1RJZA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjzA01
1NFDE 1WZLA 5E4IA 3MO1A 1RZ8B 1F11B 2JJVA 4X7FC 2A9NH 4XCYB 5EBWB 3AGVA 4MJ5B 1IAIM 3C5ZB 2J2ZA 2VDQL 4JO3L 2W07A 4OCSH 4XBEH 4U7MA 4HKXB 1CXKA 1WBZB 4O2CA 5IFAH 4I0PC 4L29A 1KIPA 1ZT4B 4LLQA 3IDNB 4JEGB 5B4MC 1E6OH 4YO0A 2V9RA 5EWIH 4KRLB 1JTOA 2N56A 4ZFFB 1DUYB 4R97B 4D8PB 5JUEH 4JHAL 3NVQA 3JV0A 5J1AB 2Y23A 4FMKA 3LSOA 5CSZA 1FO0B 4N0RA 4CMHC 2AABL 2NZIA 3KYOB 2AV7A 4R7NB 5TF1H 5FYJD 2FO1A 1MCCA 1UWXH 4TUJA 3UROR 3F7QA 4X7TA 3GMRA 4KHXL 1I7TA 4KJYB 4UILH 4PREB 4RISL 3KJ6L 1A47A 4LVOC 1YN6A 4TSAH 3ZKNC 3SCMA 3VH8G 1FZKA 1NGQH 3ARFD 2A6DA 1DLFH 2BSRA 3TBYA 5D5MB 1KC5L 3MRKA 4OKVB 2FO4A 4BJLA 4XAWH 3KPOB 4BUHA 1YNTA 2L4OA 4NT6A 3BAEL 1S5HA 4ZDHA 4TVPD 2W60A 5C2BH 1EAJA 1T5XA 4RCAA 3VXNA 4YHYB 1TPXC 4MXWL 3ISWA 4NN5C 2QKIB 1H8OA 1RHHA 4HFWB 4N8PA 3B9DA 4QCIA 4ZD3L 5I76B 1T7ZA 2A0LC 4PP1C 3ULVE 3PP4H 1DQMH 3U0TA 4I5BB 3UZVB 1RZKL 3EOAB 2Y6SC 2OS7A 5T1LD 1L7IH 1J0HA 1MFEL 4UNTA 5GGTH 1E4XH 4QNPE 3QO1A 4D9RD 1IGFH 1J11A 2EDBA 3DO7B 1HZHL 4X99B 3VFWA 4M1CD 4X5WB 4HG4K 4OLZH 5DVNA 1IGIL 3BJLA 3B6SA 3MXWH 4QXUH 5IMMB 2OJZL 1QBML 2K7QA 2BX5A 1ND0B 3H42L 3EGSB 3INUL 3RVTC 4LIQL 5FA4B 1V5JA 3I02A 4AMKL 3HR6A 1YEHL 5EC1A 1QFPA 5DRNB 1VACA 1T0MB 1X5GA 3MUGA 5BRZD 5DJDB 1OAYL 1DL7H 3RZCC 1HHIA 2YBRA 3MRPA 4I0PB 4PS4H 2VISB 2XTJD 1QBLL 3MCKA 5DZNA 3P40A 2AK4E 3FMGH 4QOKB 3LB6D 4HXAH 4J3OC 3QXVA 3IVKA 3K4ZA 2ZKHL 4N8CL 1RSFA 3RWCB 4OLVL 4E9LA 2DOCA 2XWBA 4MA3A 3VCLB 1JGVL 1MQKL 4DTGL 5JIPA 1RQ5A 3UJIH 1UJTA 3DX9B 3UO1L 2DQGH 1DVFA 4CMHB 4ODSL 5T3ZD 4OLXH 3MLSL 4G6AC 4KJWC 1XGRB 1WFOA 3MJ9A 2VOTA 5F7LB 4MDIB 1RIUH 5JPMB 3C09C 1PKQB 4G6KL 4LVOB 1ACYL 3QUMB 5HYJD 2GJ6D 1UZ6F 3L3OA 4KZDH 1U3HC 4WFFE 3SOBL 1DQTA 1KB5B 5C0AB 3WLWD 3QXDB 4KJQD 4U1SA 2F9BT 4MD5B 5K9QG 1MRFH 2ICES 4RNRB 4WI9A 3IGAB 1T6VN 1ACZA 1YJDH 1OSZA 4XMKL 1XIWA 1MPAH 4Y4FC 2Y06H 5JXED 3BZDA 3MRIA 4Y2OA 5FOJA 5E2TL 4HMDA 2DJ4A 2BFVH 5LQBH 2BOCA 2W59A 1HHGA 5C07E 2RHEA 1R3KB 2HT2D 1OTSD 3UZEA 5I17B 1TPXB 5JO5A 4J6RL 4NN5B 4G9FA 3QI9C 3DXAE 5SWQB 1YEJL 1TNMA 1NCDH 1MJ7L 3FQNA 4MCYA 1MCOL 4FQHB 3HZVA 2VLLB 4UQ3B 1HI6A 5H2BB 4ERSH 3LEXB 4HS3B 2C1OA 1QP1A 3HCVB 3O6ML 1KENL 4JQIH 3NMEA 3Q5YA 4NNPL 2CO7B 4OFDA 3VWJC 3FHQA 5A2KH 4PJ7A 4KMTH 2BP3A 4FQJH 3F7YB 5D70L 3LN9A 2A77L 1NEUA 2FEDC 4BKLB 3F7VB 1KJ2B 2ZJSL 3K7UA 3GRWL 1FCCA 4JDZB 4LDEB 2F15A 2CKBB 1LO0L 1LWRA 1X3DA 2QADC 1RUKL 4MJIB 4IMLA 2VC2H 3X11A 2HVKB 4O02L 3WUZA 3L3KA 5IKCA 5HPOA 3PWPE 3UTPD 4KK8D 3MXVL 4NZTH 4WI4A 3TO4C 3DX8B 5AUMB 2YKLL 2OX5A 3I6KA 3RZCB 5EN2A 4NBYB 3UTSE 1MJ8L 5F88A 4X6FB 2J8UE 5ACZB 5LCVH 1FIEA 4AT6B 5JXEC 3MV8B 2G5BB 4RFOL 5GRJL 3AU1B 1GCFA 1RZ7H 4AENB 2Y9RT 2R69L 4O51A 3V0WH 4YIQB 4L5FH 5GQBA 3MRMB 4BZ1H 4OAWB 5DJ2B 4RAVA 5IMOA 2VXUL 4OZFG 3P0VL 4P49A 4TUKH 3GBNH 2QQNH 5IP4A 4J8RA 1J0JA 4BM7A 4P9HH 4MNGA 3MR9B 4IRJA 4PRHB 2SEBB 4XNMB 4UQ2B 2J5LC 3C09B 2FEEI 3KXFD 5T1LB 3NZ8B 3TH2T 5DK3A 1U3HB 1JRHL 3CFBB 3LKQB 1NCTA 2FR4B 3X12B 1FE8L 1IC4L 4JZOB 1EGJA 1JYXA 2XXMB 2BSTB 3X14B 4YE4H 3QQNA 4Y4FB 4W4NA 3RGVA 5JORB 3IRPX 4I3SL 2AEIT 3KPPB 5IJVB 4M62H 2J8OA 4KHTH 3BQUC 5KS9F 3QI9B 1KEGL 3LKSB 4WDIA 4Y5XC 5EH1A 5HY9B 3D85B 4YBHA 1IEAA 2CRMA 1KN4H 4ZQKB 3V79C 3LHPH 3GMPA 3LRSB 4YDVB 1XH3B 3BE1H 3H3PL 5ISZD 3RHWF 5C8JA 1B2WL 4HHAB 1BF2A 3WKNA 5IOPB 1K8DA 1QTYT 4JFQA 2VITB 4WUUA 1A1OB 3VWJB 2DMKA 4MQ7A 4LCYB 2V5SA 2UZYB 1UCBH 5KVFL 3BEWB 4GOSA 1BQLH 1CIDA 3F6LA 1CU4H 1R5WA 4M6OH 1UFUA 2B1HH 3HI6L 3EO0A 4HS8H 5GS0H 3ET9F 4PJ5A 1NC4D 2QADB 1FC2D 5EB9A 2PW1B 5L7XL 2EZ0C 1A7RH 3X3GL 4BA8A 3OR7B 5I1KH 4JFOB 3D87B 1A7OL 4YXLH 1MWAA 5ENWB 2YA1A 3N9GL 3SJVA 2AJZB 1J8HD 3F5WA 4U6VH 3E6HA 5KJRH 1JUFB 3MV7B 2BVQB 4MYWB 1RI8A 2WBJD 3TO4B 2UVEA 2O5YH 1W72A 4PGCA 1ROWA 1FH5L 1IAOA 4PRBA 4F7CB 5BZDB 4OCLC 1PW3A 2KH2B 2DIAA 4OZHB 4POZC 3U46A 3JWDC 2KUTA 1V3KA 5ECJE 4IRZL 1Q72H 1EFXA 2JF1A 2J7LA 3CFJB 4M93C 4JCMA 4GBXD 5HHOA 2DMCA 5TE4L 1UGNA 1NC2D 2ATPA 3LV3B 1DEEB 4HWBL 4HGWB 1WTLA 3QDAA 3WIFA 1MIEH 5A40E 2EICA 3BW9A 3L1OL 3I2CL 4ZUSA 4AY0A 4CMMA 1SJEB 2NY2C 2D03H 3I3EA 4L1DA 1J1XH 2J5LB 3EYOA 1NLBH 5A16B 4BFIA 1AD9A 2EEAA 4BQ8A 3TJEH 2DQCL 3D25A 4NSKA 3SCMC 4KUCD 2G60L 1Q94B 5BO1H 2DD8H 1G9ML 5IB1A 1FL3A 1WWCA 3I6GA 3QHTC 3QFDB 3RRQA 1XAUA 1SY6A 4P48A 1BFVH 4HH9B 1KJ3H 4C83A 5JHDA 1WCBA 3GKWH 1AC6A 1ZS8A 2AI0H 4LLUB 4Q9QL 1T3FA 3GGWA 3L3HB 3SHSA 1EEQA 1TVHB 4JRXB 3EDKA 4D0BA 4JPIB 5DO2C 5KN5A 3B2VH 3BQUB 1HXMB 2GTWA 4DN4H 3GIVA 4JANB 5GZND 3Q0HA 3Q5TA 4GG8B 4A6YL 4Y5XB 3PHQB 3EKCA 2VLKD 1IC7H 2IQAA 3DURB 3MJ7A 1CZ8L 2P5WE 1PKQE 4I0CC 3BIKA 5IVNA 1AH1A 4RIRB 3ULVL 1MUJB 3GI8H 4HW6A 5C3LD 2LVCA 8CGTA 3I50H 2OXGA 5E9DB 2HA1A 5C0AE 1NMAL 3RVVD 3MYZA 4RSVA 4ALAL 5FGCB 5I74C 2GSGB 4NO3B 4BSJA 2FIKB 5E2WH 1CQYA 1EIBA 4BSVB 4MA1C 3PG2A 4WI7A 5H37G 2OTWB 2WUCL 3MO1B 3DIFA 2P8LA 5CD3B 5GISL 3BT2L 2F54E 1N5YH 1H0DB 5MI0C 1KUMA 1OGAD 1ZEAH 3BIBX 1VPOL 1FGNL 2DQFA 4QXTA 4F37F 1MY7A 1XT5A 3PDDA 4O4YH 1RV6X 