1RJZA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rjzA01
3UTTB 1PLGH 3QCUL 4U3HA 1X5GA 3D87B 4ORGA 4U1MB 4PJ5A 3V5HB 5CUSH 3DV4B 5D2NC 2D4DA 4NJAH 1XF3A 2KZWA 2C3VB 4CVZB 5DMYA 2P5WA 3BYYA 3L3GA 1QSED 2EH7H 3DMMA 2Q8BL 4ODHL 2DJ4A 1L9MA 2JCCA 1MPAH 3A67H 1TTUA 4NKIH 5DQDL 2XYCA 1QFWM 3GBNL 3VG0L 4EN3B 3G5VA 1ONQB 4EUPA 1A7NL 5ISZA 2E8ZA 2BVPA 3C5ZC 2C9AA 4RZCB 3OKYA 1CFTA 3K7UA 4GAJL 3FB5A 5BZWA 1DTUA 4S0TD 4KKCD 5C2BL 1T1XA 1YEFH 4Y8DC 2O61A 5DC4B 2Z93A 3SQOH 3RIFF 3MV9A 1A7RL 3JBG7 1T80A 5AAMA 5IFAH 3O8XB 5C07A 1RJYB 3KHOA 4KROC 3FO1B 1SY6L 3AC0A 5SWSD 1FFOA 5D96B 4M7LL 4HWEH 4JM4L 4OKVB 2AXFA 1MFDL 2YA0A 1TQBB 5IIEB 4KZDH 1LO4L 2VOTA 4YO0B 2CMRH 1N7ML 3I50L 2XWJA 3B9KD 4H1LB 3E3QE 3WSQL 4IOIB 2P48B 2W07A 4LU5H 3V5KB 1YNTA 4OFYD 4GBXA 2ZNWA 3OPZH 5DT1H 5FGCE 3HAEG 1AD9A 3MBXH 1CZ8L 4IOSD 2CGRL 3ZHLA 1YQ2A 3QQ4B 43C9B 4HMEA 2EDOA 3LN4B 4OZ4B 2DI7A 4M93C 43CAB 2BVQA 1IRAY 1BJ8A 2ZNXA 3WNKA 3DUSB 5CGTA 3FQWB 3OHXA 1I8MB 1FCGA 1TJGL 2FX9L 3M1BA 5KVEL 4RFNC 3H42L 4NQCA 2LU7A 1AE6H 4IRSD 4IIQA 4ZUSA 1K4DB 3FB7B 3V5DA 3RU8H 4M7JL 1W72B 4XPBH 4OB5H 1AY1H 3S35H 1WFNA 2W9EL 1ZS8B 3BKCL 3EJYD 5F89B 2BP3A 4DQOL 1U42A 3DVNB 1T3FB 1J05B 1BD2A 2AQ3A 3IFNH 4FOMA 2J88H 1I1AC 3WDJA 5DR5L 1JFMA 3RWJA 2HLFC 1GL4B 1GOGA 3MLXL 1QPPA 1A3RH 3TO4C 1SJXA 2R23A 5I9QB 2CK0H 1T04B 5L2JB 4HX1B 5KVDH 4DW2L 4GAFB 4GKSA 5CJOH 1JVKA 2AXHA 3L7EB 5ENWB 3LPGA 4F33A 4LEXL 4YEEA 1NGXA 5HHMD 1JWUB 3SJVB 5HHOB 1UXSB 1MFAL 2H32B 3FCTB 2ZCHH 3H9SA 4F2MB 3IETA 2IAMC 4F8TA 1P6AB 1MCOL 5FUCC 1DE4A 2ZPKH 4JM2F 2OJZL 3VXMB 5KVGH 2BSED 5DD1L 3OMZA 4AIXA 2BRQA 2VLKD 1H5BB 5I18H 4EUPG 2CDEA 5CP3H 5I6XC 1N6VA 2QSCL 3FL7A 2BXZA 2RIKA 3U46A 3NIGF 4N90E 4IMKC 3T0EB 5DMGD 7FABH 5IFHL 5EO9A 2H3NA 1EXUA 1CDCA 2Y5TB 5TF1H 4LMQI 5ID1B 1ERNA 2JLLA 3ULUC 2I9TB 4QGTA 1TDQA 4OTXH 3AU1B 4BUHA 2IAND 1D9KA 3QULA 4BKLA 5MHSE 1CIUA 4XMLL 3RX7A 1LHZA 4M62H 3QCVH 1BFOB 4LLWB 1OCWH 1S5IH 2YBRB 2V7NB 2V9TA 5BZDB 3G6JE 1IGTA 5EOQL 4GMSH 4GAGL 3TLRA 4MDIA 4M43L 4NRZB 4J12A 5J56B 2X89D 5TE4H 2CK2A 1G1YA 3D39D 3VGHA 4U1LB 3F8UB 4R97C 3RZCA 3DRTA 4D9RE 5E08L 3T8XA 1MRFL 5I71B 3BIAX 2LABA 3G5XB 4ZQKB 1WK0A 3PP3K 5JLZB 3G04B 1I3VA 1HHJB 4NGHH 4LHUB 3KPLB 1MAMH 2Y07H 3O6MH 1EVTC 1D5BB 3V6ZA 5I8EA 2DI8A 4LCIL 5GZNC 1UACL 2XRAH 5DUML 5JNYB 2WIMA 3BP7A 3ULSB 3MV7D 3TBWB 3PV6B 5CD3A 3S88L 3U36A 4G9FD 3PWLA 3ZDZF 2Y1VA 3AAZA 1RURH 4JDTH 4UIMB 4POZD 4YWGL 1BX2A 1KCUH 3BUYB 4BSWA 4ERSH 5EOCJ 12E8L 4DKAA 4K9EH 2EXYC 3CPLA 1KC5H 5A40E 5EZOH 5HYQA 4WU5B 1DN0A 5E8OA 1JHKL 4UNTA 2XKNA 5HHNB 2Z31D 3HG1A 3GSNH 4NQDA 4UINH 3VG9C 3EOBB 1CD0A 4U6XA 5FO7A 1BBJA 3UO1L 5C0DB 4CU8A 1F5WA 4OGZA 4PV9A 4XBPB 5DQ9A 3IDNB 1C7TA 4LLQA 1NMCB 4CMHB 4UIKH 3SKNA 4OZIF 2DIJA 3EOTL 4K7PY 3EDDA 2NY6C 4YNYB 3P9WB 1A6UH 1MFBH 5JR1H 2YN3A 3MV11 4RWHA 4M5ZH 1U3HA 5IBTH 1Q9OA 1CDGA 3IXTB 3QDAA 5EU6E 5KSUB 2UV3A 2J8UA 2CKBA 2A0LC 5IJVB 2GY5A 4JFFE 5C08D 2P1YA 5JIIA 2ORBL 1Q94B 1Z9MA 4Z0BH 4JVUA 3I85A 3MLRL 2H1PH 2DLEA 5JPMA 1NDGA 1A8JH 4JY4B 2WP3T 4G9DA 5EZIL 5F1IB 1VFAA 3MJ8B 4H0IA 4KV5F 5C0RL 2VXTH 1MI5E 5EC1B 1DBJH 2D7MA 3MV8E 4ZS6D 1IGCL 4UT6L 5T3XD 1JGLL 4UB0H 3AREB 4AEIH 3KLHD 3HMWH 3RVWC 1DFBH 4FABH 4AJ0A 2PYEA 4DTGL 3STLA 2EIEA 2A77H 3QXVA 1FO0H 3EO9L 3O4LE 2YD9A 1QO3A 4GH7B 3O2DH 2WP3O 3HZKA 3TZVB 4BFIA 3EO0B 1XF4B 1HHGA 2JF1A 2L7UA 4OLZL 4JG1H 5DXWA 2RGSA 4BELD 5A2LH 3RUGA 5J6GA 2WANA 4N5UA 4HG4J 1AP2B 4JHWL 5FKAB 4DZ8B 4MWFB 3PWNA 4LVOC 3MSPA 1JNNL 3VXUE 1LK2B 4HT1L 4IM8A 1NUDA 1Q9WB 4ZXBC 1EFQA 5E70A 5EORL 2B2XL 2EE3A 2Q3ZA 4FS0A 4M1DH 3BO8B 3ULVE 4J6RH 2FNBA 2ED7A 1ZLSH 4PGCA 1QBLH 3DUUA 3LKSB 3RVXC 1T7XA 3RVVD 1KCVL 1RHHA 3DX9B 2NYYC 3TT1L 5I1JH 5CJQH 1EHNA 1K6QL 4K3DH 1WEJL 5IV2A 4J3VA 3F12A 3T0DA 4HK3J 4PJBE 1FL6A 4HXAH 3GRWA 1J8HB 4ODXB 3EOAB 4ZTPL 1A6TA 2ESVA 2YD2A 4WVRA 4QO1A 1VA9A 2FIKB 4PJ9B 1GGBH 3LQAH 1U6AL 5MENE 3P73A 5J12B 2KQNA 1A02N 5IF0A 3WFEH 1NCWL 2ERJC 5J06A 5B39G 5C0BA 5JDSA 5B8CB 4WTXA 1AKJD 4NYLA 3NCYS 3T2OA 3QUMH 3HCVB 3PDGA 2ZCLL 5DEFB 4PB0L 5DJCB 4AT6B 2OJEB 4RAUB 4Y1AD 5B38G 3GMPB 2XZAL 4LCWA 5BRZE 3EKCA 4GFTB 2BSTB 2DYPB 2JJTA 2KL6A 4K8RL 5SV4A 2XNAA 5EN2B 3MBED 3E8UH 5L9DH 4Q2ZA 3UDWC 1YC7A 1M7DB 1NGZB 4AL8L 4CGTA 3LQMA 2XT1B 3O9WC 3BRFA 4JQIL 5KG9A 2M26A 5DTFA 3WEXA 3EFFA 1CGUA 3N1FC 1S9YB 3BZ4A 2FDBP 2DQTH 2ZUUA 2AJ3B 3RWCB 3GK8L 2V2WA 3C60B 4QTIH 5GGTH 1V7NL 2NY0C 4YDJA 4R7NA 5FUOH 4I0PB 1D6EA 2BVYA 3WKNA 5EZLB 4K3EL 4G8GB 3NTCH 4ESKA 5T3ZH 3QUZC 1FFNA 3OKNA 4BH8A 3P9LB 3VFMB 3MLWL 4XX1E 1C5CH 3EYOB 4JFHD 2EIZB 5TDOA 3C87A 2H26B 3MGOA 1YA5A 2AEWA 1FE8H 4MSWB 4LCCB 4XMKH 5IESL 4TSBL 5EWIH 4M6OL 3WJLC 1I1CA 4F7EB 3LEYL 5CEZD 5ITFA 3DXAA 3O11B 4MD0B 3MLSL 2RJMA 1CDIA 5M94B 1G7HB 5JZ7D 1A6ZA 3FT4A 3QJHA 4X9FA 5BMFH 1BJ1J 2VAJA 3OJMB 4PUBL 3O4OB 4Z95L 5KSVB 4O58L 4QF1B 4PRIA 4RMTA 2UYLA 1UKTA 1EJOH 1URLA 1WJ3A 4B50A 4KDTA 1ZGLM 4MA1B 2XACC 4P9ML 1S7QA 4PD4K 4JRYA 2IQAB 3CNKA 3QDMA 3GUTA 4O00A 1J5OL 2UZIH 3JTSB 3WIIL 2P44B 3OBAA 