1A9EA

Decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to non-standard positioning of the C terminus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class i/peptide)
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B*3501 (ALPHA C
total genus 77
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1998-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a9eA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a9eA01
4IRZL 3H0TB 2OL3L 4LSRH 3LCYA 4LLUA 1NFIA 3VGFA 3T2NL 3D18B 2DQJL 3DHJA 1FFOA 4XP6L 2FX9H 3HRZA 3UZVB 2IQ9H 3DUUA 4L3EE 3IJYB 3U46B 2CLRB 3QULA 2Z8SA 3OXSA 3ZTNL 3IF1A 4RGMB 4F57L 3U6RB 3OV6A 2X44D 3K2UH 2V7NA 3PGDB 2HFGL 5D5ME 4CGTA 5ID1A 2GIYA 2H2PC 5HHOE 4E5XA 4H0GA 4MX7B 4QRRB 5FCUH 1EHAA 3HUJE 4A6YA 2ITCB 4N68A 3RWJA 4X7FC 3DMMD 4KRPD 4DKEH 1NH6A 1UZ6E 3LPFA 5BJTB 3RWEB 3BO8B 1U6AL 1RZ7L 1QHPA 2HVKB 3UJIL 3GSUB 1E4WH 3ZSTA 2ZOLA 2R1XA 4BSVB 8CGTA 4PV9A 4LRNH 5F8RC 4KRNA 1RZGB 1MOEA 3FOLB 3GMRA 4IEFB 2NPLX 2HRLA 4XPGL 2ZSVA 1WT5A 2AJYL 2VISB 4RMVA 4DCQA 1OY3B 4JKPH 1S8DB 2MOVA 4UB0H 4IDLA 2ZCKH 3EO1A 3IDJA 2FLRT 3N06B 3OKKA 5EUOA 3BPOB 3VFRB 1QBML 5J9PA 4YO0A 1QSFE 5JA8B 4L1HA 5EU6D 3T0EB 5CINL 2HTKD 1X7QA 4YDVB 5J11B 1I85A 4M62L 2NY7H 5JOEA 4ODSL 5GGVH 4DEPC 3SDXF 3QBTB 1J0JA 3GGWB 3TVMC 3GGWA 2Z92A 3U9UB 2NR6D 2LQRA 1JHLH 5DXWA 4GBXB 2P43B 4JM2A 3KPSE 2DMBA 1II4E 2BVUA 4M8VA 1WBZA 3E3QA 5D4QA 1WBZB 4M61A 3F65A 4LEOB 3BGFB 1LEGA 4HMEA 5IQ7L 4ZAKB 2ATPA 3D2UB 1UWEL 1V7NL 5E8OA 3IDIA 4IOIB 4EBQH 4QXGH 2BXZA 2E7LA 3P3YA 4X6FA 5HHOD 3TA3B 2KQMA 4LLAA 1HNFA 1ACYH 2OI9C 5DK3A 4RGNE 1IEHA 1I1AB 2G2RB 3L3GB 1A21A 5F1SA 1QD0A 3Q5YA 4OFYD 3W39B 3C87A 2OLDA 1CFSA 2B1HH 4PJAB 4HUVB 4XAWH 1NEZB 4OZIE 1E4XI 1IM9B 1NEZA 3MRQA 3BWAB 2ZJSH 4LASH 1EFXA 3QXTA 4EN3C 3VFMB 3RZCD 2NTFA 4H8WH 3RGVB 1BF8A 5C08D 5K9QG 1CE1H 1H9VA 1QO3B 5KG9B 1NPUA 2FRGP 3MLTB 4X8JB 3DNKA 4PYGA 3VMNA 5F9DC 3NZ8A 5IB2A 4KWUA 3AU1B 3HMWH 5H37H 3GMOB 3GK8L 2E7MA 5IVXA 5IFAH 1QSFD 5IVXB 3O3UN 3P73B 3CX5K 3ARFD 4D8PA 5J11C 4M48H 4LL9A 4OCWL 3D3VA 4OD1H 3D3VB 2V2XB 4OD1L 1QUNA 4I9WE 5GIRB 3QJHB 5KANG 1E4XL 3MRLA 5HDBE 5C09E 4L1DA 5A2KH 1F00I 2GT9A 1E28A 1Y18B 3I6LE 3K2UL 3GK8H 3EJYD 5KS9E 1RPQA 3QEHA 4PTTA 5D1QD 4J4PC 2EZ0D 1NFDE 4LGPB 4BKLB 5C0RH 3VWKB 5D6DC 4PJBF 5ALBL 2OR7A 2DIBA 3DMMC 1WZLA 3VFTB 3R06B 3G08A 3R06A 2UV3A 2ZG3A 5F72S 3WSQL 1XAUA 5HGBA 2FCBA 2H3NA 4G8IA 2F8OA 2VAJA 5FYJE 1CTOA 1J1PH 4YHIA 5J56B 5HHOA 1KLUA 5E00B 2GAZB 3D39B 5TE7H 1U58A 4ODSH 5GGVL 2CGRL 4YFLI 5I9QB 4R96B 3OKDA 2L4OA 1I8LA 2UUDK 4K7PY 1JF5A 1E4KC 4FQIL 3SKMA 5E5MB 3SE4A 3CMGA 4WWKC 1VADB 4M6OL 5DA4A 4UTAL 3JV4B 1JNNL 4V3DB 1KEML 2AJUL 5BXFB 2MPAL 2JE8A 1ZWIB 4XPTL 5C0FA 5C07B 1OOAA 1D5MB 5KVGH 4P5KB 2EC8A 5ICYA 3CH1B 4LDEB 1XGQA 4WTZA 2HKFH 1T1WB 2R2CA 3JV6B 4MS8C 1CLZH 1D9KA 5ACLA 1YPZB 3ZZ1A 3O6LH 2X4UA 4HJGB 2W65A 4Y5YC 4I4WB 4JZOB 3WO4C 4JZOA 2N56A 2VQTA 1ZKAA 2WWKO 4JFPA 1T7YA 1ZT1B 4PP1C 3CCHA 4L8DB 5F1IB 3C6LC 3CCHB 2JJSC 1U8HA 1NC2A 4YEEA 5GRWA 1HSBA 2H32B 3D0VB 2RJMA 5ESVA 1AE6H 1I1RA 3CFDA 3DO7A 1QSED 2Y7QB 4JO3H 1CVSC 4AG4L 3MRRA 1FCGA 3FB6B 1ZT4A 2HRPH 5HY9A 4XBPB 1OSPH 5FDYA 1CR9L 3B9KB 4MD5B 4U6HA 4LRNL 5HTSA 3QCUL 3ZDXF 3O9WD 5FECB 4G59A 2AK4E 1JZ5A 5FB8B 5IBLC 4DKEL 3P4MA 3EIFA 4YDIL 3P4MB 4WI3A 3Q6FB 5C0AE 1YDPB 1F3RB 1KELL 1HEZB 2M8XA 5GS0D 1HHIA 2DLIA 2XYCA 2WV3A 2ARJB 2G60H 5DQDH 3QEQB 5C0BD 2P48B 2UWEA 2DJUA 2HFGH 3FRUA 5JQHC 3HE7D 1JPSH 4LVNC 2ADFL 5FF6B 1Y0LA 1J5OL 5CGYC 2JB6B 1TNMA 4O2FB 2NXZC 1PY9A 1W0VB 5GS2H 1I9IH 3WLBB 3OJDA 2DL9A 4IRJD 3CUPA 2SEBB 2FHFA 1LO0H 4WHTB 4FXKA 4U1IA 1V8HA 4P2CG 4YZFF 3HFMH 3LEXB 1M05A 2WAHA 1HQRB 2P5ED 3K8LA 1HINL 4G5ZH 1EA9C 4JG1H 3KLDA 4JG0L 3SCMA 4ZOAA 2Z91B 3IRZA 3M8OL 1TPXC 5L8LB 2QR0A 5HYJD 2ED7A 2VDOL 3QEUB 5F7UA 1FAIL 4OUOA 1MY7A 4LU5L 5ESQA 2E9WA 4JM4L 1C5CH 1DQDL 4D3CL 5BVPL 1Z9SA 4LK4A 2HMID 3MLWH 3STLB 2QADC 3CSPA 4QOKD 1YEHH 3QDJB 2BNRB 4X6BA 3CLEL 2O5YL 3AAZB 2Q8AL 5I8OL 4U1GC 3FFDA 3CJJA 3LSOA 1DVFD 3RIAK 5I1EH 1ACZA 2EXYD 3TIDB 2HAZA 4PB0H 3TIDA 4WU5A 3QEGH 3KPRA 4MWFA 1JMXA 2H45A 2LABA 1ITCA 4GSDH 5ALCL 3O6LL 4GW1B 3MMEA 1L7IH 2F5BH 1C5BH 1VERA 3O2WL 4HZLA 3PHOA 1FSKC 1NMAH 5KOMC 2ADJA 5IB1A 1X5AA 1WAAA 4WJ5B 5IB1B 4HJ0C 4XMLL 1T5XA 3VJ6A 2DQHL 5IKCB 1CXKA 1S9YB 2AEWA 2HLAB 3JUYA 5HI4C 4ZTOH 1QKZL 2R1WB 4KROB 1C7TA 1YJDL 2R0KH 1A6VL 3GIZH 3SDDD 2YPVL 5ERWB 5AYUL 4U3CA 1XEDA 5I1JL 1CD1A 3MV9A 5B21A 5F9OL 2AV7B 1KJ2A 4NPYA 1TNNA 3DI3B 1KB5H 1BIHA 3IU3A 5LGJA 4UZGA 5IHLB 4G3YL 2DYPD 1VFBA 2AEIT 3D2UD 1WCBA 5LAXA 1BQUA 1S3KH 5I2IA 2VQ1B 2EDDA 3ZDXE 4LSUH 3ALXA 3O9WC 1NBZA 3HR5B 3IT8D 1IGCL 5HYSB 4QRPE 3W81A 1YEFL 4G80A 4CNIA 1U9KA 1YEKL 3FRPA 2DBLL 3BIKA 4UAOC 5GGUA 3B9VA 3U79A 3WKNA 2GQHA 1PSKH 2EH7H 3HRPA 5E5UB 2J1KA 4NSKB 2C7UA 2OTUA 4L4TE 2ENYA 4W4OC 4G8GA 3ARGC 1DCLA 1OD7A 3QYCA 4I8DA 1UZ8A 2ED8A 5IT2H 1K8IA 4AY0A 3VI4E 3FHQA 4R90H 2ZCHH 5IM7A 4WUUA 1P7KA 4N1EA 4JO4L 1ZHBB 1ND0A 3FCTB 4HX1B 3RU8H 5C0BE 4EUPG 2P8LA 4GAFB 3DRQA 5HPMA 4OCRL 3KPSB 4DVBA 2XFXA 5DRWA 