 1H15B 4S1QH 5C6WH 3SE9H 4HXBH 1I85C 2PW2A 4ERSL 2KPNA 3TPUE 4TNWK 4G42A 3PNWB 4RMVA 3H0TB 2EIEA 2EYSB 3EDDA 1HXYB 5F9JB 5I1EH 4TTGA 1H3XA 1OWRM 3FT2A 4GOSA 4DGYL 5ICYA 5KSBA 1KLUB 1MY5A 1YC7A 5E8EA 2W38A 1K8IB 3SDDA 1J05A 5D7KE 1H8SA 1WBXB 2EZ0C 3EDKA 2QEJA 4JKPL 3S5LA 5JPMB 4TVSa 2Z4QA 1AR1D 4FFYH 4UTBL 5HGBA 4WFED 4LLMA 4MD5A 1P7QA 3TZVC 4XNUL 3A0OA 3TO4D 4TSCL 3LKSA 2B0SH 2BX5A 3ZDXF 1KIRB 5HGAB 3UPAA 1KCKA 3C9NB 1S9WB 1T5XB 5IROA 4N5EC 1ZS8B 1JUFB 1I9EA 1F4WH 1KCLA 2NTFB 1K2DA 2WBKA 2FB4H 1IGFL 3VG9C 5SX4H 5IIEB 4LP4A 3OPZH 1WT5A 4KKLC 4LSUH 3CDGB 3GIZH 4HK0B 2JF1A 5EO1A 3O3AB 1UJ3A 2BY0A 1SJHA 3BVNB 1TENA 5DRWB 4F7EA 4XCEA 3QO0A 1RIHL 2QBWA 4FOMA 3S34H 3E2HA 2AJSL 3EJJX 1VDGA 4XMLH 4Y5YB 3IS1X 2R9HD 1DANT 5E2VL 4O02H 5CCKH 3H3KA 4YWGH 5C08B 1LD9B 1T83A 2EKJA 1JZ5A 3KYAA 3JBG7 4GQPH 5TJWK 3ARWA 1HHJA 3MBEB 3LKRB 4ZFOB 2CKBB 5BS0D 2A6JA 4G8GE 4J3WA 4Y16D 3ARBA 2CUMA 4HEME 2IAMA 5C0AE 4KMTL 4RX4A 4QRRB 2FHCA 4H20L 2UUDK 1HHKA 4DQOH 1D5IL 5C0DA 1AHWC 2BMKA 4JRWA 4M7ZC 2YK1L 1KLFA 4LBEB 4Q58C 1BPVA 1MCCA 4M5ZH 5F7EL 2FHFA 1QFWH 5GS0C 4H1LB 1CXIA 1JPSH 2VNCA 1IGML 4X5LA 3VD3A 4LLDA 2WBJC 3LEYH 4V2BA 2Z8SA 1QYGL 3BD3A 1FYTA 2BDNH 5C3TA 5F3BA 1DN2A 3E6HB 5C3LD 4RZCB 5D1XA 4Z7VB 2JJVA 1FRGL 3C09B 4K2UH 3GMOA 3WXWL 1DLFH 5KJRH 1PSKL 3INUH 3MA7A 3O6FA 3WFHB 3NH7L 3T8XA 3QIBD 3UYRL 4CJ1A 4KJWD 4OZFH 2GJJA 1IT9H 1CGSH 2R2EB 3L3IB 3QAZC 3BMVA 3DVGA 4U6TA 1AD9A 5E1HB 1A6ZA 1RJYB 4P3CL 4M1GH 2ESVB 2CO6B 1ED3B 5DJAB 5D1QC 3FZUD 4GRLA 4UINH 4HKBB 1OTTC 3QFJE 4NQCE 3GKWH 3SKJH 1VACB 4KRPC 5CZVL 4HIHB 1WITA 5LCVL 1R3HB 3JV0A 3MV7B 3D87B 1D9KD 3N1MC 3QIUD 4HJJH 3S4SB 4APQD 3GBML 4OZHF 6FABH 1TITA 2O5ZL 4ZPVB 2W07A 4JHWL 1AE6H 3FOMB 5CUSL 3EDFA 2R29H 1CD1A 2IG2L 1FHGA 4ODTL 