3KPRA 3ARFD 4TUOA 4TVPD 3RQ3A 3VFRA 3DVFA 3UAJD 3GSUB 5F1KC 4G42B 1PY9A 2YA2A 1DN2A 2MQ3A 4X5XB 2Z35A 4PRPB 4Q6IA 5MERB 3OX8A 4U0RC 3PJSB 1RUML 2MKLC 4P3DA 2FHBA 1UZ8A 4XPHL 3HNTL 1CF8H 1GZQA 3BHBA 3IDXL 4FXGA 4JPWL 4X6BA 4NUJA 1UYWL 1QLEH 3T65A 4MLIA 1QRND 3AXLB 1S7SB 5KSAC 4TSAL 3TH2T 2C1PA 2WZPD 1LILA 5T3ZE 5ICZA 4Z7VA 2FHFA 4X7TA 5GGSY 4WI7A 1DQQA 1I1AA 1QSEE 1UEMA 3WN5A 1XIWA 2ITDB 4BQBA 1JZ3A 5H35A 1LD9A 2WNGA 1M6OB 1DANT 4I9WD 1F3DH 4TNWK 3AY4C 2RFXB 2WWMC 5C7XH 4RMVA 5IBUB 1AR1C 2ICWA 2XQBH 1Q0YL 1A6WH 3WLBB 5IMKA 1S5HB 1V8HA 1WBYA 4ZO9A 4WWKB 3QPQC 3ILQC 2DRUA 1JFQL 3FQTB 2HP4A 4ALAL 3JWDH 3EFDH 1AH1A 4I77H 1CGWA 35C8L 1AGEB 5DC0A 2NZIA 3D2UD 3KYNA 4X6EB 3QEGL 4CDHA 1FFQA 5DRZB 3BGAA 1FL5A 5D1ZC 1KJ2B 2C4FU 3FTGA 3FN0H 3RDTB 4GS7B 2W60B 1TMCB 5HGDA 3ILPA 1MCWW 5DRXA 4G59A 4MZ2A 2ITCA 3W0WB 5SWSE 2BK8A 3IVKA 1XR9A 3WE6B 5F97E 2DQIL 3G6JF 5FOBA 1A1NB 1JWMB 1U8QB 5ALCL 3PWVA 4DVBB 3GSWB 4MNQA 4K7PH 1MJUL 4GXVH 1U3JA 5D7IA 1N4XH 1KCSL 5LJYH 3FO2B 4GRWB 2VZUA 4M8QA 1UJ3C 1ORQB 3G6DH 3P3YA 3S34L 4OV5B 4O9HL 4JG0H 1CG9A 5GRUH 4F7PA 4PP8C 3EGSA 1XGYL 4UU9A 2AJZB 5BW7A 3OR7A 1P84K 4EDWL 4JR9L 3QXUA 1UWXK 1J1OL 4ZPVA 1RZJL 4KJYB 4J1UA 4M6ML 1KIPA 3VGEA 4BJLA 3L95B 3AGVA 4XI5C 2O5YH 4FQ1L 5EU5B 1KBGL 1T2XA 3Q3GB 2ADFL 5D2LB 5KVFL 4YAQA 3CC5B 1F11A 4M3KB 1EGJA 2DN7A 1CLZL 4JKWA 3GMRA 2HT4D 4ZOCA 3BGFB 3MRPB 4N8VG 1CL7H 5D7SL 3SE9H 2CD0A 1YZZA 4ZOAA 1KN4L 1RULH 3QUKA 1CQYA 3CVIH 4HPOL 1VSCA 3WKML 4WFGD 1HCVA 5GISH 1YUHA 2IGFH 2DWEB 5JUEH 3CX5J 3SE3A 3D18A 2OTUB 4LARH 2QSVA 5E2VL 3RVTC 3X17A 4XP4L 5HHME 3UTTD 1MHPL 2CRMA 1MUJB 4MCZB 4NQEA 2J6EL 2AXJA 1JF5A 1PAMA 4KTYA 4WHTB 3GSRB 4QXGH 4E5XA 4HUWA 3MX0A 1JI1A 5IVZA 3VXPB 5MEQB 5HI4D 2IPKB 4HUVA 1OF2B 1RMFL 4FFZH 4OLWH 1M05A 2EC9U 2OS7A 4NNXA 4YIQB 2R1YA 1S78D 4N1HB 3RY6A 5T1KD 4FMFA 5AZ2H 5GS2D 1XT5A 4OFPA 3A6BH 4LVNC 4UQ2B 1CQKA 4NJ9L 4EN3D 2VLKE 2ADJA 3MNVB 4PG9B 3QNZA 3SGEI 4V2CB 1RJZA 4M6NL 5E2UL 4MXWH 1TNMA 3IDJB 3I3EA 3KPSA 3KR3H 1ZLVK 2QSTA 1VEPA 3FRUB 4XRCA 5C8JA 5FECB 4NO2B 4PLOB 1YEDA 3ABZA 1RZ7H 1R5VB 3PL6A 1AI1H 1IAIM 1VGKB 2A2QT 4FXLA 3DSFL 4PLJD 3QA3B 3F7RA 1FSKC 4DEPB 4P4KC 4NQVB 1PYWB 4PJCE 1INDH 3JVGC 3O8XD 1VPOL 2J8OA 1JWSB 2P7TB 3UEZA 1NCAL 4X6CE 4PGZA 5ANMA 2HKFH 2QQKL 3RWFB 4AG4H 4DGYH 5L8LB 5ERWA 3MRJB 4YDKL 4HLZH 2IANE 2ZSWB 4N8CH 4WO4D 4YDLB 3SGJC 4KPHH 1HH6A 1Q9LA 4OGXL 1WC7B 3PQYB 4Y5XC 3MV01 1GPOL 2QADB 1Q38A 4KKAC 1AO7B 4N9OB 5SWQA 1C5DA 5DRNA 1IQDB 2FBJL 3WFHB 1CYGA 2CQVA 5BQ7A 3IXAB 2CUIA 1R24B 2BVOB 3NFSH 5JA9A 3D39E 1U8OA 1U93B 4L8SA 4F15B 4Z77A 5ITBH 5CUSL 3FB8B 3T4AA 4OZFG 4Y5VC 2FJGA 4U1SA 5C9JB 1T5XA 5DI8B 4U1HA 1FG2B 3ULVF 25C8L 5FYLD 1L6XA 3THML 5TH2A 3LCYA 4Y4HD 5J6HA 1KJ3H 2OI9C 3JV5A 1H8NA 3S37X 4LFHG 3A67L 2X2YA 3SDDC 1AHWB 2XTJE 4YGVA 4YX2L 2J7LA 4S1DC 4CL7A 5I1HH 3QIUA 3CJJA 3MV7E 4CW1B 4APQA 4G9FE 4PTUB 4KXZI 1NFDE 4PJBF 1EEZB 5T3XH 4RIRA 1KG0B 3HMXL 5HYFA 1WISA 4XH2B 1MF2L 2X4OA 3DURA 2DLHA 1YEFL 5HYJB 4XAWL 1MWAB 4Y4FA 2PNDA 3WUWA 3SDAB 5KW9L 5EIIB 1A64A 1KIRB 1EJ6A 3OQ3B 2ZUSA 3VXOB 2NY2B 2IH3A 4BZ1H 4OCRH 5IFAL 2D7PA 1A7PH 1AXSB 3EYSL 4JY6A 3TESA 4K8RC 3F62A 3GB7B 4F7CA 4JM2C 3SJVD 1ORSB 1FYTB 4QTHB 3IFLL 4UDUB 2H8PA 5HHOD 4XCNA 4HJJH 2A73A 1WFTA 5GS1A 4KZDL 2XXMB 1FRGH 3O3EA 1G7QA 2ATKB 1QBML 2CMRL 4TUJA 5DMIL 3V4VL 4FQCL 2FGWH 5IMLB 2VDPL 3S5LG 4LU5L 1FHGA 4QHKI 3TV3H 3VXMD 3CFJB 4BQ9A 1RU9H 3BFOA 2ARJA 4YLQT 5DEZA 3MBXL 1HILA 4OF7A 4MB5A 4XPFL 1YJDH 4HF5H 4HFWB 4MAYB 1N5YL 2CDFB 2XN9A 2HRLA 4HIJA 1G7PA 1LEKB 5F9JB 1M1SA 5ADPH 1KB5A 2YEZA 5BO1L 1KELH 1FZJA 3MRBB 1KPUA 1SYSB 4NQSB 4ZG1A 5C08E 3HAEB 3T0ED 2FL5A 2R0KH 2ZKHH 3HE7A 3LH2H 2PTTA 4JN2A 1UB6A 5E2WH 4MZ3A 2DKSA 4XVTL 4FZEH 5IQ7H 3TVMB 4KAQL 2H41A 3T04D 4LPTA 4OB5L 1T2QH 2FJFA 4BK5A 4LIQH 1OSZB 4PJHB 1KNOB 4MA8L 5T3XE 3RX8A 5HD8C 5FO8B 3IFNL 3UJTH 5KJRH 2ZCKL 4Y2DB 1A1OB 1KV3A 3Q6GH 5IB3A 1F90H 2CK0L 1C16B 1E6JL 3ZSTA 4PJIB 2YD7A 2XA8H 4MVBD 1A4KB 3WO4C 4J2XA 2A38A 2EDFA 1S7RA 5CZKA 4P5MA 4JFDB 5DJYA 5GRZA 1EBAA 2WBJA 1I8LA 4TSCH 4WY7H 5HI3D 5IVOA 3ZSSA 3PG2A 4PJEA 3QUZA 3HC3H 1JV5A 4HC1L 1MCSA 4WW1B 2YUVA 1ES0B 2BNRA 1S3KH 2KZ1B 3ARGB 1TVBA 4HWBH 1BECA 3BISA 5GJSL 5INCA 2ZPKL 1S9XB 2NY4C 5LXGH 4R4FL 4LHUD 5C0CB 5DMKB 2X5PA 5KVGL 4M48L 3TPUE 4D0DB 2OSLB 3EJZC 4WI2A 2DBLH 3ROOA 4OQ1A 1NMBL 4ORGB 4PJ5B 1HHHA 3MLZH 5I18L 3OKOA 1XF3B 2R8SL 3S3JA 5BVPL 3D3VA 2P5WB 3QNYA 4K94H 1I9RL 4ENED 3L3GB 1LWRA 4WI8A 5JOFA 4GRLC 3DMMB 3O2VH 4U1JA 1ZGLP 3GDBA 3TJHC 2JCCB 4P2CG 1JGVH 3CCHB 1IEAA 4HBQA 1VKXA 4GMTL 4OZHB 4IHOA 4EUPB 2VR9A 4HAFA 4NRYA 5ISZB 3WXVH 3MXWL 4A2LA 4LIQE 5CINL 1ZGLA 1CFTB 2HFTA 2G5BB 1CDUA 3EDJA 5BZWB 1FAIH 4XBGA 2Y36H 2KBGA 2D2OA 1OB1A 4L5FH 2F5BH 1T1XB 3OKKA 1RV6X 2O61B 3SGKC 3BQUC 1OTSC 2Z93B 5JO5A 4M4PA 4XP9H 5B3JE 3MV9B 4OF0A 3I02A 1BMGA 2G60H 1A6AA 1CGVA 1S5IL 1GXEA 5C07B 4CAGA 2J4WL 5E1HB 1LDPH 3KPOA 3BT2L 4GMSL 4TNWF 4FP8H 3ZL4H 3C5SA 2AXFB 3K4ZA 4TQEL 4WIQA 1FBIL 3FQXB 4B7LA 2MQCA 2XWJB 4PRDA 