4RQQB 4Q2ZA 1I1YA 1D6EA 3W9EA 1FLTX 4OI7A 4FQJH 4QF1B 1P53A 5D7LA 2VDQL 3S35X 4K7PL 3X3GL 4JRYB 4NJAH 2WBKA 5T3ZL 1ZA3A 4ZS6C 1OAYH 4X6CB 3T77B 1FFOB 2IPKA 3X11A 4C83B 4N8VA 4JHZA 5AYQA 2Y4SA 3FB8B 3VG9C 3ZKMC 3QXDB 3DUUB 5CEZL 4F7MB 2KDGA 4PJDB 3NN8A 7FABL 2WINB 4KJWD 2N7BA 1U92B 3ROLB 2QQLL 5B22A 2Q7YB 3PF2A 2W0PA 5CSZB 5EIIB 4C4KT 1RZIB 1B4JL 1AXTL 1A6PA 2F5AH 3HE6B 1K6QL 3VD3A 3OAUH 3DJ9A 2VR9A 4MLSA 3PHQA 4FQ2H 1CFQB 3VXUE 3KPTA 2WY3A 5IW3A 4JPWL 4KK9C 1MF2L 4NWTH 4X83A 3O6MH 5F9WB 2J8HA 1BLNA 1I4FA 2QKIB 1G7HA 1T3FA 3G5YA 1FNSL 2JK5A 4AG4H 4MJ4A 1UWGH 2X4SA 4NHUB 4RGNB 4X80L 4UDTA 5DSCA 3T0AA 4F15C 2ARWA 3NFNA 4RMTA 1ZS8B 1LK3L 1S9VA 5E70A 1T0NA 1MJ7L 1FFPB 4Y5VB 2KUTA 3MA7A 5H2BB 2KL6A 1U8OA 3QFDB 3GMRB 3SO3B 2QSVA 5D2NC 3CFCH 1EAPB 5D1ZD 4UILH 4K94H 5FA3A 2F58H 3B9KD 1UGNA 3O3AB 4LVEA 4NQSA 3UJIH 3VD7A 1A7QL 2OI9A 4Z95L 1QP1A 3FT3B 2IF7A 1YEEH 4Q58C 2Y6SD 3SE8L 1QSEB 2ZCLH 4NOFA 4X9GA 3D6GA 4XNMA 1WFTA 3MLXL 3MJ9L 3BGMA 1KIRA 3K4AA 3KJ4B 1EJOL 2DQIH 3HTLX 3O9WB 4TPRL 4M9OA 1AP2B 3MLRH 4OGAC 1SYVA 4KRLB 3W0WD 1XF4B 1AQDA 1IT9L 3PDOA 1HWHB 1SMOA 4ZXBC 1QQDA 3FN0H 4KK8D 4HWBH 4Q6IA 5IEHB 3OGCB 3H9SE 5T5FH 4BFEA 5T1KB 4XP1L 5CD5C 1G7QA 4QHKJ 5B4MD 1EO5A 1LO3L 2H32H 5KG9A 1L4IA 3CC5A 3HPLB 4V1DA 3PWUB 4NHCH 3VRIA 4ZUSA 1NCUA 1MH5A 3FZUC 4P23B 4KMQA 4U6YA 1ZLVK 3EGSA 3ES6A 3EDFA 4M48L 3EDJA 4PRBA 4Y2DD 3HZMB 4MJ2A 1W0YT 5GZOD 3SE9L 2Z0BA 1RQ5A 3MRDB 3HNSL 4WI6A 3HMWL 3I6GA 3BPCB 2X70A 1S7QB 2YD3A 3PWLA 2X70B 2X89A 4HIJA 5MERB 5JA9A 1MCLA 5A2JH 2XTJC 2HJLA 1PDKA 4KAQL 2AJXL 5D1QB 1CT8B 3DVGB 5E99L 4MQXC 2VZVA 1TQCC 2VZ3A 1G0YR 3SDDB 4L9LA 4DN3H 1N0LA 4XZUB 4ZDHB 2Y5TB 1IKNA 5E08L 5HGBB 5D1XA 4QLRA 5TFSL 2DQUL 4NQDD 3QP3A 1DZBA 5ETUA 3MLVL 4JAMB 3GMQA 3SGKC 3IFOB 3O3EA 4PLJC 4Y4FA 4F8QA 5I75B 1Z6JT 3D39A 5IP4A 5F9OH 2XN9A 5DFVD 5EORH 2KPNA 1N3NB 5HGAB 3JV0A 5J12B 4LNVA 1LEIA 1XMWA 3VXSE 4B50A 3CSBA 5GRZA 1AC6A 1I9RL 3MYJA 1FORL 1YEEL 5E8PA 4Z95H 4N0YL 4D9QE 1MRFH 1NAML 4C56B 4PR5A 3VRLE 3GBNL 4X6DF 5GS1B 3DRTA 3IFPA 3RL1A 5IBTH 1IC4L 4OLUH 3NOIA 2X4UB 1PX3A 3QWQB 1A7OH 4GSDL 4OM1H 5J6GA 2NLJA 4NFBA 3LKNA 2X05A 4K2UL 3H9SA 1JTTA 3S4SB 3ULVH 4U0RB 4LKCA 5JHDB 4XWGH 1INDL 1F3JA 1PG7X 4S2SA 4WNQB 1INQA 3KPMA 3RY6C 5I1LA 1JZ2A 2X4OB 5KSAC 4U1HB 4JZNA 3RAJH 2BJMH 3OAUL 2MSPA 1XR9B 3LZFH 1QFOA 3DO7B 2P44B 3F7QA 4H25B 3PV6A 4JFQA 3H3PH 4UOW1 1YY9C 4KVNH 3V5KB 3L7FA 3H7BA 1RK1A 4X5XA 3MBED 5AD0B 4JM4H 4OQTA 3HE7C 4OKVB 3TT3L 1JE6A 1F6AB 4MNGB 3O8XA 1ZVSA 3QDJE 1IKFL 2OL3A 2BRQA 2VNCA 4I48B 2VLRE 4PD4J 3DV4B 4PRIB 4Z7UA 2F8XC 3SDYH 4IRZH 2Z4QB 5BW7A 1O5DT 1N6QH 3QIBC 4D94A 4PJ9A 4LHUB 5JW4M 3RI5F 1LO0L 1RURH 4FQCH 4CADA 3QI9B 5FM4A 2IBZY 3C60D 1HOCB 1YPZF 4AMKH 1FO0L 4N5ED 2NY1B 1FZOB 3MYZA 4KRMB 1OGAB 3RU8L 1U8PA 5T1DL 2ARJA 3IYLW 4PB9H 2P5WB 4KVCH 1XF5B 4OCLC 4DGIH 3FRUB 4OJFL 5IVZB 2XNAA 5IT2L 3DTXB 1ULVA 4N8VG 2EO1A 4PJ5B 2CDEB 1KGCD 1WAAE 2H1PH 5DD1H 2KZWA 4CN1A 1RUQH 4R0LC 2IANE 3VDCA 3FL7A 3I9GL 1MREH 1KCSH 2JIXB 1Z3GH 1B0GB 3HC3H 1QACA 4S0TD 5FOBB 3HUJA 4ODTL 4XWOC 4YHMH 5DHYB 3WJLC 3AS0A 4JKMA 3DMMB 1I8IA 4XRCA 5C0EB 1AH1A 3KPRE 4PLNC 5CBAB 4NKIH 2FSEA 4HGKC 4LLUB 5J0BA 3OKEA 4QRRD 2MFNA 5I73B 1CLCA 1GIGH 3NFPA 3E1F1 5B8CB 4WO4C 3C8KA 1OM3L 4POZC 5JLZA 4QRPA 4BSWA 3ULVF 4QRPB 4BSWB 4XXCA 1N5YH 3AY4C 3CFEB 3AC0A 3H9HA 4W6YB 5D5MF 5FYJH 5I15H 3AAZA 4G6FB 2WUCH 4JN2B 5ICXA 1IILE 4NZUH 3HI6H 4RIRA 5ICXB 4YHYB 2AQ3A 2ICWA 3QUZA 1OAQL 4LCYB 4XX1E 4P3DB 5DFTA 2IQAB 5EOQH 1LO4H 2MKLC 4X0KA 1S7RA 3QPQC 1PD6A 1NLDH 3U9PH 1RK0A 2FL5A 4O02L 1M1SA 1G0DA 5ALCH 4EN3B 4PP8C 1AKJA 4YPJA 4PJXA 5I1IL 4GKOA 5LGJB 2CK0L 4FQPA 1DBAH 4YXLL 1JRHH 2WBJC 4F2MA 5I1JH 4FTVA 4OIIL 1T5XB 1CGSH 4F58L 1XH3B 4JRYE 1G6VK 1MI5D 2B2XH 5F88B 1KGCE 3GJEA 4BFBD 3KPNA 2HLAA 4OT1H 1TCRA 2ATKB 5IFHL 1MVUA 4GW5B 3IXAB 4IHOA 4HGWA 4R7NA 1D5XA 2WUBH 3MJ6A 3P4LA 1EBAA 4HT1H 5JXAH 1PZ5B 3BZ4B 3MJ8A 4XB7A 3UJTH 2HFEB 1FVEA 2EDYA 5I8KH 4BZ1H 3QIWD 1SY6H 1UC6A 5E6YA 3CLFL 2VLJD 4G6KH 4NSKA 3KYOA 5TDNB 1R5WA 1U8MB 1YEJH 1AGDA 1TIUA 4HWZA 5JTWA 3HCVB 4L8BA 4OCNC 5I1CL 1I8LC 1UM4H 4MZ3A 1U3HA 2V5YA 2PTTA 4WUUB 4ZAKA 1KCSL 4X4YA 1JGUL 3CLFH 4MVBD 1KTLA 1MCIA 2Z31B 4P59L 2P8LB 4MMZC 2H1PL 3PXHA 5DRWB 4G8EB 5D8JH 1RULH 2D0GA 4H0IA 5TDOA 5DLML 1F4XL 4K7FB 3OKMB 5HGGS 4Y1AA 1HN1A 5ECJE 3FO9A 5GSVA 4ZAKD 1BX2B 1SJHB 5JNYB 1P7KB 4EEEA 3QUMA 4HUXB 2YPLD 2J8UA 3I50L 5I8EA 4JDZB 3O4LA 5FXCH 5F7WC 1DQLL 1QO3A 5EB9A 2NY0D 1IEBA 4XC1H 4RQQA 3NZ8B 5IB2B 2XWTA 5J13C 4XCEA 1SEQH 3ARYA 2BFVL 4UBDC 2D3VA 4P4RA 4LHQB 5D7LB 4OSUH 3H3KA 4HKXA 4HKXB 3UX9B 4D8PB 2IPKB 2PXYC 3X11B 4C83A 5J13B 4FZEH 3PP4H 1OL0A 3SY0A 4FFVC 4K3EL 1OPGH 1BZ9A 4CMHC 1OTUD 4LMQE 2R4SH 5KW9L 1UQSA 3ARPA 2F74A 4WHYH 5DVMA 1D5ZB 3BDXA 5L7XH 4XVUC 3MV7B 2UUDH 5FKAB 1J8HD 5CSZA 4TNVF 2DQEL 1W72L 3LKSB 4D0BB 2GEEA 4Y16D 4NO5B 5C09D 4NQCE 1JNJA 1CR9H 2DBJA 4NO5A 4QHNA 4CU7A 4PV8A 4LMQI 3QA3B 4FOMA 4CN4A 4XPTH 5IHZA 4ENEC 3GRWA 3BO8A 3UBXG 4G8IB 2BRRL 5BV7H 2P49B 1NFDB 4QRTB 4UDUB 1ORQB 1FNSH 4ZUTB 4Z8FL 4JZJC 2EO9A 