1A9EA

Decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B*3501 (ALPHA C
publication title Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to non-standard positioning of the C terminus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class i/peptide)
total genus 77
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1998-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a9eA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a9eA01
1LO4H 5D7JD 4YHPB 2GSGB 2R2HB 5FYLH 4F9PC 2COQA 3FT2B 5B39A 3H3PL 1NC2D 3BOVA 2ZWLT 5E2TH 3X13A 5GS0C 3BEVA 3AM8C 4NNPL 2XOTA 4AT6A 1LEGA 2DWEA 4E41A 2X4TB 5CLWA 3T0AA 1WSST 4M43H 3RZCB 4F7CA 3AUVA 4EUPH 2HFGH 1RURH 4WHCA 4NQCA 3H9HA 1CYGA 5CSBA 4FNLH 1YY8B 4G8IA 4CMMB 4FMFA 1QSFE 5DC4B 5GHWL 4ZYKB 1HHGB 2J6EH 1EMTH 1WQVT 2P24B 1K3ZA 1HHKB 2IWGA 3TT1H 4RFEB 1MVFA 3BPNC 1MOEA 4I0PB 2PW1B 3G6AA 1ROWA 5EU3B 5D7JC 4FFYL 4MS8A 3RQ3A 4O02L 4Y5VC 4R7NA 4ONFL 2NTSP 1XF3A 4HX1A 5IB4B 3S3SA 1Q9OA 3F6LA 3QXUA 1FFPB 5F3HB 4D8PB 1JYNA 4OLXL 3RGVC 1A3LL 1MFDL 4M93C 4JCMA 5IUSA 4OZFB 5CWSB 1NMAL 2QSCH 1GZQB 1YC7A 1ZTXL 4JFFE 2DBJA 2VDOL 4GKOA 3UTTE 2JJSA 2AXJA 5CHNA 2YXFA 4DGIH 4ODWB 2XA8L 1UYWL 1J1XL 1NQBA 4HK0A 1YEFH 4RX4D 5EU7E 5DC0A 1WUNT 5E2WH 2J7LA 2H2SD 3QI9B 2ZOKB 5C09A 1BFOB 1MUJB 3J8F7 5FYLD 1S5IL 1WFOA 1LP9E 5E94B 3OXRB 1Q1JL 1H0DA 4C83B 3U4BL 5IFAH 4YHOH 2HFFA 1T0NA 4ETYA 4I3RL 5EU7C 4WUUE 4YAQA 3QDJE 1S7SA 3MACL 3R0MA 4GSDH 1FYTB 2OJEB 3ZSSA 3T1WA 4M6NL 5I76B 3FO0L 3ARXA 1U8PB 2ZCKL 5EO1B 5C08E 5HGDA 2AV1A 1KLGB 3QEGL 4WI8A 3K0WA 4FQPA 5TE4H 1UVQA 3PDOA 4YHYC 1ZHNA 2V7NA 4HEME 4WFHD 3WNMA 4S2SB 4P2OB 1SQ2N 2MWCA 3BQUC 5E6IA 5CUSL 1OPGL 1R3LA 1R24B 3SE9L 3DO3A 3D2UD 5D2NA 4LSRH 1MCWW 3BHBA 5J1AB 1AXTH 2H26B 3Q6FA 4JPWH 5J11B 4O5LH 3VI3F 1MIEL 3CPLB 4QXTA 4R2GC 1ZT7A 4WFHE 1Z9SA 2AK1H 3A6BL 1IGCL 3KYKL 5HBBA 4LPXA 1JBJA 1L7IL 5M94B 1NFDA 5KS9B 2C3HA 3DV6B 4G6JH 1YPZA 1B2WH 4GKNA 2CXGA 4NKIL 3UPRB 1FNFA 5ESAA 4ZD3L 4AJ0A 4YHMH 1DQJA 5IB2B 2MSPA 3MNVA 1JNLL 4FS0A 5K9KB 3VGGA 3QUKA 1RIHH 3L3JB 4Y89A 1HKLL 3OQ3B 3HC0A 3MV7A 4MA7L 5DUMH 2H3NB 3W81A 3VXUB 1BQHA 4ORGB 1XGYL 4PJXF 2DQGL 1A2YB 3R8QA 3O3AA 3P0YL 3QZWB 2EYSB 5T33H 4IEFB 3MXVL 4HMEA 4EOWH 5HHXH 3UBXI 1X7QA 2Y36H 1Z3GL 3ZDXF 3G5YA 2VZSA 3O3EA 2IALB 3G6DL 3QPXL 1QFWL 4LCIH 2AABL 4L4VA 4LSTH 3QDHA 3VXPB 2VDLH 5EU5B 4GAFB 1N8ZA 5CLTA 4X7CC 5DK2B 1ERNA 2PO6A 4UOJA 4X80H 1E27A 5JHDE 4RGMC 2CMRL 3ZDYF 3UBXB 3CH1B 3LOWA 5C0BA 3ALXA 5DTFB 3ZL4L 5DS8A 1FV1B 4U1NB 4IOIA 4HH9B 3GSXB 1D6EA 2VSCA 4LLMB 5F7YC 1N2RB 1AXIB 1KCLA 3TBTA 4MDIA 4N5EA 2WIIA 4ODUB 2F74B 3NPZB 5IK3B 1R3KA 3HI6H 2X1XR 3OPZH 2H41A 3JV4A 1HXMA 3WBDA 2VDML 4B0MM 4G8FA 1A7RL 4X9GA 1Z5LB 4OZIF 1CWVA 4PV8B 1RHHB 5L2JA 5EA0H 5FDWB 4IRZL 3IJYB 1X5HA 3PWPB 4QXUH 2AK4A 2D0HA 1YUHA 2DQCL 4ISVB 4V3DB 1LO0L 4XMLH 4LHQB 3LQAL 3QIWC 4BQCA 5MHSD 4JFOB 5F8RC 4NO2B 5I1KL 2VDKL 5CKAA 3TM6A 1T1ZA 5DD3H 43CAA 1QKZL 3IRPX 4I2XB 3RIFK 2A77L 3HMXA 4OBRA 1BAFH 5FYJU 1T1YB 3PHSA 3AVEA 4UT9H 1ES0A 3T3ME 1BIIB 4XMKH 2XRAL 2BVTA 4TVPL 1EEZB 2Y72A 3SJVB 4L3CB 4BSWA 1NAMB 5F1KC 1BIHA 2EXWC 3GSVA 4F58H 4OI7A 3O6KL 5GS2H 3UJJH 4RIRB 4NSKB 3GSOA 3VXRA 3INUL 1C5DA 5C0FA 4L29A 4X4ZA 2VDNH 4JN2A 4KQ3H 1I8LA 4XCYB 4AYFA 4ERSH 4LHJB 1HIMH 4QRSB 1WZMA 4LIQL 3VFTB 4TNWF 1KXVC 2P42B 3L1OH 1PY4A 3JXAA 5MERA 3MCG1 4QRRD 4PJ5A 3UTSB 3D39D 3TO4D 4IMKC 1NCNA 4QHMB 5BMFL 1V7ML 1ZT4B 4LKCA 5E4IA 4DAGH 4Q7DA 4DVBB 1KJMB 3W2DH 1N5AA 2R29H 5JQ6H 2GHWB 1CDUA 5EC1A 1KF9B 3KHQA 4U3HA 1JPFA 3D39E 4YBLC 1OAQL 3BDYL 1TQBC 5ETUA 4Y2DA 2EDEA 3HE7A 3P11H 4PJ9B 1T21A 1AI1H 2EE9A 4XB8A 4J7RA 1AGDA 4TNVF 4AL8L 1MRCH 5E6ZA 4A2LA 3TF7C 1YEKL 4BQ6A 4KV5F 4BELD 5HYSG 3P4MA 1EZVX 4PJDF 3TO4C 5TH2B 2UUDK 1TVHB 2AEPL 4LCWD 4X8JB 5DQDL 5GRZA 3JTCA 5I30L 1UZ8B 1EFQA 3HZMB 4PLJD 1IC5L 5L7XH 1Q94B 3GSNH 5ACZB 3AXLA 1G7HA 4KKCD 4LCWE 5EN2B 4JFQB 3V4UH 2BNRD 4Z7UB 5T3XH 4FQJH 5E0QA 4DTGH 1FRGH 2P45B 5GS2D 4XCNB 4G9DB 4OLYH 4XI5C 4HJJL 4CU7A 2X5PA 3HNTL 1QFUH 1VHPA 4X6CF 3RKDD 4GAYB 1SMAA 5SWZD 3BH8A 1P7QB 2F5AL 1CG9B 1H3WM 3E1F1 1FP5A 4OD1L 4FZEL 5D5MA 3S4SA 4IDJH 2X4RA 1F45A 3KJ6H 1A7PH 1BWWA 4LGPB 2FJHA 3H9SA 2AXHA 4PLJC 1BOYA 1P7KA 3MJ9H 3T4YB 2IBGA 5DGRA 4KKCC 2IG2L 3WFEL 3ES6B 5D72H 1KCVH 3QUMB 2WUCH 5E95B 4I8DA 1AP2A 4M48H 4NNYB 4H20L 5ACMA 3TN0D 4D0CA 1BMGA 3BH9A 4XX1G 3K81A 4M6OL 4OCSL 1FZOA 2BNQE 1FZMA 2J88H 5D8JL 5DJ0B 5FOJA 3MOAL 4P2QD 1ZANL 1TQCC 3STLB 4YFLF 3MV8E 3L5JA 3O4LA 2BC4B 2JIXB 2UWEA 5C70A 4OCYL 4OD3H 3WFDH 3VFWA 1OP9A 5DJAA 3GI8H 1G6RH 2YC1B 3UZVB 1I3GL 3HNVH 2XWBA 1V8HA 4MQ7A 3VI4E 2C5DC 3D3VA 2EYRB 1FQ9C 3DVNB 2NZ9D 1ZGLA 1CGWA 3GNML 1LD9B 3GKWH 1T83A 1S7XB 4CKVX 4HWZA 2FSEA 2M2DA 2QQKL 3VD4A 5T3XD 4POYA 1LQSR 3ZDZF 1Y18A 4OFPA 4D0BB 3OAYK 5D96C 2B7DT 2JJTC 2FIRT 2CK0H 2NY3B 4YZFE 4JY4A 3RY4A 1PX4A 1RK0A 1I1FA 3GJFH 4PRNA 1F90L 3MLWH 2DMBA 1KEGH 1J8HD 2APVA 2J2ZA 1A02N 3BWUC 1A7QH 2W60B 1Q9WA 3DVIA 2ICEB 1DQML 2NZ9C 1RAMA 3W39A 3QNYA 2VIRA 3O41B 3PQYB 3EBAA 1HEZB 5GGSB 4JFPB 4WW2A 1CDGA 4AM0A 4IRJB 3VFVA 