1Q9KA 1VESA 1MCPH 1YNTB 4XCCL 3G5YB 3Q6FA 4GBXB 4W6XB 1ZA3A 1AD9B 4TN9A 4MNHA 1KLFA 1RQ5A 4NN5C 4G43A 2IPUK 3VDAA 4TRPH 4R90H 1ZE3C 2L4OA 4ZFGH 1SBSL 4WW2A 2BVQB 1IEBA 2NNAA 3OHXB 3K74B 4NQCB 1RZJC 2HVJA 3KG5A 2HRPL 4PS4H 2COQA 1JZ5A 3ARED 4UZGA 5ICYA 1KCUL 3BD3A 4ZUSB 1W0WA 1YN6A 3MRHA 4O4YL 3V5DB 4L4VA 4NHCH 1VHPA 1A9EA 4PJFE 4OF5A 5CEZE 3O6FC 4OGYH 3K3QA 1E6OL 1MFNA 4RQQA 1KTKE 1BD2B 2VNCA 3TZVD 4YJZL 3N1MC 3KPNA 4E41A 5E6IB 1AGDA 2AKRA 2RB8A 4XC1H 3QZWG 4ETYA 1PJ9A 2WIIA 1TVDA 1QYGH 2R23B 3QG7L 4JHAH 3AMLA 4GKNA 1SYVA 4JFEA 1I7TB 1SEBA 5F8QC 5HGGS 2APTA 5L2KB 3TFKC 3CUPA 2ADIA 2HLAA 2IJ0C 1NGXB 3FT2A 4JDZA 3V6FA 3ULVL 2BNUA 4UNVA 3IFPA 3RWHA 1F8TH 4M5ZL 3BSZH 2R2EA 4TVPE 1OAYH 5T5NG 1T4KA 3SOBH 3H9SB 1EFXB 3IETB 1MAKA 1XCQA 1DE4B 3V2AR 3I2CH 4PRBA 1NUNB 1NCDH 3HE6C 4WEBH 3HI1B 2JELH 3T2QA 4Z0BL 3CFDA 3WNLA 4HK0A 1J8HD 3QPXH 2H1PL 4LBEA 4ORZC 4ZUVA 1OW0C 1QRNE 1CFBA 4KWUA 2CDEB 4G6AD 4JEGB 1EVUA 1S7XB 5B22A 1KLUA 3M07A 3U46B 3L3KA 1H0DA 4AEIL 3SDYH 3E2HC 1ACYL 4L4TA 2PW1A 2QEJA 3ZTJG 1DFBL 4P23A 4I9WE 1EXUB 4OCYL 4YHPB 4HKZA 3O3AA 1TENA 2DIBA 4JFZL 3VFVA 1B88A 4KGJA 4W70A 4NFCA 3SDDB 1FLRL 1ZVHA 2DYPD 3QULB 1D9KB 4EBQL 1J7VR 4BKLB 2QV2A 4I18C 4PJCF 5F44A 2WUCH 4QCIB 2YWYA 4X6CF 3E3QC 5HVGB 1T7WA 1F4XH 1IGTB 4EIZC 3QHTC 3P4MA 3MA7B 4R0LC 4XXDA 4MDIB 2APFA 1CCZA 3C60D 2ZJSH 1I85C 2HT3D 2Y06H 3CIQA 4NC1E 3T2PA 4I0PD 4J6RL 4FQXC 1OARH 4G8GD 5DD0L 4QRUB 4M1CD 4MJIA 4U6HA 4BSVA 2F5AL 2FLRT 3T8XB 1LNUA 3GIVB 1WZKA 4X6FA 4GKZA 4JRXA 2AJXH 3HC4H 3GMOA 5GHWL 4H26A 3WFDH 3R0MA 4LCYA 2FH8A 4OZGE 4W4NA 5GS2H 5BS0A 2DMKA 5I8EB 3HI5L 1F3JA 2DM2A 4UBDC 3C6LA 4NDMA 3BP7B 5HGBA 4NFBA 1IGFL 3PWLB 2OZ4H 3AAZB 2UUDH 4RX4D 4NO3A 1BX2B 4QRRE 1JP5A 4XTRD 4MS8A 2BC4B 4NCC1 1T6WA 3CAFA 3VRIA 3CPLB 1BP3B 1NFDF 3BDYH 4KY1H 4L9LC 4Y5XA 1DN0B 5E8OB 2XKNB 5HBBA 1JPST 3V6BR 3HG1B 4RBPH 4NQDB 4UOW1 2Q7YA 1Z0NA 5D1XC 4U6XB 5TE7L 4OFIA 5FO7B 2XFXA 4QHUB 1BBJB 5CGYD 2JB6A 5B39B 5E8PB 1PBYA 4XCFH 4PV9B 3RKDD 3AS1A 5DQ9B 1R3IH 1JYWA 1FZOA 4XC3L 1I8IB 4WFGE 5DURB 3SKNB 2FX7L 4PRPD 3LEVH 2YC1A 1VEOA 4MQTB 5B38B 1BBDL 2D03H 2DQTL 1U8JA 3X13A 2I26N 3K4AA 2XV6B 3UTTE 4P2OA 1XF2A 1U3HB 2AEPL 1Q9OB 2VDKH 5EOCH 4TOYH 4XNMA 1B6DA 3ALPA 5T3ZL 5FAAA 4OCSH 1O7SA 2J8UB 2EDRA 2CKBB 5IQ9B 2GQHA 4C56A 1L0YA 2BSRB 1ZT1A 1MSPA 4C57C 1XR8A 5DF0A 2CIKA 3MODL 5JPMB 1NDGB 3JWNC 5C0GA 2VXSH 2EDNA 5I1KL 2VMFA 1CT8A 1VFAB 3WIFA 3IDYC 3LKOA 5DVLA 3GHEH 5CHNA 4WWKD 1KACB 3VXSA 2IG2L 4RFOL 2PYEB 2FRGP 1B2WH 3GNMH 3STLB 4PTTA 5J1TC 1YNKH 2WM0A 5E1AA 1QO3B 4NO5B 4PRAA 4LRNH 2CLZA 3RDTD 3HZKB 4WFFD 3UJJH 1YMHA 1HHGB 3W0WD 5GGQH 3F7PC 2AJVH 3TCLA 1TIUA 2FD6H 5J6GB 3VFTA 4DFHA 3M8OH 3P30H 3BN9D 1S7WA 1Q72H 4QWWC 5LGJA 3IKKA 1P6FA 3PWNB 3TJEL 5I17A 2W65A 2EEAA 3NAAL 3VDCA 1RIUH 4HCRA 4K2UH 5I1GH 3RGVA 1H3PH 3VXTA 2GYSA 3H8NA 4PGCB 3TT3H 4W6WB 2XZCH 3DUUB 3ZDXE 1G7JA 4K23H 1GGTA 1CXLA 1HH9A 5MI0C 3QIWC 1RHHB 1AQKL 3BJLA 5KTEL 2OL3L 5CILL 4W4OA 4GUPA 4N0UE 1JNLH 5FYLE 5T33L 3DX7A 3F12B 1LO0L 1FL6B 4XPGH 5EUOF 3S7GA 1A6TB 3B5TA 5C7XL 4XWGH 2VXVH 2M1KA 1L9NA 2XQBL 4FFYH 1CWVA 4HBCH 2N1KA 8CGTA 4UAOB 2CUMA 1DEEA 1I3RA 2M2DA 1CVRA 5C0BB 1HN1A 4DKEL 5JDSB 4I77L 5C09E 1HKFA 4NYLB 3T0WA 3MRFA 5E5MA 1N0XL 1PDKA 4WUUD 3D9AL 1NAMH 1IC7H 3L3IA 1NH6A 4YHYC 5FHBH 5KANG 3IB4A 5ILTH 4JDVA 4LCWB 1H3TA 3VWKC 2XNAB 5ELIA 4R8WH 2CKNA 4JHBA 2RQ8A 5HVWA 3FRPG 1T66D 5DUBB 5KG9B 4I0CC 3A6OA 5DTFB 5ECJE 1MHHA 1YMMA 3EFFB 5HHVL 3K2UL 4L3CA 4YHKH 3BZ4B 4A6YL 3TN0A 3OKMA 5I75B 1X5IA 3VXME 4JY5H 4GXVL 3MRNA 3GMNB 4GXUN 2V2WB 5TDPA 1RIVH 4D0CA 1FH5L 4YDJB 4C59B 5C2UB 3ARDA 1D6EB 5C1MB 3UP1A 1A14L 3KPPB 2DD8L 4JG0L 1FFNB 3AS3A 5GRUL 2UZYB 1GGCL 3OKNB 4BH8B 4LKCA 5IR1A 3FO9A 5E00A 5TDOB 1LEIA 3MRGA 3T0EE 3VW3H 3MGOB 3MZGB 4QT5A 4JO2L 3ZHDA 3L5HA 3S9DB 5L88H 1TTGA 3Q48A 4HUXA 5J7CC 5CSBA 2DQUH 3QXWA 2FEDC 4YXLL 4Y89A 3T3MF 4M61A 4TULH 5ITFB 5EOTA 1JN6A 4YHML 2D9QB 5DFWH 1A6ZB 3FT4B 3QJHB 4V1DA 3TBTA 4NQTA 4PJFF 3JV0A 1QACA 2D7QA 5DHYB 3H3KA 3S37H 1RULL 4PRIB 2UYLB 5F21B 2NY7H 4XNZC 4U7SA 3PQYD 4OJFL 3D5OF 5GISL 3ARBA 1I9IH 4JRYB 2QADD 1IM3A 3ZDYE 2B0SH 1KOAA 1AO7D 1MNUL 3GUTB 3V52L 2CR6A 4LARL 5EBGA 3ULVC 2VLJA 1RI8A 4KI5E 3KPRB 4ZAKC 3V4PL 3P4OA 3RHWK 2AGJH 4TUOB 1OOAA 1RZ8A 3VFRB 5E6ZA 3VWJC 4LL9A 2BHUA 3EO1A 4HMCA 2Z35B 4Q6IB 2NY5L 3OX8B 5FYJD 2GW5A 4FFZL 4LLAA 4JRWA 4P46C 3WFBH 4P3DB 2O93L 1UZ8B 4NM4H 1GZQB 4AIZA 4UV4H 4X6BB 4X7CC 2A6JB 5AZ2L 4NUJB 3MXVH 1BJ1H 4YQXH 2FB4H 3A6BL 2JK5A 1B6UA 1PX3A 2C1PB 3OTTA 5D71L 2BMKB 3GKWH 4Z7VB 1JK8A 4X7TB 1Z2KA 1BVLA 4DZBA 1TITA 3WN5B 1XIWB 5H35B 1LD9B 2E5EA 2ZOLB 5IW6A 1GH7A 1FCCA 5HYJD 4G7VL 3PGFL 1RZ7L 5TFSH 1AI1L 1DR9A 2ICWB 3SDAD 4GJTB 1CL7I 1BQHG 3ARPA 3FFCE 2NY2D 5JIKA 5IMKB 5DA0B 2I9LA 3QSKB 4AEFA 1WBYB 3NZHH 3U6RB 3ZKXC 4KH2A 1MJ7L 4DGYL 1FYTD 1YN7B 4N8CL 3PP4H 5AWNH 1PZ5A 5GJTH 4WHYG 3A6CL 3KYNB 4H25A 3PXHA 5SWZB 4OFKA 2OK0H 5E03A 3BYTA 1BHGA 3GHBH 5BV7L 1FL5B 4MA7H 3FTGB 4UILL 5IGXL 3ILPB 1X4XA 5DRXB 2ITCB 