4PLJC 3QFJD 5C9KA 1DQJA 3FQUB 1W0VB 1TIUA 4LCCA 1RVFL 2ADIB 4FFYL 1OSPH 3OAZK 5JORA 3SO3B 5T3ZE 4ELKB 1ZANL 4ZFGH 1NJ9A 4N8VA 5GRVK 5E2WH 3WXVL 1S9YB 4HWUA 1CXEA 1NDMB 4QTIL 2C4FT 4M5YL 3KLAB 4XB7A 5J13C 1NAML 3CFJA 3RIAK 3SPVA 4UTAH 1UH3A 3F7RA 4ELMA 3HFML 1OQOA 3M45A 1T1XB 3K8KA 4O9HL 4M7LL 4YHML 1U42A 4N5UA 4R8WH 4M6NH 3ETBF 1S8DA 1EZVY 5HJ3A 1G7IA 4LVHC 5IV2B 3GIZL 4POZD 1T5WA 3NAAH 4X4YB 1NGXA 1L6XA 4MCYA 3D39E 5C0CE 4PJ9A 1A0QH 5FK9B 2VDPL 2EIBA 3QWRA 5BZWB 3S34L 4UIKL 1OB1A 1TJHH 3H9YA 1DL7L 4X6DE 4XMLL 4RMUA 1NGWA 1LEIB 1A64A 1VGKB 2Y4SA 2VXSH 3PDOB 2LE9A 3RIFK 1INDL 1U8HB 4LARH 4OT1L 2XWJB 2O5YH 1F11B 3AC0A 1IFHH 5EO9B 3RUGA 2XY1A 2BCKA 2DQDH 4JFHE 1I1FB 1OHQA 1V3MA 4I8DA 5D7SH 2NY3D 4XCNA 1B0GA 3A67H 3AM8C 3P11L 3V6OA 1V7MH 1HINL 4JE4B 1XF2B 4LVNB 3HZKA 4QXUH 3U4EA 2W9DH 3DETC 3IXAB 5EA0H 3D39D 5ERWB 4EDWH 35C8L 4PJ8C 4Y1AA 2GSGB 3ZSSA 4NN6B 1OVZA 1UC6A 1WF5A 4R7DA 3UO1L 2HLAB 3EFFB 5KAQF 3Q48A 5MHSE 5EZLB 3ULSB 5ILTL 2N7AA 4NNXA 2GKIA 3D3VA 3T08A 5DT1H 1QFWL 1QSED 4ZSOA 1JPSL 4MJ5A 5EU6A 1JGDB 5AAMA 4D3CH 1GC1H 3B8SA 3CXHK 3CC5A 1PVHA 2P24A 4H5SB 2YD2A 3OX8A 3H42L 2BDNL 4K55A 3HE6D 3OKDB 1D5BB 5J6HB 3ZKMD 4MAYD 4CUCA 2I07B 4K2UL 4L1HA 4PJEB 4W4OA 5C0BA 3INUL 2R15A 1FJ1B 3QHFL 2C3XA 3PHOB 4XCFH 3JTSA 4HK3N 1BBDH 3HI5H 5I17B 1JN6A 5I1KH 3PQYE 1AJ7L 1U6AH 4JEGB 1FGVL 4OAWA 1HQ4A 1NEZB 4I0PA 3VXTA 5CZKA 3NCEB 5E2JA 5TF1H 2VDLH 1T7VA 3VD9A 2X1XR 2QQNH 1MF2L 1JZ4A 2KQNA 3C8DA 4KI5F 4ZODA 2IANB 3FB8A 3KPQA 2I9LB 3MGOA 5DK2B 1KJ2B 5IW6B 2DYPA 2NR6C 5KN5A 4HJJL 4CNIA 1U8QB 4Y19A 4M61A 4ZO8A 4MNQB 6FABL 2MOVA 1UWGH 1AD0B 2HT4C 5IEHA 2PW2B 5DGRA 5KZCD 1AE6L 1UCBH 5ALCH 1TETH 3FB5B 1A6VL 3C08L 5ANMA 4YDVB 2R29L 5SWSA 4ODWB 1BMGA 1QR1B 4XXDA 3FT2B 3C60C 4JQIL 4FXKA 