4K23H 1Q0XH 4G6JL 3IXTB 1EGJH 2B4CH 3MJGX 3SJVA 5HBBA 3EO1B 2HJFA 3JV4A 3MV8A 1Q9KB 1RIVH 5E9DD 4OTXH 3GIVB 2DQUH 3NCYS 4HH8A 2CUHA 5EC1A 2A6DB 2NY5L 3ILQD 4TVPH 3TGXA 1S5IH 2R56H 2OM5A 3D9AL 3GBNH 2XN9E 2QTEA 3D39E 1U8OB 2VZOA 5FA4B 3MUJA 1LWRA 5TGBA 5FGBA 3SQOH 5TH2B 4PJDF 5ESAB 1B0WA 2IAMD 1X6LA 5T3ZE 2VXUH 1JWSB 4M5ZL 2CGRH 3TT1L 1BAFH 1NL0H 4XVUD 1UCTA 3BZFA 3H8NA 1P7QA 1VKXB 1S7VA 4Z76A 3WIHL 4JDVA 4O2EA 4GMTL 4M1CD 4O5LH 1XFPA 1DLHA 3UBXB 5J3HD 2Y7QA 3L3JA 5L2KA 3P4OB 3O6KH 3NIGE 2V9QA 3BGFC 3KS0J 3EYQC 4OLVL 4A2MA 3S8WA 4GH7B 4UT9H 1NEUA 3V0VA 4JFXA 4UI2A 4CKVX 3WXVH 1KF9B 4M00A 3IDNB 4K71C 5GSRB 1EO8L 3HNSH 4QTHB 4X7CC 1XCTB 4LF3B 1T5WB 4Z5RA 5T1LB 2AEPL 1FJ1A 1HHIB 3GFUA 5DS8B 2A6KB 3TBVB 4N9GA 1E0OB 1XGPA 4M7JH 4GW4B 3I6GB 2BDNL 1CS6A 4GLRH 1S7WA 2NMSA 4P3CH 1H5BC 2JCCE 5E2TL 3QFJE 5EA0H 4V1DB 2PTUA 5DQ9A 1NGXB 3HB3C 1JF1B 1I9EA 2AJ3A 5DJXA 3TZVB 3UDWA 1VFOA 5DJXB 5M95B 4KUCF 5C07E 4OLWH 1RIHH 2OQJA 1P9MA 4PTUB 5L8JB 3AREB 4PJEE 4FFYH 1UH4A 4R26L 1YPZE 1XGTB 4TSBH 3G5ZA 3I6KB 2BVEA 5LWYL 4MD4A 3KJ6L 3PL6C 4LLWA 2X5PA 4DN4L 3QDMA 4F7TA 2X4TA 1XGYL 2B0SL 4ALAH 5F6IC 3TFKC 4DKFL 1N26A 1WK0A 3G5VA 4NRXA 3WL9B 5L88H 4JPVH 3TP4A 3LQZA 2B1HL 3H9SD 1ZTXL 4MA1B 3TBTA 1J12A 12E8L 3QFJA 3K4ZA 4K71B 1OGAE 2EEAA 5DJ6B 4CL7A 5TF0A 4NN6C 1XGYH 1QHOA 3MRGA 1DVFC 4OZFG 3CXDH 1WFUA 4X5WA 4JPIB 4TSAH 3EOAA 5DD0L 3N1MC 2YD7A 5DJ8B 4JFZH 2V9TA 3WFCL 2DQHH 3BP5A 3X3FL 5I17B 4IMKC 4ZFGH 1VEPA 3FO0L 4LIQE 3RDTA 1LNUB 4BQ9A 3RDTD 5JMRA 3TVMA 4TVPL 1A47A 4YHLL 1CICC 2IANB 2BX5A 4V1DE 1WJ3A 3SE8H 3UTTE 1QG3A 3RBGA 5KAQG 3VXQA 2W9LA 3ZDYF 3RBSA 3OKDB 2MHAB 3MMEB 1CFVL 2CO7B 5IF0B 4X4XA 3LS5L 5EFIA 5HVWA 1MCQA 1HQ4B 3VFSA 5EFIB 2CUIA 2H2SD 3S36X 4KK8C 1U6AH 4L4VE 1KCRL 3MRPB 3U4BL 4HS3B 1I1FB 3SDCC 3P11H 2BNQE 3M07A 3L95B 3TYGL 3PDGA 5C3LD 1I3RB 3S35L 5EUKA 3NGBC 4RMSA 3DVFA 2WQ8A 2BFVH 2YD8A 5ERWA 1I3GL 2R4SL 5KTEL 2ZCKL 3MLWL 3KDMA 3MUZ1 4QY8B 2NY1D 5D9SB 2BCKB 4X7DC 1RZ7H 5IMMB 4PJFA 1OCWH 2JELH 1KBGH 5D7IB 4MXQD 2PYFB 5D7IA 4LSTL 1Q0YL 1C08B 3B8YA 4H1LG 1KPUA 2GK2A 4XT1C 1KB5B 1BVLB 2R2BB 2EDJA 4NJAL 1ZXQA 2Y06H 2HMIC 1CF8L 2BNRE 1JNHA 3UPRA 1X44A 4KDVA 5EBLB 8FABB 1FHGA 3HE6C 3ULUH 1LD9A 1FNLA 5CZXD 2WBJD 4D9QD 4ORGA 1URLA 1ZHLB 5E94B 1JWUB 6CGTA 3JVGA 3O3DA 1CLOH 4ONFH 2DQJH 2IBZX 3KHQA 3LAFA 3S6CA 4E42B 4WI4A 4AT6A 4G8GB 1CU4L 2HT3C 3QEQA 1GRWA 1IGML 4R2GC 1DEDA 2DQTL 4KMTH 1UM4L 3DTXA 5IM7B 3SEPA 4Z7VB 3K2MC 5CZVH 3EJZC 5I19H 5I30L 5E2UL 3GSQA 5C0JA 3NCMA 2BY0A 3MNVB 3RY5A 4FMKA 5BV7L 4M3JA 2C3VA 2A6IA 5IR1B 3IDGB 2NR6C 4WCYL 5DJ0A 3BEVA 5JDJA 1U8PB 1A6UH 1HQRA 1DVFB 4PJAE 1IE5A 2H8PA 2EDRA 1JV5B 3OGOE 3MXVH 1MI5B 2PO6C 2B2XL 1R5IA 4WVRA 5CIPB 1Z9LA 4FTVD 5MP6L 4HBCL 2FO4A 4HMCA 4PY8I 5SX4H 2EDBA 2NW3B 2VOTA 5GZOC 4UNVA 2B4CC 1AD0B 3HPJB 3G5XB 4V2BA 4HT1L 1LEKB 5DJCA 3VGGA 3OMZA 5JMOC 3QDGA 3FB7B 2C1PA 4R97B 4TOYL 3TV3L 1SY6L 3IDXH 5EOTA 5C8JA 3MLYH 4EI6B 3SO5A 4D0CB 5ILTH 3FQNA 1XIWA 2FBOJ 1CDCA 3MJ9A 4XC3H 3H0TA 1B9ZA 4OSUL 5F3HA 3ZHKA 5TE4L 4M43H 5GRJL 4JR9L 3T3ME 2H9GA 2HH0L 1KJ3H 1QNZH 4PJIF 3MLYL 5I0DA 4KV5F 4JFDE 4ZQKA 3U0WH 3ARGD 3QIUB 4BELD 3V4UH 5J8OA 4ODXB 2APTA 3EYOB 5BRZA 5EBWA 3SPVA 1YEIL 4Y19A 4ZXBB 3EFFB 4ZSOB 2VE6B 2JF1A 4JFFE 5F88A 5BS0D 5HHPA 3H3BC 4FZEL 1R3IH 2QHRL 3QIBD 1X4XA 3CX5J 5DURD 4WO4A 3RWIA 5FO8B 2CIIA 1AGFA 2ADIA 5HHME 2EC9U 2P42B 2AV7A 4DOHB 5ADPH 2J88L 3SGDI 4H5SA 4OLYH 4OIBA 4PB0L 1R0AL 3PWPD 3KR3H 4KJWC 5IG7A 1EEZB 5AUMA 5DQJA 1TXKA 1OP3K 1UACH 3KS0H 4K9EC 2YUXA 3VFRA 2ATKA 4OGYH 1IGMH 4FA8A 4GW5A 3CFJA 4IOFD 5MEQB 4Q0XL 3S9DB 4JQVA 4RA3A 1FFNA 3IDIB 4QCIA 5JQ6H 3V4PH 2PF6A 4BQ6A 5IGXH 3GBML 4NM8H 5EO9A 3R1GH 2DTML 4FQCL 2Y07H 3RPIB 4OV5B 3B6SA 4QNPF 5EC2A 5DC0A 5DD6B 5HJ3B 5IFHH 4AL8H 1JGEB 1CDGA 3BFOA 3D87B 1UCBH 4P2OB 1G6RL 5D7KE 1U8QB 1QQDB 4K8RC 1IM9A 2WWMD 1A7BA 5TQ0L 3VXTA 2ZSWB 5CZVL 1AGCA 1LVEA 3X17A 3U36A 1J0HA 5IESL 3E8UL 3TESA 3TPUB 1KCGC 3TPUA 2P7TA 1MCDA 4KPHL 1HYSC 5HHMB 1AGBA 5CS7A 2XPGB 2UZIH 4FFZH 1UVQB 1E4KA 2JCCF 1ONQA 3QG6A 4RNRA 5T3XE 2A83A 1A3QA 3L3GA 5GRJH 2PO6D 1A5FL 4NZRH 4RBPH 2BSRA 4ONOA 4URTB 1HHHB 3LMJL 1NCTA 1BX2A 4CVXB 4YHZL 5D70L 2WLZA 2CJUL 3MLUH 3PQYB 1U0QA 4M43L 2JELL 4L8SA 2BNRD 3ZYJA 4QRQA 1IRAY 2A38A 4K2UH 4U31A 3P30H 5C0DA 3VG9B 1SJEA 2E9BA 1ZLSL 1LHZA 2Q7YA 4U1JA 5C3TA 1YY8B 2AK1H 2Y36L 4CBPA 2PTVA 4LSSH 3MUY1 1ZSDA 4OGAD 3U0PA 2HKFL 2X4NB 1ZOXA 2ADGA 5AZEH 4GLRI 3QA3A 5KJRH 1S9WB 1KC5H 1CFBA 1T0PB 1WUNT 4U1LA 3TJHA 1RJYA 5IIEB 4U1LB 4KKNA 1FIGL 4YFEA 3GMQB 4TUKL 5CJBA 4NUGL 2XA8L 4XP5L 5D72H 4J3WA 1BLNB 3BN9D 3GSVA 4QHLA 3HMXL 3OF6A 3SDXE 2OBGA 4R96A 2C3HA 3VFGH 2B39A 3G08B 1A3LH 3SKMB 1KEMH 2AJUH 1MY5A 5CILH 2HWZH 4NQDB 4KVCL 4MNQE 4HAFA 1T0NB 2I9TA 4JFYB 2Z93A 2YA0A 3MRHA 3MA7B 2O26U 1WF5A 3RY6A 4ONGH 5DUPL 5L9DL 5IEKA 2DTSA 1F4YL 1U58B 2W65B 3DX9A 4RFEB 4Z0BL 1BBJB 5SV4A 1FLRH 4K9EL 4DKDC 1DUZA 4JFPB 5I30H 3FN9A 4L8DA 1G9EA 5D6DA 4BK4A 5M94B 5HHVL 1MFAL 2ZOKB 1D5MA 2DQTH 1GOFA 1BOGB 3MLVH 5B38G 2A0LD 5HHNA 1KIRB 4MB3A 4PB9L 4Z7WF 2XZAH 