3LEVL 2VLRD 3AXLA 4O2CB 4PRPA 4WFHD 4LCIL 1QR4A 1KIPB 5EOCJ 1ITBB 2IADA 5JDJA 3TVMA 3BUYB 1QFWM 2NPLX 5L8JB 2A6KA 1NMCC 3TFKC 2R4SH 5IVXB 4FQCH 4M93B 3VFVA 1A64A 1T20A 1S7QA 3LSOB 5CSZB 1DVFC 4RGNE 4UOW1 2OYPA 4Z7UF 1OOAA 2BVYA 5DWUH 2AV7B 3RPIA 1V7NL 1V7ML 2OR9H 3RNQA 2P7TA 4MJIE 5GHWL 5AZEL 5HHPA 2ID5A 1EO8H 2E7BA 3GMRB 1I7TB 2NY2B 2FCBA 1KTRL 3HC0A 4QHKI 2GAZA 5ISZB 3BN9D 3GO1L 3V5KA 1CFVH 3HE6D 1YN6B 1W0VA 9CGTA 2WLZA 2KZ1B 3SCMB 2DQIL 5EOCL 1RIVL 3U9PL 4PTTB 3MYJB 3TBYB 3LIZH 2FO4B 3BN3B 5HYQA 1D5MA 1YNTB 1KPRA 4C4KT 1CQKA 5DLML 2WLYA 4NT6B 2YRLA 4XZUA 4ZDHB 5TQ0L 3L7EB 4ZS6D 1NCBL 1T5XB 1YY8A 3JWOC 5H8DA 1AXSB 4EIZC 1FNLA 4W6WB 4XBGA 3RNKA 4HMEA 3S35H 3DBXA 5SWZA 1M7IA 5I1JH 2DI8A 5JQHC 1VFAA 3FQRA 2XZAL 4XP9L 1D3CA 4M6NH 1XEDA 3RWHA 5I1CH 2W1NA 3U0TB 3MOAH 3WJLC 4B7LA 2M26A 2QQKH 3WLBA 1HHHA 3QO1B 1MFNA 4GG6A 2FWOA 1NL0H 1QSEA 1OAKL 1NCAH 4WI6A 5GSRA 2J1KA 3TA3A 4LAJH 5I74B 4U2YA 5I1EL 3RIAF 2FJHA 3B6SB 2WM0A 4MA1B 3T3ME 3WUWA 4HT1H 4U1KA 1UKSA 5DYOA 3L3JB 1P69B 3U7YH 3I02B 5MI0B 1OT1A 2P44B 3MZTA 2JK5A 1Q9OB 3DETD 1SBBA 4NRZA 5EC1B 3UPAA 1VACB 2VXQL 1FV1A 3NCBB 3KR3H 3N85L 2JJUA 3QG7H 4ZUVA 2OZ4H 1A9EA 2ARJB 2B2XL 1KNOA 5CSGA 1HHIB 2B20A 2YBRB 5ANMB 3LPFA 4HG4J 1K4DA 1XF5A 5C08E 5GS3A 2XFXA 1GPOH 4S1DC 1AQKL 4NO0D 3TT1H 4LHUG 1NMCB 4S1SL 4NNXB 4YXKH 1LO2H 5I1HH 5IVXF 4GW1B 1BVKA 5E2JA 2XPGB 1DVFB 1CGWA 4WI2A 4OZGA 4KVNL 2VLKB 4IRJC 5ILTH 2FECL 4OZ4A 5F3BB 2VLJE 4M3JA 3FOLA 4EI6A 2DLHA 5CKGA 2X4OA 5DZLA 1MHPL 1EHLL 3UYPA 2Q76A 4QRPA 5FK9A 2P8PA 1E4KA 4OFYD 4XB7A 2CLVA 3HMXA 2FD6L 1NGWB 2DLTA 4S2SB 1DANU 2WBKA 4KKCD 5IM7B 2MQ3A 4PJEF 5IBUB 2WP3T 4WU5A 3RVWC 1TVDA 1NMBH 4NQDE 3B43A 4J3TA 3MRIB 3CZFA 3MUHL 4UNUA 1N5AB 2BOCB 3ELAT 5F7MC 1OGAB 3RDTA 1K4CA 2JJWA 1TTFA 5TQ2L 5JO5B 4B50A 3QEQE 3RAJH 3O3AA 3IJHB 1GGIL 3BJ91 4MAYA 5DD1L 2IPUK 2VLRB 2DWDB 3SKMA 3MUZ1 3FQNB 4MCYB 3W39A 5B38B 3HAEH 4FFWD 4Q0XH 3WHE0 3P9LA 4NN6C 1HI6B 4TRPH 3U7WH 5JHLH 1MLCA 4PJDF 1RUAL 2C1OB 3FQUB 1LE9B 5I1DA 2CMRH 5AYUL 5KOMC 3WIIH 4Y19A 3Q2CA 6FABH 5IW1A 4OGXL 2Q20A 3QDGE 2Y07L 1BWMA 3DRTB 4PJ7B 4L8CA 3P77A 1QBBA 3FB8A 2HRPH 2VDQH 5BV7C 4JO3H 4OD2A 1KLUA 3N50A 3SE4C 1CFTB 4X6EB 2A9ML 1ED3A 4IMLB 3WN5A 1UM6L 4JRXE 3X11B 3T0ED 4YNYA 4C56A 1IAIL 1G7HB 1B90A 4NQCA 4EUPH 3VD4A 4DGIL 4GAFB 1D7FA 4G8GE 4OGAC 1U8NA 1HN1A 1P5VA 4KUCF 2H2SD 1MFDL 3MFFA 4YHPA 2ZUQC 4KKCC 3I6KB 1S78C 4LKXA 3GMLB 4H20H 5EN2B 4Y1AE 3OB0K 1HDMA 1V3LA 5EU5A 3WDIA 4P23A 1A6ZA 1YPZF 3FB6A 2MMXA 1EJ6A 4GRWB 3TO2A 4O51B 1CVSC 5FGCE 4KHXH 2JIXD 2EC9T 3FO9A 1N6VA 3FONA 4RISH 1I1AA 4M1DH 4ESKA 3KJ6H 1RJCA 2X4QB 3QZWG 2F58L 3MJGX 2BSSB 5IMOB 4Y89A 4J8RB 4DKFL 1ZTXL 3WFZA 3DSFL 5E03A 3QDJB 4IRJB 2CSPA 4Q6YA 3X17A 4NP4L 2E7LC 1HCFX 1C5CL 2NY1D 4JG1L 1FN4B 2J4WH 4YGVA 1EA9C 5C0IA 1WWAX 4P2RE 5DEZA 2DB8A 2NY3D 3BAEH 3SGDI 4POYA 4QRRA 3AAZA 3BWUC 4MLIA 3SPVA 1OP9A 4MXWH 2ZG2A 4FP8L 3ME0A 4JFDA 2ZNWA 2BHZA 4X4ME 3BRDA 3OX8B 5DD3L 2VE6A 1KACB 5IW3A 1FPTL 5FO8A 5JR1L 3T0EC 3TT3L 4RMTA 5FO7B 1EMTL 3BPCB 2NY0D 1TQBC 2IBZX 1Y18B 4WDIB 3BFOA 1IEAB 5D7KE 1P2CA 1P9MA 4ODBD 2R1YA 1ZWIA 1OWRM 3BKJH 3IS0X 4NN6B 4ZAKD 1IGIH 3MA7A 3GHBL 1JWMA 2BRRL 3QISA 4WTZA 2OJZH 4YDKL 2VWEE 3BUTA 3H42H 1KB5L 3FQTA 4D9LL 4MQ7B 4R3SA 1FHGA 3LEYL 3P11L 4NPYA 4AMKH 1YEHH 4HV8A 5BV7B 2CXKA 1OAYH 3EO0B 3EOTL 4PJ5B 5DD6A 3BMWA 4Y4KD 4UTAL 3EO1B 3SDYL 4JFYB 5CZXC 2BVEA 3QB7C 1MWAB 2FZ3A 3V4PH 3SJVB 4FTVD 3F5WB 1S7UA 4QTHB 4GRMA 3C60D 1D5BB 4OLVH 4HIIB 1JGVH 2ICCA 2ZUQB 4DTGH 5CS7A 1U8MB 2Y36L 1W72B 4PGCB 1GC1C 4PRBB 1BZ7B 3UO1H 1OVZA 4ODSH 4X6BA 4TNVF 5D1ZA 3MLSH 4UB0L 3U46B 1OHQA 2EXWD 4KMLB 4R90L 1T2JA 1CICD 1UACL 3OL2A 2D7OA 2HH0H 3HG1B 4JN1L 4J4PA 5GJSL 4L8SA 4QLRA 2ATPB 2DIJA 3SOBH 1KJ2L 8FABB 2AEQL 3LN4A 3AMLA 3S34L 1IGJA 2CKBL 3WIFB 4B0MM 3IDXL 1JMXA 4ZUSB 12E8L 2ICWI 4ZAKC 1OL0A 2DRUA 3CSPA 4BH7A 2VXSL 1OSPL 1SYVB 4PBXA 2JELL 2XKSA 5LAXB 4TSBH 3BISA 1VENA 4XMKH 1J9CT 5I8EA 4NHUB 1OTUD 1EEUA 2LABA 4MWFB 2JCCB 3TBSA 2DM7A 4JFPA 4KI5E 5HI5C 2BK8A 5IB1B 1FL3B 2QV2A 3I6GB 3EYFA 3B83A 5C86A 4P0DA 4PGZA 1FRGL 4C83B 3UTZA 1YEJH 3LQAC 3TJHA 1WCBB 1H3UA 4WVRA 1MJ7H 4Z95L 2EYRB 1MCOH 1ODAA 1T3FB 3QEGH 4K3JL 5D93C 4CNIB 2XYCA 4PJIB 3QWRD 4PJFE 3VXMA 2ORBL 3T0EB 3E3QE 1H3XA 5IHZA 4BQ9A 1TQBB 1KENH 4NZRL 3VFUB 5KN5B 1BOGB 2GTWB 1KGCE 2L7JA 3OV6A 1WZ1H 1YECL 3DSNA 3OKKB 4Y5YA 2IQAB 3MJ7B 4P46D 4H26A 5D70H 2A77H 2OM5A 5KVDL 2ZJSH 4MCZA 4L4TA 3GRWH 4NFCA 3T4AB 2EXWC 1LO0H 3UAJD 1T83A 1CICC 3AS0A 4LCUB 2XZQH 1K8IA 3BI9X 3TA3C 2RCSL 3LMJL 4K23L 1QPXA 2XKUA 1OWWA 3IU4L 3K80A 4MD4B 5LBSH 2UZIL 3VXTB 1PZ5B 5DQ9A 3S37X 3MXVH 1P6FA 1DN0A 3AS2A 1PY9A 1A22B 3FO2A 4XNUL 3DIFB 3STLA 1Y0LB 1JNNL 1MJ8H 4G9FE 1ZHLB 3N1QC 2DQFB 4QXTB 1OTUC 4LSDA 4RFOH 5GRJH 3ARVA 1E4XI 3Q6FA 4GKOA 3K81A 1F00I 2R69H 3C6LA 1DBML 1U58A 3AXLB 3WXWL 4PRPB 3QWQB 5AYQA 4PY8I 1RZJC 4CVUA 1I9JL 4LVEA 2EH8L 2IADB 4F8TA 4HC1L 1LK2A 2VXUH 3P0VH 4HJ0D 3NZHL 4WV1A 2A6KB 1S9KC 1ONQB 1MJJA 3PWVA 4PV9A 2BVPA 1JF1A 5HHNA 