4LCCC

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
384
structure length
341
Chain Sequence
IQRPPKIQVYSRHPPNYLNCYVYGFHPPQIEIDLLKIKSEQSDLSFSKDWSFYLLSHATPNSKDQYSCRVKHVTLEQPRIVKWDRTHSLRYFRLGISEIPEFISAGYVDSHPITMYNSVSQLKEPRALWMEENLAPDHWERYTQLLRGWQQMFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTLSWMAMDNVADIIRRVWEANQHELLYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHKTTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELGDIYSCHVEHGGVHMVLQGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 80
structure length 341
sequence length 384
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC03
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lccC02
2DQTL 4LCIH 5HHOE 1EEQA 2EO9A 2Y1VA 5MEOB 4WI6A 2DKSA 2F53E 5I16A 2H1PL 3VD9A 4HJJH 2VKXA 1A6TA 4JKPH 4JRXA 1TJGH 1T20A 5JORA 4L8DB 4JFHE 4K3DH 3LH2L 3D69A 4HCRH 4NKIL 5ADOH 3DO7A 5E6IC 3SDDD 4OV5A 1SMOA 5HJ3A 4NUJA 1Q0YL 4N8CH 3B3IB 4Q74A 5JOFB 4LKCA 2EH7L 4GW5B 1MCOL 1P4LA 4NN6C 4M6NH 4KI5F 4XNZB 3C6LA 3BPCB 4JJ5A 2XWTA 2A6IA 5C0ND 1KCSH 3MRJA 5I30L 5IESL 1IM9D 1JGDA 1JZ5A 4APQC 3PHSA 1CTNA 3KVQA 4QTIH 3WHE1 5LG1A 3WCYA 3C9NB 2IWGA 5EUKA 4HIIB 3FMGH 2B1HH 2PXYC 1UM4H 1FL3A 3WIFB 4WU7B 3EO0B 4G7VH 2Q1EA 3UEZA 1XAUA 2W07A 5E70A 3DV6B 4YDIH 3TJHA 3FT2A 5TDNB 2H2SD 4DN4L 4QXUH 3VI3F 3F7PC 5F7HA 1AO7A 1G7JA 4RAUB 1ZSDB 4OZGB 4PGZA 3EOTH 2J8UB 4X8JA 1K8DB 4LKXB 4HC1H 4PJ7A 4YFLF 3O4OB 5T33L 1R0AH 3RJQB 1JYWA 3EO9L 3SQOH 4Q7DA 1U8IA 4AEHH 4AZ8A 3VWKD 1LK2B 1UZ8A 2ESVA 3U2SB 1X5GA 1WWWX 1QTYT 5FF6B 3NABH 3OJVC 2ICWB 3V5DB 3QIWB 3LKRA 4G6KL 4WTZG 3EOAB 2UWEE 3O4LA 4TSCH 4JM2C 1KIPA 2CQVA 1FZOA 3D2UB 3VW3L 5SX4H 3E2HA 4G9FD 1PDKA 2WBJB 2PO6A 4Z7VA 3MLUH 5HHMD 4WY7H 4ZUSB 5EOCH 5DD5L 2ADFH 3E8UH 3X3GH 4YIQA 1MFBL 3HNVH 1F02I 3WLWC 4Z7NE 3BKCL 3GMPA 1MWAH 2DMBA 3KYOA 4QEGA 3GJFB 5DRWB 3TO4D 3M8OL 5IVNA 1CBVL 3KPOA 2K7PA 3MV9D 4RMWA 4AM0B 1PX4A 2XZQL 1T7VA 1JZ3A 4LSQH 3V7AE 3QJFA 3F7YA 3ZKND 1JUFA 2DI8A 3E6HB 3MV01 3ROOA 1VFUA 4ZPVA 2L4OA 2EDOA 2V5YA 4O58L 2X1PA 3PV6B 4ZFGH 3MRDA 3QAZB 3TVMD 3J7HA 4F8QA 1VFMA 3SDAB 5JPMB 3KPMA 4E0RB 3VCLA 3CUPB 5I1CL 5DVOA 1RHHA 4J3TA 1U92A 4K9EL 1R3HA 2FECL 2AK1H 3BEVB 1N2RB 3WS3B 5IQ9B 3C09C 1YY8B 1HXMB 3FB5B 1AJ7H 4P3WA 5JW4Q 4XTRC 5EIIA 4PV8B 4NQDA 1UVQA 3BVNB 2WV3A 2X1WL 2ITDA 2D0FA 4JN1L 2BNUA 1UQSB 4HS3B 5JW4R 2CKBL 3SDYH 4L4JA 1I7ZA 2HN7B 3UYOD 4N68A 2YD1A 3T2QA 2DF3A 4X6FB 3HG1B 5CIPA 2CK0L 4X98A 5IMOA 1UADC 3W5MA 4D8PB 3P9WB 1DBKL 3R0NA 4PY8I 5J3HC 5DHYA 2PYFA 4ZPTA 1ZGLM 3MODH 5C2UB 5F7KC 2GTWB 1HYSC 3O6KL 5T1LD 5D1ZA 4L8CA 4F8TA 5L6YL 4NRYB 3K46A 3A6BH 5FKPB 1T1XA 4NDMB 4JGJA 4Y4FC 4G59A 1XGRA 3NIGF 5LGKA 3MV7B 4WFEE 2GKIA 1BQHG 3U9PH 4R8WH 2X70B 3MRNB 4GMTL 2ZOKB 4JLRA 1ZWIB 3QUML 2C1OA 4R2GB 4WGWB 5I8EA 4F9LA 1EGJL 1UWXH 1QFOA 4JZNA 5BS0B 1QBMH 3ARPA 4HFWB 3DETC 2DTSA 5F72S 4BFGA 3WMSA 4XC3L 5ICYA 3VXSB 3DURB 3P11L 5DO2D 1LEGB 2VIRB 4QLRA 5FDWA 2V2WA 4TPRL 4XCEA 1TCMA 2B1AH 4JG0L 1VADB 2EDJA 2P42B 5HYSG 1S9KC 3T0EE 2I5YL 2ATKA 1YNLH 3K8MA 5IFHH 1DL7H 1VPOL 4JZJB 4UT6L 4XXDB 3SCMA 1NBVL 3V6ZA 2Z93B 1PEZA 3O3BA 1TFHA 2CK2A 2A38A 1A9EA 3QDGA 1CT8A 1AIFB 3AS3A 5T3ZE 3C6SA 5DDHA 4MNHA 4P4KC 1JHKL 4YEEA 5HPMA 4FS0A 3X13A 4I2XA 1TMCA 4JHWL 2CRMA 1XGYH 5TE4H 2GFBB 3QWOA 1FSKC 3O3DA 3RKDD 4ELME 2PR4H 2R1WA 4G6AC 4L4TA 3LHPH 1KB5H 5KN5B 5SWSB 1FJ1A 4LPVA 4IOIB 5T3XD 5KAQF 4DGYH 1KN4H 4ZMAT 3NTCH 4Y2OA 3SHSA 4OFYD 3KAAA 4XAWL 3NZHH 5F7FA 4FTVD 5JIPA 1OSZB 2P8MB 1CQKA 1HQ4B 1T22A 1YMHA 1XGQA 1WCQA 1YYLH 1D9KC 5F8QC 4NT6B 3TZVC 4MGXA 3FZUD 1XCQA 3HI6L 5EO0A 4TRPL 5HDQH 4I3SH 1K5NB 4RMTA 12E8H 1XIWD 2BVOB 1ZANH 5I1AB 1A7RL 3AU1B 3GO1H 3OKLB 5INDA 1DVFC 5IB4B 2Z8VC 3RP1A 3MLRH 1FFRA 2P5WE 3KPSA 2H32A 4I8DA 5HYJA 2ARJB 3GSRB 3PWJA 1BQSA 2N56A 4A6YH 2EDQA 4U1KA 3EGSA 4U6XB 4KK8D 3TLRA 3BW9A 1G7LA 4YPJA 2VLME 4XVSL 1WF5A 1DEEB 4NWTH 3BDXA 2H3NB 1S3KL 4QRTB 2RR3A 2YUWA 1J0ZA 3QDGE 4IMKC 4W6YB 5IBLC 1WZKA 3B9KB 3UJJH 4CN4A 5K9OB 1FFOB 5JO5A 3MLZH 4M5YL 5CHNB 1GH7A 4NWUL 3IAGC 3WN5C 1QFUH 4NZUL 3TPKA 3BPNC 5I9QB 1R24A 1F4YL 4KROD 1U93B 3QIUA 4ODUA 4OAWB 3D39A 3GGWA 1KCRL 4V3DB 1LDPH 3CZJA 2NY7H 4U0RB 1W72L 1Q8MA 2XKNA 1JNJA 3GB7B 4I3GA 4M02A 1JWMA 5IG7B 3DX7A 1H3TA 1I3VA 2HKHL 5EG6C 2R15A 3QXDB 5KSVA 4LSVL 2NY5C 5GRXG 5BVPL 3MYJB 1JPFB 4FFVD 3OKNB 4G6JH 4A2LA 5FB8A 3GFUA 4J3XA 1Y0LB 3REWA 4I0PC 4OZFA 1J8HE 5MEPA 4CGTA 3T8XA 1MCKA 4M43L 2G75B 2DIBA 3BO8B 2DQCH 5MENA 4K07A 1Y6MR 3SY0A 1FNGB 2R2EB 5L2JB 1I9RL 3W2DH 2DQEL 4F7CA 4KK5D 3S97C 4ONHA 4NQSB 3RGHA 1KCVH 2R39A 3FJTA 1P1ZA 2EC9U 3A6OA 3KHQA 3L1OL 4GRLC 3T0XA 3OAYK 3S5LG 3K2MC 5HYJE 4I48A 2BC4A 3QT2A 4FG6C 2FLRT 2IG2L 5KVDH 4XMKH 5IKCB 4HUKB 4M1GL 4OLYL 4W70A 4PJCA 2AEPH 4F33A 1OAZL 2N7BA 5DWUL 4M7JL 4Y16D 2X4OA 4ZUTA 1RZIB 1C16B 1TETH 5DF0A 4JFYA 4S1SH 1BM3H 2FB4L 3L9RA 1BP3B 2EDXA 4ALAH 5BJTA 4PJFB 5J1TC 1UEYA 5B8CA 1AHWB 2M26A 4NM4H 4PLJC 4KY1H 3H9SB 3QNZB 4XMPH 4K3EL 1B3JA 5IHUH 1CFNB 3D2UD 2EDBA 2WBJD 5DSCA 2VXVL 3QCTL 4JR9L 3V0VA 3U46A 4HWZA 1UYWL 5E9DE 1RIUH 4OB5H 4RFEA 3QG6B 4N0CA 4QO1A 