1A9EA

Decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (mhc class i/peptide)
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B*3501 (ALPHA C
publication title Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to non-standard positioning of the C terminus.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1998-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a9eA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a9eA01
1KJ3L 5JTWA 2AV1B 1N59A 3QULB 2ICEA 1IGTA 1UWEH 4X7TB 1CGTA 2V6HA 1D5MB 4YGVB 1AGFB 3MRLB 3OB8A 3T4YB 5CWSB 4A2MA 4QYOB 4OZFG 1F6FB 1HIMH 3RU8H 2RAMA 4NUGH 1Q9KB 3QCVL 3KYNA 4U7KA 4ZAKA 2OZ4A 1NUDA 3FHAA 1NBVL 3O41B 4XPFL 4Y5YA 3GMPB 1MQKH 4TSBL 3SE9L 5IG7B 5EFIA 2HH0L 5IW3A 3LKNA 3KXFD 1QPXA 5EO1B 1KT2A 4D8PB 1ZEAH 4NKIH 3OPZL 3I85A 4YHZH 3VDCA 4D9LL 1L4IA 2AJXH 5EZLA 4NKMB 5A3ID 1EJOL 3SQOL 1S7UA 5EOTB 4ODWA 4PJXA 5ID0A 4LLMB 4HS8H 1KCGC 1P2CB 2F53E 5BVJA 4XXCC 1U3HB 4PRID 4RFNC 2CDFA 3BP6B 1SVZA 2J8UF 1JRHH 4K9EC 4NRZA 3V95A 2Q6WA 5I1EH 4JAMB 4HCRA 1IEBB 4XP5L 4AEFA 1KENL 4JGMA 4XP6L 4JRYE 3RZCD 2PO6A 3GI9L 2YMXL 1BD2B 3LQAH 3RUGF 3LKPA 1AE6L 3PDDA 2AXGB 3U4EB 2DS4A 4OLXH 3JV4B 1GAFL 4U1IB 1AY1H 2OXHA 1ZOXA 5D6CB 1MF2L 4L8SC 5CHNB 4UUJA 2R56L 1A64A 1D9KD 1VPOL 4GAYB 4U6HB 4DTGH 5IW1B 5FAAA 1KB5L 4QTIH 1ZWIB 3GFUA 5EU3A 4QNPF 4ZO7A 5I6XC 4OIIH 1BEYL 3QCUH 4GUPB 1U92B 4OD3H 5IESL 1FJ1A 4MA3A 3MLPA 1T66C 4JFZH 5HYQA 1AGCA 1S7TB 1EDQA 1PLGL 3TYGH 3HB3D 3DPBA 5ETUB 4JFPB 3IT8D 1XGQA 2DJUA 2DLFH 1X5YA 3M1BB 4QXUH 4AENA 2RB8A 5M94B 3RX5A 2D9QB 3V4PH 4MSWA 3CDYA 1WBXB 1QRKA 5HHOB 3TA3B 1UM4L 1XF2B 5GGRY 3BT2H 3L3IA 4FZEH 3MRDA 2ATKA 3K8KA 4PRDB 3DXAD 3NPSC 5DO2D 3TJEL 3X13B 3B2UD 3S34H 5DUPL 5F6IC 2MKWA 4URTB 1H3UA 3HE7C 3WSQH 4YFEA 4ZQKB 4AEHL 5JDSA 3MRJB 4MJIB 4WUUA 2PXYB 5EO0B 1M1SA 5I1GH 3RVXD 2PKDA 2SEBA 1WJ3A 3MRBB 1KTLA 4I9WE 4KMLB 5DEGB 1OSPL 1CGYA 4Y5YC 3G5VA 3QR2A 4KI5E 2I25N 4RDQF 3FQXA 4MNHA 3HZYB 1FL5A 1L7IH 5C0IB 3S36H 4C58B 4EVNB 1MCQA 3L1OL 3UC0L 4NNYB 4LSVL 1DLHB 3SGKC 1DN0B 1KLFA 4Q0XH 3KPRA 3AXLA 3AM8A 1IAIL 4HG4J 2CUMA 5E00B 1S9XA 1RIUL 3K4DA 4HT1L 2DWEA 4X8XA 4RMUA 1DQQB 2R39A 3MV7D 5EWIL 2BY3A 6CGTA 5K9KB 3DYMA 1A6AB 2P5WB 2LQRA 2AJVH 2AEIT 1CFTA 3JWDC 3FO0L 2K1MA 4XNMA 4FQCL 3NA9L 5JW4R 4NQDE 5DMKA 1K8IB 5DRZB 3UPRB 1WUNT 3RQ3A 1IKFH 3HLAA 2YR3A 4U1LB 2O5ZL 3B4NA 1FBIL 1S5IH 5JNYB 4XPBL 3QDJA 5FECB 2IPTL 3CLFL 4QHNA 2DL2A 1IAIM 3FFCA 3ZYZA 2XN9D 2Q7YA 4XVSH 1DE4B 3G9AB 4NQTA 3QIBB 3RDTB 1MJ7H 2Y07L 4Y89A 1Z0MA 1JGDA 4JHWH 3VFRA 2DD8L 2FEEI 2HLFD 3BD3A 1GGBH 4DVBB 2HT4C 2FD6L 2VMFA 2NY7L 3Q3GA 4PD4J 2GSGA 1S9VB 4QOKE 4Y5VB 1T89C 4DK6A 4WI4A 2E7LC 3QRFM 3L5XH 2UY7A 3VFWB 2F58H 1SEQH 3C09C 4K3EH 4WGWB 2WWKT 4XH2B 4TN9A 4RMQA 5C0BD 1MCNA 1FYTE 1IFHH 3LSOA 1Q72H 4UU9B 1N0XH 3ZYIA 4RMWA 4M9OA 4K71C 2FZ3A 3EKCA 1MFCL 1FIGL 1YNKH 4NRYA 2YRLA 4CVUA 2AGJL 2C7UA 4LCWA 4U31A 3LKQB 4XC3L 5IOPB 2CR6A 3O81A 3CVHA 4F2MB 2V2TB 3DX9B 4I3GA 2IBZX 4MXQA 2I07A 4K7PH 3L95A 5KVEH 4YX2L 8FABA 4G5ZH 5GIRB 4JZJB 3DBXB 2E9BA 3HC3H 3O2DA 3ZKQD 5HJ3B 5L2KB 1L0QA 3MRCA 2VYRE 4HK0A 3EYUH 1EO5A 5IBUG 4HUWB 1Q38A 3QNXB 2R2EB 4K23H 1F11B 3I6GB 3D0LA 3DIFB 3FB8B 1QHPA 1SJHB 5IW6A 4NQCD 5IK3B 1CE6A 4APQA 1XGPA 3TO2B 1I9IH 5FHBH 5SWZA 4MQTB 2CO6B 1R3KB 4OM1L 1BOGA 4HLZH 2A6JA 4M1DH 3W9DB 4QEGA 3TN0D 2DLHA 4N8VA 3FT3A 4HWBA 1BOYA 1MHPH 4YHNA 4R7NA 4S1DC 3SKJH 3RL1B 4XPHL 1HQ4A 1F42A 4MNQD 1DSFH 2LVCA 5ITFA 4S10A 5JUEL 2OP4H 1KPRB 1ITCA 3X14B 2JB5L 1N64L 4JRXA 1MEXH 2CR3A 4JREC 3BSZL 4OCRL 4JVPA 1UFUA 4XNQB 4S2SA 1IAOB 3CD4A 3EUUA 4TPRL 1C12B 3S88L 1CFVH 4GW5B 5E6ZA 1L6XA 2EIZB 4HZLB 4L8DB 4DGIL 5GS1B 1SM3L 2H2PC 1CGSH 3OB0K 2DQEH 3VXUA 2ZSVB 1UB6A 3C5ZA 5DJZB 4HWEH 2XWJB 4I77L 1UWGL 2E6JA 3I9GH 4HHAB 1JPTH 2B39A 1OD7A 2YD3A 5FYJL 1Z5LA 4U3CA 1CL7H 3RA7H 1FZJB 2BSSA 4Z95H 3SKUD 1QFWI 3EHBD 4NIKB 2DLEA 4XGZB 1OGAA 3Q6GL 2JK5B 3QO1A 3L7EB 1RPQA 3TBSA 5A2JH 4MDIB 3RPKA 2HTLD 2ARJQ 4AT6A 3M07A 5DUBB 5LCVH 4K7PY 2H6PB 4LLDB 3K80A 5FYJU 3TCLB 2VLME 1TPXB 1INDL 5T3XE 1XF3A 5D2NA 3BP7B 1NFDE 3KYMA 1QBBA 43C9B 5I1JL 4WI8A 5DK3A 4UTAL 1A6PA 2X4PA 1MCRA 4HIXH 4HKJB 5KSBA 2JCCE 3SDYH 1G7JB 1JJUA 2VLLA 3EYVA 2HG5B 5JIHA 5D93B 3CMOH 5CINL 3DGGA 3OGCA 2DMKA 1FC2D 3PP3H 5KW9H 1HI6A 5D1XA 3CZFA 3TH4T 3GMOB 5FYLD 1MVUA 4CN6A 4G8GD 2DI7A 1UM5H 2CIIB 4H5SB 3CIQA 4GKSB 5DMGC 4YH6A 2X89D 2ZCLH 5IEHA 4ZO6A 3WJJA 4GS7C 2ADIA 4MGXA 3SDDC 1L7TL 1U58A 1UXSA 3VFGL 4L8BB 2PR4L 3GHEH 5CSBA 3KJ6L 5E1HB 3BRFA 1YY9C 3MRGB 2ESVD 2VDRH 2HN7A 2X41A 2XG4A 1H15A 2J6EH 1P4IL 2Y25A 4HKXA 3N85L 4BZ2H 4FZ8H 2C1OB 1L8JA 2UWEF 1JHKL 4APQC 4F7EB 4OQTL 5TDOB 3HZKB 1VFUA 4F15B 3IKCA 3O6LH 4HUXB 2FH6A 4QHKI 2IPUK 1CFSA 4YHLH 4F58H 5DJ8B 1OGTB 4O58H 4OCYL 2QQKL 4NZRH 5KANI 1M71A 1S9KC 3MV9B 2ORBL 4PJXE 2DBJA 4I0PB 1RHHA 1QSEB 2WZPD 4DQOH 4IRSD 4PV9A 8CGTA 4O2EB 3DOSA 1QNZH 3EJYD 3PP3K 2BY2A 2FB4H 2VQTA 4Y16D 1ZLVH 5I9QC 1NDMA 5JA8B 3RZCA 5HHPA 4PP8C 3N9GH 5F1NB 3U0WH 5HDQL 2IJ0C 1I1RA 5IVXB 4LQFL 5ESAA 1Q9LA 3IB4A 1LE9A 4BFBD 1OCWH 3DMMB 