1X5KA 3SE8H 1QSFB 1XR9B 1C1EH 5J4MA 1WWWX 4KK5C 4OQTH 3EYFB 2VDQH 5FFLA 3PWVB 3T2NL 3U9PL 3QBTB 3VMPA 4P5TC 4MNQB 3I75B 5L0QB 5D7IB 4NKOA 1DVFC 3V79C 4YE4L 4S1RL 1Z3GL 1KJ3L 3NH7L 2GTWA 4LAJH 3I6KA 3T1WA 1HKLH 1CG9B 2YPLA 3TVMD 4F7PB 1FZKA 4UU9B 5I1HL 2XICA 2VITB 1SMOA 4OZGF 4ZPVB 2ATPA 5T3XL 1WIOA 1KIPB 4LSPH 3BEWA 4Y2DD 2DQGH 4QXUL 3L5WA 4XVUD 3RGHA 1DCLA 1DQJA 3V7MA 3NCYP 1F11B 2Y7QB 3GMRB 1LO2H 4MXQA 2GFBA 15C8L 4R0LA 4Y4KA 5DHVB 4NRXA 2QKIB 5TJWK 1CFSB 4KU1A 5F9WC 4OLUL 4KRPB 3BRGC 3BZFA 5F1OB 5E8EA 4JFDD 5FF6A 4YDVA 3VXRB 4QRPE 2MJWA 4HJJL 5EU4B 3F58H 3S36L 1YUHB 1MFEH 2N56A 3ARGD 2BHZA 1T21A 3D18B 5CP7A 2OYPA 5C0CD 4YUEL 4NN6C 4NQEB 3TA3A 2CLVA 4MB3A 4PJ5D 4JZOA 4RWYH 4E5XB 4HUWB 5IVZB 2VL5A 4LRIA 1J0HA 4HUVB 2P5WD 2AABL 2KPNA 1E4JA 1M05B 1OAQH 2WLZA 1S9WA 4GOSA 4NNXB 4CVXB 3DMMD 2R1YB 3ET9F 1KELL 2OCFD 4YH6A 4DVRH 3BKMH 1WWAX 3SDXA 1J8HE 4J3UA 4AH2A 2ADJB 4JO1L 1AJ7H 5ISZD 2HN7A 2IPUG 1RJZB 2DWDA 4LIQL 2EH8H 3KPSB 5D1XA 4OIAA 5C3TA 1WVZA 4BFEA 1AQDA 4XRCB 5C8JB 1X5HA 4KKCC 2LU3A 2AV1A 5KJRL 4HKXA 3C2AL 1E4WH 3PL6B 4QHKJ 3ARQA 4NM8H 2J12B 3O3DA 3VCLB 3MV9D 1ZOXA 3NZ8A 2R69H 3DUHA 4RNRA 1F90L 2WAHA 4X7SH 5C0IA 5C07D 4RMUA 1X9QA 4JPIA 5ANMB 3VGAB 4UNUA 2D4FA 4DN4H 5DEGA 5ERWB 4M7ZB 1EO7A 3ULUH 1QFOA 3V4UH 3X3GH 1NBZB 1HH6B 1Q9LB 2Y4SA 4WY7L 3DI2B 2R29L 4NZTH 3B9KC 1CFQA 1YECH 4JREC 5DJXA 2GK0A 3HPLA 5FYKD 2QHRH 1S3KL 4HWBL 4GBXD 1TFHA 1C5DB 5DRNB 4LASL 2X1OA 1JMXA 2O5ZH 4NO0A 1UM5H 3ZYJA 3B2VH 5AG9A 5BQ7B 3MRQA 3FO0H 2FO4A 4L8SB 4Z77B 5IB1A 5B3NA 4G8GE 3T4AB 3MLZL 2YR3A 1HSAA 4O02H 4AEEA 3W81A 2FJGB 4U1SB 4NUGL 1T5XB 2MCG1 4NQCD 3RBSA 4U1HB 1ETZB 5FUZH 4K94L 2R0ZL 3DRQB 5TH2B 4IRSC 4PJGA 1U36A 3ZDXF 5J6HB 3NBNA 2WBWB 4HK3N 4YGVB 4DUXA 3G6JA 3L5XH 4JO4H 3NACL 3QIUB 4EQ3A 5CEZL 4APQB 4N0CD 3EJYC 4GW1A 4XNQA 3FB6A 4HJGA 5AZEH 3RVUD 1BD2D 4RIRB 2R4RH 4NKQB 1NCBH 2C4XA 1LGVA 1Z0MA 1AIFA 1FAIL 3U1SH 2X4OB 5E6ID 2F5BL 4O2EA 3JXAA 3JWOH 4HV8A 4Y4FB 4LSTL 2J5LC 3WUWB 4D0BA 3I3DA 1A1MA 1W2KT 1DQDH 5H37G 4O5LL 2IH3B 3I6LD 3HNSH 2EDDA 1A3QA 4PJXA 2LU4A 3LIZH 4MAUL 1I3UA 1KJ2H 3IDIB 3L5IA 4JY6B 3SO5A 3EAKA 1TPXC 2H8PB 4XCNB 3RWIB 2E3VA 3U4BH 4EXPX 3QIBA 2A73B 2I60H 5CP3A 5GS1B 4TVPL 3O3EB 3H9SD 1EFXD 5JW4Q 4XP5L 4MDJA 1QEWA 4KMTL 4XPAH 4PRPE 5FIEA 2NW2A 3T09A 2NY3B 4UT9H 1OLZA 4HGMA 1YY8B 1B4JL 2ARJB 2YRZA 4RMRA 3V0AC 1HILB 4RAVA 4ZFZA 5I8KH 1BF8A 2VZ1A 1PEWA 4LQ1A 2XN9B 1TVHA 4HIJB 3EHBD 2DM4A 3MOBH 1KB5B 4IBLT 4Z7WE 2YEZB 1G6RL 1FZJB 1KPUB 2QSQA 3ZYZA 3QAZC 4HHAB 1F58L 1X4YA 1JTOA 4G8FB 4OM0H 5DMGC 1P4LA 3FT3A 3HE7B 2PTTB 2HTKD 3JV4A 1UB6B 5DK2A 1HYSD 4P3WA 2HFEB 1F13A 1NUFA 5E4EC 3D69A 1GHFL 3N85L 3O6KL 5HY9B 4WTZG 1MJ8L 3MJ9H 1KCGC 2FJFB 3FZUD 5FM4A 3P11H 1LEGA 5LKNA 4QRSA 3CMOH 4Y5YC 4DK6A 1D9KD 4O2CA 4ZS7L 2MNUA 3PHQA 3UBXG 4HS8L 3QRFM 5IB3B 3E1F1 3EJJX 4GW5B 5I74B 3OZ9H 2QQLL 1FNGA 1NGPH 5H2BA 3V6OE 4JAMA 1EDQA 3BWUC 1KGCD 4WFFE 1IMHC 2MKWA 1Z9SA 4FTVA 1S7RB 5DJYB 3W0WE 2WBJB 3CU7A 1LMKA 2E8YA 3RZCD 5KSBE 3KAAA 4PJEB 5E2TH 3ZDYF 1P9MC 1JV5B 5FGSA 5EBLB 2NY5C 4HZAA 2BNRB 2EDTA 4WEMB 1YC8A 1TVBB 2VH5L 5INCB 1UH2A 4KI5F 3LMJH 3I2CL 1NCDL 4N5EA 5CKGA 3P0VL 4B7IA 1RIHH 3ROOB 4LVHC 1MHCA 3QPXL 4WFEE 3SE4A 1HHHB 3LVEA 1KT2B 1V3MA 3QDGA 3OKOB 4XPTL 3QCUH 1ACZA 1LK3L 3GSNA 3QNYB 2IPTL 4POZC 1B9ZA 1U8LA 3F7VA 2H6PA 3NCJH 5A2JH 4MX7A 1KPRB 3FQNB 4U1JB 3RHWF 3QEUA 2LVCA 2PTVA 1IEAB 2FCBA 1HIML 2DQEL 1TJHL 4ODHH 3OXRA 2WLYA 1VKXB 2NW3A 1J0ZA 4IHOB 5D2LE 2EE9A 3VXUA 3CVHA 1CXEA 2Z31C 3HG1D 4NQDD 3ZYIA 1ZGLB 3ARXA 3VG0H 1ADQH 1CBVH 4FFWD 2W9DH 1A7NH 4XBGB 1REIA 3O3BA 3OKKB 5DFVC 4GAJH 1JYXA 3OJVC 5D93C 3VFUA 5JO5B 5C2BH 5BV7C 3I02B 1B3JA 5DURD 3BGMA 1A6AB 1NBYA 1IFHH 1A7RH 3KPOB 1RSFA 4H1LG 4WU7A 4PR5A 1UXWA 2ZJSL 4XAKE 2Y06L 4AM0B 2SEBA 4UOW0 1RZFL 1KIQA 1U3HD 1SY6H 3P2TA 5AUMA 4XNXH 5MENA 1MEXL 4M7LH 4PRDB 3ZKND 4CKVX 2RAMA 2DAVA 5C0JA 1Q9KB 3IU4H 5FYJH 1LO4H 4Q9BA 1ZA3B 2I25N 3I50H 1N7MH 3HC4L 4TPRH 3D6GA 3WSQH 4OCWL 4MNHB 4G43B 1B90A 4WW2B 3GFUA 1NEZA 1FO0A 1CZ8H 1IEBB 3NPSC 5JOPE 4ZSOE 1UFUA 1JCKA 2NNAB 2VC2L 3O2DA 2GI7A 4PGBA 5BRZA 1UVQB 1FV1A 4ZS6C 2HVJB 2OZ4L 5C0FA 4OFVA 1TJGH 5ICYB 1J0KA 2FX9H 1BFVH 5KVEH 3KLHC 1IKNC 5IJKA 3MRHB 2PYED 1ED3A 1YPZF 4L4VB 1GOHA 3B4NA 1NMAL 3GJFH 1A9EB 2W91A 2CRZA 3BDYL 1Q0XL 5IW1A 2X44D 1XEDA 5D6DC 4Y0GA 3RWGA 2FJHA 4M7JH 1FYHB 5CJXA 5F9DC 2ILLA 3SO3B 4GG8A 2W9EH 3KPNB 5AEAA 4L3AA 4E41B 3BKCH 4DQOH 1T1YA 2AKRB 1WBXA 4PJDE 2WIIB 5DR5H 3PQYE 3H9YA 4PGEA 4GKNB 1SYVB 1IILE 3MLXH 4JFEB 1SEBB 3CUPB 4GLRH 2D03L 2ADIB 2P45B 1AO7E 4NIKB 2HLAB 5DD6B 3C8KB 1OGTA 4GO6B 2DI9A 3FT2B 1XF1A 2Z8SA 2A83A 4JDZB 4DW2H 3V6FB 4BQCA 2R1WA 4LEXH 1OGAA 5A2FA 3MRIA 3X14A 4EIGB 2MSPA 2R2EB 4BA8A 1T4KB 3RVVC 3ZT7A 5EOCL 4AQOA 4TOYL 2EDXA 1KXVC 4J3OC 5I66A 2YOCA 1XCQB 5HYSA 5JW3H 2YN5A 1MFAH 4LKXA 5J1SC 5FYJE 3CZJA 4PRBB 1MLBA 2VABA 2AV7A 3HAEH 1MCOH 5FYLL 2VZ3A 2OJZH 3QUMA 3CFDB 4HK0B 2Z8WC 3BPLC 1FVDB 3E6HB 3GEWB 3IKCA 4LBEB 5EPMA 2ESVD 4ZUVB 4JHZA 4HUMB 1CFVL 