4LCCC

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
384
structure length
341
Chain Sequence
IQRPPKIQVYSRHPPNYLNCYVYGFHPPQIEIDLLKIKSEQSDLSFSKDWSFYLLSHATPNSKDQYSCRVKHVTLEQPRIVKWDRTHSLRYFRLGISEIPEFISAGYVDSHPITMYNSVSQLKEPRALWMEENLAPDHWERYTQLLRGWQQMFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTLSWMAMDNVADIIRRVWEANQHELLYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHKTTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELGDIYSCHVEHGGVHMVLQGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Beta-2-microglobulin, MHC class I-related protein
total genus 80
structure length 341
sequence length 384
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC03
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lccC02
5J12C 2WLYA 4YFEA 3WS6C 4HIHA 4ZOBA 1Z3GL 3RJDA 3WXWH 5LWYL 3LCYA 4PPTA 5HGBA 2Y5TB 5F97E 3HG1B 1DDHB 3HE7C 1JPGB 2DAVA 3RWFB 1MIMH 3BZ4B 3U0PA 2ZUXA 5ETUA 1TJHH 4NQUA 5E8PA 2V9TA 4NQDB 3ZT7A 2YUXA 4Z76A 4UT9L 2FD6H 4HK0B 2ITDA 1WWCA 2CIKB 1PZUB 3GMOB 2QADD 4JANB 2NY5L 1S7TB 3HZMA 5GGQL 1NSNH 3WO4C 6FABH 5D93C 4LSRL 1OTUD 4PRIE 3JWOC 5IFAH 4TUKL 5D1ZB 3RVWD 1B3JA 4RGOH 4EOWL 3E8UH 5D1XA 3GK8L 3OR7B 1DN0B 1VGEH 1ITBB 2R29L 5BS0E 3D85D 3C9NB 1JFQL 4WENB 5EBMB 5CZXD 5EULV 4NKMA 4CNIB 3PGDB 4KRPB 4Q7DA 2GHWB 4UT6H 3ZT6A 1JHTA 1RU9H 2XQBL 4YHIA 2DQCH 1OY3B 1NGYA 5DMJB 1I1AA 1JWMB 1P1ZB 2ERJB 5ILTH 3MYJB 4L4TE 3VRJA 1JMXA 2C1OB 4AEIL 2WIIA 3R8QA 1CDUA 2O5ZL 3QULA 4M6NH 1KIPB 4U4BA 3TH3T 3P4NA 3V52L 3FB7B 1KJ2A 4KPHH 3E2HA 4PLKC 1NLDH 3EDDA 4AEFA 4CVUA 4JZOB 2BSRB 3JVGA 1G6RB 3CMGA 1T2QL 5DD3H 2D7TH 3C2AH 5IVZB 2IPTH 3S37H 5HDLA 4G9FE 1B9ZA 2IFFH 3VA2C 1IAOA 1T3FA 1CS6A 4NCC1 2DWEA 3EW3B 1G7JA 1IGFH 4PG9B 4OUUB 1OL0A 4OD1H 4HJ0C 1ADQH 1CR9L 5LGHH 1KJ2B 5EG6C 2GAZB 2P8LA 1ED3B 1RIHL 3O8XA 4JCLA 3HPJB 1KUMA 4DCQB 5IT2H 5EU3A 1YEFL 2LU3A 1TENA 2KDGA 4JANA 5KANG 2E3VA 1LK3L 3ARGD 5FYKH 3S35L 1B88A 2VLMD 5EOCL 4G8FB 5BRZD 3QXAB 5LXGL 3EDEA 2V9RA 3P4OB 4R3SB 1DQLL 2GAZA 5AEAA 2R9HD 2AGJL 1O5DT 2IH3B 1B6UA 4FFVD 3NCEB 2PYFB 4YDKH 1AGBB 5C07B 1D3CA 2ICCA 4EQ3A 5MEPA 5I75C 1HHGA 4X7TB 5FV2A 3MV11 1KG0B 4PJGA 2OMNA 1D5MA 3D25B 4G7YL 1LE9A 2WMPA 3DYOA 1YZZA 1P84J 4Y4KA 5DMGD 5ID0B 1AD9A 1YPZE 1WF5A 5FYJH 4LASL 1I8KA 3E8UL 3GK8H 3ARPA 4J3UA 1HSBA 2AJVL 4DAGH 3TEUA 2OK0L 5FO7B 3O4OC 1RJLA 3C87A 2DM2A 4NFCA 3RL2B 3FFDB 4DKFH 3MLSH 5GGSB 5F89B 4ZXBA 4MXVF 2KZ1B 4NDMB 3WEXA 1WUNT 5I16A 1V7NL 2BOBA 3G6JA 2GJZB 4G59A 5D9SB 2DKUA 3T0DA 4HIIA 3TO4D 3QEQB 1YN7B 2ZZUT 4ZPVA 4KUCF 4BQCA 3LQAH 5CJXA 4MMXC 4PGEB 4HULB 1TQBC 4DN3H 1B4JH 2I9TA 3FFDA 4G43A 3ARWA 3L3HA 4YGAB 1UM5H 4ZMAT 3VXUE 2A6KB 1NBYB 4XNZC 2B0SH 4DJMA 4NQTA 4XP6H 4OLZH 2EZ0D 3WS3B 1IBGL 3MBEA 1P2CB 2D4DA 3OR6B 3BESR 5FHBL 1NGWB 2VC2H 3B5TA 3S98A 2H6PA 5HVGB 1OAUH 5J1AA 3IT8D 4OIAA 1J5OL 3O6FA 3VG0H 4HKZA 2F53D 4DQOL 2V7HA 4PTUA 1FGNH 2FX8L 3I9GL 1BZ9B 3P11H 4KZEL 1KT2A 1R6VA 3EZ8A 1KGCE 3VFGH 4OZ4B 4I2XA 3CSBA 1FQ9C 1TZIB 2FL5A 4P9HC 3DNKA 4LIQH 3P0YL 5DQJB 2VDRL 4F9PC 4FFYL 2GSGA 3BPOC 3MRQA 2UUDH 4NQDD 3TH2T 4TUJB 4C56E 1HOCA 3RRQA 4GRLD 4HKZB 1MOEA 1ETZA 3LD8C 3T8XA 2NY0D 3V7MA 5EFIA 3WFHA 4GG6F 4ZFFB 1TDQA 3VD7A 3RZCC 1HDMA 1MHCB 3OGCA 4BSVB 5BVPL 1SEQH 4QRPA 2DBLH 4E42A 4WTXA 3WEXB 4RZCA 3V6ZB 3B4NA 3FO9B 5DJCB 4TNWF 3HZKB 2DJSA 2QJDA 2APVA 4RMUA 1OF2B 3BEVA 2VDPH 3O45B 3O6KL 2HJFA 4PJCE 1T83C 2WSKA 1FL5B 4XWOC 2V7NB 4QHUB 4HZAA 1JV5A 3JWDL 2YA0A 4FN0A 4F7TA 5ITFB 1NFDF 3MLPA 1S9YB 1YMMB 3CJJA 4ZFFA 2VITA 4IRJB 5ITBL 5K9KB 4FXKA 2GSIA 4BKLA 3MV7B 4JFQB 5CHNA 2NX5D 4GRMA 4GXVL 3VFUB 4GRWF 1U2HA 1EGJH 1KTDB 3GB7B 1U8IA 5L6YH 1DSFL 2EDOA 3MZTA 1I1YA 3FQUA 1A7RL 3PV6B 3FTGA 4GW5B 4L29B 1UXWA 4YFLF 4G6AC 4FXKB 3WFZA 5IG7B 5DGQA 4PJXB 4H0HB 4KDVA 3NA4A 1MRDL 1N0LA 5TDNA 3RHWK 1L6XA 4KJQC 2JLLA 2DQUH 3SDAA 4U6XB 4J4PA 1OAXH 5EU7E 4M1GH 3P77A 4IBLT 1EXUB 1X4ZA 1XIWB 2EH8L 3OHXA 2ICWI 3SDDD 3IXAA 5KN5B 3P4LA 4UDTB 4X80H 5JUEL 4XVUC 1A7PH 4KWUA 2Q20A 4NPYB 3M45A 4P3WA 4H8WC 1L4IA 5HHNB 1R24A 3O8XC 5J6HB 3UPRB 4HLZH 4KVCH 2Q3AA 4XNYL 3BZEA 1JN6B 5CD3A 2XA8L 3QIUB 2CJUH 2YXMA 5F3HA 1HYSC 2R1XB 3TBVB 4F37K 1I7TA 4R9HA 4PJXA 1PG7H 2UUDK 4HBQA 3WMSA 1BEYL 2WWKO 1UWEH 4HS3A 5H37H 1BLNA 5DEZA 2WBWB 4C4KO 3LQZA 1EUUA 5I9QC 1BFOA 4P5KA 2J8UE 1TQCC 1ADQA 3T3MF 2YK1H 3VXSB 1KC5L 3QPXL 5I1KH 1AQDB 4E41A 2X4OB 3G08B 3K80A 5SWSA 1NDMA 2UWEF 1EJ6A 1SEBB 3P9MB 3O9WB 1HI6B 3PWLA 2EDKA 1YEKH 4HZLB 2X7LA 5GGRA 2VITB 5MHSE 2R1YB 1E6OL 4MXQC 2YUZA 2NMSA 5CUSL 4L3EB 2FNBA 1MCPL 3MRPA 1NCTA 5CLWA 2K1MA 3DX8A 2E6JA 4UQ2B 3DX6B 3KLAB 2YN5A 5IB4A 4PR5A 4KJPD 1FO0B 3P0VL 1AXTH 1TETL 2H32A 3PL6D 3D48R 4H26B 3MRRA 1QP1A 3UCRA 4MX7A 2W91A 3IU3B 4XPAH 1KTLA 2X4OA 3T2PA 3PV6A 1QFOA 5BV7L 1T04B 2NX5E 5FGSA 4JPWL 4R4FH 3PWNA 4HS8L 1XCTB 3BKCH 5DTFA 5GZNC 3MYZA 2YR3A 3GSQB 4P2QA 3C08H 4KAQH 5DD0L 1UYWH 3FQTB 5L7XL 4FQ2L 4F33A 2FHFA 1I7UB 5KSBA 4U1KA 3UDWA 4XVTH 1RAMA 4AENA 1PVHA 4YEEA 2AI0H 5DQDH 1VSCA 8CGTA 4WNQB 4MHHG 5HJ3B 4NGHH 4RMWA 1DBML 1VACA 2KH2B 5DMKB 1JNJA 4PRHE 4CVXB 4RNRA 5D7SH 4BELD 5KG9A 5IFJB 2E9BA 