1A9EA

Decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
277
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B*3501 (ALPHA C
publication title Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to non-standard positioning of the C terminus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class i/peptide)
total genus 77
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1998-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a9eA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a9eA01
3WIHL 2IFFH 4AY0A 4U6TA 1NKOA 5F3HB 5E2WH 1G7JA 2JK5B 3RWGA 3VE0A 4K3DH 3ULVD 3DV6A 3ZSTA 4JR9H 2DYPB 1BD2A 1A3RL 2JIXA 2Y06H 2WWMD 1WBZA 2DQJH 1UB6B 5HHVH 3WIFB 1G7HB 3V52H 5F7HA 4ALAL 1EDQA 5CJ5A 3L3GB 3LHPH 2EDKA 5GGVH 2GSGA 4PJDA 5DQJA 3SKMB 2VLJE 1D5BA 3O4LB 4RISH 2DQGH 1KCSL 5BV7L 2ITDA 4GXVL 1KCRL 3L5WB 2ZG2A 3IDNA 3KLDA 4PJFF 4RGND 3I75A 1ZA3B 4G6AC 4KZDL 4MHHI 3HI5H 5DD3L 4BSWA 3U82B 3NCFB 2O5ZL 4UQ3B 1OSPH 5KSAB 3RX5A 1FRGH 4PJFE 4K94L 4M6MH 2NY5L 3S7GA 3EJZD 1WTLA 3MRIB 4NQDD 4G6FD 5ISZD 2FSEB 4PJBF 3HMXA 3HI6L 1DDHA 4QHUB 5EZIH 2J8UF 2G2RA 1UENA 2P46B 3V5KB 3QJFB 5LG1A 3FB5B 4WO4B 1MY5A 3GMNB 3KS0H 3PGDA 4DZ8A 3RAJH 4J4PA 1U91B 5I75B 3QCTH 1HKFA 5F7DB 2EIDA 3A67H 4PJBE 1ZVHA 3MV7A 4LSVL 2J8UE 4HUVB 2ED7A 3MV8D 3MZTA 3LOWA 4AMKH 5CEZE 1U8KB 4OZ4A 5C0AA 1RUMH 5DTFA 2E9IA 5GXBB 3MGTA 3QH3A 4G3YH 4QY8B 2OZ4L 4LSTL 5BZDB 1L7TH 1RUPH 1DZBA 3WV0A 4XC3H 4WFGE 5IFAH 3ROLA 3EOAA 5HI5D 5D1QA 5GRYA 4R96A 4M1GH 3VXUB 3C60A 1G7PB 1NFIB 2VXQH 1B0GB 1E6OH 1JPTH 1I3RA 3O45B 3E8UH 3C5SB 1JWSA 1QFWI 1P7HL 5EO0B 4PJGB 4LHJB 5IJVB 5CKGA 1I9IH 1FAIL 3F58H 1KC5H 2HFGL 2HFTA 3VDBA 4UIMA 3EJYC 1AP2B 1TETH 2DMKA 1JNLL 4MA7L 1G9NH 3F5WA 1N0XL 4UB0L 3SGEI 1UQSA 5CBAA 2V9RA 2BNRA 4OLYH 4X6FB 2DM7A 3BDXA 2K7PA 5EA0H 4ZD3L 1H8NA 2WP3O 5DLMH 4TVPL 5FYLL 1QPPA 1OW0C 3SDCC 3QO1A 3MBXL 4LASH 4NQXA 4OJFH 3HC0B 2RFXB 1H3PL 4OZFB 3TN0A 3BE1H 3VFNA 2VLJD 3TBWA 3CVHH 3E6FA 2RJMA 3VXQA 4DVRL 3I3BA 2YSSA 4G43B 1WAAF 4XC1L 3WKML 1K4DA 1WFOA 2AERT 1QHPA 2WUBL 2VLME 3M17B 1YEHH 2R9HC 3VXPB 4LVOB 4Z18A 4L9LA 2XTJE 1WAAE 4R90L 3C87A 5GRJH 3EGSA 5DJ8B 3IFNL 4D0CA 5B8CA 1QP1A 4K7FA 5BQ7A 3QIWC 5IBLC 1RZIA 4O58H 5GGRY 4HIHB 4P59H 2AK1H 5DR5H 4ISVB 2NQCA 3M8OH 4OIIL 1CR9H 4IHOA 4AIOA 3TFKC 3Q1SL 3PL6A 1VPOL 3SE8L 1MHCB 5FGRA 5DZNA 4JKPL 3D2UD 1W72L 4PJGF 4L4TA 5CEZD 3VXUE 1G6RL 5IBTL 3BP4A 1EJOH 2G9HB 5L7XL 4FMFA 3SKOB 2YPVL 1MWAB 1QSEB 1HZHH 3H3BC 4PRHD 2B20A 3M1BB 1N8ZB 1JYNA 1CXKA 3MRFB 4KTEL 4B50A 1KBGL 1LDSA 4G80B 4IIQA 4M8QB 4RQQB 3VFGL 4K9EH 3VGFA 5H37H 4H0GA 3BX7C 5EOCJ 3LQAL 1BM3H 3P30L 2C1OA 3HZYB 3BPNB 4X5LA 1F13A 3ARGD 3BZFB 4GMTL 3GSWA 1DN0A 3RNQB 5IB2B 2CUIA 4XPHH 5E99L 4CJ1A 3V6FB 3QUYC 3FRUA 3E3QA 3FN9A 2BRQA 3I84A 3RVTC 4OFYD 3TESA 4YXLL 4LK4A 3HAEA 4KUCD 4S1RL 2YHGA 4U05A 2F5AL 5DK3A 4JVWA 1R3HA 1XCTA 3BAEH 3RDTD 3TNMA 2XYCA 3MOBH 1RMFH 2XZAL 2Y6SC 3NGBB 3IDXL 4FQ2L 3LV3A 5HGBB 4N8PA 2OL3L 5T1LB 5DYOA 4OZGE 4RGOL 5IB5B 5A3IC 3UPCA 1XGRB 1FVDA 1KCVH 2VITA 3IAGC 2BOBA 5J6HB 3RI5K 4XNUL 1H3GA 2EE9A 4F9LC 3D6GA 1F3RB 4F57H 2FJGA 3GSNL 4MA3A 1A7PH 1YUHA 5F6IB 2Z31B 4KPHH 1OARH 1ERNA 4X7CC 2R4RH 5KVMC 2XTJD 4XP5L 2A0LC 3TWCL 3V6ZB 4WI2A 4JPVH 5FA3A 1I1CA 4POZD 4Y5VC 3P0GB 4EUPH 1KIQB 3FB8B 3F7QA 3PIQB 4NM4H 4CN4A 1G0DA 1H15A 4GAYB 1GIGL 2VQ1B 5I0DA 4LLUA 2MHAB 2VDPH 5BVJB 5IJKA 1UWEL 4WV1A 1UWXH 5MENB 2NY2D 5IHUH 1P4BH 2ZUXA 3I6GB 2ZNWA 4G8IB 4M1CD 1UCTA 1F2QA 5I2IB 3WDIA 4PJIB 5C92A 1N59A 3QUMB 3ULUH 4BFGA 1FCGA 2HTKD 1KPUA 2X4OA 1KJ2B 3QNXB 4G8FB 2EYSA 4LHUB 4X6DB 7CGTA 4FQQB 5DSCB 1YYML 4WW2A 4KJWD 5ISZA 4NQDA 4G9DB 4ZDHB 3CCHB 1I7ZA 4D9LH 4HIXH 5EN2A 4Z7NF 3UC0H 1KULA 2Z4QA 4PPTA 5DK0B 2V9TA 1OT1A 1FCCA 5GGSA 3RIFF 3QQ4A 3KPLA 5F1NA 2HLAB 4Z7NE 3SGKC 3MV8A 1SBSH 5F7WC 5MEOB 3IDJB 4NQVB 4NRXA 5CHNA 5JOPE 1FLRL 3P0YL 2BY0A 1G9NC 4RRPA 3GEWB 1K5NA 1HSAA 1JNNL 1MHHA 5EUOF 5GRWA 2DB8A 3RA7L 1S7WA 3MXWH 5JIKA 5CJ8A 3RWHB 3IXTA 1RIVL 3O6ML 5DJCB 4D9RE 3F6LA 1I7UA 2ZOKB 4G7YH 1N5AA 1IL1B 5I19H 5EUOE 4NO0B 3S4SA 4FTVB 5FOJA 2P5ED 4OGXH 2ATKB 4WEUD 5JUEL 4P2CG 4LLYA 2GK0A 3V4VH 5EZOH 3L5HA 4ODHL 3MRCB 5LXGL 3DTXA 4MA8L 1C7SA 4PJIF 1MCOL 2KH2B 4R3SA 4Y16D 3STBA 3TBYB 3MJ8B 5MEQB 4X6DF 5GJTH 4FFVC 5B38G 3DIFA 5I15H 1EXUB 1DEEA 4PJIE 1SJXA 4PRPE 3RNKA 4N0UE 2VAAA 3T0BA 3TJEH 4L1DA 3BO8B 2C1PA 3QCVL 4P4KC 1MY7A 4POYA 1UYWH 2X7LB 1LNUB 4X6DE 2VDNL 4URTB 1RZKH 5IQ7L 2DWEB 1WT5C 4TUJA 1MQKL 4A6YA 4LPWA 2NZ9D 2D31B 4PBWD 2QADC 2VZVA 1JGVH 1XGPB 4QHNB 1I3VA 3GMPB 2KQMA 4MQ7A 5DVOA 3BQUB 3FN0L 1H8SA 4ZOBA 1U2HA 4EVNB 5DJ2A 2YZ8A 2Z35B 1MEXL 5KVEL 2AVGA 1ZHLB 4GAJH 1HINL 2AKRB 3DSFH 3R8QA 2NY0D 4PB0H 1P7QB 3G5ZA 3MRLA 5IB1A 5DVKA 1CG9A 1JI2A 2A9MH 5JPMB 3L3OB 3QNYB 3O9WD 2Z8RA 5CZXC 5JXED 3G9AB 4LAJH 1OB1B 1EO8L 4KRLB 4IRSD 3AM8C 5A2KH 3BGMB 1MLCB 1UEYA 3T2QA 5EC1B 5D6CA 4MXQD 1NDMB 3KDMB 1JZ8A 2HT2D 4TTGA 5E6IB 1MCPH 5EU5A 1NLBL 2EDXA 5TDOB 2CRMA 1V8HA 3V4UH 2ILLA 4PJ8C 5HHNB 5EOTA 3GK8H 1RZ7H 3D2UA 4K7PY 4U0RB 3DPBA 2R2HA 3N0PB 5JOPD 4M6OL 4TUKL 5GSRA 