3FMGL 4Y1AB 2FCBA 1EX0A 3D85A 3JTTA 2YPLE 3QG6A 5FM4A 3KPPB 4F33A 4PJIA 2B1HL 1RUAH 1KG0A 3FFCB 4QTHA 4JO1L 1AR1C 4D9LH 3Q6GL 2L7JA 4PB9L 4PJBF 3I3EA 4F2MA 4G59A 2RR3A 4OLUH 4NRXB 5C6TL 1U3ZA 3KPMB 2CR3A 1U3HB 1FG2B 1JN6A 4R4BB 1KJ2L 1DN2A 5FOBB 4ZOAA 2GK0A 1IEHA 1GOHA 2J12B 3ELAT 1CFTA 2YWZA 4Z8FH 3SKNB 3B6SA 5MENB 5GGTL 3DVGA 5FGBC 1NFKA 1EUTA 3S96A 2EECA 5DJZA 1GZPA 1YNTB 1JUFA 3D87B 2YA1A 2VDQH 3RUGB 4GRLA 3VFGL 2ZUSA 1IC1A 4LVOC 3ABZA 3MLPA 1XF2A 1KB5L 1G84A 1L0YA 4LSPH 2NY7L 4MSWA 3VXQA 4O51A 4JO2L 12E8L 1IT9L 5D2LA 4JHAH 3HI5L 4F9PA 2CRYA 3OSKA 1DVFB 2C7UA 1HQ4A 3AM8A 2XZQL 3DRQB 5CJ5A 4XB7A 3ZYZA 3CFKA 4BM7A 1D5IL 5FA3B 5E00B 2VL5A 3L95B 1CICC 4X99B 3CIQA 3VH8B 4KAQH 2EIDA 5D70H 3O9WD 2G5BA 1Q0XH 1DE4B 3HI1A 5IV2A 3U7YL 3P77B 5CMAA 2YUWA 3FOLB 3FRPG 2VABA 4HG4J 5ITFA 3DXAE 5D7JA 1ZA3B 5DHVB 4Y5VA 1CT8A 5EZLA 3FONA 4RWHA 3NPSB 1TJHH 3PWNB 4FXGA 4X5WA 3MRFA 2H32H 5BZDB 2ZKHL 4OKVA 4WTZG 1LHZA 1NC2A 5T5NF 4WNQB 4QHKI 4KZDL 4GRWH 4R96B 1QSFA 5DFVC 3M1BB 4EI6A 3RGVA 2XN9B 4AQ1B 5T5NG 4NZRH 3MCLL 1JTPA 2CDGA 4G7YH 5DJYB 2E27L 5ADPH 1AE6L 1FL5B 5JHLH 2X4UA 4G5ZL 3V0VA 4DKAA 1B6DA 2VITB 2QEJA 4Z78A 3TBVB 3OKEA 3BP6A 3S3JA 2Q86B 3FOMA 3O4OC 1K4CA 1EHLH 5EPMB 4NZJA 5IHZA 3SGDI 4NWTH 1WFNA 5F1IB 3MRHB 4P23D 3SCMB 4H25B 2P8LB 4TRPL 4X8XA 4BH8A 2FWOA 3BKCH 1K4DA 1CTOA 4LMQE 4XNXH 5J3HC 3MXWH 4BZYA 3EIFA 4Y5YB 3UTTA 3WEXB 5DO2C 3LV3B 3VGAB 5IW1A 4Q9RL 2BRRL 5EFIA 4QT5A 3ZTNL 4ZAKD 4H5SA 3PWUA 3G9AB 3OTTA 3BW9B 5D7SL 2EDLA 2ZCHH 4BQ9A 4PRHE 1ADQL 4NKDB 5BV7H 5KVEL 1UKSA 1RVFH 2JB5L 1MHCA 4PJHF 1MFCH 5AZ2H 1DCLA 2D2OA 5JUEL 3ULVH 5BS0E 1ZLWK 3K2MC 2J1KA 1G9EA 2BNUA 4JGMA 4L8CA 2X44D 1FLTX 3PG2A 3HKFA 2IFFL 5DSCB 2OL3H 5JOFB 2Y7QB 4AENB 2R4SH 4APQB 5L8KB 1OGAE 5DHYB 4RCAA 1JZ2A 2P47B 3BQUA 4HUMB 4WUUA 2F8VA 3QDJA 5EH1A 4XPHH 2GT9A 1QLRA 2MKLC 3FQNB 4ZAKC 1NANH 1MQKH 4NHCL 4HJ0D 4X0KB 3RAJL 4P57A 1IAIL 1CLOL 5AYQA 5C08A 3RVVD 3VRIB 1NGZA 3CJJA 4JJ5A 2M8XA 1YN7A 2B4CL 5EZOL 4Z7NE 1NGYB 3H42L 2FL5B 4JY5L 4K9EL 5CBEA 3CVHA 3VGDA 2OR9H 3QWQB 4FXKA 1KCSL 1C16A 1VPOH 1HILA 4NHUB 5A2IH 4LMQI 3MGOB 2B2XH 3U1SL 2PXYD 1AH1A 1A6AA 3SPVB 1U8JA 1FFQA 3DUSA 5ALBL 1RJZB 1OM3H 1CU4H 2CGRH 3LRGA 2AJVH 1GC1H 3D2UA 1KC5L 1NH6A 4DQOH 4EQ2A 4K7PH 3KXFB 4HJ0C 1K6QH 3DBXA 3QQ3A 5IG7A 5IVXF 4M62L 4DEPB 4TN9A 4HLZG 3HE6D 3KPNA 1F8TL 3LD8C 3WIHL 4CL7A 1CFQA 2C4FU 1WWAX 2EKSB 4JPVH 4JHWH 3VMPA 4YUEH 2V17L 3HUJE 3MBXL 3V5DB 3DMMC 1BFSA 1KIUA 1YJDH 2R23B 2GSIB 1U8KA 1QTYT 8CGTA 2NNAA 3FT4B 1MHHA 4FQIH 4C56D 4XWGH 2ITCB 1Q0YH 1JPSL 1PYWA 4R7DB 2A6KA 1ZAGA 2D7OA 2I27N 4JQVC 4YC2B 1EH9A 1KB9K 4HDIA 4YBQD 5JHDA 1CI5A 5DRNB 4CN4A 1CZ8H 2FJGB 4OT1L 3CZFA 1VGEH 1H3PH 3ZT7A 3QWOB 5ECJE 1YEGL 4YGVB 1RZKH 3IFOA 3WXWL 4LRNH 5I9QC 1BGXL 2ZUQB 1K5NB 1HXYB 2ARJA 4LDOB 1IGTB 3VRLE 3BZFB 2PYEE 1ZEAH 1CXHA 1VFAB 3QIWA 2KKQA 4N0FB 2B0SH 5CINL 1A6TA 3EOAA 3FN0H 4XC1H 2WBJB 1T3FB 4HWEH 4LCUB 1A14H 1S7VB 5BVPH 3V5KB 1FFNA 1S7QA 4A2MA 1IKFL 4HPOH 2BDNL 3PL6D 5E9DB 8FABB 3O8XC 3RGHA 1MCCA 3S37H 1ONQA 5ICXB 2AQ1A 2NX5B 2P5EE 4JM2F 4TUJB 1KXTB 4WUKL 2MOVA 1U6AH 1KJ3H 4NZTL 4XAKD 2ATPB 4QYOB 4W68A 4FFVD 1NLDH 1QSEB 2OMBA 3SBWC 3OHXA 3X11B 5FKAA 1RMFH 2X4QA 3HC3L 3UCRA 3EFDL 4JRYE 1E6JL 2F58L 3GBLA 3NCFB 1P84J 5BVJB 4BSVA 5I6XC 1G0XA 4Y4HB 5JPMA 1AGEA 4P3WA 4J3TA 4M3KB 5IEKB 4OJFL 1LDPL 2A9MH 3WNOA 4ZS7H 4OCWH 4ZPTA 2A6DB 4X4ME 1VB9A 4ZUVB 5C0CD 1KCGC 5KSUA 1A0QH 5FYKL 4MZ2A 3GB7A 4PJAF 2BVPA 2VXQL 4X4XA 1A9BB 1KYOK 1IC4H 4HS8L 4IMKA 1XCQA 4HGKC 4PRPE 4BQ8A 3KJ4C 2JCCB 3LH2H 4FFVC 3HPLA 4Y4FB 2AJYH 3DI3B 5HI4D 5CAYB 4W6WB 3VA6A 1INQB 4YX2L 2IH1A 4XBGA 2XZAH 2HMID 3OKYA 3T77A 4NYLB 4XHJD 1NCBH 2J4WL 4NUJA 5IJVA 3P4NB 5EOCH 1UADC 4U3CA 2GJZB 1ZLWH 3X14A 3ZKMC 1ZLSL 3ZKND 3TF7A 3GIVB 3WDIA 3ZMRA 3DX9B 2ZUVA 3OGCB 3V7AE 3D39A 3TO4A 3U7WH 3BP5B 2AJUL 3EJZC 5CEZH 3QUYC 1J11A 3TCXA 5HI4C 5TE7L 3T0EE 3SKOB 2R8SH 3F58L 3EO9H 4IHOA 1Q9LA 3MGTA 1U8HA 5HYQB 4ZFZB 4QNPE 1GGIH 1GVIA 1FH5H 1D6VH 2MHAA 2ZCLL 5I1CL 3Q2CA 1TVBA 1A4KB 4U2YA 1DLFH 1AD9A 3RBGA 3ZKNC 5ID1A 1A5FL 4KK9D 1T89C 1CLCA 2PTVA 1RD6A 3T0EC 3MODH 3G6JA 2MQ0A 2NXYC 3MRCA 3TZVB 5AUMB 4QRPE 4K94C 1I9JH 4JO3H 4OQTH 1BZ9B 2V5MA 1S7TA 2BY1A 3WN5C 1MJJB 3IXAB 4LCWA 4QRTB 3W82A 1SBSH 4D9RD 3P3YA 3T2OA 5F89B 1AGCB 4I3SL 4PJFF 3VE0B 4PG9B 3IT8D 3VXMB 4X5XA 3G5VB 4MJIE 2BNRA 4HKZB 3E6HA 5ERWB 1F3DH 3ZKSD 4P46B 2V2TB 1IZJA 4P4RB 3RKPA 4DJMA 4KK9C 4OZFH 3F12B 3MRPB 4JY6B 5FUCE 3GJEB 4WY7L 5I0DA 2X4SB 1ZVYA 1BLNA 2VLJD 1QLEH 2CIIB 5SWZA 1A4JB 2FJFB 2Z8RA 1RI8A 1MHPH 5I1LB 4D9QE 1BJ8A 4LFHG 1OL0A 1TJGL 2BFVL 1MCKA 1U0QA 4Y4KD 4YHIA 2DTML 4RNRB 5CEZD 5I8KL 4M8QB 5FUCC 1U3JA 4UB0H 4UILL 3WIFA 5ALCH 2LTQB 2WWKT 4HJGA 4UUJA 3MCKB 2EEDA 2Q7YB 1WV7T 5LBSL 2ADGB 4JPIB 3IKCB 1JWUB 3IJSA 3RVUD 5FO9B 4HUVB 3ARUA 3MV8A 4P2RE 4TUOB 3RZCD 1IVLA 4X7SL 2EDYA 3B2VH 2JJTA 4XP9L 1WC7B 4X6DF 1IGJA 3C08H 3CCHB 1C08B 5ICYA 4PGDA 1AO7D 4I0PD 3OL2A 1GPOH 4L8SB 5GGQH 4S10A 5E99H 3IJHA 3IU3B 2B39A 2NY6C 3EW3B 2AJXH 4S1SL 1AO7E 3U4EA 2VXUL 3TH3T 1G7IA 2HWZH 3U82B 