4XP4H 4PJCB 3I6GB 5CEXB 3MRKA 4MCZA 5FHAH 4Q9QL 1CL7L 3P9MA 2ZG3A 4YHOL 3MNVB 3GDBA 3TFKD 3ZDXF 3KGRA 3KG5A 3V6OC 2Y07H 4P23B 5E6ID 4PB0L 5IUSA 5E99H 4R4NC 1G7QA 5IQ9B 2OQJB 3CVHH 3QDGA 5DQ9B 5I18L 4N0YL 3CFIC 5AWNH 1Z3GH 1GCFA 4D3CL 2FYYB 4L1HA 3GSUA 5T1KD 5DUBB 4WY7H 2P7TA 4KY1H 3QDAA 3BPNC 4KROB 4XVSL 5DI8B 3DSFL 3KS0H 3OMZA 4BM7A 1T7WA 2XG4A 3KJ6H 5GISL 3UBXI 3QA3A 5E56A 1I9IL 4ZS7L 4MSWA 3UTTD 3B9DA 1JPFB 2BNQD 2HVKA 4S1SL 3UTPD 5BS0A 1N0XH 7FABL 5DS8B 2Z8RA 5J4MA 4EN3A 2HTKC 4BJLA 3CMOL 3U46A 4GSDL 2BK8A 4D0DA 1UJ3B 5T1MB 2UY6A 3AB0C 2J1KA 2CIKA 4PJGB 4NN5C 5KSAA 3L5WA 4OCLC 4Y2DD 2VLRD 3BN9C 2IC2A 2M2DA 1FSKC 3JWNC 4D9QD 4UILL 2OTUB 5HHMB 1UKSA 4PJIE 3RTQD 4YFDB 4DWHA 5D1ZA 1TTGA 4LLAA 5KSAC 4LPXA 4TRPL 1R0AH 1CE1H 2HVKB 5CJQL 4NN6C 1O7VA 2P5ED 1XGTA 4QTHA 4G9FD 1M71B 3QUZA 5CBEA 3RGVC 2X05A 5C70A 2CDEB 4Y1AE 1HHKA 2DBJA 2HFGH 3W5NA 5EZIH 4B5EA 1NDGA 3PWVA 1GGTA 2J5LB 4Q2ZA 4ZXBC 4ERSH 1WK0A 4N8VG 4H25A 2JELL 1VFBA 3IDMA 1FNHA 1U8QB 2YKLL 2CUIA 3WL9A 2ICWB 4I5BB 1QYGH 4FFZL 3TLRA 4N0CC 2DQIL 4I2XE 1HH6A 5TDPB 4LVNB 3PV7A 2P8MB 4P2OB 2DTSA 1OP3H 3EO9H 4P4KD 1HKLL 4HG4J 2OR8A 5F8RC 4LCUA 1DEEB 1ZS8B 3GSRA 1ZLWK 3ZKND 2IGFH 1SJXA 5EU4B 3JTTA 3IYLW 3DYPA 2DQGL 4N0CA 1ZHLA 3U30C 4GAGL 3BGFC 2IMMA 3C5ZA 4C57C 3QCUH 5GGUB 1I9EA 1E4JA 1Z9LA 4QHNA 2XZQL 4PJFF 5T1DL 2EO1A 3WSQL 4UBDD 3G5ZB 5IT2L 5BRZA 5HI3D 1WFNA 4GKZA 3OAYH 1C5BL 3OJVC 2N4IA 4RX4D 5SWZB 1OP5H 3QNXB 5FO7A 4K8RD 2FJGA 1FHGA 3BXNB 5E2VH 2NTSP 2AK1L 2BVTA 4Q9RH 2C3VA 4RAVA 5CEZH 4YHNA 1JZ5A 1LO0H 1EHLH 5EZLB 2F54A 3MV9B 5FUZH 3HUJB 3P9LB 3MNWB 3MUGA 2NW3B 4PGDB 3N9GH 5T5NF 5D70L 3K2UL 5H2BA 1GIGH 1HWGB 4WFGD 5I17A 1T20A 5EUKB 3H3PL 1RIVL 4Y4HA 5F88B 1H3PH 3U48A 1X9QA 3Q1SL 4TSBH 1RUKL 3GSXA 1MJ7H 3ROLA 4MJ5A 3ZTJG 2JJSC 1QLRB 3I50H 4UMGA 5EN2B 4F2MB 4FQ1L 4U3XA 1ORQA 1CBVH 5GHWL 4R0LA 3BXNA 4A2LA 5J0BA 3MA9L 1S5HA 1SMOA 2DLHA 4PRHD 4K23H 2R4SH 2VDKL 4OTXH 1YC8A 3AFLA 3OBAA 4X4YA 2MHAB 1AGEA 1J1PL 1QVOB 2BXYA 3C6LB 3MOBL 4Q6IC 3EUUA 2DQHH 5DMIH 5ID0A 2H32H 1PKQE 2XFXB 3D3VE 4NZUH 4M9OA 4EJ1C 4U2YA 5E2WL 3WIFB 5ISZA 1NMBL 5DVLA 3GBMH 1E4WL 1AGDA 2OSLA 3DBXA 3OZ9L 1BBDL 1CFBA 5FYKU 5IFHL 2AXJA 2KBGA 4XI5D 4XBEL 1AO7D 5DQJA 4P59H 1KTDA 4TSAH 5JIKA 2LAAA 1TZIA 3JWOH 2C3WA 2IPUG 3HI6H 1KCRH 3NFPB 3TO2A 2XZZA 1AP2B 2QEJA 1T1XB 3LMJL 4WHYH 1JNNH 2X44D 4ZO6A 3HA0A 1G7HA 1UWXH 2J6EA 4R7DA 3RGHA 2DMBA 3HS0A 1N59B 2IQ9H 5LJYH 1CWVA 5EFIB 4M00A 1QBLL 1I75A 4P4KC 4XP5H 4F7PB 4MAYA 5I8KL 1GGIL 3U4BH 3V9FA 1KLGB 4UDUB 1OF2A 3A6OA 1W0WB 2YPLA 4WGWB 2C3GA 3KXFB 2FX8H 2Z35B 3I9GH 5K93A 4TVPE 1I8KB 3MLRH 2EC9U 2PXYA 5T1DH 5JPNB 1HXYA 2BHZA 2ZOLA 2ZUQB 1OW0C 1D5BA 3VXPB 3HCVA 4RFOH 4ZDHB 2G75A 5HHVH 1I7TB 5KOMC 3HS0B 2HTLD 1BOGA 4LNRB 2FIKA 2OL3L 2NXZC 3VFNA 3SE9L 1BLNB 1HXMB 1ZVSB 3SO5A 1ZHBB 1QHOA 3QQ9C 5E94A 4DEPC 2IAMD 5CEZL 2Z31D 1HHIA 5EBWB 2B4CC 4XPBH 5HGDB 4WW2A 2HJKB 3DXAA 3EOTL 4JO3L 5CD5C 1BD2D 1Z0MA 2W0FA 3CVHA 1GGBL 4K3EH 5C9KA 3U9PH 4NRYA 3RI5F 1HH9B 4HG4K 1KYOJ 2HWZL 4X8XA 3GO1H 1AKJB 3HFMH 5ADOL 5C0JA 4LCWE 4PJFB 1U93A 2Q76B 5E5UB 3MLYH 1EHAA 2O26U 1F4WL 2RB8A 1VEPA 1XGYL 1T1XA 2FB4L 2XPGA 4NHUA 1LNUA 4KKAC 5IEKA 1HK6A 3SDCC 1P84K 4JN1H 3ULVD 4XPHH 1R3JA 4OZHB 3BDYH 3B9KC 1N59A 2B7DT 1S9YA 4MZ3A 5DWUL 3V6FB 4AH2B 2AERT 4M43L 3K8MA 5DURD 3SBWC 1KXQE 4RX4A 4MCYB 4TSAL 5JPMB 4WI2A 4BQBA 5EZOL 3KS0J 3QFJA 3SE8H 1B0GA 2WP3O 1H3UA 5EO0B 3DTXB 3KXFA 3HE7B 2YA2A 2VXTH 3MV8B 3PJSA 3IJYA 5C0IB 3RY6A 1C5DA 1UB6A 3J7HA 2CO6B 2FECI 5HYJE 4EI6B 1NGQH 4PRAB 5F72S 2Z8SA 4DOHB 4AG4L 1OAQH 4PJ7E 2W0KA 1EA9C 3C5SB 5LG1A 1MCWW 1JZ7A 1T03H 1ZVSA 4F7EA 2VR9A 2Z4QA 4HS6A 3SDAB 1H3VA 4J8RA 2A6JA 3QHZL 4R2GC 5C08D 2LU7A 3R1GH 3X12A 1IGMH 4MXQD 1JPTH 3MGOB 1MHPL 1VHPA 5L2JA 2VTFA 2GJJA 4L8SA 5DJ0A 5CGTA 5K9QG 3BDXA 4QTIH 3BZEB 3TPUB 1C5DB 1UB6B 5SWSE 1EFXA 1T5XA 3KJ6L 1VADA 4PLOB 4BUHA 4M61B 1PJ9A 2G9HB 4J4PD 1MEXL 1NFDB 2H3NA 1KB5A 4PJFA 4F7EB 1RZKC 1Q0XL 5E9DE 5KSBF 1PYWA 3QNYA 5D1ZD 4NKOB 3ARTA 4LFHG 3D3VB 1PKQB 3B6SA 3PGCB 5E4EC 3BSZL 4LSSL 1RJZB 4QNPE 2WAHA 4OAWA 5SWSB 3AB0B 2O5ZH 4N5EC 1H5BB 4D9RD 2WLZA 4MNGB 1MJJB 3JUYA 1IGTB 4K3JH 4QRUA 4KRMB 5TH2A 5JNYB 2EYTB 5BS0B 2EXWC 4WFHD 5AZEL 1PLGH 3U7YL 3O2DL 4EN3D 2P48B 1J11A 3CFBB 3QUXB 3DX6A 4OLUL 2A9MH 3IS0X 1IAIH 1B0GB 4I4WB 4JQIL 1NGPH 5GZOD 4CVXA 2LTQB 5GRJL 1RHHA 4Z7WA 5TJWK 4HT1L 2PO6C 1P69B 4HUXA 3EOYG 4UV4H 4HIHB 3QIUA 5ALBH 4JCMA 5HYJB 2IQAB 3HC3L 5JR1H 2V5YA 3LN5A 4M3JA 5HPMB 1ZGLP 1I8LC 5TH2B 2P5EA 4CMMA 4P3DB 3MNVA 1C16A 5JW5A 3FQNB 3OKOA 4MJIB 4OIIL 4GQ9L 3S5LB 3N85L 3P73B 2CH8A 1MFEL 3EO9L 1S7TA 4M1DH 2NW2A 3HUJE 3V4VL 4Z76B 1BQHB 3WE6B 3CDCA 3T09A 3EO1B 4JPKH 3KPSA 4PRPB 1RIUH 1FJ1B 4LSVL 4AG4H 3FQNA 3ORJA 3HNSL 3RDTB 3QH3A 1XMWA 5DJDA 2UWEA 2N56A 1NC4D 3TH4T 1FAIH 1J0ZA 1LMKA 2J6EH 4OI8A 3S37X 1S9VB 1DE4A 3SKMA 5E5MA 1YJDL 1FVEB 1RV6X 4JDTH 1I1AB 1JWMA 4BSWB 3QWRD 2BNRE 3T4AA 5KAQF 2IANA 1WBXA 4GUPA 5KVMC 3MOAL 4MAUL 4M6OH 4XCYB 3OAUH 3C60A 2BZDA 2VLLA 4XGZA 1QSFE 3O3AB 4W81A 2P8PA 4R26L 1VDGA 3MUHL 2AJYL 4JRXA 5EUOB 4Z7UE 3Q0HA 3BRGC 4X7SL 