4U3XA 5KVFH 3FHQA 5FUCE 5I8OH 2V7NA 1NAMH 3VGEA 3MRNA 1T80A 4LU5L 1AXTH 4P3CH 4PRHA 1OTSD 4P2QD 4AL8H 2HJFA 4HEME 3Q6FB 2E7MA 5LCVL 4KQ3H 4OKVB 4WJ5B 1CLYL 1V7MH 1IT9H 1MUJB 3BWAA 4LCIL 5HDQH 5GIRA 2J88H 3GSRB 4UUJA 5DVNA 1F6LL 2X4QB 3NMEA 4HS6B 4NKQB 4XNQB 4TNWF 2FD6L 3ARGA 5EO9B 3GHEH 1WIPA 3HPLA 2PTUA 1D6VL 5HGHA 3QUXC 4O00A 3REVA 5IFHH 1VEPA 5KW9L 4WFED 1WWAX 1P4IL 25C8H 2CDEA 2ZPKL 5T3XE 1F02I 1HXMB 3TNNA 2VDOL 1A2YB 4OFYA 5FFLA 4OFDA 4W4OC 3QXAB 4PRPD 5MI0B 3MJ7B 5DA0B 2BP3A 4QXGH 3QDJD 5C7XH 3SCMB 3RDTA 1EV2E 4YGVA 43C9B 3C5ZD 3P0VH 2BZDA 1AO7B 4KVCH 3ULUC 1OAQH 2CLVB 1INQA 4OFPA 4G42B 4R0LA 3S97C 2O26U 2G5BB 5GISL 1CL7I 4XCEA 3SO5A 3CUPA 2CIIB 1OAUL 2H32H 2XWJA 1OAZL 5C07D 4WHYH 3UJJH 2YA1A 3BMWA 4M48H 4F3FA 2X4RA 3C5JA 4XH2B 5IG7A 1D6EA 4JFPB 1FFOB 3JUZA 3F62A 4QTHB 3SE9H 1CICC 1WAAA 4JG0L 3MLRH 3VCLB 3OKKB 4Q6YA 2ORBH 3D39D 4RFOH 1ZGLA 3FJTA 5CGTA 1VCAA 4XRCB 1AY1H 2HJKB 4QXTB 4AIZA 1DQMH 3DV4A 3THML 4X80L 4NO3B 5KANG 1C16B 2PYFB 4YPGB 5FUOH 3RGVC 5C6WH 4OZIB 4FFYH 1FNGA 4PYGA 5I8KH 2OTWA 3RWFA 3HNSH 1RZJC 3QXWA 4CRPA 2NXZD 5BJTB 5HXMA 1R3IL 1A3LL 1UEMA 2B1HL 1KV3A 1YEFH 1FIGH 4L4VE 4M6NL 3MRRA 1R5IA 5A2JH 4P23D 4AQ1B 3KJ6H 2EZ0D 3QDMD 1DUYA 1T83A 2AI0H 2X4PA 3O2DL 4DKFH 4UT7L 3NCJL 2OTUB 3KYMB 1JGEB 1FL5A 3BUYB 2FR4B 5D7IB 3ARBD 4AIXA 5I18H 4DAGL 1CLOH 4HS8H 1FNEB 1NQBA 1YQVH 1FNFA 3HMWH 3I2CL 1AO7E 1I8IB 4K3JL 1MCKA 3AAZA 5HYJB 3KG5A 4HPYH 1QSFD 4MX7B 4DK3A 4KXZH 4QT5B 3VD4A 5TF1H 2EDRA 2NYYD 1T7YA 4NN5B 4ONGL 2PNDA 3ZKSD 5FUZL 1AKJB 5IMOB 2IH3A 4WW1A 1W0WA 4PRIB 2JCCB 2N1KA 2R29L 2EKSA 2H1PL 1ND0B 3D9AH 2P5EA 4BH8A 1WTGT 1VEOA 3O6KH 1QR1B 5TPWH 1CFNA 4OZGA 1F42A 2B5IC 3OXSB 3K2UH 5ACZB 1M6OA 4NZDA 3QI9D 1OWRM 4OZIF 5ETUB 5FA4A 3VFTA 5FYLE 4TVPE 2OYPA 5ICYB 4L8CA 1S3KL 2BDNH 4BFIA 4Y16A 4MJ5A 3T77A 4MB4A 4UU9B 2R0WL 5GGUB 1ZHBB 4JPWL 4YR6B 4Y1AD 4TQEL 1RUAH 4P46C 3PHOA 4KDWA 5F88B 4KWUA 1I85C 4PUBH 1A1MB 2FCBA 2AEQL 3FFCB 3BKCL 1EVTC 3MGOB 2JJUA 2G75B 2E7HA 4ORGB 1RY7B 4R9HA 5D7IF 2W91A 4MS8D 3U0TA 2X41A 4I0PD 2YWYA 3WMSA 4LVEA 3GNMH 3SQOL 2DLGA 2OBGA 3FO1A 1ZOXA 2F74A 3P4MA 4GRLC 3CSYB 1IFHH 5D7IE 4ELMF 2AJXL 2AV7B 1EHLH 2ICEB 4MD5A 5HTSA 5I1DB 4HGWB 2X1WL 1U92B 4WNQA 2RBLA 4MYWB 2JCCF 3MUGB 3X11A 5JXEA 4L4VD 1CD8A 1NPUA 4XI5C 1HHHA 3MR9A 4ELME 2W9DH 4DFHA 4IRSA 5B38B 3CX5J 4BM7A 2X1OA 5EU3A 3SO3B 1U58B 4HC1L 3OR6B 4MXQA 1IGFH 5GS2H 2JCCE 5FHBL 2RR3A 4NKOB 4FFEX 1U8PB 3K3QA 1W8NA 1T1ZA 5JIPA 1XGTA 2XZQL 5F93C 1I8KB 1WBYB 4YNYB 3DETD 4HXAH 3KLAB 5MP6H 2V2XA 3N1GC 4P2OD 3GBNL 4RMTA 1CFSA 2Q86A 1XR9B 3QEGH 3MCKB 5L88H 4PTUB 4JFYB 2EDTA 1E4WL 2RIKA 2VZTA 4HDIA 4P2QA 3R06A 7FABL 3LEYL 2XQBL 1QUNA 2IMNA 1FE8L 2DQUH 4YK4C 2VLLB 3PWLB 1BQSA 2BSED 3MRPA 3RWCB 5D7SH 5EUOA 2WSKA 3FHAA 4K2UH 1DQJB 3PXHA 2GJ6D 5EO1B 3FFCE 4PIRF 5EG6C 5I9QB 4OGYH 4V1DD 5CJXA 1AE6L 4ZYKA 2VUYA 4OGAD 4EOWH 1CU4H 4XWGH 1NC4A 4IRZL 1IRAY 1H3VA 1OD9A 1CFBA 1A5FH 4TVPD 3FFDB 5FYLD 5JQ6H 1FN4B 1SYVA 2C4XA 2YN5A 1U41A 1X5GA 4HS3B 4ZXBB 3FQTB 1NC2A 3QZWG 4YWGL 1OM3H 5F9DC 2J6EA 1T0PB 1MFNA 5DI8A 4P5TC 1I1AB 4YUEH 5JDSB 5ENWB 3W39A 4PRPA 4N0UA 6FABH 5EDXA 1FO0L 3UROR 2JTDA 3QDJA 2CKNA 3VXRB 3P4OA 3C5ZA 5ID1A 4BKLA 32C2A 1LO4L 3QHFH 4UILH 4HUMB 1CF8H 2A83B 4KUZL 3SY0A 3L7EB 4HZLB 3CPLA 3TV3H 1NL0H 5I66B 4ODXA 1MHPL 5CZVL 4KKLD 1MVUB 4YDJA 2H9GA 1IEBB 4XTRC 3LN4B 2APVA 3TJHC 3U30C 3UPRB 2M8XA 5D7KE 4MAYD 2CD0A 5C07A 4Y4HB 3AB0C 3V5DB 2I5YL 2L7UA 3KAAA 1NGXB 3RZCB 3U46B 4ZTPH 4LCYB 1DUZB 1T5WA 4HMEA 4Z7WA 4NFDA 4JGJA 5MHSD 3D39A 2GK2A 2ZWLT 2B1AH 3UTPE 5I73B 2VZOA 3G08A 3VXTB 4LVHC 3OAYH 2WUCH 3WIIH 2F19L 1QBLL 4DN4L 5EZJA 2VDLH 3MOQA 5CLTA 4M9OA 4PGCA 3NZ8B 2HN7B 2BK8A 5DUBB 4OD3L 2E9JA 2Q8AH 3BZ4B 3V6OC 5F9JB 2CQVA 4LOUD 5HHXL 1MWAL 1TQBB 2BXYA 3PDOB 1UJ3A 3DYOA 2CJUH 4OF5A 3WFHB 3OKDA 3FAXA 4P23A 1MFAH 3QDMA 1YDPA 4OFKA 4XP9H 3DMMC 4XNYL 4JREC 2FEEI 1URLA 1WSST 4MXVF 1F8TL 2ZOLB 3TVMB 3IJSA 5DMKB 2NZIA 4JN1L 1A3QA 3TPUE 4WWKC 1NCDL 2IPUG 4PTTA 3ARBA 2QSTA 1A1OA 3UTZA 5CLWA 4M5ZL 4HX1B 5AZEH 4ODTL 3DJ9A 4TSAL 1LK2A 4MXVE 2VLRB 1BPVA 2PYEE 2J2ZA 1DP0A 1FZOB 2BOCA 4TOYL 5D2NB 1KENL 1QSFA 2E3VA 3D25B 2VNCA 3CMGA 5AZ2L 1SEBB 2HG5B 4PLKD 3UTQA 5CP3A 1NGZA 3UTTB 3WIHA 2C7UA 1AHWA 1TDQA 1RURL 4NHUB 1WWCA 1Z0MA 5F96H 1YEKH 5T1KB 5EUKA 1FL6A 5JPNB 1LO0L 1K8DA 2B8OT 3BP7B 1I9JL 5D2LB 1A14L 2H26A 2EKJA 3BHBB 4OIBA 3QI9A 4PGBA 3AREB 4WU5A 1IBGL 1ONQA 3B9DA 5ICXB 4Z6AT 1H5BA 1ZT4A 1P5VA 2MQCA 1FIEA 3L3HB 5D7KD 5E24E 4Y1AA 3GMRA 4JFOB 5ANMB 3CD4A 2YC1B 3HAEH 1JPGA 1WISA 3MNZB 1DVFB 3RVWC 2FLBT 5IUSA 3LZFH 1IMHC 1AIFB 3MRBA 4X0KB 4XPBH 4HHAB 3DRQA 4H8WH 4GKSB 1B2WH 3UTPD 4MS8A 2HYMA 4M93C 4M7ZC 4I0PA 3PV6A 3OKNB 5KANI 1CBVH 4DGIH 2XY1A 4S1SH 1OPGL 4HK3N 5DJYB 2P8PB 4XNXL 1YNTA 2AJVH 3C6LB 4M5YL 1KJ2L 4J4PC 2VLRE 2V2WA 1NUFA 4O5LH 4M62L 1V7NH 1OGAE 4KJYA 2OSLB 4RZCB 3VFRA 1IQDB 3CFKB 2OZ4A 3OAUH 3PHQA 4PGJA 3HLAA 3MV01 1FVCA 1S9XA 3FMGL 4PJAB 5D5MA 4YE4H 5AAWA 3G6JB 4K8RC 4YBQD 2UUDH 3MRJA 1NCBH 1U2CA 3EYVB 4KK5D 3OXRA 5FB8A 1MAMH 1JHLL 3LEXA 5IVXF 1QLEL 2PYED 