2OK0H 5JR1H 5I66B 1T5WB 5K33A 4UBDD 4ENED 1LILA 3GSRB 1CK0L 3RHWK 4LLYA 2JB6B 1T22A 4ZFFA 4R4FH 1NUDA 4G6MH 3HG1D 2XWJA 5DEGA 1EO5A 4U1HA 2G9HB 1OD7A 4WEBH 2QHRH 2HH0H 3LRSA 3HG1E 4HAFA 1NKRA 1K85A 3WNPA 3QG7H 5KN5A 4R0LB 1I9IH 5MP6H 5TFSH 2YPLA 1MEXH 1ZWIB 2VC2H 5B8CC 2YPVH 1I7TB 5C3LD 5FGBA 3EYSH 1NAKH 4F7PA 1QR1A 4AMKH 3OF6D 5EIVA 2Y06L 1KLUB 3OKMB 4OFYA 4UBDC 2AAVA 4ENEC 3I6KB 4K7FA 1SMOA 2HJKB 4JLRA 1UG9A 4TPRH 1MJ8L 5FGRA 3NCJH 1XR8B 2NTFB 4KRMB 4WW1A 1KXQE 5TQ0L 1ZS8B 3VFPB 1N3NB 3WXVL 1FYTD 2XZCH 4XPFL 1IQWL 3MX0A 5IFHH 4OM1L 5DJ8B 3QPQC 3OKNB 3L3GA 4NQSA 3EYQC 2IMNA 4PTUB 1U8OA 1W0VB 3VI3E 3B5HA 1UEYA 4F37F 1A1MB 1UWGH 3ZO0A 2VKWA 2QSTA 4UQ2A 1H5BB 1FNAA 2PR4H 3ROOB 1CICA 4JGUA 1FL3B 4JFDB 4I5BA 4Q6IB 4HW6A 4RISH 4GO6B 1MCPH 4Z9KB 1Z9LA 1M6OA 4KJWD 1EXUB 1F11A 2WP3T 4X9IA 5FXCH 3UP1A 4RBPH 4G6AD 1IGYB 1GGTA 4S1QL 4WVRA 1IZKA 4PJXE 2IPTH 5IBLC 2Q6WA 5I18L 5IOPB 3MJ7A 4N0CC 2AI0L 1INEH 2QR0A 4H0IA 5DRXB 1ZVSA 4BKLA 3AS2A 3VXUD 2JK5B 4GW5A 3WIIL 3RWIB 1RZFL 3DXAA 3VMOA 1JK8A 5ANMB 3ULUL 4X9FA 5D1ZC 2AKRA 1URLA 1LK3L 1S9WB 3RTQD 2IJ0C 1EO8H 4GXUM 5DJ6A 4CUCA 1RU9H 4M9PA 1DBKH 4Z7WF 2J5LB 3ZDYE 1OVZA 3TA3C 2DQIH 3DV4A 3FTGA 3PP4L 3I50L 4TULL 4QRQB 4I48A 3MYJA 3NFNB 2IAMB 2AEQH 3QYCA 1I3RA 4KC3B 5FYJH 1DANT 2ATKB 4HZLA 2VR5A 1AHWB 1ACYH 4X6EB 3ARBD 2ESVB 1W72B 1U8NB 1MCSA 3BMWA 3OB0H 1A21A 3WCYA 1S7WB 2GI7A 4NRZA 2Z31B 3PIQB 1JTTA 5KSVB 1DDHB 3RTQC 4OZIE 1WBYA 4MLSA 4B53A 4HFWB 2WNGA 4U2ZA 1HHJB 4JVPA 2Z93B 1I4FB 4M4RA 3LEXA 1B0GB 4MXQC 2YRLA 3DROB 3G5XA 4JAMA 1HOCB 2NW2B 1CL7H 3ILPA 4QOKB 2I24N 2QV2A 1MELA 2EYTA 1FORH 3ZKXC 1J05A 2F15A 1VSCA 5T5FH 4GW4A 6FABH 3ARBC 2W9EL 3O2VL 1UWXH 3PWPD 2EH7H 1CXIA 4PRHA 3FO1B 2DQUH 4P5TB 5J9PB 1AQDB 4ZAKA 5I1AB 3QDAA 4M7ZB 3KPTA 5ITBL 3IXTA 4NQVA 2DJUA 5F6HJ 5K9QG 1OGAA 4PRAA 4GMTH 3VXNA 1D5ZB 4QF1A 5LQBH 5IM7B 4DK3A 4R97B 3SY0B 3QA3A 1T80A 3K2UH 1MQ8A 2ADJB 2BSRB 3MRRB 3VWJB 3TBYA 1QLFB 4NJ9L 1ZVHA 2X1WL 5B38G 4QHUB 5GS0L 4WWKC 3SJVD 1CD0A 1A1NB 1C7TA 5FYJD 4PDCE 1AY1H 4YWGH 5CILH 3BI9X 2I5YH 1DL7H 4KROB 4JG0H 1JHTA 4NO3B 2JJVA 4FTVB 1G9NH 1RZ7H 4YHNA 3T8XA 1I1YA 1Y6MR 1FO0H 1JMZA 2BVQA 3DGGB 2GEEA 3NN8A 2DDQL 4S0UC 2QTEA 1S8DA 2DLFH 4KVNH 2SEBB 3L3IB 5FHBH 1PLGH 3DMMA 4FQQA 3UTSD 1RZGB 2D3VA 2ZSVB 5C6PB 5J12B 1JNHA 1GIGL 2GAZA 1MAML 2ORBL 4YEFA 4N9GA 3IAGC 4MJ6A 3KNBA 1O7VA 3A0OA 4KV5E 2IFGA 4MNQE 3PV6A 4JQVA 3HUJA 1DBMH 4TQEL 3SDYL 1JMXA 3WE6A 3ALWA 4Y16B 2X9XA 4RGNB 4DUWA 1RJLB 4JDZB 3EYOA 1O7SA 1AXSB 1YMMB 4XRCB 4NP4L 4B5EA 5HYIA 2FLBT 3EDEA 3QJFB 4M7KH 1IM3B 5MI0B 4OUUA 4PREA 1FNLA 1G9ML 3IAQA 3C9NA 4YIQB 1MFBL 4UT7H 2E6JA 2AJZB 4P4KB 5ID0B 2L7UA 4KJQD 3TPKA 4XPGH 4YDIL 5LGHH 1SYSA 5IEHA 4JRXB 3GUTA 1VGKA 1WFTA 1JPTL 1ZHBB 4X6CE 4JR9L 2E7LE 3QXDA 3SEPA 4LVHB 5E08H 2V2XA 2X10A 1CFNA 4NDMA 3RDTB 4HIIA 5IQ7H 5KSBF 3O8XA 1ZSDA 1UM6L 2BJML 2X4NB 4BZ2H 5IESL 2PYEA 5GS1B 5LWYH 3I02A 2XV6B 4LLDB 1P7QD 4RWYH 1JGLL 3W0WB 4MAYC 1NFDF 3SBWA 2E7LC 4XX1E 2XKSA 2Z35B 1YPZF 3GBNL 4ONHA 1LO4L 2ERJB 4HUXA 3OZ9L 4P5KA 3PJSB 5FYLL 4GG6B 1XGTB 1C8PA 4LKXB 3TBWA 3BGFC 2VJXA 4C59B 3BWAB 4MVBC 2YK1L 2EXYC 1XT5A 1QBLH 4PBXA 4KUZH 4LOUD 1HZHL 1BD2E 5ICZA 3V2AR 3MLTA 2YPKA 1WIUA 4JKLA 1FZJB 3DRTA 4PJDB 3GSQA 1PX3A 2EKJA 4LAQH 3IRZA 3MRIB 1EMTL 1SEBB 3RL1A 4Y8AA 4HS3A 3TT1L 2YD4A 1I7UB 5JQHC 3QQNA 1XR9B 5IIEA 3SQOH 2BSTA 1H3VA 4X4MA 3DUUA 4OZ4A 4IOFC 4TYUA 5L2KB 3ROLB 1I1AB 3UAJD 3ZDZE 1I7RA 2NPLX 5FFLA 4PRPA 4HQQL 4WI7A 5DMKB 3C60B 2FX9H 1CFSA 5C0CA 1RHFA 5D7LB 1JF1A 5I8CB 4P9HH 1FCCA 5H35B 5EU6E 4K3DL 4NBXB 1IBGL 3C8HA 1A3RH 1B4JH 3UTQB 2EC8A 3QUYA 2MKWA 1FNGB 3ARWA 2WANA 3JV6B 5EBWA 5BJTA 4DGIL 2X4PB 2NY3D 5KSAB 5CKGA 4P5MB 2R2CA 3T0WA 3NTCH 1I7ZB 4KHTH 1YEFL 1U91A 4M3JA 5E2WL 3ORJA 2CRZA 2VAAA 5FKPB 3UAJC 4YFLI 2AV7A 3CFBB 2AW2A 5EWIL 3VGHA 4NQTA 2CUIA 2HLFC 1T89A 4PJBE 2FYYB 4YHOL 3T0EA 4CVXB 1YYMH 2ED8A 3PQYD 4NWUH 4OF8A 1P6FA 4IRJD 4LBEA 3WN5A 1UM4L 4Y1AD 1CD9B 2V9TA 1J5OL 4GSDL 4PY7B 2VLRE 5DHVH 3FFCD 4AIZB 2HT4C 3LAFA 1QBAA 4YE4H 3O2WH 3HFMH 1QSVA 5TE4L 3IGAB 2EICA 1U3HD 5JW5B 4QRPA 4GLRH 5LGJB 5DUBB 4MNHA 3GHBH 2KQMA 3H7BA 3BO8A 2VDPL 1G7PB 2C1OA 1AXTL 4JPWL 5MEND 3LKSB 4O5LL 4I13B 3N0PB 4AK1A 4HV8A 2AK1L 3NMEA 4IRSB 3RZWA 2R56H 1WWBX 2WV3A 4LF3B 4MJIA 1HI6B 3IFPB 2W0FA 1T4KB 2ADFH 3AC0A 3H9ZA 2QQNH 3P73B 1IJ9A 1B2WL 1NEZB 4XH2B 2DICA 1LO5A 1BVLB 1IFHH 2VUYA 4B7LA 2IANB 5TGBB 4ELKB 1A7OH 1KCRL 5T1LA 3WL9B 1RIHL 4QTIL 2E9BA 3BFOA 5DUML 3BT2H 4MQXC 4M61B 1SVCP 1JIBA 3GSWA 1DVFD 3RWFB 2OI9B 3LN4A 1OAXL 3SGDH 1JWMB 5A43C 4EBQL 5HHXL 1EFXA 4EOWL 5T33L 1NFIA 2Y36L 3AREC 3ARSA 25C8H 5H94A 1L7TH 3B9KC 4M02A 4N8VG 3TC9A 4PJEB 2APFA 1OP3H 1U8MB 4NBYB 4KPHL 2W59A 2HG5B 5HPMA 2CLZA 5C07E 1HSBA 5IF0B 2FH6A 4ZPVA 3CNKA 3FHQA 3GK8H 4X5LA 3H9YA 4GQ9H 4X80L 2VN4A 1JWSB 1RPQA 1CE1H 3JWOH 2GSGA 4HKXA 4G8GB 2DQFB 4GAGL 5FO8B 1EV2E 4KKAC 4MNGE 3E2HB 1DVFC 1DN0A 2PN5A 2Y1VA 4LSVH 1IKNC 4KHXH 4MJ5A 2OR7A 2XN9D 2X4TA 2WBKA 1VEMA 3QEHA 2WQRA 5I2IB 2E7CA 1KELL 4PLNC 3DX6A 1FSKB 3NBNA 2HT2D 3HI6L 3OPZL 