5KSBB 1GAFH 1T0MA 2X2YA 2WINB 4U2ZA 3U36A 5IB2A 1MNUL 3SDDB 5F89A 1HIMH 2VUYA 2OR9H 4M6ML 1YYLL 3PP3K 5L2KB 1AC6A 4N0CA 4MD5B 2HJLA 4FQIH 5E2WL 1Z9SA 5MENA 2IH1B 5T1LA 3O0RH 4YHKH 1WAAA 5JHDD 3BDBA 3QG6A 3UEZA 4EKXA 4Z7WE 2HTKD 2DMBA 5ITBH 2HFFA 5F9WB 1PZ5A 1S9XA 3OR7B 3SDXF 5E6YA 4HV8B 1CK0L 3ARVA 4OD2B 2HKHL 4JFPA 2PYED 3V4VL 3ILQD 1C8PA 2Y23A 1TZIA 4X6EA 1IGIH 2BNQE 4JO2H 4G9FB 5DURB 1DDHB 1UJ3B 1FE8H 1QPXA 1SJHB 2VWEC 4JQXC 4YR6B 2BK8A 1QD0A 4U3XA 5GZOD 4P9MH 1LNUA 1HK6A 3S37X 5D8JL 1OT1A 3VXSB 3RGVB 4P23A 1L7TL 4JPWL 2EYRB 1RI8A 2O5YL 3I85A 4JO3L 4ODHL 5JXED 1QPPA 1LP9A 2WIIA 2XT1B 4V3EB 3QP3A 3WHE1 4HIIA 2IGFL 1OT2A 3FONA 1Q0YL 3TBWB 1D5MB 5SV3A 5FYLL 3BDXA 1HHJB 3R06A 5KVFH 3KS0H 4J4PC 5MEPB 1YDPA 1HYSD 1KT2B 3QDGA 3MRDB 5FA4B 1G7PB 4NZTH 4JM4H 2BVEA 4RGNB 1CTOA 2MCG1 4YHPA 5B8CA 3G9VA 3D0LA 3VGDA 1NUGA 3IJSB 3B9DA 1VFAA 3ZKND 1ZGLA 5HI5C 3MV9A 3KPOA 4LHJB 5DQDL 3E3QA 5DR5H 4MXQA 4ONHB 1BJ1J 1CFQA 5IFJA 4K3JH 4F58L 4OZGF 4F7TB 4KGLA 2OTPA 4MHHG 4JCLA 2D0FA 1HQRA 4LDLB 3TP4A 2X44D 1TNMA 4X5XA 3ZDYF 2JJSA 4XBGB 5EC1A 1NANH 2H32H 2A74A 3HCVB 4LLDB 1GHFL 3ARGA 1XF1A 4XVTH 2R2BA 4PLNC 3WDJA 2VLLA 1QFWM 4FG6C 5JMOC 4Y5VA 3JWDL 4JG0H 1LEKA 3SCMC 3O6FB 4XCFL 1G7HB 5HVWA 3T8XB 3GM8A 3L5JA 5E8DH 5JHLH 4ZFZA 2UY7A 5I75C 3F7YB 5T1KA 1QRND 3BEVA 1AD9B 1A6ZB 3LS4L 5TF1L 4CU8A 5KAQG 4LCWE 3QEQB 4UILH 4GRLB 4JGUA 5GJSH 3MXVH 1FLRH 4I18A 2X10A 3DJ9A 3H9SA 2ZKHL 1NAKH 1EFXA 4TSBL 1U8PB 1HWGB 5E2UL 5BZDB 4EBQH 3MODH 1PG7H 5I74B 5IK3A 4WFGD 1BEYL 3RWJA 5HGGS 1UWGL 2DKMA 5JO5B 2ED8A 4F33B 1CGVA 3O11A 4P2YA 1FL3A 4WU5A 4OGYH 1T1ZA 1RY7B 1OTSC 3CK0H 1AXTH 3A6OA 3RPIA 5EWIH 4L8SC 4KAQH 5EZIL 4HLZH 1CD1B 4DGIH 3CUPA 2EKSA 3IJYA 4R3SA 3U0WH 2OR9L 3MX0A 4HG4K 2CJUH 3K81A 4HW6A 