3PL6B 3S36L 3PL6A 5FEBA 5FA4A 5KBNC 5D7SL 3WNMA 5C1MB 5A3ID 2DB8A 1BFVH 4I0PA 4UTBH 1MAML 2DDQL 1I9JL 1EMTH 4RISH 3SDXB 5CBEA 1BM3H 1M6OA 4PIRF 4CVWA 5EU3B 1CICA 1RZJL 3BVNB 4M7JL 3T08A 3VGEA 3NCJL 1DQJA 1IFHH 1GHFL 4MCYB 2IALB 5T1KA 1A0QL 4GMTH 3GJFK 1HYSD 1TZGH 3L6FB 5HGHB 2Z4QA 4OF6A 2BC4A 1F3DJ 1T2QL 5D7KD 5DUML 2R9HC 4E41B 1MFDH 1GC1L 4YXHH 1IC7H 3SDDC 3IJHA 1FFQA 4F3FA 4U7KA 5E4EC 3O2VL 1MRDH 4KUCD 1H3PH 4KFZC 4Q6IC 2ZUSA 3F58H 2AXJA 1DN0A 3GB7B 4GRLA 2AXGB 5F89B 1JNLH 4GRLB 4XNZC 3DLQR 4PJCB 1NBYB 3SE3A 4XXDB 1CE1L 1XGPB 5DC4B 3B83A 3QDMB 2XNAB 1F90H 4I2XE 3BQUC 3KYKH 4J12A 1NGPH 5C9JB 2W9EH 3C09C 2EDXA 1RJZA 3SJVD 2FIKB 4X4MA 1KTKE 4XWGL 5FDWB 3FQRB 3KPLA 5BQ7B 1JIBA 2NTFB 5CJXA 2UYLB 5D1ZA 1QRKA 5J6HA 4UOJA 3G9VA 5DEGA 3OKLA 1TVBB 4OCSL 4RRPA 5LVEA 1OB1A 4X8JA 4IRSB 3HUJB 1WC7A 1WC7B 3ZE2F 4X99B 5IMOA 1CGWA 4M7ZC 2E7LC 4GQPH 4LLWB 3P77B 1H8NA 3E3QE 4F7TB 5C0IB 4LCCC 4PJHA 3VD4A 3BZDA 5LKNA 2OK0L 3V79C 4GJTB 1IJ9A 1A9BB 1UKSA 2D7PA 3CSGA 4WUKL 1A9BA 2B4CL 1KLGB 4KDTC 1BWWA 5IQ9A 3UBXI 4TSAL 3DYOA 2HT4C 4LVHB 4NKOA 3PWVA 3V0AC 4G7VL 5CCKH 2EDWA 1RIVL 1XR8B 3TJHC 5C6TH 3GMMB 4QT5A 2O5XL 3LRHA 4JFEA 5JW5A 3U48A 3STLA 1H3WM 4QO1A 3RUGE 2M1KA 3QFJD 5C08B 3F12A 3UYPA 4OD3H 1MI5E 1KCKA 2Q20A 1WFOA 4YHPB 5C9KA 2BNUA 3QDAA 2DLFH 1NEZG 2NYYC 3LN5B 3NABL 1FG2A 3GSWB 3QDMD 1JN6B 1V3JA 3B2VL 2X9XA 2CKBA 2CKBB 4NYLA 1MWAL 1I1AD 4L8SC 1RIUL 5LG1A 4YUEH 2P5WE 1E6OL 2Y25A 1KPRA 2Y6SC 5D7SH 4J6RH 4OLEA 4PLKC 4X5LA 4GW1A 4TNWF 4H88H 3WEXA 5BVJB 3SO3C 2CR3A 1EMTL 1OLZA 3BZEB 2ADJB 2EICA 5I1AB 2Z9TA 4NQVB 4GXUN 1HI6A 2BVQA 1U8JA 1U8JB 5EIVA 1F6FB 2GTWA 3HE7B 1BQHG 2CD0A 2L7JA 4P5TD 1DE4B 5JZ7C 4MAYC 4NQXB 3S34L 1DP0A 1KCVL 4BH8B 4M8QA 5INCA 3F5WB 4OQTH 5HHVH 4JFHD 1NLBH 2DQGL 1SYSA 4CUCA 1EAJA 1SYSB 1D9KB 3N85L 2FEDC 2OSLB 4P2RB 2VABB 4OLZL 5SWZB 2CRIA 3CX2A 3L1OH 2OTUB 5AAMA 3M1BB 3ZDYE 1S7UA 3WFDH 1GGCH 3PL6D 4JPKH 3UTQA 4E0RB 5LGHL 4POYA 4LAJH 3DBXA 3BP6B 3VGAB 4PJ9B 2I9LA 5DZOA 1I7TA 4DGYL 1PVHA 3HR5A 2VLJA 4QXWA 3KXFD 1A1MB 4CNIB 4WGWB 5HY9B 4XBPA 4WW2C 4MJ5A 5I6XB 1MAJA 3ZT7A 5SX5H 1YQVL 4YLQT 4YHNA 5ISZB 3HMXA 5H94B 4ZUVA 3W0WA 3EZ8A 4YBLC 4FFWD 3KPPB 3M45A 3KNBA 3WE6B 4G8FB 1PJ9A 3G6JF 4ODVL 3I75A 1BQHB 4YC2B 1YN7B 3TF7C 4PBWD 4WI2A 1R24B 1MCFA 4NUJB 5CGMA 1RJLA 4YXLH 2NW3A 1CDUA 1NCCH 1AD0A 1JHKH 4MNHA 4LQ1A 2C4XA 3MA9H 1IGCH 3ARGA 5ELIA 4RWYL 3O6FB 5FHBH 3CVHL 4JJ5A 5AG9A 2YXMA 5FYKE 1UJ3B 5EU5B 3VW3H 2YPLE 5C0EA 4JR9H 3QO0A 5BMFH 1CGSL 4W70A 4F58H 3IETA 3BH8B 1NGQH 1LQSR 4K3DH 3ZL4H 5JXEA 1KB5L 3FB8A 3MRJA 2FYYA 4U1NB 4MAYB 5HDQH 3SHSA 3OAZH 4TULL 5FYJL 3QDGD 1UH2A 3IF1B 2OX5A 1J8HA 2QL1A 4MVBC 4MQTB 3LV3A 4HCRL 4WUUE 5GS3A 4IJ3B 4ODXA 5C8JB 3TN0D 3UYRH 1R3KA 1XIWB 3FQNB 5C70A 4WFHE 4JVWA 4ELMA 4ODHL 2FZ3A 4TSCH 4OFIA 3SGEI 1ZAGA 2H26A 4FFWC 4X7TA 5IESH 3FQUB 1FFPA 4Y5VA 3FQUA 4EZMA 5CMAB 5HHQB 5CMAA 3OAYH 4OCRH 2GSGB 1SEQL 1FBIH 5CEYB 2XRAL 2PO6A 3QR2A 43C9A 1CE6A 1AKJB 5DWUL 3KXFA 4HWEL 5BRZB 4PJIA 4LSVH 4GO6B 4K3JH 1N5AB 4UDTB 4FTVB 4WHYG 4ZFOA 1B0RA 2Q76A 4PJDE 3S96B 5DQJB 3VDBA 3CDFA 1OAKH 3KPNB 5EU4A 5GJSH 2CQVA 5CJOH 4PUBL 1S9VB 2EIBA 5E8NB 1F58L 1Q9WA 3EYUL 1FVCB 3ORJA 4WY7L 4HWEH 4YDJB 3EYSL 4QRSA 1UACL 5A43C 3BKCL 4MJIE 1KUMA 5ANMA 5E2WH 1TVHA 1AP2A 1KOAA 3GSXA 2FB4L 4LBEA 1OTUC 3AXLA 3ZDZE 1MNUH 1AGDB 1CLYL 4DK3A 3O3AA 4HWZB 1A64A 4B41A 3BEWB 1MFEL 3FN3A 5HDLA 5E2UH 4NC2B 2BP3A 1RHHB 2V2TB 1L0QA 4JQXC 4UV7L 3STZB 2HA1A 2NY4D 3V52L 5I1IH 1OT1A 2DD8L 4N5EC 1Q0YH 1HH6B 4NO0B 2P7TB 3P4NA 2BVPA 4GRWE 1J88A 2LVEA 2RHEA 4KZEH 3ZTJG 3MC0A 4NC1E 2R23A 4P49A 2VB5A 3W11D 1EHXA 5F7KC 3LB6C 4RNRB 3PWPE 4FHBD 2C5DC 5IB3B 1YEFH 1TQBC 4KVNL 4ENED 4U1KA 4LCIL 1T5WA 3C2AL 3HZYA 4Z5RB 1FJ1B 1HCVA 4RA0C 3TBWA 2G5BB 1W8NA 2PW1A 1OP9A 3VXTB 1GAFH 4EOWH 4XTRD 1AR2A 4GW4A 3WJLA 4HKJB 3QIBA 3ULVC 4G3YH 4JY6A 5F21B 1H15A 2AXFB 1NGWA 3G04B 5D96B 1U8KB 1ONQB 3QG6B 1BP3B 2VL5B 3EGSB 3ES6B 3O45A 2C3XA 1KBGL 4GAGL 1ZSDB 4M7LT 3U0PB 2IAMC 4FQ1H 3D69B 1FL6A 2BXYA 3HR6A 4KI5E 3LOWA 1HHKA 2XOTA 4JANB 4ZFGL 3T09A 1KENL 5I1DA 4MXWH 1FNGB 1CDIA 1EDQA 4PGDB 2DLTA 3NIFE 1RMFL 4QRQB 1Q9LA 4C55A 1EEYA 1JZ8A 2OJZL 1INDH 1JZ7A 5EORL 1CFNB 4YHML 1A14L 3C5ZB 1BJ1H 2FH8A 2NX5D 4OUUB 1NKRA 1M7XA 3ULUC 2VH5H 2EDKA 3L5WA 4FQLH 2YD2A 1DDHA 2OS7A 5J3HC 4YXKH 4NKMB 4CMMB 1HILA 4NQDA 2Q87A 4CAGA 4M6OH 3NA9L 2I25N 2I26N 4PGBB 4PR5B 2NY2C 5TJWK 3MV01 5GS1A 2XQBH 4WW2A 2YPKB 1JYWA 1FYHB 5KOVC 4W81A 5LGHH 3N85H 1NCAH 1CL7I 4JRXE 2NY5C 1J8KA 4B5EA 3WUWB 1CU4H 2HFFB 4MSWA 4Y4HA 1YYML 4QOKA 4GUPB 5INDB 3FAXA 5J12C 2JCCB 3L1OL 1UADC 2LU4A 1UWXK 4LSDA 5GRVL 1S8DA 3T04D 1YZZA 1IAKB 5EC1B 2WM0A 4U1HA 2V7HA 4OJFH 1NANH 1QSFB 3JWDH 4O58H 2I5YH 1UJTA 3RWJB 5CP3A 2AJXH 3U82B 1CZ8H 2HVKA 2IH3B 5LWYH 2A9NL 4OF5A 2NZ9C 2ZKHH 3L7FB 4V1DD 3FOLA 4NN6B 3TNNA 1JPGA 3JXAA 4XPAH 1PG7H 5L2KD 3CVHA 4MA1C 2A73B 3TO4D 4XMPH 4JDVB 1WICA 4LASL 4YXHL 4W68A 3L6FA 1VHPA 5DRXB 5IK3A 4PRPE 2WLYA 4G6AC 4OFYA 4JHAH 2J4WH 3F8UB 1OTSC 4U6HB 4OB5H 3L3KA 1X5ZA 5KAQF 4Q9RL 1WBXA 2I07B 3NIDF 