5HHOB 1FVDB 3DI2B 1IAKA 2GUOA 1FC1A 1M7DA 1M05B 1AO7A 1JGEB 3QNZB 3PNWB 2QL1A 4MCZA 4NZUH 4HG4K 3RWEA 5I71B 3EHBD 4EVNA 2ICWJ 1NDMB 3TVMB 4WHTB 1YEHH 5B8CA 4XMLL 1EIBA 5F97E 3OKKA 3TP4A 2V5SA 2PCPB 4IDLA 3UYPA 4ZFOL 4XZUB 3SKJH 5DD3L 1GAFL 3I3DA 3QAZB 2XXMB 4N5UA 3GMMB 3AS0A 3HG1A 3S34H 1C1EL 3I6GA 3MROB 3L3DA 2VXSH 3U36A 3MRGB 1RZ8A 1EJOH 3NA9H 5F1SA 4RMTA 3O6FB 2O5ZH 2E6PA 2ADIB 2CQVA 4DGVH 3MRDB 4L8DA 3BKJH 4R3SB 3WFZA 5ELIA 3SDAB 2YA0A 4GMSL 1V05A 1JYWA 5F71A 1NC4B 1CGUA 1FAIH 3RY6C 4K55A 4APQD 4J1UA 3GMLB 2ZOKA 1BFOA 5E8DH 4F58L 3HNSH 1EGJA 4OGAC 3UJJL 2UWEF 3OF6A 5AAMA 3QUXB 1UA6L 3QR2A 2VQTA 5C0AB 2BMKB 3KYMB 2VDNL 5HHNB 3U6RB 4NT6B 2OZ4A 1PJ9A 3MV11 1U92B 1RSFA 5C0EB 5HHPA 1S5HB 1T2XA 2ZNWA 3ULUF 5I76A 4U1MB 4XNYH 5KZCB 4X7TA 2UYLB 2R1XB 3JBG7 4H26A 2FGWL 5DMJB 4CDHA 1GOFA 3DSNA 1F2XK 4CBPA 4NO0B 2XTJB 1CF8H 1PG7X 4N0CA 4APQC 3W2DL 5JQ6L 1R5VB 3VGFA 1XIWB 5IVXE 4L1DA 2KZ1B 4ZUTA 1UWEH 5DWUH 3V6ZB 3WD5H 3WS3A 5D1ZA 3KXFD 2DLIA 4PJXA 3PHQB 3P11L 3L7EB 1AI1L 3O3DA 2XKUA 4BZ1H 3MRLA 3TA3A 1OSZB 4PJHB 2W38A 2X1OA 1BVKB 2J8OA 3VCLB 2DYPA 4NC2B 4N68A 4PS4L 4R8WH 4WTXA 5F1NB 3B9AA 1NDGB 2P8MB 3CFCH 1P4BH 3MRBA 5F9OH 5GS3A 4PJIF 2YBRB 2NXZC 2K7PA 1HHHB 1HH6B 1TNMA 4NO5B 3PWVB 3VXUA 1R6VA 2A6IA 3GSNL 4LHUG 3QQ9C 4UNTA 1F97A 5CEYA 1BJ1J 1QFWI 5T3XL 5HHQB 4FQJL 3RTQA 3ISWA 1UT9A 3ERYA 4GBXB 1T2QH 4MXQA 4OLYL 2Q3ZA 1U41A 1WEJH 3V52H 1MWAA 1XMWA 1T03H 5EO9B 4XNMB 5HXMA 1G7MB 3HB3C 4PGEA 4HS6A 4RAUB 2F54B 5IR1B 1TXKA 3LQAC 2HT3D 4FQXB 4YDVB 1K2DB 4IDJL 4TVPE 5IROC 5IB3B 1JFMA 4OZIA 2HKHH 3ARBA 1FZKA 1IGIH 3QO1A 1B9ZA 3AY4C 5INCA 3MJ9L 2Z9TA 3FQTA 2DJ4A 3M45A 5D2LF 1X6NA 5D72L 3QEUA 5IVZB 3T1FB 3GMOA 4OFVA 1HH9A 3VJ6B 3RJDA 1N2RA 5B4MD 3HR5A 4QY8B 4L9LA 2JJUA 2WUCL 4RFOH 5LGKA 1SM3H 3REWA 5MEOB 1OTUC 4W81A 3CLFH 4LIQE 3DX8A 2F74A 2WBJD 4JFYA 2HVJB 2XA3A 4FZ8H 3GZKA 2R69H 3KPSB 3BGMB 3PV7A 1CGSL 4KK5D 2J88L 5E9DD 4LCCC 3ZSTA 4MB5A 3ZT5A 4L4JA 2NX5D 4GW1B 4QHLA 2XKNB 3BPLB 3D69B 3QJHB 4N0UB 1QSED 4WWKA 3WFDL 2LVCA 3VG9B 3S5LB 2EDFA 3GI8L 1G6RL 2UZYB 3JWDH 4WHDA 2GKIA 1YEIH 3HNVL 2XXCB 5DK0A 5EZIH 3SDXE 4EXPX 3WNLA 5ESQA 4JHZA 4PJAE 1J0JA 1KNOB 5C8JA 3WHXB 4Y4HD 3B4NA 1UCTA 4KRPC 1AC6A 1KGCE 4G80B 1OP5H 4PGZA 3RNKB 3V4VH 1FGVL 2NY2C 3TCLB 3VD3A 4FXLA 4H1LB 3CMGA 5I1HH 2CK0L 1ZGLP 4XCFH 2VZUA 2X4OA 2I26N 5C2BL 4CU8A 4CGTA 4OF7A 4Y4FD 1KEGL 2OTWB 4L3CA 5IWLC 3QFDA 1A7QL 2CLRB 2H1PH 3LKQB 3QDMB 5GJTH 1NAMA 4F7TA 4N90E 4P59H 4RIRA 2UZXB 3Q5YA 1P84K 1MH5B 2LU4A 3RY5A 3TYFA 3PGCA 1XGUB 1WCBB 2EDBA 3QXVA 1VKXB 5JZ7D 3BPOB 2CDFB 1CDJA 4G9FB 2HN7B 3MPCA 2D31A 1RK1B 1KENH 2HP4A 5HYSA 3UTSA 2XNAB 3BZEA 2EO9A 4QHMA 2NY0D 2YS4A 1OB1A 4OZHB 4OLUL 4Y4FC 4DVBA 3EUUA 5E6YA 1C12B 1ZK9A 2BSED 1DSFL 4ZMAT 3SO3C 4DOHE 4Z8FL 4LRIC 1LO3L 5EZJA 5JZ7C 4YR6B 1JYXA 3J7HA 35C8L 1NBZB 5C0DB 1FAKT 4FFZH 3GBMH 5HHVH 1HQRA 2VDQL 2CUHA 4PJ7E 3TZVD 1XH3B 2PYFB 32C2B 5HDQH 2BOCB 5TH2A 4YDKH 2F5BL 2QHLA 2NY0C 2DLGA 5H37H 1EEYB 1LK2B 4MAYA 4X6CA 1TVHA 3NCYP 3O6MH 1MCOH 5ISZB 2E7LA 2B1AL 4TOYH 4JHAL 2VSDA 1NGPH 1B88A 4EUPG 4PR5A 1NGWB 4J8RB 1NCCL 1R3JB 2ICWI 3VXMD 5MEQB 4HUUB 4MVBA 1WISA 4MCYB 5A40E 2I9TA 5LVEA 1GHFH 1QRNB 3FT3A 4M9OA 3AAZB 4PJ8B 5IW3A 5C92A 2DM3A 3BZ4B 3X3FL 3QQ4A 4P46D 5FUOH 1XCTB 1WBZB 1TMCB 4KAQL 2GJ6E 3RWJB 5D70L 1WK0A 5JOPE 1P7QA 3OR6B 1FVEB 2XPGB 4QO1A 2P1YA 3UPAA 3PGDB 3EGSA 5E8OA 3N1MC 2NLJB 2PTTA 1MVUB 4CW1B 3S88H 4ODBD 5DA0B 4YK4C 5K9JL 2HTLD 3P0GB 3QUMA 2OLDA 4NZRL 2KUTA 2VDRH 4LNVA 4F15B 4G7YL 3A6CL 1KFAL 4KI5D 5GRXG 5JHLL 2HLAA 4NCC1 2R0ZH 4ZDHB 3NVQA 4LLQA 1VACB 3EOTH 2BCKB 4M1DH 4JPKL 4KRNA 3TPUB 2OTUA 3EOBB 3NH7H 2BY0A 5CP3A 3WJJC 2CKNA 4PJFB 1EHLL 2Z92A 3MO1A 4ONOA 3IFNH 5ILTH 4MA1B 4NWTL 5F88A 3NACH 3OKLA 1A6ZA 3CFIC 5I15L 2MMXA 5EU6A 2V7HB 1YNLL 2LTQC 2FECL 2HYMA 3MXWL 5DYOB 2EYRA 4YHKH 2HTLC 5INDB 3PHOA 4HMDA 4NJAH 3EO0B 1JRHH 4B50A 1CXFA 1CXEA 4KI5C 1KCUH 1PKQE 5IB1A 4D0BA 5F7KC 5BV7L 1U8LB 1DQLL 4LNRB 4TNWK 4XVJH 2GTWB 1TENA 3IDJA 1MFCL 5AZ2L 3BPCB 4FFEX 1DFBH 3T65B 2UVFA 4WFFE 3RVXD 1GYAA 4H88H 4Z76B 1MI5B 4S1DD 1QFWM 2OL3L 4K2UH 4UU9B 4JFHE 4U6VH 3EYUH 1KIQA 1KPVA 3MJ6A 2M26A 4ZXBC 3RJQB 2P5WB 5FK9B 5EC2A 5AD0B 2YKLL 3FZUD 4PTTA 4XPHL 1FN4B 2P8PA 4XVSH 2VLRA 1F58H 4U05A 2Y5TB 3CMOH 5SX5K 2XWTB 1ZLUH 2GCYA 4ZFGH 1F4YH 4Y1AA 5ESVB 2VH5H 4X6DB 5KVGH 4M00A 4M7LH 4JFED 2OR9L 3V8CA 3RX8A 1S3KH 4IS6A 3SGEI 1BP3B 3FAWA 4YXKH 1H15B 5T1MB 5CP7B 4MD4B 4S1DC 1C5CH 3RHWF 4NRXA 3I75A 3KPMA 4HIJA 2A73A 3FQUA 4JFEE 1R5IA 5C7XH 4N1EA 1OM3L 4I77L 1CU4L 5TDPA 4R0LC 2EDNA 5GSRB 3QO0B 3SKNA 4K7PL 1KJ2B 4XT1C 2VXVH 3BEWA 2V9RA 1K6QL 1A9EB 1UH3A 3AREA 5HYJE 3FO2B 4HBQA 2FEDD 3B9KA 3SE3C 4JFDD 1FE8L 3IF1A 5FO7A 2CUMA 2VXTH 2XY1A 1IQDB 3KWWA 1MHEB 4JPVL 3FRPA 4OIBA 3IDUA 1MNUH 1S9XB 1QA9B 2YUVA 3KR3H 5IHUL 1S7UB 5DI8B 1P1ZA 1YJDL 2J8HA 3RRQA 1KACB 4LASH 4WTZA 1YQVH 1X5YA 1YDPA 4FQIL 5F7DA 4XWGL 1Q0YL 3FQWA 1DVFA 5L9DH 3QFJB 1HDMA 1GGCH 1IKNA 1PAMA 1B3JA 5C07A 4Z7WE 4MA8H 4YH6A 2APBA 4LEOA 2H6PB 3SDDC 3W9EA 5FA3A 5KW9H 1H5BC 5JORA 4XHQA 2APTA 