4NN7B 1KOAA 1N64H 4P2OA 5J11B 5L8LB 5IEHB 3IVKB 2Y5TA 3NPSB 4ZUUB 4P4RB 2NY4B 4FQHA 2HFFA 1T1YA 5D1QC 3IRZA 4PP2A 5IB4B 5F97E 3C60C 1FGVL 3DRTB 3BI9X 5IVXE 2VXSL 4OLXH 4MNQE 2CDGB 3SKJH 3QUKA 3A6OA 5D1XA 1DQTA 3I3EA 3H6JA 4MDJA 4ONFL 1BAFH 1FFNA 2R0ZL 2DTMH 2GJ6A 1DQQA 4EDXA 2QQKH 3OHXA 4V1DA 1E28A 3RY5A 1GYAA 1EJ6A 1U3ZA 3RZWA 3T0ED 1S7UB 3UYOD 1IEHA 2X2YA 3RVVD 4JJHA 1MCQA 3QR2A 1K8IA 1U3HD 3P4LA 1NMAL 1A9BB 1GGCL 3L6FA 4LFHG 3CJJA 4GMSL 1R24A 1I7TA 3VWJB 5SV3A 1O0VA 1AGFB 4XMKH 15C8L 3TN0C 1DLHA 4JCLA 3LPWA 4S0SD 1TJIL 5INCB 4KMTL 5EZLA 1CD1B 1EMTH 4UOW1 3MV9B 1YC8A 5FK9A 4LIQH 2DQHL 3AROA 4PJAF 3EJJX 1A7OL 1JTPA 1HQ4A 3G6JF 4UBDC 1QG3A 2YD6A 3S6CA 1YMHB 3QIUB 3V2AR 1IZKA 5AYUH 4L9LC 1UA6L 3MX0A 1U8LB 4W6XB 2WBWB 3KR3L 5B8CC 4PJAE 4MAYA 5F1IA 5IIEB 4W6WB 3GMQB 5C0IB 3G6JE 3MLXL 4YEFA 4PGDB 1UH3A 1OP5K 1W72A 4ZUWB 4PJ9B 3QRGL 3REWA 5GGTL 2MKWA 1G6RA 3NA9L 3PL6C 3QZWB 3SJVB 4D0BB 1OGAD 4ELMA 1T1XA 5HYQB 4G6KH 1Z5LA 1JYVA 4TUOB 3JV0A 5ITFA 2AGJH 2WMPA 4FP8L 4HUWB 1RZFL 4NGHL 2DLFL 1KGCD 2A6DA 4U31A 1NGQL 1MCWM 2WWKT 2D7PA 4Q0XH 2DBLL 5FV2A 2R1XA 1FORH 5DMIL 5T5FL 1P2CB 5DEFA 2JB6A 3MCG1 3SPVB 3OKYA 4IIQC 4HFUL 1ZLWH 2HJLB 1A64A 4EJ1C 1I8MB 4M1DH 5T1MA 5I1AB 1GHFL 1AGCA 2C3VB 1NCCH 1MCBA 1KPVB 3AMKA 5GJSH 4QRPD 5J13B 5TE4L 5HI4C 3LS4H 1N6QL 1S9YA 1LO3H 1OAKH 4MNQD 4XPTH 4KKAD 4BQ6A 2HMID 4Z7UB 4S1QL 5DGQA 5GRVL 4LPUA 4NQCD 5LBSH 3BEVA 2YRLA 4YGAB 3E3QC 4Z7VF 2NNAA 2YUWA 3LD8C 4X4YA 5HI3C 2A6IA 3U79A 1I3GL 3F6IA 5E2WL 3HR5A 4K3DL 1YNLH 5T33H 1DE4B 1YY9D 4Y19E 2OL3A 5HY9A 4JR9L 1B0RA 3CFIC 5SX5K 1FC1A 2Y06L 2Y7QA 3S88H 4Z7VE 3BPLC 3I6KB 4FQXD 2H8PA 2DQJL 4TPRL 2DQCL 2FL5B 5HHVL 4MJ2A 1JZ7A 4H8WC 4WUKH 3LHPL 2YA0A 2OXHA 5CBEB 5GGVL 4U1LB 4AG4L 3VH8A 5ACLA 5ECJE 1IAIH 1UC6A 2J8HA 3MREB 2DQGL 5JW4Q 2XKNA 1PKQB 2V2TB 3GSNA 1BOYA 4S2SB 5BS0B 3BXNB 1NBYB 1FL3A 5EIQA 1CDUA 3SDDD 5TE7H 2D4DA 3INUH 5LQBL 1LQSR 3D0VA 3STLA 2X4NB 3ULVC 2EH8H 2Z93B 3BIAX 3TF7A 3BT2H 1FYTB 1OSPL 1QRNE 1ZHNA 4M6ML 2QQQA 5KAQG 4Q6IB 2EE3A 3LQMA 2YXMA 3MSPA 3BD4A 5EZIL 5FIEA 1MFEH 3KGRA 2AQ2A 1KPRB 1JMZA 4EDWH 3VW3L 4HSQA 5IJKC 1ED3B 3QCTL 1J18A 3QO0B 5HHOD 4PR5A 4WV1C 12E8H 1JGLH 2CKBB 1Z9MA 4RGNC 2FJHB 4Z7UF 4MA1B 1HXYA 3S35X 2FX9H 4QCIB 1E4XH 4AMKL 4LP5A 3TA3B 3NIFF 3WSQH 4HT1L 2D7QA 2ICWI 4KV5F 3GO1H 4ODUA 4G3YL 4EN3D 4UINH 4BQCA 4WW2C 4Z7UE 2OJZH 2DQIH 3EJZC 2QSVA 1RUPL 1CFTB 3NIFE 4R26H 4XC3L 5IFAL 3SGJA 4KV5E 1ZS8A 3EZJB 2NTFB 2RCSH 1V3JA 2B4CH 5FKAB 1TJGH 3TIEA 3MCLH 2O5XH 5E7FA 3CDFA 3OZ9H 4WTWA 4HEPG 4Z0BL 3NIDF 1F97A 1RJLA 3EYOA 4G8EB 5LAXB 1NCNA 1QLFB 2VXQL 1AJ7H 3O3DA 5FM5M 4O02H 2YD1A 5DC0A 4PJXF 3CNKA 3NIDE 1I9IL 3F58L 1UXSA 2C3HA 4ZOEA 1HN1A 3AS0A 4GLRH 3MRHA 5BS0E 4IS6B 3ALXA 4NWTL 4Y19D 2PYEA 4PJXE 4AM0A 3BPOC 2CIKA 3J7HA 4I5BA 4FXKB 4LLQB 4Y8AA 4CW1A 4OCMC 4OLYL 4ELKA 3VFWB 1N4XL 5HI5C 1Z3GH 3PGFL 1FZJA 3TP4A 1ZGLP 5CIPH 1BFSA 5KSBB 5DLML 3N50A 4HBQA 1JWUA 4LLVA 3LKRA 3KPOA 2D7OA 4LASL 3MGAA 4OJFL 5DRNA 3R4DA 4I2XE 4I77H 3F7VB 3AGVA 3DBXB 2F54B 3CVHL 43CAB 5C0GB 1INEL 2WINA 1QOKA 5JHLH 4JZOA 4WDIB 2GCYA 3EOBA 1I1FA 4I3SH 3HS0B 4QHMB 5C0EB 1YEHL 2ITCB 1QRND 2A77L 3T0EA 4KJPD 3KYOB 2EDFA 3U36B 4ENED 5GRJL 2DQEH 4NKMB 1DBBH 1MNUH 3RY4A 1U3HA 1MFDH 5KBNC 3RI5F 4PJHF 3BVNB 4WFFD 4O58L 5IMKB 4LLWA 5DR5L 2AK1L 5I16B 3RL2B 1CR9L 1AGEB 4PS4L 2R0LH 5SWQA 3ZTJH 3IF1B 1XF2B 1ZTXH 3X12B 5CJOH 3PXJA 4WI3A 4PJHE 5FO7A 4LLMB 4P5KB 4F7TB 5A2FA 1EJOL 5MEPB 1QQDB 1GXEA 3KPQA 3VXNB 3WNMA 1HZHL 3QXDB 2CMRH 5IHZA 3P9MB 4C56B 3SOBH 5J57B 4U1IA 1J12A 5I8CB 4OZHB 4K9EL 1A6UL 4KHXH 3LN9A 5D9SA 5EIIB 2GUOB 1OGAA 1BM3L 2B39A 3LKPB 3SDXB 2M26A 3UZQA 3KWWB 1TFHA 4JJ5B 4IOIB 2X9XA 5TF0A 2YPLB 3QISA 2PW2A 2ZCLH 5H35B 3ZYOA 3MNVB 4HKBA 4LF3B 3AC0A 4GG6B 1RULH 3DROA 2PW1A 5E8EA 4HFWB 1T2XA 2VLKB 4UV4H 3MNWB 1MRDL 3IETA 3BZDA 1HHGB 1G7QB 5BMFL 4U49A 4NQSB 4QRPA 4M61B 3G5YB 3ARGC 1Z6JT 5IVXA 1JF6A 1G0YR 2BNQD 3B3IA 1K4CB 1KCVL 3ARDD 4NQCA 4KMLB 4HH8A 3B4NA 4XBPA 3GSUA 4P9ML 1S9VB 3IDMA 1LEKA 2FZ3A 4O51A 5J1SC 1B4JH 1DCLA 1OLZA 4F57L 3U0WH 3IDGB 1OARL 2R4RL 3RDTC 3T1FB 3ILPA 4FQXA 2J4WH 3Q5YA 2XA8L 4HK3J 4OZHF 4JPVL 1YPZB 5CGMA 1JNJA 4XVTL 1M71A 1OAXH 3PJSA 4NM4L 4OLWH 1QNZL 1HYRC 1VACB 5I30L 3SDXF 4R0LC 4N0RA 4PG9B 2P48B 4OZHE 1P4BL 4YAQB 4AENB 2OCFD 3NCYS 2FIRT 2H3NB 1LVEA 3G5VA 4WEBL 1MLBB 3O3AA 2E8ZA 2GIYA 3SDXE 3WEXA 3U7YH 1QVOA 4KY1L 4ZPTB 5L2KD 1ZMYA 3FOMB 2X09A 3MO1B 4WFHE 1N5YH 1CZ8L 2XTJC 1HDMB 5FYKE 4HIXL 3KYKL 4F37K 1WUNT 3HZMA 3RWJB 4HV8B 2PO6D 4POZC 1LE9A 2HT3D 4GH7B 4JKWA 2Q8BH 1FFRA 3DYMA 2UYLA 2VLKE 5E6YA 1KXVC 4NZJA 4Y2DD 5HHOA 4EIGB 2XV6B 2NY2C 5DFTA 2BVQA 2VQTA 4YDKH 4M1CC 2EC9U 3H9HA 1C08B 2GSIB 1YYLL 4Z95L 1S9WA 5IESH 2HTKC 4ZPVA 3WHE1 5DF0A 4EN3A 1YEIH 4EI5D 3O2DA 4P5MA 4KJWC 1ORSB 4PLOB 3MXWL 4V3EB 1YA5A 1T83C 1BX2A 4X8JA 4ETYA 3NTCH 1YPZF 3HKFA 2P7TA 1EEYB 2F53B 3EO0B 3NN8A 4U1GC 3RFZC 3V5HA 2AJZB 4OGXL 1R3JB 2QR0A 1JYWA 3GB7A 3SDYH 4XP4H 3WO3B 4RMSA 5EZOL 3QIWB 5KG9A 5DQ9B 3CX5K 2FB4H 1YPZE 2WLYA 4MJIB 2XZCH 1KCGC 5FYJL 2CXGA 1QFPA 2CUMA 1F4XL 