4MD4A 2Z8WC 3PV7A 5D6CB 1AO7B 1E4XL 1YECL 2E9WA 2NMSA 4HJGA 2WUCH 1UZ8A 2HG5A 3OTTA 5DD1L 3IKCB 1YMMA 3O0RL 4YHKL 1EBPA 4N8VB 3KXFB 4LRNH 3TA3D 3GUTB 2J5LB 3C2AL 4CVWA 1OCWH 3WIFA 2Y6SD 3O8XB 1KXQE 5DDHB 5ITBL 4BQ9A 2FIKA 4RWHA 2VQ1B 1A9BB 4JN2A 3S35H 4ELMB 4NO0A 1UG9A 3BGFB 1DBBH 2BVTA 1BGXL 4OLZH 3VFRA 3BUYA 2YZ1A 2VR5A 2FLBT 2NZ9D 1XGPA 1IGYB 4M4RA 4KHXL 1CDJA 1FGNH 4Y4KA 1KTLA 2R0KH 4TPRH 1G7IB 1IGIL 2VC2L 1T5WB 1WC7A 3VJ6A 1NGXB 5GXBB 3QXDA 2Y07H 2YBRA 1MJ7H 1RZ7L 4NDMA 2W0KA 4KV5E 4Y8AA 1YYML 3LZFH 1DEDA 4N0YH 3DXAB 4BFEA 1X7QB 4GKZA 4CRPA 1BZ7A 2DN7A 3SN6N 4XP4H 4U49A 4Q7DA 2FJGA 3IDGA 4OCXH 5LGHH 4L29A 3RUGB 1NCWH 3VXMB 3MJ9A 4QKXB 2H9GA 2CDEB 4PB9H 1JWUB 1EBAA 3AS0A 1LO2H 1ONQA 1DBML 1RZJC 5TDPB 4Y1AB 2EDDA 3QI9C 5DJ8A 1WFUA 5C07B 2EZ0D 1N5YL 1J5OH 2Y25A 5SWQA 5GHWL 5D7IE 2DWDA 4HWBL 3STLB 4BKLA 1SM3H 1IM3A 3IFPA 3BKYH 2L7UA 5GJTH 4NC1C 4NNXB 4V1DE 4K7FB 5GRJH 4ZSOB 4K8RL 5DD5H 5ALBL 1LEGB 5H37H 1T7XA 5DUBB 1R0AL 1BP3B 1DEEB 3JV6B 5IM7A 1LMKA 2P24B 5HHME 4KMQA 4MHHI 2Z91A 1NCDL 1MFCH 4JFDD 3OKEA 4MNHA 1GGUA 5CEZD 4JPIB 3VFSB 2FO1A 1IAMA 1AXIB 5C0BB 1X44A 2Q8AH 3IAQA 2W60A 3ZT5A 2MJWA 4GAJH 3VH8A 1RMFH 4NHUB 3OJVC 2BSTB 2VISA 3V6FA 1QBML 1AI1H 1YPZF 2HJKB 2CXKA 4DN3L 4QTHB 1HH9B 4XNXL 1JN6B 1T21B 3RVVC 3TIEA 4MVBD 3OXRA 3JXAA 1HQ4B 1ZVSA 4GW4A 4UILL 1CFTB 1NH6A 2P1YA 3O4OC 4B7IA 4YK4B 3HNSL 3B9VA 3QQ3A 5JZ7C 4BQ6A 1FFNA 5DYOB 3HC0A 1CCZA 4PJFF 3QCVL 1BD2A 4F80A 4QXGH 3MGOB 1UACL 2ED7A 1CE1L 1I1YA 4M61B 1RPQA 1DUYA 2GFBA 3PWPB 1T7WA 3CK0L 3CXDH 1I3GH 3RHWF 3QXWA 5EWIL 5MERA 5HHVH 2VYRE 4KAQL 3T1WA 2VDOL 4WW2C 4ZS6C 2QR0A 1QNZL 5SWSB 3NTCL 3QJHA 2DWEA 4YH6A 4XXDB 5EBMB 5BO1H 4ZUUA 3U0WL 1X5YA 4QLRA 1P7KA 3QWOA 3L3KA 1T0MB 1UXSA 5KSUA 2R56H 3T09A 4LPTA 