3ZO0A 2Y5TA 5AWNL 3VCLB 1P4BL 4PYGA 3PNWB 1L7TH 1BJ1J 4TVPL 5BOZG 3FFCD 1BX2A 4R96A 2DOCA 3MLSL 2VLKD 3QCTH 4P2RD 3RVVC 5C7XL 1FZKB 1YEFH 2BOCB 4WI8A 1XH3B 2J8UB 3PGFL 3GMOA 4LPUA 3PWPB 5JHDB 3E3QE 2BVQA 3EDKA 1TNMA 5DUBA 3KPRD 5CSBA 2DLIA 4IDLA 1QR4A 5JDSB 1CFNA 4WJ5B 1UFUA 5KTEL 1RJYA 2B2XH 3K3QA 5DT1L 3IDUA 4EVNB 4QF1B 5EBMA 1RJLB 1A6ZB 4Y16B 1H8SA 4N5UA 4ODBD 1NQBA 1T7YA 2VDOH 4WI6A 3WJJC 1FP5A 5F93C 4ZXBB 1PW3A 3LQMA 4O2EA 4XXDB 2ADIB 2Y6SC 5EIIA 4GMSH 5GS1A 3ZE0F 5KG9B 1E4KA 1FFOB 5IVNA 3MV7D 3HC4H 4MXWL 2ZCHH 5B4MC 3W9EA 5DJXA 1IEHA 2BVOB 4AEEA 4OCWH 1CGXA 2X89D 2GCYA 1INQB 3ZKNC 1RZGA 5DJ6B 2I60H 2IH3A 2GJ6D 4LRIC 3SCMD 5EH1A 3VXRA 4MJIE 4NQCB 2XRAL 4JFPB 2DQJH 4C83A 4FZEH 5I8KH 3RUGF 4H8WH 4M03A 4X6BA 2I24N 3NABH 2Y36L 3C60B 4XGZB 3HR5A 5J1AB 4WHYG 1XF5A 4EDXA 3L9RA 3NFSH 4JKWA 3FOMA 4N9GA 2JK5B 2V7HB 1N26A 3L3KA 1E27B 5JXED 1J88A 4J3XA 4PRBA 4S10A 3QEUA 3RQ3A 1N2RA 3L3JB 5FK9A 1OWRM 4PLJC 4M7ZC 1A1MB 5GGSA 1ORQB 3PQYA 1ZT4A 5JMOC 1IL1A 3P30H 4U05A 1QQDA 1YEGL 2HN7B 2A1WL 1A6VL 2AEPL 2HYMA 5IJVB 4H0GA 3TC9A 4OM1L 4PBWD 2IBGA 2AJYH 4NNYB 1J7VR 1CVSC 4D0CB 1CLYH 4DQOH 3SDYL 1FLRH 5EORH 4BFIA 2G75B 5E8DL 1KYOK 2DIAA 4R2GB 1A7NH 3OAZK 1RUPH 1LO0L 1F6AA 3QI9B 1PBYA 4HQQH 4FQIH 1RZ8A 4MA3B 3PQYB 4D9LL 2AW2A 4L4VA 2NY6D 4WUKH 4YBHA 2DKMA 3FRUA 4ODXB 1FNGA 3VU2A 43C9B 4LSPH 2O5YL 2LE9A 4BFGA 1A6UH 2GTZA 1NKRA 1KB5H 4NNXB 3PL6B 4XRCA 2NX5B 1WFTA 2FSEB 1INQA 3FOLA 4PJHB 1YMMA 4MNQD 4BFIB 3KLHC 2XY1A 1RVFL 5JW4R 2OL3B 5C0BD 4YIQB 5ESAA 4G8GB 2ICEB 3JV4A 3U6RA 5D96B 1RZKH 1J12A 1QKZL 1WIPA 5HHMD 1FRGL 3HPJA 2ILLA 4GMSL 1WWWX 4UIMB 1OAYL 1ITCA 1FNSL 2X9XA 3TYFA 1I1YB 2G60L 3RVUD 3WKNA 3DUSB 1BD2B 2AJXL 5E4IA 1R3IH 3MFFB 3FQXA 4WO4A 1KFAL 4X8JA 2DQFB 3WV0A 4HIXH 4P46A 4S1QH 5D2NC 4OZGA 3TN0C 4L3EE 4PJEE 2EDYA 4G9DA 4NJAH 3MMEA 3BIBX 1I3RA 1D6EB 2VR5A 4LHUD 1CGSH 1VENA 1FE8L 1RPQA 4HXBL 1U8HB 3BEWA 4Y1AB 2R2CA 1ULVA 5KVEH 1BECA 1E4XI 3TWCL 1QQDB 4KK9D 4GOSA 4PRIA 1WQVT 3VFOA 1MSPA 1WCBB 4YHZH 3QEGL 1QBLH 2ZP0T 4HF5H 1ZANH 3MLZL 5DUPH 3B8SA 2BC4A 4AM0B 4MB5A 1IGIH 5F88A 4QWWD 1X5XA 2KKQA 5I1IH 5TQ0L 1FC2D 1LO5A 3QQ9D 1BQLL 4OFYA 4LCWB 4PJFE 3C60C 4FQXA 1YEIL 3QDME 5DD1L 1XFPA 2YD8A 3QXTA 3T3PE 2SEBA 1MRCL 5EWIL 3RX7A 4ZTOH 1QBAA 1H9VA 1Q0XH 3IKCA 4PJAF 4U33A 3S36L 1BIIA 5KW9H 3T77A 4POYA 5D9SA 4A6YL 4GG8B 3CXDL 1WVZA 4MJ6A 2JE8A 1MF2L 1NCBH 5I9QB 3BWUC 5JO5B 4Z77B 4X7EC 3WN5B 2ZPKH 3SDYH 2P24B 1NDMB 1IM3B 4R7NB 1L0XA 5CP3H 3S3PA 1JUFB 1QBML 4Z8FL 2MFNA 2BSSB 2XN9E 5T3ZH 3FQWB 4WW1A 2Y9RT 2Q87A 2EDDA 1MNUH 3TVMC 4FQXB 1U3HD 3DURA 1UZ6E 3VGHA 3W11D 2VH5L 2F74A 3UTTB 1S78D 1U58B 2VDML 2JIXD 3MRHB 3HMWH 4I77H 5FKPB 3EO0B 4ZUWA 3MXWL 4RSVA 5I19L 5EU7C 5I15H 2EDHA 4YNYA 3UPRA 4NO2A 1G7LA 2EDLA 3MLYL 3VDBA 3ULUH 3MLWL 4EDWH 3DMMD 4WDIA 4R8WL 3WFEH 1W8NA 1LDSA 2QHRL 3H0TA 2CKNA 3PP4H 1YYLL 3AMLA 1BF2A 3AY4A 5CKAA 3QFDB 4TUOA 5TQ2H 1IFHL 1EK3A 3CCHA 2OMBA 4U1NB 3LEVH 5MP6H 1R3LA 3WDHA 3T2NH 3DUUB 4KK5D 3U0WL 4JGUA 2BC4B 2BHUA 4FMFA 4NHCH 5DJ0B 4JZNB 4XNMA 1MAKA 2WUCL 3IJHA 4APQD 4DUXA 1NCWH 1DLFL 4WFGE 2R2HA 1A5FL 1PZ5B 3MROB 1SJVA 4NRXB 3LKQB 2VZ3A 3ARSA 4U6XA 5IHUH 3DX8B 4UQ2A 4IIQC 2NY5C 1UQSB 3TWCH 4JVUA 4QY8B 2IANE 4ZNCD 5KZCB 1QNZH 3BEVB 3O45A 4KI5D 5IESL 5DUMH 3LKRA 4FXGA 1WC7A 1Q0YH 1I9JH 3TBWA 4F9LA 2VQTA 2CMRH 4JM4L 1XIWC 3PWJA 5IJKC 3N06B 5A1AA 4HK3J 3E1F1 1AFVH 4WUUE 3UMTA 4MNGA 2XWJB 5IB3B 3LQZB 4LNVA 3ARBA 1PQZB 5CEYB 4F9LC 2LVCA 2ZNWA 3G5YB 3BO8A 3DVNB 1A7BA 2BRRH 3QUML 1E6OH 5EO1A 4ACPA 3BPLC 4X5XB 3NACH 4L3CA 2COQA 2BDNH 3NCFB 5JW4N 4P2QD 3RY4A 5ACZB 4CAGA 5AAWA 3UAJD 15C8L 1TJIL 5J13C 1T66C 3NIGE 2NTFB 3C6LC 3THML 4NZRL 4LAQH 4WDIB 3INUL 5DD5H 3PWJB 1QUNA 1VFMA 2HVJA 1RZJH 4LHJB 2AK4D 5C07D 1JI2A 1WEJH 3VWKA 5F9WB 4MNQA 3OL2A 5KSAB 3QNYB 1N5AB 3ARBD 2ICES 3EO1A 2DWDA 2FGWH 4HK3N 3BKML 4XMKL 4TUKH 4PJ7F 5GISH 1JP5A 1INDL 1II4E 4JO2H 4YDLC 2IPUK 5DJDB 4FNLH 1NMAL 3BMWA 2HLAA 4ZUTB 5CJ5A 3AREA 4EIGB 4X6DA 3CMOH 5TE4L 1ZOXA 2DQEL 1CXLA 3KPQB 1GAFL 4QHKJ 1SY6L 4ETQA 4HK0A 1IZKA 1GPOH 1VFAB 3NIDF 2VLLB 5FA3A 3U0WH 3CXHK 3VJ6A 1NBZB 2BNQE 5GPRA 3O9WA 3PWLB 4PUBH 3UTPE 1Q9WA 3FCTB 5DO2D 2IPKB 4M1DL 3BQUC 4ZODA 3SGDI 4K71B 4G7VH 1G7PB 3H9SA 3RWEB 1C5BH 1O7SA 4HAGA 1FLTX 1NANI 3MJ6A 3TBTB 1OAXL 4OF6A 3M1BA 2ESVB 1KTLB 1UKTA 3W9DB 1T2QH 1XR9A 5IQ7H 4M7LL 2I07B 1LE5B 4BH7A 3OAYK 4PB0H 3HR5B 1UM4H 5FA3B 2C1OA 5GJTH 4XI5C 4G9FB 2ARJB 3X3GH 1IC4H 1IILE 4JFFA 2X4NA 2R4RH 3MLVH 2NNAB 3VWJB 2CLZB 5HYEA 4P2QB 1BP3B 2DN7A 4IM8A 3VGFA 5I73C 5E08L 1U8JA 2WINA 4J6RL 2EH7L 2F5BH 4Z7OE 1HKLH 4M6AA 5FYLE 4QTHB 5JOPE 4ODVH 3QISA 4HKXB 1K4DA 1U3HB 4EBQH 4F33B 2FR4A 1KIQA 3AUVA 5D2LA 5EPMA 1S7SB 1I9IH 3SGKC 3HMXA 1GGUA 5GGVH 5BMFL 1KB5L 4PGDA 3JV0A 3QZWA 4IMLA 2BVOA 3LQAL 4X5WB 1JGVH 1OPGL 2EZ0C 3NTCL 5IBUG 4NZUL 4OF3A 1NCDH 4HJ0D 2VXSL 4XNUH 3TO4A 3TA3B 3RU8H 4DUVA 4OD2B 1YNLH 3Q5TA 3TJHC 2CK0L 5CP3A 3U46B 4L4VB 5T1KA 2CGRH 5D2LE 1TQBB 4P2OA 1Y0LA 1LO4L 3TGXA 1FN4B 2PW2B 3I3DA 3MRGB 3JTSA 5TDOA 1EEYA 1E6JH 3M8OL 3MLUH 2VERN 2QSVA 5INDB 3VW3L 4KGLA 1JHLH 2P5WE 5FXCH 