3P4LA 5DD1H 1W72L 5IEKA 1KN2L 4KUZL 4U1GC 2XOTA 1KLUB 4H88L 1OY3B 4ACPA 2RBLA 3GHEL 3GMLB 4M5YL 3L3KB 3F5WA 2DKUA 3RTQA 5C0BD 5CD5D 2PW1B 4P23B 1B2WL 5HYJE 4OIIL 2R56H 4WDIA 5FO9A 5C70A 5MEOA 2VAAA 3O3AB 1Y6KR 5IFHH 4HKBA 3VFVB 1IAKA 2R9HD 5HDLA 2L0DA 2XY2A 2JJVA 4PY8I 4LCWD 5GGTA 4KJWD 1UCBL 4JLRA 2PW2A 1EEYA 4U6VL 4TNVK 3IU3A 3MBEC 1FYTE 3TF7A 5GGQL 1NLDL 2AJVL 1A5FL 2VDNL 4OLXL 4N9GA 4RGMC 4XMLH 1QVOA 2QHLA 4PRNA 3VMOA 4X8JA 2GT9A 5EC2A 3WYRA 1WFOA 4XXDB 4K07A 3R1GL 1ZT4B 1L7TL 3CZFA 3FQRB 1ITCA 5EOQH 5I1GL 5A16A 1BZQK 4UQ3B 4GAGH 3CLEH 4C4KT 4M43H 4LHUG 1FFPA 4KGLA 4MJIB 4U6HB 4YPGA 4BSVB 1TPXB 1LNUB 2Y6SC 5DJ2A 4X6FB 4GKZB 4K94C 3AB0C 4JRXB 3GMOB 5E08H 1TZGL 1MRFH 3ISWA 1FZMB 4H26B 1JNLL 4EJ1C 4LCYB 3LHPH 2W0PA 1RUAL 1OWRM 3LZFH 5LBSL 5CZXD 5BS0B 4XPGL 1J1XL 1F3JB 1SMAA 4JKPL 3FONA 3C6LB 4NDMB 5HGBB 3VH8A 1EO5A 5ID0A 4X4YA 4LCIH 5FA3A 1UACH 1TZHA 1WWBX 4LEOA 4PD4J 4HBCL 4C4KO 1KTLA 5JZ7C 3NFPA 1KLGA 1OP3H 2RHEA 2WBKA 4PRID 1WUNT 3GMMA 3KJ4B 4YWGH 2ZUQC 4R9HA 1OPGL 3KHQA 4EEEA 1ZKAA 2F19H 5CEYA 1P2CA 12E8H 1T0MA 1LP9A 3P9MB 4JRYD 2GTZA 4HFUL 1NANI 3S3PA 4WI9A 2Q7YB 3QDMD 1JPGA 1JHKH 4GT7A 4H0GA 1FAKT 2P47B 2JB6B 3KPRD 3ARFC 4JFDE 2PXYA 4R8WL 1T89A 5D9SB 1OT2A 3UAJC 3QQ9D 3UO1H 2H2PD 2YC1B 3HNVL 5EBWA 2BXYA 1PQZB 2J2ZA 4YHKL 5JW5A 1IE5A 1O7VA 1HOCA 3X13B 3U4EA 3BPOB 5C0CE 4PYGA 1U9KA 2BVTA 4P2OB 4WV1A 4RISH 5DD3L 1AC0A 1AGFB 3MCKB 4WEUD 4GAYA 1QLFB 4RRPA 4C56B 1XIWD 1ZT1B 4AYFA 4D94A 3GBML 4KKNA 4QOKA 2JCCE 1BEYL 1V3LA 5C0GB 2LVEA 4EVNA 3HB3D 4IS6B 4LLDA 1CT8B 4Z7WF 4OZHE 2PYFA 4Z7QF 5EA0L 5ISZE 4MJ6A 1E4XL 3RWDA 3B2UD 3EYQD 5E9DA 3O45A 4CUCA 2IQ9L 5CHNB 1K85A 1KFAL 4S10A 3VXSB 5C71A 5ALBL 5C0RH 3EYVB 2DQDL 1WFUA 2FO1A 1ITBB 4WJ5A 1IGCH 1KCRL 2AK4A 1I7RA 1TZIA 2DJSA 1UM6L 1XCTA 4NN7C 4UT6H 3GO1L 3QEQA 3MYJA 5SWZD 1BWMA 3MV9E 5E1AB 4DTGH 3RNQA 4PRAB 5LAXA 2CLZB 5C07E 1NLBH 2B0SL 4QRTB 5J1AA 3TCLB 2OP4H 3UX9B 1PKQA 1K4CA 3SHSA 3VFTB 5IMMA 4NNPL 1KJVA 1S7WB 5HHPB 4OLZH 3I6GA 5F6HJ 2R15A 5FYKE 1T0NA 3KYAA 4MNQD 5I17B 2APVA 1P84J 4BFGA 1JRHL 1FC2D 4JHWH 4X83A 5TDNA 5KSBF 5BXFA 1NBVL 3OR6A 1ZHLA 3RGVB 1JNNH 4HT1H 2FWOA 2A6DA 3CFBB 4HQQH 3K8MA 5EORH 4A2MA 3CSBA 1G7JB 2B2XH 3MXVL 4PJCA 4YQXL 4P4RB 1NAKL 3NGBC 4NQCE 4Y5YA 2XWTA 3K2MC 4QXWA 4GUPB 2IANA 1KCVH 2J3SA 3DX7B 1CI5A 1FIEA 3TT1H 3HZVA 2BRRL 1E4XI 1K6QH 4ODSL 1K3IA 1WEJH 2DQCL 4D3CH 2VLRA 1VADA 4OKDA 2JB5L 4PJ7B 2HT4C 4ZTPH 5JPNB 1GJIA 3KXFE 4LAQL 2P46B 4L8DB 1HNGA 4PV8A 3N1GC 5INDA 1DEEB 4KRPD 1U6AH 4LGSB 5IBLD 3WNMA 4MJ5A 2FH6A 5D2LF 3VXRD 8FABA 1MRDH 3H6JA 3PP4L 3PGDA 5GJTL 5JA8B 3MRFB 4XHQA 5E5MB 5DVOA 2HWZL 3MCLH 4K7FA 3L3IB 4KUCD 1NFKA 2P5EA 3I6LE 5F7DA 3IS1X 4CN6A 2ZCLH 2AEIT 5L2KE 4JDVB 4PB0H 1SBBA 4FNLL 3BP4A 1RHFA 4NQED 3HKFA 2XZAH 2BDNH 5C0ND 4KJQD 5FKPA 1A3LH 1C1EL 1FC1A 4K8RH 1JRHI 1MHHB 1NFDA 4OQTL 1EZVX 1YMMB 5HI4C 4OSUL 2VDQL 3H9SE 4AL8H 2Z91A 1CE6A 2P42B 3MGTA 4JQIH 4ZUUA 3TN0B 3OKMB 1S78C 5AG8A 2QQNH 5TDPB 2OR7A 3UTSB 1VACA 3ARDB 1Y18A 2V5TA 5B4MD 4S0UC 1V7NH 4LSVL 4EN3C 4U6YB 3P0GB 4LKCB 2EKSB 4K3EH 3KPSD 3FO9B 5E00B 3TIDB 2EDHA 3MLWH 3MRGB 4HWNA 1MJJA 2KUTA 4QT5B 3BH8B 4KVNH 3PL6D 1E28A 4HUXB 4PLJC 3G5ZA 4XB8A 3VD7A 5ADOH 1HXYB 4URTB 3O8XC 3OWEA 1JN6B 2BJMH 4XHJD 5EOTB 4TSBH 5IESH 4FFEX 1F02I 4M6OH 3DGCR 3WXWL 3LEYH 1JHTA 3O0RH 4V1DB 4UTAL 5D96C 3C09B 3MLSH 1TQBC 2Q6WA 3HR6A 4PUBH 4O58H 5D7JA 3ARBB 4XNUL 1IM3B 2XG4A 4OM1H 1PGRB 2VERN 5C08A 3NMEA 4V3EB 4OUOA 4PJDF 2XWBA 4P9MH 5KS9E 1HSBB 1KGCE 5LCVL 3REVA 4JPVH 3IAPA 3P4OB 1NBQA 1RZ8B 3WIIH 4RWYL 3EO1B 4DUVA 5IB4A 4YBLB 1XF5A 1QTYT 3WUZA 1FVEA 3MO1B 4PY7A 1OAQL 3L5JA 5FV1L 4RGMB 1T6VN 3NCBB 3HA0A 4AIZB 2JJWA 4U7KA 1Y6MR 4XPHH 1JNJA 2JK5B 1QBAA 3HNTH 3IDXH 4JPWH 3QIUD 4CADA 4R4BA 3MRLA 3PWJA 3SKMA 4APQD 2FEEL 1JK8B 2PUQT 2NY1B 1YEIH 4DZBB 3VRJB 4NWTL 4TSAH 4JFPA 2X1XR 5HVFB 5D5MF 5IW6B 2D3VA 4Y4FD 4ISVB 1E4WL 3AROA 3INUH 2HA1A 4HXBL 5I9QC 1HE7A 3OKEA 5GRXG 2I9LB 4NQDE 4IOFD 3IS0X 5GIRA 3TBYA 1JGEB 5E6YA 5BOPA 3TPUA 1Q0YH 4MLSA 2X9XA 2HFFA 5TQ0H 2Z8RA 1PZ5B 2VKXA 3V95A 1CTOA 5EUOA 5I1LA 4H25B 4ALAH 2MMXA 35C8H 5K93A 3UTOA 1KUMA 3QT2A 1XGRA 2NY3D 1CN4A 5GRJH 3S4SA 5DJ0A 3HTLX 1QFUH 2YD8A 1CTNA 4RGOL 1H5BC 4Q0XL 4KK9D 4FQ2L 5IWLA 2XN9D 4MHHG 4HKJA 5GGSA 3ZT6A 4DKFL 2J8UE 4NKOB 5ALCH 2EECA 4ETQB 2YHGA 5FUZL 2VLME 3T0EC 5JMRA 1VGEL 3HE7D 3SKJL 1MJUH 3NFNA 3Q1SL 3L3DA 1KCSH 2FEEI 3I6KB 2YPLB 5DJDB 4Z9KB 4E0RA 4QYOA 4XXCC 4HH9A 4O9HH 4KK6D 4X9BA 5SX5H 1G7IA 2ATPB 3QEHA 1XGYH 2ZP0T 1L4IA 3HFMH 4PG2C 4YBHA 1ZXQA 5I2IA 3BEWB 4KHXH 1TCRA 2PYEE 3RFZC 1J1OH 4UTBL 1RZJH 3DECA 1K8IA 4QNPF 4LLVB 3JWOL 1DQJB 4LQFH 4M6MH 3GGWA 3IJSA 3TYGL 3HHRB 3QUXA 2GFBB 1DQDL 2EXWD 1KBGH 4X0KB 4MVBC 3HNSL 4Y4KB 1MCNA 3QWRD 5EO0A 5KVFH 1KJ2L 4ZUWA 1CLZH 2E7LA 1JF1A 3BZFB 3MUZ1 5IVXF 1GC1L 3HI6L 4L3EA 2E7HA 5I1AB 5FF6B 4YDVB 4POYA 2WBJD 5K9QI 3KNBA 5HI3C 1FNEA 1N59A 1ZHKA 3NOIA 1MAJA 1KN4H 2I60L 3BP5B 5JW4M 1BIIA 2BNRD 5I71C 3EDFA 1T21B 3WKMH 4UT9L 1QOKA 2BOBA 2VQUA 5JORA 3SCMA 