1NCCL 1INEL 3T77A 2KBGA 4Z8FH 3FTGA 1T03L 2YUZA 3O9WB 2O61B 2HG5B 4L8BA 1GGCH 4WI5A 2QR0B 5C0EB 2ED7A 5LAXA 1HEZB 1GGBL 4R90H 3BH9B 4NP4H 1U8LB 4X6DB 5CEXB 3BKMH 3VFWB 3IFPB 1QSFA 5MENE 4HBCL 4AIXA 3MGTB 4DVBB 1RUQH 5E7FA 3SDCC 5DMJB 4I13B 3S6CA 3SDAD 2V5RA 2F19L 3KPRA 2JJSA 1IEBA 3W9DA 5JXED 4JGUA 4ONOA 1XZ0B 3MCKA 3RTQB 2BVPB 3QR2A 3QQ4A 1CFTA 3RWHA 4U1NA 4B50A 43C9B 3E0GA 4Y2DA 5GGSA 4XPFL 4JQIH 5DS8A 1CK0H 4OLUH 2O5XL 3IRPX 1TPXB 3IXTB 4U3HA 5DJ6B 4CU7A 1JGVH 5D2LA 5HI4C 2OL3L 3CU1A 2DYPA 1YQVH 2LV4A 5GZOD 2VO5A 1INQB 4BSVB 4UTAL 1KJMB 3PGDA 1AD9B 1BEYL 2LTQC 3HG1D 4PJBB 2FD6H 5GJTH 1XGPB 1YUHB 3WJJC 4Z7WB 5AAWA 4JPIB 2XTJE 5EUOB 4JFEA 1QSEB 2VDML 2WQ8A 5HHOB 4M6AA 3OKMA 5FGBC 2ZPKL 2APXA 3WO4C 1ZLSH 2C4FU 1RIHL 2JCCA 3FOLA 4QHLB 3SGKC 5EU4A 4I18A 2F53B 4YXHH 4ZFOA 4GAYB 4LPUA 4IDLA 5D70L 1FG2B 3T3PE 4S0SD 3PJSA 4OZ4B 4ZXBB 1EHLL 3HMXA 3GSQA 3RWEB 2GAZA 3MV7D 4X5LA 1RUAH 1IEHA 2LVCA 5FIEA 1U3ZA 2A9NL 4JFFD 3F12A 2DQFA 1HI6B 4R2GD 2RCSL 2NNAA 5BV7B 5BS0D 1R3LA 5FO8B 1DN2A 3KPRE 6CGTA 4NHCH 1FBIH 4QXWA 5IB2A 5C2BL 5L0QB 4I77H 1Q9OB 2FJGA 3CU7A 4PJ9C 2XKUA 4FZEL 3F6LA 4N0UE 3HFMH 2R56L 2VWEE 4HXAL 2ZCHH 3LKPB 4WCYH 3LKOB 2LE9A 4PJGF 3EYUH 2KZ1B 1KT2A 2UYLA 1MFDH 1BECA 2EDTA 4JJHA 3PIQB 2JIXA 3IFOB 1RVFH 2PCPB 4H5SB 1KCUH 4NC1E 1MFAH 4ETQB 1A7NH 5B38G 4N0FB 3PV7A 3JV6A 2QSCL 1MREH 1S7VA 5ICXA 1JWUA 5JW4M 4RFOL 2FRGP 1ZAGA 1ZHNB 3H3PH 1OSPL 1F4XH 1F3JA 5C0AA 5L8LB 3TV3L 3G5ZA 1YY9D 2Z35A 3GSXA 3QUZA 4KK6D 2JCCE 5DJXB 2NY4C 4UINL 1P69B 5I16B 1LE5B 1T2QL 3QG7H 2Q3ZA 2NZIA 1QFHA 2NY5H 1A6TB 4JRXB 1T20B 3MA7A 5JORB 5LBSL 1EHAA 3D69B 4F3FA 1ZVSA 2R8SL 1BZQK 3DO7B 3NFSH 3NVQA 2ZOLA 3EYQC 4OV5B 5HJ3B 1I3RA 4NUJB 2NR6D 4GLRH 3SGEH 3LEVL 4LKCB 4C56E 4P57A 4X5WA 2OXGA 1F90H 1P4LB 1ITBB 3C6LB 4JJ5B 4D0CA 2XWTB 5D1QA 2YZ1A 2A6IB 4C57C 4LVOC 3MRJB 1MCLA 1A47A 4X8XA 2D7MA 5D8JH 1JGDB 4E42A 2JK5A 1FG9C 2VJXA 3QUXA 4LQFH 5I0ZA 1T1WA 3AAZA 2Z91A 2YR3A 5EUKB 4LPCA 4O2CA 4Y5VC 3RL1A 4JY5L 1FL3B 1CLYL 3RY6A 1GGYA 4YHNA 1AXTL 4JCLA 5DMIH 4Z5RA 1BQUA 3HR5A 1YJDH 4JKMA 1VCAA 3GM0A 4HWEL 5GGTL 4GJTB 4KHXH 3B9KD 1HK6A 3FT2B 4C4KT 2EC8A 4MQXC 4NRZB 5CD5C 1GC1H 1I8LA 1JHLH 3ARFA 1I1CA 2ZCLH 4KTDH 4Z7UF 3W9EA 4PJ7B 2IFFL 1JL8A 5E03A 1OF2A 3GHBH 4G43A 5F1IB 3ULSA 1U8IB 1C5CH 3KLAA 1EFXA 1BAFL 5GRVK 3AC0A 1QKZL 1UZ8B 3FO2A 1KENL 5AZ2L 2ESVB 1Q1JL 3NH7L 4R4BA 1NGWA 3K4ZA 1JPTH 3ZO0A 4F9PA 3BESR 4FQQA 1BX2A 2Y7QB 3LKRB 1RUPH 1GGIL 2JELH 3ELAT 3ARZA 3H9HA 4YHYB 3O4LB 1KIPB 1FZOB 3E2HB 4W4OC 2PO6B 3QEQD 4Z7VB 4MSWA 4YIQB 1CXKA 3P30H 4GSDH 4OJFL 5EOQH 3BOVA 3GMPB 3WFDH 3MRRA 3KYOB 1BLNA 5DD6A 4HJGA 2X4SA 3KPOB 2VC2H 1L9MA 5CD3A 4Y4KC 5ILTH 3IDMA 3QEGL 5T5FL 4IJ3C 3KJ4B 3QJFB 3O2WH 3F7YB 1L6ZA 1JUFB 1TNMA 2CXKA 3ROOB 2CIIA 1CVRA 3CVHH 3VD3A 4KJPC 4OM1H 4KKBC 4M93B 3MRDB 4AEEA 4BQCA 4EDXA 3WD5H 3KPMB 2VZ1A 4EVNB 3VCLB 1RHHB 1U92B 1UM5L 1L0YA 2FX7H 2X4UA 1YNKH 4PD4K 5E5UB 1R3HB 3V79C 2F8VA 5TPWL 4Y88A 1U9KA 2DM7A 3O6LL 3H9SD 3G04A 4PDCE 4NYLA 3ARTA 4NO3A 4CBPA 2DLTA 4NQDB 3PP3K 4KMTH 1DDHA 1UVQB 5KSBE 2ITDB 2FX9H 4J7RA 1JYVA 5KANI 1I7ZB 3SGJC 2OP4H 3O9WD 4ACPA 2VDNH 1BFOA 4BZYA 4X98B 1RUML 5D7LD 5IMOB 1YYML 4TVPH 1YMME 3LS4L 4PIRF 5DHYB 2PYFB 3P40A 4LLMA 4UT7H 1XCTA 3PGFL 5D1ZB 4L8CB 1IT9L 3LN5A 1ZA6A 3STBA 5DT1H 2GJJA 1T1XB 2N7AA 2VSCA 1DBAL 4HPOH 1J7VR 4DAGH 5DK3A 4M1CD 1XGRB 3MNZA 5EFIA 3RTQD 3P2TA 4HKJA 2VXUL 3HZYA 2VSDA 3VH8G 1KCGC 4A2MA 3TF7C 1CDYA 1J18A 4JLRB 5ERWA 1YPZE 1ADQL 2C1OB 2QHLA 5I8EB 5ESAA 3CFJA 5F9OH 4JZNB 5C6TH 4UDTA 1OY3B 2J88L 1T6WA 2AW2A 4F37F 3QPXH 4XMLL 4D3CH 1YC7A 5ICYB 3CFDA 1GAFL 4OIIH 2EC9T 2V2WB 4LSRH 4XCEB 4HIXH 3VFMB 4K8RL 5A43C 4KGJA 2P5WB 5E2JA 1QSED 3KS0J 1NCTA 3ARXA 5J56B 3GSWA 2ATKB 1I9EA 1ZA3B 1KJ2H 4EOWL 3SCMB 3V6ZB 3O3BB 4X9HA 1NMCC 2XPGA 5D93C 3K4DA 1NGPH 1SM3L 1A9EB 1V3MA 3QDGB 1CT8B 4R97C 3C6SB 5DDHB 4S1RL 4PJDF 4ZXBD 1IGYA 2A1WL 2BSSA 5HPMB 1RY7B 1K8IA 4KDVA 4GRWF 4YZFE 4FFZH 1ZLWK 3TYFA 1TMCB 4I2XB 7FABH 4B5EA 3FFDA 3CXDL 3QWOB 1JPSH 2YD4A 3O3DB 2R1WB 3DMMA 4GUPA 4ZAKC 4L4TB 3QPQC 5JZ7C 1FJ1B 4FQXC 4DKFL 4NO5A 4PGJA 4HS6B 5GSRB 4I5BA 5GXBB 4U6VH 1MLBB 4LIQL 4RGMB 1V7NL 2IAMC 5D6CB 3TBVA 4ZTPL 3ETBF 4JVUA 1DE4A 1T22B 1YMHB 1XGQB 4PJDA 4OFVA 1KELL 3T2OA 4OGXH 1IGTA 5MEQB 3NAAL 1D5MA 3Q1SH 1X7QB 1T7XA 4LHUA 5EO0B 2WMPA 3LQAL 3RNQB 2NY0C 4WWKC 3AXLA 3W81A 5INDB 2Q8BL 4S1QL 3BAEL 4H25A 2KZWA 2BDNL 3UJIH 3OG4B 2H32B 3MGAA 5HYJB 3MRHB 1VEMA 3PWJB 4U1KB 3EGSB 1Z0NA 3BW9B 3FB6A 1G7LB 3HE7C 2X40A 5M95B 3HE6C 4HGKC 4JRXD 5FCSH 4GXUM 1VENA 3U4AA 1R3IH 5JO5B 3QFJA 4OIAA 3TC9A 4HXBL 2UUDK 1A7OH 1KGCE 1OM3L 3KYAA 1R24B 1JGLL 3QIUB 1LO0H 4XXCC 4ODUB 3VGHA 2VQTA 3DO3A 3GSNA 4WV1C 1SY6L 3GGWB 3SDXF 5C09A 1C5BL 3C6LD 4O2FA 2OQJA 2CUHA 2XKNB 5DFVD 4K23H 3C2AL 2C4FT 4YC2B 1JWMB 3DX7B 1HZHH 5T3XH 2EE3A 1JTOA 4EIGB 5KSVB 4D94A 2H2PC 3P4LA 1PZUB 1UGNA 2R0KH 1X9QA 32C2A 5FB8B 3ARUA 3UTOA 5JW4N 3WUWG 1RV6X 2FSEA 5MEPB 5LQBL 3T8XB 4YX2L 3SOBH 4OFKA 3C2SA 5FYLH 4EI5A 5A2FA 5MENB 3T4YA 3SY0B 1KC5L 4YGVA 4F7CB 4X9FA 3TJHD 4QWWC 4ONHB 4R26H 1MCWM 2AK4E 1KACB 