1AJ7L 3IDGB 2FHFA 5FDWA 2B1HL 3TBWA 5E9DA 5F3HA 1KJVA 3MRPA 4UDTB 3HR6A 4V1DA 4LU5H 4KJQD 2VLRD 5JMOC 3HZMB 1FH5L 4RMTA 3ROOB 1VB9A 2VISA 4X6CA 1ZS8A 1F90H 3ARTA 5D7IF 3HNVH 4JFOA 4GMSL 1N2RB 1GGIH 1BFOB 1FL6A 5D7JD 1PZ5B 4F8TA 2OYPA 4TTDC 5K9JL 3I3EA 2E7LE 4FQLH 1VSCA 3MGOB 2BHZA 3BRGC 3D85D 5GGSY 3VG9C 4YPGB 3NOIA 4RSVA 1H3PH 43CAB 4Y19A 3VXPA 1HINH 3LEVL 4LLWA 3BIAX 3F58L 1S7SA 1RHFA 3DX6A 1T5XA 1ONQB 3HCVA 1JZ7A 5ESQB 3STLA 4JQIH 2ZJSL 1UA6L 1D6VH 3MLYL 4ZS6D 2IFFH 2CSPA 5D1XC 1B4JH 3PHQA 3LB6D 5DHXB 4KQ3H 1KELL 5E70A 4JFHE 5A1AA 1JF6A 2NXYD 4WUUE 4ONFH 4NC1C 3WHXB 3WJJC 2IANB 5IMMB 1M05A 4ZUWB 1EUUA 2YSSB 4UINL 3BZDA 3DECA 3TZVA 4WTXA 1WWWX 2WINA 4I3SL 3TH3T 1A0QL 4YZFF 4M8QA 4HWUA 1DVFD 1J0JA 2X1XR 4KJPD 3ARBA 1D7FA 3QQ3B 3KPTA 4MJ5A 3GMQA 4FXKB 5JW4M 1P1ZA 5IHBA 4POUB 5I8EB 3VI3F 2VITA 3CXDH 2R0ZH 1TCMA 3W0WB 2F53B 5A3IC 2R2BA 5IMLA 1Q0YH 1J8HE 5DMJB 4P59L 3T4AA 1TJGL 4MX7A 1YQVH 5D1ZD 3VFNA 1NSNH 1Q1JL 4XAKD 2J4WH 5IHZB 2IC2A 3CLEH 3WMSA 5LJYH 3S5LA 4JPKL 2FJHB 4EI5A 4PJIB 3RGVD 4JRYB 2DQGH 5ID1B 3QIWB 2GSIB 5I16A 4PJ5D 4P9HH 3RZCC 4P3WA 4L3CB 4XVTL 1AD0B 1CE1H 2OTPA 1ETZA 1G6RH 4OUUA 2VJXA 3KAAA 4ORGA 2FSEA 4H1LB 4KRNA 5LAXB 4OD1L 4OZHE 4Z0XA 5BW7A 4O2FB 1A1OB 5CJXC 4HJGA 5EPMB 1J1XH 3QDJE 1D9KC 2P47B 4OZ4A 4ZXBD 4XNYL 4Y0GA 1YEIL 2ID5A 3QG7H 4M5YL 2X9YA 4OZGF 4MD5A 1G7IA 1QKZH 4XRCB 1GXEA 4NKDB 32C2B 3BIKB 2APWA 3HB3C 4EUPA 3FQTA 1DQLH 4X8JB 5CBAA 3GB7A 4U33A 2UZIH 2FBJL 4AL8L 3DRQB 3ET9F 4PDCE 4RNRA 3MV8D 3MNWB 1JGEB 5CIPH 1ORSA 5E2WL 3ARDB 4IOSD 1U93A 5LXGL 3IFLL 3NIFF 3GJFA 4K8RH 5IROA 5AG8A 2GFBB 2WWKO 3WLWC 2VLKD 3ZDYE 4LSDA 2NX5A 5DO2C 3VMOA 2XI9A 4LCWE 5E5RB 3RL2A 3B2UC 5JPNA 1NCNA 5MI0B 4OLYL 1U3YA 1NCCL 4W6WB 3C2SA 3OG4B 1U8LA 4BJLA 3PWPD 1LD9B 3DHJA 5EU6B 5FGCB 2BK8A 4BQ6A 5CD5D 5L8LB 4HS6A 3RVXC 2DTMH 4NHUB 2NW2B 4R7DB 2E7BA 1CZ8H 5FCUL 4X5XA 3WD5L 3O45B 3BKYL 3FOLA 3SO3B 3EJZC 5C6WH 4R3SA 3MO1B 4EI6B 3QJHA 5JOFB 5FA4B 2QQLL 4LAQH 1L9NA 1RZKC 3HI6H 4NSKB 1GVIA 4OM0L 4G43B 4Z7VF 5H2BA 4XB8A 3TVMB 4Z7OE 4HPOH 3GUTB 1GIGL 2VC2H 5SWZE 2C1PB 1NGZB 4P57B 5F7EH 2I27N 1EAPB 4Y7MA 1LVEA 4NQUA 2FJFA 1ZXQA 4AQOA 4HBCH 4NO2B 1ZGLB 3BPCB 4P3CH 1V7ML 3OXRA 3S8WA 4NJ9H 2I9TB 3NFSL 3QIUA 3IRPX 2D7TH 4D2NA 1IKNC 4MXVE 3P30L 4ZUVA 2X1QA 2H8PA 3VJ6B 1YEEL 1W0VA 1WK0A 1WZLA 1XGRB 4PRHD 3M17B 1U8OB 1D3CA 2VLJA 4HC1L 2CIKA 3RNQB 5MEOB 1OLLA 3VXUE 3GMNA 1L9MA 4P46D 5JIPA 5ACLA 2F5AL 5J13B 4WFHE 1QHOA 2GTWB 2DQTH 1YMMD 5HGBB 2Q8BH 3MACL 4J8RA 3SJVD 5EB9A 3IVKB 5F7DB 3KJ4B 5DLMH 3VXRD 1FNEB 4I13B 2DM4A 3SCMB 1FN4B 5EA0H 3FQRA 4RAUB 4FQQA 3JZ7A 3ZHDA 3GSWB 1KC5H 2Q3AA 1G7MB 4XBPA 5I30L 1YYLL 4JHBA 4D9RD 1CGVA 3IJYB 1GGTA 2AI0L 4M6ML 1XGUA 4CMMA 1RZJC 5C3LD 4N0CD 5D2NE 3SDXA 3P9LA 1JTTA 4HIEA 4P2YA 1A02N 2VQUA 4BH8A 4ZS7H 5TDNB 4GRWF 2HJKB 3GMLB 3P77A 5KSBE 2DYPB 4Z5RA 1INEH 4NO0D 1VGEL 3OQ3B 1DUYB 4U6TA 1RUKL 2H32H 2NY5L 3T8XB 1E4WH 2BNQD 3U7AA 3ZTJG 1GZPA 1PW3A 1C5DB 3SDCA 3CFCL 2WLZA 3WFCL 3NZ8A 5GS0L 3WEXA 4ODTH 4JY6B 4DVRH 1FPTH 4KJYB 2AS5M 1U3JA 2X09A 5FUCC 3VFUA 5F1SA 1PAMA 2UYLB 5HD8D 3CFDA 5BZWA 4LEXH 1I8MA 4RAVA 4J2XA 2DKMA 4K07A 1WCBA 3DUHA 2V7HB 4UIKH 1KLUB 2RCSL 1QFWH 5D8JH 3RWEB 2XT1B 3DJ9A 3U2SA 3KXFE 1NEZA 3ARFB 3RWFB 2DQDL 4D0BB 1AXTH 4UNVA 1IGJA 2BXYA 1EO8H 1N8ZA 4KHXH 4MNGB 1MUJB 2ICWA 3B83A 4M7ZB 5DR5H 1F4HA 3TN0C 3BN3B 3HRZA 1NBYB 2BVOA 4TNVK 4JFEB 5C07A 1ZHKA 3MJGX 2VZVA 4HWNA 4H8WL 1JV5B 3ILPA 4M3KB 4FOMA 4Z78B 2VNCA 1SYVA 4OGAD 4LFHG 3THML 1UEMA 5IQ9A 2CLRA 3QZWG 4J12A 2VL5A 4XWGH 5E6ID 4PJBF 3NH7H 3N1PC 4TVPL 1JN6B 3IFOA 3VWKD 4NCDA 3JTCA 4OD2A 4TOYH 1FZMA 4JKLA 4PGBA 4ZD3L 1VKXB 1G9NL 3HMXA 5E9DE 4ZPTA 3LKSB 1P53A 3R0MA 4P2OA 1J5OL 1EHXA 4V1DE 3ELAT 4QRQA 3FRPG 4IHOA 4AK1A 3QSKB 3EHBC 3U0PA 1RIHH 1WICA 4LF3B 2HTLC 3BGFC 3TP4A 3TPUA 5CMAA 1JE6A 1BGXH 1H8OA 1WEJL 5DC9B 3ZE2E 3NCJH 1I8KA 4GW4B 4NNXA 4JO1H 5GSRB 4CAGA 4Q97A 1NFDB 1YMHA 4LPWA 2VSDA 4RWYH 3QP3A 3ZKSD 1ZT1A 3BE1H 4Y19E 2JCCB 1UQSB 4ODVL 2BY0A 2DM3A 1T2JA 1TJHH 5C08A 1YEDA 4HUKB 3ISWA 1T7VA 1FG2A 1BQSA 4PG2C 5ERWB 1N59B 2ICEB 1MIEL 1HSAA 3WDHA 2CH8A 5DFTA 1MRFL 4DKEL 1N6QH 1F4WL 4Q6IC 1IGTB 3MLTA 1LO4L 1WIPA 3LY6A 2FJGA 4U2YA 4P4KA 4HDIA 4PJEF 1NC4A 3B8YA 4X7SH 1BIHA 4ZAKB 3KYNB 3U0TA 4JM2D 2XPGA 2BVTA 2D9CA 4Y4KA 1MFDH 1NCBH 1Z9MA 2EYRA 4S0TD 1U42A 4WU7A 5K59E 1MCJA 3MXVH 1OARH 3NN8A 1EEQA 5EFIB 1XFPA 2DI9A 3GRWH 4LRIA 3LKNB 3F7RA 5GRYA 1KT2B 5L7XH 4A6YA 1DFBH 4JN1L 1LO5A 5HYJA 1ZGLM 1S7UB 1MLCA 4PJXB 1AGEA 1NMAH 5ID0B 2OL3L 3D2UD 4W68A 1ZLUH 4C83A 5BVPH 4M6OH 2CDFB 5LGHL 4J3WA 4IRSC 4ONHA 1M7DA 4NRZB 3BVNB 3MCLH 1YQ2A 4PGDA 3EJYC 3RTQD 2OI9C 3OKNA 3PGCA 5DQJA 3TESA 5ANMA 4YXLH 4Y16C 5T5NG 2BFVL 2PO6B 4MQ7A 3UJIL 1B88A 1SEBB 1IM9A 3LKPB 5IBLD 1MRCL 1FG9C 1ZVHA 4IRZL 5IB4A 1U91A 4UUJB 3KHOA 2EH8H 3L6FB 4KKNA 2VQ1A 1R3LA 1RZKH 1SMAA 3EYFA 1Z9SA 2ED8A 4KKCD 5LG1A 2YKLL 5EU3B 5DF0A 5DZOA 3C5SA 4QTHA 3UYRL 4KJQC 2BOCB 1FJ1B 4MA3B 4XVUC 1AGCB 3GEWB 3WFHA 4LIQL 1XGQB 5D7JC 1ZLUK 4N0RA 1F3DJ 4G9FA 3M8OH 4PLJD 4AENB 4N0YH 5GGTL 2FHCA 3ALWA 