3OHXB 1BM3L 3NVQA 5F6IB 1N0XL 5DJDB 3C6LA 4M4PA 1JFQL 4GOSA 2VXSL 2OP4L 3PABA 2YBRA 3CDGB 4HBQA 5D1XC 2ZCLL 2BJML 4KKAC 4IRSC 4H20H 4RFOH 2XY1A 4HLZG 5DJZB 1CVRA 3U4BH 2YXFA 2JB6A 3WMSA 4TYUA 3ULVL 5CHNA 5CHNB 3OJDB 1T21B 4HSQA 2AQ2A 5B39B 2Y72A 5GRXG 5L6YL 3ZLQC 3LEXA 4M6NL 2NQCA 4WV1C 3EBAA 3MTRA 4U6VH 4EVNA 4P9ML 4L9LC 2CRZA 4P2QA 4XBGB 1LE9A 4NZDA 5C09B 1G9ML 1CQYA 4LPYA 3NIDE 2DQEH 3WL9A 2VLMD 4J8RB 5JLZB 1MHEA 1S9XA 4AEIH 4DN3L 3S88H 2DI8A 1JGVH 2QQKL 2BVYA 4D9RE 5CJ8A 2YD6A 3SE3C 3TNMB 3ULSB 1FH5H 1E6JL 3MBXH 1X5HA 1QR1A 3DMMA 2H6PA 3F62A 1VPOL 3VFTA 1BEYH 1DUYB 5CD3B 3OKEB 1DUYA 1S7SA 5CD3A 4ZDHA 5E9DE 5DJYA 3I3EA 5SWSE 4AZ8A 3WS3B 1UWGL 4KDWA 4X0KB 4PBXA 4DTGH 2VKXA 5T3XL 4M7KH 2A9NH 1J0KA 3H9HB 3DUSB 3MX0A 1MRCH 1CGUA 3ILQC 2R2EB 3QCVH 3SQBA 1WQVT 5CIPH 4WENB 3D85B 3P9MA 4WV1A 1NFKA 2DQFA 3BT2H 1UA6L 3GJEB 2XTJE 4GAYA 4V3EB 4HH9A 1RZKC 4X9FA 1BFTA 3L5XH 3QISA 3UTZB 3S98A 1RUKH 4HGWB 4U3XA 4R7NB 1CFTA 2GUOB 3S37H 2J6EA 3JV6A 5I73C 4M6AA 4EN3A 2BCKA 2NNAA 4JFFD 4NM4L 4NM4H 1H0DA 5SWZA 1QTYT 4R8WH 1R5WB 4X7EC 4LCWE 2QADD 4IS6B 3QPQD 1R6VA 3MRFA 3WIFA 1X4YA 2BY1A 3MRFB 3WIFB 4DZBA 5IB5A 1QSVA 1X9QA 4UT6L 4O5LL 1HSBB 4Y5YB 2IEPA 4PPTA 1FZMA 1DBML 3RVWD 5ICYB 5I76B 4Y89A 3ARQA 2AV1A 4DGVH 4EI5B 1H3UA 1FVEB 4MA7L 1I1CA 3WFHB 5ISZA 3H7BB 2EYTB 4X5XB 4U1MA 1U8MA 4U1MB 1WIUA 2COQA 4BUGA 4LLDB 5E7FA 4XPBL 4BUHA 5DTFA 3Q1SL 1NC2B 1CIUA 3LH2H 1HXYA 1CIDA 3QUYD 4CW1B 1RMFH 2OMBA 4GRWF 4QXTB 3RIFK 3VXOB 2A9ML 4UINL 3O4LB 4KY1L 2F53B 1T4KA 1A3LL 3JTTB 1IAII 1KC5L 4MMXC 1ROWA 3BD5A 1S7TB 3TM6A 1LO2L 3MXWH 4LHUA 3MRIA 4RGMC 5F7EH 4YBQD 5KW9H 1UXSB 5JHLL 3O6FA 3ZHLA 1JGVL 2QQKH 3IDYC 3T0WA 3TCLA 3QI9A 3V0WL 3LEYH 5JPMB 3AS3A 3ZKXC 3CUPB 4OAWB 5ITBH 3KPPA 4XMKL 4O2CA 4F9LC 5JR1H 3GI8L 2IMMA 4J3TA 3IETB 2Z31C 5FM5M 3B9EA 1FNFA 4N5UA 4ZOEA 2DM4A 1A1OA 2XY2A 4U1NA 4L8SB 1JZ3A 4L5FH 3VCLA 3PGCA 3CMOL 4L4VD 1JCKA 1UXWA 5FYLE 1SJEB 1A6VH 1U91A 2GJ6E 5HI5D 4QRPD 1WIOA 1IAIL 5CKAA 4L4TA 3ZYIA 2EXYC 3HNVH 4XCCL 3JWDC 2M2DA 1D7FA 3RFZC 3RNKA 5EIQA 5DMIH 2RB8A 2OMNA 1TDQA 5MHSE 5EZJB 4LQFL 1IAIM 3GNMH 4PRDA 5JZ7D 1Q38A 5D7JC 5TF1H 5E2VH 3KYAA 1C5DB 1TJHH 4WFFE 5D8JL 2FD6L 1NUNB 2HTLC 4P46C 4NZRL 1JPTH 1CD9B 4IIQB 4FQHB 3QIUA 4RMUA 1MELA 1RJCA 4PJ8A 4PJ8B 4HIXL 4XC1L 1JL8A 3T4AA 4HXAL 3U6RA 4LPVA 4R4NC 4H1LH 2K9UA 4UIMB 4UIMA 3IVKB 2Q76B 3S96A 1EBPA 4RIRB 4JG1L 5F6HJ 5GGQL 4OZ4B 1DSFH 3TYFB 1KTDB 4M5YL 4NDMA 4AQ1B 4HF5H 3MV9E 3DOSA 5IOPA 3BJLA 1AXIB 5L2JB 2YKLL 4JRXA 3MLZH 1MJJA 4YIQB 2XTLA 1F8TH 1UG9A 5F96L 4PRNA 2FJFA 4QEGA 4YWGL 5IV2B 1CZ8L 3RX5A 3IJSB 4JQIL 1F2QA 4Q0XH 3I6LD 1CD0A 3S3SA 1FBIL 5GS0C 5IVOA 1J87A 2A6DA 4Z7WB 4P0DA 1JRHL 1TPXB 2GHWB 3LKPB 1OP5H 3UTSD 3WFBL 2RFXB 1U3HD 4KK6C 3K7UA 2FJHA 3DYPA 3NFSH 3C6SA 2MMXA 3EZJB 4OF8A 3O9WA 4Z78A 4JM2F 2LU7A 4NQCB 4O02H 4AIZB 4AIZA 1NLDL 3PWJB 3V0VB 3PWJA 1XF4A 3A6BL 4QTIH 1KJVA 1CLOL 4ONFL 4UQ3A 3RVUC 2HRPL 3HZYB 2NXZB 3MFFB 1IAMA 5GRYA 1YUHB 1NC2D 3BN9C 4LLMB 4Q7DA 1N6QL 4ZUUA 4ZUUB 3TLRA 4AM0A 5KZCB 3IAPA 2Z31A 2KZ1B 4KGJA 2AJSH 3MZGB 3MA9L 4R0LB 3JVGC 5K9JH 1EERB 5GSRA 1LP9B 4M93B 1NSNL 2AS5M 5J4MA 2L7UA 3GIZL 5TDOB 4OKDA 4TVPE 5F1OB 4ZFZB 4KKBD 5CJ5A 1CFSB 4ZNEE 4OCYH 5BW7C 4P4KB 3ARDD 2IMNA 3GSRB 4OF0A 4KHTH 1Z3GL 4Z0XA 1RJZB 1DL7H 1TTUA 1JZ6A 4MA3B 5KSVB 4LSSL 5HYJE 2NX5B 5D71H 5DO2C 1KCRH 1T6VN 4HWNA 5KVEH 3STBA 3OKLB 4U2ZA 2UVEA 5D5MB 1J05B 2VLRA 4KMLB 3DX7A 3BXNA 1I1YB 1DDHB 3VH8G 1JHKL 3C08L 4KJQD 4JPKL 5EIIA 4L3CA 5D2NB 5I66B 4LLVA 4OQ1A 5DD3H 2C3WA 5E24E 4F37K 5F7MC 5F1NA 2D0HA 3UXFA 1OARH 5F93C 1RZFL 2N1KA 5DGRA 2O5YH 1QRNB 1PBYA 3UYOD 3MV7D 1QFUL 2BSSA 4UTAH 1PLGH 4F7MA 2CRMA 3WFDL 4HXAH 2CLRA 3QULB 1DQDH 3PP3K 3S34H 1T3FB 2VITA 1NCNA 3DXAB 3VFSB 4DGVL 1JP5A 3WHE1 3OPZH 3BDYL 5J1AB 4OD2B 2W9DH 4UIKL 4KMTL 4UT6H 4HIIB 2DWEA 5CAYB 3EO9H 4X7SH 3RL1B 3T1WA 3ZE1E 4ELMF 5CEZE 1MCWM 3GHBH 2ZPKL 35C8L 4WWKA 2H3NB 3X14A 2NX5E 4O51A 1KPRB 5F7NC 3KDMB 4JFOA 4XI5C 4TUJA 3TC9A 1IBGH 3AROA 2IH1B 1GZPB 3WEXB 4MS8A 4JY5L 4LSQH 4ZUWA 4H8WL 3PDDA 3A6CL 5J57B 2FX8L 3PNWA 3PNWB 3L95A 2R2BA 4FN0A 1P7QD 1QBLH 3HE7A 4UNTA 2FECI 1T89C 3NFNB 5BXFA 4X4ME 4OCWH 3TIEB 2VLKB 2QBWA 5EBLA 3QXUA 4I2XA 4Y4KC 2IGFH 1T1WA 2DLGA 1R0AH 1BEYL 4PLJD 1BVKB 1BVKA 1YPZA 1WBXB 2I07A 1QFWI 4RMWA 3BDBA 1QPPA 3HG1A 5EPMB 3SKOB 5EPMA 4GG6A 1AGEA 5DJDA 5I18L 3H3PL 1TQBB 1RAMA 2R4RH 2XTJB 5GISL 2W1NA 3X3FH 4MCYA 1KB5A 2FGWL 4OLVH 1LK2B 2YD9A 2WP3O 4HDIA 1H5BA 1G9NL 3GO1H 1W0WA 1QVOB 4NZJA 4YHLH 4KTDL 4C54A 3KVQA 5C08E 1YYLH 5DMIL 4Z7QE 1D9KC 1J1OL 2VDLH 3HAEG 4HIEB 1ZHLA 4HIEA 1KPVB 1FGNH 1C12A 2ZWLT 2YN5A 3B2UC 2HLFC 5EU6E 4YHNB 3TA3A 3GKWH 4HLZH 4XH2B 1N6VA 5E8EA 5A2IH 5DJ0B 4OBRA 3ZE0F 3KYMB 3MGOA 1BECA 3L7EB 1G6RB 1JI1A 5MENA 1EFQA 4YFDB 1IGFL 4FMFA 3OKNB 2EC9T 3DO3A 4ESKA 4P2QB 4XBGA 3ZL4L 3TBVA 4GKZB 5I16B 4H20L 5D7IE 4FS0A 4WTZG 4UB0L 5B3JF 3MROB 4RGND 5MI0B 3BPLB 1UM5L 1T21A 4LPCA 1CTNA 4OZIA 3O11A 1NGXA 3QDGB 3L3DB 3ME0A 5DUMH 5EU5A 3V5DB 1T2QH 3EW3B 2V9RA 4LCWB 1AJ7H 1RFDL 2WMPA 5SWSA 3U30B 2GITB 