2AGJH 1JV5A 5E2VL 5FUZL 4KI1A 1R5WA 4Q6IC 3VXOA 4V1DE 2J8UB 1BBDL 5C9JA 3DETC 5D1QB 4RQQA 3VFMA 3IU4L 4HC1A 5IB5B 3V7MA 3IAPA 3S8WA 1YYLL 3BJLA 4NM8H 1ZHKA 5A16B 3G6JF 4NN7B 1RZKL 4NN6B 4YXLH 5GSVB 5EORH 3NAAH 3CAFA 3VRJB 4LRNL 3W11C 3MV9B 2WSKA 4L3EE 1KPUA 2KQNA 3BN3B 4WO4B 3L9RB 4JREC 5BZDA 2QKIA 5IBUG 4LPTA 3BD4A 1C7SA 1U8QB 3EO1B 1S9YA 5EBMA 4F8TA 4ONGH 4L4TE 1UM5H 4X9BA 2FB4H 1QBMH 4NM4L 5GGVY 2JTDA 4MX7A 2B0SL 1NCDH 1QEWB 4JFZH 1G7QA 5DRZA 3FN0L 3TLRA 4XC1L 2Z31D 3K4ZA 4M6AA 5C0NC 5GJSL 2DF3A 2EIZB 4RZCB 3MLYH 3MREB 3U2SA 4U6XA 2YSSB 4HPOL 4Q6YA 2VITA 3MNWB 3PGFH 4LLWA 3TBVA 3I6LD 3TIDA 4QOKD 5DD5H 1OCWH 3MUHL 1U6AL 2OXHA 1ZHLB 3DHMA 3HZVB 2Z8VC 1CIDA 2N1KA 1NLDL 2DWDB 2VLKE 3RY6A 1RMFL 3FRUB 2ZG2A 5IBTH 1VFBA 4Z95L 4K9EC 2F19H 2W0KA 3LB6D 4O2EA 3QUZB 4P5TD 3WLBB 4P3CL 4PGCB 5BXFA 4QGYA 3TJHD 2O5XH 1Q9KB 3BW9A 4JZOA 4ZO9A 5IW6B 3RI5K 5IMOB 2EE2A 1A0QL 2B5IC 4B7IA 1R3HA 1SJEA 3VFOA 4Z7VB 5E5RB 3T3PF 5F7NC 1IC4L 5AG9A 4MDJB 5D6CA 3LH2L 1V5JA 2GIYA 3QIUB 5JOFA 2EDRA 3TT3H 2DJSA 4ZTPH 4APQA 3TH2T 3OAZH 4IIQC 3VWJD 4HUWB 1IAII 3P9MB 4KXZH 5HVHB 4CADB 4HWBH 4QGTA 1TJIH 4X0KA 5J6HA 5EOCL 2IQAA 1HK6A 4I4WB 3VRIA 4KROD 4YZFF 4ELMB 1KBGL 4OZGB 1NGYA 4FTVD 1M1SA 5GIRA 1ETZB 4XMPL 5BRZB 5K9QI 1SJHB 3U7WL 2EH8L 4BH7B 2DQDL 2ZJSH 5CEZL 4K8RD 3MGOA 2AXGA 1MFEL 2A0LD 3KLHC 1FL6A 3SPVA 1G1CA 1GGBH 2R8SL 4HD9A 4U0RB 5SX5H 5CD5D 1JGUL 1GGIL 5C0IA 1FH5L 3KS0H 2OP4H 5B39B 4TSAL 3BEVB 4N8PA 1OTTD 4HF5L 4WI4A 5FECA 4XP6H 4AT6B 2PW2A 2F53E 1NL0H 2W65A 3MODL 4E41B 2WP3O 4RGND 4PRIE 1X5FA 4F7CB 5JW4Q 1OAZL 1I9JL 4JO3L 1YMMD 4OQTL 4DKEH 4LEXH 2CKBH 5C6WH 4K8RC 4HUKB 4NQCB 3H9HB 3HPJA 4G8IB 3MUJA 1SBSL 2NQCA 4C58B 3V5DA 5IROA 5DMYA 1FDLH 1N7MH 1TZHA 2R23A 4XNQA 4PGBB 4H8WH 2XQBL 3AY4A 4P2YA 3G6AB 4MXVE 4P4KD 4XVTL 3BXNA 4R7NB 1MLCB 3X12A 2X89A 4Y19B 1PZ5A 1XF3B 4HX1B 5KSBE 3WFHB 2OQJB 1MREL 1E4XL 3DX7A 4JRXD 3HZKA 1PG7L 3HZYA 4M1GL 2LVEA 2JKXA 2FJGA 3IDIA 4YO0A 1DZBA 1UXWB 3MFGB 1YPZE 3RDTD 4LCCA 5GZOC 5MI0C 5TPWH 2QLVB 1HYSC 2R0LH 3KPRB 4XBEH 1JI1A 1ZLVH 1MY7A 2BZDA 5DVNA 4M4PA 1TCMA 2KPNA 5E56A 1IAOB 3H3BC 3LN5A 5CHNB 3W0WD 3HLAA 4P4KC 2DM2A 5DLMH 4UB0L 5ALCL 1CVSC 3F7VA 3C87A 3BP4A 5C09B 3KPLA 4R26L 5JOEA 3SOBH 1JFQH 1H0DB 3RDTC 3B2VL 2HFFB 4KKBC 4P9MH 1FHGA 5KTEH 1T1WA 1MJ7H 3SDXA 4YAQB 1S7SB 3C08L 4PJAA 1MFAH 4DZBB 5T1DH 1T5XA 3LQZA 3QDGE 5C0BE 4JKPL 5IWLA 2AQ2A 1GPOL 2NY5H 2ERJC 5HGDB 2AV1B 5E99L 5ABDE 4I9WD 3UYOD 1UVQB 1ZHNB 2A9NH 2V7NB 5L2KD 2AJXL 4DZ8A 2WLYA 5B3NA 1I1AD 4PP1C 3GI9H 2HVKA 2Q8BH 5E6IB 5IEKA 1R3LB 2YN3A 2HWZL 5IJKC 5D2NB 4ETQA 5JR1L 5FYKU 3C60D 4DK6A 2A6DA 3BHBB 3Q6FB 1UACH 1OT2A 3OJVC 5D7LD 3VGBA 4QXTB 3MA9L 1ZT7B 2BVOA 2DQEH 4BJLA 3WKML 4BSJA 1CLYL 2HFEA 4R4NC 4JJHA 1NFDB 2JCCA 1NCTA 4Y4FA 2QADB 2V2WA 4WEBL 4GKNB 5KSAD 2BVEA 5ESAB 2HH0L 2ICWA 2D4FA 5FGCE 4KK8D 1P7HL 3QG7L 3MNVB 5TFSL 1I9IL 3QUKB 4D0DA 1MEXL 3HC0B 3MV7B 3MOBH 2VC2L 2YPVL 4LRIA 4WRLA 4Y5XC 1BQHB 3EYSL 1NAKL 3MLVH 4X98A 1ODAA 4AMKL 5EU4A 3PWJA 4D94A 3O3AB 5IKCA 5E4EB 3LEVH 4TPRL 3G5YB 3NCJL 3O3EB 3SDCC 2MQ3A 3B5TA 5JXAH 3S36H 5T3ZH 4BFIA 2XFXB 4L4VB 4POZD 3ARGC 4UAOB 1KJVA 4LU5H 5IFHL 4XNZB 5KSAC 4NPYA 1N8ZB 1CLZH 4KK8C 3IDNB 2PO6B 3EYFA 5BO1H 4GS7B 2D9QB 2MPAH 2DIJA 4PJ7A 3LHPH 1UWGL 4JE4B 3CFDA 3H3PH 5FEBA 5DS8B 2O61B 4IOIB 4JZNA 3BVNB 4AZ8A 2AVGA 4RISL 3V0WH 1D6EB 4GRWF 5L0QB 5I16B 2EIBA 1MCEA 2X9YA 2WIIB 2FDBP 3CC5A 4IRSD 3VGEA 3ECBA 3LEYH 3IXAA 4QRTA 5GHWH 1FCGA 2H8PA 3JV4B 1HXMB 4J3SA 1J8KA 1A7BA 4G8FB 2IPTL 3CUPA 3QHZL 5L2JB 2IAND 5T1KA 4OLWH 3L6FB 2GJ6A 1INEL 1MAJA 4O02H 4YNYB 3G5VA 5C0JA 5I8OH 1WLHA 2H2PC 2AK4B 4DCQA 3B9DA 1YUHB 4YDLC 3QCVH 4QXGL 4ODTL 3TIEA 2APXA 1A3LH 5F7EL 4M1CD 1B4RA 1P4IL 1EO8L 1MFDH 3F7PC 3HUJF 3OV6A 1T2JA 2FJFA 1T1ZB 3IDYC 3G08A 1F6FB 3NZ8A 2AXFA 2PF6A 4QRUA 43CAB 1NMAH 1IAIM 1CIUA 1SEQH 3GO1H 2Y6SC 3WJJA 1QPXA 3WSQH 2YD8A 3OKOA 3UTPE 1ORQA 2AEQL 2B8OT 1UZ6E 1X4ZA 2RIKA 1UYWH 4WEMB 5FYJL 3UJTH 1NAML 1J1XH 2FHFA 1O0VA 1C5BL 5DJDA 2LU7A 5AWNL 5H2BA 4NQDE 4IJ3B 2Q7YA 3GSVB 2CXKA 3NGBB 3O11A 3GSOB 4JPIA 3VXRB 3IKCA 1S5IH 5DMGC 5FO9A 3EZJB 1Q72H 1C5DB 3NIFE 5C0FB 4L29B 4LSSL 4JN2B 1VERA 3U4BH 4OCMC 1HKFA 1DUYA 5DD1H 3AMKA 3O2DL 1KTDA 1KOAA 1CL7L 5CBAA 4I3RH 4J4PC 5HHOD 2QQLL 2FD6H 5MERB 1C08A 5GGTA 1B6UA 2X7LA 1FORL 1TDQA 1RFDL 4PJ5B 3VRLF 3FO0H 1HNFA 3BIKA 6FABL 2ZCKH 3VA2C 3MA7A 1PKQA 3C5ZC 3SKMB 4CN1A 3CFJA 4ZXBA 2EH7L 3TVMD 1L9MA 1N5AB 2DQUL 4U0QB 3T2NL 1KPRA 5F9WB 1JPFB 3N06B 5LCVH 1G7JA 3GIZH 3GRWH 3U79A 5ETUB 3BGAA 2WBWB 3ARFC 5I1DA 4GMTL 1VEOA 1AGDB 1IGCH 3G04A 3KYKH 5HHME 5LQBL 3K3QA 4IMLB 3MLSH 3NFPA 3K2UL 1QYGL 4NKIH 4EN3C 3P9LA 3ARQA 3SDAD 3TVMC 1JNLH 5TDNA 3PXJA 1NC4D 4R0LA 3HC4L 4MA7H 1AY1L 2NZIA 2OS7A 1XGYH 5HSFA 4LSQL 3AXLB 1DL7L 1G7HB 4JG0L 2DQGH 4BQBA 3ULUE 3QNXA 3QUXD 5C0AD 3SE3A 1G9NL 1RZ7L 3QAZC 1X5JA 5F6IB 4JFEA 2WQ8A 4LK4A 3X3GH 5D7IE 3QPXH 3M8OL 4L3AA 4RFNB 1N3NA 2DLFL 4LPVA 4KVNL 5J13B 2NR6D 1QFWH 5FHBL 4Q9QH 1WWWX 4NFCA 3BH8B 5DJ8A 5KZCD 4UINL 2XT1B 5HD8C 5HYJA 2NY1D 5D5MB 3S4SB 4NO0D 