4LCCC

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
384
structure length
341
Chain Sequence
IQRPPKIQVYSRHPPNYLNCYVYGFHPPQIEIDLLKIKSEQSDLSFSKDWSFYLLSHATPNSKDQYSCRVKHVTLEQPRIVKWDRTHSLRYFRLGISEIPEFISAGYVDSHPITMYNSVSQLKEPRALWMEENLAPDHWERYTQLLRGWQQMFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTLSWMAMDNVADIIRRVWEANQHELLYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHKTTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELGDIYSCHVEHGGVHMVLQGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
total genus 80
structure length 341
sequence length 384
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccC03
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lccC02
2NXZD 5C0ND 5ITBH 5J13B 1EZVY 5I1LA 2YA1A 3P9MB 4JJHA 5DJDA 1FE8H 1QA9B 1A4JB 1F90L 2YN5A 4J3XA 2F53A 2OTWB 5T1LA 1M7DA 3OGOE 4KY1H 1NCWH 2ZOLA 1FFQA 2AJ3B 4JFEA 2EIBA 5T1DH 1K4DB 4LLWA 1FL6B 1L8JA 2B8OT 3SDXA 1G7MA 4XNUH 3R1GL 4KHXH 3RTQC 1AI1L 3BP7A 4XCCH 3UJTL 5GS1B 4OAWA 1S9YB 4JQXA 4NUGH 2GEEA 4WW2F 2FECI 3MV7A 3RVWC 2J1KA 3S34H 3JV4B 1P4BH 1OPGH 3ECBB 1X5AA 4CBPA 1GXEA 1UXWA 4LCWA 3H9YA 5I1CH 2WW8A 5EZLB 4ERSL 2ARJA 4KU1A 3JVGA 5F9OL 1UYWH 2R69H 1I7ZA 5I0ZA 2OZ4H 1OD7A 4U1SB 2AK4A 4M00A 4F57H 3B6SB 1RZ7L 4CVUA 1F6FB 4W6YB 3VFMB 3ARPA 1KIPA 3FCTA 1QNZH 2H6PA 1MH5B 3QA3B 4QXGL 4PJEA 2AJVH 2LU7A 3I75A 1ETZB 3WDIA 4XP5L 4PRHD 2Q86B 3UTTD 43C9B 4HH8A 5EBMA 3S35H 2V17H 3Q0HA 2FBOJ 2HWZH 2ICWJ 1JGVL 5T5NG 4APQD 4RZCA 3WLWD 1CG9B 4KTYA 2LAGB 1WEJL 1T7YA 1GGIL 3GSOA 1FP5A 3SE4A 3V8OA 5C0CA 4FZEL 1T1WB 1DDHA 4HDIB 5LCVH 2GSIB 3K2MC 2MCPL 2NTSP 4KKLD 2ZNWA 1JE6A 5GRJH 3FJTA 1AD0A 2FLRT 5T5NF 1MVFA 1L7TL 1EGJA 2PTVA 4DW2L 5BRZB 1CLYL 2ESVB 2Y07L 2DMCA 3FOMB 4PJAB 3QT2A 1B6DA 4U6YB 4YDJB 1NCCL 2ICCA 4NM4H 3HCVB 2B2XH 1DSFL 1CGUA 2WBJB 3S8WA 1AO7E 