4KI5D 1P1ZB 4OIBA 5HPOA 1AO7D 4XPAL 1UACH 4I48B 1BFSA 3QCVL 4RQQA 4ZNEA 1B90A 4XNUH 2KKQA 1WLHA 2HLAA 5JOEA 4UUJA 1LVEA 3IJYA 3DTXA 4PJCB 5GRYA 4F33B 2X4OB 2Y07H 3RDTA 4ZUTB 3H42H 5H2BA 4JFYB 2ESVD 1FH5H 4FP8L 2Q7NA 3L9RB 1NEZA 3GEWB 1B88A 5BJTB 4LLUA 4WFFE 3UJTL 5B8CB 5DRXA 3O4LD 1MRFH 4JFXA 3O3EA 5C7XH 4PPTA 5I6XC 3QZWA 5TE7L 4BUGA 1FGNL 2PO6D 2EDKA 4EUPG 2F58H 3DYMA 1WAAF 3V0VB 4HWZB 4RFEB 5FYJE 1E6OH 2BNRE 3T77B 1TQCB 1B9ZA 4GXVL 3FTGB 2CGRL 2C5DC 2NXYD 4L8BB 2YS4A 4L8SC 2VN4A 5LAXB 1TZGL 5J12B 3BP4A 1FL5A 1FORL 1XR8A 3BKYL 2YK1H 4FQIL 1NLBH 1QSFB 2VDRL 4MHHI 4ERSL 4PREA 1UA6H 3WHXB 4NQCA 1G9MC 4M62L 2R1XA 3TN0A 4WHCA 4MX7A 3WFEL 3KPRB 4ORGA 1GPOH 1P4IH 1S7SA 3UYRH 4RMVA 1IEBB 3W9DB 3DUHA 3WXWL 4P9MH 5LWYL 3MCKB 3QNXA 4OZHE 3BE1H 2RQ8A 5CKGA 4Z7NF 3QQ4B 1CFTB 4POYA 3RWHB 1HIML 4U1NB 4Y2DB 5GGSB 4M6OL 4D9RE 5DS8B 4NQDD 2Z31C 2YRPA 4JFZL 2ZUQC 4P5KA 5F9JA 2RGSA 5D2LB 1WWBX 4WW1A 1OAQH 2DYPB 4C4KO 1IARB 1T0MA 2OCFD 4E41A 3PGDB 4YQXH 3UPRA 5HYEA 1V05A 5T3ZD 3BJ91 4NKMA 3UBXA 3VXQA 2BXZA 4NGHL 5DJ8A 4F15C 3ULUE 5CEZE 5IEKA 1VEPA 1A7PH 2ZNXA 1PG7X 3TT1H 3IFLL 3G5YA 1MFEH 2HFGH 4JFEB 1ED3A 2J6EH 3OKMB 3QDME 4PS4H 4Y8AA 1FPTL 4YXLL 1S7TA 5D1ZD 5CGMA 3KHOA 2JCCB 3FOLB 3GUTA 5EU4B 4ZFOB 5IGXH 3FQTA 1QNZH 3TJEL 3RAJL 4F58L 4POUB 3PJSB 3GSQB 1ZT1A 4DGIL 1A5FH 5D5MF 4WDIA 5C70A 3V4VL 2LQRA 1CF8L 1WBZA 3SO3C 4UIMA 3OKDB 5JOPE 4WFHD 5E94A 4G9DA 1R3LB 4R4FL 4JN2A 1A1NA 4WO4C 4Z0BL 5IB2B 2L7UA 2EXYC 4HCRA 2FJGB 5IFJA 4L3AA 4KTYA 5CINL 4U1GB 4P3DA 3W11D 5ADPH 1ZEAL 1CG9B 2O5ZL 4KZEH 1XF4A 2X4RA 1KT2B 2UYLB 1N59A 3CDYA 4QNPF 3TH2T 2JIXB 3V0WL 4DZBA 2R69L 4GBXC 4X0KA 3SCMD 1H8SA 2DAVA 4ZOAA 2BY1A 4JKWA 2N1KA 2I07A 4E41E 4KVNL 3VFRA 1IC5L 3BN9D 3P9LB 1S7VB 5ICXB 1JWUB 4Q9QL 2ERJB 4EN3C 1W0WA 2XWBA 3BQUA 2ZUYA 3VFNA 4CVUA 4KXZI 4PGCA 5IBUB 4OSUH 3FRPG 4KKLD 3FN3A 3AS1A 5JQ6L 3G5ZB 2HYMA 2Z35B 3GSXB 3QUZB 1D5BA 2VL5A 5I18H 1Z3GH 4L4TD 5HGAA 4OF3A 2D9CA 2HTLD 5ACMA 2R29H 3L3OA 1V7ML 3IDIA 3B2UD 3KJ6L 4F3FB 1ZVSB 1HKLL 3PF2A 3ARGA 2ZOLB 2FGWH 3HLAB 4J6RL 2X4QA 4YHIA 4ZS6C 4WUKH 3KLHD 1ORQA 2DM2A 4JQVA 4OFIA 4D0CB 2WNGA 3SE9L 5D1QB 5IT2H 2EIEA 4PJEA 5J4MA 2QSTA 3LPFA 1YEKL 4HKXB 4MYWB 4R0LC 4E42B 3ARRA 2JK5B 3QUXB 4ELMF 3VG9C 4OCLC 5FUCE 1T1WB 2Z91B 3KPSD 4IDJL 4N5EC 5HYJD 2EKJA 3HAEB 4YHNB 4X80H 4PGDA 1D5XA 4UV7H 4Z5RB 3B2VL 3U0WL 1OVZA 3LPGA 3HR5B 4P2QA 3L5IA 1MWAA 1F8TL 3NGBC 1NC2A 3DX8A 3MRFB 5H8DA 4X4XA 3U4BH 3VDCA 4U1SA 5I19H 3ARFB 5MI0C 4KPHL 3WKNA 1KXTB 4F57L 3B9EA 1C1EL 3W9EB 1ZT4B 4HK0A 3QIUD 2HVJA 3P0VH 3D39D 5E5MB 1OF2B 1M7IB 4G43B 4U1MA 4XVTH 1AC0A 3EBAA 3ULSB 3EDKA 5I71C 2XZCH 3KLAB 1EFXB 4FNLL 5A16A 3FO2B 5KSBB 3PDDA 1CLOH 5KS9E 2X09A 2CIKA 4R4BB 1NGWB 3H8NA 4UQ2A 2WWKO 2VH5L 4FQQB 1UZ6E 4FZ8L 1KNOA 2YWYA 2QSVA 4LASL 1WBXB 3ECBA 3H9HB 4M7LT 1KEMH 1I8KA 4MSWB 2WIMA 5MEND 3MRGB 4WW2C 5KAQG 1XF1A 3CFCL 1BVZA 4UI2A 4PRAB 5BOPA 1MHPL 5ALCH 2FYYA 1I1YB 1CTOA 3MLSL 3MRRB 2OMNA 5C3TA 1QHOA 1JMZA 1BLNB 5DD6B 3KWWA 1RK1A 2X4SB 2J4WL 3R1GL 4HJGB 3QCUH 5CD3B 3RZCC 3IDMB 2NPLX 3IJHA 4GXUN 4Y19E 5DYOA 1AP2A 1N6UA 3RVWC 4E5XA 3C8DA 4P2QE 1KEGH 1U36A 2CIIB 5KVEL 4XH2A 4YDLB 4EDXB 1D6EA 2ZNWA 5GISH 5IP4A 4P46A 2D03L 2X4UB 1CGYA 3MXVH 5CGYD 3ISWA 1U3YA 5HHXL 2C3WA 4PJAF 3G04B 4U6HA 4PGEA 1NBQA 4NYLB 4NO3B 4NZTL 1DDHB 5F6IC 2NTFB 4N0CD 1S7QA 4OZFG 4KC3B 2ZJSH 1CDIA 1TJHL 1LD9A 1BFOB 3U6RA 3BIKA 1FYTA 4CUCA 5GGRY 5IVXF 1PKOA 4AG4H 1QSFD 3HTLX 5I74C 1WIPA 4LLMB 1LO2H 4PJAA 1L0XA 2E6JA 1XCTB 4J4PA 1MFCH 4HMDA 5E6IA 3LN5B 1ZA6B 5DEZA 1JFQL 3S3JA 4K71B 3KPRD 3I2CH 5L8KB 1MRCH 1OPGH 3EJYC 2ZG1A 3U7YL 3MNZB 5EFIB 5GGUA 3R8BB 5AYUL 2QADB 3S88H 4HKJB 2P8PA 4MXVF 5GS0C 3HZYB 2GSGA 4Y2DD 3I02A 1FNFA 3H9YA 2VLRA 5ESAB 1KB5A 1N0XH 2OR9L 4PRDA 3G6JE 3CFJB 3T0WA 2OYPA 5IVXA 2AXGA 3VXNA 4Y5XB 1YC8A 2DYPD 2KQNA 4U1JA 2PXYA 5DC4B 4U1HA 4OM0H 3CFDB 4MAUH 3ARDC 1CVSC 3ME0A 5T3ZL 1CGVA 1J1PL 1MCJA 1IKFH 3GI9L 1H3WM 1WQVT 2EIZA 1J87A 4XC1H 3V5HA 4JFED 2AXHA 1PLGH 3GSWB 3LH2H 2DWEA 4HQQH 5LGHL 4KK9C 3LVEA 1YN7A 2BX5A 2XPGB 4OQTH 2VISA 5KW9H 2B4CL 3NA9L 3QXWA 1GSMA 1FYTE 1IGYB 4G5ZH 4V3EB 2BSSB 1D5IL 2ZKHH 3PDOA 5EU3A 1VERA 2OTPA 5EZOL 1K8IB 1F3RB 5CLWA 3MLWL 5TF0A 4LRNL 3TYFB 4RWHA 2V5TA 5HHQA 4CADA 3IDUA 3FFDB 3DMMB 4GUPB 3DUUA 4Z7QF 1MRDH 1IC4H 4DTGL 1KTLA 2D7TH 4NO5B 4I5BB 4JM2A 1B0GA 2YPKB 4ZQKA 3TBVB 1EVTC 4XVJH 1J5OL 1DE4B 2JJVA 1HXYA 3QA3A 1QO3A 2JIXD 1OTSC 2ZZUT 9CGTA 1IGTB 4XRCB 1D5MB 3QI9C 2DQIL 4LHUB 5SX4I 4HZAA 1AFVH 1RQ5A 3VRLE 2UY7A 4NC2B 4NPYA 4JO1H 3AXLB 2BNQA 1EEZA 1U8JA 4H25B 1LO4L 4OZIF 1J10A 4TOYH 1GIGH 5C0AD 5MP6L 3D87B 1CXLA 1YEEH 4DZ8A 3QUZD 4YFEA 3S9DB 3FB6B 3I85A 2J12B 1TENA 1DQLL 4LCCC 4M5ZH 4FN0A 4JHAL 1CXHA 3WE6A 1N8ZA 5FECA 35C8H 3VW3H 3QFJB 4YHKL 4UT9H 2W0FA 5F7DA 5F9AC 1MCDA 4CMHB 1NAKH 1T4KA 5K59F 1YEFH 5TE6L 5EC2A 2AJSH 1CIUA 5JDSA 1ORSA 1S7UA 1J12A 3OPZL 3K74B 4O2FB 1SJEA 2DTMH 2OQJB 3OKKA 5BV7H 5D1QD 4ZSOE 3LQZA 1BREA 3K0WA 4K94C 4UAOC 1M6OB 4NCC1 5HY9A 2V17H 1OWRM 1RIVH 2BNRB 5IB5A 1I8MA 1C7SA 3QUXD 4R4ND 3CPLA 2XWJB 1XR9A 32C2B 2FH6A 2JJTC 4JHBA 