1MFBH 5HGDA 3NACH 3S96B 1XCQB 1JZ6A 4N0FA 3G6AB 1KJVB 1X6NA 5GJTL 5CFHA 1KIPB 2VJXA 1MIEH 5I15L 5E7BA 4RAVB 2QKIA 4Y19A 2V7HA 3TJEL 4XCNA 3WN5A 1T2JA 1M7DB 2FO4A 2ZP0T 4Z7VA 4QNPF 4FXGA 1KXTB 4ZFOB 3KPNB 1RZKL 4FZEL 2FLRT 1FNSH 3UYRH 3EZ8A 5DEGA 1ZVSB 4KTYA 5SWSB 4JAMB 5F3HA 4U6XA 4NM8L 2Q1EA 1JGVL 5F72S 4QF1B 3BJLA 4X4XB 5EBWB 4QNPE 1P69B 2OS7A 1T04B 3BKJH 4Y16C 4GAJL 1BMGA 3DSFL 4GXUN 1JUFA 1SM3H 4JQIH 4CVXB 2NY3D 4M02A 5HDBF 2IANE 1QRNA 4P57A 2GY5A 4WFHD 3ECBB 3GJEA 4G8GB 3P9LA 3QUYB 1JIBA 1Q9WB 2HH0L 3HFMH 3BPCA 2F5BH 3QPQD 5J06A 3CFJA 4HKJA 4PJ7B 3QXUA 2NZ9C 1NFDA 2UUDK 5HDBE 3WIHH 3KHOA 4KMQA 2F9BT 1MCPL 5H94B 3UTOA 4DWHA 4DKDC 3QWQB 4DFIA 2VN7A 5HHMD 5E1AA 5KSAA 1RZ7L 1HQRB 2KUTA 4MWFB 5C0CB 3M07A 2NY0C 5KSUB 1NCTA 5KVFL 5DS8A 5I8OL 1NAML 4MJIE 4HC1A 2XA3A 4J12A 5JXEC 2KKQA 4MB5A 1U91A 4FABH 5EB9A 1CFVH 4AL8L 5KVGL 4IRSC 5E5MA 3LDBC 2X70A 5L2JB 4PV9A 3EYUH 3HUJA 4MXQC 4NO2B 4KK8D 2HT2C 1V7ML 2A6JA 5H2BA 5JLZB 4LCWB 3FRPA 3DUSA 3WNLA 4QRSA 1F4HA 2J88L 3X3GH 1CLCA 2ICWA 3MA7A 1HKLH 3R0MA 4HLZH 4ONHB 4Y5VB 3BJ91 1I1RA 5B3JF 2H2PD 3NPZB 3T65A 1A4JA 5IFHL 3LY6A 4L29B 4F33A 5IQ9B 2IG2H 2HVJB 1S7TA 5TFSL 1T20A 1MRCH 5B39A 1KELL 2ZUQC 4MCYA 3V8CA 1EAPA 1OTSC 1R3LB 3JWNC 2A74B 4X7DC 5B3JE 2DRUA 3P4NA 1NGYB 4Q74A 4PJXA 4QXGL 4GAGH 5J9PA 4PJ7F 5D7JD 4RX4D 4L8BB 4GW1B 3C5SA 3OV6A 5IJVA 2L7JA 1E27B 4X98B 2YD3A 1XF5B 5CJXC 2OZ4H 1S9KC 3ARUA 1RIUL 2BNQA 4I2XA 4PJ7E 5E8OA 3ARDA 3PWJB 2JF1A 1D5ZB 1N6UA 3BW9A 3QA3B 1MAKA 1FO0A 4BQ8A 2XWTA 4RFNC 4M3KB 2W38A 2QJDA 3UJJL 4F7PA 4G7VL 3EDFA 2Q76A 1LE5B 4HUNB 1TTFA 2UV3A 5C0CE 1T22B 1OP9A 2IAND 4E41B 1IAMA 3SDCD 3HG1B 1KB5B 3WS6A 3P73A 5BO1L 3MLRL 3C5ZC 4Y4FB 1GGUA 1H3XA 4IM8A 1X6LA 2ORBL 4MQTB 4RFOL 1IGJA 4G43A 1J1XH 4HMDA 5JR1L 3OTTA 1AY1L 1YEJH 1DQML 4WI9A 2BVOA 1P7QD 2Q87A 2FX8L 4C4KO 1U8NA 4LCWE 3VRIA 5FUOL 3ZYZA 4HKXA 4FFYL 4UB0H 1H0DB 4NZUL 1B4RA 4LSPH 3HNSL 4U2ZA 5DJXA 4JY5H 5IFJB 1A6WL 2X4SB 5CUSH 1SEQL 4HIHA 5L2KA 4OF3A 1FIGL 4ZNEE 5CD5D 4LMQE 3TFKD 4FXLA 2PO6A 4J6RH 2NW3A 4YO0B 5JW4N 2EC9T 4I48A 4XC1H 4PJEF 5BRZE 3CGTA 4DKFL 3U4AA 2WUBH 1JHTA 5JOFB 4P4KB 4Y2DA 5D7LE 1JPFB 4JRYB 1TMCB 2JJTA 1MWAA 2VE6B 1IGIH 5I18L 4HS8L 1YQVL 5J6GB 3T0XA 1GGTA 4R90H 1CT8B 3HMWL 4PJEE 5DJ6A 3IFNH 1ZANH 2WNGA 2QADB 4BZ1H 1CXFA 2NXZC 2BSSB 2XRAL 3H0TB 4MJ6B 3H7BB 1UJ3C 3ZE1F 4EI5A 3QG6A 5TF1L 2OX5A 1BZ7A 3C09C 4P23C 1D3CA 2EZ0C 1VPOH 3SE8H 1LWRA 4U6VH 3LN5A 1PZUB 1W72H 3BZFA 3ESVF 3ZE1E 3D9AL 5IBTH 4UTBH 3O8XD 3HG1E 3ARBC 5H8DA 4PV8A 5L7XH 2YPVH 4OI9A 4EI6B 3K2UL 3RVTD 3MFFB 4KTEH 1GZPA 3MACL 3DHJA 4DTGH 1AGDB 2VYRE 4LEOA 3K4ZA 3N1FC 3VFGH 1E6JL 4WI4A 1RUAL 4DZBB 2YPKB 3MYZA 1AHWC 3LQAH 4YHNA 1MCIA 3D0LB 4Y2OA 3ZYIA 4BZ2L 1LP9B 3OR7B 2CDFA 2CH8A 1QFWM 3VA6A 1MREH 1JWMB 4XGZB 1BJ1J 3CFBB 4U1JB 1LO5A 1KSRA 2IJ0C 3LQZA 3QI9C 4K7PL 1FZMA 3HZKA 1KNOB 1J05B 2X4UA 3WS3B 4JZNB 2F5AH 1H5BC 2I07B 1IFHL 3K7UA 5BV7C 5KN5B 2A0LD 4JRYE 2FJFB 3OKMB 1P9MA 3IDXH 1RK1B 1U3JA 4FQ2H 5DJ0B 1KTKE 1U93A 2OL3H 3LKNA 3QUXB 5JO5B 1LEGA 1A6AA 4HMCA 3PE9A 2ESVD 3RUGB 5GGQL 5C1MB 4K94C 2NY5C 1Q9KA 4X6BA 5I2IA 4MS8C 4M7KH 4UAOC 5BRZD 1JGUL 4I0PC 1Z9LA 1NCAL 4X6EA 1M05A 3GSNH 3CFDB 5D7LD 5HHMA 2R1WB 3PGCB 4G9DA 3O41A 4XP5H 1ZT7B 1KG0A 4HXAL 2CK0H 5I17A 5DHYA 3ZT5A 4CVZB 3ES6A 1OGTB 3D3VB 5HVHC 1ZT1B 2CO7B 2C4FT 4KI5C 4O2EA 2YN3A 5L88L 1BREA 4YHML 1YEDB 2OK0L 1GIGH 4C83A 2VR5A 3C8HA 1UWEH 3RWDA 1R5VA 3T4YB 1UGNA 3RHWK 4ZG1A 2DQUL 3E6HB 4RMUA 1KTRL 4NUJA 1FNLA 4K2UL 2R39A 3H9YA 3WCYA 1CICB 3GZKA 1U8MA 1RZGA 4OGYL 3T8XA 3L1OH 4H1LA 5ALBH 1JTOA 5ESQA 4YZFF 4NP4L 1QEWB 3DETC 3RWHA 5F3BB 1A5FL 2GKIA 3S36X 4P2OC 3AY4A 2LE9A 1UB5B 4FTVA 4ZAKB 2ATKA 4TNVK 4YZFE 2SEBA 4YUEL 1R3KB 2WAHA 2UZIL 3MRCA 4H5SA 5D1XC 4U1SB 5D7JA 4RX4A 3GMLA 1FLRH 1P7KB 5IMLA 2R56H 2ENSA 4OAWA 5DDHB 2DLIA 4UILL 4LLAA 1CF8L 3GM8A 4U1MA 4OGAC 2BY2A 1WIUA 5ILTL 3ULSA 3TV3L 1NL0L 4GKZA 4X5XB 3EYSH 4NSKB 1FC2D 2P47B 3ULUF 1QBAA 1WCBB 4I3GA 4HCRH 4N9GA 3EKCA 3K80A 3QEUB 2XT1B 1LD9A 4NN6C 2IEPA 3SDAD 5JW5B 4NBZB 2DWEA 1T1WB 5JUEH 5E4EC 1VFAA 3UDWA 4CADA 3ULUE 2IANA 2NR6D 1FLTX 3IFOA 3QDHA 5LXGH 2FBOJ 4MA8H 3C8KB 3D3VE 3TLRA 1Q9LB 1MJ8H 4HG4J 3QWOA 2WUCL 3OGOE 1P7QA 3OB0H 4KKLC 2VDLL 4JO4H 3QNYA 3J8F7 4QHLB 5GGTA 4ZUTA 1L0XA 4MAYC 3QCVH 3GRWL 5CILH 4X5WB 3RL1A 4Z76B 3O3EA 2E6PA 2VDNH 8FABA 4NQEB 2Q8AL 5KS9F 2VDQH 4AT6A 4M43L 3QXTA 2CJUL 3U7AA 2BVPA 4GKOA 3QJHB 5E94A 4DKAA 4JANB 1MFAL 4PJ8D 3FN0H 5TDNA 1MEXH 5KS9E 1VGKB 3EUUA 3VFMA 1WZKA 4JLRA 4LCCB 4KH2A 4HULB 4Y5YA 2DQFA 2XFXA 1TIUA 3T04D 3R0NA 4BZ2H 1KJ3L 3T2NH 4LARL 5AZEL 1WWWX 3AXLB 2EICA 3LEVH 1M7IB 1WZMA 3Q6FA 3S3SA 3VWKD 1HHKB 4ODVL 1G7MA 4IMLB 2YXFA 4HJGB 3PQYE 2ZNXA 4K3GA 1H9VA 4OGZA 3WYRA 3IAQA 4GRLB 4IDLA 3NVQA 3ZE0F 1BJ1H 2VR9A 4XNQA 5IMMB 3ZKND 4CBPA 3UZVB 4LQ1A 1SJEA 5E0QA 1YEKL 4NRYB 3D85B 4TUKH 3IKCA 3L95A 3OKOB 3O8XA 3ZE0E 2H6PB 4XNZB 2PXYD 3VG0H 5L6YH 3QXAA 1A8JH 4DVBA 3KPPB 5MERB 3OKEB 2UWEE 3BP5A 1CLYH 5C6TH 43C9A 3P11L 1FGNH 3C9NB 4PLKC 4LCIH 4PGZA 1PD6A 3WUZA 4HWZB 2JJSA 1TQCC 3BIKB 3NZHL 4JFDB 