3UBXA 5TDOB 4YEEA 1I1AB 1V3KA 4K7PH 5J4MA 3NBNA 2Y25A 4MQSB 4FQIH 5GSRB 3TO4B 1BLNB 4MZ2A 5H94A 3QG7L 5JHLL 5DMIH 2WP3T 1GZPA 3HC4L 3P77A 3U36B 3OAYH 3TCLB 1ZHLB 4NQXA 2AKRA 5FM8A 1S9WB 1ZSDB 4LDOB 5LQBL 4XPBL 3WIHH 1I8MA 3C2AL 2ERJB 2XPGB 1G7JA 1I9RH 1EFXB 4KK8D 1FGVL 4B50A 2F54E 3LEXB 3DV4A 4ALAL 2YUVA 1ADQA 1U93B 3TBWA 3CVIL 1RFDL 5ETUB 2NY0D 2CK2A 1ZHNA 4YBQC 5IR1B 4NZUL 4TVPD 1KG0B 2FIRT 5DC9B 5EZOH 2AEQL 2HVKA 4DQOH 5DA4A 5FA3A 5C07D 3QUYB 4PY7B 4EI6A 2DLHA 5F71A 1YUHB 3BPLC 3GI8L 1ZV5A 4ISVA 2R0WL 3UYRL 1HINH 2H2SD 3RY4A 2DRUA 2NXYB 3HN3A 1TNNA 3HR6A 1G0YR 2QR0B 3L5IA 4G80B 5J6HB 4X9HA 5HYJA 3MRNA 4YH6A 1A7RL 2GT9A 2NQCA 3RTQA 4A2LA 1GCFA 1N7MH 2XA3A 3OZ9L 4M1GH 4P46D 5KJRL 4M4PA 1NBVH 4KPHL 4QYOB 4GKSB 4PRBB 3F62A 1UVQB 2EZ0D 4PJ8D 5F7DA 2OBGA 1QTYT 1SHMA 4GRWH 2OL3H 2W92A 3F12B 1R3LA 1IM3A 3RGVC 3LRGA 4MD0A 5T1KD 3T8XA 4OFPA 3N1QC 1R0AH 4ODVL 4HZLB 2K7PA 4RFEA 2E8YA 4WCYL 7FABH 5I66B 1EX0A 1JWSB 1VEOA 5FUCE 3HZKA 4HV8A 5HDBE 3QDGA 1IGIL 2JB6B 1JGDB 1EJ6A 1RURH 1AY1H 1JF5A 1KC5L 4UV4L 3VH8A 2KH2B 1N8ZA 4ZODA 4XNXH 2GSGA 4TVPH 5SX5K 4FQ2H 2AJUH 1YJDH 5EFIA 4MNQE 5TF1H 5J12B 3KYMA 5HHNA 3FTGB 2R4RH 4RISL 5FYLL 1F45A 3STZA 2FEEL 2XZQH 3ROOA 2JCCB 1CK0L 4GAJL 2D31B 2OMNA 3NPSB 3SE8H 3TGXA 5ESQA 1U3JA 1UZ8A 2X4TB 4UUJB 4DZBB 4HAGA 5DQJB 3B8YA 3NABL 3QUZD 3JTTA 1II4E 2VXTL 2EKSA 3OKDB 4G6KL 4PRID 5D6CA 3PNWB 5I1EH 3MGTB 4HGWA 3C5ZC 1MWAA 1YQVH 3DVNB 5DRNA 2BNRD 5T3ZE 2OJEA 1NDMB 3FO2B 3ULUL 3WFHB 3KPTA 3SKNA 2DQUH 4M1CD 3RVTD 4WWKC 3C5SB 4LCCC 3IGAA 1UXSA 4PG9A 3ZDXE 3OHXB 2W9DL 4CADB 1MJ7H 2F53D 2X4SB 4EDXA 5I8OL 1OP5K 3OXRB 4JFED 3QPXH 1S7VA 4U7KA 4GBXD 1FORL 2GUOB 5F8RC 1R3JA 1Q72H 2C1OA 3OG4B 4HWEL 1WBXB 4NQCD 5D70L 4K3HA 2DIJA 2YHGA 5DJXA 4XZUB 4PJIA 3P11H 1F4XL 4EIZC 5CWSA 1J8HE 1QRNE 4WEBH 2NZ9C 3S98A 3L5XL 