4PJ7E 3TPUA 5EU3A 5C0GA 3P3YA 3RL2A 1T20B 1KTKE 1LO5A 4JY4A 2VUOA 1A5FL 2HT4D 4PRNA 5HI4D 3N1FC 1F4WL 4PJBF 4UIKL 3RPIB 3ULUC 1JRHH 3ARDD 4NGHL 3RNQB 2P7TB 3C9NA 5IV2B 4P46C 1IKFL 2BVOA 2P47B 5FCSH 2CUMA 1FE8H 1IC4H 1L4IA 1BIHA 4YC2C 4ZAKB 5I73C 3HC0B 1CD1B 2R0KL 3V5KB 1UT9A 1HILA 1W0VB 3QHFL 4HBCL 4P2OA 1A1MA 1CLYL 4LARH 4I3SH 1EPFA 3VD9A 1M7DA 4NKMA 1JNLL 5HYQB 1D5MB 5FM5M 1KPRB 5HVFB 5GGQL 5I71B 5FKAA 2P8MA 2DQUL 4XZUB 3SQOL 2Q8AL 5D93B 4KUZL 5DTFA 2N1KA 3S97C 1GXEA 1L0QA 2WIIA 3NFSH 1YY8B 5D2NE 4DGVL 3MGAA 1QFOA 1S7TA 4KRPD 1QSFA 2B4CC 2DQDL 3H3PH 5C0DA 1B2WH 4XBGB 3RNKB 3SEPA 3U4BL 4MAYC 3DBXB 3OPZL 5GRVK 4MNGE 5FIEA 3I3DA 1VSCA 3C2AL 1M7IB 3E2HC 4U1MB 3FQRB 1CLOL 5HJ3A 5IVOA 5L2KA 3FJTA 3VXSA 5KSBA 4MQSB 4YH6A 3RWHB 5KVFH 4TNWF 1P7QD 3C8KB 2CD0A 4X5LA 1N64L 2BNRA 4WHYG 1EZVY 1CICB 3X3GH 5I1IL 2IFGA 3TA3B 2HT4C 1TIUA 2HTKD 4ZXBD 1A7OH 1ZHBA 5ESQB 5HI4C 4PLNC 2FJHB 4L1HA 5CJ8A 5I2IB 4KPHL 1QRND 3WUWB 1Q9LA 4WI5A 3I6LE 5D2LB 1D6VL 5DYOB 2PTTB 1F4HA 5IB3A 1FH5H 1FZMA 2E7CA 2JK5B 4MS8A 1VADA 1ADQA 3O9WA 1FV1B 4IRZH 5A2JH 3ZHLA 3MRHA 1YMMD 1FIGL 1A9EB 2PETA 1KNOB 5TE4H 3ARGD 3AY4A 4XPAL 1K4DB 2WBJA 1XF5B 4OI9A 2XFXB 4HK3N 1LVEA 1BPVA 4P23C 4HWBH 4PJDA 4N90D 2I60L 4WNQA 2J6EL 4WUUE 4NUGH 3HC4L 3CSYB 3DGCR 5MEQA 1I1AC 1BVKB 1Z9LA 5DS8A 3S96B 4P4KA 3D0LA 5I16A 5F9OL 4GXUN 3I3BA 2DQCH 5L8LB 3DROA 3TYGL 5BS0E 2G60H 4IIQA 5KVGH 3EDJA 5F8RC 5D1XA 3NIFE 5IHBA 3BP6A 4P46B 4FZEH 5DZOA 5FO9A 1LP9B 3D0VA 3GM0A 5DA4A 3S88H 4LLDB 4YC2B 1Z5LB 4QRSB 5I73B 1EVTC 1HQ4A 1S8DB 3PXJA 2NXZD 2H2PC 2Q76B 4QRPB 1BFOB 3NCYS 2P8PB 4KAQL 4Q9QH 3ARXA 4P4RB 4I48B 2HKHH 4ZXBC 3CFEA 2V5MA 4WU5B 4I3RH 1BQHG 2KZWA 4R4ND 2ENYA 5CEXA 4A6YH 2C3XA 2VXTL 3WS6A 3NCJL 5I30L 3CZFB 3JWDL 4L3EA 2Q86B 1CZ8H 5HHOE 4CKVX 5E0QA 3ULVH 1F90H 1K4CB 4O58L 4V1DD 4C57C 4DVRH 1CI5A 3O3AB 2V7HB 3VJ6A 4MAYB 4XCNA 5F1KC 3SKMB 5E99L 3W39B 4ALAH 3E2HB 2VR9A 3VG9C 3P9LB 2R56L 5KAQF 2YN5A 4JB9L 5FGBA 5I1DB 1T2QH 5T1KA 5IW1B 5EUOB 2WUCH 5GISH 5DEGA 5F93C 4O9HH 1VCAA 4M5YL 4HUNB 4L8CB 3P77B 1KYOJ 3FB8B 1IM3A 1E4JA 1FGNH 4PD4K 5JHDE 5TDNA 3LS5L 2DDQL 3C5SA 4IDLA 43C9B 1OLZA 4NQXA 1U8IB 3LEVH 2YPVH 2NXYB 4LCIH 4XWOD 5D2LF 3MOQA 2FYYA 4JFXA 4YNYB 4BQBA 3BYTA 4C56B 2NTFA 2FHFA 1YEIL 1FVCB 4J3XA 4APQD 2I9TA 1OF2A 5IGXH 3VGBA 3G04A 1F4YL 3WFEL 2H6PA 1F6AA 3MFFB 4YHPB 3V95A 4KK5D 5JDSA 1UZ8B 4LKXB 4Z7NF 4NM8H 4R4NC 5KSAD 4N0CA 7FABL 5D1ZC 3RBSA 1QFWL 3NAAL 4P23B 1AHWA 1GGCL 1V7MH 1V7NH 1A6ZB 1VA9A 2XN9D 5GHWH 5AZEH 2DJUA 5FUCC 3MLVL 1NDGA 1NKRA 1I8IB 3S8WA 5HGDA 3VA6A 3FO9B 4J4PC 5IG7A 2R0LL 3FONB 1I1AB 4C4KO 1H3PL 4WO4D 2Z35A 1X5IA 4YDJB 2NYYC 3U9PH 3HC3L 4XP5L 2EC9U 3JUYA 4K8RL 1LGVA 4N0FB 4WFED 5C0IB 4PTUA 5DLMH 3MV9A 3GFUA 5GRZA 3ARWA 4QRRB 5I8KH 5TQ0H 1KFAL 3HE6A 4DAGH 3SPVB 4G6MH 3P2TA 1M4KA 4ZXBB 4U6HA 5BZWA 1CFQB 3QEUA 3HLAB 4G42A 3E0GA 5L88L 4JFDB 4YEFA 4XVUC 3TJHC 1KSRA 4P3CH 3W9DB 3WFCL 1J5OL 3KPRD 2VE6B 4RMRA 4XWOC 2XZAH 5FO8B 1N4XH 4XP9H 3RU8H 4U3CA 3S36X 5C3TA 5GS1A 4WU7A 1B6DA 3P0YL 2UWEA 1TNNA 4Z7VF 3M17B 4FQLL 1ZLWK 4CVXA 1OAKH 4R2GC 4Y5YC 5EU4B 3NCCB 1P2CB 4KMQA 3OXRA 3DHJA 3VG9B 4JRYD 1ZWIB 3MJ9L 1OCWL 5I1EH 4HF5L 1NBYB 3U2SB 1KCKA 2IMMA 5DEFA 4H8WC 3OAUL 1T83C 1JYVA 2Y25A 3CH1A 1L0YA 3FKUS 4KTDL 4Q97A 4AEHL 1A6TB 4WHTA 3ARED 4WO4C 4R3SB 4XPBL 1BAFL 4P2QE 4GKSA 4JHZA 3OB8A 5CBAA 2VXQH 5CJQL 3QBTB 3MREB 1QG3A 3SKJL 3L5HA 3IKKA 5E6IA 1MLBA 3UMTA 5LGKA 1MCSA 3JWOL 1AQKH 2FZ3B 1VEMA 2CRIA 5SWZE 3K3QA 4G43A 3C6LC 3KPQA 4GRMB 4S1SH 3V6BR 1N3NB 1G84A 5DUBB 5FUOL 3F12A 4PJCF 4YQXL 3JV6A 4JCLA 1WWWX 3KWWA 4N5ED 4WV1C 3AROA 1KLGA 4FABL 5MEOA 5D1ZB 3ZMRA 4KVNH 4GG6E 1OT2A 1UZ6E 1QSEE 3NTCL 4PRIE 3CFCL 5KSUA 2R0WL 3RWGA 3RWFA 2WP3O 4OCMC 3BZ4A 2YPLD 3NFNA 3B4NA 2H41A 2NY4D 5DD0H 1MHPH 3TM6A 1UXSA 1EHLH 3CPLB 2X4RA 3LN4B 4GJTB 5J6GA 2AKRA 1IGJB 2XOTA 4PYGA 1MFAL 4DVBA 1YC8A 3IFOA 1KXVC 4JFEE 2R15A 5DT1L 3VXRD 1JPSL 2R1WA 3BDXA 5I8EB 3THMH 4IS6A 1T7VA 1A6WH 4P2OC 4UT7L 4N8VB 2BDNH 1XGQA 3DX7A 4ZNEA 2O5ZH 3VMNA 3TBSB 4U31A 2FSEA 3EYFB 5GS0D 5TQ2H 4GAJH 1J8KA 4YPGA 1FO0H 4V3DB 3UTZB 5DD1H 1D6EA 1JTPA 2I5YH 4X80H 3EJYC 1XGPA 3VXMB 1NLDL 3DO3A 3FQXA 2ZUTA 5EU7E 1X5FA 1RUAH 5IHZB 2HMIC 4XTRD 2ZG1A 5AYUH 2J3SA 4OZGE 1UVQA 4KKBD 1M05B 3CDGB 1EHNA 1NKOA 5FFLA 1QHPA 3ESUF 4PJBA 2Z8SA 3ARQA 4R2GB 4FFZL 4Y5YB 2HYMA 3FAWA 2GT9B 2QLVB 2OK0L 2GTZB 4H26B 4U7KA 2XY1A 4DKDC 4RMUA 2IANE 4MCZB 3RBGA 2HRLA 5TE7H 1BBDL 4M8QA 4MQTB 3RVUD 2A9MH 2Q1EA 1MCHA 1L6ZA 1I9IL 4F2MA 5TE6H 4MVBD 4EI5D 4X5XB 2NY4C 1IAIH 1L9MA 4WO4B 3ARRA 4DGIH 2XT1B 1EGJL 3O6KL 5DQ9B 3V7MA 5C0BD 1DN0B 1P4IL 2P45B 1L7TL 3MTRA 43CAA 1MFDH 5TFSL 4QF1B 3OKOA 3STLB 4KH2A 1MEXH 4Y16A 1EZVX 1N6QH 4UIMB 4MS8C 3SBWA 1FCGA 1QEWA 5DK0A 1O5DT 1I1YB 1B88A 2ARJQ 1HK6A 2AJ3A 3DARA 4LSVL 1LDPL 3C6LB 1U58B 3T0VA 1FFQA 2DTMH 5DJ8A 3TIDA 2F58H 5BJTA 4Y19E 1AJ7L 4H1LA 3MV01 4WV1B 1BJ1H 3PUCA 4XCFH 4DKFH 1ZTXH 3KPRB 4Q9RL 3PWVB 1MCEA 4UDUB 1PD6A 2B8OT 2BVPB 1JF1B 4NP4H 4PR5A 5HHNB 5CP3H 5GIRA 