3QDMD 4MSWB 1YZZA 4I0CC 3BDYH 3P4OA 3OKEA 2FR4A 1JHLL 3LHPL 1F4XL 4FP8H 4G6FB 4KGLA 3PDOA 3L3IB 4I18A 3MRDB 3UZEA 2ATKB 2B1AH 2P45B 3T0VA 1B0GA 4FABL 5D2LA 1CK0H 2I5YH 3AMKA 5AYQA 3TNNA 4ETYA 2NX5E 3ARZA 4NM4H 2QR0A 1RZFH 4PUBL 1IGCL 4QRRD 4W4OC 1NUNB 5J06A 1SBSH 3MRMA 1GCFA 1Q94B 5JDSB 3LB6C 3FO2A 2GUOA 3OAUL 3MGTB 4P4KC 5CGTA 4GBXA 2NXYC 3QUYD 4GQPH 2SEBB 2BZDA 3L7FA 3QWRA 2XZQL 1KTLB 1A6WH 3BDBA 3SPVA 1JF5A 1CCZA 1RZ7L 4PJGA 4KVNH 4Y4KC 2NXZD 4HEME 5C7XL 2GJZA 1E6JH 4XBEH 1U8NA 3FQXB 4MNHB 1T1WB 1MFAH 2IAMD 1WT5A 3K74B 1FL5B 3QHZH 5GGQL 3PE9A 2A9MH 2BC4A 5JW5A 1PX3A 1DVFC 4LRIC 2J88L 4KJPC 1A9EA 3CDGB 4P23D 4F33A 4K3JL 1RZJH 4X4XA 4HIIA 3KPRB 4YLQT 5EOQL 2EXWD 4MS8D 1E4XL 1HCFX 1S9XB 5TE4L 4NFCA 5MHSE 1TZIB 2DWEB 1JTPA 3RFZC 4U6VL 2R0KL 3VFTA 1MHCA 5I8CA 2X40A 1ZAGA 3FCTA 3RGVC 1R6VA 3WBDA 2P5EA 1CFTB 3I75A 4XNMB 2NY3D 1QBLL 5LQBL 3WHE1 1U41A 3QUXD 2MMXA 4ZOBA 5DMKB 5D1QA 2VLJE 2FGWL 3HLAB 4Y1AD 2DJ4A 4K2UH 5C0AD 1IGYA 4N8CH 4M7JL 5H94A 4KK8C 3QDJB 4O2CA 4Q9QH 2Q86A 4QHNB 5T3ZL 3P4MA 3ULUE 3FFCB 1WFTA 2Q7YB 4LVNB 4DN4H 3F5WA 3SJVA 4ZXBC 1NLDL 1BZQK 1R3IH 2FECI 3FRUB 5C3TA 3VFRB 2LTQB 3ZDZE 4BFGA 4HLZG 1TCRB 2DTSA 5DD1L 3TGXA 3X3FL 2HT2D 3Q3GB 5DURB 3B9KD 5L0QB 5D6DC 2NY1D 2HFGL 3LSOB 4R0LC 3BYYA 4UNUA 1NQBA 2FZ3B 1LO2H 4HUVB 3GKWH 5FHAL 4NRYB 1PSKH 3O3BA 4I18C 3EFFA 4O4YL 3MRFA 2ZUQB 2C7UB 4N90D 4RIRA 3H9SD 3VD3A 3D69A 3CVHB 1T3FA 3KDMA 3EYQC 3RNKA 4CRPA 2I07B 3L95B 5FYLE 5A16A 4G8GE 4YIQA 4JPIA 4MHHG 8FABB 4YK4B 3UYPA 3TBYB 1W0YT 2MJWA 5DUML 3O4LD 1TVHA 5CD5C 5HVFB 4WFGE 4X9BA 3FOMA 4HK0B 3HUJA 3BP4A 4JG0L 4XCCH 1U8QA 4ZFOA 4OFVA 3D0LB 4R2GB 1DJSA 5IW6B 1I3GH 2MPAL 4Y2OA 25C8L 4DEPB 1CE6B 4LP4A 5CEZE 3ECBA 3V5HA 1XGPB 3NTCL 2J7LA 4OBSA 5CJOH 5DVLA 1YEGH 3ZE0E 4JHZA 5SWZB 2ATPA 5F88A 3MCG1 2MWCA 1BOGB 2A6JB 3C08L 2IPUG 2VDQL 4PIRF 1DLFL 2HRPL 4N8VB 3FT3B 1TNNA 4R7NB 1A5FL 1FSKC 1LK2B 3RVTD 5FDYA 1X4XA 1HQ4B 4XX1E 2IQ9L 4UOW1 1UEYA 4MAYB 5ITFB 3MOAL 5C07E 4GRMA 5T1KD 4JRXB 4U49A 2NY6C 2A6IA 2FX9H 4OI9A 3HPLA 3ARSA 3G6JB 4S2SB 3HHRB 2QSCL 3ARRA 5FYLH 1A14H 5HYSG 1G7PA 4FQXB 2QTEA 4BELD 4J3OC 3RBGA 1MCCA 2EC9U 3OAZH 1Z3GL 2ZOLA 1H9VA 3C5ZB 1UB6B 5D1QC 5KVGH 4WV1A 4QRPB 5JLZA 4NZJA 2Q8AH 4DOHE 4P46C 2EDHA 1EHAA 5HBBA 1YY8B 1Z5LB 3V6FA 4UIMA 2BSSB 3SOBH 2C9AA 2FEDD 5JA9A 1OGAB 2IH3A 3QO1B 2VLRE 3TBSB 1FGNL 2AABH 4AT6B 4GXVH 2MCPH 3PQYD 5IWLA 3TPUE 4K3HA 3VFVA 1RU9L 5I18L 2XQBH 1NAMB 4LL9A 1V8HA 2GIYA 3V6BR 5D2NB 3KYMB 3MBXH 1UJTA 5F1IB 1MRDH 4OF3A 4N0CC 2X4PB 4NRXA 1FE8L 2X4OA 5KSBB 5J12B 4LPCA 4LARL 3WUZA 3RAJL 4KROB 4KAQH 1DEEA 1VERA 4YR6A 1TZGH 3EYVB 1U8IB 5C08E 3DGGB 3OGCB 5GPRA 1RZIA 2R4SL 3C60A 4AEIL 1HI6B 3CZFB 4U05A 4F57H 1MVUB 3MLWH 1HHHB 2HFFB 1FLRL 4LSQL 4R8WL 5IEHB 2VZ3A 4HD9A 4X80H 1U58B 4JFXA 1M7IA 1UXSB 4NKOB 4Z7UF 1J0KA 4PJAF 3WXVL 2HN7B 1J88A 1DBAH 4JDZA 1H15B 4BFIB 4HKXB 4J3TA 3VI4E 5DRWA 1S3KH 2OR9H 2G9HB 5CD3A 4AH2A 3U7WH 1I3RA 1LDPH 3IKCB 4Y4FB 1H5BA 4O02L 1CFSB 4HS3A 1K6QH 1FAKT 2E3VA 3TF7C 2JLLA 2Q1EA 5E1AB 3SGJA 1UACH 2BX5A 1M71B 5GS2D 4NGHH 1LO3H 1RHHB 2PYED 1S7XA 4PV9B 2AJ3A 2R1XA 2UVEA 4XAKE 5C71A 4L9LA 3MRQB 3FQUA 4TQEH 4X99B 4PGEA 5CEXA 3B8SA 1EMTL 2PCPA 2PW2A 5BS0D 3PWNA 2H26A 4QHUA 1CDUA 1NDMB 2RQ8A 4JZOA 5HHPB 3AROA 3GHBH 5A43C 5IUSA 5ANME 3LZFL 5JORA 1B2WH 4OGAC 5DRXA 1CN4A 3G5XA 5ESAB 3P11L 3AY4A 2C3HA 5F6HJ 1BAFL 1Q9LB 2YC1A 2OJZH 1LE9B 5E6IC 5DT1H 2EDJA 2IADA 3T2QA 5FDWB 3TBWB 4BH7A 5BQ7A 5J1TC 5E9DB 1DDHA 5GGUA 2EE3A 5F3HB 3VWKC 3MRPB 4JM4H 4ZODA 5BCAA 4V1DB 4QHKJ 3W39A 15C8L 2P42B 3IU4L 2VISB 4X6CB 5T5FH 4MVBA 1ZS8B 2EECA 1RK1A 1Z2KA 4X4MA 4PP2A 2B20A 4D3CH 1FL6B 3QUML 4Z7NE 5IWLC 1NPUA 1BMGA 2K9UA 3QEQA 1WFOA 3KYOA 4G9FE 4J6RL 4Y19B 4MD4B 2E27L 3VXPB 5I73B 3UBXI 2JJSC 3QUZA 4HXAL 3GSNL 1S7SB 1ADQA 1G7HA 4MJ6A 3LEXA 3MLZL 3HCVB 2ZUTA 3STLB 3LV3B 5I1CH 1MCKA 2VLKE 5D2LE 4OKDA 3ROLA 5ALBL 1BD2D 4P2CG 1MPAH 3PHQB 5C09A 1NUGA 3C6LA 4KRLB 4JHAH 3CK0H 4ZUSA 3O6ML 3PWPE 2A73A 3FAXA 4OLWL 3T09A 4JQXA 2EEDA 5KSVA 2DQHH 1DANU 5EIQA 1TTUA 3K7UA 3SKOA 1M05B 4WO4A 4JM2C 5EUKA 1QTYT 4NOFA 4PJGE 3TZVB 3V6OC 2WINB 3AC0A 4P0DA 1UVQA 1KULA 4M8QB 3NABL 5AYUL 3ARBB 4MJ5B 5BV7C 3GMQB 2DQCH 3VRLE 1P1ZB 1RUQL 2BRRH 3QISA 1FO0A 4XAWL 2F74B 2VITB 2CKBH 2R2BB 2KL6A 5IMLB 4S1QH 3MJ9H 2YEZB 3LN9A 4WW2A 3VFNB 2ICES 3JUYA 2YXMA 1V05A 4EEEA 1ZHNA 4KY1L 5HHOD 3TA3D 1OAQL 1X5JA 3O2VH 3S5LB 2Z9TA 4WI2A 1NAML 4N0UA 5CLWA 4EI5B 4L9LC 3ULVE 3SE8L 4J23A 1BFTA 3RTQC 3L5WA 5I16B 4H26B 1NMCB 3RRQA 4TRPH 2A9NH 2P5EE 5EIIA 5HI4D 1ZGLP 1ETZB 3QNZA 3H7BB 4OUUB 4Z7WF 5JHDB 3GSQA 1NCUA 4PB9L 3V8CA 5IBLC 4MJID 1BVKA 3RJDA 2JELH 2FSEB 1IZJA 2ZOKA 3GO1H 3KWWA 1CIDA 2PXYD 2XACC 3EFDH 1T1YA 1EEZA 2R69L 4ZNCD 2DB8A 4Z0XB 2WP3T 4HJGB 3GGWA 4W81A 4NN6C 3UJJH 4EBQL 5EBMA 3S36X 4LHUG 4OZ4B 4FHBD 4CN4A 4KKCC 4GW1A 3SJVE 4JY5L 3U36A 1NLBL 2DIJA 2ERJB 2A74A 1XCQA 5KVFH 1T5WB 5GGRB 4DKDC 4EUPB 3T0DA 3E6HA 5AZEL 5CBAB 3GZKA 4PLJC 1YJDL 1NCDH 1TETL 5I74C 1NGPH 2XA8H 4GQ9H 1FORH 3WUWG 2EYSA 2GT9A 3O6FA 4Q9CA 4X6DF 3ZYOA 1G1YA 1MCLA 