1OL0A 4X6CE 2FSEB 4PG9A 1CQYA 5TJWK 3BH8A 4CJ0A 4EI5B 1BZ9A 3T4YB 5GS3A 4Y4FA 5JIIA 4YGVB 3OWEA 4DK3A 2B2XH 2YZ8A 1G9NL 1MCQA 1F2QA 1BJ1H 4LLDA 3ARFD 3EFDH 1HNGA 4M7ZB 1NAMH 1EH9A 4M8QA 5JPNA 1OGAE 2HLAB 3MSPA 4ZNCD 1CGSH 1OP9A 3PE9A 2O5YH 1U8HA 5GJSL 1KLUA 1RJZA 4UUJB 2FL5A 2AGJH 3DTXB 2WM0A 3PP4L 3RDTB 4GH7B 1A3LL 5H2BB 3FKUS 1HYRC 4RMQA 3CX2A 4XZUA 2WUBH 2X4PA 1KB9J 1NEZB 5AEAA 4LVHB 1JZ2A 2FATH 3E3QC 2NW2B 4LLUB 1YEJL 4LAJH 2AJYH 2R4SH 5DRXB 1KXQE 2QKIA 1P53A 3WNOA 4EQ3A 4JFXB 3O3EB 4JFDE 4CDHA 1FL6A 1TQBC 3QZWB 5ANME 5KG9A 4M7KH 1GVIA 5EBLA 1T80A 3HPJA 5L88L 2J8OA 2VXTL 3PHOA 5D72H 3I50H 3EIFA 1D5ZA 4P4KA 5AG9A 3QDMB 5CCKL 5JA9A 2D7QA 2FWOA 3VGBA 3X12A 4YDJA 3DXAE 4PRBA 2DQHL 4QRRE 4EUPH 5GS0H 3BP4B 4JO4L 1FL5B 3WUZA 4BYHA 2GY7B 3NFPA 1XR8B 5D2NC 1RZJL 5D96C 4KDTC 3IDXH 4FFEX 1WT5C 4PREB 1NSNH 2YPLE 5GS1C 4NQCB 1OCWH 1X5JA 2GY5A 2R1XB 4R7NA 1Q94A 3TN0B 5I1IL 3NZ8A 1IQDA 4MX7B 2X9WA 2P8LA 4F2MA 4PBWD 4WTXA 3CFBB 4ORGB 5GSVA 1MCBA 1S7SB 1T1YB 4XCFL 4Q97A 1D9KA 2UV3A 1L0QA 1KFAL 3QNXB 3TZVA 2IPTH 1LO5A 2YPVL 1T5XA 4M61A 4QTHA 5BZWA 5BO1L 3I6LD 2ARJQ 1JHKH 1L7IH 1DVFA 2QQNH 4P5KB 5F9JB 2DQJL 4WW1B 1T0MB 1CXIA 4E41B 3EDDA 1MHHA 1IM3A 4PJ5A 3D9AH 3UPRB 4NKMB 5D1XC 5ACZA 5DR5L 3UBXB 3VXQB 3K4AA 5DJ8B 5IEKB 4IMKA 1M7DA 3G5YB 5FUZH 1NANH 2P47B 1ED3B 1KCLA 1S7TB 2GJ6A 1QOKA 1P84K 1D6VH 1IFHL 3WN5A 2FX8L 3S36H 3HZMA 3GUTB 4OCNC 2EXWC 3FQTB 4U1LA 3V52L 4GW1B 4LPXA 2BSTA 3RWJA 3FHAA 4TSAH 1DP0A 1JI2A 1UWGH 4GAGH 1FE8L 4M9PA 4WDIB 2FR4A 2ZUXA 1YEHH 2I26N 1A7RH 1WBZB 4JVWA 4KJWD 5DJ0A 4XP9L 4ZS7H 4UV4H 5C9KA 5E94B 4G9DB 2VDQL 1EJOL 1T89C 3MLVL 4JN2B 1WFNA 4JGMA 5FCUH 1CD1A 2HT3D 5EBWA 5IFJB 2DDQL 7CGTA 4I0PA 3SKUD 4P3DB 5SWZA 1NCDH 1MAJA 3PXJA 3VXMA 4CVXA 1XF4B 2X4RB 3KPTA 4RX4A 2X1XR 3MRLA 4WGVB 2H9GB 1NLDH 4DZBB 3FFCE 4GRLA 2MNUA 4X0KB 2YWZA 4GKOA 4ISVA 2I07B 2RFXA 4LCWA 3VFRB 1F4YH 4HUVA 2WWMD 2WIIA 1YPZF 5CIPH 2AS5M 1DQQA 3LN4A 1W0WB 2XWBB 3TGXA 4DW2H 3BQUB 5DEGA 3VFNB 4LRIC 4KKAC 4Q9RH 3WXVH 3UTSA 4HS8L 4K94H 4QOKA 1D5BB 2VL5B 3DMMD 4M4PA 4P3CL 2A0LC 4TN9A 4KQ3L 1G7IA 2VQUA 3L3OB 3IDIB 2YD9A 3LKNA 2NY6C 1NDGA 4XP1H 4RRPG 3ARGB 4H88L 4LBEA 4ZO6A 4G6ML 2X4QB 5E2WH 4MA8H 3TWCH 1UXSA 3LS5H 3L1OH 4MQ7A 5KSUA 3HC3L 3FQNA 4RGOH 2H6PA 4FQCL 2EYSA 4PJEB 3WBDA 4M6ML 4LHUD 3RVVC 3SPVA 1CDJA 1FRGL 1KTKE 4Z95H 1UKSA 5ALBL 1IMHC 1YZZA 3B8SA 3VXME 2BHUA 4I0KA 4XNYL 1WV7T 4KRPC 5FHBL 3SDCA 1PY9A 2FO4A 5E4IA 1SBSL 1MJ8L 2EYTA 4Y7MA 4PGDB 2FB4H 1SMAA 4Y19B 1HCFX 3RNKA 2BJML 4LPYA 2YUVA 4P2QB 1GHFH 4WTZA 4LCWE 5I1EL 1MWAB 5LCVH 2KDGA 1NC2B 2NX5A 3DX8B 3DSFL 1JNNH 3CXHJ 3QFJD 2UVFA 3WFCH 2X10A 4X4XB 2YMXH 2F8XC 4U1SB 5J13C 1E4WL 2V2XA 3GKWH 1DQDL 1INDH 4ODSH 4WFFD 4UOW0 4HK0B 3S3SA 4L4VE 3H7LA 4XNZC 5JHLH 4BZ1H 3INUL 5C09D 3MRMA 1UKTA 4U1MB 1KIRB 4XPGH 4MS8C 4F7TB 4I3RL 3MOBH 5A16B 4JY6A 2BP3A 3K1KC 3RHWF 5LXGL 4OGYH 2CIKB 1WSST 4G80A 3WJJA 4UQ2B 1OAXH 1CDUA 1NCWL 3CFIC 1KNOB 1J0KA 4XP4L 5FGBA 4B0MM 1MJ7L 4HSQA 3ECBB 1I1FA 1K4CA 1SHMA 2EO1A 2OI9A 2DRUA 3SGKA 1C8PA 1I8KB 3E6FA 5T1DH 4EI5D 1MJJA 1GL4B 3GBMH 1H0DA 2OJZL 4V1DA 2YHGA 3CC5A 2FYYB 4OCYL 2OTWA 4OCXH 4KUCF 3HZVA 1RURL 4CW1A 5A3ID 3KWWB 3LRHA 3S37H 2HJFA 3FN0L 1X5AA 3V6BR 2FIKA 3IJHB 2WY3A 5DYOB 1AP2B 4E5XB 1J05A 4YHZH 1FAIH 3JWOC 4PJ9A 5DJZA 3ALPA 3AY4C 3RDTD 2F5AL 2DM4A 2FEDD 1JBJA 3QIWC 4HUNB 4AL8H 3QHZH 4OCSH 4P46B 4F7PA 4LU5L 4BFIA 2VDMH 3CX5J 5KTEL 3SE3C 5EA0L 1OTTD 4U6HB 4FQ2L 1FCCA 1G6RH 2PYEA 1MCNA 3B43A 3ILPA 3MJ9L 4QXGL 1NC4A 1BQHA 2QEJA 1S7QB 1HHGA 1SQ2N 4XI5D 3H2WA 3ZKXC 4XBEH 1LEIA 5CZKA 1U8QA 1LD9B 1MVFA 1YEIH 2QQLL 4M00A 4TSBH 1U8PA 2DL2A 3ARSA 1BF2A 1FYTB 1N7ML 4KQ4L 4EBQL 4OZFH 3N85H 1DANU 3FB8A 5I8OL 1BPVA 1KJ2A 5E4EC 3VGEA 4V1DE 1CD8A 4NQCD 4EI6A 2ZCKH 5DRNA 4RISH 3RY5A 2R2CA 4QGYA 3TN0D 5E6IB 2OMBA 4DVRH 1A8JH 1GZQB 3G08A 5JOPD 1N6QL 5C71A 5HYSA 1CLCA 4JRYA 5JR1L 1JVKA 3ZTNH 4TVPE 1U58B 4WI3A 4NN7C 5HHME 4DQOL 5HGDB 3BD5A 3MC0A 4NN6B 3GK8L 5GGUB 2KUTA 2P8PB 2R0WL 2FGZA 3A6CL 1J1OH 5E2UH 2GSGB 3RWDB 3OGOE 1JNHA 2E6QA 3WSQL 1F58L 3THML 1JWSA 1YNTA 2VLRB 5CUSL 1KB5B 4PRDB 5I8KL 4GLRI 4KV5F 1RU9H 2P4AB 5IR1A 3SGEI 1N64H 2AXGB 3VXNB 2G9HA 4XWGH 4Y5VA 4U1JB 2PXYB 1MIEL 4MD0A 5HD8D 4E41D 4NIKB 4J1UA 4EDWL 4BKLA 5JUEL 4C58B 2XT1B 4FQ1L 4K8RC 1JHTA 2EDLA 4P2CG 1WBYB 4J3UA 3O45A 1VA9A 2EIZB 3R06A 4UNVA 1BZ7A 3V5HB 4FFYL 2DWEB 4CU6A 4AMKH 2EZ0C 1H3PL 4GQ9H 3I3BA 4NQVA 1YN7B 3WFHA 2VISB 4HKBA 1CXFA 2YC1A 4LGSB 1E4KC 2L7JA 1CZ8L 4G7YL 3PDOB 5EU3B 3PABA 3FT4A 4XWOC 2VDKH 2NYYD 2E7BA 3MV8D 4BZ2H 2OBGA 4CADB 4H1LG 2C9AA 4LLYA 4OUUA 3L7EB 2ZP0T 2ZSWA 4JRYE 4MJIA 2FDBP 1IGCH 1KTLB 5IB3A 3WFBL 4JM2B 1B0GB 4KRMB 3KDMA 4BQ6A 4W4OA 4HK3J 4HUMB 4H8WH 15C8L 5CBEA 1UJTA 2HWZH 4QHNA 3LMJL 2UZIL 1HXYB 3DHMA 1NEUA 3QA3B 1QO3B 1WFUA 3TESA 4Y8DC 1XF2B 2Y6SC 1NCBL 3LQAC 3ZHKA 1E0OB 3Q48A 4PJHE 5CJ8A 5EU6A 2E8YA 3GZKA 5E8DL 5BOZG 1RZ8B 2A9ML 4MD5A 4Y4KA 4KMLB 3ZTJG 1CGTA 2JB6A 4NPYB 3V5KA 1ND0A 4MDIA 2BNQB 1EEZB 2WAHA 3L5XL 1NGZA 5CZXC 3BQUD 4PYHA 2I60L 3LEYH 3VFSB 4BH8A 1WTGT 1N4XL 1ROWA 1I9JH 3LDBC 3PNWA 