5EUOA 3DURA 5GS0D 4NQEA 2AEIT 4P2QA 2X4PA 5TE7H 1EEZB 4JANB 1TJIH 2EIZB 2WBJD 3NA4A 5E6ZA 2HJLB 2QLVB 4I2XE 1E4JA 1FG2A 2E7LC 4WFFD 4D0CB 4JFFA 3SDAD 3MREA 4U6HA 4M43H 4S10A 4CU7A 1S9KC 3S35L 5L0QB 4OLZL 3FMGH 4OF8A 1PZ5B 1S9XB 4KUCD 3IDUA 4GS7B 2KDGA 4GLRI 3O9WB 3LMJH 1F3RB 4X0KA 4QRPA 2J6EH 1W72L 1Q9WB 3WEXA 3PL6A 3KLDA 1U2HA 1MJ7L 4HD9A 1MIML 2V9RA 5D1QD 4GAYB 3MNVA 1G7JB 3U1SH 2AK4B 3GM0A 5DUMH 4GMSH 4KRPD 1DQTA 1MFBH 3DUUB 4M48H 1OLLA 2XNAA 3VFNA 5F7YC 1X9QA 5KW9H 1WSST 4OCWL 1GGCL 2WIIB 1EGJA 1NCWL 2YPLD 5JDJA 4ZAKD 4RNRA 4PYHA 1WCBB 3BRGC 3L5WA 1IJ9A 2OXHA 2FBJL 5I1HH 1A1MA 4QRQB 1GIGH 1XGRA 3GSNL 3FO2A 4LNRB 4ONOA 2NY6C 2PO6A 4BFGA 3VRIB 1OSZA 3HR6A 3MGTA 2Z93A 1N6VA 3QDGB 1IGCH 1EEYB 3STZA 4OCLC 4IRSD 3BE1L 3KJ4C 3QT2A 4PLJD 5IB1A 4RRPA 4YHPB 3FT4B 5KS9F 1I8LC 2BJMH 3ARDA 4L3EE 4XPTL 2NY4B 1G0XA 4YAQB 4GXVH 2NLJA 3BPLC 2PTTB 3D0LB 4JRYA 2V2WB 2DD8L 5MEQA 1SM3L 1VFAB 5B39B 1FFRA 2ADJB 4IJ3C 4FTVD 5BCAA 4WCYL 1Q0XL 5GJTL 3MV9B 5I73B 4WWKA 5EOCJ 5DD5L 5E9DB 4CVZB 4XMKH 1YUHA 2HKFL 2XXMB 1EVTC 3RZCB 2PYFB 4KHTH 2GJ6D 5GGUA 4V3DB 4I77L 5LWYH 5K9JL 3ARGB 1PY4A 4KI1A 2R2BB 2RJMA 1J8HA 3PGCB 1G9MH 1I8KA 4O2FA 4U1LB 1NCBL 4PJDA 2XTLA 3O6LL 2FEDC 5KSAC 1ADQA 5FM5O 4Y5VB 5DJXB 3DOSA 3UTZB 4X6CF 4XRCA 3ZT6A 2UZIL 1R5WA 4OZIF 4XHJC 4LPVA 4ZS7H 1KGCD 4R9HA 5T1KB 4P2OA 1DBAL 1ZSDA 3Q5OA 4YBLB 5D96C 1RUML 3QXTA 1ZXQA 5AWNL 2WQ8A 1WTGT 3UZQA 1KB5A 3QJFB 5EN2A 2YD1A 4I18B 1EO5A 1DUZA 2OZ4A 4IIQC 5GZNC 3H9SB 4X4XA 1IC7H 5E5MB 2Y06H 1NFKA 1F3JA 2D31A 4E9LA 1IC5L 4JFZH 1XGUA 1JRHL 5IK3B 4X7CC 4ODUA 1EHLH 3DETD 1YEJH 1FL3B 4WU5B 1R3IH 1IM9D 2VDNL 1NGQH 4PJ8D 3RPIB 3N50A 4EDXA 4QT5B 2NQCA 3ZL4L 1HSAB 1X3DA 3CUPB 2EKSB 3AB0C 1BVZA 4G6KL 5F72S 4YPGA 5KVGH 4AYFA 5FUZH 2C3VA 2R69H