3LKOA 3SKNA 5F7WC 3P73A 1U93B 5KVDH 2MTPA 2WK2A 2ZUXA 4X7DC 3GJFB 3QUZC 1YPZE 3C2AL 1BF2A 4XNZB 5K9OA 2XWBA 1IQDA 2NX5B 3ZHKA 3HG1A 5EZJA 2BHYA 5FYKL 5E5UB 2P8MA 3RL2B 5JPNB 2P5WD 5LWYH 4ODBD 3BKJL 2ADFH 4XP9H 3VGAC 1U8LB 4F7CA 4R97C 1FV1A 1QR4A 5JHLL 3CX5J 5IEKA 4P5TB 1MFBH 4NO3A 3I3DA 4HS6B 3O4LA 1BJ1J 5FV1L 3QUYC 5E99L 3VXOA 4CNIA 5FOBA 5FB8A 3HUJE 4X5XB 3FOLB 1F8TL 5FYKU 1OY3B 4R3SB 5T1DH 2NXZC 4P48A 3IDUA 4UB0H 1FAIL 3QIBD 3IDJB 4L9DA 3RDTD 3BPNB 1I7RA 2IAMC 4JPVH 3U1SL 3MRIA 3V0WL 5H2BB 4OTXH 1ACYL 5CEYA 1XZ0A 3G6DL 4P23C 2QADB 4N8PA 4I1NB 5HDOA 2A2QT 1P7QA 1OM3H 1SY6H 5IVNA 2EXWC 4MS8C 4IOFD 3E8UL 3OXRB 4N1CA 3C8DA 3SE3A 5K9QI 2VDNH 2WV3A 4WW2C 5F9JA 5K93A 1R3HB 2EKSA 3MJ8B 3QIUB 5DDHA 2VDLL 5B8CA 5IGXH 3VXSB 2X4NA 4GKOA 5GHWL 4E42A 4GKZA 4K7PX 3D39A 4ZUVB 4EN3A 2H8PB 4O9HL 3S6CA 1CR9H 4O51A 1W0VB 5DSCA 3SKMA 1GYAA 1L0YA 4OAWA 3UZVB 2NY3C 3EOYG 4KDWA 4M48L 1JMZA 1KB5A 4PJ7F 3ZTNH 3CJJA 2EC8A 1WVZA 4TULH 3L3DB 5L2KD 1RD6A 2R0LL 3MBEB 5HTSA 1MCFA 3WDIA 3DURA 5J1AA 1JGVL 5DZNA 4ONGL 4J8RB 5TDPA 2BNUA 4IDLA 3NCCB 3RBSA 3NIGF 4GAGL 1P6AB 2ZPKL 1OAZL 4XC1L 2HT2C 4XBPB 3P0YH 1JZ8A 3B9KC 5EC2A 4BK5A 4RGMB 2OJEA 3OJVC 5D71H 1XGUB 2R23B 4CMMB 3SDXB 3P9LB 3EDJA 4BH8B 3TT3L 3V9FA 5MP6H 3O6FC 2XTJE 2AEPH 1BBDH 3HMWL 3P77B 4S1SH 1P4LA 3VGFA 1JYNA 4Z5RB 2CJUH 2NLJA 1U2CA 3M45A 3X12A 3MR9A 1A1MA 4HSQA 2ZUSA 5JPMA 3MLRL 1EBAA 1GZPB 5FK9A 3ZDXE 2R0WL 2XY2A 4YUEH 1JYWA 3SDCB 1AXIB 5DD3L 3QPXL 4HFWB 4U6YA 3NZ8B 5IVZA 1A7PH 2XKSA 3WEXB 4RGOH 1S7RA 3KS0J 3VFUB 1U6AH 1PZUB 3A6CL 1KCUL 3CFDB 2FLRT 4WU5A 2AQ2A 4RAVB 1WCBB 1RUMH 1KGCD 1XF4A 1A6ZA 1CQKA 1Y6NR 4MA1B 4NZTH 2Z93A 3U2SB 1KXTB 1NEZB 1BJ8A 3WL9A 1UWEL 5IIEA 3S3SA 1N8ZB 5DYOA 2ICWB 5KANG 1HIML 1QSFD 3RU8L 2X4UA 4WHDA 4NUGL 5D7KE 2WBWB 1VEOA 2QKIA 1I3VA 4KPHH 2PYEA 1HHKA 3RVTC 5C07B 1MQKL 3CFIC 5BJTA 3SE3C 3GSVB 2HAZA 1P84J 3WN5A 3U6RA 3ILPB 5HI5D 3TO4D 2PTVA 4HJ0D 4K3DH 1ZEAL 4NKIL 5MEPA 1N5YH 4YHZL 4EN3C 1SYVB 5IQ9B 2AV1A 2CLRB 2HFEA 4Z6AT 2AJXL 2VL5B 4XT1C 1Y18A 2ZKHH 1U8JB 2V5TA 2W65A 3VXTA 4HS8L 2LV4A 5I0ZA 4DOHB 3VD9A 3N1GC 1KCRH 3IFOB 3CSPA 4J3UA 4OD2B 1FZMB 1BQHA 4PGBB 2RFXA 1JRHL 4ZPTB 1T7ZA 3O41A 3OXSA 4Q2ZB 1BFVH 4P2OB 4WIQA 5I1EL 1ES0A 1HNFA 4QRQB 5BV7H 3TPKA 2BJMH 4IHOB 3FB6A 2FEDC 2J8OA 4UT9H 3P0GB 3U0PB 5FGBA 2UWEA 3EO9H 5T1LA 2IF7A 3LQAL 4U0QB 4X4ME 5J7CC 5CMAB 4WGVB 4OLXL 4LBEA 3MNVA 1AY1L 3DTXA 1X4ZA 1KV3A 1U8HB 4DUWA 1I8KB 1X5IA 4HUUB 2ED7A 3QEQE 3K4ZA 1YMHB 3MV9D 1I85A 3QDME 5I8KH 1U3HA 1VDGA 4HK3N 1MAMH 4DTGL 1QSED 3RWCA 4QTIL 1VFBA 1PKQB 5ADOH 1LDSA 4OIIL 1DTUA 3QCUL 5HDBE 1ZVYA 2VDOH 4OD3L 5C08B 1YEDB 4JFZL 1FG2B 5H35B 3H8NA 3TYGL 1HSAB 3HTLX 4MZ2A 2YA1A 2DLFL 3MLTB 2KDGA 4QXUL 2XOTA 2FJGB 5E4EB 5C09E 4WY7H 2ENYA 4HDIB 1NC4B 3V4PL 4JJHA 3BESR 4HQQH 2W92A 1AQDA 4JO4H 3U0TB 5CHNA 4F3FA 4F37F 2XPGB 5TF1H 1SBBA 1NANI 1AFVH 2EYRB 4YFLI 3BT2L 4FZEL 1GZQA 4OZFH 5C8JA 2Y6SD 2RJMA 4S0SD 3NN8B 3PGFH 1EEYA 5KS9F 3S34L 5D7IA 5DFVD 1U92A 1BQLH 5DHVA 4LMQI 3WSQL 1ZA6A 4DGYH 4J4PD 1LO5B 5HYJB 1S7TA 3UTQA 1DQMH 5I1GL 3CSBA 1C5BH 3TFKA 3CFBA 1MLCB 4HBQA 3LD8C 5B21A 1AGEB 3M1BA 1M6OA 4C83B 1MCDA 1OAYH 2WUCH 1WIOA 4JY4B 5GSVA 4ONHB 3TA3A 1M7DB 2MOVA 4XVJH 3QAZB 1S7VB 3QXDA 3LQMA 4PGDB 1L7IL 1NAKH 4N0UE 3S36L 3OKNB 3PGCB 5DQJB 2P44B 5ANMB 3LRHA 1JZ6A 3D18B 5TH2A 3DSFH 1IM9B 4Q0XL 4UI2A 1F45A 1FNHA 5EOCH 3WKMH 5HHMA 4JGJA 1U91B 5C1MB 1LP9E 1R5VA 4NC0B 2VQ1B 4HZAA 3T04D 2W1NA 3EYFB 3D3VA 2W0PA 5LBSH 4L1HA 4PLKD 4QTHB 2WY3A 3R1GH 1J1OH 1DR9A 1HZHH 2AJVL 3QEGH 2WP3O 5INCA 5EZOH 3WIFA 4IMKA 3LS5H 1IKFL 1R0AH 4G9FB 1DLHA 4FQ1H 2QJDA 3TJHA 3L5IA 2F53D 5EU5A 1S5IL 2VXVH 2R2CA 3BHBA 5J6HA 3EAKA 3OKEB 1I85C 1EGJH 2CRZA 2FR4B 1U3HC 4XVSL 1YN6B 3B6SA 2F54A 1MJ7L 4N9GA 4JHWL 5EBGA 1B0GB 1QEWA 2YZ1A 5IMKA 5D2LB 2MCG1 3HAEH 1GGBL 4JRYD 5D7SH 2B0SH 3TNNB 3KPQA 3QIWD 2DLIA 3HG1E 5IQ7H 4Y2DA 3MRMB 3K46A 3L5XL 5E8OA 2F58L 1SEQL 2Z8SA 1F97A 1OSZB 3FO2B 4K3EL 4YWGH 2GUOB 3T0EA 3ARGA 3UPRA 4MDJB 5TJWK 3FONA 4GBXB 4NBXB 3SGDI 1IFHL 2WANA 1Q72L 1N0XL 3L7FB 3O4LE 4XPGH 3QI9A 3SPVB 4X4ZA 1CLOH 4OF0A 4PJGB 4OQTA 1YNKL 3MOQA 3BDXA 2FLBT 3UTPD 5KJRH 2GJZB 2L4OA 4N68A 3GJEB 1U8NB 5DJ0B 5DK2B 4MWFA 2CK0H 3FZUD 4OZGA 2BC4B 2W0FB 5JW5B 1W72H 2DIBA 4LVOB 5DK0A 4K7PL 5KVEL 1A9EB 1FYHB 4F33B 4G5ZL 1WFNA 1T20A 4PS4H 4X4XB 2XKUA 4HIIB 3HC3L 4Y8DC 5IMOA 2IFGA 2CUHA 4HV8A 3GM8A 4NP4H 3EYUL 3PJSA 1TLKA 4K23L 5IV2A 3GMMA 4UU9A 1A7RH 1I8IA 3TA3C 3ARDD 3VFTB 3OZ9H 1MCEA 4LLVB 3VD5A 1MHCB 2APVA 3FCTB 1I9IL 3D39E 2LU4A 3SDAA 3LKQA 5FHBL 3VU2A 3I75B 4M1DL 2E7HA 4L3EA 3DX9A 2KZ1B 5HI4C 2G75B 4JG1H 2DQJH 2A77H 1MHPL 3O3UN 3SKJL 3N50A 1AR2A 1IGYB 5EU6D 1FFRA 4OF5A 2PXYC 3VRIA 1DSFL 5H94B 4O2CB 2OP4L 1PG7H 2Q86B 3QRGH 1WQVT 1P9MC 3P4MB 4I9WD 3QEHA 1MEXL 1QUNA 5F97E 5T5NF 1LQVA 4KV5F 2R2EA 4KI5D 3F5WB 4PJ9A 1SJHA 4PJHE 3F7VB 4RAHA 1CFVL 1QLFA 2Y1VA 2ARWA 1JNHA 4Z7VA 1JIBA 1CGSL 2DQEL 3TVMD 4YHOH 3PXJA 3QXAA 4KU1A 1R3KA 4HWEL 3KPMA 4LCCA 3I9GL 1JPTL 1X5XA 3QFJA 2V5YA 1KENH 4XP6H 3HNSH 4XB7A 4LNVA 1JWSB 4P2RA 3PIQA 