3FB6B 3ULUD 5I1EH 4WUUD 2FD6H 2FO1A 4G42A 4MZ2A 5CSGA 3SEPA 4MJ4A 4ZO6A 5J0BA 4Z5RB 4F2MB 5CSZB 4LKCB 1TZHA 3X14B 1N7MH 5KW9H 2P8MB 4PRDA 3SGDI 2ZPKH 1J87A 5FAAA 4BUGA 3TF7C 3PWPD 2HRLA 2HLFD 3W82A 2VDOH 3I02A 2ZUTA 1RUQH 5EU4A 4QTHA 4S1SL 1IKNA 3QDGE 4PY7B 3CU7A 4KK6D 4DQOL 4G9FE 2AJVL 3I6LE 3QQ3B 3KPSB 2YRZA 3IJYB 5DT1H 3IXAB 5JNYA 4QRRB 3ARTA 5K59F 1AR2A 1RD6A 4XRCA 3G5XA 4XMPH 2D7MA 2P8LB 2FRGP 4O5LL 5ID0B 1MH5A 5F7YC 3LKQA 4NHCL 2BXZA 1L0QA 2ESVA 3RX8A 3HPJA 5GISH 1GZQB 3OAUL 4P5TB 3RGVD 2XOTA 5K59E 4JDTH 3DSNA 5BRZA 4GW5A 2XTLA 3WJJA 1IGTA 4HD9A 5D7LA 3CLFH 4S1DC 1BVLA 3AU1B 1FV1B 3T09A 1NCBL 2W60A 2O61A 1MHEA 4XVSH 3ERYA 4ODSL 5FCSH 1MAML 1JN6A 3QXVA 3SGJC 4MDIA 1PYWA 5CJQH 4MNGE 3PQYD 4UT6H 2XQYG 1W8OA 1ULVA 5JIHA 3THMH 3U30B 5I1LA 4WTZG 4X80H 3DOSA 3AB0B 4ACPA 1C12B 4HIEA 3WDHA 1QO3A 3SKJL 4L3CA 3B9VA 1CGVA 4EBQL 1I8IA 1BAFL 3A6CL 3BH8B 2DTML 4B7LA 4HWNA 4YBQC 2B1HH 5DGRA 4NOFA 4KK5C 1XT5A 1GCFA 2BMKA 2NMSA 5IMOA 1TCRB 3PWVA 5ICZB 4LVHB 2OJEB 1GOGA 2VISB 4KKCD 3VGHA 5D72L 4RAUA 3O2DH 5SWZD 3CVHA 1ND0A 5C08E 2E27H 2NPLX 1NAKH 4AEEA 1WZ1H 3HE6B 5FEBA 3HTLX 3NCMA 1U42A 3B9AA 4DCQA 3OXSA 4L8DB 1UJTA 3MROA 1H3UA 4DAGH 1X5AA 3KPSE 3BOVA 3PWUB 5EPMB 3NFPA 3I2CH 1EMTL 3W5NA 4K3JH 1VKXB 4C59B 4NOBA 3TZVD 5ICYA 3O11A 4LIQL 1DQLH 2J3SA 3DMMB 4JREB 3GMOA 2AJUH 4OCYH 3STZB 2BSRB 5FUZH 4P46D 4BSVB 3CH1B 3NCYP 4WWKB 3T0EC 5I76B 5GZND 3RVVC 3QDGD 1NEZA 5DJZA 4PG2A 4MQXD 4G9FD 1U3HC 2GJZA 1BVKA 1FVEB 3CU1A 2G75A 4X9IA 3SDAA 4RBPH 5DC4B 1EUUA 5DURD 3WD5H 2MFNA 1NBZB 4C57C 2GI7A 1A6TA 3TGXA 1IM3A 4G6KL 3BH9A 4R2GD 2OM5A 1CGWA 1S3KH 2EDBA 2R0WH 3ZDXF 3BMVA 3GSXA 2X5PA 3TCLB 4J8RB 4TQEH 3TBTB 3NH7L 4KXZI 4HH9A 4GUPA 5EIVA 1FORL 4U7SA 2YUZA 2Y9RT 4JN2A 3PF2A 2AEQH 3QIBB 5C0JB 3BKCH 1G7JB 4JHAL 4X9BA 3ZDXE 3RWGB 5JA8B 3VE0B 2X6MA 3DV6B 3LRSA 4M1DL 1BD2B 3P40A 2FX7L 2JIXB 4I18A 1NCCL 4KDTA 1WBZB 1U8PA 3ARWA 2HVKA 2I26N 4PRNA 4JVPA 5CP7A 4XPTL 3O3UN 2GSGB 4PJDB 5DQJB 2DD8H 2AJXH 5JORA 1D5BB 5LBSL 4RRPG 1WWBX 2ITDB 2EECA 4CAGA 3V6OE 4CN6A 2MMXA 3I75B 3DVNA 4BSWB 2NXYC 1BECA 4YHIA 4L8SA 4M7ZB 3VWKA 1ZLSH 4F80A 4NCC2 3S88L 3BFOA 1S8DA 1F90L 1G6VK 1DQJA 5C08D 1DDHB 2G2RB 1NDGB 5IWLA 1IAIL 2XZQH 4KKAC 2HMIC 3PGDB 4DZ8B 2DIAA 4WTXA 1ITBB 1CGTA 2BJML 1CK0L 1CXHA 3T3ME 3MV7B 2YK1L 3GBNH 3FQTA 3OJ2C 4JM2F 5TE7L 2PXYA 3INUL 3HZVA 2EH8L 4NIKB 1KLGA 4OZ4B 5C0AB 1YY9C 4MSWB 4YLQT 1E4WH 5DTFB 3E2HA 3BT2L 4EUPA 1BF8A 4F7MA 5ENWA 2XQBH 3VXOA 3QH3B 5K9QI 4PB9H 3F8UB 4FQLL 4FQXC 5E00A 4P3DA 4CMMA 5E8NA 2AEWA 2NLJA 5J1AA 2IQ9H 4EDWL 3ROLB 3G04A 1Z9SA 4WUUA 3ZSSA 1O7VA 1T0MA 2GTZA 4FRWA 4FA8A 3U48A 2R2BA 3EOAB 5CEYA 12E8L 3ABZA 1BD2E 1JGLL 4PJDF 1IM9B 5AAMA 5D1QB 4YHLH 1RPQA 1FZKB 2FX9L 4R96B 3VXSB 1E4XL 1DLFL 1JL8A 3C60B 1VADA 2AXFA 3WSQL 4OFIA 3MXVH 3PWPA 1I3RB 1P1ZA 3A6BH 2H41A 1JP5A 4UINL 1NGXA 1A7RH 1JWSB 5INDA 4PJDE 3VFVA 2DQIL 4UIMB 3T3PF 2ZJSH 2BCKA 2JJWA 3WXWH 5FGCB 2RCSL 1LO4H 1TJGL 3MCLL 4HGKC 4NDMA 4OZFH 3F5WB 5CBAB 1UQSB 4EXKA 5EORL 3GGWA 4P2RE 3T3PE 2OMNA 2X05A 2C3XA 1J5OL 3NZ8A 5KS9A 3QO1B 4NQXB 6CGTA 2EXYD 1W0VA 4O02L 3TN0B 3W0WB 5D8JH 3VFNB 1D5MA 3S37X 3TBWB 1JK8A 4EN3C 3E6FB 2IC2A 3VXQB 1K85A 4XAWH 5C9JA 2QLVB 1K4DB 1XEDA 1QSZA 1CS6A 1X44A 4Q2ZA 1FG2B 5C9KA 4JPKL 3QEHB 4RFEA 5DD0L 4RA0C 4L9LB 5DMKA 1Z3GL 1ZVYA 2QQLH 2GAZA 5IM7A 3EGSB 1SY6H 5I1IH 5B8CB 4K7FB 5BQ7B 4DN4H 5L0QC 1RZIB 4YXKL 1YMME 2A73A 4IHOB 3BRDA 3PL6B 2IPKA 4QLRA 4P9HH 5JHLL 5HHXH 1MWAH 4KRMB 3MQIA 5GGRA 1BLNA 4JPIA 3D25A 5DRWA 2A6KA 4L4TB 1WFNA 4NRZA 4LEXL 3BP4B 3UTTA 3WN5C 4XNYH 1QLRB 3O6FD 2UWEA 5SWZA 4JM2D 2DQEL 1F8TH 1RK0A 2DOCA 2YD9A 1DBBL 1MNUL 4JN1H 4QHKI 4X4MA 5T1KA 3TO4D 1NCDH 5D70H 3DI3B 3VFOA 1WZLA 4IIQB 2X1PA 2E6QA 4M5ZH 5D2LA 2R0LL 2R23B 4TSAH 4Z8FH 2D9CA 3O2WH 1ZTXL 5CJOL 4YFDB 2GY7B 3TZVA 4HZAA 1PGRB 4N1EA 3EOTH 2C1OB 2BNRE 3GSWB 1QZ1A 1DN0B 2YC1A 3VXME 4KJPC 4YHZH 5GS2D 4ENEC 1RURH 3MLPA 3QDGA 3B9KD 3LD8B 2NY6D 4X0KA 1HYSD 4G9FA 2CMRL 1CVRA 2IBZX 4HHAA 1IKFH 5E4IA 3SOBL 3ZZ1A 4ZFZA 3B8SA 3V7MA 1I9JH 4AEFA 1A14H 1R3HB 4KHXL 1XCTB 3TNMB 1OF2A 3BPLB 1NAMA 3D1MC 3MUY1 5KSAC 1QHOA 4P2RD 3LV3B 4F37F 1CTNA 1U8JA 5DJYA 1BFTA 1F5WA 5DYOB 1A0QL 1WVZA 2Q6WA 2EO9A 2EDLA 1FVDB 1BFOA 2ZCLL 3L3DA 1HWGB 3O2VL 5IP4A 1JVKA 4NBXB 3WFDH 5J56B 1RULL 2BOBB 5TQ2L 3PABA 3WUWA 3F7RA 4UV4L 1J0KA 1M7XA 4JY4B 2FJGB 4MA3B 4L4TE 1YUHB 4MNGA 2D7NA 3DUUA 5HJ3B 2ARJA 4GRMA 5FA3B 5D93C 2MQ0A 1SVCP 1YMMD 4RMWA 1WK0A 3QUMH 1H15B 1RJZB 4LLUB 4WV1B 1KJ2H 1T2QH 4RGNB 1JZ5A 4PRBA 1IGYB 4NKIH 5I74C 1EGJH 3EDDA 1B4JL 5IB4A 1N59B 3OJDB 5C70A 3U0WL 4OF8A 1KPUB 2X4OB 3HB3D 2AV1A 1ZLVH 2EYSB 2CO6B 3QAZC 2J4WL 1RZ8B 4WW2B 1NGPL 4TN9A 5ISZB 4NQDB 3FMGH 4G6FB 1I7ZB 1AXSB 4JO3L 5C08A 1W2KT 5EN2B 2H32A 2YZ1A 1OAXL 2Z4QB 3E3QE 4PJCA 4OLWL 1QR4A 2YOCA 3U6RA 5GGSB 3QQ4B 3AUVA 3ARDC 3RU8H 3KPLB 1QLEH 2J12B 4FQIH 5F1NB 1SJHA 3MV8B 4HPOL 2BNRD 3PWNA 5JDJA 3U7YL 4MD0A 3S5LG 1FGVH 3VXMD 3WS6C 4W81A 1K5NB 1WGOA 3ULVF 1NMCC 1HSAB 1CD1A 1XIWD 4ONFH 2Q8BL 3QDAA 4JFFD 5KOMC 3IXTB 5CCKL 5A16B 1I7UB 1Y0LA 2PETA 3BPOB 