2CMRH 2X4RB 2XTJD 2ITDA 3KPOA 5HVWA 2FJHB 3H9SB 4HLZH 2YR3A 3SDDA 1NBQA 1P7KB 3QUML 1UEMA 1H5BA 3BYTA 5LAXA 3ROOA 4PBWD 1XGQA 4Q6IA 5J7CC 5I73B 2Q8AH 1DBBL 1AP2B 4D0CB 5SWSB 4C55A 3LKOA 5DD6A 3FB6B 1IGYA 1KCKA 1FZOB 4Z7WA 1FZMB 4UT7L 2NY1C 3HAEG 3QXAA 1JGDB 5IOPA 4XAWH 4V1DA 3SHSA 2IPKA 4IRZH 4DKFL 3EYVA 4Z0BH 1ADQA 3CDCA 2UWEB 3O4LB 1MCBA 5DURB 5J8OA 4RAHA 3TNMA 5LGHL 3VFWB 2DQCH 3G5ZB 4UV7H 3UO1L 5CZXC 2XWBB 3D3VB 4AEHH 1KN2H 4L3EA 5E08L 5FCSH 3MBED 4H1LH 5IQ7L 2FSEB 1QKZH 5I1EL 4QRQA 2C3WA 5LWYL 1Y18B 4PJCB 4RWYL 2F54D 4RRPA 1P9MC 4JY4B 4EKXA 1RK0B 2YEZA 4NC0B 1I1FB 4K23H 4K71B 4WFGE 4PRNB 4UOW1 4X6EA 4FFWC 4TVPH 4LVNB 5A1AA 1W72A 1U8NA 2EE6A 3QH3A 2XYCA 3WUWB 4J3OC 1Q9WB 4WHYH 1YY9D 3EDFA 1DDHA 4PJGF 2G2RA 3WMSA 3INUH 4ZSOE 3BUTA 4KUZL 3MBEC 1FNEA 3QNYB 1HHJA 2UZIL 1SBBA 2VLKA 5EO0B 3DROA 4XBPB 4WW2B 4AM0B 1EAJA 1PZUB 3KPSD 4HZAA 3LS5L 3VFVB 4X4YA 1OLZA 3D85B 3JTTB 3QG6B 4F33B 3MMEA 2VERN 4PJIB 1EBAA 1KG0B 3CX2A 4QTHB 4IIQA 1X4XA 1VFMA 5BMFH 4G8EA 5B38A 1FGNH 5F7LB 3WIHA 3U0WL 1A7NH 1JN6B 4A6YA 2AJ3A 5I1AA 1WBXA 2Z4QB 2A74B 2GK0B 1J0YA 1RUMH 1LNUA 1CFTB 1PVHA 3BDYH 4JO4L 4MJ2A 4GRMB 3DVGB 4P9HL 3STZA 1A3RL 3S96B 4RDQF 1N4XH 5DJZB 3ET9F 1JUFB 4O2FA 1D5MA 4UOW0 5CFHA 3SY0A 4GRLB 3MOQA 3B43A 4RDQG 2ADJA 1SYVA 4HMCA 1XF2B 5F96L 3NTCL 4MSWB 3VXQB 4O51B 4KHTL 4ZNEE 5I30H 3U9PH 4ZNCD 2XG5A 4JB9H 5D2LB 2DBLL 3QDMD 4CNIA 1IM9A 4OGYH 1G9MC 1S9KC 2FX8L 4EI5D 4F37K 5DC9B 1ITCA 2C7UB 3S35X 4LDLB 4WGVB 1CDYA 2OXGA 1H3UA 2VZOA 2VOTA 3CFKB 2EDOA 5HDOA 4HC1L 3DGGA 5LJYH 5EIIA 2VL5B 3I2CL 3NIDF 3HS0A 4G9FD 1L6ZA 4U1IA 3L3IA 4KTEL 2G5BB 1LEIA 3KAAA 3HI1B 5IV2B 2DL2A 5FF6A 4YE4L 5CMAB 3BPNB 3O2WL 1M71A 4UQ3A 5FHAL 2OYPA 3UTZB 2VABB 4FZEH 3HFML 4Q0XH 5ITFB 1LE9B 2WW8A 5FYLE 2CDEA 2F53A 3RX7A 2XY2A 1RIUH 4Y5VB 1CT8B 3REVA 3FONB 2EZ0D 3Q5OA 1DBJL 4FXGB 4PRIA 4X5WB 4OKVB 1NC2B 4EI5C 3GHBL 2DQTH 4OI9A 5BW7C 4Y2OA 1QSFB 4EI6B 4PGJA 4HXBH 3RGVB 2VR4A 2H2SC 3BPOC 1FIGH 4WEUD 5SX4H 1AXSA 1YMMA 2CDGB 4M93B 2R56L 1IM3A 1U8IB 3C6SA 1I8MA 3CU1A 1UJ3C 2ADFL 1U3YA 2X4UB 5KSBA 4ZQKA 5D8JH 3V0VB 3MOAH 2YN5A 4Z78B 1IFHL 1TPXC 3OKEB 1NUGA 3BP6B 4MD5A 4P4KA 3FOMB 5ID0A 1JZ8A 1K4CB 5ISZD 5IHZB 1NMCC 4L5FH 3WKNA 1NBVH 3BT2L 4OCYH 3VFRA 2FWOB 3TJEL 1K4DB 3TO2A 1I3GH 4JFFB 5IGXL 1BZ7A 3UTTB 3OAUL 5HY9A 1K3IA 1QRND 2E3VA 4PJ8D 3I9GL 5IW1B 5EFIB 1BREA 3RDTA 5FCUL 1L7TL 4H5SB 3PWUB 1AKJA 2QQKH 1J0IA 2CJUH 3BUYA 2LV4A 4W70A 2D0GA 2OSLB 3B3IA 5AG8A 1MHCB 3GK8L 4EDXA 5KS9F 4GQ9L 2BXZA 4TSCL 2R0KH 2BNUB 4L8CB 1F90H 1LP9B 2D0FA 2I9LA 4YHYB 4G43B 3C2AH 4P3DA 3BWAA 2DTSA 4LSVL 2P4AB 3BQUB 3GMQA 4KHXL 3FQXA 4WUUB 3QDJB 1U95A 4PJ8C 5IJKA 1QLRB 4N9OB 3QDGA 4WDIA 4P57B 5C08B 4R2GB 1NGZB 4JJ5B 1YN7B 1QHOA 1Y6NR 2EDWA 4OLZL 2DN7A 3MRIA 3U46A 1ZA6B 5IMMA 3QZWG 3KLSA 3WLWD 5CBEB 3CVHB 4I3GA 4OD2A 4FXKB 3FQRA 1FVCA 3BE1H 1A6VL 3IYLW 1D5BA 1CXLA 1C16B 1XR9A 4KJYA 1HILB 2ED9A 3BISA 1YC8A 1NEUA 1Q38A 5C6TH 3TESA 1A6AB 1U8JB 3Q1SH 1YEHL 1KJ2H 3DUSB 3UYRL 2DMKA 2DQJL 3SGEH 4Y5XA 1JHKL 3RU8L 1RIVH 2MFNA 5MEPA 3SKJL 1ZGLM 2DI9A 4HUNB 3UDWC 3DBXB 4HIHA 1U93A 3QQ3B 3S34L 5DZNA 5IG7B 3SDCA 3TV3H 3UTQA 1G1YA 1FNGA 3JV6A 1LE5A 1EJOL 3NA9L 3KPNB 5HGHA 3CXDH 3ARGA 1CFQB 2O5ZL 5KSAA 2FO1A 1KB5H 1YNKL 4RMUA 2R2EA 4DGVL 3BKJL 1XGPA 2CLVB 2ENSA 4Q9BA 1MI5D 4JO2H 4RGMB 1IT9H 5MHSE 1SJVA 3HI5H 2JELH 1U8KB 3HNSL 5GGUA 1MHHB 2P5WD 4N1CA 3IETA 1F13A 1I75A 1PYWB 2A6KB 1PQZA 4U1JA 4CVXA 1D5IH 5F8QC 3CSGA 4HDIB 5CIPA 1BF8A 5F72S 3NOIA 5JHDB 1L4IA 4JZJC 3NCBB 1KTLA 1I9RL 3CZFB 2XICA 1OY3B 4XNYL 2HRLA 3U7YH 4RA3A 1CR9H 5DVOA 3Q3GA 3IFOB 1LO2H 3F65A 1LDSA 5JW5A 4NUGH 5DUBA 2R1WA 4OB5H 4KU1A 2ARJB 4KZDH 3KLDA 4EJ1C 1I1CA 1II4E 1UWEL 3WD5L 3QIWB 1BOGA 4JQXC 4QRRE 1R0AL 1A6TB 4N8VA 4BZ1L 4KVCH 3LKNA 3R1GH 1AE6H 1S7QB 3UMTA 3JTSA 4R8WL 4G5ZH 1BVLA 3CFCL 1ONQB 2IF7A 1VA9A 4HCRL 4WFED 4MZ3A 3EFFA 1F00I 3OHXB 3QHTC 5FDYA 4TRPH 1KSRA 3QFJD 3TBSA 5HI3D 1J1PH 2HJLA 1A6UL 1M7XA 2GTZA 3G6JE 1T2QL 1U9KA 4HWUA 5CJBA 3ZTNH 1SY6H 3VFNA 5JPMB 1AGEB 3LDBC 3QFJE 1EA9C 4DW2H 5D1QD 4J4PA 4ZPTB 3V52L 4XNUL 1T03L 5IF0A 3ILQD 4Z77B 2N56A 3D25B 2JB5H 1OAUL 4NQDA 1QO3A 3GB7B 1BFVL 4U6HA 4X7FC 1IRAY 2LFGA 1TTUA 1T20A 4QWWD 3C5ZA 4ZO8A 1E4WH 3C8KB 3MV9D 1IGIL 2DQFA 3HPLB 2BNRE 4WO4D 1FO0B 4KKLD 3HA0A 4RMQA 4CJ0A 5F1OB 4LSUL 2IH1B 1ZMYA 4YBLB 1Y6KR 1J0KA 2VB5A 1TQBB 1SM3L 4NUJB 5IJVB 4XVUD 5SWZE 3CLFL 4NQED 1D7FA 3ARFA 1IAIH 5E8EA 3RAJH 3VFUA 4AQOA 1T1XA 3X14B 3GGWA 4FZ8L 3BSZH 5TE6L 4NKMA 4UTBL 5EZOH 2B4CH 2EC9T 4YDJA 4U31A 1M05A 3E6FB 4EDWL 1T7XA 3D39B 4NQEE 3BRGC 1KCSH 2LQRA 4QWWC 3UZEA 3FB7A 4OAWB 4WO4C 4EN3A 5E8NA 3RKDC 3U1SH 4KKLC 3TVMA 1P5UA 3OX8A 5F21B 4OIIH 5ALBH 4IHOB 3NCYS 1Q9LB 1WAAE 3MGTB 5HHMA 2DOCA 5EZIL 1U8HB 4CVUA 5GXBB 4OBSA 5DEFB 3DHJA 1S9VB 2E5EA 3ALPA 4CMHC 3QUZD 3CFEA 1DQQA 3T3PE 1R3IH 2Y23A 1TVBB 4P2QE 1UB6B 3V4VL 5ID1B 4OIAA 4DN3H 3U30C 3WHE1 4KMTH 5I1HL 1MF2H 3V4PL 1J88A 1WICA 4KTYA 3TN0C 2R4RH 1S7TB 5C0GA 4WU5A 4K3HA 4XP5H 2V17H 3MBXH 4FQLL 4LCWB 1BWMA 3QIUD 1NC4A 1IL1A 3VXSD 1K8IA 2QQQA 3BN9D 5GJTL 