4MVBA 1JZ3A 4G8FA 1INDH 4XWGH 4WRLA 3G5ZA 2PYED 2NXYD 4P2OC 4X9BA 1NCNA 3WIFA 1MCQA 2ZWLT 1BQHG 1P4IH 4RAUA 5BQ7A 2EE9A 3C2AL 5E8OA 3HNVH 2JB5L 2VKXA 3V7AE 3OKKA 4MVBD 1S9VA 2JJTA 3SKMB 4FQXD 5C2UB 3PG2A 3O81A 3S96B 3BIKA 2BCKB 5C0EA 1H3WM 3RX5A 5DJ8B 3KNBB 5DMGC 1F02I 3V5DB 2HKFL 1MJ8L 3QT2A 4NO0B 5HDBE 5IV2B 4WWKC 4PTUB 2FZ3A 4MS8A 5I17B 4WO4D 4NQEB 4G6AD 5F7HA 1KTRL 2VUYA 3MRLB 4LBEB 4K7PL 2R2BB 4D0BB 2YZ1A 1BF8A 3DVIA 3MREA 3VXME 4PB9H 3SGJA 4PS4L 2YD6A 3ULUF 4J23A 3KYMB 4MB3A 1CDYA 4QCIA 5E1AA 5KSUA 4ODUB 2YWYA 1UEYA 3N0PB 4UTAH 3GMLB 3SOBL 4NQEA 1RJYB 3F7QA 4R3SA 1EX0A 5TGBA 5D5MF 1Q72H 4D0BA 4QKXB 4MDIB 4P2YA 3CH1B 5KVDH 4YXHH 2BSRA 4PJ8A 4LIQL 2AXFB 4D2NA 4AMKH 1UJTA 1NBYA 2FH8A 4GXUM 4X83A 5GRUH 4G6KL 4YAQA 2EDWA 4I0PA 1RUPL 4XPFH 4CBPA 4PP2A 4DKFL 5KAQG 1MH5A 4I18A 3ETBF 1ZHKA 5I30L 5IGXL 3F12A 3NGBB 1OSPL 4HUKB 3D39B 5E5RB 3UO1L 1LK3H 2O5YH 2LQRA 5EBGA 2X1QA 5I1JL 3H7BA 4LHQB 4XPTH 4OGYL 2EIDA 5D6CA 4DCQA 4XC3H 1X4YA 4I18C 4C56D 3R4DA 3PP3H 5B3JF 4HEME 5EZOH 1QFWH 3WDJA 4Q9CA 2Z35A 5ALCH 2DJUA 4UDUA 3MODH 4DN4L 1FZJB 5A16A 4AM0A 1UKQA 4KVCL 5CAYB 4PP2B 4XNYH 1T21B 1DQML 1T1WB 1KENL 3GMPB 4IRJD 1UENA 3L3KB 1INEH 5CJBA 4N90E 5IVXF 4MVBC 4JKMA 1EAPA 1EVTC 2NXZD 5DA4A 3I2CL 3U6RB 3H0TB 1MHCA 3VFNB 1JNNL 4KFZC 3QDGE 1S7RB 2XZAH 5JQHC 2FO1A 3BP5B 5E2TL 3HI1A 1AP2A 2CRZA 4KKBC 2BERA 3KPTA 2QQKH 3SE4A 4KKNA 4HD9A 2QKIA 4AL8L 4BZ2L 1PX3A 1OOAA 4LEOA 1NEZB 1J8HD 2MKWA 4JQXC 5IHBA 1U8KA 1RZFL 4Z7QE 4DZ8A 4O02H 3REWA 1H3XA 2XTJC 3ZDYE 2Z4QB 4HS6B 3MV7A 4JFQA 4FQCH 3QP3A 1GC1L 3SCMA 3VXRD 4FG6C 1GL4B 3RX8A 3P0VH 5KS9B 2H26B 1CE6B 2AV1B 3BUYA 4QY8A 3U0TB 1N6VA 2Z0BA 5C0GB 1IEBB 2DMCA 4W4OA 2GTZB 1W0WA 2YPLB 2I9LA 3H42H 1I7ZA 2BNUA 4OSUL 3TZVC 1IC7L 1R3JB 2NX5A 1ZHKB 1SEBA 3SDXE 2QKIB 3B9AA 4P9MH 2X4SA 4R4BA 5LXGH 2I9TB 1XGPA 2APBA 4MAYD 3Q3GA 3KPRA 3BRDA 4L8CA 3CDGA 2J12B 4YBQC 5JPMA 4QRPB 2EDQA 4H5SA 3LZFH 1IEBA 5E2VL 1FNLA 1N5YH 2H26A 4KTDL 3B83A 1NAKL 3WO3B 1P5UA 5A40E 4NFBA 4U7KA 3SJVB 3MCG1 2HJLB 2AK4E 4N8VB 1T22A 5FYJL 2DQFA 4QTIL 3BGAA 4IJ3B 4OAWB 4XMKH 2P24A 5F3BB 1WZ1L 5B39A 4V3DB 5C9JB 4EEEA 1MCSA 3T0EE 5L8JB 5I76A 1CXHA 3CIQA 4X9HA 1LD9A 2BY0A 4O9HH 1JTOA 3CFDA 4XCCL 5GGTH 5C0JB 1DBMH 4DW2H 3LN9A 3BN9D 1TVDA 1G9MC 5DRWA 5TE4H 4QGTA 4EOWH 4P5KB 2A6JB 5HD8C 1ZA3A 1YC7A 1VGKB 4O2FB 1RURH 4TULH 3RL1B 2Z91B 2NY4C 3ULVL 4OQTL 1KENH 1MCHA 1HXYB 4NWTH 1UXWB 3P2TA 3V5KA 3M17B 4HPYL 3QXWA 1RZJC 1D5IH 3T3PF 2W9EH 3VXUB 3BGMB 5HDOA 1ZEAL 4JG0L 1ZHBA 4GS7C 5F96L 2F53B 3LH2H 4WWKB 1HEZA 3TNNB 1DQJA 2XYCA 2YD1A 5LQBL 1JL8A 5DZOA 5IVXB 1BREA 2HH0L 1QSEA 4HSQA 2R0KL 3QEQE 4HCRL 4M8VA 4ORGB 4M6ML 1JWUA 4ZFOA 4JDVA 2V7NA 1QBBA 4YHPA 4PLKD 1JUFA 2QQNH 5C0BA 3QDHA 5SWQA 5LAXB 5IBLC 4H1LH 3IVKA 2NXYB 3HG1A 3KPRB 3SE4C 4L8CB 3QH3B 2R2HB 1ZVHA 5FCUH 1IGTA 4Y4KC 5JNYA 2YA1A 4MB4A 5DF0A 4J6RH 1ZT1A 5E7FA 5FM5M 3SKUD 2Q8BL 5ICYA 1A4JB 2BNRB 1TMCA 1YEJL 1YN6A 2ZUVA 4JDVB 4KVNH 3SCMC 1NL0H 5CD5D 5MENB 1EHNA 4J1UB 4JRXE 5INCB 43CAB 4YUEL 3RWDA 4NT6B 3ZE2E 2D7NA 3B8YA 2PKDA 1HINH 4ZAKD 4OCNC 3BN3B 4P3DA 3PL6C 2CO7B 1X5AA 3D18B 2H8PA 1AE6L 2OP4H 3JV6B 4RGMC 2ESVD 5I1GL 2DQTL 4BH8A 1BZ7A 5DGRA 3CCHB 4U1NA 2YD2A 4MX7B 1PG7L 2EIZB 3WIIL 3WFBL 4ESKA 3RAJH 1JGLH 3G6AA 1NBZA 4KY1L 4X5XA 1CICB 4NQSA 4HWZA 4F9PA 1RULH 3W0WE 3VXUA 2EYTA 5HGBB 3O3DA 5MERA 3BVNB 1A14H 3WKMH 1BZ7B 4ZUSB 1NUFA 4YJZL 4OB5H 3K4DA 3HZMB 4LL9A 4YXKH 4P2RE 1C12A 5TPWH 4HAFA 1WZLA 2UZIL 4MJ2A 3V6OA 2XQYG 2DDQH 3QI9C 4IDJL 4GH7B 4H25B 3R0NA 4ETYA 4BH7B 4A2MA 2DLEA 2V9QA 4DGVL 5DFTA 5HYSG 1YUHA 3IFPA 1WT5C 5CSGA 3KJ4B 1CF8L 2G5RA 3D85A 4EZMA 5BRZE 3PWPD 2YPKA 2MOVA 5DFVC 4GAYB 4Y5XB 4FZ8H 1JZ8A 3WHXB 1L9MA 4W4NA 2CLVB 3CLEH 1WCQA 4ZAKA 5T3XD 3U4AA 5I66A 1A1NA 4U6HA 3GKZA 1KN4L 4JKPH 4Q74A 3C08L 3BUTA 3HZYB 1T04A 3B6SB 2BY1A 4C54A 5L7XH 5ESQA 5EOCJ 5C2BH 1OP3K 1RZ7H 4C55A 2AXGA 2PYEB 4LLWB 5FOBA 4L8BB 1A6AB 4PJDE 1ADQL 4Y2DA 2DM3A 5TE6L 5AG8A 1AJ7L 3LDBC 4KDTC 1BVKA 5IQ7L 1DDHA 4IOFC 5F1NB 4L3AA 4M48L 4ZAKB 1KCSL 4XXDA 4Q0XL 3LDBB 2CRMA 5D71H 3WHXA 3RNQA 3UC0L 5C0NC 3LS4L 4S1RH 4NN7C 4NUJA 1JWSB 4OLYH 5JHLH 4KDTA 3MRGA 4XAWL 5BZWB 1MI5E 3BT2L 2P7TB 4XCYA 3WD5H 4BUGA 5IVZA 4PJDA 2X4PA 2EEDA 3RGVA 5HYIA 2ICWA 4I5BA 4LPTA 4U1IA 1X3DA 4Y4HB 4DTGL 2VLRE 2A0LC 1A6AA 1VFBB 1K5NB 4JAMA 4TSCL 3DVGB 5T5NG 4JVPA 4NDMA 3S88H 3QFJD 1QFHA 4R0LB 4JPVH 2IFGA 5EDXA 2PXYC 5FM8A 4HKJB 2XKNA 2B1HL 4YZFF 5D2LB 2DJ4A 1X5LA 2ZCKL 1UWGH 3S96A 3QAZC 5DZNA 1M05A 1EO7A 4I8DA 4XHQA 3SEPA 1HQRA 4I48A 2UZYB 4LDLB 4XB8A 1YUHB 3IFPB 5L88L 3QUYA 4N9GB 4LK4A 5IV2A 5A2IH 1FNAA 1H15A 2D7TL 1MY5A 3E0GA 3H7BB 5IFAL 1HQ4A 5MEPB 4MQXD 5E5MB 3TBTA 2CDEA 3D5OF 5DHYA 2OXHA 2O5XH 1YY8B 3ARGC 1VFUA 1FFOA 4W6WB 4FFEX 4NBZB 1AQKL 2XXCB 5L9DH 5ENWB 2J8UF 3KPOB 1T7XA 2VL5A 4QGYA 3HNTL 2W60A 4PREA 3MACH 1CF8H 3QA3B 3AM8A 1CGWA 4PG9A 1U8QA 2GCYB 4X6CE 1C1EH 1T20B 5ANMB 5EUKA 1CU4L 3D0VB 1F90L 3ULVC 1J87A 2J4WH 1LEKB 1D6EA 4FFWD 2GIYA 1F6AB 4Y4FA 3MC0A 4JRWA 2VDNH 4QRRE 3E6FB 5F6IC 5F89A 1X5GA 5IBUB 3VXMA 1TVHB 3EKCA 2ESVE 3IAPA 4YAQB 1CE1L 5EU4A 2AEQH 