4QXUH 1IC7H 3ULVE 1YMHA 4UBDD 2PTVA 4LVOC 5FDWA 4LLYB 2GK0B 3GBMH 3MYJA 5E56A 5C2BL 5IESL 3X13A 5IIEA 1HCVA 3GMQA 1T3FA 3DTXB 4J1UA 5IW6A 4JHBA 1GGCH 4MNHB 4XXDA 5J3HD 3WNKA 4R3SB 15C8H 1NANH 1TJIH 3SJVA 1UCBH 2FH8A 2PO6C 4BA8A 3DIFB 1HIMH 4RGNE 4WW2F 5HYQA 1KTDA 3GM0A 1DEEB 2HAZA 3NTCL 2DQHH 3RNKB 2VAAB 2C1PB 1A7OH 2JJTC 4NC1E 5T3XH 3SDYL 3QFJD 4ZNCD 1P2CA 3GHBH 2R4SH 1UA6H 1E0OB 4NQDE 4A6YB 1GC1C 2BC4A 4F58H 1R0AH 1IC5H 2FB4L 3FOLA 5DUPH 2XZCL 3KR3H 2L4OA 2VLJB 4LHQB 3MLXH 4EI5C 1I8MA 1NBVL 3C8DA 5DJ2B 3QRGH 2NX5D 2Z9TA 1MIEL 4NBYB 1VA9A 5IEKA 4U6YA 1PG7X 3B2UD 4Q97A 4RNRA 1HNGA 3G5ZB 3MRLB 5IB1B 3MV8E 1MI5E 2DWDA 3IFPA 1CG9B 2NY1D 4L3ED 3RJDA 4QO1A 4FP8H 3OQ3B 3HI1A 2FATH 4NGHH 1FNSL 3TEUA 3UYRL 5DMIH 5DEZA 5C0RH 5D6CB 1MOEA 5EU5B 2BVUA 4IDJH 1CTOA 4GBXD 4U7MA 1JBJA 3HE7D 5EOTB 3GMMA 3IFLL 3D2UB 1SM3L 2R2HB 4LIQE 2CLRA 2D9QB 5GSRB 3WL9A 1UH4A 2I60H 1J0IA 1JFQL 5TE4H 3EO1A 2V7NB 1N6QH 3HN3A 2CR6A 3MRNB 1J10A 2IAMD 2V2TA 3O6FA 1ACYL 3CFCH 4JM2A 3HFML 2F5BL 4PRHB 4YDLC 3TO4A 1IC4H 1WC7A 1BF2A 2HJFB 5D96B 4HWBH 1I3GH 2LTQB 1MCDA 2Z93A 4NKDA 1FYTA 3BWAB 5IB3A 4D3CL 5F9OL 5GIRB 4XVJH 4NYLA 4UUJB 3JV5A 3LKOB 5EULV 1AD0A 4TPRH 2DQCH 1P9MC 3ARGB 4HWUA 3HPLB 2NY3C 1Q0YH 5HGHB 3JV4A 3REVB 3F12A 3ESUF 3FT3A 4Z9KB 4AG4H 3KPMA 5E8PA 4FABL 1MIMH 1CFVL 1RHFA 2CDEB 3B9KA 2IQAA 3QPQC 4QRQB 3TNNB 1OAYH 2FJHA 4QRTA 3U0PA 2VABA 3RWEA 1UXWB 3EYUL 5CINH 5LQBH 4ZMAT 3VG9C 3RDTB 4ZSOE 3X3GL 2VZ1A 1G0XA 1HKLL 4P2RA 4JM4L 4HG4K 1CFTA 1X4XA 1CIUA 1BWWA 5AWNL 1INQB 1S78C 3PP4H 3H9SD 4R0LB 4OLVH 4P3WA 5FKAA 2IG2L 3VW3H 4XCEB 1MRCL 1QBMH 2HTLD 3CUPB 2XWJB 4LPCA 3MRDA 1RIHL 2V17L 1JZ3A 3HCVB 1MI5D 4F3FB 2X4RB 2AXGA 2W65A 3C5JB 3FO9A 4HUUA 4KK8C 4GAGL 1A7QH 5IG7B 1D6EB 4HT1H 3BN9D 2XTJB 5CS7A 1VFOA 2GJJA 3H3KA 1BZQK 1SJVA 3BGFC 3VFSA 1ZGLB 5KJRH 2B2XH 4PRHE 1S5HA 1YMMA 3LKSA 4AIZB 2H2PC 3DV4B 4RBPK 5TDPA 3S3PA 1DN2A 1T03H 4KKNA 2FH6A 3AY4C 5DJDA 5LWYH 4L3AA 5GSVA 2NY2B 1HHJA 1LO2L 3WLWD 5EBMA 4Z0BH 3T4AA 1FNGB 3OKLA 2OTWB 3RWFB 4O2CA 4U1HA 5SWSD 1XF3A 5D7JC 3CFEA 2F54A 2D4FA 4N8CH 5FKPA 1VEMA 4RIRA 4KUCF 2ZSVA 3MRRB 1R5IB 5ELIA 2EDJA 1DUYB 5ESVA 1J1XL 1YY8A 1YEJL 5CWSB 2X4PB 5C0EA 2ITCA 4NWTH 1FL5B 4RCAA 4GXUM 1Z2KA 4BJLA 5DA4A 4LSPL 1A7NL 1N4XH 3PGFH 4JB9H 3BVNA 4D8PA 4JY5L 4X6CF 3RP1A 3UDWC 5C0DA 5CUSL 2YS4A 3AAZB 5GS3A 3VXMA 4J6RL 1XIWA 2IH3B 4HIIB 5C0FA 4WW1B 4CU7A 1W0WB 1INEH 4JFFA 4X6CE 4TSBH 4OQTH 3GRWA 2GITA 3CIQA 2E7BA 4QWWD 4AQOA 2FWOA 1CFQA 2P5EB 1D9KD 1IGIL 2ADJA 4GLRI 2A77H 4BH8B 2DI9A 1QBBA 2BHUA 2MJWA 1EZVX 1CFNB 4OZGB 5HBBA 1ZANL 4BZ1L 1M6OB 5FA4B 3VFTB 2OI9A 1EPFA 4L8CB 2GT9A 4BFIB 3TYGH 4Y16B 4MJ5B 2BHYA 4PS4H 3T77B 5CD5C 2E7LE 3U2SB 4P0DA 1PKOA 3O3BA 3T2OA 4U6VL 5EC2B 5B3NA 3PHOB 2LVEA 4U0RC 2WIIB 3N85H 3KWWA 3S5LB 4Y4KD 2MPAL 4Y5YC 5FF6A 4UTBL 5TH2A 3WHE0 1YNKL 4RMQA 5LGHH 1YN6A 5C09E 4N90E 5FM5O 3TYFA 3QFJA 2F8VA 4HFWA 4J23A 3U0TB 3NCCB 3RHWF 2W0FA 1NKRA 4DTGL 1HWHB 1XGQA 4OLEA 3K8KA 5FCUH 3FO1B 3IS1X 2F74B 2NX5A 3P4MB 5E9DE 1A6UH 2PCPA 1U3YA 3IU3A 5FYJU 2NY0B 2ZUWA 3QYCA 5F9WC 4MD5B 4M61A 3G5YA 4D0DA 4WNQB 4L3EA 3SKNA 2H45A 3O9WB 1K4CA 3X11B 4KKBD 2BVTA 3O8XC 1HHHB 3MR9B 4E0RA 1UWGH 1YJDH 5CGYD 3UBXI 4IRSB 1MREL 3LDBB 4TNVF 4N5ED 4HKZB 4U1NA 5EU3B 1RFDH 4YX2L 4XCFH 2I27N 3DYPA 4OZGF 5MI0C 1XR8A 4ZFFA 1MRDH 4GBXA 3HE7A 1T1ZB 1KN2L 3FZUD 2F8OA 1XGTB 4Y4FD 2VDRL 5BMFH 2P5EE 3NAAH 2JJSC 5DK2A 4OCRL 2HP4A 4H25A 4X9FA 5ERWA 3ARZA 1CFSB 1T89A 1XF4B 2Q86B 4O2FA 2IAMA 3FT4A 2VXVH 2ZUQB 4XBGA 4HDIB 4P2QB 5HHQA 4P9MH 4NCC1 4M7KL 4PBVC 4XPGH 1Q72H 2XWBA 2Y5EA 3CDGA 4M9PA 3DX6A 1A21A 4XXCA 4OBRA 5EUOB 4RWYL 1IKNC 4X8XA 4I0CC 1HDMA 1PZ5A 2X1QA 3Q6GL 4TVSa 4Y8DC 4ZYKB 2CK0L 5IT2L 2XA8H 1X7QA 4FS0A 2IH1A 3RX7A 4XVTH 2AK4D 1SYVB 4PGEA 1QNZH 5I30H 4RFNB 3WFCL 4PD4J 5C0ND 5DI8B 4XVUD 1I4FA 2WBJD 1UVQA 3W39B 2EE2A 4PRPB 4N0UB 1BBDL 1KB9J 3WJJC 4WEBH 3DGCR 3QDJB 3V0VA 1LHZA 2MOVA 4KY1H 1UKTA 5C09D 3JWOH 3C5ZB 4N90D 3L1OL 5ALBL 1IEAA 4U3CA 1WQVT 1WCQA 3JTTA 5D1ZD 1CZ8H 3SY0B 2UZXB 4FG6D 1PFCA 3CPLB 3KYKH 3L5JA 3RVUD 3PDGA 4ODXB 3H9SA 3X17A 4YDJB 2H9GB 1F4WL 3H8NA 2QBWA 4JRWA 4OD2A 5E9DD 1A02N 4K3EH 4MCZA 1OL0A 5C07B 2EDEA 4YHYB 4WIQA 1MI5A 3GSVA 4E42A 1YYLH 4Z95H 3L9RB 4APQD 1BBJA 2W07A 4WY7H 2R56L 1T5WB 4R6UA 4YHOH 4Z7WB 4W4NA 3D39B 4OM0H 3EYSL 3G08B 3FO0L 2P5WE 4P2QE 3LSOA 5LJYH 1BQHA 4HCRL 2FECL 4JDZA 2EDQA 1UZ8B 4JO2H 5EZJB 5K93A 5IHLB 3GKZA 1CDBA 3EO9H 4PGCB 4YIQA 1JNHA 4KDVA 5C0BE 5SWSA 3VH8G 2NXZB 2P24A 5GS0H 1B9ZA 3RPIA 1UJ3B 3ISWA 1E4JA 5DWUH 5FYJH 1PEZA 3C09B 3OKDB 1F4XH 4NNXB 1MJ8L 5TQ0H 4P23B 5AUMB 4WFEE 3QDMB 1YDPB 3P9WB 5IOPA 2R1YA 1BIIA 2ADGA 5I6XB 4JO4L 2ATPA 1T0NA 4PTTB 4QOKE 3QNZA 5DRZA 3QDJE 3ARBB 4PG2C 1A1OB 5CILL 1Q9WA 3SDAC 4DGVH 4FZEH 1WBXB 3QULA 5FO8A 4LDLB 3ETBF 1X5HA 2VDQL 2NR6C 2BOCB 1AGBA 1QSFB 3DXAD 4NM8H 1S7RA 3MRQA 3UTQB 1BOGA 5CD3A 5C07E 2C7UB 1AHWB 4Z7WF 3F7YA 2JELH 4ZSOA 5HDLA 3QBTB 1QRKA 4OUUA 5EBLB 1D9KA 1FL6B 5EUKB 1K8DB 4K9EC 3T2NL 3V8OA 4F7CA 4LGSB 5EFIA 4DUWA 4Z7WE 2H26B 2HH0H 3DVGA 3LEVL 2NTSP 3D39E 