4JJ5A 4LSTH 4YDIH 1A7QH 2AQ1A 2OLDA 2VOTA 1JGUH 4CMHB 1FO0B 3X17A 5E00B 2O93L 2CH8A 2LQRA 3KPRD 5L88L 4TTDC 5F7MC 1NLBL 3STLB 3FN9A 3MNWB 4NZDA 2CLZA 1HZHL 2X1OA 2NY7H 4NM8L 5CJ5A 5F7KC 3M45A 4X6CB 5EDXA 1SJEA 3BWAB 3ESVF 4YZFE 1MPAL 3H7BB 3PIQA 3AXLB 3B2UD 4M3KB 2CGRL 5IQ9B 3CIQA 4R4FH 3LPFA 3PP3H 5F88A 1OSZA 2ZSWA 3V4VL 3NCYS 4WRLA 4M03A 1YMMA 1KB5L 5IB5A 3QXWA 5D72H 3EYUH 2VLRD 3BKJH 3U82B 1X5YA 3MRQA 4XX1E 3RGVA 4OF6A 4Y4FB 3BP6B 2MPAL 2I9TB 4G8FB 2YD1A 1DBBL 4JFHD 1M71A 2EDQA 2P46B 2C3HA 3OKLA 1CT8A 1GOGA 3NN8B 3PJSA 1P4IH 4KK5D 3HZYA 3S5LG 1E4KC 3DMMC 3X13B 1A1NB 4LOUC 4QHMB 5H35B 5ISZB 3HRPA 2KUTA 3CFKB 5EU4B 3V5KB 2GJZA 3NA4A 3WSQL 2OK0H 2R0ZH 5B39A 1KLGA 1LDSA 1UKTA 2APXA 4JY5L 2IMMA 1JNHA 5IOPB 3VFRA 5MENE 2VDLL 1PJ9A 2HYMA 1RZIA 1T3FA 3RX5A 1H15B 1S9VA 5I15H 4FQCL 4ZUVB 1QSEE 2P5WE 2CKBA 2VDOL 1J5OH 4PR5A 2Z92B 4TPRL 3BN9C 1CICD 1D9KB 2ZOKB 1JNLL 3T0WA 3CD4A 4GLRH 1PX4A 1MFEH 1EHAA 3TVMD 5CD3B 3QDJA 4P57B 3MSPA 4JRXD 4LVOC 1BVLB 3MRDA 5CJXC 4AQ1B 1JGLL 2VC2L 1QSFD 2VLJB 4PS4H 1LP9F 5DJ6A 4ZFGH 4EQ2A 5EIQA 1FVCA 3C5ZA 1OAXH 3MXVL 4GKOA 4Z76A 2HMIC 1ACYH 4PJ5B 1P6AB 3CLFL 4S0SD 2DL9A 5DWUL 1S7UB 5JW3L 1PDKA 4WWKA 4LCCA 1E6OL 3D48R 4RMRA 5E2TH 4POZD 5CGTA 1YEGL 3GI9H 3QFDA 2CIKA 2XG5A 4L9LC 1VFBA 1YEKH 1GGTA 4X5XB 1V8HA 2XQBL 1ERNA 1EGJH 3GMQB 5F7NC 5FHAL 5H37G 4PRNB 4D9LL 4DGIL 4TUOB 5F96L 1YYML 1Y6MR 3MA9H 4FFWD 5EU6A 5C0FB 1KTDA 2PO6D 4JM4L 3DTXB 4XCEA 5DJ0A 2HN7A 5D7LD 1C5CH 1WT5C 3R0MA 1OQOA 4XMKL 3A0OA 5FFLA 5E1HB 3D39D 4YZFF 3FT2B 3MRJA 1EJOH 5I1AA 3K1DA 1CTNA 2P43B 1JWUA 2EEDA 5CJOH 3P4NB 2H26A 4PJXA 4DGYH 4M7JL 3P0GB 3P4LA 3BUTA 1YPZF 1FPTL 1ADQH 1JUFB 3PWPD 1AFVH 1ND0B 1PLGH 3HE6C 2P5ED 1Z3GH 3VGDA 4O58H 4WHYH 4PLNC 2WY3A 1CLCA 3U9PL 1MFBL 1XGRB 4WI3A 4Y5XC 5C0EB 5DD3H 4LPVA 2EH7L 2H8PB 4POYA 5B8CC 5IBUB 