4DZ8B 1AGCA 3V7AG 2XZAH 3ALWA 4U05A 1GGIH 1MCPH 3WE6B 1RULH 5IW1A 1N8ZB 5FECB 3C09B 2CDFA 5GQBA 2XN9A 3LIZH 5L8JB 3LKSB 4EXKA 3L3DA 1FIGL 3HMXH 4LLVA 3BISA 2W0FB 2X7LA 4KUZH 5F7DB 3JWDC 3ARGD 4G6FB 1T4KB 1B4RA 1KPRA 5EC2B 3MOQA 5E2VH 5JDSB 1ORSB 1S7UB 3IKCB 4PTUB 3S5LA 3SGJA 5IMMA 5MHSD 4JFDB 4ZDHA 1SJEB 4PB9L 3LQZB 5F6HJ 4MA1C 4OD3H 3HMWH 5HY9B 4UB0L 2ICEA 3BPLC 3EYSL 1NGQL 2XNAB 1BOGA 5IB5B 1I8MB 4PJXF 4DOHB 3ZE1E 3DXAB 3KLDA 3CPLB 1S78D 4HZLB 4QRRB 1XR9B 4FFWC 1E27A 3PP3H 1CDHA 4G3YH 3JWOH 1K2DA 3DRTA 1WIUA 4NBXB 4PG9B 3BH8B 5T3XE 4WNQA 1BZ9B 4P2QD 2R0LH 1JZ8A 2P46B 3NFNA 1AY1L 4Y4FB 1HH9A 5F7EL 5TPWH 1CGWA 1FVCA 5BRZA 1NC2D 4FTVE 1J88A 3FT3A 1ZHKA 5CAYB 1A9BA 2WANA 1EAPB 4O02L 3TF7A 4LLDB 3T04D 3IDYC 4XP6L 1A14L 5FYLE 3DVGA 4M8QB 1L7TH 5JPNB 4PJXA 3L3HA 1U8HB 4KFZC 3MXWH 1KLUB 1RJZB 1CLZL 3ZMRA 5KJRL 2FL5B 1KLGA 3ARQA 3LV3A 4P2RA 1MF2H 2XRAL 2HAZA 2FBJL 2XN9E 2CLRA 4LSTL 3UZVB 4XZUB 4JG1L 4LSUL 1W0VA 2X4PB 4ODHH 3A67H 1I1AC 5FYJL 2AJXH 3CLFL 1MAML 2E8ZA 3P0YH 5EU7C 3N1MC 3VRJB 3ULVF 2X41A 1P4BL 2QKIB 4OQ1A 4B41A 3BT2H 5CZVL 1FL6B 1I3UA 5KG9B 5EBLB 2C3GA 3HPJB 4V2CB 4RAHA 3PHOB 4UILL 1KBGL 4X99B 1ZLUK 1D5ZB 1S9XA 1UM6H 2ILLA 3WNPA 3X12B 2KL6A 4IRSC 4L1HA 4UDUA 4YDJB 1A6WL 1FLRL 4G8GA 2K9UA 3F8UB 4PRBB 5CJQH 3KPNA 2AEWA 4ZOBA 2IPUG 5IJVA 1FSKB 3AGVA 2DQGL 1I9IL 4ZD3L 4ZAKA 1JF6A 3DIFA 4HPYL 3QISA 1PAMA 2AABH 4FQXA 4LOUD 1Q0XL 5GS2H 5E6ZA 1U3JA 3GBNL 3VE0A 4ODXA 2F54A 1DSFL 4R7NB 2IAMA 3I3EA 2ICES 2G60L 2Z4QA 3U1SL 3NZ8B 1IQDB 2P8LB 4F2MB 3GSVA 4P46D 5GSVB 2HT4C 2VDPH 5TFSL 4OLWL 1LO5B 3LOWA 4NO0A 1RMFL 3V6OE 4BQ9A 5DUPL 4MNQA 5BZWB 3FQUA 3O2VH 3UTTA 2HH0H 1KIQA 3DV4A 2XY2A 3ULUL 4GG6A 4WWKA 5CEZL 5IUSA 5DHXB 1JPGA 3O6FC 1DVFB 4OZGE 3W5NA 1A1OA 2J8UE 4D9QD 1ZTXL 3GRWA 4PJ5B 2ID5A 3CXDH 4JDTH 4KAQH 1I7UA 1FYTD 5EPMB 3RIAK 5ACZB 3HE7A 4N0YL 1WIOA 4P48A 2NY3C 1NFDF 2DLFH 3HE6A 3OG6B 3WIIL 1M7DB 4GKZA 2D4DA 1FNHA 3CX5K 3UO1L 3HB3C 4LIQH 5IHZA 3IFNH 4YBLB 3CCHB 4M1DH 4ONFL 5E6ID 4GAJH 3HZMB 3BPNB 3X3FH 2LVEA 2BZDA 1P7QA 4U1LB 4XXCA 1P9MC 3CVIL 2BSTB 4WV1A 3NCJL 3RWJB 1IILE 5I15H 1RK0A 4ENEC 3UC0H 2AVGA 5B38A 4ZUVB 4UQ3B 2FR4B 1TPXC 4G8EA 2F54E 5DJ0B 4APQD 2VLRD 3RA7H 2CMRH 1JE6A 4NJ9H 2APTA 1LNUA 5HHVL 2HJKA 1NFDA 2VUOA 2FZ3B 2R0ZH 2XQYG 3ZYOA 1U0QA 3B4NA 2PXYD 3GIZH 4NM8L 5DJ2A 3VG0L 1CWVA 4I0PB 5I0DA 3BYYA 1WFOA 5CSBA 1JI1A 5HDLA 5SWZB 3TT3L 3VXMB 4CVXB 1QUNA 4JFFA 3UTTE 2V2TA 2W59A 1CFVL 3MRLB 5K9QG 1P2CA 5EZLA 5B39G 2YN3A 1B4JH 3MRIA 3GMMA 4GRLB 4X4YA 2IQ9H 2YD3A 2WLZA 2Y5TA 3HUJE 4ISVB 2RFXB 4LCWB 1MNUH 4K7PL 3S35H 2WIIB 3JWDH 5C07A 1MSPA 3UMTA 4JREC 2ATPA 1C5BH 4JDZA 2YA1A 1DQQB 3LN4B 3G6JF 2VDLL 1PQZA 4HDIA 4LCIL 5DMGC 3UTSB 4J8RA 3I84A 5DEFA 2AJVH 2VLJA 3LCYA 1VGKA 4OLVH 4QOKB 4HJJL 5MERA 4JKPL 5IHBA 1G7IB 1TJGL 5BQ7A 3RWCA 4K3DL 5FYKH 3MTRA 2ORBH 5CSZA 2DWDA 4JM2D 4HCRL 1QFWH 5ADOL 4KZDH 3LKNB 1NDGB 3PWUA 4V2BA 1BQLH 4MJ2A 5A2IH 1MFNA 3MFGB 4QY8A 3U0TA 3TH4T 3WLWD 4LBEB 2R9HC 2A74A 2Y06H 4L5FH 4ELKA 4LAQH 4LEOA 4M6NL 1T3FA 4MQ7B 3FQNB 1TLKA 1KCSL 2H6PB 1HCVA 2EYSB 1RJLA 2ZUSA 5H94A 3SPVB 5D7IF 4YHPA 2HA1A 4NC0B 4CVWA 4QTIL 3RX8A 1JRHH 2BNQD 3MLYH 4TUJA 4JFFE 1DQMH 4XPTH 3FMGL 1EK3A 2B1HL 3MO1A 1UM4L 1P7KA 3RIFF 2FO4B 5BS0E 2NW3A 2EYTB 1WFTA 4WHTA 4FRWA 3RNKB 3FONB 4ZYKA 1U42A 4YDIL 3NCYS 3MUZ1 5C07E 1KF9B 4QXUL 2VLLA 4H20H 4XTRD 4FXGA 4ZOEA 4G6FD 2V2XB 3EOTL 3VFTA 2Z31A 4C83A 3MBXH 5D7IA 4HC1L 1JYXA 4MNGA 1JIBA 3ZKMC 3SQOL 1HKFA 2VDOH 3MRMB 4MVBC 4N5UA 4AEHL 4ZO7A 2LTQB 4JY6B 1OP3H 3NABL 2V9TA 3VXOA 5GGVH 3BUYA 1G0YR 4G80B 4P9HL 1ACZA 4RMUA 5J3HD 4H26A 4NNPH 1CS6A 2A6KA 3FO0H 4M62H 4TSCL 1HYSD 4GG8A 2OI9B 5D6DC 1I1FB 1K4CB 2NXZC 4IHOA 3TP4A 3WO4B 2VYRE 4YO0A 1VSCA 3MLUL 4WY7L 4BJLA 5EOCL 5DJYA 2ADFL 3E8UL 4U1IA 3X3GL 3HNVL 5HVFB 5DQ9A 5B3JF 5HDBE 3CDGA 4GRWH 2OZ4A 1MJJB 4WHDA 3C5ZC 1H0DB 4Y4FD 4V1DB 1MWAL 3CC5B 5IIEB 2B0SH 4B7LA 5EZIH 2OTWB 2Y5EA 3HZVB 1HHJA 4CW1B 1Q9WA 1LP9F 3ZHDA 5I1LA 2HJFB 2HMIC 3IETA 4LSQL 4TULH 1N5AA 3EAKA 2GSIA 2FIKB 2MTPA 5HHMB 2HJLA 3T3ME 4WEUD 4XVUC 5ECJE 1J05B 4WO4A 2EDNA 3DETD 5EDXA 4YWGH 4ZFGL 3DWTA 5DJZB 2FHBA 1DTUA 3BZEB 5ITFA 5AWNH 4KXZH 4L3EA 4XX1E 4NRXA 4X6CF 2I9TA 4NGHH 3GHEH 3UCRA 4F7PB 1KJ3H 1HINH 4BFIB 3GMRA 3U30B 3EJJX 1A3RH 1FIEA 2AK1L 2YA2A 1FPTH 4MNGE 4GBXA 1AJ7L 5DQDH 4ODVH 3GSNH 1LP9A 5KZCB 2PYEB 4HLJA 1WZ1H 1QD0A 3ILPB 2BVYA 2YRZA 4OLEA 2APVA 1NC4B 1LWRA 1O7SA 3NA4A 2X9YA 4RMRA 1BQHB 4P4KD 3SDYL 4EN3A 3VH8A 1NMBH 2J5LC 1HHGB 3DECA 3FOMA 4YHLL 3TYGH 1U8QB 3WYRA 1ULVA 1U8PB 4U6YA 4MJ4A 3MBEC 1IAMA 2NY4B 4G6AD 1XF3A 4P5TC 5KANG 2YSSA 1KYOK 5FEBA 3MODL 1KJ2B 3QQ9C 1JF1B 4JPKH 4EI6B 5DRNB 3MRBA 4OQTA 3A6BL 2UVEA 3G08B 1KPUA 5HYSB 4JRYB 3NCCB 3V9FA 4N1HB 4D2NA 1EUTA 5C0RH 3L6FA 4N90D 3ZKSD 3QEQE 1D9KD 2R69H 4OUOA 3U9PL 3TZVD 4R8WL 3AB0C 5B4MC 1OD7A 2ZSVA 4R7DA 4LVOB 3OX8A 1JNHB 5C0JA 3T0EC 2VXQH 4R0LA 1JWSB 1YNTB 4BSJA 2IBBA 3KS0H 1QBML 1DVFD 1YEGH 5IR1B 2DN7A 3P9MA 1NKOA 4PJHB 2G9HB 4N5EA 1CD0A 4Y5VB 4MD0B 4J1UB 3HHRB 4NQXA 4PJ5D 4BKLB 4HFUH 4YJZL 3QNYA 3K3QA 2B1AL 2P5EA 3IAQA 1UWEH 3O45B 