3QI9B 2Y25A 4PGBB 4Y7MA 5ESAB 4WU5B 1ONQB 4I18C 1EEZB 4KDTC 1H5BB 2HKFH 1YN7A 4LCUA 5BV7B 3MLZL 4WU7B 3GMRB 4NNYA 1PSKL 4FFWD 4C55A 1J0HA 2IALA 1JPGB 4Y4KA 4LDEB 5FGBA 2NW2B 3FONB 3QQ9D 2GFBA 5DHXB 3MRBB 3GUTA 1MF2H 3IYLW 5HSFA 3SE3A 3DRQB 3VG0L 1YECH 1CN4A 5L6YL 4L8SC 1SVZA 2P5WD 5KVGH 3QDME 4PP1D 3VWKC 2EDHA 4I0PB 3PV6B 3WFBH 1EH9A 1U9KA 3DX7A 2WQRA 3WFEL 1ODAA 5T1DH 4Q9QL 1QPXA 5FO9A 5C6TL 2VL5A 1FGNL 3JWDL 4YC2C 2I9LA 4FN0A 1YNTB 4X98A 4AJ0A 3ZKNC 4NCDA 3CLEL 2IADA 5C0BD 5FOBA 3IS0X 5IWLC 2RB8A 5I1EL 1RVFH 3F65A 2ZCHH 5HVHB 1NC4D 1C7TA 4R7DB 2EIZA 2V2WB 4L4VB 3PWJA 1QSFE 4KJYB 1N7ML 1N0LA 2PXYC 1NC2D 3VFRB 5TFSH 4N5EA 1KELH 3PHQB 1A6ZA 1F4YH 3ARRA 3E2HC 3HLAB 1S9XB 4K3HA 1RUQL 2XICA 4U0QB 1RI8A 3BN3B 4Q58C 4QGTA 3V95A 9CGTA 4QOKD 5D5MB 1TTUA 4Y4FA 3OXRB 1J1OL 1I75A 1Z0NA 5DT1L 3LEXB 4TYUA 4XMPL 1DL7H 4P2OB 1F00I 1IZJA 1FP5A 2Y5TB 1NJ9A 1RIUH 4NZRH 3IDUA 3ZTNH 4FQHB 2HFFB 1T1YB 1ZWIA 4X6CA 1H8OA 4JDTL 2GTWA 2UY6A 4G7VH 4Y1AE 1MJ7H 3QUKB 2HLFC 3S8WA 4MDJB 3U83A 3CLFL 1FFNB 2J1KA 2DDQL 2GJ6B 4XVSL 3V7AG 3FQWA 4KK6C 4EDXB 2OMBA 3OHXB 4V1DB 5BO1H 1E28B 2P42B 1OTUD 4H26A 5CJQL 4KC3B 4HJJH 4MD4A 2AK4A 4UT6L 5JR1H 2WWKO 1PJ9A 4XAKE 3F7PC 2E7LA 3M45A 4AEIH 3P77A 1K8IB 3NFSL 4NN6B 2FX8H 4KI5F 2APFA 1NLDH 1HILA 1DR9A 1R24B 2WBJA 1CGSH 2VO5A 5E4EB 1DLHB 2VB5A 4NZUH 4LGRB 3GSOA 1TQBC 4MJ6A 1A6WH 2YR3A 5C09A 1SEQH 4KI5E 5FK9B 2XPGB 2W0LA 5D1ZA 3C08L 5GRVK 2DN7A 5D5MF 5CIPA 1HQ4B 3BYTA 1J8HD 3RTQD 4ERSH 3OBAA 5IW1A 2DM4A 2YKLH 2XZZA 4V2BA 3U9UA 4XNMA 4C4KT 1QKZH 3KXFE 5E9DA 2E27L 1NAKL 4MAYB 4XCYA 1WZ1L 5F1IB 5D5ME 4X99A 1G1CA 3I9GL 1QA9A 4G6ML 2ERJC 5KZCD 1WEJL 5E2VH 3QT2A 4FFZH 4QHKJ 4APQA 1G6RB 2XRAH 3IDYC 4U1KA 1DQLL 4R4BB 1I1YA 4ELMB 1T1XB 5B4MD 1CLZL 4Z0XA 1RZKC 2AJUL 2FHBA 2XN9E 4IRJD 4OCYL 5ITFB 1HK6A 4KRPD 2A6DB 4KKCC 1OY3B 3EDEA 2R1XB 1AQKH 1LGVA 5DEFB 2JB6B 2RAMA 5CEZL 3PHSA 3VDCA 2GJ6E 1QFUL 5JZ7D 3WD5L 4V1DE 2AJYL 3ZT7A 3UBXA 4C58B 4I1NB 5T1MB 2IBZY 1AGCB 4FNLH 4LGPB 3TZVC 4OV5A 3MACH 4XHQA 1MJUL 2QSQA 3DLQR 1RJCA 4JY6A 5D71H 3L3IA 1RSFA 5KN5A 1S9YB 1E6JH 1T66D 5D6DA 3GIVA 1XGYL 3LB6D 4TSCH 2LU4A 3S34H 3BDYL 3Q5TA 2NY7L 3BEVB 5GZNC 1F58H 3MLTA 3KNBA 2NNAB 5E8DH 4X4YB 4MQXC 2A6IB 3SQBA 1ZEAL 3OMZA 3HR5B 1CIDA 3RKPA 5HY9B 1LMKA 1XGUA 1B0RB 2DMCA 3Q0HA 3DXAA 1Q94A 2Y7QB 4XAKD 4K7PH 3JXAA 4TULH 4OB5L 4YDIL 3PGCA 4R2GC 1TQCB 1HEZA 2DD8L 1G7LB 3AMLA 3ALWA 3VH8B 3WE6A 2JE8A 2XKNB 1EHNA 2IPTH 4QKXB 4JEGB 1A4KA 3BSZH 3JV6A 4KI5D 1FL3B 4BELD 2VIRA 3D0VB 3STLB 5GGQH 3L3JB 4ZS6D 4N0CC 1ZLSL 4KROD 5MHSE 5BZWA 1ZHNB 3S3JA 3VGAC 1G7IA 1JGUH 2YMXH 1NCAH 3KXFD 2QSCH 5F71A 4XPFH 4DEPB 2MWCA 4N5UA 4KZEH 3BEWA 1PY9A 5CKAA 1KLUA 4ETQA 5E2UH 2W0KA 3DX9A 1J1PH 5F3BA 5KOVC 2AW2A 4PR5B 2GHWB 2NY4C 1C5BH 1HXYB 1XH3B 4IMKA 2UVFA 2YEZA 4YHMH 2OK0H 4ZAKA 3W9EB 2XN9D 4BH7A 3MLSH 2P5WA 1F2XK 2VWEC 4FHBD 1S7SB 1U95A 4PB9L 2ZSWA 4IJ3C 5D1XD 1U8IA 2VKWA 1X5XA 3FB7B 1QFHA 2Y36H 3FTGB 2IQ9L 1ZS8B 5C0BA 2RHEA 5E2JA 4AZ8A 3TIEB 3ARFD 4NP4H 1J0ZA 4YHLL 1RJLB 3EYOB 4ODBD 1IAKB 4JFXA 1DBKH 1CE1L 4KHTH 3MXVL 3O3DB 3EYFA 1FFPB 4ONOA 3A6BL 4HUXA 1A7RL 3MJ6A 3S37H 3TPUB 1ITCA 2UZIH 1UXSB 4QOKA 4GKNA 1B6UA 1DBAH 1A9EA 2KZWA 3MRHB 1Q8MA 2ZJSL 4JFEE 4WHTA 4NT6A 3WXWL 2VXUH 2PYEB 4AM0B 1EHAA 2CIKB 4I5BB 5ILTH 4XT1C 4CW1B 1NCWH 4B5EA 1AC0A 2DIJA 4ELKB 4RMRA 1FZJB 4QHLA 1INDH 3DECA 1JWUB 4LLVB 2AJ3B 3LKRB 3KPOB 5DRNB 4CKVX 5D8JL 4ZO8A 1S7VA 4XAWL 1QYGL 4J3TA 2WINB 4CMHC 4JZOB 4JO1L 3EOBB 1I1FB 4UDTA 1KEML 3V0WH 4DJMA 1I7RA 2W9EL 1D5XA 4M7LH 4RDQG 1UM5L 3FRPG 4LCCA 3T0EB 2R0KH 1F3JB 2QQLL 4GRWB 4FQJL 1SY6L 2VERN 5I1IL 5F8RC 1U3HB 3CC5A 1EHXA 2W1NA 1N3NA 4LLWB 1C1EH 2AJSH 3GRWH 2EXYC 2FECI 5SWQB 5EU6D 2V5SA 1CDCA 4CNIA 3GJFA 4P9HL 4HJGA 2BVYA 5B39G 4M43H 5FO7B 1TTGA 5J13C 5CEXA 1J8HA 3RTQA 1MFCH 4LSRH 3KPQB 3D85A 1MVFA 4LKXA 5D70L 3RKDD 4G5ZL 1HSBA 3EBAA 1ROWA 2H6PA 5GGVY 1KJ3H 4LARH 4OBSA 4U1IB 1LDPL 3JUYA 4Z8FL 1AXIB 3BIBX 3O2WL 4PY8I 4PRAA 5D9SB 4ODVH 1HH6A 1OGAB 5MERA 3MRGA 3EOTL 3VMNA 2W59A 3P2TA 3FQNB 4IRJA 4LP4A 1UWXK 4X7TA 1EBAA 3BIKA 4MQSB 3FB6A 4YHZL 5F1SA 2PW2B 4YPJA 1T5XA 3O6FC 2V5TA 1T6WA 4JM2C 1FDLL 4HKBB 3DROB 3TO4C 5KTEH 5J89A 1IKFL 4LKCA 4JFED 4W6YB 1BZ9A 1ZA6B 4GRWF 4ZODA 5A1AA 5EWIH 3IETB 2L0DA 1PLGH 5F21B 3ARSA 3IGAA 1RJYA 5FXCH 4LSSL 2OTPA 1DEDA 3ET9F 3BGAA 3T0EE 4GRWE 3EYQD 4QRPB 1CYGA 5IVXB 3P11H 4MNQB 1HCFX 3B3IB 3K2MC 2MKLC 1CCZA 4NQCB 2FIKA 3WFDL 3NZHH 1EIBA 2P8LA 3KJ4C 3GSUB 4XBPB 1LEKB 3IDMB 3B9KC 5E1HB 2NY6C 1HYSC 2FZ3B 4O51B 1A6PA 1PQZA 1GZQA 5K9KA 35C8H 1RHHA 1X5KA 3BZEA 4FQXB 1MRFH 1HI6B 2M2DA 1NUNB 4S1DD 3MRKA 1T21A 1M71B 3V7AE 3PJSB 3QUML 3UTSE 4DQOH 3WLBA 1MJJA 2ADIA 2Q7NA 2DI8A 2VUOA 1GPOL 4M00A 1T2QL 2K9UA 3MA9H 1DANU 4NKIL 1EGJL 3SDDB 5IV2A 2VZUA 4NHCH 3G5VB 2XG5A 1S7QA 3O3AB 1FPTH 3WEXB 3WHXA 1UKQA 3S98A 3VA2C 1KGCE 3KXFA 3HZMB 1LE9B 1FNAA 1GOHA 3OX8A 4BSJA 5EU7C 1F3DJ 2UYLB 4ODSH 3QG7H 5E5RB 4ZS7H 5ICZA 3RU8L 2FYYA 5HHOB 5DXWA 1JI1A 4FQIL 2VL4A 4CUCA 2BVQB 1G84A 4R97C 4WHDA 1S9WB 2XN9A 4NQUA 3HE6A 3LIZH 5HGAA 4ZPVB 4QRPE 4RGMC 