3VFOB 4P5TA 4LSTL 5CJ8A 5KSBE 1BJ8A 2JJSA 4MA7H 3G5XA 4JO3H 1UCBH 4ODSH 1CQYA 1BBJA 1PGRB 3BWAB 2F58H 3KPSD 4RGNB 4HWBA 5KVGL 3LD8B 4YGVA 4APQC 4KROD 4NCDA 1P5VA 1BQUA 2HTKD 3MRLA 4YX2H 1J1XH 2MCPL 4OM1H 6CGTA 4H1LA 3OB0K 4X0KB 3GRWL 4JHWL 1CE6A 2AV1A 3BUYB 4WFED 3MLXH 1F4WH 1RIVH 2D7QA 1CT8A 5DJXB 2DQIH 3NFPA 3TYFB 1DJSA 1BEYH 5DK2B 4UINL 3ZZ1A 1OTTD 3V8CA 3RPIA 1IM3A 3ARUA 1KPVB 3IB4A 5CINH 1RZGB 4AMKL 1VEOA 2XWTA 4QHMB 4MLSA 5IOPA 2WBJA 4N68A 4I2XB 3TF7C 3BYYA 7FABH 2VSCA 3FAXA 3KYAA 3DROB 1YYLH 3KYKH 3RUGB 3K8LA 1JHKH 1D9KB 1S7RA 3T0EC 1LP9A 2BCKA 2O93L 1A7QH 4DVRH 1A6PA 5C0AA 2ZOLB 3BPOB 4PREB 1CLCA 1NC2B 1MH5B 3JWDH 2ZCLH 4WFFE 4DKEH 3GEWB 2WUCH 2F53E 3Q6FA 2EYSA 3BP7B 4LEXH 1ZVYA 3O2VH 4LASH 5KOVC 2YBRB 3K4AA 1OAUL 3AXLB 4C58B 1JPSH 5C08E 4UT9H 3B9KB 5J12B 3IETA 5MEQA 1S9XA 3SO3B 3MNWA 2V5MA 4YQXH 4PG2C 1JZ2A 4LOUC 4KRNA 4Y8AA 4IHOA 4OT1H 3DYMA 4QHUA 5I74B 2R56H 3VI3F 4G6ML 4WUUB 4M9PA 1LEIA 4K7FA 5F7DA 3ILQC 1AGFB 5LBSH 1JGEB 5BXFB 2C4XA 5CHNB 5DQDL 1AKJA 4JFYA 1SYVB 1T4KB 4P0DA 4TNVK 4MXQA 2X70B 1S9XB 3GFUA 3MRMA 4N8CL 3T2QA 1U8HA 3BEWB 4Y1AA 4N0UA 2M26A 2CDGB 2AK4B 1N3NB 3EZJB 1FH5H 3ZE1F 4HJGA 3SQOH 2EIBA 4KI1A 2XFXA 4NO2B 2PXYB 3TPUA 3T0WA 4DGYL 4GW5A 1KTKE 5C0CE 3HG1D 1T0NA 3VFSA 3I3BA 4FQLL 3GBLA 3ECBA 1G0XA 2IAMC 3L3OA 4I0CC 4W6XB 4UTBH 2H2SC 4P57B 3VFRA 1FAKT 4Z78B 1I4FA 2A83A 1HXMA 3EYVB 3VD4A 3SDCA 5F7EL 5D72L 4K9EH 3IU3A 2CSPA 2J8HA 3P77B 4U1GC 3QFJB 3S9DB 4KZDH 2RJMA 4XP5L 4U1SB 2IPTL 4KMTH 4PJIA 4KKCC 2Z9TA 4LU5L 4BK4A 2CD0A 5FF6B 2VZTA 3PWNB 4R7NA 3RIFK 2VLJE 2DI7A 3H3PH 4U1HA 4NO5B 2E7CA 2JCCA 3HMXH 1CLZH 4OZFG 4WW1B 4DFIA 3ECBB 4UZGA 4I77L 4PJCF 3LKNA 4KK5C 3BZFA 2A0LD 4L4JA 3UJJL 2LFGA 1DFBH 2VLJD 3UTTA 1EEUA 1AI1L 4MDJA 1QPXA 3VXMD 4WU5B 2DD8H 5JORA 3LKRB 3OTTA 4M7JH 5E95B 3O6FD 1FDLL 2YC1B 1A64A 3AS0A 3T2OA 3MRCA 1MUJB 3MV9D 1YEDA 2VABA 4GS7B 4G3YL 2ENSA 4PRDA 4HUVA 1LO3L 1UXSB 3VFVB 4HIEB 2AVGA 4NBXB 2JCCB 2GK2A 1RK0B 4GMTH 3HAEH 5AD0B 3KYOB 5L0QC 1WEJL 1EHXA 3PF2A 1FRGH 2FBJL 4Z7NE 3U0TA 1NGPL 5T3XL 3MRRB 5D5MB 1G7IB 2VAAB 5DYOB 4Z7VB 2NR6C 2W9EL 2BNUB 4POZD 2JJVA 2FEEL 5E03A 3DJ9A 4N1HB 2OX5A 3FONA 2J88H 4MQSB 1F42A 4CJ0A 3OX8B 4QWWC 1N6QH 2OTPA 4KDWA 2NTFA 5HGHB 5JW4Q 1DQTA 1MHHB 5CZKA 4NQCD 1L7TL 1HEZB 4QXGH 2XA3A 2R23B 5KSBB 1E4XH 5GS0H 4OGAD 3S36X 3X12B 1JGUH 1HN1A 2ZOKA 1V5JA 1IT9H 4N8VA 1B2WH 2CRIA 4P3CL 3TFKA 4Z7WB 4U6VH 3HTLX 3G6AB 5HY9A 2P5WA 5I6XC 1N7MH 3C6SB 4LSVH 4R0LC 3MGTA 1JGVL 2M1KA 1B4JL 3T3ME 3WUWB 4Y19B 1KCGC 5I1LA 3MJ8A 5IMKB 4JB9H 5JW5B 4IEFB 4N8PA 1AC6A 3FKUS 2A9NL 5HPMA 2R23A 3C09C 3NACL 4ZTPL 5DD1H 1T2XA 3QIUC 3ULSB 4U1JA 1X5IA 5EC2B 4ZUSA 5E24E 4OJFH 1TJGH 5HHXH 2I26N 2FEDC 3VGEA 5IIEA 3MRFB 5FUOH 2WIIB 2DQDL 1OP5K 3QB7C 4YHML 3TA3D 4YDVA 3GIVB 5FA4A 1X5KA 3DRTB 4OCMC 3FHQA 1JE6A 3R1GL 1QBMH 1DQQA 3MGTB 4JO4H 4Z8FH 1J1OL 4HDIA 3C5SA 3BDBA 2MSPA 4E41D 5I1KL 2AJUL 1RJCA 3QI9D 3MR9B 2Z93B 4QXUH 3SN6N 5IQ9A 1X5YA 5JOFB 4YPJA 4JZOA 1ZLUK 3IAGC 3JV6A 1G7QB 4ODVL 4XCNA 4CL7A 5IM7A 5IIEB 1YDPB 1DQDL 3VWJD 3TT3L 1EEYB 2XKNB 2R15A 4E5XB 4Y5YB 3OXRA 1FIGH 1OLLA 5HVFB 2BY3A 4PRPD 4U0RC 4FXGB 3O2WL 3P4MA 5GRZA 5JDJA 4KK6C 2R8SL 1A14L 3GHBL 4G3YH 1WIUA 4HDIB 1G6RL 3N50A 4JY6A 5FOBB 3V4VH 1U36A 2VLRB 3K4ZA 4O4YL 1L0YA 2ZUQC 4EI5A 4EUPB 1JHTB 1MFCH 2B1AH 1U8PB 4PJ9B 4M1GL 4PJGF 4K3DH 5DEGA 3WIHL 3LKPA 5F1IB 1MRFH 1A21A 4XPGL 1CZ8H 1OGAA 2FR4B 3OKNA 5HHPB 3GKWL 3PGCA 3T2NL 1HNFA 1IGYB 5IF0A 3ARGA 4FQQA 3TIDB 5IMLB 3FQRB 4OD1L 3OG4B 1IBGH 2FZ3B 1A9EA 3ZL4H 3SDDA 1EEZA 3BP6A 1KELH 2G5BB 1D5ZB 2CXGA 3NCYS 1Z9OA 4KK6D 2BP3A 2NZ9D 4QXGL 1HHKB 1A47A 4ZFOL 4HC1H 2R0ZH 5C07A 2MQ3A 3QUZB 5CBEB 2E6QA 4XXCA 2GTWA 5HHPA 3GRWH 4JHWH 3IDNA 3GZKA 1MREL 3KHQA 5HVWA 1JRHL 3JTSB 5TDOB 1T3FB 4C56B 2NY0B 4E0RA 1FL6B 1P9MC 3X3FL 5DC9B 5GGRY 1I3GL 3VWJA 4HWNA 4QOKE 3LS4H 1P7QD 4WEBH 4ZO7A 2DTMH 1X5ZA 3EYUL 5BMFH 1H15B 3TNMA 5I74C 3UTQA 3O8XB 4XCFH 1OPGH 3NTCH 5C0EB 2GJZA 1KCVH 3SDAD 3RDTC 4E5XA 1P53A 3HC0A 4FQPA 4QRPD 4IIQB 5F6HI 2ZJSH 3RWCB 2P1YA 1R3IL 4UT7L 3RPIB 4E0RB 1KFAH 1X5JA 4KQ3H 4WHTA 1J1OH 5ISZB 1NSNL 2JK5A 4PJEA 5HDQL 3N1PC 3I50L 4JFEA 4L8SC 4N5ED 5BJTB 2VDPL 5GXBB 1JHLL 1LEKA 1RK1A 3B5GA 3GGWA 4QRRB 4F37F 4ELME 1NAMB 1NGWA 3PHSA 3IDXH 3D2UD 3QQ4B 2HWZH 5GGTA 4V1DE 4F58H 4YHZL 4WHTB 5EZJA 1F4YL 2VE6A 4OI9A 3LAFA 3RWCA 2EXYD 5FDWA 4M5YH 5IVOA 4OUUA 1R3HA 4JGMA 2HA1A 3SGDH 3OKMB 2D4FA 1RK1B 1RZ8B 3GGWB 4MA3A 1UM6H 3NCBB 4GAGH 5ANME 5F7KC 5BJTA 5T3ZD 5J89A 4N0UE 4YFLI 1IKNC 4X7DC 4QRRA 2ATKB 5C0ND 2DQEH 4QEGA 5B3NA 1P7KB 2BVQB 4RBPK 1ZLSH 1CU4H 1A2YA 1QFUH 3RWIB 1YPZF 2FSEA 3RGVB 5CEZE 2PTTB 5BCAA 2VE6B 4NNXA 1JF6A 2DM7A 3STZA 1BVLA 2H1PH 1NMCC 1TITA 5FUZL 1JPST 1RUQH 1E4KC 5D6CB 1FIEA 1RFDL 2QSTA 3ERYA 5ESAB 2X9YA 1LP9F 4PGJA 1AY1L 3HE6A 5J1TC 1SQ2N 3HUJA 1HHHA 1FZMA 5ADPH 3U7WH 2HFEA 2R0WL 5KVFH 5ERWA 5C86A 4R7DB 1FL5A 3CVHB 4BZ2H 4X8JB 1U8NB 4B53A 5JOEA 4DVBB 5JZ7D 1GYAA 2ICWJ 4X98A 5L2KA 4X6DE 1G9EA 5IP4A 3VFUA 1HQ4B 3CH1A 1BQSA 2B4CL 2R1WB 4IRZL 4TVPH 5EU6B 3GSNB 3RDTD 5C8JB 3T65A 5FM4A 1AO7E 4P46D 4H20L 2OK0H 