1FQ9C 1QR4A 5JTWA 4UU9A 3O6MH 3R06B 3GBLA 5IBLD 1BZ7B 1YNLL 4HIHA 4L9DA 5IFHL 1DL7L 4XT1C 5HI5C 4FABH 1X5FA 2GJ6D 4PJFE 3KYKH 4MAYC 3LQMA 3WFHB 3H9SE 4J6RH 3QSKB 4HKBB 1IAKA 4NFCA 2YC1B 1QSVA 5JIHA 2YA0A 2XZZA 3UAJC 5DC9B 3PABB 3FT4B 4PJIF 5EBGA 4YE4H 1EDQA 4I4WB 4Y5YB 1XGYL 5TE4L 1MAKA 2PR4L 3CIQA 3LHPL 4LLYB 2ZSWB 2BVQA 4MJIB 3F6IA 5D7LE 4DGYL 4X6DE 1KN4L 3NTCL 3KDMB 4I0PD 3IXAA 4NNYA 3NZHL 4H1LH 4ZOCA 2PW2A 5SWZD 3NIDF 1G0XA 4C59B 5CBEB 3VXMD 4WW2A 4RX4D 1PFCA 4KWUA 4QHNB 1TIUA 5IFAH 4LHQB 2VR4A 2D3VA 5EU6B 4GRLD 4BUHA 2A6DA 1GJIA 5HDQL 2MCPH 4MD5B 4LCWD 3RZCA 4Y4KB 12E8L 1KN2H 3SKJH 1ZANL 4FG6D 4O51B 3QWRA 3WV0A 1DFBH 3HI1A 1ND0B 4MDIB 3GJEA 5GIRB 4WU5B 2SEBA 3MLRL 1MCRA 2P5EE 1CGXA 2B39A 2PUQT 5I1KH 1NGZB 2OTUB 1HN1A 4QHKJ 4BH8B 5IBTH 4A6YL 3UTSD 1B6UA 3HAEG 2GCYA 3DI3B 2X89A 1AGCB 3DYPA 4QOKD 2AJUH 1H5BC 2MCG1 2GI7A 4PJBE 4ZG1A 2QHRH 3KPPB 4NOFA 4PLJD 4RBPK 5IW1B 3WUWA 3MLZL 2XN9B 4DEPC 5DK2A 2A77H 3L3DB 1NAMA 1QFUL 4TNWK 2X7LB 1QSEE 3ZYIA 5ENWA 1FGVH 1KPRB 2XA8H 2PTTA 1LDPL 5IMMB 3S5LB 3F7QA 3HRZB 2NY7L 3R1GH 2J4WH 4NSKA 4OT1H 3BHBA 5CBAA 4M7LH 1JFMA 3OF6A 1FZJA 3HC0A 3DVNB 1TJIH 4YPGA 3FO9A 4M9OA 2ICEB 5GGSY 5IM7B 1ZLVK 1BOGB 2F9BT 4KHTH 4IS6A 3VD5A 4KROB 4G6JL 3JWNC 4ZODA 1Y6KR 3SDCD 1F3DJ 1MHCA 1K2DB 3DRTB 4PG2C 5C92A 2MPAH 2DQCL 1C7TA 1YQ2A 4WNQB 3W2DL 4D0DA 1K4DA 3JSSA 3QQ3A 3NFNB 3TBTA 1HH9B 1AI1H 1FVCB 1X5IA 1FNSH 1U6AH 2NX5D 4EUPA 4D9LH 3FT3B 2UZXB 1ZHKB 3QUMA 3T0DA 1A9BB 1UB5A 2DB8A 3KR3L 3DLQR 1UC6A 3DVGB 3EOBA 5KVDL 4ZFFB 4XMKL 1NGYA 1J0HA 2Y36H 5HI4D 1UT9A 3L3HB 3RUGF 2AEPL 2BCKA 5EO1A 5K93A 1KLGB 3IF1A 1G6VK 1TETL 3BP7A 3LV3B 4S1SL 4PRNA 3O11A 2EH8H 3ARDA 4OCRH 1BM3L 2CLRB 2NLJA 2W1NA 1W0VB 5IF0A 4ALAL 4MB3A 1E4XI 2BHZA 5JXAH 4AENB 4NM4L 5J0BA 4KY1L 4XMPL 1MI5A 5IHUL 5IK3A 5F93C 5I75C 1NMCB 4Y16B 3K7UA 4JRXE 3M17A 1RIUL 4OB5L 2V7NA 4R97B 3U7YH 5TF1H 4V1DD 5AYUH 3G6AA 1S9XB 4Z8FL 3O81A 5FO7A 3EHBC 4UDUB 1GGCL 3FHQA 4G8GB 3KPNB 3NPZB 3EJZC 4R90L 3Q6FA 4TVPD 1FVDA 5IJVB 4NP4L 5JW5A 1HQRA 3BKML 2P1YA 4ONGH 3BRGC 2D7OA 3C5JA 4ZAKB 3DIFB 4FQXB 1LGVA 1RUQL 3DVIA 1VEOA 3BSZH 4PJ9D 3VE0B 4ODXB 2IANA 2F54B 3L5WA 5CFHA 2IAMB 5ETUA 4JDVA 1IAIH 1N26A 1GOHA 2Z4QB 3GI9H 3OAUL 2EIBA 5I1GL 3GSVB 4K2UH 2EDYA 3RVUC 1SEBA 3MLXH 4UTBL 4KUCD 5IQ7H 4NO0B 1F4AA 3QI9A 4MNQB 5H35B 5SV3A 2H8PA 5K9JH 2PYED 4JQIL 5KZCD 2XTJC 3FQUB 3LD8C 1CK0L 3JUZA 4XNQA 4OLUL 3UTTB 2AI0H 4XNMA 1KIQB 3DV4B 4KI5E 5F44A 1NC4D 1NJ9A 4GG6B 4WWKB 2BSED 4YHOL 5CILH 1JPGB 1JGVL 4UNTA 1AO7E 3S4SG 1D5IH 2EICA 1P5UA 1YQVL 5JNYB 1A1OB 4N8VG 3V6FA 3HUJB 5J12C 4PJ7E 1NFIB 2WP3O 3UPCA 1MI5E 2FD6L 5GJTL 5F9WC 4HH8A 4WWID 4OI9A 5CEYA 2NY4D 3HE7B 4LCCA 3HE6B 1M71A 3AREC 2ESVE 4GKZB 1UJ3C 1ZLSL 3U82B 3QULB 3GI8H 1W2KT 4JZOA 2AJ3B 3EYQD 5IW6A 3O4LE 4JRYD 1NUGA 1P7QB 5FM8A 3VI3E 1FLTX 1I75A 1OAUH 1OGTA 4WV1B 4Z7VE 2RBLA 1RK0B 1FYHB 1RUAL 3Q6GH 4IRJC 5B38B 4S1DC 3T2NH 1S9YA 4XHQA 4G8EB 2NY1C 1OOAA 4PBXA 4J23A 4ZUWA 4PUBH 4YAQA 1LNUB 4NHCL 4NC1C 4RWYH 2F5BH 3FRPA 4WEBH 5E1HB 4UBDC 3MZGB 4FMKA 4TUKH 3VFVA 2JJTA 1DZBA 5JHDA 5DJ2B 5BZDA 3HFML 3DROA 4WCYL 3W0WA 2V6HA 3NCMA 3VRIA 3EYUL 4Z9KB 3UXFA 2J3SA 1MFDL 2Q87A 2DQDH 3F5WA 3MREA 4W6WB 4JHAH 1AKJA 4OD1H 4JFFB 3T0AA 2DI7A 3VMPA 2V2TB 3VMOA 4Y1AA 1RVFL 2HFEA 3Q0HA 1ERNA 4MQXD 3JTCA 5CD5D 1ZV5A 3MRIB 2R4RH 1KCUL 3GMMB 3BRDA 2MKLC 2Y5TB 1A7NL 5IROC 1MREL 4XCCH 3V4UH 4W4NA 5C07B 4DCQA 4YXKH 2ATPB 2FECI 4FQJH 1OLLA 1XEDA 4D0BB 4JDZB 3H3PL 4NQDE 1F4XL 3ZE0E 1PQZB 4PRPA 4HDIB 3TIEB 1OP5K 4J8RB 3PXHA 5DEFB 1DLHA 1QBLH 3MUY1 2VLJB 3QG7L 3ESVF 2VZUA 5MERB 3E3QA 3V8CA 2NY5L 4MJID 5BQ7B 1PYWA 1MLCA 3RWCB 2CD0A 5CSZB 1CI5A 2DWDB 4PP1C 5I6XB 3PQYA 3PWUB 4EEEA 3NFSL 4YNYA 4UIKH 1G9EA 1UCBH 3DX9A 1BGXH 4PFEA 2A74B 2EEBA 5TQ0H 4ELKB 2N4IA 3J8F7 4HUWA 4MJ6A 1F90L 4LEOB 1T3FB 5DMYA 1QSZA 4MA3A 1F00I 5EU6D 5H94B 4Q2ZA 5D8JL 4Y4KD 4EZMA 5D2NA 4X9BA 3O0RH 4KDTA 4LQFL 1WT5A 3VI4F 4KJPD 5GS1A 3OB8A 3MO1B 4KKBD 1P7KB 4Y1AE 4WFHE 5DMIL 2NW3B 1T83C 5FYLD 1K6QH 1OW0C 4JO3H 4KKCC 1BVKA 1YJDL 3QRGH 3HN3A 1FHGA 4KHXL 2AV7A 4WI4A 4WENB 3UTQA 1MHEB 5C08A 1GC1L 2MMXA 2XN9D 1JHLL 2VLLB 5E8NA 5HYQA 2ZCLL 4KTDL 1LILA 5L88H 4FXGB 4C83B 3NIGE 3VFTB 5D7IB 3T4AA 2OL3A 1ACYH 2X1OA 3PWVA 4MNGB 3GHBL 3OV6A 3OZ9H 4K3JL 1B0RB 4XBGA 5J6GA 1OTUC 1IBGH 2GIYA 1ZS8A 4X7SH 1OLZA 5D1XA 3PQYE 3VXOB 3DARA 1KJVA 4F15B 4I2XE 1EO5A 1RUPL 3D18A 4ZTOH 1D3CA 1LQSR 4NFDA 3TBWA 1WZMA 3SE8H 2A6KB 1G6RA 4GG8B 4F7EA 4IHOB 4L4TE 5I1IH 4YO0B 4LLWA 3C60C 3O2DH 4QF1A 2QBWA 3QIBC 4HIJA 4HT1H 4U31A 2AV1A 2MHAA 4U1IB 1OARH 4GT7A 5DJYB 5DVLA 5DQ9B 3TA3C 3P30L 4GSDL 3CDGB 5EOQL 3S98A 1DBMH 2RB8A 4CKVX 3IRZA 3WFDL 2D4FA 5BRZD 4U7KA 2YPVH 1NANI 2D0HA 1HHJB 5HGBA 3TBYA 3HC4H 1Q9WB 2DMCA 5I1LB 2ZUWA 5ILTL 3IETB 1D7FA 3SO3B 1N5AB 2GSIB 5DMKA 3QEQB 5EO9A 3MCLH 3O2WL 4LCUA 1BIIB 1T89A 5C0FA 4WO4B 1HSAA 3CVHL 2VLKA 4OM1L 1MEXH 3OJDA 3KPLB 4OF5A 4Z7OE 1S7XA 2OXHA 5ITFB 4P2RD 1W8NA 4L3EB 1NCAH 2H26A 3QQNA 2YD8A 2BOBA 2YBRA 3KPSE 4NRXB 5FK9B 3WD5L 4QHKI 2FX7L 1G7HA 1YNKL 3GMRB 1OAYH 3UP1A 4RGNC 2CR6A 3WNNA 2ICWJ 4GBXB 