2AQ1A 1Q9OA 3HB3C 4S10A 1HE7A 5IVZA 2DS4A 2R69L 4EN3B 3QEQD 4P5MB 2VOTA 1F6AA 1DBML 2IGFL 4EBQH 4NQCE 3A6CH 4ZUSA 4DW2H 4HQQH 3TC9A 4XB7A 3RWIA 1HH9A 4CU8A 3MUJA 1BX2B 4X8JB 4Z7OF 4QXUL 1JV5A 1IC7L 3STZA 2P7TB 3NN8B 3ARFA 5E03A 3V5HB 4J3XA 1X3DA 5I76A 3B6SB 3DGGA 3ZE2F 4ZQKA 5D72H 3GBML 5F7KC 2WV3A 3QCUH 1K2DA 2NCMA 5KG9B 1XZ0A 5GRXG 4Z7OE 3QFDA 1K9TA 2K1MA 3GI9L 3MBED 5SV4A 3IKKA 4YBHA 1KTLB 3TPKA 1BEYH 1EZVY 2EYTA 4IBLT 3ZE2E 1UCBL 2ADFH 1XIWC 1HIML 2JB5L 1UFUA 2QKIB 1HHIB 3OSKA 4K71B 2V7HB 2VTFA 4XCNB 4Y19B 3WN5B 2VDKH 2HFEA 3MC0A 3C2AH 4Z7VB 4FXGB 1A47A 3LAFA 5T3XL 1A1NA 3GHBL 2R4SL 4PJ5D 5DEGB 4F58L 5K9OA 1R0AL 3QIBA 1IC5L 5DUPL 5C0JA 2FGWH 3UTSD 3UJTL 4U6XB 5DD6A 4UIKH 2X42A 3OPZH 2OI9C 2HA1A 5J3HC 5HVGB 2YD5A 5HHOE 4LNRB 1JUFB 1HOCA 1UM4H 1LEIA 2ZUUA 2CK2A 1QRNB 1BIHA 4P57B 2FATL 2DM3A 2QV2A 2YWZA 5DO2D 5IW3A 3GJEB 4B53A 3P9LB 3NH7H 5DHVA 3FQUA 1EFXD 3BPCB 4H1LG 1U8HA 3CFJB 1AQDA 4PD4K 2BNUB 4HKJB 1X5YA 5C0RL 4JRXD 1NFDB 2Z91B 3PNWA 2NXYD 4IDJL 4JHAH 3VGGA 1KB9K 1F11A 5EU6A 1NSNH 4NZTL 1OTTD 5E1AB 1BFVH 1CL7L 2XNAB 2FX7H 3QUZD 1MAJA 3B2UC 4M7JH 2I60L 4M3JA 1U0QA 1NDGA 1S5IH 5DS8B 2NY1C 4MMZC 3CFCL 2CGRH 3FAWA 1H3TA 1IC4L 1XFPA 5E5MB 4HWBL 2X70B 4PV9B 3CVIL 4R4ND 3HUJB 3ARVA 2D3VA 4K23L 1NMBH 5H2BB 2A6JB 1ACZA 5B22A 4MSWA 1KN4L 3DUSB 1KJMA 4QRSB 4GBXC 4XVJL 1VFMA 2ICWB 3HE7C 3WFZA 1EA9C 3MA7B 4XZUA 5D93B 4JZJA 4JDVA 1WLHA 3DO7A 1F90H 5I0ZA 4CDGC 1Q0YL 1Q0XH 1WIOA 4LSQH 2Z92A 3T65B 1FSKB 1A4JB 4F33B 1T89C 2AEPH 4IOFD 4Y89A 1MIML 2IAMC 1S7TB 1T20B 5B39B 5I1GL 3KPRD 3N1MC 4MCYB 1OAYL 1IM9A 1EAPB 2R2EA 5I74B 1C5DA 2BJMH 1CK0H 1FZKA 4JFEA 4YDVA 3VXSA 2YK1H 3U4EA 3ELAT 5CINL 3P4NB 4N9OB 5JHDD 1XF1A 4PJXB 4XXCC 4YH6A 5J9PB 1NFDF 3QAZB 4FOMA 1K3ZA 2X10A 3O4LE 4Y0GA 2DJSA 4FQLH 2ICCA 5IK3A 4YBLC 1AD9A 1R5WA 2BNQB 4I2XB 4WFFE 3CSBA 3PP4L 4OLVL 1NFDE 4UT9L 3ALPA 5E8OB 3GSQA 3ROOA 3ARDB 1QBML 3BW9B 4HK0A 3VGBA 1FO0B 2IWGA 1KB5H 2XWTB 4G6JL 1N2RB 4PLJD 4F7PB 1F3DH 4S0TD 2Q76B 3WO4C 3RQ3A 5KSVA 1DLFH 1A7QL 4Q9RL 4OD1H 3W0WA 3P73B 4F7EB 1NMCB 4R4FH 3HUJF 1DTUA 1KT2B 4NC1C 4RDQF 3MJ9H 1IGJB 1DANT 1SYSA 2B2XL 5F8QC 5KJRL 5SX4H 4FMKA 2FHCA 5JXAH 2DBJA 4UV7H 2BVOB 1T03L 5LWYL 3HUJE 1FG2A 3QEHA 2HTLC 4NO5A 5T5NF 1U8NB 4LBEA 3VRIB 4PJHB 4HKXB 1FJ1A 5M7QA 4DKEL 2BERA 3L3KA 5EORH 2EYRA 1T6VN 2GW5A 5DJXB 1U8QA 1J5OH 4N8CL 5L2KB 3JZ7A 3MMEA 3B2VH 4MXWH 3BN9C 2PTTA 4HCRA 4LPVA 4NNPH 2PO6B 2NW3B 1MCJA 2Q20A 2VXTH 2CPCA 4I48B 2EO1A 2ZUVA 5ALCH 5I71C 3HRZA 4DUXA 3ARYA 1JHTB 1ZK9A 4EEEA 4Y2DB 4ZUVA 3BD3A 1QLRA 5HGGS 4Z77A 4JPKH 5K9JH 5DD0H 3WLWC 1MCLA 2BY3A 4PJGE 4JB9L 4XPAH 5DJ6B 5K33A 1JGDA 1KCUL 4WFGD 3FT2A 1X5JA 3L5XL 4YXKH 3CZFA 2R23A 1FH5L 2BNQE 4EI5B 3QEQA 5HPMA 2ZG3A 3QG6B 2X1XR 1GGYA 1BZ7B 2DYPD 1U8OB 4WTZA 4TSBL 4OQTL 3IDIA 2IPUK 3LN5B 2DQDH 1I9RH 3NABH 2DIBA 4N8VA 1CXIA 1MELA 4LEXH 1OHQA 2VZ3A 5FECA 4PV8B 3T2PA 1X4YA 3O4LD 2LU3A 3C6SA 4LRNL 5BW7A 3L7FA 2YBRA 3MBEA 3MLVH 3CXDH 2FEDD 1GZPB 5F7NC 2MCG1 5CMAB 4LEOB 1Y6KR 3TYGL 3UXFA 2LU7A 2WIMA 3NCEB 2DKSA 5KSAD 3N85L 4XCCL 4YHNB 1T4KA 1KCLA 4LNVA 3NFNA 1S7XA 3Q3GA 3EHBD 3PG2A 5LGHL 4QWWC 4WO4D 4OLZH 5GS1C 1TNNA 1D9KC 5L2KE 2OQJA 3TBSA 4YDLB 2CDFB 4MLSA 4PJ5A 4Z78B 3D48R 3UTSA 4ZFGH 1LO5B 3N9GL 3LQZB 4JY4A 1G9EA 2VLMD 1FZMB 3K0WA 3HZKB 1TVHB 1XAUA 2X4UB 5FCUL 5DMJB 2D2OA 5HJ3A 2G60L 3OB8A 3D69A 5DC9B 1QSEE 2NY3B 1U93B 1D7FA 3LKNB 4U3HA 4Y4KC 5T3ZH 5FGBC 4OSUH 1A0QH 1RJZA 1LEGB 1A6AB 2FGZA 3VFUA 3AFLA 1UWGL 1YJDL 3QHZH 3SE3C 1EFXA 3BRFA 4FQ1H 3O2VH 1Q9KB 1IGYA 4X6BB 4JRXA 1RFDL 5DD5L 3TH4T 4XCFL 5TQ2H 3VXUD 3OJDA 4UQ2A 1ES0A 4X6EB 1J86A 4YFLI 1M05B 3VG9B 5F44A 5HHMB 4YXHH 4ZO7A 2YUXA 1RZ8A 2P44B 4L5FL 4NJ9H 3NAAL 3QUZA 1AFVH 3O41B 1AXSA 4YFLF 1KG0B 1KIRB 5I17B 4P99A 5DHYB 3JTCA 3ES6B 1F4AA 1BVZA 2OR9H 4O2EB 2BFVH 4KKBC 4C83B 1RU9L 2VXVL 3BKML 3MRMA 5CGYC 3RWDB 1R5VB 4JFQA 3IJHA 4OCSH 4XPGL 4FZ8H 4N5EC 1Q72L 2ID5A 4UDUA 4U6HA 1G9ML 5LGJA 3EFFA 1ZHKB 1IJ9A 3HC4H 4F15C 3CAFA 4NUJB 1EX0A 1VFBA 3QSKB 1QFOA 1NEZG 3FZUC 1RZGB 1U8MB 2X89D 3T8XB 4H1LB 3OAYK 4Y4FC 5ESQB 1NGPH 3BGFB 3DUHA 4JO3H 1X5IA 3KLHD 3S36L 1RZJH 2VAJA 3IAPA 5A16A 2QQNH 1VENA 4GQ9L 5J7CC 4NPYA 3KPRA 2I9TA 4R7NA 4CJ0A 2SEBB 4CDHA 4TTDC 5HYSA 2CLZA 1ETZA 5JHDA 4HPOH 2FEEL 4H5SB 4Y5XA 5AEAA 1NEUA 3OF6D 5D7JB 1K6QH 4MNHA 2B4CC 3GMLB 4X7EC 3W9DA 5IMLB 3JWOL 1PX4A 4OAWB 5H37G 5IKCA 4PREB 4YHKH 4KK9D 4OCLC 4U1MB 1JMXA 5MENE 3ULSB 2D7TH 4GKZB 1JF1A 1JZ2A 1OSZA 5CSBA 3VJ6A 5CZKA 4N9GB 3D18A 1ZSDA 4ODWA 5CCKH 2E7LC 4H0IA 1P4LA 3DURA 1LD9B 4K3EL 4HAGA 3JTSA 1J0YA 5HHME 1CE6A 5C0NC 1QSED 3BKYH 2AABH 4XVUC 2WBJC 2EDWA 1VFAB 2EXWD 4CADB 2IANB 5C2BH 4GG8A 3SDCB 5L8JB 3IFOB 3FQRA 1TXKA 2VLJA 4WY7L 4YHOL 1T7XA 1ADQL 3MLYL 5D1ZC 4OM0L 3QWOB 4FG6C 1JHKH 2DL9A 3V0AC 1ORQA 3RVUC 3NA4A 3TO2A 2BSTA 4JO2L 3OGCA 5EOCH 2GEEA 4PJFA 3EO9L 4ZUTB 2DQTL 1CXEA 5F7EL 3RL1B 3O3EB 4ZTOH 8FABB 1TZGH 5GS0L 2Z8WC 1TZIA 5ADOH 4APQC 4AT6B 2WY3A 2BVPB 5DWUL 5E94B 5TQ0L 5GQBA 4PJBA 3ZMRA 1L7IL 2BVEA 1NBVH 2J8UA 4FTVE 4DK6A 5TDNB 4OTXH 4QYOA 3CZJA 1EBPA 3VFMB 4JLRB