5EU3B 3TN0A 5C0GB 2Z9TA 5DK2A 5KVEL 1LO5B 5CCKL 1P1ZA 1WAAF 1KCUL 5BV7L 1VFBB 3DYOA 4IIQC 4PJXB 4NFBA 3IKCB 3EZJB 5D1XC 3IJSA 5KTEH 1FSKC 1KCVL 2BVOB 4JRYB 1JPTH 4K94C 4NQCE 4FP8H 3BKMH 4LBEA 4NHCH 3RVUC 1AO7A 5T5NF 4BYHA 1MWAL 5DD3H 2R2BB 4P2OB 2WY3A 4MVBC 1A1MB 3BP7B 4LASL 1FPTH 4LDLB 5JR1H 1CTOA 1EMTH 2ZP0T 3F58L 4OB5L 4JREC 3HTLX 3I9GL 1FFOB 1W72L 1Z6JT 1BX2A 4LPVA 1ZE3C 1FC1A 1E6JL 5FKAB 3WS6C 4PJAB 3BDYH 4YZFE 5EUKA 3PNWA 5DTFB 1AP2A 2ZUYA 2WIIB 4U05A 3QP3A 2EDKA 1NFIA 1QSFB 5C0DB 3LQZA 2W92A 4HKBA 4NQTA 1QR1B 4YDKH 1OPGL 3QUMH 2HFEB 4UBDC 4OQTH 1KB5H 4D9LH 2OSLA 4KQ4L 3RX8A 3ZSTA 5L2KB 1XZ0B 5HJ3B 3D3VA 3PDGA 3LEYH 3HE7A 3P11H 3TNMB 3V4UH 1W0YT 3O3UN 2VDLH 3BSZL 5FGBC 1N0LA 1J0KA 4QRRE 4LLYA 1HH9A 3EOTH 4UTAH 3RTQD 3SDYH 2DYPA 5JOPE 1HKFA 2YPLB 3IXTB 2XWJA 2NY4B 3G5YB 4NC1E 5EZIH 1LE5A 2OI9A 2ADIA 1SY6L 3QFJD 3OSKA 3U48A 1KJMA 1Q9LB 2X10A 1G7IB 4XRCA 3VW3H 1JPST 4TOYL 4RRPG 4TVPE 5SWSD 4PLKC 2AAVA 2WQ8A 3VXRB 1X5AA 1YUHA 1C8PA 1MF2L 3ROLA 1VADB 3GSWA 4JO1L 4B41A 4R90H 4HWNA 3MRHB 1T0NA 4JN1H 5GJSH 3S98A 3W2DL 3DYMA 4N0CC 4MJ2A 3N1GC 4KVCL 1AHWC 1KJ2H 1PYWA 2AEQH 5HBBA 4PJHF 2XQYG 3S34H 3G6DL 2CKBH 4WHCA 5F8QC 12E8H 4D9RE 4ZO8A 3D39D 5CJOL 2Z92A 3P4OB 1EBAA 2VXSH 4XPFH 5EO1B 1OSPH 5JW4N 4OIAA 5DS8B 3FTGB 3D0LB 4KDVA 2BY0A 4H88L 3RVXD 1JHLL 4JFFD 3QT2A 4IIQB 5GZOC 3DVFA 1MCIA 5D1XB 1FSKB 3BP6B 1AGEA 5FO9B 5LKNA 3D0VB 2HLAA 1U8OB 1F3DH 1UH2A 1HQ4B 4CRPA 1A6UH 2R29H 3EFFA 2ZUXA 4OIIL 5EIVA 1BREA 3RTQC 1HIML 2NY6C 4K3JH 4NUJA 5HYFA 5BRZE 1UKQA 5HDBE 1PDKA 2DJSA 4V2CB 3CFEB 3EDFA 4JREB 4NZRH 1PLGH 3AFLA 3EYUL 4K3EH 3W9EB 4LCCA 1S9VA 1GC1L 5C0BB 2C3VA 5CEXB 3WYRA 2C1PA 3KHOA 4L3EB 2WAHA 3KPMB 4Z7WB 1RAMA 5GS2H 1YA5A 5GS1C 5CEZD 5KVDH 3B9KA 3VJ6B 2LTQC 4XCNB 5T3ZE 1S7XA 2A73A 3CSGA 3FO0L 4G8FB 5LXGH 2RCSH 2F53D 1IKNA 3LMJH 4F9LC 4K23H 2CDFA 1MSPA 3BH9B 2UZIH 4OIBA 3MQIA 4U6XA 1ZANL 4Z5RA 2GUOA 4LLWA 2E3VA 4XNUH 2C5DC 3A6OA 1IM3B 3RVXC 1DN2A 4HFUL 4XI5C 4P2CG 1CT8A 1LEGA 1JZ3A 1RMFH 2HFGL 4NQXB 4XMLH 1QLFA 3CLEL 5E08L 3VXME 3LQAL 3WXWH 5E6IC 4XPGL 3OHXA 3V5DB 1WJ3A 2FYYB 2GK2A 5EU6A 4ETYA 4HC1H 5MEND 5DVKA 3NZHH 2DLFH 1NGXA 5EA0L 3DI2B 5IMKA 3DVIA 4B53A 1MCLA 3G04B 4JO4L 4PGJA 2H6PB 1Z9MA 4PG2A 1IILE 2P5EA 1ITCA 3OJ2C 1A5FH 4L4TE 1ULVA 2EIZA 5F7WC 5JOEA 2ADJB 1F4WH 5ACLA 2EDFA 4UIKH 1AHWB 5TPWH 4NGHH 2VDMH 2Z31D 3VI4F 5J6HA 4HIJA 1IKFH 1NDGB 3ARBD 4XBPA 5HGDB 4UU9A 4ELMA 4YHKL 2R0KH 5IG7B 4M7LL 1XGTA 3TH4T 3CJJA 3SDAD 3SDXB 1G9NC 2NX5A 3WL9B 3QHFH 4JZNA 1MI5A 1CLYH 2Z35B 2C3HA 3OR6A 3TPKA 1VEPA 1MH5A 3D69A 3AB0C 4KK9C 5DA0B 5GGQH 3CMOL 4PTUB 3MV9B 2VMFA 4OI8A 5KSVA 2DQUH 3SQOH 4UT9L 1JGEB 2Q8AH 4U1JA 2NY6B 4GQ9L 2QL1A 4KUZH 2YD4A 3V8CA 3B9EA 1A7QH 2CDGA 4DGVH 1NGYA 2CK0L 2A6JA 5FGRA 1DCLA 4U6HB 2DQDH 2P48B 1UB6A 3QEUB 1WQVT 4G42B 4M7JL 1RZJL 1S3KH 3QFJB 4XCEB 5CD5D 3OPZH 4NN7C 1ZLSL 4X6CB 1YNKL 4FNLL 5LWYL 3LH2H 4X9BA 3C2AH 4DOHB 4JKPH 1GIGL 5I0ZA 3TPUE 3U9UB 4CDHA 3EJZD 4CBPA 1NUNB 3TCLA 3CXDL 3GHEL 1P6AB 5GS1B 3FB5A 2PYED 1N64H 3QCUL 1NUDA 3BX7C 1R24A 3DVGA 1UA6L 5D7LA 2LTQB 1C12A 1XR8A 4CVXB 4FQ1L 3VXQB 3ULUL 3OXRB 2ICEA 2E7MA 4KGJA 1T21A 4XNYL 3QRGL 5DQDL 5DEFB 2VQ1B 3OAZK 2Z31C 3MODL 4KPHH 1JNHB 5LGJA 3KXFE 3ARBC 3MC0A 5KBNC 4KI1A 3EFDH 1D6VH 3CH1B 1G6RA 4FA8A 3PV7A 3MLXL 2Q3AA 3HMXL 3SDAC 5F7HA 5F1IA 4GKSB 3SDDD 5CBAB 2ED9A 1DBBL 2DQHL 3GK8L 4RWYL 2V9TA 5LGHL 4Y2DD 2A83A 3QQ9D 5E6IB 2K1MA 1MLBB 1JHKL 1QSFE 4Y16C 2WV3A 3OKLB 4WIQA 1NFDA 3SBWC 3TBTB 4XCCL 2B4CL 4TUOA 1MRDL 2I60H 5F1OB 5CINL 2XKNB 4GT7A 1FL5A 2IPKA 3KPQB 3JTSA 1AD0A 3ZLQC 1IM9A 3VXSE 5KSBE 5C0NC 2RJMA 1E4WL 3IF1A 3JV6B 1CBVH 3KWWB 3ETBF 3FQWA 2BNRE 3ARGA 1KLGB 3VGGA 1Q0YL 4R7DA 4R26L 2EDDA 2G2RA 3PHSA 2I24N 5KSUB 3TN0C 3T1WA 5ID1A 3T65A 1QFUH 3RWFB 1MCFA 1LD9B 4HK3J 3U6RA 4D0DB 3NFNB 1BHGA 3HZKA 2PYFA 4I4WA 3SDXF 1X5XA 3BRGC 2X4RB 4KAQH 5HVGB 5C0JA 4ZOCA 5D7SH 4LFHD 1CDUA 1I3UA 5F3HB 1J87A 1VESA 4JAMA 3B3IA 1NQBA 3BRFA 1U6AL 2LQRA 3QUZA 3AB0B 3GSUA 2R1WB 1N59A 3NIGF 2ESVA 1LO3L 4IS6B 2VXTH 2DWEA 4ZMAT 3KLAB 1JFQL 3NCJH 1J8HE 3JWDH 5GXBB 1NPUA 1QYGL 3GZKA 4OZIF 4W4OC 4O58H 4ENEC 5EO9A 3GSRA 3SDDC 5AD0B 4YPGB 4PJDE 1P7KB 3VRJA 5ADPL 2L0DA 4NN7B 1D6EB 1JRHI 4X6CF 3GI9L 1XGPB 3VD3A 2HWZL 3FQXB 2AXJA 1AR2A 5C0FA 5DJZA 1NJ9A 1HYRC 1AFVH 1UVQB 1IC5L 1UCTA 4V1DA 3O0RL 1RULH 3PL6C 1HXYB 5CGMA 4LRNL 4AQ1B 4M5YH 1DJSA 1E27A 1OAQL 1SMAA 2JB5H 5B39G 5IR1A 1RZKC 3V5HA 2Z31B 3S6CA 2X70A 4YBQD 3ARBB 1IFHL 1YNLL 3TH3T 4F2MB 1TJIH 2EKJA 4J1UB 1AE6L 1OAXL 1ZHKB 2K7PA 5DHYA 5D7JD 1GOFA 3SDAB 1RUPH 1YEIH 2GIYA 5IJKA 2OI9C 3ZYZA 1WVZA 3FFCD 4Q9CA 1F4YH 3LN5A 4L3EE 43CAB 2G75A 2UV3A 4PPTA 3OKOB 1KTLB 4NM4H 4Y16B 7FABH 5IW6A 3NA9L 2GY5A 1QEWB 1QFWH 5DK0B 3NAAH 1GGCH 5FHAL 2MOVA 2AJ3B 1F6LL 3MLVH 3PP3K 4ZSOB 1UM5L 4LSPL 5L8KB 4LGPB 1GVIA 1SYSA 4OCYL 2R0LH 2MCPL 1FNEA 1H3PH 1PEWA 1J05A 4H1LB 3SKNA 4EZMA 5I6XC 3ESVF 3HC3H 2XRAL 4PR5B 2X1PA 3TN0B 4UDTA 4ZO7A 1IAKA 5DK2B 3OAYK 5K9JL 4LGRB 2AK4A 2D7PA 1CVRA 2MNUA 4K8RH 