4JQXC 3CXHJ 4PJFA 3TA3B 4JZOB 5E2VH 4FQJH 4XP4H 2VL5B 3VXNB 1MHPH 2OTPA 2J6EH 1KENL 5F7HA 1QFWH 4ODWA 3QI9A 3MOBL 1S9WB 1U8KA 3O81A 4ENEC 4M7KL 4IRJA 1RMFH 2XKUA 1A7QL 2OMBA 3SDXB 4AK1A 2ARWA 3W11D 3ESUF 1T7VA 5GPRA 4AH2B 1AR2A 3ZE0E 1V3KA 4OT1L 1QKZL 5BCAA 1NFIB 2HN7B 5GSRA 3MJ9L 4O2FA 2FZ3A 5L6YL 1OTUD 4J4PA 4NJ9H 4LGRB 1AQDB 2PF6A 2AV1B 4M6NH 5E2UH 4OZHF 5DRWA 5C0BE 4UV7H 3U9UA 3QQNA 1MVUA 1NMCC 3O3DB 1WZ1H 4CMHC 4KXZH 4RNRB 2R39A 3LSOA 4JPIB 3DSFH 1MLCA 3CXDH 2PR4H 1INQA 1HWGB 4LCWE 1NGPL 1TETL 1VPOH 4OBRA 1NCAH 2ZUYA 2QQKH 3B9VA 3HZMA 5E4IA 2D0HA 5J13B 4YDKH 1IC5L 1CFQB 2GK0B 3HPLB 5SX4H 3MRRA 3TO2B 2XZQH 4MHHI 4ZFFA 2V2TA 2O5XL 4PGDA 1NSNH 1P53A 4NO0B 4K55A 5GS0D 5KOVC 1T1WA 1U2CA 4NZUH 1UWGL 2FO4B 2FBJH 5HI5D 5IB1B 4KTEH 3SBWA 1EA9C 1HSAB 3VFGL 4F3FA 3BP6A 3AREC 5IUSA 4PJGB 1GRWA 3NCJL 3EYUL 3KYKL 5ACZA 4L4VD 25C8H 3QUYB 4JCLA 3THMH 1BOGA 4QHNA 3MQIA 3HZYA 3G6JB 1UJTA 3BW9A 3BDXA 5T1KB 4GW1B 4XNQB 3FB6B 4HJGB 4YX2H 3GZKA 3TZVC 1J11A 4H0HB 1ADQL 1CBVL 4E41D 1AIFB 2W9DL 5IROC 4NHUB 1S9KC 3LRHA 4M1GH 4PRIE 1QNZL 2I5YL 2MWCA 3HMXH 3IDMA 1MF2H 4D0BB 1JZ4A 4R96A 4FXKA 2PN5A 4JFED 4XAWH 4PJXB 1IFHL 5KW9H 3QRGH 4JPKL 4OZGA 2IALB 4LLMA 4ZPTB 1EBPA 1QP1A 2QTEA 5FA4A 3U30B 3GMQB 3GIZL 3EYSH 1R3HA 5HVHB 3QIBB 5K9OA 2XPGA 3IFLH 1QRKA 4XNXL 3WJJA 2FSEA 4WO4B 4MDJB 1QEWB 4QRRA 3IU4L 5FYJL 3L6FA 5IOPA 4MCYA 1QBMH 4ZODA 5DMIH 3V4VH 4FQHA 4TPRL 4FQCH 4F9PC 2VDPH 1IAMA 1TLKA 2NXZB 4HUKB 4ZFZB 4G80A 1GIGH 3SKOA 1IL1A 2ZG2A 4G6FB 5DQJA 1TVHB 1H8SA 1Y0LA 4PJ9C 4G6AC 4OZFH 4XPFH 1BQLL 4Z7VE 5J12C 3BPNC 1RFDH 1N5YH 5DA4A 4J3XA 4X80L 1BFVL 3FT3B 5B8CC 4L4TD 4YFDB 5BO1H 3JV4B 1H9VA 4P23D 5DK2B 3U7AA 2GJJA 2P4AB 3D69B 1JTPA 1SJEA 5A1AA 1MWAL 4Y4HB 1FGVL 4EI5B 5JHDA 5CAYB 4HS6A 2YD1A 3GSXA 4XVTH 3T77A 5DHVH 2HFGL 4QRSB 4KAQH 4O2CB 3PHQB 3AM8C 4U1MA 4MA8H 1J18A 4DAGL 2EDJA 5SWZE 2ZCKH 4YBQD 4U7MA 1EHLL 1FNGB 5FGBC 3QO1A 5H2BB 4P3CL 4JAMB 1E6JH 3C60C 4NP4L 4FTVB 3WO3B 2HT3C 4NPYB 1QSFE 4I0PC 5DUPL 1O0VA 3DYPA 4U1IB 2A9NH 5A2KH 4M1CC 1RJLA 4MJID 1X5YA 2OZ4A 2GITA 4LDOB 5KS9F 5DJ8A 1U8MA 1FNLA 5JW3L 4MNQE 1BGXL 4JRXD 5D7IE 4ZD3L 4HC1H 3ERYA 5DJZA 5GJSH 5BS0D 1MHCB 4LCCC 3LKPA 3EW3B 4R4FH 1BOYA 4NKDA 3C6LD 3QDGB 4M48H 1OTTD 2APBA 4AMKL 3GSNB 1RJYA 5JOEA 5DHXB 1NMBH 1AC6A 2OXHA 4K71B 1M71A 1U8LB 3F7VB 2H6PB 4MS8D 4XTRC 2R8SH 2ED9A 5BVPH 3T0BA 3QEUB 4P9HL 3EZJB 3O4OC 1SEQL 4YHOH 1I9RH 4ZFOB 1T5WA 3OXRB 4Z76A 2NW3B 2YKLL 2R56L 3PP3H 1GGIL 2X4SA 2XI9A 3EUUA 3REWA 5K9KA 4MA1C 3V5KA 3CVHB 3BI9X 3O6LL 4HDIB 2OX5A 1OT1A 1BPVA 4GMTH 3K1KC 5C9KA 4KVCH 3S36X 5JXEA 3MXWH 3O3BB 5CGYC 5CINH 1I4FA 3VXRE 3RKDC 3DUSA 1IAOA 3VFUB 4ELMF 4GLRI 2IMMA 3BGMB 3ARSA 4CU7A 3BDBA 4N0UA 2GY7B 2APXA 4KTDH 1EAPA 1YNLL 3FB7A 4PR5B 1IM9A 1UXWB 2J4WH 4P2OD 4Q9QL 1W8NA 5D1QA 1X5XA 2SEBB 1KIQB 3BT2H 4NOBA 1RUQL 3CLEL 5AUMB 5KN5B 5MENB 3WS6C 4RA3A 3OB0H 5C0JB 4NZRL 1INEH 1J05A 4TQEH 1I7ZA 4F9LC 1FBIH 4C56D 4XWOD 1AD0A 5C09A 2GKIA 4OD1L 4XCCH 4ELKA 3LHPL 3GI9L 4PY8J 4Z7UB 2HJLB 3LZFL 3RRQA 1NEZB 1FO0B 3H2WA 2NXYB 2YUZA 2J8UF 3X3FH 4MD5B 2ICEA 3DX6B 5M95B 2PO6A 1A7OH 1SBSH 5BRZB 1FV1B 5ENWA 3DVGA 5C0FB 4WWKC 3VXSD 1JWUA 4MYWB 4Y7MA 3AFLA 1JPSL 5H8DA 4CRPA 1UXSA 3QFJA 3FQUB 2HRPH 1UG9A 4MA3A 3JWOC 2X05A 3PUCA 1VFUA 5IW1B 5LQBL 1G9EA 4O4YH 3UTPD 2F19L 2VR5A 2NX5A 3RWGB 2FJHB 1U91A 3RDTC 3FOLB 1U92A 2HTLD 4GS7C 5AYQA 3V6OC 5ANME 2PETA 5IFJA 1EERB 1GC1C 4GG8B 4HUNB 5HJ3A 4ZTOL 3V8CA 1E6OH 1T1YB 1WBXB 3RL1A 4XNYL 3MLPA 3BN9C 3OB0K 4U05A 4PGEB 1G9ML 2HJKB 5FYKL 3MJGX 1T20A 2C1OA 2DM3A 3R0NA 3QG7H 1A6PA 1OGTB 1FNSH 2A83B 5CIPH 4ZUTB 3RGVD 2DOCA 3H7BB 2BY3A 3DSNA 1IKFH 4X99A 3VD5A 1OGAB 2Y5TA 2HKHL 3X14B 1KULA 3S6CA 4RISL 2EE6A 3ULVH 2I07A 5HYSB 1J88A 4PYHA 1MLBB 2AV7B 2Z0BA 32C2B 3F65A 3ARZA 3N50A 1T83A 3QUMB 4R6UA 4ODTL 3IKCB 5EPMB 1BFOA 5ABDE 4I13B 1NAMA 3R4DA 5IEKB 1X6NA 1YEEL 1I1YA 1ZHNB 4J3WA 3BGFC 1ODAA 2EYTA 1I9JL 5D4QA 3P0YL 3RTQB 3VU2A 2FECL 1U3ZA 3ZE0F 2Q76A 3OL2A 2K9UA 4WDIB 5FO9B 3QO0B 3HS0A 5MEOB 2VAAB 1ACYH 3GSVA 4HKBB 1P5VA 1IAKB 4KMLB 1BF2A 4ZQKA 2V2XA 1OAXL 4XVJL 4OCYH 1C12B 1NLBL 3OAYK 3KPLA 4NZJA 4JFZH 2ADGA 3FOMB 2PW2B 4JLRB 1EEYB 1IZJA 2D0FA 3IU3B 1BVKA 3PGCA 2OP4L 1FLRH 1T66C 5D8JL 5JNYA 2V5MA 4RFEA 4EBQH 1FORL 4GKOA 1JBJA 1EX0A 2EIDA 1N8ZB 1QVOB 1YMMD 4PRNB 4KZEL 1XZ0A 4OV6F 2GT9B 3HUJB 1QA9A 3TN0D 2RCSL 5EC2B 1BZ7A 3BUYA 4PJ8A 1JJUA 3ARWA 1P1ZA 4LLUA 3EIFA 3CZFB 3UTSD 1B0GA 2EDBA 5DLMH 1VDGA 5A16B 3ARDD 4LNRA 2YPVL 4JFQA 4DKDC 4HQQL 3FFCA 2DDQL 2H2SD 1CK0L 2XN9E 4YPGB 5GRWA 1HI6A 5DJ2B 4X6DB 4JZJA 5DD0H 5HDBE 5DS8A 5FCUL 4U0QB 4NNYA 3T0AA 2F5AH 1FG9C 2B5IB 4JQVC 2GK2A 1NCCH 2VJXA 2DIAA 4XBPA 5CMAA 4DN3L 2N4IA 5GHWH 3FONB 2P43B 2F58H 4DEPC 3QFDA 3VH8B 4D3CL 3O2WL 1G0XA 5KOMC 2I24N 4X4YB 2UY6A 1OD7A 5FA3B 4YNYA 3HI5H 1AGBA 1TZHB 4LEOB 1KTLB 4G7YH 1KLGB 1VEMA 3O41A 4V1DD 1IGFH 3V9FA 2F53E 3CK0H 2X9YA 3ZTJH 3BPNB 4JANA 4YDLC 1MIML 1MRDL 4YHIA 5DZNA 5CEYB 2R4SH 1OM3H 3MCLL 1T0MB 1LP9B 3CMGA 3ARBD 2QADC 2GTZB 