4PUBL 4P59L 5JDSB 5D7IA 5T3XE 4X5XB 1A47A 4KWUA 3KYMA 3JUYA 2CRIA 3QHFL 1G0DA 3VFSA 4PYHA 3VXSE 1ZOXA 2C3XA 1BQLH 3QEQD 1NLBL 1U92A 2K1MA 5TF1H 1QP1A 3SE8L 1K8DA 5C0EA 1KENL 2DQHL 1BLNB 2IADA 4OT1H 2W0LA 5BRZD 1J8HE 3U0PA 4LGSB 3PP3K 3QEQE 3RI5F 3HRPA 1TQCB 1P2CB 3QIUC 3IDGA 3VDCA 1EAPA 4YHIB 4YBHA 3L5WA 2J3SA 5DUPL 1BQSA 3LQMA 4LHUA 4XCCH 3WIFB 1YEDA 3WHE0 4N8CL 1YMHB 2BNQB 3FO9B 5GGRA 3LPGA 3PHQA 4HJGB 4MA3A 1KLFA 3QBTB 2YD9A 1PG7W 3CSYA 5HHVL 3IJSB 4MMZC 4E41D 3MV8B 4MB3A 1EERB 2HA1A 4ZUWA 5HDQL 1F02I 4YDKL 4J3VA 5D96B 3QWRA 5JIKA 1BHGA 3GMPA 1P9MA 3F8UB 4NQCD 3D0LA 3O6ML 1MCOL 1WZ1L 4TOYL 4HIXH 4PGDB 2DKMA 1DEEA 1QQDB 1RULL 3EFDH 4MS8D 4Y7MA 3IJHB 2DKSA 4GG8A 4KK6D 1E6JH 1EVUA 4Y19D 4M5YL 2F58H 3ZTJH 1GHFL 1T7WA 3CDGA 3MBEA 5FUOL 4PLKD 3U4EB 2IH3A 2MCPL 1G7IB 1XGRA 4OCXH 3T2PA 4O9HL 4O00A 3OR7A 5FYKH 4FN0A 4ZFFB 1T22B 2UUDH 2XWJB 1JI2A 3KPRD 3L3OA 5DEGB 4HS8H 3RWDA 4ZSOA 1ZE3C 3MFFB 1DUZA 3LIZL 4Z5RA 5GZND 2QSQA 1T0MA 4MQSB 4ZS6D 3TGXA 2GK2A 4YX2H 3EDJA 3F5WA 3S88L 3LRSB 4KK6C 1P53A 5D4QA 3BKMH 5IVZA 5KG9B 1F4AA 3VJ6A 2YPLB 1XF5A 2YUZA 4IM8A 4CAGA 1JPGA 2VDRL 5C09D 3VD7A 2CPCA 4F7PB 1QR1B 2OX5A 2R0ZL 4K7FB 4JLRB 4YPJA 3EOTL 4M1DL 3U4AA 5C0RL 4GW1A 3NH7L 4WW1B 5SV3A 1DBAH 3DPBA 5GZNC 3VH8G 3O9WC 5DZOA 3N1GC 5TE7H 3EKCA 3QJHA 3B5GA 2RHEA 3F58H 3RVWD 3FCTA 3VG0L 3L3GB 1A1OB 1U8OB 2I60H 2RFXA 3OJMB 4WI9A 4PY8J 5JW4N 2ZCLH 5I1CH 3EDDA 1JRHL 5JXED 5E6ID 2OM5A 2BRQA 3HR6A 1KCUL 4I18B 1CQYA 1CICB 4KFZC 3N1QC 2BVUA 4HEPG 1A5FH 1FC2D 4I5BB 4LQFH 4QHNA 4ZNEA 1CD1A 2ZOLA 1M6OB 3AB0C 4XVJL 5DVKA 3SO5A 1UB5A 1F11B 1DFBL 3KG5A 1XF4B 1QNZH 3ZLQC 1RY7B 4H88L 4OGZA 3AS3A 4XTRD 4K2UL 3R06B 1RUQH 4U6VL 2QADD 1AIFA 4I3SH 1OF2A 3HTLX 4F9LC 2Q6WB 4EI5A 4P48A 5BW7A 2QR0B 2IMMA 3QT2A 3MV7D 4P23C 4RX4A 1LQVA 1ZVSB 2D4DA 4BKLB 5JXEC 4GW5B 1VADA 4KH2A 3CMOL 5D2NC 3VWKB 3SKUD 4L1HA 1UQSA 3MRKA 4OF0A 4ZFGL 3DXAB 1TCRB 2AKRB 4WY7H 3OJ2C 4K7PY 2VH5L 3KLAB 5KVGL 3HMXH 1UJ3A 4M7LL 3V5HB 3OAYH 1PW3A 5DJ6B 2XNAA 5M7QA 2IBBA 1RZJH 4YXKL 3DV4B 3FTGB 4UV4H 3T0XA 4OZHA 4XTRC 1I85C 3NFSL 4HGMA 4L4VD 1F6AA 3MYJB 3O4OB 4I48B 5EB9A 4HHAA 4U1LA 1E6OH 4EUPA 2YHGA 4BUHA 2A2QT 3HMWL 2D7QA 1W72L 5C7XL 5I8KH 1I3RB 2PO6D 4GRWE 4G42A 4MD0A 5DRWA 4HZLB 2J6EA 1J0ZA 1OARL 1IARB 1PKOA 4YR6A 5C0DA 1AGBB 5ACLA 4KUCF 1RJYA 4NRZB 4PV9A 5LBSH 4KKNA 1ZKAA 1DQDL 1OLLA 5D7KD 2L0DA 2HRPH 4GKSA 2O93L 1WBYB 3MRMA 4X7EC 1XH3A 5CS7A 3RIAK 5D1XB 2FIKB 1NGQH 3RVVC 3S35L 3G5XB 5EOCJ 4JAMB 4V3EB 2VL4A 2P7TA 3ILPB 3CGTA 3KR3L 4UAOC 4NFBA 5DD0H 1J05B 4WU7B 3C09C 4GW4B 4A6YL 5L9DL 3GM0A 1U58A 4U1GC 2PXYC 2WM0A 1J1OH 4PRHB 1VCAA 2AK4D 4JANA 4MA8L 4X6FA 4YXHH 1QRNA 4PJ8A 3ULVD 2BP3A 2AGJL 3WDJA 5BS0B 5JPNB 2VXUH 5HGBB 2QSVA 1RV6X 3IXTB 4NQVB 5IMKA 1OGAB 4PRAB 4NM8L 2R2BA 1YEEL 1CK0H 2EDTA 4MHHG 4NRYA 3QXTA 3VXNB 4C56E 4QF1B 4XC3H 2NLJA 4GAJH 3WNKA 4NNXB 1MCNA 3HE6C 3QA3B 3WFBH 4TUKH 2R9HD 3RP1A 5IQ9A 4FP8L 2IQ9H 4ONGL 3TBYB 2C3VA 5BV7C 5F7FA 1UM5L 4M6MH 1QBML 1JNNL 2FBJL 1AD0A 1NCDL 4JFZL 3MLRL 3MLXL 3C8DA 4NKOB 2E9WA 3UDWA 5AAWA 3VXRD 2KDGA 1J7VR 3K1KC 2Y06H 3MLYL 1JHTB 3P0VL 4K8RL 2ZUYA 4YPGA 2I07A 1X3DA 4YHNB 1I1YB 3KPQB 1F3DJ 3PGFL 1MAKA 2BVQB 3LD8B 2DS4A 1MJ8H 4YBQC 3NN8B 5TQ0H 3PABA 2FECI 1S8DB 3L3KB 3WXVH 1IQWH 5JO5A 1MRFH 3DMMB 4PJ5D 4FQQB 4OM1H 4UIMA 4MXWH 5AZEH 1VEPA 5IBTL 5CGYD 5JLZA 5DQ9B 2F19L 1JNHB 4J3UA 1OTSD 1AQKH 1TIUA 5GGVL 4N9GB 2QBWA 4MJ6B 3ZYJA 3KNBB 5KVMC 3LZFH 5J6GB 2O5XL 1KB9J 3HUJB 4YEEA 1GOGA 5L6YH 1W0WB 4JZJA 5I1JH 5IVNA 1IGFH 4XAKE 4JQIH 2GTWA 3H3KA 3EYOB 1GC1C 2GFBA 4HK3N 2Y07L 2YD2A 4OUUB 4Z76A 1ZT1B 4PREB 5IMLA 3C9NB 3PL6C 4OLVH 4S1QH 2UVEA 1NANI 2ZUTA 5F44A 3SDXF 4XPAH 2NCMA 2OJZH 2ARJQ 3IDXH 2HJFB 1JJUA 4U1KA 5D9SA 2BSSB 4HWBL 1FN4A 1TJIL 2FZ3B 4UDUA 3V6FA 5C0CE 3LCYA 4JQXA 3AU1A 1SYSB 5IEHB 1CVRA 3WIIH 1KN4L 5EOTA 4NN5C 4HGWB 1VGKB 1YJDC 5EUOE 2VWEE 2GQHA 1CGXA 3QXDB 4LCYA 3ULUH 1LK3H 2A83B 2QJDA 1CFNB 3H7LA 4NDMB 4HIIB 4ODXA 3O8XB 1ZSDB 1JGVL 3PP4H 4UDTA 3I50H 5I74C 2GY7B 1AJ7H 2PYEB 4P0DA 4TULH 3I02B 4QRRA 5C71A 1GGBL 2VWEC 2JCCF 1UXSB 4WJ5A 2NW3A 4ONHB 4HUXB 4P5KB 3RWGA 1TFHA 4EQ3A 2RCSL 2OP4L 3TBWB 3D18A 1RZKC 3QISA 43C9B 4MWFA 2P5EB 2HMIC 1I8IB 1BM3L 1OGTB 1NL0L 4XHJC 4XGZB 5ICZB 3D6GA 2Q20A 2YPKB 3CSBA 4LEXL 3QRGL 4RFNC 5CJOL 4JRYB 5I8EB 5SWSD 1S9XA 3GSQB 5AEAA 1QRKA 4ZFOA 3RL1B 3O3UN 4HS3B 4H8WL 1T0PB 5A3ID 5IIEB 1A64A 3QFJA 2BSTB 2CIKA 4OCLC 4PP2A 3O4LD 5DURD 3DUUB 1T66D 4OZ4B 2PKDA 2C26A 1MRDL 4S0SD 1CDCA 4KTDL 4HFUH 1I7RB 4PJ7F 1PSKL 1VENA 1PGRB 3F7YA 4HPYH 4PRPB 3D3VD 4YHLL 3WYRA 5EBLA 4D9RE 1CFSB 4PY8I 1JF1B 2BHZA 5TPWL 1HHIA 1EHXA 4XBEL 5GSVA 1JHLH 4BUGA 2YD3A 3QUYB 3H2WA 5EBWB 4WO4A 4J12A 5BJTB 3MRJA 1MY5A 4XP1L 3LS4L 1TVDA 4PJGE 4FG6D 4F7EA 3EO1A 3TWCL 3BP7A 5DLML 1N59A 3THML 1U91B 5GS0H 5TJWK 4OSUH 5LXGH 2VLJE 4BK4A 3PDDA 4NQEA 2BOBA 2WWMD 2Z91A 2FO4A 3SOBL 1JFQL 1EVTC 7FABL 5HI5D 1CGTA 3SN6N 3T0EB 1YA5A 3MNWA 5F9JA 2NXYB 2ZSWB 4P9ML 4K3EH 3TFKD 5CEZE 1WAAA 5KTEL 3TN0A 3U9UA 4LBEB 4BFGA 3ZE2F 1MFAL 5I1GH 4RMRA 5GRJH 5T1DL 4BK5A 4XWOD 