4UAOC 2PYEB 3QXAB 2A6IA 1KFAH 1SJHA 3IJSB 5E2UH 2IBBA 4IRSD 5FA3A 5IUSA 2CGRL 4JM2F 3DLQR 2ZUUA 2EDEA 5L88H 4LQ1A 4X8XA 4LBEB 5DMIL 2YEZA 4F58H 4YBQC 5F7UA 2VQTA 1J5OH 2ZUVA 4G5ZL 4CU6A 2NLJA 4I0KA 4MQXD 3P0YH 3SDDB 5CJBA 1LMKA 4I2XA 4RAUB 4FQLH 3T0AA 4TYUA 1X5JA 5C9JB 3FAXA 4LL9A 3IDIA 1U8HA 3CU7A 3OB0H 5EUKB 3I84A 1FYTD 2WNGA 1BP3B 1TDQA 1OCWH 5BQ7A 5JW3L 4JE4B 4RX4A 4HF5H 1NFIB 2OP4H 2V2XA 3AC0A 3LQZB 4HKBB 3VWKD 2HAZA 1A0QL 2LVEA 4ODUA 4P2YA 2X89A 5T5NG 4UT6L 2OSLB 4I9WD 3VRLF 4GFTB 1BIIA 3PL6B 4AEHH 2H8PA 5T3ZL 3D3VB 1ZVHA 3MLUL 4XPBH 1BAFH 1DQDH 4FQXA 4CL7A 3WHXB 4LU5L 3G6JF 4LLYB 5C9KA 5SX4H 1I7UA 2X4PB 5HDQL 4OSUH 5HI3D 3K8MA 5CWSA 5ICZA 4KQ3L 2DM2A 2XWJB 3JWOH 2GQHA 1LE5B 2MSPA 2OI9B 4HWUA 4LVHC 4ZO6A 5FCUL 2YUVA 5HHMA 2W9DL 3NIDF 4DOHE 3GBLA 4OUUB 4XP4L 1KJMB 2NY5C 4XRCB 5FUOH 3NH7H 5KG9A 1F13A 4ORGA 4Z7QE 2UWEE 5AAWA 3ALXA 3G9VA 3TZVA 3D2UA 4FABH 3T1FB 4PJ9D 3TF7A 5FUZL 3ROLB 3GSWB 3BWAA 3NTCH 1R3HB 3O6FC 3C8HA 2V17L 3CFCH 4PG2C 2R0WH 4IDJL 1IAMA 2X4TB 1T0NB 4IOFD 4MQXC 3ZDXF 4OM1L 4EN3D 4FQ2L 4DN3L 4PGDB 3H0TA 2MQCA 1J0YA 1PYWB 7CGTA 1JPFA 4JY6A 3EYSL 5I6XB 1JE6A 4UV7H 5IEHB 4H8WL 4H5SA 2PO6D 4M8VA 1PG7L 4GO6B 3JBG7 4OCNC 5EORL 1MFAH 4NQED 2J8UA 3HUJA 4ZNCD 4JN2A 2Z92B 3LKNB 5DT1H 3VWKC 1JPSH 2C9AA 4UAOB 3JWNC 3GNML 4UT7H 4QXWA 2APXA 1I8KA 5EC2A 2FX9L 5JW5A 2HLAB 2IJ0C 3ZDZF 1IBGH 2QSTA 1CR9H 3W11D 3EFFB 4Q2ZA 1N6UA 2HP4A 4QXGL 5HI3C 4ODVH 1T7WA 4AH2A 4NUJB 3QUKA 4GRWH 1NLDH 2F74B 4NKQB 2JB6A 3LKRA 1S7VA 4ZFGH 2UZXB 4NZUL 2DQEL 3FFCB 4KXZH 1S9VB 1KPVA 4Z8FH 3ARPA 2C1PB 4K3GA 1C16A 3PWJB 3OF6A 4MB4A 1M1SA 2BRQA 1KIQA 2NMSA 5EOQH 3B9KB 1BBDH 2KL6A 3UBXA 4AG4H 5DF0A 1GJIA 4GMTH 4IOFC 1S7XB 1I9IH 5MEPA 1FFNA 3RUGF 4KY1L 1EGJH 4GUPA 4Z5RB 1P4IH 2PO6C 1L7TH 5C70A 2GUOB 2R9HC 3S36L 3UJTH 3ZSSA 4LLWB 3VRIA 4ZNEE 4L8BA 5TFSH 5KOVC 1D5IH 3U83A 1JZ5A 4CADB 1YYML 3GMNA 4JY5L 4OBSA 5J4MA 3IFPA 4WY7L 3O3DA 1LEGB 4LVHB 3BVNA 3TNNA 1QLFB 4X98B 1JN6A 2QHLA 5J12C 3RJDA 1FG9C 1BZ9A 1WICA 5IB4B 3MNVB 5EU6B 3S5LG 2HN7A 1JGUL 4ELKB 1AJ7H 3GDBA 1NGXB 3QNZB 4Q9RH 4PJBE 4L8DA 3O6FB 4ZYKA 1PX3A 1OP3K 2P5EB 1WCQA 3MBED 5KVEH 5CCKH 2I9LA 4MXVF 2EIZB 5HYSA 5IK3A 4Y7MA 3CZJA 1KCUH 5BV7H 2FL5A 3ULVD 3VD5A 3UTQB 1UG9A 5J6HB 1KCVH 3EIFA 4HIJB 5JPNB 4CN6A 2ZCKL 4X6DA 2I07A 2FJFA 4UU9B 1EK3A 5FM4A 4ELMB 4G7YL 3GSXB 3VWKB 2YK1L 4X9GA 5JLZA 1MWAH 2NX5B 5E7FA 2AJVL 1F4XH 4LASH 3PGCA 2FATL 3FT2A 4W68A 3KYMA 5DRZA 5F89B 3OR6B 1GZPA 1RHFA 3F58H 4OB5H 3UPRA 5CZKA 4KK6D 1CCZA 3W0WD 3I9GH 1MH5B 3ZE0F 1W72H 5HHQA 1KELL 1E6JH 1KPUB 2R1XA 5KSVB 3MLTB 4ODTL 1RJLA 1AXTL 3HN3A 5L6YL 4MJ4A 3P73B 1IEHA 2FECI 4U4BA 4MNHA 5C09A 3KS0J 1RUML 1CG9A 2DS4A 2A6JB 5EIIB 1G9MC 4MD0B 1HWHB 1UB6B 4K3DL 1PGRB 1JK8B 2BJML 3DUSA 1S7WB 3EYVB 4KQ4H 2E27H 3TCLB 4KKNA 4WW2C 3QDMA 3BSZH 2WSKA 3OKNB 3FB5B 2A1WL 3EO9L 1R24B 2WWMC 1C12B 3MBEC 3RL1B 4OKDA 3CVIH 2ICEB 4N0YL 1T21B 3R8BB 1AO7E 4J3SA 1SY6H 2MPAL 3ULVC 1TCRA 4L4VA 4PRDB 2PO6B 2P5WA 2VN7A 1UC6A 1G6RB 4OLWH 5FYLE 4G8IA 1JGDB 3MRBA 4TOYH 3QUYA 5IJKC 4JVUA 2EH7L 3O3EA 4WFFD 1MF2H 2CR3A 1OAZL 5HD8D 1T66D 3DV4A 1QSVA 5DJ6A 3FFDB 4KK6C 2A83B 5J12B 2EO9A 3BH8A 1KV3A 4HMCA 2NZ9D 3W2DH 1OAUL 5E8OA 2IF7A 2HVJA 1NFDB 5HYSG 4GAYA 1F5WA 1URLA 3DMMA 4KROC 4TUOB 3G6DH 3P4NA 3NPSC 5AG9A 2F54A 1HSBA 5C07D 3JTSB 1AD0B 1IM9B 1C5DB 1UKTA 3D3VE 4M61B 5ERWA 2OR7A 2Z93B 3LKPA 2PXYD 3UTTA 5CJOH 1IAII 1MHCA 3IF1B 3DXAD 3QPQC 4V2BA 2G9HA 4H88H 4S1RL 4PJ8D 5K33A 2RB8A 5C6WH 1CGYA 4XHQA 3VFSA 1BM3L 2G2RB 4S1QL 4XXDA 3BO8A 5INDA 1BD2D 2EXYD 4QYOA 5FECA 3DRQB 6CGTA 1LO4L 3HZKB 5D1QA 4OIIH 2PYFB 5D6CA 1HIMH 5IBTL 1NEZA 3SO5A 3LS4H 1VFMA 4WGWB 2AERT 4FXKA 2YD1A 4YHIA 5EBLA 4PUBH 1CDHA 3HZMB 3ZTJH 4Z78A 4JAMB 1YMHA 5SX5K 4PYHA 1EVUA 3EYUH 1XMWA 1GC1H 5DQJB 1N59B 1SMOA 2ESVB 4OT1H 2DWEB 2EDQA 4FTVE 4TQEL 3EW3B 5EZOL 1FYHB 5EO9B 3CLFL 3DX6B 1TFHA 3GSRB 3PWPD 4LPCA 4Z9KB 5IFHL 1CFSA 1R3JB 5M7QA 3VRJB 1HHJA 1S5IH 4IHOA 4PG9A 2CLZB 2EDYA 3PGFH 1YEKL 4HGKC 3UTSD 3MX0A 5DJYA 1QA9A 2X2YA 1FNSL 3DTXA 2OJEA 5DJZB 4JGJA 4WW2B 1Q9WB 1ZANH 4MX7A 3QNXA 4UZGA 4WENB 4DCQA 1DEDA 3QO0A 4FXGA 5C0CA 1BJMA 3MBEB 2IGFH 5F1SA 4LVNC 1FZJA 1G7QA 1WLHA 3O8XA 3WD5L 1E27B 4FQXC 4PJ8C 2YD5A 4HFUH 1TZGL 2BNQA 4QKXB 4JM2A 2FX7L 1B0WA 3KPSA 2HFGH 5F7DA 5IHUL 3V5HB 3CLEH 1KTDB 1RK1A 1INQA 2X70B 3IDYC 5GJTL 5E08H 3LQAH 1X5HA 2MCG1 4XPGH 1UB5A 3C5ZD 1JGLL 5DHYB 4PJGF 2VUYA 2EE6A 3CMGA 4BSWB 4Z7NE 5EA0H 1NCNA 1KN2L 4KV5E 3FRUB 4FMFA 3NCFB 4JO4H 4NKOA 3MJ8B 3LN5B 2D7MA 3OJDA 1NBVL 3ES6A 5AZ2L 4RMVA 3S4SG 1MCPH 4DW2L 5IW6B 3TF7C 5DHVB 1BVZA 1DBKL 4KROB 1TTUA 5MENA 3NPSB 1XF4B 1HSAA 2APBA 2X05A 2R23B 3TWCL 1SYSB 1X6NA 1KIRA 5EOTA 4YHKH 1WT5A 5B3NA 1IGMH 1T89A 1FNEB 3WKML 1DDHA 2IAMA 4U6YB 5L0QC 1QPPA 3SKNB 1ORQA 4HLZH 2EYSB 4ONFL 5C08A 3VFMA 4QWWD 2YSSA 3QIBC 4NZJA 4XC1L 4LCWA 4UDTB 2C3WA 1E28A 4XWGL 4JDVA 4LNRA 2AK4B 4M5ZH 2LAAA 4F7EA 5BMFL 1G6VK 3CAFA 1C7TA 3RWDA 4A2LA 3CMOH 3T4YA 2A6IB 2VKXA 4M9PA 4XNXH 3MLZH 1SJHB 3N06B 3OJMB 