3KYNB 5E08H 4XB7A 1BFVH 4G42A 1LEKA 1LP9B 1GGTA 5E2TH 5C0CA 5DZNA 5GGVY 5KVGH 4KMTL 5J06A 1RUKH 1BBDH 2AXJA 2FX9L 3KNBA 5JA8B 2Z92A 2DM3A 4EN3B 3VH8B 3FOMB 2OP4L 4LRIA 5DJDA 5GRUH 4M3KB 4G8GD 2VDNL 3IU3A 4Q6YA 3D39E 3QXVA 2A6JA 2WQRA 4U6YB 5FDYA 4TVPL 3RPKA 2CR3A 2VDQH 4ZAKD 1EJOH 1XF3B 2YSSB 3ES6B 3QPQD 5JZ7D 3HNTH 4FQXD 2ADJA 4LARH 5F3BB 1CICC 4YDLC 1BJMA 4LEXH 4BFEA 2F54D 3WNKA 3JV4A 3BGAA 2IAMD 3MRBB 5DT1L 1KPUB 1TTUA 3KXFA 1UH2A 4HPOL 4XHJC 4DAGL 1QFWM 5D7LB 4WI9A 1O7VA 4AIZA 1X5XA 4ODTH 4NO0D 2IEPA 4MNQD 2VLKE 2ZSVB 4R7DB 2Z8SA 3OX8B 2NY0D 5C0JB 3UTTD 1C12A 3P73A 5F1SA 2BFVH 1FO0H 4NJAH 4UMGA 4R0LB 4WWKD 5F9OL 4CNIA 5C6TL 4R9HA 3VG9B 3P9MB 4OCWH 1TDQA 1ONQA 1SVCP 5A2KH 3U4EA 1NUFA 3QPXL 1BVLA 5EN2A 4D3CL 5CWSA 5DURB 4OIIL 1IC7H 1OD9A 1NKRA 1QZ1A 3GMQA 4TQEH 1JCKA 5GGTA 1AGDA 3QNYB 4LSRL 4P3CH 1F5WA 4HIXL 4PJCE 2P5EB 3HE7D 2K7QA 2VITB 3VXUA 3QJHA 4UU9B 3HE6D 5C9JA 3CK0H 25C8H 1U41A 5FHAH 1NQBA 3HI5H 4HIHB 1KJ2L 3BYTA 3VMNA 1YA5A 1JPST 1NGPL 2UY6A 1U2HA 4MZ3A 1IAKB 1P7QD 4JPWH 1CN4A 4GW5A 1TNNA 2QADC 3GSUB 1KCKA 1GOGA 3L5JA 4X6EA 3D5OF 3VFGH 5I71B 4MS8A 1J1XH 4FFZL 1LMKA 2J8UF 2AEQH 7FABL 1N5YH 3VJ6A 4G8IA 1IGFH 5KVMC 4QXTA 1JPSL 2DD8H 1RFDH 4Y5XC 4XNYH 1EBPA 1TTFA 2H2PD 5IOPB 2BVQB 1ZHLA 1R3KA 4U6VL 3ZHLA 4CDGC 1QSFE 3IXAB 4ZO8A 5C6PB 1RZ7H 3F7RA 3IVKA 2PW2B 1LK3L 1F45A 1YECH 2PKDA 4WW2B 3ROLA 4DGVL 4QWWD 3LSOA 4OGXL 3MGOA 1TVHA 3Q1SL 4RAUA 1NBZA 2A6DB 3MJ8A 3RZCB 3IB4A 1SYVB 5I73C 3ZDXF 5C07D 1I1RA 4O9HH 4CN6A 4P23C 4LNRA 3INUH 2SEBB 4HH9B 3CLEH 5EIVA 3UJIL 2BK8A 5FUOH 1ZT7A 3AY4A 5EORH 2OSLA 3MX0A 2FH8A 5D2LE 2GCYB 3DI2B 3QIWA 2VLJD 3LN9A 4YDKH 3OR6A 2E9BA 3PWNA 4GRMA 3SE3A 1R3IL 2VNCA 3WUWB 5DK2B 4ZUSA 3PHQA 3T09A 1ZHBA 1A7OL 1NAMB 5AD0A 4JFEE 3WL9A 4LP5A 5ENWB 3MR9A 5EWIH 5F6IB 1U91A 1LO0L 4PJGA 4IM8A 5DRWA 2PTTB 5L2KA 2JTDA 1A0QH 3BZ4A 4NSKB 3BHBB 5CBAB 4K23L 4R6UA 1FZJB 3STLA 1WUNT 3HC0B 2BOCA 1HZHL 5T3XL 3HKFA 1I85C 3FO9B 4YPGB 5IVOA 2CJUH 1QFPA 4IS6B 2HTKC 1QLEL 4WTWA 3NACH 4NCC2 2R0KL 4U3XA 5I74B 3EZJB 4KGLA 3BDYH 1MHCB 3DRQA 4XNXH 3GNMH 3SOBL 5F1KC 3CDCA 5FYLL 3GMLA 4LU5H 1A6UH 4DKEH 1K4DB 3LB6C 1T0PB 4S2SA 4X7TA 3EYOA 5ITBH 2O93L 1FDLH 3C87A 3MV11 4LVNC 4EUPB 4KMQA 1ADQA 1UB5B 2W92A 4Q6IC 1UACL 4IOSD 2Z31D 1IQWL 1UQSA 1Z9OA 4XNUL 4K7PY 1IC1A 3EOBB 3RVTC 3IDGA 1LQVA 5E99H 1NGYB 4RDQF 2Q86A 5EO1B 4PJ8C 4AT6A 2Y07L 2HT2C 3IF1B 2APBA 3H42L 3BP7B 1ZKAA 2G5BA 3H6JA 1FH5L 6FABH 4PRNB 4D8PA 3ARDB 4KQ4H 2G5RA 2NLJB 4IRZH 1AO7B 1G7JB 1T0NA 1FP5A 5C0AE 2QL1A 5HVHC 4Q0XH 2BMKA 1UCTA 4X8JB 5AYQA 1MPAH 1MI5B 1MRFL 3BGMA 1B2WH 5C7XL 5IV2A 2F58L 4NDMA 2VAJA 5DD0H 3ZE2E 3M17B 3QO0A 2V7NB 4XP5L 1CE6A 1E6OL 1E4KA 4OI8A 1TTGA 3G6AB 3M1BA 1AE6H 5FO7B 4M7ZC 2ENSA 3VFUA 5FGRA 3C8HA 3NCFB 3WSQH 3MOAH 3Q6FB 5GGQH 5JW5B 3ZYJA 3C5JB 1MVUA 1CFQA 1UA6L 4Z7UA 4WO4D 5ICZA 3LAFA 3VXSA 2EXYD 5BVJA 2E7MA 2FLBT 5JUEH 2IANB 3L5WB 1X4ZA 4L3ED 4MXWH 1X5ZA 2NXYB 5ETUB 2XG4A 4JDVB 4IMLA 3FCTA 1GPOL 1P4IL 4LHJB 3UYRL 4P9ML 3BE1L 4XXDA 5J11C 4GBXD 4KVCL 4PY7A 4ZPVB 2FEEI 3ULUC 2H8PB 3OXRA 4XNQB 2EIDA 4XNMB 1KTDA 4U3CA 1NJ9B 1WWAX 4GAFB 4MXQC 4EN3D 3T3MF 2HVKA 1XFPA 2LAAA 3V6FB 1HE7A 1MCSA 4YQXL 1ZXQA 5K9KA 2B5IC 4XGZA 4CU8A 5LKNA 3BP5A 1EO8H 5SWSA 1DUYA 5DQJA 1HHKA 1T7ZA 5EIIB 5I2IA 1A7PL 1G0DA 4LCCB 4BK4A 3TT1L 1M71B 1MFEL 2HFGL 5C0DA 4MWFA 2J6EL 2BNUB 4PS4L 4TNVF 3MA9H 3DGCR 2H41A 4ODBD 2DJSA 1HOCA 2W9EH 3RWFA 1BMGA 2RIKA 2P8MA 1QNZL 5IGXL 3U83A 5IW6B 3S8WA 3MRPA 4O5LH 5CIPB 4LVEA 3QHFH 1AXSA 1OGTB 4ZS6D 3ZDYF 3I75A 1PG7W 4Z7UE 1A5FL 4ZPTB 4PTTA 4FOMA 1H9VA 4UAOB 3AU1A 2IGFH 3OKLA 1S9WA 5IB4A 4OF0A 3WKMH 1F6LL 4PP2A 3L5XH 4ZUWB 4YAQB 3NPSC 5FOJA 3U7WH 4S0UC 5EOTA 4N5ED 3VFVB 5JHDB 5DURD 5BZDB 3DROB 2ICCA 3BMVA 2MOVA 3NIFF 5ADPL 3W0WB 4XPBH 1A4JA 2YRLA 3VRIB 4KZEL 5CP7A 5F1OB 2P5ED 3F5WB 4LQ1A 1AKJB 4HD9A 3HRPA 5CHNA 4Y1AB 4GKSA 2HFEB 1RZFH 4RRPA 5DI8A 4YHMH 3CSBA 5I1HH 3S96A 2NZ9C 5BMFH 1BIHA 5ID1A 1U93A 1KUMA 1CL7H 4LSSH 4CN1A 4DCQB 2OJEA 5FDWB 3WFZA 3KGRA 2F15A 5FGCE 4H0HB 4AYFA 1DN0A 3I6LE 4PRPB 1NMAH 1N6VA 4PY8J 4OSUL 5I66A 3BXNA 3DGGA 1UB6A 4RMSA 1DLHB 4RZCA 2C3VA 2I25N 1I1AA 1Z3GL 5I18L 4YBQC 2ITCA 4J2XA 1LHZA 1PYWB 1MLCB 2R29L 4MNHB 3VXRA 1MIMH 4PB0H 1S9VA 1WCBA 1TQBB 3PQYB 2W0KA 4YNYB 3X13B 2FGWL 5FUCC 4LFHG 4PJFF 3PL6C 3DX9B 4WUKL 3IDNA 4MJ6B 4HUWB 4IRSA 2GW5A 5FYKE 5IT2L 4MA3B 5E56A 2DBLH 4NZDA 4AEIH 3ULVC 2GEEA 3AMKA 3D48R 4Q2ZB 3RZCD 3X14A 5T5NF 5D2NB 3QWRD 3V95A 3RVWD 5D96B 1EFQA 4P2OC 3I9GH 1C16A 5GS1B 4OGAC 2DL9A 5DFWH 4X80L 4UV7L 1MCWW 4X6DF 5F21B 1ZLUH 1UEMA 4KKNA 1XCQB 2X89D 1BVKB 2ARWA 4MCYA 3DHJA 4PBVC 2DI9A 1JNLL 3UTQB 3U4BL 5E8NB 5HYQB 3KPSB 5I19L 4UOW1 3RVXC 1NFKA 3DVFA 3AS2A 3WIHH 3K8LA 1EMTH 1R5VA 1DLFL 1A1MA 3T4AB 2OL3B 3P0VL 1TVBA 2CUIA 3O6FA 3PWVB 2DOCA 1W8OA 4MQSB 3GKZA 1A6WH 4XVTL 4P99A 5KBNC 4LNVA 4XBGB 5J6GB 5EU7E 3BFOA 4F7MA 3OF6D 1VGEH 4P9HC 3D85A 1ZS8B 1CLOL 3VXRE 2DQGH 5D1XB 3QXTA 2APFA 1KJVB 3MGTA 1Q0XH 3D18B 2Z8WC 3TBWB 3IU4L 4PJBF 3D39B 1G6RB 1IGIH 3QYCA 4F7EB 2DQUL 1KEML 2BRRH 2G60H 4LSPH 4LLWB 4Z7WF 4QF1B 4HIJB 