5JQHC 1TDQA 3RL1A 2OX5A 1CL7L 4LRNH 3RA7L 4Z95L 3QCTH 4WW1B 3NCEB 3O3BB 4P2QA 4RIRB 3G5ZA 1IAOA 3D69B 3H3BC 5JQ6H 3B5HA 1A7OH 5LCVL 3RNKB 1HEZA 1MJJA 4BFEA 1C12A 4PJDE 4ENED 1GOGA 4JCLA 2QHRH 4JPIB 1QLRA 3MUZ1 1P5VA 4F80A 2ZSVA 5IT2H 2VN7A 2W9LA 4HHAA 3PGDA 3BI9X 3MA7A 3HUJB 3BP4B 4HIXL 1UH2A 4E9LA 1U8QB 3CXHK 4ZFOB 5I1LA 4GLRI 3SDYL 2WBJA 1OAXH 4LCIH 1A3RH 4U3XA 3CMOL 4OCLC 3CC5B 5KW9L 2JK5A 1J9CT 3ECBB 3V5HB 3QIBC 3LS4H 3RDTC 3SCMD 1UM5L 2ATPB 5F88B 2ZCLL 1V3JA 2HVKA 5B4MD 4HX1A 4Y5VC 4C57C 1YNLH 3OHXB 3GHEL 1WISA 1FYTD 4NCC2 2VDRL 2PYEE 1I8LA 4GRMB 4AEHH 3LPWA 2J6EL 4JLRA 4BZ2L 1RURH 1LGVA 2PNDA 1DUZA 4FZ8L 4HKJA 2A6IB 3HPLB 2XV6B 3RY6A 1G7PB 5DGRA 2C5DC 3O6LL 4F58L 4YHLL 4QY8A 2GYSA 4O58L 4Y5XB 4NZRL 4MQSB 1MELA 2ZOLB 4GH7B 3HNTH 4WV1B 2V7NA 5JLZB 1OOAA 3B9AA 4MCYA 4DQOL 4JZJC 1C8PA 1EHLH 1YECH 3V6FB 4L8BA 4WTZG 1UKSA 4F9PC 2FB4L 1AHWA 1KTRL 3MOBH 5EBLA 1YEFH 2IH3B 5GJTH 3A0OA 3N9GL 3U0WL 2UWEE 4F7EA 2NTSP 1J7VR 3OX8A 3VFVB 5E8NA 3ARFD 1OCWL 3WFBH 3OV6A 2EH7H 5EN2A 1KN2H 3P9MA 1EPFA 5E95B 3HI1B 1T2QH 4I0PA 2XTJB 2K3TA 4JFED 4LU5L 4NRXB 4OFPA 2X4OB 3H3PH 5J6GB 4HMCA 4XP4H 2A6KB 4GG6F 4DGVH 1UCBH 1F90L 4YR6B 1DEEB 3HNVL 3DYPA 3C5JA 4IOIA 1GGIL 1RZIB 3C60B 4AG4H 1QYGH 1T83C 3EYOA 3D25A 5DJXA 5ECJE 4RX4D 4AIXA 4FQLL 4U1JA 4PJBA 3KNBA 5GS1C 3W9EA 1H3PL 2GCYA 3DMMA 3GIVA 4RWHA 1M7IB 1HINL 5F89A 2BSTA 3VD4A 2YUZA 4JDZB 4JQIL 1D6VL 5DRWB 5B38A 4FQJH 5IHLB 5CD3B 3ROOA 4C56A 3T0WA 3KR3H 4AH2B 1I3RB 2IFFL 3CH8A 5D7IE 1B4JL 1N2RA 1JZ4A 4KQ3L 1H5BB 2J2ZA 4HS3B 1KB9J 2AJZA 3RPIA 5BRZA 1IC7H 1AH1A 3DWTA 3ARYA 2VLMD 4LSRH 4ONFL 5T3XD 1HCVA 1IAKA 2JJVA 4LMQE 1A1NB 1S7XB 1TPXC 2DDQH 4HLJA 2AJ3B 43CAA 2R1XB 2EC9T 3BJLA 5ABDE 5CEXB 3FQUB 4UT7H 3BKCH 4KXZI 4HC1A 2PCPB 1CXIA 2PW2B 3PWNB 2H26B 4QO1A 4QHUB 5HI5C 3JTTA 4JZOB 4YDVA 4WWKB 1WFUA 1KJ2H 4J3SA 5D93C 5DRXB 5DEZA 3CXDL 3G5XB 2R0ZL 2QL1A 3AMLA 1Q0YL 5T3ZD 4DKFH 4PJEA 1JTOA 2XFXA 4ZFFA 2IADB 1YQVL 4QWWD 4ZDHB 4BH7B 2BMKA 1NSNL 4RBPH 2ADGA 3WHXA 5BQ7B 1DDHB 5GGUB 3DSNA 2J4WL 4ZAKD 3CLEL 3KPSB 1AD9A 1JBJA 2IANA 1CYGA 4CVZA 2YSSA 3D3VE 3AU1B 2DQGL 3G5YB 4H25A 4IM8A 1OHQA 4P9HL 1RK1B 2VSCA 4KUCF 5C0DA 1U0QA 4YZFE 4PP2B 5CCKH 3VWJA 1CE1L 1V5JA 1G6RL 2VUYA 4FXKA 1KG0A 3VI3E 3QEQB 3KYOB 1P6FA 1YC8A 3W0WA 2YS4A 2FHBA 2V9RA 4OCNC 2EEAA 2OR8A 1J1XL 5BMFH 3SHSA 4OFYA 5SWSB 4M93B 4I0PC 3V6ZA 3Q48A 2J8UB 3QUZB 3QG7L 4F7PB 2XTLA 4PRBA 5B3JE 2VDKH 3MLUH 1G7HB 2F54E 4MJ6B 3LEXB 1R24B 4X6BA 3FT4A 1BM3H 3RWJA 3WLBA 1QKZL 2FIKA 4CW1A 5C86A 2D7PA 2PO6D 2EIEA 3ROLB 3WKNA 3K0WA 5CS7A 2E7CA 1DQLL 5C09B 3RUGB 3C6LB 1EIBA 4MYWB 1F00I 4RBPK 2UZIL 4MLIA 2R4RH 4ZUSB 3T0EE 1P69B 1I9EA 2N4IA 3O6KH 2A73B 4R9HA 3PV6A 4YE4H 3DMMC 1KPVA 4WO4B 3STBA 4B41A 2AK4A 4K8RL 4OV5A 2Y6SC 1N0LA 3NGBB 1UVQB 3I02A 2AAVA 4K94H 5I71B 2EDDA 3GMRB 5E2VH 3L3OA 1MWAH 4CBPA 4OZGE 2HT4D 1QFPA 4LEOB 1CGWA 4J4PC 1EHNA 3MFGB 32C2A 3BIKA 1YDPA 2G2RA 4ODHH 1LILA 2DTML 5ACZA 4NZUH 2HKHH 4XCFH 1CZ8L 3LVEA 1ZHNB 4UNTA 3DRQA 4RMRA 1IGMH 3VGBA 1HN1A 4YNYA 3MNWA 4G6FD 1A6UH 4LAQL 5D72H 4DFIA 4N0UB 3HI6L 4YDIH 3H2WA 2PF6A 4HG4K 3ULSA 3L5WB 2F15A 4GRLA 3CX2A 4HPOL 5ICXA 3QQNA 3FN0H 2LFGA 2FEEL 2VC2L 3MCKA 5F7EL 2DM2A 2AXHA 2J5LB 3S37H 3GSQB 4JFHD 4X7CC 1A8JH 1BVKB 1KCLA 3QA3A 4HBCL 2ZOKB 3KWWB 4P3CL 1T1YB 1LD9A 1MNUH 3OR6B 3EOBB 2LU7A 4NJ9L 3NFNA 1GHFH 3JWNC 3JWOC 3GGWB 2D7TL 3SGDH 9CGTA 5EBMB 2NW2A 5FKPA 4R7DA 2H2SD 4KK6D 3HFMH 3DLQR 4GW1B 3IDIA 4M6NH 5J89A 4EI6A 2IBGA 5JOFA 4PLKC 3DNKA 3NBNA 3U36B 4B53A 1MJ8H 5TE6H 1P4BH 3IJHA 3TEUA 4L4JA 1KIRA 2A74B 4UBDD 4Z7VE 4OZFA 2W9EH 5DHYA 2AJSH 4UT6H 1QP1A 2YPLA 3KPRD 4R4ND 4CGTA 4LVHB 3QFJE 2Y4SA 4HGMA 1NJ9A 2EYSB 2GT9B 1HSBA 3O6FB 4G8FA 4P2RE 1ZGLA 2DQTL 1ZA3A 2IH1A 1CFBA 2Q8BL 4PD4K 3LKOB 3SKNB 2D2OA 1B4RA 1I9RH 1V3MA 4KDVA 2NY5C 1NMBH 5DLML 5LKNA 5F70A 1A7QH 5K9OB 2XWBB 1IQDB 5EA0L 5HVHB 3IETA 1UYWH 3HG1B 2BERA 2P8MB 3T3MF 3QIWC 1DANT 2H2PD 4JEGB 1FV1B 4D9QE 2QSVA 2W0LA 1A9BA 5MEOA 1CVRA 5IEKB 1I3UA 4ZUTA 2AJUH 4NO3B 4LGPB 1MQ8A 4ZS7L 4G42A 3VXOB 4CNIB 3QDJD 5FB8B 5FOBB 1SYSA 2NPLX 3BUTA 1XIWA 3FFCD 4ODXA 1INEL 2GY7B 3PP4H 2R1WA 1KGCE 4WEBH 4X0KA 2VXSH 1E4WL 1I7RB 1T0MA 4XHJD 3KYKH 5F7UA 5FO8A 3MRIB 2OL3A 3WDJA 5CEYB 4X98A 1AC6A 4DN3H 1XZ0B 1QLEH 5DURD 4KMTL 4ODTL 1P7QB 4DVRL 1FPTL 5I19H 2V17H 4AMKH 5FEBA 1CT8A 1MCIA 1KCSH 5IB5A 4LEXL 5F9JB 3MJ6A 4OF7A 2EKSB 3JSSA 5DDHB 5B8CB 1C08A 4UIKL 4QGTA 4GRWE 2X4NB 5FF6B 4ODSH 3BEWA 2HJKA 3GMLA 4E42B 1QFWL 3D39B 5D8JL 2DYPA 3O3EA 4O51B 5DSCB 3SKMB 3VGGA 2YRPA 1AXTL 4OAWB 1EO8L 1ZANH 4KHXL 4MXQD 5MI0C 1OVZA 1NUFA 5DR5L 1C5DA 1T03H 1JZ3A 1J11A 4KRMB 3S4SG 1GGCH 1TMCB 3MV11 4KJYA 1NBZA 1DBMH 4P5MA 1ORQA 3DURB 2BVQA 5J1AB 2I26N 1FL3A 1VENA 2AW2A 4WUKH 1C5CH 4R2GD 5TDPB 4OZIF 4OZHF 4FQHA 3ZL4H 4KI5C 3SO3C 4GLRH 4JQVC 4APQD 1KPUA 5GGTA 4OIBA 2XN9B 4XWGL 4YAQA 1QFWM 4HAGA 1T7WA 3NH7L 5SWZD 3RWFA 3BAEH 4UDUB 3TVMC 1B3JA 1GC1H 5ENWB 1RVFH 4MNGA 2OJEB 4TOYL 4WTWA 1MY5A 3MV9E 1EFQA 2Z91A 3EO1A 5HGAA 3W5MA 4MAYD 4OSUH 5DQDH 3D6GA 5F96H 1P4LB 2BSRA 4JRXD 4LPXA 1MCPH 