4IMKA 1T1WA 1WGOA 5M94B 5T3XE 1RZJH 1R3LA 1ZA3A 2PTUA 2YEZB 2GJZA 1ZLSH 1AGFA 1A6AA 4XB8A 4WUKH 4PBVC 1D9KA 1T22B 3RIFF 5DJCB 2FHBA 32C2A 4CVZA 3CXDH 1AIFB 1CXEA 1WEJL 3QCUH 4I2XB 4URTB 3WMSA 1ZKAA 1UA6H 3IETB 5CP7A 1NDMA 1YEEL 4FQQA 3ULUH 3JV4A 1U8HB 3LPGA 1KT2A 4XNYH 4HKJB 3SGDH 1QACA 1FGVL 4NQDA 4JR9L 2XICA 2NX5E 3QRGH 2V2XB 3MODH 1MI5E 4ODUB 4WW2F 3FCTA 3TYFB 3SE9L 3MLXH 4WJ5A 3L7FB 3IU3A 1BIIB 3P9WB 2BOBA 3QEQA 2H8PB 4LVNB 4HH8A 1J88A 1JI1A 4FQXB 2FGWL 3I85A 3JV5A 1DBBH 2DQHH 2OBGA 3GK8H 4RWYH 1A7PL 1I7UB 3IDYB 3ULVF 4GW5A 1R5VB 4JKMA 1DSFL 3RY5A 1W0WA 3KYKH 1MOEA 4GKZA 4YX2L 4NRYA 4PJCE 4XCCH 1GGBL 2B4CH 5DR5L 1MRDH 1YN7A 5HHMB 4QNPF 4I77H 5CINH 1JZ7A 4NWTL 5DJXA 4LEXL 1F97A 1E4WH 2C4FU 4QOKD 5ITFB 1A1NA 4J23A 1MNUH 3D2UB 2F8OA 1Q0YH 1CGXA 4O5LL 1JWSA 5D7LE 4LMQI 4R26H 3DHMA 5FM8A 1HNGA 2HKFH 5I1AB 4D0CA 4RFNC 1CGSL 1CD8A 1J1OH 5D7IF 3QWOB 4WRLA 4HSQA 1CYGA 1MCBA 3M1BA 4N1EA 5BOPA 1ZLWH 1QLEL 1X5LA 1P5UA 3RUGA 4MB3A 3H0TB 3HNTL 5L0QB 4JY6B 4YXHH 1KB9J 3LKOB 3DYPA 3OBAA 3MLWL 3UTSB 4PP8C 3HAEG 2J8UB 3HUJB 1MRCL 3ULSA 1MHEA 3QIBB 1HH6A 1K6QL 1TZIB 3CVHA 5L2JA 4PB9H 4HAFA 5I66A 4JGMA 4JPKL 5C0AD 1LO3H 3BP4A 4A2MA 1JFQH 2ZOKA 4LKCA 3D5OF 2EIBA 3T0XA 1QYGH 1QRNE 2VL5A 3FOMA 3QUXA 1I8KB 5EC2B 5JW5B 2E6QA 3ILQC 4ONGL 3F7RA 1RZIB 2E8YA 5ADPH 4ZFZB 2DLEA 4Q2ZB 3ZKMC 1Q9KA 3UX9B 3GI9H 1X9QA 1ERNA 3MRJA 4LHJB 3QUKB 1R3IL 2RBLA 2VL4A 4KTYA 3FO1A 3Q3GA 3S35X 4P2RA 1HQRA 4RGOL 4EUPG 2Y5TA 1IC5H 3VFOA 3VDCA 2A0LD 4PP1D 3UPCA 3O0RH 2DKUA 3UJJL 1KJVA 4LRNH 3OKEB 3E6FA 1C16B 2Y6SD 1IJ9A 1RU9L 1OAQH 2JJSC 4HPYL 4X4MA 5C0RL 1KIQB 1FG2A 3MRLB 4DUWA 2VZ3A 3MLPA 2MKLC 2AJYL 3UBXB 2OL3A 1IFHH 3HNSL 4JM4L 5CBEB 5BW7A 5MEPB 1AE6H 1OAXH 3KPTA 4RZCA 3U79A 4ZG1A 1FFNB 4X8JB 1YQ2A 3JTTB 3L95B 2ESVE 3FT4A 4RAHA 4GUPB 1G7MB 4MJID 5GGVY 3K4DA 4JO2H 3RVTD 1MCQA 4P5TA 1KG0A 1I8LC 4L8BB 5FM5O 1B9ZA 4M7KL 1A2YA 5FYLL 1NSNL 3GMNB 3NA9H 5JIKA 2QHRL 5H94A 4YDIL 3PABA 5FHAH 3O3DB 2W0FA 4E41A 3TNNB 4EBQL 4HJGA 4DUVA 3RZCD 1UM5H 4LSPH 4EDWL 5IQ7L 4ODHL 4OCYH 4G7VL 3ABZA 2MCPH 3I75A 1L9NA 1F8TL 3MV8D 5IVZA 1MFCL 2HN7B 4K7PH 3DMMC 4V1DE 2OQJA 5E8DH 3L3DA 3MRCA 4L8DB 2XRAH 3SGEI 2GI7A 4LQFL 4UV4L 4RFNB 5F7NC 1A6PA 5K9JH 3HB3C 1XGUA 1I85A 1BEYL 5IK3B 1J1PL 4LF3A 4PRHD 4G6AD 4KJWD 3UC0L 2FL5B 1EUUA 5GS2D 3QULB 2BNUA 5F71A 4F7PA 2CGRH 4X6DB 2I07B 2FJFB 1CF8H 1KCRL 1U3HD 5DMIH 5J1TC 1K3IA 1N7ML 5D1QC 4HAGA 5HHVL 2DTSA 3L3GB 4F3FB 4G5ZH 1MQ8A 5IT2L 3OGCB 5E24E 3KYMB 4NDMB 2PUQT 4LLMA 3O45A 5DRZB 1GZPB 2V5RA 4RGNC 2AJXL 2H26B 4HDIA 4Y4FD 3UEZA 1BQUA 5HHQB 5IQ9A 3DV6B 2R1XB 1RJLB 4Z7OF 3BDBA 3ALWA 5C09B 1BFTA 3VG0L 3H3BC 3QI9D 3VGEA 5JW3H 1UJ3C 4ETQA 1ZA6A 1MCWM 3D85D 3V6ZA 2X1XR 1FVEA 1AY1H 2QSQA 2YC1A 4ZTPL 3QCVL 5B8CC 1A0QH 5JA8B 3DUSB 4DQOL 4UT6H 2XN9E 4OF0A 2XZCL 4LSQL 4XX1G 2VN4A 4F57L 4Z0XB 2J88L 2NY7L 4C58B 3QDMB 3ZE2F 3K1KC 4LU5H 3VWJD 4PJFA 5CUSL 5IEKB 3E3QA 5I8OL 1QFHA 1IEBA 5F7KC 2D0FA 2FEDD 1FP5A 5BXFA 4JPWL 2GK0A 4LPWA 4BFGA 5FCUH 2QADD 2W9DH 5HPMA 2D7TH 1DANT 4XP4H 3EOBB 1TCRB 3LZFH 4LLVB 2H45A 4L4VB 2VLJD 4WFEE 2P5WB 2IWGA 4G8IB 4OZFA 4N0UA 3V4VL 2I27N 4OF8A 1S7SA 4JPVL 4I2XE 1MJUH 3MV7D 5E70A 2YRPA 5FUZH 1EXUA 4JHBA 3TO4D 25C8L 2V17H 3QIUA 1H5BA 3GMOA 1IGYB 4PJHE 2CJUL 5DJ6B 3HHRB 5D5MF 4JG0L 1AR1C 4FN0A 3H8NA 2DM3A 1RZFL 5L9DH 2HVJB 4ZS7L 1CD0A 4GAYB 5CEYB 3DMMB 4YHNB 3P4NB 4H8WH 2F54B 2G5RA 1A3LL 1PG7H 5EORH 4DKEL 3HPJA 4NJ9L 2V9QA 4QHMA 1WT5C 3IFLL 3LKPB 4U2ZA 5C1MB 1T89C 1U91A 2IAMC 3PWUA 2ZSWA 1UXWB 2Z4QA 2G9HB 2ADFH 3GNMH 4WHYH 1S9YA 3VFSB 5JXAL 4XXDB 2Q8BH 2DIBA 2FX9H 1A3RL 4ZUTA 5INDB 4FZ8L 4QYOB 3IDGA 5D71L 4POUB 3KPLA 5HHME 5FECB 5D1QB 1I3GL 1QFWI 3DGGA 3KLHC 3QDGD 5D6CB 4QRQB 2VZSA 1HEZB 4NKIH 1NEZB 4FG6C 4LP4A 4O2FA 3T2NL 4FXKB 4YHIB 5SV3A 2NY5L 4IMKC 4RGNB 5EBLB 4QTIL 1A4KA 1YMHB 4NZUH 2DQEH 4YPJA 1I7ZB 5F9WC 5T3XL 4QRUA 4LSSH 3RQ3A 1D9KC 4DZBB 3HRPA 4JRXD 2E5EA 3RPKA 5K59F 3BQUD 1TJHL 1SVCP 1UJ3B 1U8JA 1DE4A 4G8GD 4ORZC 4FFEX 4AL8L 5B8CB 5J57B 1H8NA 5DDHA 3HUJE 3O11A 4Y1AD 5GGSB 1EFQA 4GSDH 3ROOA 1T04A 3H6JA 5DJYB 2ZSVA 1QA9B 1K2DB 3DTXB 5E9DD 4Z76B 2OJEB 4KY1H 4F33A 1AQDB 5ITBL 3QNXB 4PY7A 5D2NA 3QO0B 3BXNA 1FZJB 1MAJA 1G7QB 3G5XA 1YYMH 1QLRA 5HGHB 1WC7B 1CGTA 1U8LA 1B0GA 5I8CB 15C8L 1NAKL 4KKAD 3CD4A 4WY7H 2LU4A 5F7DB 4MAUL 2ZZUT 2EZ0D 1RK1B 1INQB 5C92A 1WTGT 2GFBA 5ALBL 5FAAA 2CIKA 1Z9SA 1U2HA 5D9SA 1UB5B 4L3CA 2EYTA 5DSCA 3N0PB 1BGXH 2W9EL 2X6MA 3K2UL 1JGUH 1FZOB 3QSKB 3GMQB 4OCRL 5CZVL 5J9PA 3V9FA 4NKOB 2CRYA 1WISA 1A4JA 3VI4E 3OJDB 2A9NL 4M43L 4R0LA 1RZGB 2K9UA 3ES6B 1RJYA 5EBMA 4POZD 4NJAH 2DM4A 4H0IA 4XH2A 2OTUA 4XBEL 5SX4I 3HZYA 4LSUL 2Q7NA 5EO0B 2A38A 3KPNA 1HSAB 2PR4L 5EOTB 1KIRB 1QSZA 4G7YH 1FNAA 2IAMB 1E6OL 3BGMA 4U0QB 3HR5A 1VFOA 4G9DA 2AJVH 5D7KD 1EBPA 1ORQB 2FATH 2NY2D 1LQSR 3WDJA 1A9BB 5C08B 2YR3A 2YSSB 2B1AH 1G6RL 5JUEL 1QD0A 4LNRB 4Y5VA 4S10A 1XF2B 5E8NA 3SCMD 5I0DA 3RWDB 3T4YB 1XGYL 4CAGA 1ADQH 5L6YH 3NA4A 3D48R 4N9GB 4OLYH 3HMWL 1JHTA 4HIXH 1RUMH 4PV8A 