3AREA 4OCXL 3F7VA 2FSEB 3KLHD 1K4CA 3P73A 4MD4B 1MJ8H 4PRAB 5E2TH 5IHUH 2VIRB 3HAEH 4MAYA 4EDWL 2V2XA 5E8DL 3QIWC 2B8OT 3IFOA 1S9XB 4QRRE 1CWVA 1FNHA 5AG8A 1RIHL 3ZKND 2HJLB 1JWMA 2PNDA 1TZIA 3W9DA 2R2EA 4YHOH 3ULSA 2XWJB 2EZ0C 3WLWC 1A7PL 5DJ8A 4QXUH 1GGBL 1WWWX 1WFNA 3INUH 5F8QC 3WS6A 3QUXA 3RVVC 4CVZA 3VXMB 1AGFB 2ADIB 3RTQB 4N9OB 4JKWA 4XAWL 1G7PA 4YFLF 3ISWA 3QNZA 1VACB 4D2NA 1I85C 4PY7B 3V7AE 2R56L 3BZEA 2APBA 4R4BB 1ACYL 3SPVB 5I1AA 2XIDA 4GT7A 4OBSA 4ZXBA 5J6GB 2AERT 2X7LB 1G7LB 1VGKB 3H9SB 3S4SA 5IUSA 1JTPA 4PRHB 5E6IA 4FQXA 1M71A 3SGJC 1QYGH 1WBYB 1VADA 3NCCB 5BCAA 5L9DH 3LKQB 2GFBB 2BOBB 4ISVB 1TCRB 1EFXD 2ZJSL 3DV6B 3QQ3B 4PJCF 1FFNB 3UTPE 4C59B 2CXGA 3QJFB 5B3NA 2V2WB 1U8IA 1V7MH 3QUMH 3WFHA 3V5KA 4LBEB 3N1QC 1T2JA 4MB4A 5KTEH 4HS8H 4TNWK 3TPKA 5A40E 5KSBB 2CMRL 1RIUH 3LRGA 2YEZA 4YBQC 4PDCE 5KJRL 3N1FC 2VC2H 5K9OB 3C5JB 3QNYB 3NPZB 3L3HB 4LLQB 4QHMB 5DD3L 2BVTA 3V6OE 3P4NB 5EN2A 2X41A 4ZNCD 3BQUA 3FAWA 4PY8J 3VXRE 1JNHB 1RHFA 3SKNB 3GMLA 3UPRB 4OV6F 4MJ5B 3JTSA 3WD5L 3OB8A 1UXSA 3QRFM 5AZEL 1B2WL 4J7RA 5GZND 1T66C 2YWYA 4PFEA 4M9PA 4NT6B 5FYLL 3DURB 1N4XH 3DURA 1AQKL 4S1RL 1K4DB 5MENE 5ITFA 3BQUD 2AJVL 5DURB 5DD5H 1F2XK 2ILLA 4NO0D 5KVFL 2XA8H 2BSRB 2QEJA 1DBBL 4LSPL 5IVNA 2NY4B 3FO9B 5GSVB 4O4YH 5T33H 3BOVA 3QCTH 5AZ2H 5EOCH 4APQA 1M7DB 2ZUVA 3PQYA 2QQLH 1J1XL 3HC0B 2OTWA 1AGBB 2F5AL 3U4EB 1I8KB 2UZYB 1HXMA 4N0UA 2RGSA 2X1OA 1LMKA 3NCBB 4JO1L 4O2CB 4XVTL 3O6ML 5GXBB 3Q0HA 1I7ZB 3HS0B 5IVZA 1CLYH 3UEZA 4J3SA 4K8RH 4B7IA 5T3ZH 4N0CD 3K4DA 1CFNA 3BYYA 1T0MA 1G6RH 3HC4L 1T0MB 1MQ8A 1P84J 4Q9RH 2KKQA 4ZO8A 3CFEA 5J89A 4ELMB 5TQ2L 2E5EA 4KZEL 2J4WL 2X42A 5EZJA 2ICCA 2APWA 1UKQA 5D6CB 4XAKE 3CFBA 4JREB 5JW4N 4RAVB 5JIKA 4NDMB 1L0YA 2FBJH 2EH7L 2ORBH 4ERSH 5I8CB 3MRNB 1QFWH 1JYXA 5HYEA 5FGSA 2VL4A 4YWGH 2W60A 1CE6B 3VFPA 4I1NB 4JRWA 3T4AB 3I3DA 1PZUB 5E5RB 4G6KL 4KROC 1AO7B 1FVDA 1G9NC 1HNGA 4GRWH 1QFWL 1AR1D 4U0QB 1BJ1J 5E8NA 3ZT5A 3DSNA 5GGQH 4LDOB 3BDYH 4ZFFB 3Q5OA 1YNKL 5HHNB 3QT2A 2J2ZA 5L2JA 5BZDA 5GJTL 2PETA 2YN3A 3U0WL 3DGGB 5ACZB 2WW8A 1X4ZA 2FJFB 2VXQH 4X6DE 3MUGA 3BVNA 3MUGB 4PJXB 3VFUB 2P1YA 4F7CA 5FA3B 4JO3L 1A3RH 3MRKB 4YGVA 3V6ZB 2V2TA 2X6MA 4OI8A 4PS4H 1XH3A 3KGRA 2PKDA 3E2HA 4LLMA 4Z7NE 1OVZA 2QHRH 5HI3D 4M61B 4MNGE 4G9FB 2J5LB 1MQKL 4X98A 2VXTL 2E6QA 3IFLH 4I13B 4X4YB 2P8MB 1Q1JL 2JKXA 2GSIB 3HAEA 2HT2C 1ZHNB 1OSZA 3MO1B 3QEQE 1U3YA 3QI9D 1JGDA 5EU3A 3QEGL 4F9PC 1VENA 1ERNA 1EV2E 5FUZH 2D7NA 5TDNA 5T1LA 5EO0A 2CIKB 2ZUQC 3HHRB 2VXVL 3I84A 1OQXA 4MQ7B 3W39A 1T83C 4Y0GA 2BK8A 3QZWB 2IPTH 5CGYD 3WKML 2IPTL 1MCOH 1ZT7A 4Z0XB 5CJQH 3QUMB 2HN7B 1GOHA 5KVFH 3C5SA 4W6WB 2ARJQ 3WDHA 4HC1L 3D39D 5DEFB 4GFTB 4HQQL 5HHMA 3H2WA 5F7YC 1LP9A 3BXNB 1IGJA 3IU4L 2ZNXA 3CPLB 3L3OB 4PRPA 5C0NC 1RZ8B 5HDOA 4KUZH 4EI5D 1KSRA 2ICES 3T0BA 4JRYA 3MRQB 3WNNA 3RA7H 3TO4C 4D9RD 3BWAA 3JWOL 1FL5B 2Z35A 3LMJH 4F8TA 2NY1C 4J3VA 3BPNB 3IDMA 2BSSB 1FORH 2CPCA 3B43A 2BZDA 3NN8B 1YEDB 3GI9L 2AEQH 2W0FB 1OT2A 3CVIL 1V7ML 3LDBB 4LARH 3FKUS 1RZKL 3O3BB 3VH8A 1QBAA 5EBGA 4EN3D 4RX4A 1T1ZB 1F11B 1D3CA 3QXVA 1BQLH 1MCPH 5TDPB 3BP5B 3QZWG 1UYWH 4DAGH 1QLFB 2N4IA 3HE6D 3HE6A 2JJVA 4M7LL 4MJ6B 2DWEB 4Y2DA 3V6BR 5EZLB 3QDGE 2V5SA 1I3GH 2YRZA 4JFEB 5JW5B 5FHAL 3MGTA 5DRNA 1GVIA 5CEXA 5C0CB 2F8VA 1D5ZA 3NH7L 1YC8A 3RGVD 3V8CA 1QSEE 3L3IA 2MQ0A 3ARFB 2P24B 4POZD 1U95A 4UT7L 4PJ7F 2UWEF 2VLLA 3I02A 4Y5XC 5C0ND 3UCRA 1AD9A 3O6FC 5T33L 4PJBB 3VFVA 2F19H 2WNGA 2EKSA 3IFPB 4K3JL 1LDPL 5C7XH 1AQKH 1GZPA 4PJFB 4OZIF 4XVJH 1VFMA 5DJ2A 3VXPB 43CAB 1LO2H 1C08A 2LTQC 4NO2A 4NO2B 3CH8A 3LS4L 5CCKL 3BZFB 2R2HA 3GNML 4S1QL 3RUGB 1MHPH 4NQXA 3CSYA 8FABA 4H25A 1NJ9A 1L6XA 2MJWA 5DR5L 3S5LA 5FO9B 2MWCA 5I75C 3QXWA 3TO2B 4IDJL 5H94A 4I77H 3M1BA 1MCRA 2XZQH 1G6RA 3CMOH 4OKVA 4AT6B 3FT2B 4P2RD 4MNGA 2CLZB 1IC5L 4NNXA 3EO0B 4NNXB 5F7DA 5F9AC 3CAFA 4QXGL 1ADQA 4LOUD 1QVOA 5BS0B 1HXYB 4CW1A 2OK0H 1CK0L 4JFDD 5FV1L 1Y6MR 1T4KB 2YC1A 3MRRB 5ILTL 2YC1B 4I3GA 2AJYH 5DFVC 4E41A 1BF2A 1CDJA 5H37G 3MR9A 2EIZA 4I18B 2A6IB 1KNOA 2VLJE 1EEQA 3HLAB 4NGHH 1IC1A 3BD4A 4P3CL 4N0UE 2VR5A 1E4WL 2D03H 2VDLL 4U1IB 4LF3A 3UTSA 4HBCH 5CINH 1RVFL 1W8OA 3BX7C 4M1GL 1R24A 2VIRA 5IBUB 3PQYE 2EKJA 4NNPL 1V5JA 5FF6A 1MFBH 4GKSA 3G5VB 4NRXB 4W4NA 5EBMB 3TA3C 3QEUA 1P84K 3BW9A 2C4FU 4MCZB 1MCEA 4LCWA 2J12B 4QKXB 5KSBE 1FDLL 4LCCA 4MNQB 1O7SA 2H6PB 5L0QC 2HFTA 4KI5D 4Q9BA 4DGYH 1AHWC 4KQ3H 1IM3B 4WWKD 4X99A 3J8F7 5DJYB 4LGSB 3FQXA 1HZHH 4NHUE 1C5DA 1BZQK 1IT9H 2Z91A 4Y7MA 2HKHL 1KLGA 5BO1L 3IRPX 3WNKA 3QUYC 3TVMB 1UYWL 4D9LH 4RX4D 2EEDA 3G6DH 3V6FA 4OFVA 4G7YH 1X5FA 2EEBA 3LKOA 4NO3B 1DANU 4NO3A 1P1ZA 2XQYK 1P4LB 1I3VA 1HK6A 2ZG2A 3CDCA 2BNQB 5BO1H 3BGAA 4Y4HC 3UTSE 3QAZB 3LRSA 1IARB 2HWZL 4YHPA 3FO1B 3IAQA 2ICEB 5CP3H 3WYRA 1GGBH 4HW6A 3RGHA 1P9MC 3NBNA 1R3LB 3QDHA 4KGLA 4Z7UF 2R0ZH 4RWHA 1BWMA 3VXUA 1IC5H 2IQAA 1J10A 1CG9B 1DQQB 2Y5EA 4L4TD 4NCDA 5FKPA 4OGXL 4F7EA 5FKPB 2PO6B 43C9B 1FZJA 5FYKH 1CBVH 5CILL 1A7QH 3VXQB 1PY4A 4ZODA 5F9JA 1RK0B 4PBVC 5GGTL 4G6JH 5HHMD 4G6AD 2DQDL 