4F3FA 3OAZH 3DARA 1DLHB 1NGZB 3UO1H 5C08B 4LVEA 4M7KL 4NC0B 3FOMB 2GITA 4LKXB 1NEZA 2EXWD 5FDWB 1FPTH 1X6LA 3T8XB 2Q86A 2PYEE 1GVIA 1U8MA 5K59E 5FO9B 1A7OL 4X98B 4JPIA 3RY6C 1CICD 4JE4B 2L4OA 4PV9B 4DN4H 3UJIL 1TTFA 5K9OA 1EIBA 4UIMA 3SJVE 5C8JA 5KS9A 5CLTA 5E9DB 3U1SL 1F3RB 4RFEB 4K8RC 3IF1A 2OTWB 4UUJA 4F7TB 5C0FB 1HYRC 4JN1L 4M5YL 1ZLVH 1I9JL 3QDJD 2C9AA 1OGAD 3WHE1 1T80A 2BRQA 5E2TH 1N4XL 3VFPA 5C92A 3RWHA 4U0RB 4NJ9L 3UJTH 2X6MA 43C9A 1PD6A 3KLDA 4HUWB 3BE1H 3IETB 1NMBH 5C0AD 1CK0H 2C3XA 1WZMA 3AU1A 4Z7OF 5IW1B 5C0FA 1YMMD 3GJFB 3O0RL 4G8EA 1IEAB 3FMGH 4JHZA 4M93B 4GAFB 3QIWC 2GK0A 3P40A 3IKKA 2ERJC 3LKSA 1EO8L 3LPGA 4X4ME 4JFDB 4UIKL 1FORH 4FXLA 4FQHB 1FGVH 1ND0B 1ZT1B 4ELMB 4O58H 1F45A 2OP4L 2UYLB 5E8EB 3I75B 5HYFA 1D9KA 3TN0B 4NJAL 3MFGB 4PB9L 5D2NA 2R0LH 4JN2B 4L3CB 2LVEA 3C09B 1RZIA 4G8EB 4HC1A 1JI1A 2ZSWB 5I0DA 2BX5A 4P46B 4Y5XC 5JIPA 3DMMB 5IMOB 1W72B 1WBZA 3GRWA 2OR9L 1PZ5A 4JPIB 2FB4H 3OWEA 4LSRH 3V0AC 3I75A 2J7LA 4UOW1 3O41A 3TYGL 1NC4B 5D2NE 1U58A 2X4QB 2R29H 4QRRD 1MFDH 1FL3B 3MLWH 4EDWL 5BV7H 1Q9LA 3EJYD 1OTSC 1T6VN 3SE3A 4Z95H 3IFLH 4IOIB 1JFMA 3WSQH 1QRKA 4MD0B 3W0WA 3DMMA 3QG7H 1OAZL 1LO2H 4NN7B 4K7FB 5F7DB 2P5EB 4CMMB 3FB5B 3V5HB 1XF2B 3O6KH 4LRNH 2XTJD 1NC4A 3G5YA 5IVXE 4XPTL 1SYVA 1T4KA 4I3RH 4OV5B 1RZKL 2NR6D 3T77B 1RMFH 5F8QC 4RAHA 3FB8B 1OGAE 5HBBA 5F7WC 4F7CB 4YHYC 1FV1A 4KPHL 5DJZA 3DXAE 3VRLF 1ERNA 5I73B 4J1UA 5EUOE 3LMJH 1EPFA 3K2UH 5ELIA 1KLFA 4RISH 5GJTL 1S7QA 4U7SA 5CIPA 4HWEL 4JHAL 5FKAB 2VDMH 5ICZB 3VMNA 1A3LL 1JPGA 4P23A 4RMSA 1R5WB 2HH0H 2HP4A 4UQ3B 1W0YT 2EXYC 5DTFB 5HHOE 1CGYA 2JIXA 2X1XR 4GG6B 2OI9B 3S37L 2PR4H 4U1JB 1CGSL 2Y23A 1JZ6A 1FZOB 4MGXA 1S8DB 5CZVL 1UADC 1CFVL 4ZXBD 3MOQA 2ZUSA 3EO0A 4XMLL 4ZUWB 1AQDA 2RAMA 5GGVL 1Q9OB 4ORGA 4PRPE 2CKBA 4KKLC 2D2OA 4NO0D 4OFYD 4Y2DB 2VUOA 5F7FA 5FKAA 4H8WL 3QUMH 2IGFL 4L3EA 3FZUD 1B6DA 1YEJH 1MCEA 3L5HA 5IB5B 3ARFA 5BZDB 3NZHH 3VGGA 1UJ3A 2R9HC 3ARBB 1YEKL 5FAAA 1DLFH 2H9GA 3UBXB 4HWBH 5I6XB 4Y5YA 1U92A 3MCKB 2CRYA 1URLA 3O4LE 4LP4A 4JB9L 1YDPA 5DVOA 3NA9L 4LLVB 1OVZA 1J5OH 3DSFH 1U8OB 5TFSH 1SYSA 1S9WB 1DVFB 3H9YA 5B8CC 3PXHA 2YD3A 4K94H 4TYUA 1X6NA 2OM5A 5CILL 4NT6A 2HFTA 5DR5L 3BZ4A 5I8OH 4RFNC 3GSQA 1Z9MA 2W1NA 4FP8L 3EOBB 3WFCH 3VWJC 4XH2A 4PRHB 1NUNB 1C5CL 1ZGLA 4X6EA 5CBAA 4MXVE 5D5MA 1OGAB 5FYJD 2EIZA 1DN2A 2DF3A 3HC0B 1K2DB 3QEHA 3Q1SH 4TSBL 5IJKA 1HZHL 1KBGH 1WC7B 3IDXL 4P4KB 4HUXB 1N64H 2EC8A 3ZSSA 4Y19E 3BW9B 3H9SD 1F4YH 1P6FA 3QG7L 1HIML 3IVKB 3D39D 5GRWA 4B41A 2J5LC 4FQ2H 2X4NB 3UTZA 2CR6A 3PIQB 4OCSL 4OD3L 5E7BA 5E8OB 1VA9A 4HFWA 1FIGL 2BVUA 4QRSA 3DMMC 1NCAL 3IDJA 4I0PC 3OF6A 1BZQK 1TMCB 5D7JD 3JTTB 2KL6A 3INUH 1ACYH 1RZJL 4PJBE 4MCZB 1T6WA 1SM3H 4X6CA 4D94A 3P4NB 2FDBP 4ODTH 1CFNB 4L8DB 4U3CA 3JXAA 2R2BA 4ZFGL 2YPKB 2FCBA 2MNUA 4EI5B 3TA3A 3QIWB 4P9HL 3QDMB 5MEOA 2GYSA 4JFDD 5AZ2L 4LSUL 2KQMA 1UEMA 4KKLD 3IFNL 4OIIH 1YEHH 4L5FH 5JHDE 5D6DA 4EXPX 1QSED 1K85A 2ZKHH 3AREC 2WV3A 5DJ6A 3MO1A 4NNPH 1W72L 1ZSDB 3O6MH 3IJSB 4JFPA 3O4LD 3NH7L 5D6DC 3H9ZA 3IDYC 5TE7H 3STBA 3CSYB 4JY4A 4XC3L 1C7SA 3VXOB 1VGEL 1UCTA 5I1IL 3OXRB 4ZSOB 1S7SA 3S7GA 3UYRH 3DO7B 3LS5L 1EFXD 1JF1A 4KJYA 4CUCA 5E0QA 4KH2A 5JIHA 2VXQH 3IDIA 4TTGA 1F58L 4UTAL 4I18B 1MY7A 1CLYL 4Z7UB 5IK3A 2IPKA 1YNKH 1MCFA 4HGKC 3JUZA 1U3HC 3P4OA 4PJ5D 3MBXH 3W81A 2FJGB 4MXWH 3H9SB 2XG5A 1WGOA 1A8JH 4JAMB 3QEUB 4FTVE 3NGBC 3BPCA 1KLUA 4L3ED 3VXMB 3DUHA 2IWGA 2F9BT 3RIFF 3UTQB 4TPRL 3V52H 2UVFA 5L88H 1TFHA 1X44A 2OI9C 4ZUUA 3AVEA 3VDCA 1U3ZA 4HBCH 4LARH 1NC2A 2WP3T 4LQFH 4ODUA 5D1XD 5ILTL 5EZIL 4GAJH 1NCUA 4QHKI 1GZPA 3HMWL 3DRQB 4MJ4A 3TCLB 3PDGA 3PE9A 3RBGA 4BYHA 1V3LA 2B2XL 5DT1H 2WWKT 4HIIB 4MNQE 5DHXB 1HOCB 3QDMD 3BZDA 3HAEA 3T0AA 4L4TA 4NN6B 4RFEA 5H8DA 2DQUL 4D9QE 4OI7A 4X5WA 5JPNA 1NCCH 1SBBA 3L9RB 2YUVA 1CL7H 1LO4H 3WFDL 3DRQA 4M62L 2HLFD 4P99A 3WIHA 3GHEH 3OKEA 3BP4B 4NO3A 2EDXA 1FSKB 3QNXA 4XMPL 4PY7B 4KU1A 2DRUA 2ICEA 3JV4B 1NGXA 5CIPH 1GGIH 4Q6YA 1UB5A 4ZPTB 1MAML 1UACL 4HMCA 1CR9H 3P9LA 3WCYA 1Q8MA 5CMAB 2RHEA 3BOVA 4MAUH 4C4KT 1WAAA 4OF8A 5A2KH 1HKFA 4CU6A 4NSKB 3OPZL 4HHAB 1NLBH 3BP7A 1MQKL 5EOCH 3L3OB 5DC0A 2YK1L 5L2KE 3CZFA 3ALPA 2CKBH 1BFTA 3RWJA 2ITCA 1TJHL 4DW2L 4R97B 1YY8A 3GM0A 2HKHH 2VZSA 1J8HE 1OTTC 2E9JA 1NBVH 3KPMA 3H42L 1KGCD 2OTWA 3L5XL 4OZFA 1OARH 4DEPB 4WGVB 3U4EA 3EDJA 4F15C 4K3EL 3MRBB 1MVUB 4K3HA 3CZFB 4K3GA 2X1OA 3MUY1 3U83A 1GOFA 5IEHA 3HRPA 3LZFL 1QSZA 1J8HA 5I18H 2NY5H 2ATKA 4JGJA 1A7NL 3G04B 4ELKB 4Y7MA 4PGBB 4JY5L 1A2YB 4LCIH 3DETC 4LEXL 1Q9LB 1UWGL 1N3NA 3NAAH 4J3WA 4LHUA 4X5LA 5B4MD 4OCYH 2AV7A 3GMLA 3QIBC 4OCWL 1QSFA 1SJEA 3HZVB 3QIUD 3ILQD 5AUMA 2WWMC 3PDOB 2NQCA 4LDEB 1V7NH 5DDHB 3RKPA 2YKLH 1YYMH 4P57A 3VFRB 4YHLH 3QPXH 5ISZE 4KUCD 5FO9A 1LEGB 1CD8A 5F9AC 1WFOA 5I0ZA 4YBQD 4NYLB 5J6GB 2HRLA 2QSQA 4J3TA 2UYLA 4OCXL 1NGXB 5EA0H 4OV5A 1NAML 2D9CA 4M8QB 3QIWD 1U8IB 3BKJH 5T5FL 3HR6A 2Q7YA 2YEZA 3TZVD 4CGTA 1CYGA 2HLFC 2X2YA 1G84A 2FLBT 3CXHJ 4YUEH 1NFDA 2H3NB 4AJ0A 3EJJX 3D3VD 2AJZB 1GPOL 1JF5A 1ZK9A 4YXLL 5DJYA 4IRSC 3QUZD 1QRNA 4JM2A 3BISA 1PQZA 5CEYA 