5JZ7D 3WS3A 4KKAC 4K3DH 2ZCHL 4UILL 5BS0A 4U7SA 5DHXB 1R3LB 3HI5H 1UYWL 1ZLUK 2GJZB 2QSCH 1H3TA 2VLJB 5F9WB 5JQ6L 3MRNA 3EOYG 3P4LA 1Y6MR 1D9KB 3H7BA 2XACC 4GXVH 4P57A 5FB8B 5DO2D 4KDWA 3O3BB 3GB7A 4MXQA 4K2UL 1K3ZA 5GGRY 3EO9H 2YD6A 3V52H 5CP7B 1NDMB 1NCCL 4X6DE 3JV4B 4N0YH 1KT2B 2ZPKL 3EJJX 1EEYA 2VDKH 4HWZA 4NQDB 1WFUA 4K94H 4ODXB 2MPAH 3O4LA 3KS0H 5FV2A 5D72H 2RGSA 4RFEA 5ADOL 5BW7C 3OGOE 3AS3A 3L9RA 4WJ5B 3IU3B 2BOBB 3QEQB 5E1AA 1DLHA 1DQML 2EH7H 1WV7T 3WCYA 3EAKA 4KXZI 3QYCA 1OAZH 1J7VR 1L7IL 3LPWA 5C09E 4K8RD 4GW5B 1UQSA 4OTXH 4HJJH 4X7SH 1W0WB 2VWEC 1OAUH 2IBZY 4LSTH 4OLZL 4NRYB 2VIRA 5AAMA 3MXWL 3QDGB 2PKDA 4RQQA 5FDWA 4QXUL 5JZ7C 3PHOA 1BLNA 5DJXB 2CLRA 5E6YA 4WTXA 1SEBA 3QDME 3VH8B 1A1NB 4IJ3C 4S1RH 3TFKD 4G3YH 3ZYOA 3T3MF 1JWSB 1I1CA 3IXAB 4MSWA 3G6AA 5FYKE 4D0CB 2AQ3A 1FBIL 1DVFD 4G6FB 2A74A 4G8GB 3M1BB 5J8OA 1I85C 1LO4H 3S3SA 1KGCD 4L4VE 1G1YA 1H3VA 3NIGE 5A3ID 4Y1AB 2W0PA 2VZOA 1XR9B 3ULSB 5I19L 3OAZH 2NQCA 1HH6B 2O61B 3KLSA 3CVHB 3QQ4B 1VERA 5C0EB 4LRIA 5I66B 5K9KA 2DQGL 1BD2A 3BP4B 2ERJC 4TQEH 4NO2A 3GSOA 2HFFB 1AGCB 1OGTA 2VL5B 2W65B 3FOMB 5ICYB 2DLGA 3CLFH 3VXOA 1XIWD 4GRLA 1DR9A 2WINA 3T3PF 3O2DA 4K8RC 1Q9KB 4YR6A 3UTTE 4X4YA 4G9FD 5GGRA 1GL4B 3FO1B 3Q3GB 1FNSH 4P2RB 1HQRB 1MRFL 1J12A 3QQ3A 3EZ8A 2XG5A 1Q8MA 1YJDL 4KI5C 4L29B 2H32A 3ZYJA 4LLQB 1HOCA 1MAML 1MVUA 4YO0B 1KJVB 3E6FB 2PW2A 4MNQA 1NANH 2BMKA 1SEQL 1U92A 1TZGH 4OZHF 2YZ8A 3H9SA 1FG2B 4R4FH 5IHUH 4NBZB 3H7LA 3E3QC 2COQA 2OL3B 1AKJA 3HS0A 4LHUA 1JGLH 4RZCB 3WNLA 1CE6A 3B8YA 4LSRL 2CK2A 5D8JL 5F9AC 4TUJB 4X7TB 5A3IC 4ONHA 2J8HA 5D96C 2AJSL 4XCYA 4ZUUA 5EBWA 4Y4HA 4MJ5A 1A2YB 4KMTL 1TCMA 4FQJL 5DRXA 2YXMA 5H94B 1FZKB 2WIMA 2A6DB 2ZG3A 3QIUC 4E41B 2BSRB 3P30L 3MRKB 1WBZA 3TWCH 1N0XL 2AVGA 4P2QA 1XIWC 4S1DD 5J7CC 3I75B 5DMJB 1S5HB 4MMZC 5J3HD 1CLZH 3PQYA 2W60B 1A14L 5IVZB 1FVDA 4IJ3B 3VXNB 4WWID 3L3DB 4H0HB 1MCWW 3MRCB 5C0CE 4ONFH 4ZFOA 1WK0A 1RHHB 4D8PA 4XC1H 4FFYL 4QCIB 1LNUA 2BNQE 3MMEA 5J1AA 2F53E 3KPSE 3QDJD 4XPTL 4IRJD 5LCVL 5T33L 1H3WM 4XP1L 2APWA 2UY6A 1FAKT 2BNUB 3V0WL 3HFML 4F7PB 4KJYA 3JZ7A 3RY6A 4PRIA 4R96A 3BMVA 2Q6WA 4TUKL 3GBNL 2QQNL 2X4SA 3FB7A 3VFWB 5LVEA 2FJGA 3QR2A 2ERJB 3W82A 4LLMB 3V0AC 1P4LA 4LOUC 3RVWD 5DI8A 3SDCA 5IMLA 5IQ9B 3KPOA 3RGVD 1S7RA 2QR0A 3I6LD 1B4RA 5MENE 1MIML 5F1NA 5HVWA 4JFEA 5ELIA 1H3GA 1G0XA 3VRLE 3ZTNL 3MUGB 1FGVH 4JR9H 5CEZH 4ETQB 3PP3H 4PB0L 3V6ZB 2E9WA 1G9NH 3MRPB 3G6JE 4OD1L 4LCWE 3MRGA 4OJFL 3MCKB 4KKLD 5J3HC 4M1GL 1II4E 1RURL 3IVKB 3QIWA 4I5BA 4EEEA 2FGWH 3UXFA 4KHTL 1T6WA 4WUUD 4M6AA 2XWBB 4MA3B 4PJFB 5D2NC 1YEGL 3NIDE 1K5NA 3OAYH 3MCLH 4AEFA 2JE8A 4LPTA 3DO7A 5H35A 1ZT1A 1TLKA 4YX2H 5BXFB 4WHDA 3LHPL 5ALCL 2GK0B 4PJ5D 3BE1L 3RKDD 1I4FA 2VLME 1ND0A 4NWTH 3EGSA 3QZWA 2X42A 3C8DA 5D96B 3CK0L 4OZFB 3S3PA 2IANA 3SJVD 3L3OB 1T0PB 3DUHA 1RK0A 4WCYH 3ZDXE 2VH5H 5HGBA 3B5TA 4OGAD 1S7SB 5T1DH 1FFPA 1UCBL 1EXUB 1UWEL 1BQLL 4U1SB 5DRNA 3QIUB 1I3RA 3GMOB 1S78D 3C6SA 4QGTA 1CGSH 3K0WA 3TIEA 1OSZB 4R0LC 3ZT7A 1A7RL 1XIWB 4I0PA 2VISA 1QLEH 3RGVC 5I1KL 4LPYA 2FBOJ 3HNTH 1EFXD 1MFBL 1HHGB 3VFTA 5EZJA 5HHOD 3HG1D 1KYOK 5HSFA 1PBYA 3HPJB 4G9FB 3VXUA 1EH9A 3RWCA 4QHMB 3VCLA 1V05A 2O5YL 5DFVC 1MY5A 2ZSWB 5GRUL 3ZDZE 2Z4QB 3DX9A 4JPKH 3X13A 4HUVA 4E0RA 3HZVB 5JIHA 5TJWK 1S9YB 4KKLC 2IBGA 2IPTL 2VDOL 4MDIA 4ZUTB 4ONGH 3IDGB 5DC9B 3KPLB 1WBYA 2XIDA 4ZPVA 2F19L 3QUMA 3DGGB 4NKDA 4OQTA 2EDXA 3VDAA 4GAGL 2QQQA 1R3IH 1MIEL 4LP5A 4O2FB 3QXDA 4QEGA 3IJYA 4RGOH 3RKDC 1U3JA 1J1XL 4ISVA 4WWKA 5ESAA 2VZVA 4H1LH 3IDUA 4QRUB 5MHSD 5FOBA 1LEKA 3L3KB 5IKCB 4EDXA 1HINL 5F6HJ 1KF9B 3TCXA 5B3JF 1RU9H 2DD8L 2KPNA 3BKCL 1R3KA 5KS9A 4HPYH 4TN9A 1G9EA 1U8JB 1DE4B 2AQ2A 3RUGE 1EHXA 4KTEL 1BFVL 4JHAH 5SWQA 3RGHA 3HNSH 3GKWL 1CD9B 4JM4H 5F88B 5DDHB 2AABH 3O11B 4FQHA 4LK4A 2VLLA 1T2XA 5H2BA 2ZSVB 2CH8A 3FN0L 1HWGB 4F33B 3LRGA 5D2NB 2B0SL 4M7KH 3LDBC 4RAVB 5IBLC 1IC7L 1QLRB 4HXBL 5C6PB 3F7YA 1U8LB 2QHRH 4MNGB 3EUUA 4YDIH 4JDZA 4B7IA 4EBQH 2R0ZL 1J86A 1KC5H 3FZUC 4ODHH 5D9SB 5CZXD 4L3CB 2EYTB 3Q5OA 1F8TH 2WMPA 3ALPA 5FEBA 2ENSA 4IEFB 4PRPD 5J9PB 3U30C 3TEUA 3ARFA 2L7UA 1A4JB 4LQFH 4UV4H 2RIKA 3TVMD 2B5IC 4R0LB 4ZD3H 1RJYB 1N5YL 3RWJA 1BEYH 4X6FA 3RGVB 1J1PH 3UC0H 4DKAA 3AU1A 2OTUB 1RZKH 3HZYB 4O4YL 2GYSA 3KPNB 1Z0MA 5I18L 1MFEH 5FYKL 4PGBA 1KCRH 1N7MH 5HHVH 3ZE0E 1HZHH 2BXZA 2D7NA 4GW4A 4OF6A 1WZMA 3VMOA 5IT2H 1CWVA 2X5PA 3GMPB 4OF3A 1U42A 3F7PC 4FQCL 4HEPG 5C8JB 4UQ2A 1QBMH 3WBDA 1K8DB 4XMPL 3INUH 4JFQB 4LRIC 4WUUB 5T1LA 1JV5A 3NZ8A 4LIQH 4FRWA 1OP5K 4E41E 1T03L 2UY7A 5HI5D 1M7XA 3CFBA 4PJ7F 1JHTB 1N2RA 4PV8B 3VG0H 1R5WB 3X12A 4GRLC 4JZOA 4D2NA 5BS0B 2BSTA 4ZTPH 3UZQA 3QCVH 1H8SA 1WFTA 1LDSA 1CFVL 3NBNA 4DQOH 4Y4FA 3MRNB 4NQUA 1QUNA 3O41A 3QPXL 1QBLH 3H7BB 2XZCH 4LSQH 1F2QA 4XT1C 3KPPA 4XAKE 4P57B 4F57H 3E6HB 3GB7B 2J88H 3ZKXC 5SWZD 2ZKHH 4N8CH 4JDTL 1OP3H 1MQKH 5BRZA 2OMBA 5I8OH 5HY9A 1H15A 4I3GA 1IAOB 3TVMC 4FQIL 4ZOBA 1EEYB 4JPWH 4XXCA 2HT3C 1XH3A 4HWZB 1H9VA 1WIPA 1EFXB 3B5GA 2F5BL 