1RIHL 1JV5A 2NLJB 3HC4H 3X12B 2X1OA 3MR9B 5D96B 1A1MB 4Z78A 3ABZA 4YBQC 5JPMB 5IM7A 1BGXL 4RRPG 3ZDYF 3NCJL 4JO1L 1Q9WB 4OIAA 3VXUD 3CVIH 1DCLA 4G7VH 1Q9OA 3C5ZD 5IVZB 2EDXA 5DD0H 3FL7A 1JN6A 5E2UH 1S7RB 2LAGB 3DV6B 1FNFA 3WIHH 5E94A 2VL4A 3BE1L 1W0WB 4WU5B 4LCUA 1E4XI 2B4CH 4X9HA 1YYMH 5J13C 1TJHL 4YPJA 1FDLH 4RCAA 2AV7A 4RA0C 2IBBA 1A6ZB 1OGAD 1T1XA 2Z93B 1N6QL 3KJ4C 1P7KB 3WL9B 3ZE1E 4GAFB 4BSJA 5IIEB 3SCMC 1A2YA 3LPGA 5ICZB 3MYJA 1QRNA 5DYOB 2FIRT 2YN5A 4X7SL 5BRZE 2X4UB 1F5WA 3Q1SL 4NDMA 5B4MC 2QKIB 1ZT7B 1MFDL 1NCBL 2BOBA 1HHKB 5BJTB 4ZSOB 5C0ND 4YHYB 3MXVL 3H3KA 1OARL 5IBTH 4QXTA 3WN5B 3U6RB 1OTTD 1A4JA 3GRWL 5EZIH 5L7XL 4KROD 1NC2A 5MEPB 4TUKH 1DFBL 1U8PA 4KHTH 2YOCA 3T2NH 4ZG1A 5ERWA 2HFEB 4N1HB 5FM8A 5D1XD 4MB4A 4YO0A 5HXMA 1IGFH 1Y18B 1NMAL 2W65B 3VXTB 2CDGA 3X3GH 4TNVF 2F8OA 1WWCA 4PJEE 5BVPL 1HH9A 4AIOA 2J12B 4M6OL 5F9WB 2OSLA 4AM0B 2EE9A 1BQHB 4WI7A 2RFXB 5IF0A 4PJAA 4QHLA 3MCLL 3GSUB 3OXSB 2YD6A 3O11A 2IANE 2QV2A 3P2TA 1ES0B 3FB6B 3NCBB 4YXLL 2VR9A 2UWEB 5T1LB 2BVYA 3DVNA 2BXZA 4LBEB 3MNVB 3DTXB 1N5AA 1NCTA 3ARFC 5JO5A 5AUMA 3S3JA 2C4FU 4WNQB 3F65A 4OCXH 3W0WE 2EH8L 1T6WA 3ZHLA 4BM7A 4M7ZC 1RZKL 4CADB 2Z8WC 4OKVA 3RWCB 3T1WA 1VFBB 3UBXG 5I1DA 4UTBH 3GSRA 2J8HA 4M1CD 4ZNEA 3BVNA 5B39G 2CMRH 1T2XA 4PJIE 1BVLA 4M43L 1QO3A 4KXZH 1SEBA 5A2FA 3M8OL 3IYLW 2XYCA 3ZSTA 4N0YL 1K3IA 1D5ZA 3EDFA 5TQ2H 3JWOH 1X5HA 3BDYL 4FQ2H 5EIVA 1AQDB 3U7YH 4F3FB 1E4JA 3P9WB 3G04A 4FP8L 5E9DD 1GZQB 3L6FA 3NIDF 2ARJA 5C8JB 1CDYA 2B1AL 1AR1D 2FYYA 4V1DD 2AK4E 1EEYB 3UTPE 1XAUA 1CK0L 2I5YL 2AI0H 4M6MH 3BJ91 4CMHB 4NM4L 5D7IB 2ESVB 1RZFL 2BOCA 5DHVB 1SBSL 2F19H 1ZA6B 5E7FA 3LH2H 3UTQB 5AAMA 4L4VA 2VIRA 1HXYA 3CFBB 1M6OB 3PF2A 4YJZL 4W4NA 1A6WL 4JFFA 3F7YA 4KVNL 4DUXA 1T7YA 5GSVB 3CUPA 1E6JL 4Y19D 4XBEL 1N7MH 5C2BH 3HAEG 4NFDA 3WJLA 4EDXA 1MFAL 3QHZL 3QXDB 5BZDA 5J3HD 3WLWD 3OKKA 2A9ML 4JVUA 5L9DH 1T7XA 3FO1A 5GZND 4TVPE 4XI5D 1U8MA 5TH2B 1RZJL 4XCEA 3AS0A 5M95B 4MXWH 1IC4H 1Q94A 1WZ1H 2AJYH 4H1LH 5I1KH 3VH8G 4PRPA 5HHMB 3MGTA 1MCOL 1R5VB 5EU6E 4QWWC 5F9OH 5FGCE 3BEVB 4ZAKC 5KZCB 1UGNA 3D3VB 3EJZD 4LOUD 4NHUE 3TZVD 1T1WA 1N3NA 5INCB 4R6UA 1I1CA 3ARBD 3WIFB 2BHUA 2HP4A 4Z7QF 3CDGA 4K2UL 1H3XA 4N8CL 4NPYA 2YPLE 4FFZH 5EU5B 2VR5A 3DRTA 4Q9QL 1NDGB 3BHBB 5J6HB 3ZE2F 5F9AC 1TZIA 4DN4L 3B6SB 2AP2A 3O3AA 2F54B 3D85B 4KVCH 4NBYB 5E2TH 4N9GB 1R3IL 1QEWB 2HVJA 5IMKB 4EI5D 3AUVA 1QFOA 3KPQB 4ZYKA 5HSFA 5GZOD 3RZWA 4H0IA 2PO6C 4Y2DB 2QQQA 4Z7WA 5E8OB 1NFIA 3T0EB 4PRAB 3ARGB 5BO1H 1OB1A 3FONB 4KQ4H 1WWAX 4PJ8A 3INUH 1KJ2A 4N5EA 1OT1A 1LO2L 3QI9B 3GKWL 3LAFA 5FO7A 1PSKL 4BSWA 4JDTH 3HC0A 4LFHD 4MWFB 1OP5H 1F4YH 1T04B 4XXDA 2A1WH 1SMOA 3C9NA 3MA9H 4OZGB 4X5WB 4GMTH 3ZKND 5K59F 3FRUA 5DK0B 3DHMA 1YA5A 1TCRA 5DMIH 1JWMA 2XA3A 1T20B 4YHKH 5IMOB 4HV8B 1X6NA 1IRAY 4KC3B 2MQ0A 1MFNA 3PJSB 4XCCL 3AREA 1B6UA 1MLBA 2M26A 5IV2B 5K9QG 4LKCA 4X6DA 4J3XA 4BUGA 3GMMB 1IARB 1I8IB 3MLVH 6FABH 1I3GL 4BKLA 4HUVA 1CGUA 4XCNA 1L0XA 5CJOL 1YEGL 1WF5A 1OF2A 1KACB 3SDAB 1YEJH 2NX5D 4PRNA 5JXAH 1AXSB 2N1KA 1I1YB 2EDFA 4L3EB 4NUJA 2Z4QA 4WFEE 1EXUA 1NGXA 3MNZB 4IJ3B 3PL6A 3TBYA 3VRIB 1ZE3C 4JFDA 3BPOC 4Y4HA 1OP5K 3QEHB 3OTTA 2AKRA 2K7PA 3O3DA 3MV01 4JPWH 1R5IB 2FX9L 1G0XA 3QUMA 4UMGA 3DVIA 4PJ9B 1QQDA 5SWQA 2H2SC 4KK6C 5FYLL 1A14L 4LIQE 1E4KA 4LLUA 4X4YA 1DBJH 1ROWA 1QLFB 1W8NA 1YEHH 1JPGA 1JNHB 4Z7VB 2O26U 5I66A 4ZPVA 3QXAB 4UBDC 5I76B 3KYAA 5KVGL 5J56B 1N26A 3KPMB 4LCCB 2QADD 2Q8AL 5EO9B 3QFJB 2Y23A 3GSNA 3V0AC 4MNGE 3ES6A 4R4NC 1MWAA 5IJKA 4P2RB 3PIQB 5EBWA 1LK2A 5MHSD 3AM8C 4HJJH 3SOBL 4KUZH 4ALAH 5SV3A 4MAYA 3JUZA 4JFEE 4OFKA 3QIUD 2MHAA 4UV4H 2AABL 4GXVL 2MCPL 4P2QB 2F5BH 1I9JH 3G5ZB 3MV8B 3G6JA 3H42H 3HE6A 2PETA 4J1UA 5C0CA 1HEZB 4RMVA 1MJJB 3LQZA 4FQXA 4M61B 3VMPA 2XQBL 3QYCA 1QLRB 3B5GA 5A2IH 1AO7A 2VLJD 4ZFZA 3RI5K 4YDLC 3MBXL 3TBVA 2EYTA 4PJ7A 4QRPA 1MRDL 2MQCA 3PGDB 1DQTA 3MA7B 4PJ8C 3KPOA 3SO5A 1EVUA 3ULUD 1YY8A 3HR5B 5I1LB 2WBJB 4PGJA 1NL0H 3AS1A 2NW3B 4KAQL 1TZGL 4CJ0A 3EZJB 4LVNC 3UCRA 3V5DA 4F57L 3MLWL 4XHJC 1OTSC 1OP9A 2LTQC 2D4FA 5CUSH 4RGNE 3D0VB 3WFDH 2HVKB 3I6KA 4HX1B 5FV2A 1QRNE 4X80L 1BREA 1NAMA 4D0CA 5L0QC 3RWHA 4NN5B 5E08H 1II4E 4K9EH 5J0BA 1X5GA 5F1IA 1DBAL 1MJUH 2BCKB 1OQXA 1WV7T 3C6SA 4JLRB 3ERYA 1IC1A 1PKOA 4GRWB 1DUZB 1S3KL 3VXMA 5CZVH 3U7WL 3MZTA 3UJTH 1LDPL 3U30B 5JW3H 1M4KA 3O8XA 1RI8A 1O0VA 1RZ8A 4KZDH 1U8IA 1F6LL 2ZUQC 2VN4A 3SGEI 4QY8B 1K6QL 2W9DH 5AZ2H 4MCZA 1RJLA 1HHHA 1UACL 5GJSH 2ZUYA 3T3PF 2HFFA 4MXQC 1NGQH 4M7KH 2V7NB 5DJAA 3SDCD 5T3ZE 4NGHL 1LO3L 3VFSA 4MCYB 1RUAH 4YK4C 1PJ9A 3V2AR 4WFGD 3L5HA 4NKOA 1SHMA 1PFCA 3BD5A 2EDOA 1P7HL 4TQEL 3HZVA 1AHWB 1ULVA 2IG2H 5EBLB 2BNRA 5F6HI 3RVUD 4R2GC 3GHBL 4BFIA 4MB5A 5CEZD 4WWID 3PUCA 2G9HA 1B2WL 3QH3A 5KBNC 4DEPC 2IPKA 5E8EA 3OX8B 2OJZL 5E8NB 4JZNA 5F8QC 2X4TA 5DT1L 4Y4FA 5T3XH 2DBLH 5EN2B 4JKMA 3HPJA 5E1AA 3P9MB 2WIMA 1KCVH 4JM4L 4ISVA 4U1SB 1ERNA 2CLZB 3T2OA 3IXTA 2VB5A 5C07D 1D5BB 3QWQB 4GT7A 3ILQC 1RQ5A 2VR4A 1JF1A 4MAYC 5T5FL 2ADJA 4X99A 3MRQA 4ZNEE 1E28A 5ALCH 3C5JB 4IOIB 