5FIEA 3FRUA 4P2QA 1REIA 5CEXA 1GIGH 3C2SA 4O58H 4Y4KC 1KIRA 4QRPB 2X09A 3GI9L 2Q8BL 4MNHB 1JPST 3BO8B 2DLEA 4DVRL 4KQ4L 5HI5C 1GCFA 5IMOA 3NZHL 3TFKC 3GSNA 4Z7OE 2DQEL 4KI5F 4HV8B 5ADOL 3BAEL 4Z7VA 4NP4H 5CSZA 2X9WA 1EHAA 3MTRA 1LEKA 1IEBA 3RVUC 4MJIB 1G9MH 3RFZC 3QIUA 4U1SA 5HJ3B 3KYOA 4GRLD 3RZCC 4XWOC 4YGAB 1BX2A 1MFBH 5DJXB 3VXSA 1LO5B 3BKYH 2K9UA 3CX5J 4CADA 5T1LB 3NIDE 2BK8A 3MUY1 4I0PC 1J8HA 5HVGB 5H37G 2FEEL 3QEQA 3GSWB 3MLVL 2HAZA 3FHAA 1EFXB 4F3FA 3MJ9A 1ETZA 3LEVL 5E2UH 3QI9D 1I8KA 5H94B 2IGFH 4Q97A 3X17A 4BH7A 5HPMB 5T3ZL 2CLZB 3U48A 1HSBB 4MB4A 5F3BA 4MQTB 4ZPVB 4CN6A 4FQ2H 4RAVB 3GBNH 2MPAL 3OZ9H 4N0YH 4HKXB 4XPBH 1ND0A 4P2RB 3LHPL 4Q2ZB 2VKXA 2NY6B 2R0WL 1DN0B 5J0BA 4KY1L 2YK1H 1QSFD 4MJ5B 3V0WL 4HIEA 5IHBA 3RGVD 1FYTE 3WV0A 1HZHH 3QEHB 3QI9C 4FMKA 2EDKA 1XZ0A 1LWRA 4NGHH 1G6RA 4XP4H 4P2OD 3CVHH 3DX6B 5FA4A 5KANG 3LEYL 3M17B 1OOAA 2OMNA 3R4DA 1IAKB 2GUOB 2BY2A 3P9WB 5SWQA 4PGBA 1M7DB 2A1WH 2X1QA 4YQXH 4GUPA 1E4XI 1AO7B 3DJ9A 3HCVA 1MCIA 4MCZB 2E6QA 1MIMH 3D0VA 3RWEB 4OLWL 4EVNB 5I8OL 1MLCA 4Y19A 1INDL 4AG4L 1HSAA 3WFHA 4CDGC 5JNYA 2OQJA 5I19L 1L0QA 3QCVL 4KRLB 3GJFA 2ENYA 5B8CB 1NPUA 2Y4SA 3DARA 3OKKB 5GRUL 4JFFD 3UC0H 2GJJA 2G60H 4HQQH 3UTTD 2BHYA 5KS9E 3WNNA 4AEIH 4JG1L 1UXWA 4P2OC 4Z7QF 4K3DH 1IBGH 3DWTA 1SEQL 3KDMB 3HG1B 1IGMH 3GO1L 3KPRA 4PFEA 3I6GB 5EOQL 3L3DB 3WSQL 3U36B 5J11C 1ZXQA 4KJWC 1IAOA 1RZ8B 3O9WA 5TQ2L 4ESKA 3KYNA 4OTXH 3VXUE 3BESR 4L8DB 3B83A 3UJTL 2WLZA 3ARTA 3QULA 5K59E 4G6AC 4YFDB 4S1RH 4AH2A 4E5XA 4FA8A 1EK3A 5F7UA 2RB8A 4OV5A 1X5KA 4J1UB 1M7IA 4G6FB 4R90L 4W6XB 5HDBE 5KJRL 3BQUD 3VXTA 4WUUD 3ZKQD 3QDJD 4UT6L 5DJCA 1Q72L 5EWIH 2Z8WC 2H9GA 5DD1L 4DFHA 4M5ZL 5C08D 2ICCA 4R2GD 5DVMA 3A67H 3O45A 3JUZA 3DYMA 2FD6L 1UM4H 3O3BA 1J5OH 1P4LB 4DZBA 3CLEL 5HHPB 4LARH 4WV1B 3C6LB 4AIOA 4X7TB 4H26B 4F9LA 4LLVB 5CJ8A 2D7TH 2EDXA 2PNDA 5D6DC 1NCWH 4HBCH 4UIKH 3E0GA 4P23A 2VNCA 4RRPG 4X6BA 5JXEA 5LCVL 3GIZL 2VDPH 1UJTA 1WCQA 4ZUTB 3GRWL 5DT1H 3WS3B 5D1ZB 4PJXB 3O3DB 4FABH 4RA0C 3MRLB 1BEYL 5BQ7A 3TA3B 4JRWA 1F6LL 3MLSL 1S7RA 4ALAH 1J18A 1I85A 1PY9A 1ED3B 2DYPB 3PWPE 5H8DA 4O4YL 3MRBB 5F7WC 4E42A 1FFOA 1KCRH 4QTIH 4L8BA 5DGQA 2A6IB 4I2XE 5CEYB 5TDOA 4Q74A 3C5JA 1NSNH 3OXSA 1OAXH 3SGJC 2H32A 5JA8B 3RTQB 4EBQH 3MUGA 4K3JH 4F7MA 2XTLA 1J9CT 2WUBL 3X3GL 4Z0XA 5EG6C 3W9DA 5JHDD 4KPHH 2DIAA 1T6VN 2XFXA 4Q9QL 4O2CB 1MWAB 3SJVE 4LGRB 4PGEB 4HS6B 5GISL 3IDNA 5FYJE 5AYUH 5DQJA 3ZKXB 1CE6A 3IFLH 3T4AA 4OZIB 1W8NA 3ARBB 1FZKB 3QO1B 2PXYA 3D9AH 4GAGH 2ZPKL 5INCB 5JDJA 2N7BA 1D5XA 2O61A 2ARWA 3FQTB 3BVNA 4YFEA 3AMLA 3QEUB 3GMOB 1HH9B 5F93C 3QIWD 3EJJX 3HR5B 1WTGT 4FQCH 4L9LB 4FQHB 2Q8AL 5I16A 3REWB 4K07A 1KELH 3N9GH 3UTSE 2CH8A 3HRZA 4EZMA 3DX8B 2VMFA 4JFYB 1F4XH 4OGXL 4HT1H 1YN6A 2Q7NA 3L5XH 4LLUA 1QFPA 1HINH 5C2UB 3HE6A 4DUXA 1JTOA 4PJ9D 4QHLB 5DDHA 4XAWL 5I17A 3L6FA 4YNYA 5SV4A 4Z0BL 3ETBF 3FB8A 5E5MA 4WWKB 4UV7L 4XCEA 3GJFK 3WFCH 1RJCA 3V79C 3DUHA 2EXWD 4C56A 5DK0B 2OL3A 4AEHL 4GKZA 5DA4A 1FBIL 1KN2L 5ESQB 3HN3A 3IDMA 3LSOB 5C8JB 3LVEA 1GAFH 2VE6A 1MLBA 5GGSY 1C1EH 1IEAA 5ENWA 2D7NA 1N5YH 3ZE1E 4MXVF 1DLHA 4PJ9C 3IVKA 2VQ1A 5B21A 1G6VK 4K23L 4QHKJ 2X4OB 15C8H 4GMSH 3K8KA 4Z7UE 3TH4T 2EDJA 3QFDB 4WIQA 4HKJA 4F7TB 4GXVL 1CL7I 4OF3A 3N1PC 4KJQC 1IAMA 5K93A 1IILE 1UA6H 2YD6A 2JLLA 3TYFB 3PGCB 4JKWA 3V8OA 1KIPA 2W91A 3RWCA 5BOPA 5E2TL 1YEJH 1ORSA 1F4HA 3QP3A 1E28A 3EAKA 3BYYA 3AGVA 2D31B 2VLLA 3VDBA 5J57B 4R9HA 5HYSB 2FLRT 4M43L 3PL6A 3GMNB 1MJUH 3BZEB 3FB5A 2HFGL 1RURL 2FGWH 1G9NC 4MNQB 1OB1B 3SKMA 4FNLL 1FGNL 2GW5A 2J6EL 3RNQA 1ACZA 5HGAA 5B22A 1A7NL 2A6JA 2CKBB 4TTDD 1FPTH 2BY3A 4QXWA 3VDAA 4HKBA 4GG6F 2VISA 1RUML 1TZIA 4J3XA 3BD3A 1UH4A 3DIFA 3NCCB 5EZJB 2JIXD 4Y0GA 4KGLA 4QCIA 4D3CH 4UNVA 1N4XL 1HQRB 4IMLA 4ZO6A 4EXKA 4LOUC 4XI5D 2VLMD 1JP5A 4PS4H 5BZWA 2IC2A 2VQUA 2QSCL 5EUOA 4MAYB 4X6CB 3RA7H 3U9PL 4JB9L 1L6XA 4TTDC 2YWYA 4PR5B 2VLME 4RMWA 3BGFB 4K7PX 4OGYL 4XXDA 3W5MA 5C9KA 4HAGA 2I9TB 4HSQA 2E9IA 3FT3B 4HXAH 3QQ4B 2WINA 2G75A 4U3XA 2WIMA 1FNSH 1CCZA 5C3TA 2FATH 5IFAL 4OFKA 1OAKH 3HAEA 3VD9A 1NBYB 2DM7A 4Q0XL 3T2QA 3EGSB 5E8OB 3GMRA 1D3CA 1RIUL 2C1PB 3MR9A 4ZUUA 4X9HA 1UCBH 1BD2B 2NY3C 2PTTB 4U6YA 3IKKA 3GSUB 2X70A 3SE4C 4CVZA 3PQYE 1NKOA 2C4XA 2DQTL 1RUPH 3MRQA 2X05A 4BYHA 2ZNXA 1A8JH 2BNQD 4MGXA 4HXBL 2VRAA 4Y1AE 5JW3H 1QUNA 2A38A 5IFJA 1FIGL 2GITA 3CXHJ 3FFCE 4I0CC 1EEUA 3RL2A 5SWSA 1AGFA 3FB6A 4LSRL 2HLAB 5EUKA 4CRPA 3MV8D 1CGSH 2ZG3A 4LLQB 1Y0LA 2YMXH 4OI8A 4OM0H 3DO7A 2DD8H 4IRJC 1JGDA 5L88H 2OTUB 3LKRB 2Z92B 3MO1B 3DURA 5F88B 4L5FL 1NBVL 3OKLB 1A6ZB 3CDYA 4G6JL 5MENE 5EU6B 3G5ZA 4ODSH 3C5SA 4YHML 2W1NA 3WO4B 2Q76A 4LLAA 1N0XH 3TNNA 1CXKA 1T7VA 1U3HC 1KT2A 3DECA 3PHOB 3RUGE 2K3TA 3L7FB 4PJGA 1X5XA 2CJUL 1Z0NA 1F3JA 1TETH 3S37X 3RPIA 1FGVH 5IB1B 1Z9OA 3P4OB 4PJCA 1X5AA 2VLJA 3IDJB 1DEDA 2NY4B 1X5ZA 2MTPA 1AR1D 2ZP0T 2R0KL 5C2BH 2ZUXA 4P9HC 3OJDA 4LCIL 4LSTL 4PJBB 2VDLL 1KIQB 1KPVB 5F6HI 1NEZG 4Y4KA 5HDLA 3C2AL 3WUWA 5DHXB 5EC2B 1NGXB 4YHPA 4PTTB 2YPLD 2P8PB 2R2HA 2VLRB 4LPYA 3FT2A 5EO0A <