5CBAA 3K4DA 3VFPB 1JPGB 5SV3A 1N0LA 2DLTA 3N06B 3S8WA 4Y16A 5E99L 1WTGT 2VLJD 4F57L 1S7TA 4JY4A 4IMLA 1RD6A 2PXYB 4WI4A 2BDNL 3SDCA 1FN4B 1YPZA 3MJ8A 5TE7H 4F15C 1A3LL 2MCPL 1QHOA 3ZKMD 4NSKA 2BNRE 5EBWB 2B8OT 3C5JA 5D2NA 4JN1H 4YDIL 5JW5B 3EDEA 3E6FA 4H8WC 4HD9A 4XC3H 1HOCB 2FX7H 1DBBL 2UWEE 3QISA 4X7DC 3U4EB 3RI5K 2QQNL 3L9RB 1BBDH 4EQ2A 1IVLA 4JO3L 1DQLL 4WV1B 1AHWC 1TCMA 3MCG1 1P4IL 4WI6A 4OD3L 1B0WA 1CFNA 2AEPH 4GAYB 2NY1D 4H20L 3QR2A 4XBEL 3QXAA 4QRPA 1CGYA 4QOKB 4ZNEE 3C5ZA 4JJHA 2R2BA 5D6CA 4EVNB 1C5BH 2QJDA 1AP2A 4KVNL 4LLDB 5EFIA 3SDAC 5FKAA 2EZ0D 3RAJL 2PYFB 2E6JA 2NY2C 3MODH 4X7EC 4MJ6B 5ADOL 3RWDB 5E9DB 5ACMA 2V17H 3O45B 5I1KH 2BJML 2XKSA 4Y2OA 7CGTA 2BFVL 3O0RL 4WJ5B 2NCMA 3IDGB 2AK4B 4XT1C 1I7RB 1TZIB 3MJ6A 4I4WA 1XCTB 4NFDA 4OQTA 2IG2H 2VXUL 3QEQB 3MYJB 4RFOH 3D0LA 1CDYA 3MA9H 2MPAL 4M8VA 2E9WA 1ND0B 4OM1L 1CR9H 1X5JA 4J8RB 1RK0B 5J1AB 1S7VB 2DICA 1PKQB 4JPVL 1K4CB 1EUTA 3TBSA 4XCEA 4MAYC 5IKCA 4HJ0D 4PJ9A 5IMMB 1KJVB 1CGXA 1IGJA 1JNHA 3I6GB 4JJ5A 1T0NB 3WNOA 2AP2A 2YWZA 5HYIA 4XZUA 2CKBL 2GSIA 4GG6E 2YMXH 3LD8B 5TDNB 5B8CA 5BXFB 3TJEH 3OR6B 1ZHLB 3TH3T 5FDWA 5HHXH 4TTGA 4BZ2L 1CLCA 2A6DB 5DEFA 3NAAH 1UA6L 5DJCA 1IGYA 2P24A 2YPLD 4PJCB 3TVMC 5D7IF 1MQKL 1UH3A 3PWPA 2CR3A 2HT2D 4G8EA 2EKJA 2X6MA 2DL9A 2BSTA 2XWTB 4K3JL 3ROLA 1YEIL 4P9HC 1AQKH 2A6IB 3K8LA 5KTEH 1P69B 1EUUA 2OL3H 1WT5C 4Y2DC 5CILH 4GQ9L 3HZVB 2FYYA 2OR9H 4L4VE 4XVUC 4RCAA 5DGRA 4LSDA 5DO2D 3X11A 1I7UA 4AIOA 2VLRB 5T33H 3SEPA 1LO0H 1T0PB 1VADB 2VQ1B 3INUL 4MXQD 1PG7L 3TO4A 4Y4KD 4PV8B 1UZ6E 5INDB 5JMOC 5CLWA 1RZIA 5GZOD 4E41E 1UWEL 8FABB 5TQ0L 1ZT7B 3PGDB 3PE9A 1UWXH 5GGVH 4DKEH 4HIHA 2GEEA 1SJHB 4K7FB 3ARGC 2P5EB 3B8SA 5F7DB 1N0XH 3RPIA 3D9AH 2IAMA 2Q7NA 3BP4B 4TUKH 2B4CL 5GRJL 2VIRA 4MSWA 3HRPA 2XTJB 3TA3D 3UTQA 4F7EA 5L7XL 4J3TA 1QFUL 4KUCF 5T1LA 4Q9CA 3KJ6L 1NFDB 1FIGL 1CE6B 3MGTB 1X5FA 4ZUUB 4UDTA 3OB8A 3PIQA 3DMMC 2A74A 1LE5A 5HHVH 3K2UH 5KSVA 4TTDD 3U7WL 2A6KA 4A6YH 5FK9A 1VACB 1EO8H 1Y18B 3GRWL 4IMKA 3RL2A 1FH5H 4QY8A 1IAIH 2V5YA 3VDBA 1WCQA 1KCLA 1A14H 2DD8H 1GGCH 1D3CA 1DUZA 1MJJB 3HFML 4KHXL 5CSGA 1E28B 1UC6A 3F7YA 1U8PA 4G42A 3G5ZB 4X5XA 4LQFL 1JUFA 1PZUB 4JO2H 3GSQB 4U31A 3C08L 4X5WA 1A21A 5HDQL 2F8OA 1JHTB 4YXLH 3EDKA 4YK4B 4BH7A 4HW6A 4X9GA 2DLIA 1D5ZB 2Q87A 4YHMH 1FFRA 4PB9L 3NCCB 2EDQA 4OLYL 2Q6WB 6CGTA 1TXKA 1ZLVH 1G9MC 4AENA 4Z7WA 2VSDA 5D7JB 5DJAA 5HSFA 3LS5H 2ZOKA 5E95B 2ITDA 4GBXC 4OJFH 3LAFA 4WUUB 3PHSA 4NO0D 3I9GL 3REVB 1MNUH 3V52H 3T0XA 3HPJA 4Q9RL 1YYMH 3ARYA 9CGTA 4FQJL 5MP6H 3DIFA 4MJIE 3V4PH 5IB4B 1I1FB 1XF5B 1AGCA 1G7LA 1QFWL 4PY7B 4ZDHA 4JRXE 5I8CA 1L7IL 2NY5H 1AGEA 1XFPA 4Z0XB 4HWUA 4M00A 3QUYD 5I8OH 4CADB 4R4BB 3MRLB 2X4PB 1KJ2A 3PWJB 4N0CC 3SKMB 4G6ML 4WRLA 3RVUC 1TMCA 4JFPB 5D71H 3CLFH 4KDWA 1CICB 3W0WA 3N1PC 3U4AA 4YHLH 1IC1A 5E6IC 4G6JL 5KSBA 3VFOA 2YSSB 1A1NA 4UV7L 2RR3A 5F7FA 4DVBA 3BIKB 5J9PA 1YEKL 1WZ1L 4G7VH 3VFSA 3PGFH 3OKEB 4H5SA 3DETD 1J1PH 3CXDL 3TPUB 1N5AA 2PR4L 3L1OH 4FFVD 2HFFB 3LPWA 2BVEA 2KDGA 3RNKA 3BKYL 3VRLE 5EUOB 4G3YL 3QIBD 1MJ7H 1WIUA 2GUOA 1BLNA 4Z8FL 2GJ6B 3A6CH 1G7MA 5DD5L 1XGRB 2XZQL 3R06A 3V0WL 5DJ0B 5BV7H 4LPUA 1NSNL 1HINL 2GJZA 1N2RB 2NXZD 4UILH 3LS4H 3FKUS 1JTTA 5IGXH 1QFWI 4NZUL 3N1QC 5T1DL 3MJ9A 3AUVA 4G6FD 3DO3A 3EHBC 4KTEL 5F96L 5F1NA 5GGSB 1BJMA 4PLKD 4IJ3B 2VDOL 3QH3A 1CLOH 1GZPA 1ZK9A 2R1XB 4Q6YA 3OAZK 5FM5M 4C56E 1R0AH 3WD5L 5I15L 3T2NH 3U9PH 1XGUB 5C0AA 1UT9A 5I73B 3NFNB 4PJAB 1HYSC 1V7ML 4YE4H 5JQ6L 4YFLF 1SVZA 5HDBF 2DWEA 5F72S 4S1RH 1Z3GH 4EI5D 3FZUC 1LO5A 3NH7H 1FNFA 2GAZA 1G7IB 3QEHB 2FX8L 1D9KC 1AFVL 3HLAA 3M17B 5I2IB 5KVMC 4WHTA 3GSRA 3DBXA 1K8IB 4M1GL 2FHCA 1DZBA 3VXPA 3GGWB 3GI8H 4QXUH 3UTPE 3QUXB 3MOAL 1WLHA 3EBAA 1FDLL 4YIQA 5EO0B 4ZUWB 1JF1B 3QRGL 2R2CA 3LEXA 4FTVD 4L3EB 15C8H 3BPCB 4L29A 3KNBB 4ZSOA 4S11A 5SX4I 1FNEB 2P8MA 1N59B 1ZHKB 4WHYH 2OBGA 3PNWA 4OLUH 4ZXBA 1UM4H 4PG9A 1UQSA 3FMGL 1BIIB 2LE9A 3MRDA 4N0RA 3S36H 2BOBB 2LV4A 4KDVA 4N5ED 1A9BA 5JORB 3SCMB 3P77B 1R5VA 5DVKA 1VGKA 2C4FT 4R26L 1GIGL 2X7LA 2WINA 4YUEH 3QDGD 4JCMA 1OSPL 4HPYH 4POUB 1KEMH 4QXTA 4WCYL 2UWEF 3QI9B 3DHJA 1ADQA 1U8HA 1H3UA 1RFDL 4DK3A 2H9GA 1T22A 4PRHB 4IRJB 2CO7B 4PJDA 2AABH 4G8IA 3TH4T 5T5NF 3T1FA 1S8DB 3NN8A 1JHLH 2CLRB 1NPUA 3LRGA 4HIXL 1R5IA 3VXUD 3MRMA 4ZYKA 4F7TA 4C54A 1JGUL 4PJ7E 4O2FB 2FZ3B 4RGNB 3RI5F 3MRCA 4JO1H 4FFWC 3WFHA 2V9RA 5ESVA 4CVUA 2DKMA 5HXMA 2BVOA 5DRWB 1OAZL 1U93A 1SY6A 3U9UB 5EIVA 1MVUB 3FB8A 3Q2CA 4MNGA 2WQ8A 3UDWA 5C9JA 3C2AH 3O9WA 3LSOB 1MLCB 5AD0A 1INQB 4R2GB 1DL7L 1IGML 1XGPA 4N0YL 5D5MA 1ZLWK 3HZMB 1U3HC 2OQJA 5J11B 5MEND 2A9NL 3B9DA 3CX2A 4PTUA 1YMME 4DGIH 5MEPA 4HGWB 1DQMH 1BVZA 4ZFFB 1DSFL 2R29H 2Q86A 3QHZH 4PGDB 1ZLUK 4OF6A 3BMVA 5F7YC 5BVJA 5HYJA 1HXMB 5F7NC 1T1WB 3UTSE 3GJFA 3OJ2C 1P4BL 4LASH 2NXYD 3QXDA 2B1AH 3BOVA 1MFCL 4JFYB 1NGQH 4M02A 4GG6F 1HYRC 1H3XA 5BJTA 4F3FB 5BRZD 4OBSA 3WJLA 1ZTXL 3TYFA 1ORSA 3BE1H 3HR5A 4NUGH 1L6ZA 5ACZB 1H3WM 1XGTA 4YHOL 2R0ZH 2ENSA 2EC9T 5D7LA 1BOGB 