2AV1B 2MHAB 5EUOF 2AQ2A 1S7RA 1P9MA 3B9AA 3EJYD 3FN9A 5FA4A 5ALCL 3VWJC 4AQOA 5ISZA 5DUMH 5GS0D 3QB7C 3TBYB 5FM4A 4RA3A 4PJDE 3SJVD 5TQ2H 1WEJH 4NUGH 3REWB 4OZFB 4JANA 1S5IH 5EO9B 5DMKB 4GRWE 4L29A 4LCUB 4W6XB 3N9GH 4NHUA 5F89A 1R3JA 5C0FB 1KEGL 1HSAB 3P4NA 2VLKB 5F96H 3OJDB 3E1F1 1S7XB 3SDXA 3X11A 1YUHA 4P59H 3ARDD 4Z7WA 5GISL 1VFAA 3OKOA 2XKSA 5E00A 5EB9A 1G7HB 3ZSTA 4JRWA 2BC4B 3MXVL 3FAXA 4WEMB 3UO1H 2IMNA 1MI5D 4MA7L 3UYPA 2F53A 3Q5TA 4KK9D 1LEKB 3QDAA 4G42B 2ENYA 2DJUA 4K7PX 1HWGB 5DZOA 3W82A 3QFJE 3QHTC 5CKAA 5J9PA 3ARBC 1MY7A 2Z92B 5F7NC 3S34H 2AQ3A 2ZJSL 4YR6A 3C08H 2X42A 4JPVH 1KULA 3ZKQD 1U3HC 3RBGA 4HWBH 4OBSA 4P0DA 5SX5H 3IU3B 1XF5A 2A6JB 5C09E 2YKLH 5DSCB 5HHVH 4AG4L 2QQKH 3U46B 5D71H 3U0PA 1ITCA 3LRGA 3VGAC 2ADGA 4HUXA 1LO2L 2BY3A 5ISZE 2IAND 1MFCL 2NY6B 3JV4B 1EBAA 3K2UH 1Z6JT 3I2CL 3NBNA 1MRCL 1OPGL 1JK8A 2EEDA 3CFEA 3IFOA 1FZKA 1ZK9A 4C54A 1OTSD 1Z5LA 3L3GA 3S88L 4DUVA 4NHUE 3QI9D 1QFWI 4F37K 5DLML 4HF5H 1FV1A 2AERT 3SDXE 1C12B 3P73B 2UWEF 1DBJH 1N0XL 3BZDA 1CU4H 4OTXH 4NN5B 4Y0GA 1ZHNA 4CNIB 5D7SH 1WAAA 3O41A 4JO2H 4TUOA 1ONQB 3MACH 3U4EB 1HWHB 1LO3H 1OP3K 4DKAA 4ZNEE 4KRPB 4OM0L 1BVLB 5EN2B 3IS0X 5CWSB 4MAUL 4H1LA 1A7QL 1ZE3C 5DJXA 3GMQB 5D7JC 2W9DH 3G6DH 1AGDB 1LE5A 1IGMH 1RZKC 3GDBA 1IKFL 5F71A 3IKKA 1CE1H 4XC1L 3VXUB 3QJHB 1JRHI 5C9JB 3OL2A 4QHUA 1PLGL 4J4PC 4HQQL 4YLQT 2OK0H 2ED8A 2VR9A 5J13B 2Z8RA 4FA8A 4OQTL 5KW9L 2UWEA 3TCXA 5HHNA 5HGGS 1EX0A 4G5ZL 3RBSA 2ZKHL 4X6EB 4MVBA 2JE8A 1SEQH 3HS0A 5DUBA 3BZFA 5EULV 4G8IB 4PJ7F 3VJ6B 3ULVH 4QXTB 5JLZB 4F80A 3L95A 4I18B 2JB5H 3DYOA 1MRDL 1IC4L 3MQIA 2D7TL 4O4YH 1ZHLB 1R3KB 5D6DA 5JHDD 2GAZB 3CGTA 3ZLQC 4XVJL 3W0WD 1NL0H 5GZNC 2R23A 3OKEA 3IVKB 3RPIA 3MV8A 4JM4L 4NQCE 3C5ZA 1AKJD 2FJHA 3ROLB 3F12B 2DQFB 1MQKH 4KTEH 4NRZA 4JB9H 4Y1AD 3LSOB 4XPHH 2BVEA 2NNAB 3MGOB 1WAAE 1OHQA 1TVHB 3EO1A 4Z7VF 1JZ6A 1NBZB 5DD3H 2W65A 1AFVL 3TFKC 1HHIA 2XICA 3MJ8B 4R3SA 2LU3A 3NCYP 5DVMA 5AZEH 4JO1L 1I7TA 1Z9LA 1F6AA 1X44A 3GRWH 2JF1A 2GK0A 4LNRB 5F1IA 1LDSA 2VXSH 2EE2A 4KJQC 3QDJD 4LF3A 1QP1A 4TOYL 4MDJA 1GIGL 1PG7H 4PRPD 1ZT7B 5JW3L 2OSLB 1YEEL 2WUCL 4QRPA 1QR1A 4OBRA 1YDPA 4P9HH 5D5MA 3VDAA 2Y7QA 5LGJA 3QXUA 4AK1A 4M5ZL 3MLPA 3D0VA 3CMGA 4J3WA 3JV6B 3OR6B 3PWNB 4LSDA 1KPVA 4GRMB 1QPPA 35C8L 1X5KA 3VU2A 3PHQB 4UT9L 3PQYD 4MCZA 1ZHBB 5AD0B 1F3JB 1NAKL 3MROA 2PN5A 3AROA 1Z0MA 5C0AB 2FCBA 3WL9B 5L7XH 1YEFL 3MR9B 3VD4A 3WJLC 1U91B 1EUUA 2AJSL 3SQBA 2DJ4A 1F2XK 1V5JA 4PJGB 3F58H 5L9DH 5L2KB 3ZKXB 3WS6C 3BZ4B 1JGUL 2DTML 5BV7L 1LE9A 5J89A 3ZE0F 3LZFL 3MA7B 3STLB 1RSFA 2VZVA 2BOCB 1XT5A 2V17L 3MBEA 1RIVL 3VA2C 2XXCB 1X4YA 4P5TA 1I3RB 1AQKH 3MV8E 4QT5A 3DNKA 2E7LC 1JN6A 2DICA 5E4EB 5IW3A 1PSKH 4HJ0C 1T5WA 4P57B 1A6ZA 2MSPA 4CMMA 4X5WB 1ES0A 3DRQB 3U48A 3ILQC 3ZSSA 1YN6A 4EVNA 4BK5A 3FQXA 3GMLB 1Y18A 4NN7B 1QYGH 3CH1A 2B2XL 4S2SB 4X7TB 2X5PA 3EYOB 3WEXA 3ZT7A 4EKXA 5C08D 3AAZB 4M4RA 3EFDL 4NKOA 4O2CB 5HI3C 4TVSa 3RL1B 1NAML 1UG9A 4NNXA 1MCIA 3T0EA 1K85A 3NCEB 4QRPE 4GS7C 3VGGA 4YHLH 2VERN 2HKFH 3IDGB 5D5ME 1CGSL 2O5YL 2VRAA 3TBSA 5CLTA 2AGJL 2Q86B 3EDJA 4AT6B 2G5BB 5CJBA 3EDEA 2WUBL 2GQHA 5D1XD 4DN3H 3SEPA 1T0NB 5INCA 4U7SA 2NY2C 1A6PA 2FATL 2BMKB 2LU7A 1CYGA 2AJYL 2R4SL 2WW8A 1MCHA 1A6VH 5F8RC 4U2ZA 4ELMA 3BGMB 5IV2B 4OLXL 3VGDA 1HDMA 4M7KL 4MAYA 4QNPE 4IIQC 2EXWD 3QO0B 5D72L 3I50L 1CE6B 4BM7A 1NUDA 1BX2B 3M1BB 5DHVA 5CGTA 5GHWH 5GS0L 3VFUB 5MHSE 5KVFH 2QQQA 1G9MH 4URTB 2DIAA 4PJEE 1MVUB 3IDXL 4M48H 1CFQB 3ZL4H 1NSNL 4Z7UB 5ICZB 3RKPA 2VLKD 2P49B 5F7YC 3ESUF 5BVJB 1F4WH 5HYFA 1OCWL 4ETYA 3H3BC 3ZYZA 1FNEA 3VFMA 3OB0H 4QKXB 2P5WA 4IMLB 3D0LA 3FCTB 2XQBH 2Q8AH 1RZKH 1ZA3A 3DSNA 2IALA 2IPTL 4I0CC 1V3KA 2XIDA 1T66C 3BKJH 4PY7B 4NZRH 1BD2A 3OXRB 5C0CD 3IAPA 2HRPH 1BWWA 1KTDB 4K9EC 1L7IL 3KG5A 2QQNL 3OJMB 4OLZH 4DFIA 1VESA 2HVKB 1HHHA 4KKAD 4YDVA 3D9AL 1SYSA 2Q6WA 3LDBB 4XAKE 5K9KB 4Z7OF 2VUYA 4XGZB 3CNKA 4PLOB 3RGVC 3BP5B 3V4PH 5DFTA 1DUYB 5DQJB 1HHKB 1H5BA 5I2IB 4RFNC 1FCGA 5FGCB 2A0LD 1AR1C 4HS6A 5GSRA 5FUZL 5C0DB 2E27H 4GMSH 1FFPA 4MWFB 1MLBA 3UBXI 4N9OB 2OZ4H 1F13A 5D6CA 1D6VL 2NY6D 4YUEH 3S36L 1HOCB 3RWFB 3KXFD 3JTSA 3MRPB 5JLZA 1U8OA 5B39A 3SBWC 5MEQA 1J8HA 1AXSB 3JVGC 1A22B 1X7QA 2C26A 3I75B 4TSAL 1UWGL 4GAGL 3RNQA 4PTTB 3RVVD 4MA1B 4P5MA 1YEHL 3MMEA 1CR9H 2B8OT 1S9WB 2XY1A 3BPLB 4RBPH 4ZS7L 1DBBH 4UV4L 4NQTA 4PP2B 5FCUL 1Q9LA 3UTPD 3MRHA 4J3OC 5EOTB 4KRPD 1PJ9A 2BSRA 5KSAC 3QH3A 4PG2A 1I3GH 1NCDL 1A4JB 4PP8C 5CP7B 1BD2E 1UENA 3PWPA 2Q76A 4OD2A 3BGFC 5ERWB 3VXUD 4APQA 4YBLC 5HXMA 1E4XH 4GKSB 1NLDL 4YK4C 4UDTB 3JV5A 2W9LA 3B6SA 5DI8B 2WSKA 2DQTH 1ZLVH 4LPWA 3S96B 4PLKC 4EXPX 3QUYC 2HLFC 2X4NA 5ID1B 3IDYB 4PRIA 4I9WE 3N1PC 2IJ0C 5FGSA 3SGDH 3G9AB 3O8XC 2OJEB 2H1PH 3P4OA 4DW2L 5D7KD 1DN0B 5E9DA 2P24A 4Q9RL 3O3UN 4MS8D 3WXVL 5I66B 2H45A 3JV0A 4NKIH 3BXNB 3DGGB 4K94L 2R2HA 1UB6B 5HTSA 5TGBA 4D9QE 4RZCB 2C3VB 1Q0YH 1I1AB 2ITCB 4L9LC 4PJCF 2IPUK 2EH7H 2X4TA 3DX6A 1MCOH 3VXRB 4HGWA 4POZC 1S9VB 1WCBB 4XP1L 1X5HA 2YN5A 5I30H 5IESH 3T1WA 4PD4J 4PJAE 1L9NA 1CCZA 5E2WL 4MA8L 3IDNB 3TWCL 3LS5L 1REIA 1FN4A