4X4XB 2FECL 2VDRH 2AQ1A 5EU4B 5JHDA 4APQD 1WTLA 5DYOB 1EJ6A 1AIFA 1CYGA 3HKFA 3DV6A 3GHEH 4E41E 4FP8L 4JZNB 4Z77B 4HS6A 5CJQL 1HH6A 1I3RA 4I0PC 1TENA 3BP7B 3MNZA 1JFQH 3DHMA 3V8OA 1TVHB 1QOKA 5HYSG 1MPAH 4NT6A 1CDHA 3B6SB 4N0RA 4XCYB 1A7OL 4XPGH 3MLUL 1YN6B 2VWEC 5DUBA 1FFRA 2VUYA 4P46B 5BOPA 5EU6A 5IJVB 3R8QA 1V3KA 3QUYA 3HCVA 3W2DH 4PJ5E 5LAXB 1KENH 1A1NB 1RUPL 4NOBA 1HSAA 1I7UB 1PEWA 3M17A 3S37X 3TH4T 5FGBC 1K2DA 2R23B 5ICZA 2IG2H 25C8L 4KQ4H 5DHVA 5DHVB 4NNYB 4NIKB 1A7NH 1UEYA 2C3VB 5FHAH 3BRGC 1AO7E 4YZFE 4IOSD 1FL6B 5ADOH 2A2QT 35C8H 2MCPL 4YDKH 1BJ8A 1Y6KR 2B0SH 4ALAL 4CVXA 4K7PH 4H1LA 2VYRE 2HT2D 3GMNB 4S0SD 4G8FA 1JFMA 5DK2A 1HZHL 5DK2B 5T3ZD 4NKDB 3RVVD 4EKXA 3CU7A 5HXMA 3V52H 4JZJA 4XNUH 5E2JA 5AWNH 4R26H 4JY6B 4NUJA 1HE7A 1ND0B 3FCTA 4HX1A 5C0DB 3K46A 3T8XA 4D9LL 3UAJC 1NDMA 2W07A 1G1YA 4YBLB 3RZCC 1T04B 1A6WH 2QQNH 4WY7H 2R0LH 3VMOA 5JOFA 2JIXA 4PJXE 1G7IB 1B6DA 2IQ9L 3W9EB 3IKCA 4U7MA 3SCMD 4HV8B 2OZ4A 1OAKL 3RHWF 4AENA 5JUEH 3SDCD 1RZIA 3AUVA 1IQDB 3UP1A 1IQDA 1ORSB 4XWOD 1ZA3B 4WEMB 4JLRB 1EEYB 4JHWH 1ZLUH 3EOTL 2FYYB 2BOCA 2H9GB 4LCWD 3QQNA 1MFCH 1D6VL 4KTEH 3PIQB 1A6ZA 2YZ1A 1A6ZB 2UVFA 1A02N 4AQOA 2F74B 1EO7A 4HUUB 4NJ9H 1KXQE 5FYJU 1FYTB 5FKAA 3S36H 1OAXL 4E5XB 1KFAL 5D1QC 1B88A 4EI5C 3VRJA 4M93C 3VRJB 2I5YL 1GGIH 2CKBH 4R90L 1LP9E 4QWWD 3TT1H 4PGCB 2R1XB 3RX7A 3GSUA 4LQFH 2HFFA 4MSWB 3W11C 3MZTA 3VMPA 4OFKA 1BBJA 4QRTA 4UDUA 2OTPA 1W2KT 1YECH 2IPUK 4K07A 4TN9A 1CGXA 3UYRL 3RL2B 3RL2A 4DCQB 3VFUA 3BRDA 2ZSVB 1NAMA 4ONGL 3RKDC 4BFIB 5HYJB 1N5AA 1FN4A 1ITBB 4PRID 2QV2A 5AUMB 1NDGB 1CGYA 5HHPB 4HUNB 4AYFA 1UM6L 3IDXL 3WNOA 2A6JA 5MEQA 3DECA 3N9GL 1D5XB 5FM8A 5SX5K 1DBBH 1OSZB 3MO1A 4Z9KB 3V5HB 1CXLA 1ZA6B 3NAAH 1KJVB 5ANMB 5I0ZA 4FFVD 5C7XL 1YMMD 3MRCA 3MRCB 4S1RH 4GBXA 2Z92B 3U9UA 3O6FD 4Y8AA 5EC2B 5HJ3A 3RJQB 4N8CH 5GJTH 2QQQA 4XP9H 4NUGH 2VLKD 4QNPE 3QUKB 3MXWL 1WSST 4HDIB 1CCZA 1W0WB 3OWEA 1RHHA 3OGCA 2ZSWA 2A9MH 1MCCA 3IB4A 3NZHH 3UBXA 3SN6N 2HLFD 1W72H 2NXYD 3OR7A 4GG6F 1NSNH 2F5BL 3O2WH 3OR7B 4HUKB 1OWRM 2VR4A 3VFNA 3EUUA 3PWUA 3OHXA 4GAJH 2XZZA 3RPIA 4OV5A 2VZUA 3L7EA 3MGOB 3C2SA 3I2CL 4U1KB 4MA7H 1T66D 4HFUL 4O00A 3QZWA 1U8QA 1V3LA 1QA9B 4ZMAT 5D93C 2G5BA 4PP2A 5IBLD 2PW1B 2EH8L 4PJ8C 3QO1A 3TO4A 4F9LA 3O4LE 5DMYA 5I8EB 5SWQA 5MEOB 2ED9A 2YUVA 5JIIA 5F44A 1D5BA 4YK4C 1D5BB 3ZDZF 1OW0C 4R3SA 3HC3L 2EE9A 2VDKL 4ZXBD 4WFGD 4Q74A 1J5OH 4RDQF 4F15B 1UVQA 1K3ZA 5SWZD 3O3BA 4S1SL 3V5DA 4DZ8A 1Z0MA 5M7QA 4GBXC 4KRPB 5GGTA 3P77A 3F7VB 1A22B 2VO5A 3ILPA 1RURL 3NTCL 3T65A 1NAKH 4DEPB 4L9LB 3VWJD 3VXMD 3FB5B 4KJYB 3FZUD 4S1SH 3DXAD 2BHYA 3PWLB 4DOHE 2NW2B 3GDBA 4YUEL 3DUSA 3T3PF 2NXYC 1IL1B 1JWMB 3QCVL 1AFVL 4MLIA 3TBTB 4L3ED 3DROA 4DUXA 1CT8A 2EDOA 4X6DA 2IBBA 4P59H 2DLFL 4JO4H 1NMCB 1GZQB 1J86A 5GHWL 2ZCHL 3H42L 1WEJH 5TPWH 4WFFD 1N59B 3RTQA 3TCXA 2AI0L 2BSED 4JFOB 3VA2C 2VLRD 5DF0A 3BAEH 3OZ9L 5DWUH 2MQCA 4XGZA 1OAZH 5BRZE 2R8SL 3WD5H 1G7JB 4NQVA 1DUZB 1TETH 2BVOB 4GXVL 4ZS7H 2DQCL 4J3XA 5IROC 4Y5XB 3RWGB 3MYJB 2YHGA 4F7PB 4HS3A 1ZWIA 4HK0B 1CXFA 3RAJL 1DE4A 3B9AA 1FZMB 2VLKA 5FUZL 3NZHL 1VB9A 2KQNA 5FV2A 2XZCH 3IFNL 3O41B 1DBKH 3MRHB 1CGTA 1MJUL 1YMMB 2P5EB 4XVTH 4U6VL 4PGEA 4MJIB 2NNAB 4JPVL 4P2RA 4LLYA 4BM7A 1OAUH 5ESAA 3RWCA 1KT2B 5EOCJ 5FAAA 1M6OB 4HHAB 3SE4C 3CD4A 1SEBB 1PW3A 1KN2H 5I19L 1A7RH 4FG6D 4LKCB 5F97E 2ICWI 2CLVA 3QXAB 4XBEL 5ACMA 2P4AB 3VWKC 1KCUH 4P4KC 4PREB 4M6ML 3V4VL 1WWBX 1NMAL 2G9HA 1YA5A 3LB6D 4LRIC 4ZOBA 1PGRB 4DW2L 1GGYA 2OP4H 4APQC 3WUWG 3LEVL 4GRLD 3HG1D 4RWYH 1K3IA 3F7RA 5AD0A 3NPSB 5ITFB 1JWUA 5T3XD 3O3DB 3RNQB 3ULUL 4QTHA 3SE9H 3UDWC 3UTSB 1YNLH 4HULB 4LPUA 4HG4J 2A6KA 3NCJH 4FP8H 3VI3F 4DN4H 4Z7UB 1RJLB 4PJ7B 4DKAA 3BKYH 4A6YH 3TH2T 1I8MA 1A2YB 1XGUB 4PJ5A 4FXGB 1MIEL 2FIKA 3MR9B 1KG0A 4NQTA 1U3JA 1U91B 1MRCL 4MS8D 1XCQB 1TFHA 4X9BA 3OJMB 1NCWH 1NUFA 4MYWB 4CU6A 4FQXC 1IM3A 2EE3A 1XGTA 3BN3B 2GK0B 4XCNA 3VXRA 4OF7A 4PRAA 1I8IB 3RVXD 3HS0A 3VXSA 1CL7L 4XP1H 2JIXD 4H0HB 1FH5L 4EJ1C 4FQHA 3C8KB 3KYNA 4P2OC 3LQZB 4HZAA 5DJCB 1EVUA 5CWSB 1LEKA 3ZKMD 4L4VB 3S88L 4P2YA 5I1KL 2BNQA 2ENSA 1BBDL 3O6KL 3MV11 4KJPD 4X6BB 5JW3H 1QFUH 2LAGB 5C0IA 3RVWC 3VFGL 4CVZB 5AWNL 1OGAD 2XQBL 3MOAL 5ID0B 4K23L 1FRGL 4WW1B 4M6NH 4JRXB 4M62H 3SDAD 2Q1EA 2IG2L 1W72A 4KK9D 3JWNC 3LKOB 1OAUL 2I60L 5GRUH 3U1SL 5T3XH 5KVDL 1NUDA 3RWFB 3WHXA 5IV2A 3RWFA 3E3QC 3VE0B 5E8DH 3HI5H 3PHOB 4IRJC 1WBYA 5FGCB 1PAMA 4PG2C 4I0KA 2VWEE 4XP4L 1S5HA 1U93A 4MD0B 5C0AB 2FIRT 1ZE3C 5EUOE 5IW1A 2YK1L 1CG9A 1DQQA 3MBXL 3P2TA 1NMBL 1F4HA 1HYRC 3RI5K 1N2RA 3ELAT 4FG6C 3LEVH 3EHBD 1FYTE 2EDLA 5KSBA 4H5SB 2F53D 5BVJA 4G7VH 3MFFA 2Z31D 1MPAL 3IDUA 1AIFB 5FCUL 3K8MA 3T1FB 3STZA 1BVLA 1F42A 1MRFL 1NAMH 5JHDD 1RUML 2FWOA 2FX7H 2DLHA 1E27B 1KN2L 4KI1A 3SKNA 5T5NG 3VXNB 4FQ1L 3WBDA 3BI9X 1BFOA 1ZHNA 3SOBH 5HVGB 5BZWA 1HDMA 4MB5A 4AEHL 3EKCA 2V17L 4Q9CA 5DI8B 3LQAL 2C7UB 1NGYA 4P48A 5MHSD 5KZCD 2W9EL 3GMNA 3SBWC 1UB6B 4WWID 4OZGB 1GGUA 5DJAA 3MFGB 5DJAB 1U3HB 1I7UA 3FHAA 3M17B 5E6ID 1GJIA 5C0AD 1BQLL 1MCPL 1BIIB 3C2AH 3THMH 