4QHNB 5EUKA 3CXHK 3HZYB 5DWUH 1CD9B 2J8HA 4MXVE 2DM7A 2NLJA 3CFJA 4FQLL 3WUWG 3NACH 3G5VB 4U2YA 4KVCL 4V1DE 3LRSA 5CEZH 4FG6D 1D7FA 2BVPB 4MAYA 4I0KA 3IAGC 3IDMB 3FB5B 1D5XA 1R3JA 5EO1A 1UZ6F 5DSCA 4FXKB 3BAEL 1SYSA 4LSTH 4NQSA 3TIEA 3HAEA 2B4CC 4KTDL 2AXGA 2DBJA 4O5LH 4OZGB 4LLMB 5FA4B 4MAUH 4Y1AE 1OGAD 1R3HB 1WQVT 4B5EA 5M7QA 2QL1A 3OXSA 2XPGB 3SGDH 5CLTA 2YPKA 1FFOB 2VWEE 4DOHB 1T7YA 1KNOA 1L0QA 2YA1A 5KSAA 1INEL 3L6FB 5FO8A 4TVPH 5FOJA 2IFFH 4MCYB 2EC8A 2X41A 4XP5H 4FQHB 4KMTH 1HHIA 2EDLA 3KLAA 4QGYA 5HGHA 5IVXA 4G80B 3SKOB 3UC0L 2WUBL 1B4JH 4QKXB 5DQJB 1EMTL 4ZOEA 3X3FL 3AY4A 1L8JA 1A7OL 3MLVL 4HS3A 4UAOC 1N3NA 4KJPD 4JFDA 4OGAD 1MCQA 3RTQD 3M1BB 5CD5C 5KBNC 1G6RH 4KKBD 2N7AA 4JFHE 1F58H 3BRDA 4IIQB 1DBAL 3Q5YA 5JHDB 1F4HA 3ZTNL 2R9HC 1U41A 4HS6B 1GHFH 3N85H 3GSXB 3T77B 3O6KH 1KJMA 1MJ8H 4FQPA 4KJWC 2JJTC 4D0DA 2OSLA 3MPCA 3QWOA 1OP5K 5D1ZA 3LQZA 4RSVA 3W2DH 4B41A 1NC2A 1QR4A 5T3ZD 2LTQB 2O26U 2X1QA 1QD0A 1YY9D 5GGUA 5TPWH 4ZS7H 4LOUD 3RWJB 5H37H 1OHQA 2F54A 4HS8H 1UKSA 4S1SL 5I75C 3QO1B 3CCHA 2QQLH 2EE2A 1FNSL 4GKSB 1WCBA 1DQTA 4OZHA 5HGAA 1IKFL 4F33B 2CIIA 3GM8A 1UJ3A 5DFTA 1RJLB 2GITB 5HYEA 1TNNA 2NTFA 5DJ8B 1U8MB 5JQHC 2G5BA 2DQFA 1KB5L 3DNKA 2X70A 3AVEA 2A9ML 5DJZB 3BVNA 2VH5H 3K80A 3BD5A 5CZXC 2GCYA 1A0QL 3LKPB 4NKDB 3KDMA 4GQPH 1VFOA 3L3HA 3P0VH 2YPLE 3VGBA 4KQ4L 5CZVL 3LKQA 4P48A 5F7LB 1M71B 2AJYL 5JXAH 4XPTH 1LK3H 3UPRA 4NBZB 2IPTH 1MRCL 4DCQA 5TQ2H 3FQXA 1T5WB 4Z76B 2C26A 3REWB 2X4SB 4KDTC 5K9KB 1VB9A 4EOWL 3G5YA 1HIMH 4P57A 2DQEH 2H3NB 1TJHH 5EO9B 1CGSL 2W59A 1WAAE 4LVEA 1U0QA 5IHUL 2VLLA 1I4FB 2PXYD 4X4ZA 2EDEA 1H8OA 2VZVA 1IAOB 1CXKA 3VD3A 3QQ9C 6FABL 2H2PC 4LSRL 4D9LL 1FLTX 4Q6IC 3MLYH 5EBMA 3RY4A 4N0UB 1OD9A 2YRPA 1EH9A 1EAPB 3PABA 3VRLF 3WNPA 1IM9B 1RZGA 2UVEA 1Q1JL 4F80A 5C6WH 1F4YL 5DLML 5D1QB 1JYVA 3V8OA 3OF6A 4YFLI 2JIXA 2PCPA 3H9ZA 4FQQA 2A1WL 3BXNA 3KXFA 4LSSL 4N0CA 1BZ9A 1RZFH 1I7ZB 1UKQA 3RZCB 1MEXH 3DRTB 3WN5C 1XIWC 2X4RA 1AD0B 5E6IA 3MNWA 5C09B 3VD9A 1ZWIA 4QOKD 4ELKB 1NCCL 3SDXE 5F6IB 1ROWA 3HB3C 4Q7DA 4OCWH 3ECBA 4YZFE 4CNIA 2F58L 1I7TA 2ICEB 1RK1A 2PO6B 5L2KA 1KYOK 3V6ZB 4MQXD 3B2UC 3EYQC 5E9DD 3DVGB 3IJYA 3U79A 5F71A 4P4KA 2VC2H 1IT9H 4G7YL 5CD3B 1O5DT 3JVGA 3U36B 3DOSA 3CK0L 2AK4D 3QFJB 5KAQG 4MA3B 2YD5A 4RA0C 3QEQD 5ESAA 1EFXA 3B3IA 4BSWB 3ZMRA 2R4SL 2NX5B 1OM3L 3WMSA 3SGJA 1NMAH 1U91B 4NT6A 5A2IH 1U92B 3HI1A 3LN9A 1Q0XH 5IFJB 5HYQB 5HJ3B 2C3HA 3DVIA 3RL1B 2P8PA 3MLUH 4CMMA 2IFGA 1S7XA 3U0PA 1GSMA 1JMZA 1RUPL 1K5NA 5L0QC 1T20B 2C1OB 4LLQB 4JN1L 3NA9L 4I48A 4Y5VA 4H1LH 4Y8AA 4YXKL 5DC9B 3CH1A 3UYPA 5GS0L 3MUGA 4X99B 1LO3L 1KXTB 3KS0J 2ZWLT 4YHPA 3VMNA 1EEQA 3KPMA 2G2RA 2OI9A 2I07B 3L3OA 5BW7C 1UEYA 3SDDA 4RMQA 4YR6A 3GJEA 3OKLA 1DLHA 4YEFA 4P2QA 5IMOA 4PJGE 5FV2A 2W92A 3RJQB 4UT7H 3UPCA 5AYUL 4BZYA 2GSGA 4QCIA 5TGBA 5DDHA 2VLRD 1C5BL 5FYLH 1NAMB 1MELA 4PP1D 4I8DA 3TC9A 1I1YB 1FJ1A 3MA7A 5KS9A 1CFVH 2V17L 4FMKA 1W72H 1T2JA 4G9DB 1KN2H 4KUZH 2EYTB 4KRPC 5IBLC 3UYRL 4NOFA 2Q8AL 3KVQA 4I2XA 4NHUE 2ZSVA 4H88H 2Q76B 3K0WA 4X5LA 2Z8VC 1Q8MA 4QRUA 4M5YH 3HS0B 4PJ7F 4JM2A 1Z5LA 2D7TL 3MGAA 3GIVA 4PBWD 3GSVB 1EAJA 2BNQA 1E0OB 2P5ED 2V2XB 4OIIH 4R3SA 4N8PA 3SE3C 3MA9L 4PJXE 4Z78A 1GAFH 2UZXB 4NQXA 3NIFE 1CR9L 2ADGB 2ED8A 5K59E 4EDXA 1BVKB 2XTJD 3PGCB 4KJQC 5C0NC 3GM0A 4RFEB 1UCBH 4BFIB 4JVPA 4U6VH 1S9VA 5EH1A 1NANH 1XZ0B 1NLDH 1KEGH 1A5FH 2VDNH 1QA9B 4OLXH 1BZ7B 2H32H 2BC4A 3RUGB 5F1SA 4PJ8B 1I8KA 3RY6C 4U1KA 4BQ8A 1P1ZB 4ONHA 2YMXL 4LLUB 5CSZA 1B0GB 3CDFA 4LNRB 5HHXL 4JFQB 5B4MC 3R1GH 3FFCB 1L7TH 1QFHA 1HI6B 1X4ZA 4ELMA 5F70A 2DQHL 1Y6NR 4JZJB 5DS8B 3Q5OA 4NNYB 2R0WH 3MZTA 4QHUA 5B39A 5E8PA 5DFVD 4PDCE 3QG6A 4OLVL 5CMAB 1T03H 3PL6C 3UJIH 1D6VH 3LDBB 1TZGH 2OR9L 2VO5A 1I8IA 4WI3A 5IV2B 2BVUA 3QFDB 5CWSA 1RUAH 2CJUH 3CVHH 5LBSH 5B38A 1J10A 4XHJC 1J1XH 1AGBB 4JKPH 3ZE1E 2ESVB 3VGAC 4KQ3H 3O41B 4M7ZC 1X7QA 5DJ6A 3MREA 3P73B 4G5ZH 4MXVF 4JANB 4YHIB 5IF0B 4KRNA 2R0LH 3U82B 4CBPA 5D7JD 5GGVL 4LSQH 5IQ9A 3OG4B 4KI1A 1OPGH 5CBAB 4CJ1A 2BSRA 4EI6A 2BZDA 1DANU 4Y16B 4HFUH 4TUKL 4FTVE 5JTWA 1S7TB 4YC2B 1M7XA 4IMLB 1TQCB 3SDCB 1YPZB 4L8SC 4E42A 5B3JF 3SJVE 4NSKB 3H3PL 4Q2ZB 5HHOE 5CCKL 1DLFL 3C5JB 5D2NB 3JV6A 3E6FB 2FR4A 1HQRA 3WEXB 2ZUWA 3HNVH 4HGKC 2AQ2A 3V0VA 3F6LA 2WW8A 4GRLA 1U8IA 4KK8D 1Z9LA 4Y19A 1EO8L 4Z18A 3TJHA 4NO5A 4XMPL 3QDGE 3QIUC 4APQC 4R7NB 1YEHL 1IAIL 1CFNB 4GW4A 5DD3H 1W0YT 3J8F7 4U3CA 1CICD 2DTML 3QXAB 4QRPB 3D1MC 3C5ZB 5BOZG 4OZIA 2R2BB 3MOQA 4YGAB 5D6CB 5H94A 4Y4FC 5EFIB 3IFOA 1DDHA 3GBMH 5CJ8A 1BEYH 4F7MA 5F6HI 3SGKA 2AJUL 3BQUA 5F7EL 3UZVB 1HZHH 2NQCA 4IOFC 3OAUL 2ID5A 5EA0H 1E4XH 2EEBA 3CFKA 4I4WB 3DXAB 2IQ9H 4KROB 1KFAH 3ZE2E 3OGCA 4LPXA 5ALBH 2DQDH 3T08A 2VRAA 5GS1C 3B5HA 5FM8A 1KCRH 1UB5A 1UM6H 3D0LB 4P59L 2GJ6D 3LS5L 3QQ3A 2NY3C 3GO1H 3QP3A 3BKJL 3CFIC 2XA3A 1S7QB 2MQ0A 1KXQE 1U58A 4LHQB 5F9AC 4TYUA 1R6VA 3QDMB 3TBSB 4XCEB 5IKCB 4KK9C 1IGJB 4JKMA 4S1QL 1JNHB 4JJ5B 1YYML 1D5IL 2X09A 2X4NA 3QDHA 5MP6L 3KPTA 4M93B 3P40A