1QSED 4GRWF 4HHAA 5HHOB 1T4KA 1TVBA 3TA3D 3JUZA 3ZT5A 2VITA 4G6KH 1A7BA 1G1CA 4QRTA 1ACYH 1A1OA 3VWJA 3L9RB 3V4VH 4LCYA 3LDBB 1GRWA 5E1AB 4CVWA 2VO5A 3PE9A 4JPVH 4L9LA 3FRPG 5I1CL 3BW9B 4CMMB 25C8H 3IDMA 2WQRA 2CJUH 5KZCB 3EYOB 4JG0H 1UQSB 4Y4HC 2PW1A 4BFIB 1AD9B 3D25B 4NSKB 1RZFH 2ED7A 4YHML 4ZS7H 5E2TH 1CDYA 3RWEA 3WDHA 5HYJA 2VIRB 2GJ6A 4MB5A 5KW9L 4V3EB 3BPLC 2R2CA 3DPBA 4RQQB 5FDWB 1A3LH 3MV7A 2Z8WC 4J6RH 2BVQA 4NJ9H 3U30B 3WEXA 3PHOB 1KEML 1BLNB 1JMZA 1IARB 5I71C 2YZ1A 5JHDB 2YD2A 2B5IB 2HG5A 1SEBB 1ZS8B 3QEHA 4AIZA 4F7CA 4HUWA 3U0PA 3GGWB 1X5YA 5A2IH 2P46B 2KDGA 4OZHA 5JXEA 4JLRA 2Y7QA 2CPCA 3O6MH 4D0BB 3KR3L 4OV5A 4W70A 2DL9A 4N68A 1JZ4A 3GIVB 4FZ8H 4NNPH 1IQDA 2A74B 4I9WE 4Z7UA 1F45A 4WGVB 3ULUD 1GPOL 3LV3A 4N9OB 3TT1L 1G7LA 3BIKB 3L5JA 4HGWA 1F2XK 4N0UE 3T2NH 2NY5H 4P3WA 1SJEA 2RQ8A 4M4PA 2ZCLL 1KOAA 1RUKH 4QRPD 5D6DA 4O02H 4NO2B 1P84J 3GSOB 1TJHH 5DURB 5D4QA 3CH8A 3QFDA 3VXOB 2VR5A 3O6LL 3SDCC 4B5EA 2CO6B 4GRLB 4P59L 2WINB 3V0VA 5J11C 2YKLH 2P8LB 1KCGC 1CE1L 1RY7B 4LLUA 1HHKA 3RDTD 3VFRA 4YR6B 4X4YB 3C5JA 1CFBA 3PWNA 4MAYD 3ZKXB 4M9OA 5ITBH 2ZUWA 5CJXA 1HXMA 1U36A 4JANA 1NMBL 2H32B 3PHQA 3TVMB 1S9WA 3VU2A 1KCSL 4YHOL 2BZDA 2PW2B 4MNQB 4EVNA 1CFNA 2BMKB 3QIWC 4Y19D 2R8SL 1MUJA 15C8H 1U92B 4PJGE 1NAKH 2V6HA 2CUIA 3P0GB 2XA3A 4XVSL 3VFVB 4NC2B 3RAJL 3BYYA 5EU7C 1S7QB 1AKJB 4JFHD 5DMKA 3MACL 5F7YC 4LHUB 3U4EA 2W9EH 2FIKA 4TRPL 1QBAA 5HHPB 1C1EL 2NXYD 4O2EA 1ZK9A 5I75C 4OFIA 4ONHB 2OTWA 4XPHL 3WNPA 6FABL 2GAZB 4C56D 5SX5H 4ZUUB 1YQVL 4M43H 4NQCD 5CD3A 4Y4HB 2NR6D 1NUGA 1E4KC 1H0DA 3TP4A 2YHGA 3KXFA 5DRXB 2BSED 2HRPL 3GSQA 3BPLB 2D31A 1MCKA 1R5IA 2JCCF 4LSUH 3OZ9L 5M95B 2PR4H 1KEGH 4P2QB 3T09A 4HIEA 1Q1JL 4P23D 4UI2A 2I26N 4U33A 3PQYB 1FVDB 3BUYA 5CIPA 3ZE1E 2IG2L 3RDTC 5T1MA 4PJIF 5IVXA 1I1AD 4ZFOB 3U36A 1BQHA 1G6RH 4M02A 4DK6A 4MZ3A 5SWZB 1LNUB 4F9PA 3MMEB 1FNHA 4H20L 1VFAB 1XGYH 3U0WL 2EEBA 1GZQA 4S0TD 1L0XA 3REVA 3HMWH 3HI6H 3OKYA 2EDHA 3V6FA 2XNAA 3WLBB 1HHHB 2ZCHH 4M1DL 2FWOB 4GG6B 5ISZA 4QRRD 1QSEB 1UYWH 2H2PD 2XXCB 4PRIB 4R96B 5L7XH 5GSRB 5JQ6H 2Q6WB 2X4SB 3FB7B 2FJGB 4GS7C 3SQBA 5JOPD 3N9GH 1K85A 3R06A 1EHAA 1P4LB 3K46A 4JFDD 4K2UH 4PJEA 5TF0A 3VD7A 4PTTA 3MYJA 4U1KB 5DI8B 4LHQB 2NXYC 3SDCB 4WWKC 3WN5C 5IMLB 5J11B 1S7RB 2J4WL 2QR0B 2DN7A 1NC4A 1NCCH 5F1NB 2H9GA 2NR6C 3L7EA 4JFEB 2ZPKH 3Q1SL 4NRZB 2AEWA 2NW3A 5IFJA 1AXSA 4NCDA 1DTUA 4PDCE 3ILPA 1JJUA 4OFKA 1J8HA 4ZUVB 2P42B 4JJ5A 1ZV5A 5E4EC 4EXKA 5ADOH 1A7NL 2FHCA 1NGZA 3MRGB 1NGPL 4DUXA 3QIWB 3L1OH 3I2CH 3CVHL 2AJUL 2D4FA 1K5NB 4XVJL 1CDBA 4GBXA 5H35B 1ZT1B 3V7AG 3BD4A 4RBPK 4OZGB 1NC2A 2D3VA 3BKJL 3ZDYF 1G9MH 4OZ4B 3W0WE 1FDLL 1I4FB 5E94A 5I75B 2E8ZA 3QZWB 3FOLB 4EI6B 2X4OB 5B21A 3L3JA 2IANB 1RK0B 5D7IE 5FK9B 1VFUA 4CU7A 3D9AL 5HGBB 1FFPB 2LU7A 1Q9OA 2CLVB 4K71C 1I3RB 3ARFC 3C6SB 4NC1C 2XV6B 3OG6B 3IAGC 1FBIH 2ARJA 2QJDA 3TIEB 4YHLL 5ANMA 5D1ZD 3O4LE 3FL7A 1YPZA 3V4PL 3VFTB 3RDTB 5EZJB 1GYAA 1OM3L 3TFKA 4J4PD 2OL3L 4NNXA 3VXUB 5I19H 2BCKA 4GW1A 3MCG1 1NMAH 4WEBL 1P9MC 2XPGA 3X13B 2Z8VC 2NYYD 4GXUM 4HUVB 4E0RB 4NQSA 1Z9OA 4MA8L 1J0IA 2VLKA 3BD5A 4WFGE 1MLCB 1ZLVH 4XGZA 1AGDA 5F3BA 3K8KA 4Y19B 2HH0L 1WBYB 5C71A 4ZPVB 3BT2H 4NKDB 4GG6F 5DHVH 1CN4A 1RIHL 1JYWA 1DQLL 1VPOH 1HKLL 3PWLA 4GS7B 4OD2B 3VE0A 4M1CC 3W5NA 1NGWA 1KLUB 3IJYB 4S2SA 1X5KA 4XVUD 5IM7A 2GEEA 3TJHD 2H1PL 1ED3B 4ISVB 3CX5K 4NOBA 4TSBL 4WWKB 3WN5B 5ESAB 3VXMD 1MAMH 1LEKB 2BC4A 5FOBB 5LJYH 4EDXB 5DVLA 4NQCB 3UCRA 1GAFL 1N5AA 1U8NB 1OGAA 1SEQH 4GKNA 5F7FA 5KS9B 1BF8A 4NO5A 4R2GD 3IJHA 5DJ0A 3PDOA 1OQOA 1CL7L 2VLRA 5E4EB 2DWDA 1HDMB 5B38A 5EU5B 3QEGL 1BJ8A 1X5ZA 2XTJC 2XQBL 4L4TD 4LSRH 4XXCC 1ZGLP 5JMOC 5D8JH 3FB6B 2IPUG 1LK3L 3FQUA 1LE9A 3TO2B 1BD2E 2OMNA 3L6FA 3LB6C 3WJLA 1CS6A 2CQVA 1BWWA 4L8SC 2YMXL 2IC2A 2AJSH 3GO1H 1WZ1L 4M00A 3DRTA 4UTBL 3WFBL 3VI3F 4CN1A 4L9LC 2DQIH 5EOCH 1PSKL 1RIVH 2VZTA 1REIA 4OZGF 2EECA 4U0RC 3ULUF 1RUQL 2Q3ZA 3P30H 4J3VA 1CFTA 4X6EA 2DKMA 1LP9F 1N0XH 4YGVB 2XZQL 2X4UA 4XNQA 1FORL 1A14H 3AAZB 1G7HA 3C6LD 1NCBH 5LBSL 1L8JA 3GIZL 4K71B 3WLWC 2FLRT 4KJQC 3ARFB 3KAAA 4MNQE 4FFYH 4X83A 3GMLA 3H9SE 3RWJB 3QXWA 4XPTH 1JIBA 1YEFL 2VZUA 5J89A 4WEMB 5T33H 5LG1A 2M8XA 4XP1H 3HFMH 2HT2C 1OTSC 3RI5F 3X3FL 5TH2A 4PGBB 4D9QE 3G5VA 5E5MA 2X4QA 4GW4B 2XG4A 2GCYA 5GGVL 2BSSA 3R0NA 3S9DB 2R1YB 2EDTA 3QDJA 3MA7B 1B0RA 4Z7OE 1JWMB 1E0OB 1Z3GL 1X4XA 4Q74A 5EULV 5D6DC 4P2OD 1FN4A 3FQTB 1JV5B 5EUOF 5IBUG 1MIMH 1ZXQA 1WUNT 3EDDA 4NPYB 1UM4L 5E00A 3PXHA 4HV8B 1N2RB 3ZTNH 4U3HA 3PQYE 3N85H 4PB0H 5DD6B 1VKXA 1I8MA 2B2XH 3STBA 3ZE2E 3EJYD 3OX8A 2CKNA 5E7BA 2DL2A 3RHWK 4OD1H 3O41B 1QSFD 4LARL 4OJFH 2FBJL 5B38G 2HMID 4M1GH 5FO7A 1S7UB 1RURH 3BPCA 4DGYL 5CJXC 1ORSA 4KK8C 1Y18A 4P3DA 5BRZB 5L2KD 1ES0A 1YEGH 1ZOXA 1X7QA 4CGTA 4OCXL 1H15B 3VXSD 1VB9A 1QOKA 2BERA 3BKYL 4X6BB 5CHNA 5BCAA 2XTJB 3NFSL 1PEZA 5ALCH 2BNRD 3MUY1 4NO0A 4LGSB 1I9RL 2ZNXA 1T4KB 1TVBB 4YZFF 4L8SB 2O5XL 3CK0H 4QRTB 5D5ME 3BGAA 1XFPA 4L9LB 2VABA 2FD6H 1UWEH 4QY8A 4U0RB <