3UP1A 3NVQA 4NPYA 1WV7T 4JREB 1BIIB 3OHXB 3O4LA 4FQLH 3IJYB 5C0IA 1FFNB 2C3HA 1PKQA 3D3VA 3TT1L 1A6VH 3HE7A 4JM2C 3FT4A 4LLUB 5GIRA 3FAWA 3LEXA 5I1HL 4UU9A 3WUWA 2APWA 4NZTH 4HS3B 1I3UA 4RMTA 4JR9H 3B3IA 3VFMA 4KI5E 1CICC 1A3RL 4WY7L 1MLBB 3HE7D 2BHYA 2VDLH 4WWKA 1T83A 2PCPA 3LVEA 4ZQKA 2CLRA 4GBXA 4NC2B 1P4LB 4UUJB 5DJAB 4PJIB 5D7LA 4LVNC 1T5WB 3L1OL 3U7AA 2WBJD 2OJZL 1FBIL 1KJVA 4ISVB 2HT4D 3REWB 5TDNB 4AH2A 5IMMA 1S7XB 4POZC 4NRZB 4PDCE 3GSOB 5I8CB 4I9WD 2IH1A 5FHAL 3GSWA 5I1JH 3LRHA 3U30B 4Z5RB 3IXTB 1ZXQA 3E6HB 4FHBD 2YD7A 2ZOKB 2Y07L 2VXSH 1MJUL 1RJZA 1UGNA 1AIFA 2FHCA 4OKVA 1U0QA 2D9QB 2V5RA 4N9OB 4XNXL 4S1QL 1TVBB 4UI2A 2I27N 3IFOB 2H2SD 2VLKB 4EUPA 4L4TD 3SDCB 1DE4B 4OB5L 4YBLC 3QUXA 1MIEL 2XZAL 1WLHA 4LF3A 1JFQH 3QG6A 3QHFL 5F7LB 4WCYL 4LGRB 3SY0B 3GJEB 5F9DC 1T22B 2FX7L 3IFNH 4I1NB 4L8SB 4E41B 4N90D 2XNAA 4CADA 2QQKL 1ZANL 4GKSA 3HE6D 1C7TA 3UTOA 2CLZA 4EQ2A 2NY7H 5LAXA 3OX8A 5HYJA 3GMQB 4X4XB 5ICZA 1M7IA 5CJOH 4AEIH 1GHFH 1OTUC 1DBKH 3RGVD 2DI9A 4XT1C 2NY4B 2LABA 4GRLC 5T1MA 1GJIA 3TV3H 4OF0A 3LIZL 3S36H 5GS2D 2V5SA 1TZHB 4OV6F 1F5WA 3LH2L 4FFWC 1PAMA 1UXSA 3VFVA 4DGYH 25C8H 4WEMB 1ORSB 2K3TA 3BQUD 3KYNB 4HWBL 2IH1B 3GNML 1V7ML 1I7RB 3A6BL 3QDGB 2DQDH 5D8JL 3QCTL 2AXHA 2MMXA 5ETUB 3VWKB 1M1SA 4OLVH 4PD4K 4Z7VE 4L9LA 1WT5A 1MCPH 1FV1B 2E9IA 4WI4A 1FCCA 2BVPB 2ADFH 3QEGH 5F1IA 4NUGH 4LPCA 1B0RA 3TIDA 4FP8H 5IMLA 3ROOA 3EHBD 5HD8D 3QXDA 1U8OA 2W9DH 4LHUG 4MSWB 3WNLA 2FX9L 4NOBA 4LQFL 3WL9B 4BZ1H 1WZ1H 1D6VL 2MWCA 2NNAA 1FFPB 4OZFH 1J0YA 1KB9J 5MERB 2QHRH 3MOBH 2XZCH 1FVDB 3CDFA 1S7VB 4L1DA 5GS0C 4L9LB 4Z7QF 3HI5H 5E9DD 5FO8A 5EOTA 5MEOB 5BO1H 4X6BB 2XTLA 4ZO8A 3BIKB 4POUB 4LVHC 4R4ND 1JWSA 3PP3K 4QRQA 5I1DB 1CXKA 2VQ1A 4M3KB 3TF7A 4R2GD 3ROOB 3FB7A 4L4VD 4NHCL 2F5AL 4I3SL 1HSAB 4W4OC 5I71B 3ZYIA 4PP1C 3CX5K 4OD2A 1N2RB 3BKMH 3L3JA 4RMRA 1FYTE 3NBNA 4JO1L 5E8PB 2VH5H 3WN5C 1GZQA 4HFUL 3T04D 2E7HA 5E70A 1Q1JH 3FO0H 1BD2E 4GUPB 1X7QA 3H6JA 1KEML 1AO7A 3T1FA 1WAAE 2DLGA 1CD9B 2IBZY 1KPRB 1WWAX 2X10A 3H3BC 4JQVA 4J4PC 4NNYA 1S9WA 4Y4HD 4Z0BH 1Q0YL 2PTTA 3BI9X 2CJUL 4HJJL 3OR7A 5D71L 3IU4L 2L0DA 4ENED 1BVLB 2YRLA 3TBYA 3OKEB 3DSNA 1CD1A 2P8MA 3RFZC 5J3HD 5MEND 5EN2A 2R69L 2Z93A 3D2UB 4CU7A 4WU7A 5I2IA 2VDNL 2RCSH 4PRHA 4OGXL 1XCQA 1ACZA 1ZHLB 3MNZB 2HKHL 3G6DH 1W72H 4Y5VC 5K9JL 1BOYA 5EO9A 1XF1A 1TXKA 2OJEA 5CMAA 5JXAH 1QSEE 3L5XH 3C6LD 5C0AE 3QZWB 4IMLB 2X4PB 1ZGLM 3JV5A 2ADGA 4EN3C 3CD4A 3BH8B 3WLBB 2WBJB 3FB6A 4ZS6D 3NMEA 1R3HB 2D31A 3CXDH 4NP4L 4Y16A 3RA7H 5BV7B 2QSCL 5SWZA 4MQTB 3LB6C 4LBEA 3PABB 4W70A 4XVJL 3VMPA 1TVHA 4MS8C 3VXOA 3LHPH 5E6YA 2C26A 5CEZD 3W9EB 5E08H 1UVQB 2F54B 5EO9B 3E3QA 3LQAC 3SGEH 1K6QL 4Y16C 2PYEA 1BBJB 1PG7X 5I30H 2FX9H 2H41A 5IGXH 1T21A 4I48B 3RKDD 3B2UD 3Q6FB 3PWUB 1XGYH 9CGTA 5DFVD 1AQKH 4OZ4A 3V4PH 4MAYB 3ZHLA 4NQCA 4UILH 5L9DL 2YN3A 4GQ9H 5IEHB 3BQUA 1XF4A 5FM5O 5KS9E 4OLWL 3HE6B 1MCLA 5I8EA 1UH3A 4H1LB 3QEQA 3FO1A 4W68A 2I60L 3ZKXC 4IS6A 3SKNB 3G6JB 2BDNL 2VDOL 3LB6D 1MQ8A 3GSNL 3GJFK 1KJ3H 1DQMH 2PTVA 3HG1E 5D7IF 4PBXA 4OFIA 1NFDE 2HMIC 1KJ2L 3IJSA 4NQCE 1JYWA 3LEVL 5MP6L 2DQGH 4DVBA 1JTTA 4HMDA 3EOTH 1JK8A 3O6FC 2YD4A 5IB1B 3AAZA 1OTSD 3CDYA 3UJIH 3QR2A 2C1PB 1BWMA 1FGVL 1F11A 1DBAH 1ES0A 3PDDA 3U9PL 5J9PB 3V4UH 4LQ1A 2ADJA 3X13A 1MELA 4EUPH 2AI0L 3QUYC 3ARDD 5MENE 4GRLA 5DUPL 1U2CA 3KPMB 3MJ9L 4CVWA 1UM4L 2ZNXA 2ZSVB 4YPGB 5J3HC 3WJLC 3JWDC 4RIRB 2R4RL 3MLVL 4KTEH 1EAPB 1EHLL 4X4MA 4G9DB 2FH6A 2JCCE 1N4XH 3W82A 1FYTB 1ES0B 2R0KH 4HCRH 4NIKB 4XBPA 3RI5K 3MPCA 3F8UB 3MRQB 4OFKA 4TQEH 3FZUC 2R0ZL 3BP5A 3RIAF 3X17A 1S5HB 2DL9A 3QUMA 1H5BC 4K55A 3OPZH 3WUWG 4MD5A 4U31A 1OCWH 4ZSOE 5FKPA 4ZUUB 1BVZA 2HFEB 4F57L 3C2SA 1REIA 4WTZG 2C7UA 3ARZA 1S5IL 1F00I 4F7MB 3A67H 4XHJC 4Y4FC 4F8TA 2FJFA 3R8BB 4UB0L 1QFWL 3GBNH 3OKMA 1TIUA 1LEIB 1SJHA 1YMHA 3DI3B 4HIJA 1KACB 1Y6KR 4IJ3C 1A6WH 4XVJH 4P5TC 1KOAA 3CVHL 5SX5H 3MBEB 4UDTA 4H88H 4Y0GA 1RUKH 3MRJB 3IKCB 1B90A 1E4WH 5MI0B 1Z0NA 2CPCA 5KJRL 3ZYZA 4PGZA 4HKBB 2XOTA 1GOHA 3JWOL 4MD0A 4ZAKC 4G42B 4F7MA 1PEZA 3EYSL 4ZD3H 4JM2F 4IRJA 5I1EL 2VC2L 3FQWA 1UZ8A 1XZ0B 2VXVL 5DMIL 3UDWC 2FGWL 5C07E 4UT6L 1DQJB 5TQ2L 1FNFA 3NCYP 2A83B 4FQHA 5D1ZC 2HFGL 4K2UL 1KLGA 3UYPA 4Y16D 5E2UH 5L8KB 2V17L 1SY6A 4DGIH 1MEXH 1T0MA 3ARVA 1IT9L 2DIBA 4EUPG 3SGJC 2VIRA 1FC1A 1F97A 4RIRA 5AUMB 1NAMH 1QZ1A 4S2SB 1OAKL 5HHOA 4MYWB 3MRPB 1BOGB 1A7QL 4DVRL 4XP4L 1J18A 1CGVA 1BAFH 4LVHB 4MJID 5K9QI 2CGRL 2KQNA 2MPAL 4LVOB 3HPLB 2NLJB 5DJCA 5EOQH 3KXFE 1FL3A 1P4LA 4GRWB 5AZEH 4Z7WF 3FHAA 2C5DC 3VG9B 4M6MH 1ZLSL 1I7ZB 4OFVA 4J7RA 5HI3C 2D03L 3ISWA 4E41E 1YMME 1IGFL 3QUKB 3QRGH 5JA9A 4O5LL 5SWSD 1CXEA 4Y19A 4WVRA 3SOBH 3KLSA 2UVEA 5I1CH 3FT3B 5GSVB 3W5MA 4JFHE 4AIXA 4B7IA 5FYKE 5IB5A 2MKLC 1PEWA 2DQJL 2VWEE 3CLFH 4D9LH 4PV8B 4ELMA 4WV1A 4K07A 1KIUA 4KZEH 3GUTA 3QWQB 4U6TA 35C8H 2NYYD 3O4LB 5TE6H 3G5VA 3RP1A 1MJ8H 1WJ3A 4PY8I 1DEDA 4ALAH 3B9VA 3B43A 5ESVB 3LN5B 5DDHA 2QQLL 5F3BA 1DFBL 1DQQB 4UU9B 2X09A 3FONB 4U1GB 1X5FA 1XZ0A 4AQ1B 5H35A 3H9HA 2IG2L 2VNCA 5IB4B 4MQ7A 1NCAH 12E8H 4F8QA 5T3ZL 1F6FB 1NCDL 