1BAFL 5GS0H 2WIIB 1KTLB 1NGWB 1TJIH 1JI2A 3T8XB 4YNYB 2B5IB 1K9TA 4JFFA 2AP2A 3EJZD 4MJID 2AEQL 1H3PL 3MOQA 5J1SC 5B4MC 3WV0A 1T7XA 5GGSB 2XWTB 3BEVB 5CEZH 4UNUA 3DYMA 4HV8A 3MLZL 1FL3B 4XP6H 2EIDA 5I74C 2HG5A 2H8PB 4Y1AB 1JV5A 1OARL 1YN7A 4UT7H 4JZJB 3OKOA 1Q9LB 3R8BB 2FO4B 3U83A 4PJEF 4OLYL 3BKJH 3KAAA 4YPGB 3SY0B 1UJ3C 1I3UA 3C08H 1JHTB 4MXVE 4U1SB 3FFCD 5F9WC 4JGMA 3MRBA 2MNUA 4YE4H 4ZPTA 1T7WA 4GAJL 2C1OB 5FK9A 1RU9L 3R1GL 2W0FA 3VU2A 3KWWB 3HG1E 3WJJC 2V7NB 2C1PB 4PJ8D 1UM5H 4ACPA 1HILB 4AENB 4BSJA 4LNRA 5TDPA 4A6YB 4OD2A 1MCOL 2VDPH 1S9WA 3RPKA 4DK6A 4B7LA 1A7RL 2DKMA 4PGCA 5EZLA 2GTZB 5DDHB 1FPTL 5IROA 1G0XA 3L5HA 2CR6A 4ODHH 1HKLL 2YPVH 4R7DB 4GUPA 4YEFA 4DVRH 3TN0A 1F4YH 3G5YB 1L8JA 1AO7A 1FVDB 4M6MH 3V4VH 4WDIB 1WZKA 3NCYP 1R3KB 2X4SB 5F3BA 4GRMB 4JFDA 3RTQC 3GEWB 4Y1AE 4CRPA 2EYSB 2EYSA 5BJTA 2XXCB 4OZ4A 1SBSH 5TE4H 5MEND 4ZS6D 4MGXA 1NANI 1VFUA 5KS9B 5JO5B 2EDFA 3MOBH 3F7YA 4XMLH 4TUJB 3OX8B 1HHGA 4HCRH 2D7OA 2DKUA 3OZ9H 2UZIL 4FFZL 3HG1B 2CUMA 3FT4B 4OFPA 3MRKA 4YGVB 4LHUD 3HZVA 2HH0H 3FT3A 4TRPL 4LIQL 2R2HB 1T03H 4GRWB 5IFJB 4ZYKB 1NGQL 4LPWA 4X98B 4Z7WA 2IFGA 4O2EB 5I1HH 1EHLH 4F33B 2A6JB 4OZHB 4UAOB 1BOGA 3E6FA 3L9RB 2XV6B 4ETQB 5E8OB 4IOIA 2WP3T 3EAKA 5L2KB 5I15L 3V5HA 1RUQL 3BAEL 4U7SA 2Q8AH 5I8OH 3FTGB 1X3DA 5TH2A 3BKML 2JB5H 3M8OH 3I85A 2R39A 1DBJH 2VN7A 1DLFL 3QIWB 2O5ZL 4KKCD 3SDXA 5C07D 3WCYA 3LQAC 4K3EH 4LU5H 1IAOA 3PWNA 4FNLL 1QA9A 3BEWA 3A6CH 5D70H 3EYUH 5LQBH 4M7LH 3G6JA 2ZUXA 1KEGH 3ESVF 4AMKL 3GMPA 3JV5A 4NC1C 4UV4L 3GMPB 3RGVA 2GJ6A 1B3JA 5C0CD 1GGCL 4EQ2A 1ODAA 4XH2A 2NZ9D 2XPGA 1T83A 1YQVH 1C5CL 2I24N 4BZ1L 4P23A 1Z9OA 3MLSH 2VLKE 4KZDL 3AU1A 2GJZA 2OQJB 4PTUA 2YS4A 5DRZA 1JBJA 4EVNB 1XIWC 5JIHA 1HHKB 3QO1B 3QUXD 4C56D 3QWRD 3LIZH 1GL4B 4Y5VC 3G6AA 3VWKD 3G6AB 1S7WB 3CVIH 2GY7B 3KPQB 4AL8L 1YEDA 3E2HC 3MLTA 4I18C 5LCVH 4I3RH 15C8L 1IL1A 1IAIH 4GS7B 2ZUTA 3DVIA 4AEHH 4CDGC 3VG0H 5DEGB 4DZ8B 1JTOA 1ZEAL 6FABL 1J05A 2VLRB 4BKLA 5KVEL 1T1ZA 3QUZC 3V4PL 1U8NB 1H3TA 1XZ0A 1IGIH 1MLCB 1NC4D 2CSPA 3UTOA 4M3KB 4X5WB 4FFEX 1SMAA 3FB5A 3WS3A 4K3DL 4KJYA 4P9HC 1DQMH 5GIRA 4XNZB 3CGTA 4FQLL 4IRSD 4JAMA 3OJVC 2Q8BL 4MNQD 2AJZB 4Y8DC 2IANA 5DRNB 4Z6AT 5CUSL 5EZIH 2XN9B 4S1DD 4R4BA 1P4BL 3ARBC 4GKNA 4R2GB 2ZP0T 1JRHI 3N9GH 4ETYA 4Z7WE 3SDAB 4FQXB 2BY3A 2EE2A 2W59A 3H9ZA 1X5XA 5E8PB 1IAKA 4HLJA 3UTZA 4PJBA 1S78D 1G9MH 3GUTA 4WW2B 1EHLL 3SGDH 4ODTH 5IMKA 1JNNH 1L9NA 5HHOB 2IH3A 1I9RH 1X5LA 4XNXH 3DX9B 3FMGL 5D9SA 1EZVY 3LKNB 1MQKH 1FO0B 1JPGB 5CP7A 2VDNH 2DJ4A 1HQ4A 1PQZB 4S2SB 4WNQA 4RFNB 4HK0A 5HVHC 3OJ2C 4Q9QH 5DVLA 1J0ZA 5CLWA 4LLQA 2ZOKA 4ODWB 1ZGLP 3ARDB 4ODWA 2D9CA 4ZO7A 3QI9C 4HKZA 1CI5A 3FB6A 4YGAB 1A9EB 3QHZL 1MIML 1N4XL 3T2QA 1ZV5A 3B3IB 4TUOA 5JHLH 5IJKC 2OZ4L 2A77H 3TPUE 1KTRL 3RVTD 3O8XB 4ORZC 4Z7VF 1VFAB 4OQTL 1VFAA 1YDPA 1S7XA 3EOTH 2A73A 3C6LB 1SM3L 4OB5L 5EZOH 3FONB 5K93A 1S7UB 3O8XC 1U2HA 3L3HA 4NWUL 5DRXA 1HSAB 4PREA 1J18A 1G7MB 3JTSB 4I3SL 3BH9B 5DJZA 5ICZB 1EPFA 3GSNB 1TTFA 1W0VA 3IJHB 3U4EA 1MFCL 2YA1A 4POUB 1J0IA 3KLAA 1PG7L 4M7KL 4WHTA 4RISL 2DAVA 2FBJL 2ZUUA 2VRAA 3DI2B 3THML 5GS0L 1MWAH 4NQCD 2NY2B 3EOBA 1T2XA 1NBYA 5CZXC 1ZVYA 5EO1A 1U42A 3VXSB 5I16A 4N90E 4JE4B 2RIKA 4LDLB 4MA8L 1RFDH 1LILA 3HC4H 1TCMA 3HNTL 3WLBA 1NL0L 5J6HB 1I9JH 5CWSA 4L4TB 1A4KB 5JOFB 1S5IL 3D9AH 4LCCB 1FLRL 4FXKB 3IDGA 2R69H 3F6IA 4K9EH 3QDJA 4NQEB 5C0GA 1KCVH 5D2LF 1IC4H 3SDAC 5SWSB 3FFDB 3K3QA 4OTXL 5D2NE 4X8XA 1LGVA 1RUPH 4N0YH 4BQ8A 5E56A 2VZ1A 3GJFH 4FABL 2Q3ZA 4S1DC 4YQXL 4ZTPH 1A7NL 2FR4B 2EE6A 5DD5L 4HJ0D 4NQDE 4LHJB 2D31A 1MUJA 4YDKL 4L4VA 1R3JB 1P1ZB 1AHWB 3LKRB 4TPRH 5HI4D 3VE0A 3D3VE 5HYQB 3TNMA 4NNPH 1DBKL 3C60C 3LRSB 5JXED 3CFBB 5DMJB 2ICEA 4RAVA 4KQ4L 2ICWB 3GI8H 3QUZB 4EQ3A 3MJ9H 4LCYA 1TMCA 2YSSA 3LN5A 5IVXF 1MCKA 5IKCA 1MFNA 3KJ6H 1WT5C 2DF3A 3SGKA 3LEYL 4O9HH 3VFOA 3K81A 4P2RE 3ZHDA 1B2WH 3MQIA 2EIEA 1G7PB 3FRPG 1LO5A 3KPSD 2DIAA 4L3EB 2QJDA 3C5ZD 3RKDD 2YK1H 5JORB 1O0VA 5C6PB 2IGFL 3H9YA 4C58B 4PJGF 5C86A 3D85A 1B0RB 4Y88A 2DQFB 1EUUA 4LFHG 4XHJD 1YY9D 1QBLL 2BSTA 4G9FA 4JPWH 4MQSB 1WGOA 4RMRA 3DSFL 4WEBH 4XMPL 4F57H 1P6AB 1U2CA 3DGGA 5ISZE 1PZ5A 3BZ4A 5FIEA 4AH2B 1TZHA 3T0VA 5BZWB 1KJ2B 4NRZB 4UBDD 4OCSH 5IWLA 3KG5A 2FX9L 5LCVL 2R0ZL 3KYOB 1OD9A 1HIMH 4GG6E 1I7RA 5EO0B 4NN7B 1WZ1H 2M26A 5IJVA 1DFBH 1JGEA 3WXWH 1CD8A 3UTQB 5GPRA 1IMHC 3O4LD 4HG4K 3WSQH 1G9NH 3GO1L 2YPLA 2KH2B 4QRUA 4AM0B 2ESVA 1RY7B 2R69L 5D1ZC 2I9LB 3NTCH 2VXSH 1H8OA 1NCWL 5DHVH 1JNLL 5ALBH 4M1DH 2E27H 2K7PA 4YNYA 1QYGL 4KAQH 4PLOB 1KXVC 3ARSA 1NUGA 4BZ2H 1AI1L 2A83B 5FM5O 4QF1A 4I3SH 1HH9B 3D5OF 1U8LB 5K9QI 1MLBB 4G6ML 1BVZA 3JWOH 1TZGL 3ZO0A 3MLXH 1LDSA 4P57B 3OR6A 4G43B 4Z7OE 5L2KE 1JUFA 1PSKL 5FGRA 1XF1A 2AGJH 2Y9RT 1JHTA 1FC2D 3QQ9D 4U1SA 4YXKL 3ZKXB 5GQBA 5DLMH 3HC0A 1FE8H 4PJDA 3BKMH 3QQ4A 1PKQB 4S10A 3KWWA 1A14H 4NHCL 4NP4H 1NCBH 2J8OA 4N0UB 2C9AA 5D2NA 5I66A 3CXHJ 1SM3H 1HHHA 1T22B 2V5RA 4WO4D 3OKOB 1T03L 4JANA 2D03L 5I1DB 4Q9QL 3BIBX 4Y4KB 3BUYB 4PJGA 5SWSD 2Z8VC 3BUYA 3QJHA 1RJYB 2GTZA 2ZUYA