4D3CL 3W11D 3EYOB 3D25B 5DJXB 1ED3A 3MLSH 2XWTA 4XZUA 4FFYH 4NO0B 1EAJA 4FQXC 4U1JB 2LU3A 4GAJH 2NY2B 4FXGA 3KNBB 4PJBB 3W9EB 2FGZA 4XTRD 2BVPA 2BNQB 3BQUA 2OZ4H 1FQ9C 2GCYB 3C5ZC 3GIVB 4R26H 2P4AB 4H20H 5I8OL 4X6EA 1X7QA 5F89B 2BSTB 1G84A 3SBWA 2LE9A 2FCBA 2EE2A 4P2OD 2EXYD 5I1CL 2XZAH 5J4MA 5B38B 1KSRA 4C56B 2HMID 2HFGH 4XVUD 3O0RH 4U1MA 2L7JA 2XY1A 1MPAL 1VFAA 5CILH 5E0QA 2AJZB 3RHWK 4JHAL 3RPIB 3SE4A 3CK0L 5BRZB 3UTTB 2O61A 4L4VE 3TV3H 1IAKB 2DQHL 2ZNWA 1GRWA 5D2NC 5TPWH 4JFFE 3CAFA 3PWVA 4MD4A 3F6LA 3MX0A 5C0NC 2B8OT 1ZLVK 4HCRH 4G80A 5CZKA 3EDDA 4L8CA 1OTTC 5AG9A 1TVBA 5J12C 3JWDH 3JTTB 5C08D 5DUMH 3ZSSA 2DQCL 3LV3A 4KROC 4YDVB 1F3DH 1CWVA 4OLZH 5F7MC 3VXQA 4D0DA 2BRRL 2Y5EA 4LHQB 3KLHD 4EKXA 4LSTH 5C0RH 1I7UA 2AK1H 4TUOB 5CAYB 2CKBL 4S1QL 4PJEB 3MJ9L 4P4KD 2XFXB 4ZFFB 1NC4D 5ISZB 1T22A 5F9DC 3WNNA 2UVFA 2BMKB 2KUTA 2ADGB 5EG6C 1CICA 2VXTH 1PY4A 1XGTA 3O2VL 3BPLB 1AD9B 1JVKA 4Y4KD 1EV2E 4CVZB 4EXKA 2V5MA 3QJFB 2GHWB 1UZ8A 4H25B 5KS9A 3IXAA 3L3HA 5C0DB 4TRPL 2A9NL 5DJDA 3VWJB 2C3VA 1URLA 4L5FH 3AVEA 1YJDC 4X5LA 1J1PH 1KG0B 5HYJD 3DVGA 2EICA 2JELL 2DQIH 3GO1L 2F74A 4QLRA 2LAAA 3EFDL 4Y4FC 1UH3A 2GAZA 3EIFA 3OKMA 1CD1A 3KPRE 1LQSR 4YFDB 4HKZA 1HYRC 2YEZA 3UJJL 1PQZA 3V6ZB 4PRBB 4X6BB 2WAHA 3FT4B 4XBGB 4M1CC 5A40E 3RWJB 3WLBB 2O93L 3GNMH 1UJ3A 1UH4A 2FIKB 4JFQA 4NQVB 4CW1B 4H26A 5KVFL 1DQDH 5I2IA 4RQQA 3BN9D 1EA9C 4WENB 1F58H 1IM9D 1FVEB 3H7BA 1NCDL 4M02A 4OB5L 5JHDA 1FCGA 3PDGA 1NGPL 2XA8L 5KSAA 4GQ9L 1FORL 1QFUH 3PV6B 1HXMB 4KK8D 2F9BT 1QBMH 1KPVB 5KVDL 1LEKA 4PBVC 2AK4B 1S5HA 1CD0A 4OV5B 1JK8A 3QZWA 5E8DH 1AR1C 3FFCE 3I02B 2VZ1A 1XF5A 2AERT 5LWYL 3L3OB 2ADFL 4XP9L 5KN5A 1QVOA 2FRGP 2YD8A 1TZHA 4WHTA 4U1KA 4IRJA 1T5WA 2DJSA 5GGRA 2BDNH 3I50H 1MFBL 5IB3A 2YBRA 4G9FD 1HILA 1YDPB 2G2RB 3GKZA 1JWUA 4PBWD 5ACZB 3FRPA 2CPCA 1HK6A 1FZKB 3GBMH 1ZLSH 4X6DE 4YNYB 4GO6B 5T1DL 1KN4H 4UB0L 5GRUH 3WO4B 1ZT4A 5I73C 4HH8A 4OCMC 2VH5H 4JPVL 5J3HC 3ULSB 4GRLB 2MNUA 3EYQD 4OTXL 5ICXB 1HHJA 5GZNC 3MCKB 1FFNA 3JTSA 4XI5C 1OM3L 4PLNC 5DD6A 1SY6L 2HT3D 3QA3B 3L3JA 5D5MF 2HJFA 1JGLH 3FB7A 3ZT6A 4P5TA 2VDNL 4GBXD 5FUOH 3UDWA 3E2HA 3NFNB 2X4QA 5HGDA 3QWRD 2FX8H 3E3QA 5IGXL 5FKPB 3IAQA 4KKAC 4Q58C 3KVQA 1ITBB 2HLAA 4LOUC 4C55A 2DMBA 3IDIB 1CBVH 1CR9L 3TZVC 1XH3A 4KDTA 3P4LA 3IDJA 3IJHB 4EDWH 4U4BA 2AXFA 3DYOA 1KIRB 4G6MH 2C3WA 4CKVX 4OZFB 3ARBC 1HWGB 5DHYB 4U1NA 2YWYA 5IJVA 1DZBA 5M7QA 3ZTNL 2YPLB 3IGAB 4LP5A 4TULL 4YDJA 3CFJA 5C6PB 4IIQA 2A0LD 1NJ9B 4UQ2A 3HKFA 1HSBB 3A67H 4G8FB 4I8DA 1ZA3B 2GITB 3REWA 2IH1B 1BLNB 3CGTA 1R3HA 4JO2H 3MJ8A 2NY6D 3ULVD 4JRXE 3REVA 3VXSA 3CVHH 2YZ8A 3IETB 3GBNH 4BUHA 1ZKAA 4EI5C 1JNNH 1IBGH 1UJ3C 3G6JE 4OJFH 4DKAA 2P5ED 1I4FA 3O2WH 5GZOC 5C0CE 3P0YL 1NMCC 2VXUH 3MPCA 3EGSB 4JN2A 1Z0NA 4QCIA 2PN5A 4YXKH 3HI5H 2CDEA 3PWUB 5D1QD 2VERN 1PG7X 2GTZA 3O2DH 1A9BB 5D71L 4ZUTB 3DUUA 3QDGA 3IS0X 3OWEA 2ZCHH 4PJ7E 3IDNA 4QRPE 3WFZA 4ZMAT 1QFHA 3NZHH 5MP6L 4G42B 3VG0H 4KRPB 2AEPL 2V2XA 3L3DA 1BBDL 1SYSB 3MBEA 4S1SL 1XIWB 5BW7C 4ODXB 1VEPA 2CJUL 3GK8H 3WNPA 1CDIA 5J57B 2R1WB 4X0KB 1OGAE 1T0MB 5FO8B 1CFNA 1UG9A 3STZB 3UO1H 2XICA 2OL3B 3NIGE 3BWAA 1XR8A 2AEQH 3QPQC 4HW6A 3ZKNC 4YUEL 4OQ1A 4RA3A 3N1QC 2ERJC 4X98B 2JTDA 1A7PL 4HWBH 1QSZA 1I7TA 4NN7B 4RGOL 2YWZA 1U6AL 1CT8B 2R23A 5IB5B 4ZTPH 4LVEA 4F8QA 1FHGA 1RUML 1C08B 5F72S 2E9JA 4NZTL 2FL5A 3BEWB 3OGOE 3OF6A 4R4FH 4FMKA 3O3EB 4HUMB 2ZWLT 1PBYA 5IROC 4B50A 4NQXA 4XNZC 3PWJB 4PB0H 1FNGA 1RUPH 5GXBB 5KG9A 4HKBA 5JXEA 4LK4A 5HDLA 4KPHL 4HFWA 3MODH 4P5TC 1NBZB 2X1PA 2XRAH 3E2HC 4P5MB 1ORQB 1RIVH 2BVQB 1H8NA 1FL3B 1K4DA 2NR6D 1RJYA 1OQOA 4LCYA 4PY7A 1N5YL 4FQHB 2BNRE 3D87B 2P8PA 3P40A 1WTLA 3H9YA 1KPUB 4KDTC 2ICWI 3O9WA 1UB5A 5F7NC 5MENA 4YAQB 2VXQH 3D9AH 5D7LA 2ZKHL 3BPNC 4XPAH 4TYUA 1KCRL 1OT2A 2QADC 2Z91B 3EO1B 1BFVL 5HGAB 5L2JA 3JVGA 5BV7L 2NY1B 2BJML 3GSVA 4JO3H 4PB9H 4X7FC 4XCYA 2BSRB 4UT9L 4HFUH 4XMKH 1C1EH 5DA0B 4FTVA 1RSFA 5T33H 3QIUC 3EO9L 1JZ5A 3DI3B 4NWTH 1EVTC 5IM7B 1NCWH 4QKXB 1YPZF 4NHCH 4BZYA 3U4BH 2JIXB 4HMDA 3SGEH 4NOBA 1Q9OB 1U8JA 4DW2H 5I8KL 4CJ1A 1O7SA 1MAML 5E94B 2ITDA 4NQDA 2EKJA 5ADOL 4LCUB 2VDOL 3ULUC 2AV7B 3MBEC 4Q2ZA 2KH2B 1T1XB 4YXHH 3L9RA 1HWHB 2D0GA 4X6CE 4RGNB 1A2YB 4WY7L 5GISH 3PNWA 1QRNB 3FB5A 3MYJB 5I1IL 1PG7W 3Q5OA 1U8HA 4HQQL 5TE7H 4IMLA 4JO4L 3MTRA 4NDMB 2CRIA 4HUUA 1FNAA 5TF1L 5AAWA 2BOBB 1AFVL 4QOKA 4RGMC 1AKJA 2YK1H 4M62H 4LQ1A 1SJVA 2XTJD 3PGFL 4QXTB 2OTWA 1JPSH 1A4JB 4GG6A 1PKQA 4ELMF 2YD7A 5KSUB 1NC2B 1BQLL 1U8PB 4G6AD 4G8EA 4DGYL 3C60D 5H35A 3MC0A 1MIMH 2Y36H 2ZUUA 4P4RA 4YO0B 5GRVK 1DQML 1C5BL 12E8H 1QZ1A 2ZP0T 3V4VL 2P48B 2WIIA 2CDGB 2EDQA 2P46B 5DS8A 4WCYH 2YPVH 2YHGA 1HH9B 4GSDH 3SDCC 1OAYL 2WUCL 4IDJH 2OSLB 3U1SH 4Z7UB 1BWWA 2JB6A 2Z8VC 5IF0B 4XVJL 4PJAB 4QHLB 4U7SA 2NNAB 3O11B 1LMKA 5F71A 1NAKL 2BVUA 4XNXH 3DROA 1MI5A 2PYFA 2JJTA 3RVUC 5MEQA 5EORH 4Z18A 5EUOF 4OLVH 3DVNB 2NYYD 3DSFL 4MA1C 1CDCA 2B2XH 2WUBH 3BWUC 2ITCA 1N5AB 5EOCL 4I5BA 3WKML 4G6KH 5AUMB 5IBUB 5JO5B 5D7KD 4NJAH 5GGVH 4OKVB 4OT1H 3AS2A 4GKNA 3Q5TA 5LBSL 