4EI5D 3SY0A 4MDJB 2Q8AL 4TRPH 1L9NA 2P43B 5HI4C 3L6FB 3D1MC 3WXVH 1MCRA 4OM0L 3U36A 2FECL 3MJ8B 5IMKA 1FPTL 1XIWD 3W0WB 5I75B 5FYLL 4CW1B 3L3DB 3KHOA 5EB9A 4X7FC 5CSZA 4HFWB 4NRZA 4MNQB 4NQDA 4KMQA 4J8RB 2NY1D 5ITBH 4JO1H 4QT5B 4HXBH 5HXMA 3VI3E 1YECL 4M43H 3WNNA 3RNKA 3DVFA 3WNMA 4APQA 1JRHH 3G08A 4CRPA 1QLEL 4XX1G 1DVFA 3GHBH 4HF5L 5L0QB 5IF0B 5HJ3A 4LLVA 4OZHE 5E2WH 5I1AA 4KHXL 3NIGF 3VI4F 2O5XL 3ARDA 3EOBA 1I7RA 5SX4I 5LBSL 2VLKA 5CSZB 4PBVC 1U8LA 5J57B 1G0YR 2GJ6A 4JM4H 3WIHH 3LRSA 3UJTL 4WU5A 5JHDA 1A4JA 1NLDL 4M5ZH 1LVEA 1TPXB 3FT2A 2HTLC 1T5WA 4MAYC 4YE4L 2CKBB 3CX2A 4KJQD 3FMGL 3C60D 3P4MB 1B0RB 3ZLQC 1H5BA 5HHVL 3D69B 2Y06L 1V3KA 3FCTA 5HHXL 2X4UB 4HX1A 1IKNA 4QRSB 3D18A 1G6VK 3V7AG 4OBSA 2ITDB 3BMVA 5ABDE 1WAAF 3CH8A 5EOTB 5KVEL 3CK0H 2CDFA 5ICXA 3IDJB 4Z7VA 3O4OB 3MBED 3T4AB 4WTZA 4PJ5B 5D7LD 3NFNB 3WD5L 2JJWA 3VE0A 4JVWA 5FYJU 4Z7UA 4RDQG 3Q48A 1JPFA 2EDTA 1IVLA 4LSPL 1JGUL 1R5IB 2FWOA 3FB6B 1HSAA 5HGHA 4GG6A 5C3TA 3BVNA 4Q6IB 3VCLA 5JZ7C 2K9UA 5EWIH 2G5BA 2G2RA 3MV7E 4H1LG 2OZ4H 1F4XH 1F2QA 4Q58C 5SWZD 5BVJA 1BQHA 1VFAA 4YDLB 1C08B 2QR0B 2VSDA 4NKDB 5JA8B 5FGBC 5HY9B 5B21A 5GZND 4GFTB 4OLXL 4XPHL 3E2HB 5FYLH 4Z95L 2JB6A 4ONOA 3P30L 1MFBL 1DANT 4MNGE 4XXCC 4ZOEA 2F8VA 5IHLB 5T33L 3PWUA 3RAJL 3QQNA 2AJ3A 3ZHDA 5FK9B 1MWAB 3GI9L 3MZGB 4XMPH 4EIZC 5LGKA 4LLQA 5BVJB 3BKCL 3OKLB 2MQ0A 5F7NC 4EKXA 1N5YL 5DRZA 3RBSA 2EDRA 3CSYA 4JY4B 1INEL 4U6YB 4FQIL 4L4TB 4QYOB 5ADPL 4FQ1H 5DUML 4XNZB 5C6PB 5H2BB 2ZG2A 1NEZG 2ZUWA 3ZKSD 4E9LA 5IB2B 4M02A 3DX9B 5D1QD 3MLTA 2D0FA 3BP4A 3ZTNH 3OKKB 4YQXL 4F2MA 4YC2C 2WINB 3VXRB 4LOUD 3CFKB 2KPNA 4IRZH 3BAEH 1VKXA 3V79C 4QOKD 3LSOA 4RFOL 3QHTC 1XEDA 4O4YH 4L9DA 3ULVE 2F54E 1AO7B 1CTNA 4QHNB 3C5ZB 1Q9KB 1XF5B 4EDXB 2W60B 1JGDA 4NC1C 1P7QA 4DOHE 3F58H 1MCIA 2PYFA 1VKXB 1BFVH 3GMNB 3KR3H 5F21B 2ITCB 3UTTE 1TETH 5LQBH 3NZHL 2E27H 1J9CT 2C4FT 1IGML 1BGXH 3TESA 1A1MA 3D87B 1XF3B 5C6TH 1R0AL 2GQHA 5F9OH 2RGSA 2D7PA 2FJHB 2QHLA 3PWVB 4WEUD 1CQKA 1LE9B 3VFGL 2WUBH 4UINH 4XTRC 1HSBB 5FUOL 3B2UC 1KPUA 4OCYL 4FMKA 5EU5B 2EE2A 3ILPA 5DSCA 4K3JL 3MMEB 1WITA 5TGBB 5JLZA 1SVCP 3EJZC 3O11B 3QJHA 1HCVA 4KMTL 4KXZH 5BW7A 2OCFD 3RZCA 4AIOA 4PRNA 1JK8B 1P9MA 3FRUB 3EHBC 1KIRB 1MI5A 1HILB 4GKNB 5E00B 4GRLB 3U82B 4PGEA 1FZMB 1YPZB 5KSAD 3SBWA 4XCFL 5DEFB 1T89C 1DSFH 1KXTB 3DV4A 5CP7B 5GRXG 4DZ8B 5FGBA 4K8RL 4KROC 3ARFD 4P2CG 5AG9A 1CDBA 1OSZB 4Y2DC 4JFYB 5JIIA 1Z2KA 3OR6A 4FZ8L 2LV4A 5EBWA 4UOJA 3EOAB 4XHJD 4Y4FD 4QXWA 3O3EA 4YO0A 3GHEL 2P44B 5JO5A 3IRPX 4HJGB 1L6ZA 3EFDL 3TT1H 1JV5B 5CP7A 4HUUB 3O6FB 4LKCB 1F3DH 3ZSTA 1JGDB 3KXFD 5DEFA 4GW4A 3SJVD 1AR2A 5SX5K 2HRPH 5E6IA 3BIAX 2LTQC 4U2ZA 2VQUA 3ZDZF 2FBOJ 1WSST 1FAIL 4CMHB 8FABA 4PV9A 2K7QA 2EO9A 5D5ME 1C1EL 4P2RA 3ARYA 1Y18B 3NPSC 4OQ1A 1UWEL 2NY4D 1I1FA 1PSKL 3QNZB 1CDIA 2R2EA 1N6UA 3KPNB 1LK2A 2EEBA 4RGOL 3ILPB 3D9AL 1A7PL 3MGAA 4NQEE 4P5TD 1IKFH 1QG3A 2A1WH 3QXVA 1IM9D 3T0EB 5JQ6L 3EYUH 1B0WA 2X70A 4M8QA 1YNLL 2R1WA 2XQBH 4S11A 3MRIB 2ZCLL 2EEAA 3PQYE 2YMXL 1KIRA 1AR1D 5CFHA 5KVGH 3X11A 1K4CA 3GBNL 3DUUA 2E8YA 4MJ6B 3SGEI 1MCJA 2A77H 3OB0H 5DMYA 3V5KB 1KJVB 2DQTH 1LDPH 4RBPH 3CZJA 4MA1B 3RVWC 3O2DA 4NM4H 1U91A 5E8EA 3DPBA 2VXUL 4ODHH 2DI8A 5CINL 2VJXA 4LDOB 2WW8A 1RVFH 1MJ7L 3QFJE 5CUSH 3O3EB 3MRJA 3FTGB 3TN0A 2IMNA 3QUZC 3QUYD 2GKIA 5ACLA 2IEPA 3NIDE 4PTTB 4F58L 1W8OA 3HNTH 3L1OH 4PJXF 2GI7A 2OZ4A 2BRRL 4GW4B 3B2VL 1GAFH 3LPWA 4K2UH 5C0CB 5IHZA 1OT2A 3KWWA 4RMVA 2VLKE 2DQHL 2XQYK 3RU8L 4X4ZA 1ZKAA 3CPLB 4F80A 5DRWB 1A1OA 3O2WH 5ISZD 2SEBB 5ACMA 2X4TB 1VFOA 3CFDB 1YA5A 3UZVB 3HZKA 3CSGA 1RUAL 3OZ9H 4DGVH 4JM2D 1A7OH 4I0PD 5BVPH 1IJ9A 4KKCD 2CLRB 4GBXB 2NPLX 4ZNEA 1DUZB 4WW2B 2BSTA 3MV8A 3DHMA 3EFFA 4IMKC 1J05A 4QOKA 4MA8H 1N6QL 2X4SB 4R4BB 2FJFB 3MA7B 1CGUA 2QLVB 3RZCD 4OZGE 4IOIA 2BJMH 5EOQL 5IKCA 2GSIB 1A1OB 3HNVL 1CVRA 5DVKA 2AJZA 1SVZA 4OF5A 1V7MH 5K9OB 3N1GC 2WBJC 4NQED 1IGIL 5T3XE 1IC4L 3LRGA 4XNQB 3QDJA 4PGBA 1BQLH 3X11B 3V0VA 3GO1L 5GQBA 4DZBB 4GW1A 3ZL4L 4J2XA 1DCLA 3NFSL 4MZ2A 1N64L 4BQ8A 3L5JA 1G7LB 1W72A 1VERA 2YXFA 4MNHB 3S4SB 5EC1B 5IBLD 5GJSH 2CXKA 1UT9A 2NZ9C 4H26A 3BO8B 3DVNA 4OGYH 5GHWH 4PR5B 1IZJA 5HYSB 1RD6A 5EO1B 5HTSA 4Y88A 1EFQA 4ZS7H 3RTQA 1T0MB 3C8HA 4OIBA 1C8PA 1IGCH 5BW7C 1NBVL 1R24B 3PJSB 4YZFE 3QXDB 4KJWD 3A6CL 4QRUB 1G9NC 4PFEA 4OGZA 5DVNA 1QO3B 6FABL 3RTQC 3PHOA 2A73A 1I9RH 1SHMA 4KUZH 4OZIF 4YX2L 3GSOA 1OB1A 1AR1C 5D8JH 1BFOB 2OQJA 2QV2A 4P59L 3FO2B 3SDDC 1OM3H 5HYSA 1LHZA 2FYYA 1OAQL 2I07A 1LE5A 1P4BH 2EDNA 2BVEA 2R8SH 3DRTA 3ZDYF 2B5IB 1DTUA 2JKXA 1TZGL 5HI5D 3DLQR 5M94B 1GXEA 5B38G 2P46B 2AJSL 3R0MA 1JNLL 4ZOCA 3SPVB 2DD8L 5DJ2A 4FG6D 2HLAB 4ZUTA 4WO4C 2H32B 4ZUVB 1Z6JT 5DMKA 4K3DL 1F4HA 5EBLA 2P42B 5DRZB 3FO2A 4N8CH 3DHJA 2OS7A 2BNRA 4ETQB 1TLKA 1F90H 2HG5A 5SV4A 1A22B 1TCRB 3UXFA 4WWID 3RDTA 5MI0C 3ARBC 4JG1H 5EC1A 2ZCHL 1X4XA 3TBYB 3MLTB 3WDIA 3I2CH 1SEQL 3GSWB 2H8PB 3EJYC 3ARFB 4P9HH 4HC1L 3RA7L 1FORL 2GFBB 5IROA 1ZE3C 1NGQL 2YWZA 4WI3A 2GJ6B 1GH7A 4Q2ZB 4NKDA 2IANB 4OT1L 1UA6H 3HAEG 5HI4D 4HCRA 2AJUH 3IDYB 3PHQA 4PP8C 1S7QB 3X3FH