4JY4A 5I1DB 3GSRB 3R1GL 1J1OL 3Q5YA 1HZHL 3IU3A 1S7VA 3QEGL 1RULH 5EZOL 1BVLB 1QO3B 3LS5L 3W11C 2IGFH 4DUVA 5GRXG 3D18A 4H1LG 1R0AL 4Z8FH 2IEPA 4FQ1L 5KOMC 1D5ZB 4PR5A 4TNWF 2VXVL 5JHDE 3V0VA 4XTRC 1EGJL 1Z9OA 3ZDXF 3G04B 4C59B 5F3BA 2EDKA 4QRTA 3EOTH 3KPSD 2ARJB 5HYSA 2Z35B 2FYYB 1XEDA 4L8SA 5ITBH 1EUTA 3I6LD 1LO0H 1F4AA 2GW5A 5D7SL 1Y6KR 2B0SL 1HKLH 3IDYB 2EXYC 1DQJA 4JM2F 4P2OC 1RJCA 4Y88A 4MVBD 2EZ0C 5IQ7L 1C16A 4G9DA 5GGSA 2HMIC 2L7UA 5JMRA 1KYOJ 4AJ0A 4YWGL 3QFDA 4L4VB 3IDMA 2VIRB 1HXYB 2J6EA 3QEQD 2AEWA 3LRSA 4EOWH 5F7KC 3FTGA 4HXBH 4XPGL 3L3KB 4BSVB 1CLOL 4JFFB 3F7YB 1DP0A 2FO4A 5LVEA 5KJRL 4U7MA 1NCAH 3CUPB 4HWZA 2DL9A 1YN6A 4KTDH 2CK0L 4EDXB 3QUZD 5BZDB 1Y6MR 3OKKB 4DJMA 3RWGA 1W72L 3OSKA 3FO1B 4M4RA 5SX5H 4PJCF 1UCTA 3DARA 1U8MB 1XF1A 4PS4L 3VRJA 4XCEB 4Z0BH 3KLHC 3QDAA 1R3JB 1H3GA 2LVEA 2X7LA 5C09D 3C6LD 4M7LH 4D94A 5LGKA 4NP4L 4PRPB 1OSZA 3BH9A 3HE7A 5E4EC 3S35H 1UZ6F 3BPOB 2EIBA 4MDJA 3T1FA 1VEMA 5GGVY 1A7RL 1YNTB 1JP5A 1Z9LA 2MFNA 1K4CB 2Z92A 4WO4D 2VAJA 3E3QE 3OZ9L 4NQEA 1BWMA 4MA8H 3E6FA 2C4FT 3GJEA 5DJ0A 5DK2A 2X70A 4I0KA 1N3NB 3P4NA 1VGKA 2JJTC 1G9MC 2W0FA 2WW8A 1RZGA 2NY4B 4JG1L 4EUPH 2DQJL 2Z31A 1BJ1H 2A77L 3QHTC 4NPYB 1DL7H 3DRTB 1OPGH 1PG7L 3QG6A 3QRGL 3SGKA 1X4YA 2NY0C 5F44A 3MUGA 4W70A 2E9IA 3GJFH 3O3AB 4OGZA 5SX5K 4UAOB 5IHUH 2HVJB 5DD5H 3KLDA 3QAZC 4WHYH 3S37X 4LLVA 3X11B 1BECA 3VXSE 2DLTA 4ZYKB 1KEGH 4WHCA 1ZSDA 3WS6A 4YHOL 2I24N 3MFFA 2OTUA 5HDBF 1WC7A 4YDLB 4Z7WB 3BN9C 1NFIB 5SX4I 1XGYH 2G75A 3FT2A 3SY0A 2OM5A 1OB1B 3HNSL 4PYGA 3QDGE 4PJ8B 4LRNL 1VACA 1I1AA 3QCTL 3WFEH 2CXGA 1KJ2B 1WAAF 3B9VA 5FO7B 4BSWB 3HC0B 4V3EB 4OCWH 3CX5K 5HI3D 4KV5E 4XXDB 5JQ6L 1A7OL 4UILH 3C9NB 2R15A 3QNYB 3F7VA 3T77A 1IEAA 4I3RH 4MLSA 3VA6A 2QHRL 1G7LA 1JWMB 1WCQA 3DV4A 4RFEA 1RMFH 3Q0HA 1J86A 5JR1L 4QXGH 1IEHA 1MREH 5IT2L 4M7LT 1KBGH 2D4DA 1HNGA 2OQJA 4HEPG 1FGVH 4YHMH 3GJFK 3AREB 1MLBB 1T89A 1BZ7B 1JWSA 4LKCB 4X6DB 2HFTA 4LASH 5C9JA 3O6FD 2E7LA 3SDXE 1OAXL 4LCIL 4G6JH 1A3RL 1TQBB 1S78D 4BKLB 4WW1A 1MCSA 4WEMB 4XCNB 1T6VN 2HWZH 2EDEA 4WW2F 4E41A 2C4XA 3LS4L 4NWUH 1OF2B 4PRNB 3HG1D 5EC1A 4NUJB 2DWDA 4Z77A 2Z4QB 1IT9H 1EXUB 1NGXB 3MRNA 1YNLL 1BQUA 4ZO8A 4QF1A 3TT1H 2HT3C 3WV0A 3PL6B 4L4TA 2LABA 1H0DA 3CSGA 3IS1X 3ULUH 3CPLA 4JFDB 4Y4HB 4GBXC 1JGUH 3B2VH 1RURL 2AKRB 1E6OH 2Y06H 3O3DB 5CP7B 3MXWH 1G6RA 5TF0A 3QUMB 1LP9F 1QQDB 35C8H 5SWQB 1RFDH 2MQ3A 3PHOA 4LLUB 4X4YB 3W82A 3CC5A 2RIKA 4TSCH 1JPGB 1K8DA 1WT5C 1CDGA 5I66B 4WRLA 5MENE 1KFAH 4PFEA 4ZPVB 1FP5A 2VO5A 5D7LE 5DI8A 4K3GA 4LVOC 3HNTL 3KS0H 5D9SA 1UT9A 3TIDA 1ZHLA 2Z31C 1P7QD 3GSNB 3ES6B 1O5DT 1MWAB 1EHLL 1YECL 5EBWB 3OHXA 4DZ8A 4OI8A 5CJQH 2JJUA 1T21A 1E27B 2A0LC 3MOBL 1J8HA 1YEFL 4GFTB 5GJTL 2MHAB 2FX7H 2WQ8A 4RISH 1KEMH 4U3HA 5GRWA 1R5WA 2R9HD 4FTVE 1BX2A 3ULVC 3D39D 4EN3D 3HE6B 3I84A 1S9YA 4J1UB 1VADA 5C0CB 1CLZH 3FAWA 4P99A 3LQZB 1LEGA 4NYLA 3WS6C 2E5EA 3WFBL 2VDMH 4Y5XA 2EH7L 5CIPA 2Y7QA 4MJ4A 4YDKH 1AO7B 1KN2L 4ZFZB 1D5IH 2BY1A 5DJ6A 3TBVB 2EYTB 3GI8H 4PJ7B 3MMEA 1T2QL 4M00A 4P9MH 3WXWH 1EFXA 1U95A 1I1AC 3H3PL 3KPOB 3QWOA 4XP4L 4ORZC 1CDHA 4DGVL 1UCBL 4PBXA 4XPTH 5CEZH 3LMJH 5L6YH 4KJWD 4OZIA 3BKMH 4OZHA 2Q76B 4AG4L 3CSYA 3V5DB 1QYGL 4BQCA 3NAAH 5DZLA 3FMGH 3I6KB 5CP3H 4LHUA 4D0CB 1ZK9A 3RWHB 4V2BA 3G6AA 1U3ZA 2D0FA 1KNOA 3HI1A 1JFQH 2JE8A 3C6SB 4WI3A 3UP1A 3QDHA 5I17A 4FQJL 5J6GA 3VXMB 2XXCB 3KR3L 2A6KA 2GK0A 4GG6E 1PKQE 3O8XB 1RZ8B 4LSUH 3OAZK 1NFKA 3OJMB 5L88H 2EDBA 2D03H 2DQFA 3IFNH 1IC7L 2D7OA 4MCZB 1RJLB 4LSRL 3WUWA 1P84K 4OUOA 5DJAB 2DKUA 3VFSB 2APBA 5FGRA 4G7YH 1PGRB 2DDQL 3V52H 4U1GB 4EQ3A 3HMXH 2WSKA 2YA2A 4P9HC 3WE6A 1MFEH 4UT7L 3EDEA 3ZLQC 3BKCL 3HZVB 5HHXH 1IC5H 2BNRB 3SDDA 3L3GA 1KJMA 2NR6C 3OB0H 4JFYA 1KJ2L 1MI5E 3QH3B 1AI1H 4OLUH 3WNMA 2IPKB 2V5SA 5E8EB 5DWUH 4PJFF 4PJHF 1FNLA 4JZNB 2GJ6A 2X4TB 4DKFL 3BRDA 4I2XA 2OK0H 5HYJE 5I1HH 3EO0A 1KIPB 3HPJB 5EU7C 2FO1A 1UENA 7FABH 2FDBP 3ARWA 3WS3A 4ISVB 4Z9KB 1A1NA 3IXTB 4JR9H 2NZ9D 4WFFD 5DC4B 1JF1B 2ADJB 3IAGC 1E28B 5CCKL 4F7MA 3BO8A 3VMNA 1ED3B 3GSOB 2PUQT 5ADPH 4WWKA 2XWTB 4XZUB 1B0WA 2Z0BA 2ZSWA 2WWMD 4FXGB 3LIZH 4Y5XC 4NFBA 2BVPB 3BQUB 1JNLH 4PJDF 5BMFL 2R29H 4K8RC 3WIIH 1IQWH 2H32A 4WV1C 3RIAF 4ZDHA 4HH9A 4X6EB 1X7QB 3KPSA 2VDKL 3MLUL 5IP4A 3JV5A 1BM3L 1G9MH 3BYTA 3AU1A 3G5YA 3VXNB 1HQRA 4A6YH 5HHNA 5I75B 4U1MB 3K2MC 5T1LD 1TVDA 4BYHA 1VFAB 2OS7A 1J05A 5HHQA 3ZKMD 5BXFA 4YBLB 2R4RL 5ILTH 2D7MA 4E0RA 2O61B 3O6KL 1FVCA 1AGDA 4YE4L 3LDBC 5HVWA 3DO3A 3F62A 3UROR 1U3HD 3PWVB 1QSFB 2FH8A 2OBGA 3S96B 5SWSA 4LSPH 3MZGB 3DO7A 2XTJC 4G80B 4K7FA 3K3QA 1LNUA 2J8UA 4K94L 4F7PA 4L8CB 5E2VL 1TVBB 1MWAL 1R24A 3L5JA 1FC1A 4D0DB 3VXQB 4G6AC 5C0EA 2N7AA 1X3DA 1I7UB 3C60C 3TO4B 5IB2A 1I1FA 1IJ9A 4EIGB 3RUGA 1ND0A 4ODHL 2V9QA 4NZUL 2HKHL 1G6VK 4RFOH 4XCFL 1T22B 3UTSB 1CICB 1IGML 5T1MA 1XGTB 3RWDB 1A6UL 3QHFH 5D72L 3RKDD 4YDIL 1DBKH 1UZ8B 1J0IA 1KF9B 4NQEE 5E2JA 5KS9B 5LGJB 3IXAB 3L3HB 3FKUS 5TFSH 5DJDB 3FN0L 2QQNH 2C3VB 3GMRA 3R0NA 3S37L 5J11B 1F2QA 2H9GA 2NYYC 1OD9A 1GGYA 3UZQA 2HJLA 3DVGB 4HF5H 4LEOA