3UAJD 2A38A 3O6KH 3QFJE 1I9JL 4LSVL 4NRXB 4D9RD 4Y4KB 3A6BL 1MHHA 1SJHA 4MSWA 5HYQB 5B38G 1MY5A 4YGVA 1PG7L 2VZOA 2FO1A 5JDSB 1BQHB 1UB5B 4NC1C 3WKML 3EYQD 2MFNA 3PWJB 1C12A 5K9KA 2WUBH 4LHUA 1U58A 3MO1A 1G7HB 1IQWH 2QQKL 4JZNA 2G2RB 4M7LL 1DUYB 1BJ1H 4M48L 4X7SL 2MNUA 2OR9L 1F11B 1NCAL 1BZ7A 4UOW1 1S7SB 3LV3A 1E4KA 3DMMA 3G5ZA 3VWKB 1Q9OB 2BP3A 1CE1L 3ARBD 4I9WD 4IRJB 4KRLB 3FFCB 3RDTD 4FQJL 2WINA 1G7LA 3U6RA 3BO8B 3OMZA 2JB5L 2FECL 1QQDB 2DBJA 3OL2A 2H2PC 4ZS6D 2DQGH 2HFEB 1I3GL 4ZQKB 3GSVB 4M7KL 3OV6A 5C6TH 1MI5E 2XTJC 3IB4A 1RU9L 3RPIA 3MRFA 4JM2F 1LE9B 1MJ8L 2Q76B 4Y16C 1QKZL 5CP3A 4JZOA 4JG0L 4Y19B 1A7OH 2FX8L 3EFDL 1PBYA 4K23H 2HLAA 4H1LG 5C71A 2YEZA 3MJ9A 2J12B 2Y72A 5AG9A 3CSYA 2QQLL 2ADIB 4R3SA 5ILTL 1F4YL 3HAEG 1ZANL 4QRRA 1JZ2A 5CJXA 5C09A 3I02A 3QG6A 2EYTB 3CDYA 2BSTA 5ITFB 4PREB 3CZFB 5I8KH 2BFVL 2ZUYA 1V7NH 4XBGB 5EC1B 4JQIL 1BECA 5EC2A 4N0CD 3AMLA 4KHTH 5LAXB 2L7UA 4BZ1L 4EN3B 5HBBA 4WGVB 5ELIA 1T22B 3QEQD 4LPYA 2A74B 5F3HA 3SGDH 4L9LA 1NUDA 1HKLL 1I3UA 3CCHB 2FB4H 3JTSA 3VI4F 4RGMC 2AI0H 4UINL 1KTLB 3T1FA 4YBLB 5F1IA 3MJ7A 3TFKC 3BD3A 3UPAA 3T0VA 4CVZB 3B2VL 3SQBA 5E8DH 4G9FA 1MWAH 3RKPA 3NIDF 2R1XB 3TV3L 1WT5A 1RUPH 5EIIA 1FJ1B 2H1PH 3HE7B 4YQXH 4BFIB 4BFBD 2VSDA 1WFTA 2B0SL 3EO9H 3TZVC 4UTBL 1OARL 5FB8A 1CIDA 4RGOL 5AYUH 1N6QL 2GCYA 3C8DA 3QIUC 3PWUB 1KNOA 2YD7A 5L8LB 4M62H 2LV4A 5J9PA 4PJGB 3Q6GL 4ONHA 3O3BA 4Z6AT 2BNQD 1I8IB 4HCRA 5C2BH 1OGTA 1CE6A 5HVWA 3EJYD 3QHFL 5IMKA 4L8CA 3QO0B 2JKXA 3FO9B 3RAJL 3HE6A 3CXHJ 5DK2B 3VE0B 1HNGA 4Y5XA 4M61B 3O6LH 5B3NA 3F7PC 4UDUA 2W07A 3IDXH 3DGGB 5LBSH 2X4PB 3D18A 3REVA 4NWTL 5EBLA 5B8CA 4KRPB 1R3HA 2IANE 3BWUC 1MRFH 3KDMB 2G9HA 5I1HL 3J8F7 4ELMA 5JHDD 1DZBA 4X0KA 4LNVA 2IH3A 3F65A 2ZUQB 3ULVD 4QOKB 4LEXH 1TVHA 2QLVB 4GAGL 1KFAH 3L3GB 1TZIB 3MRRA 4IRSD 4DN4L 1DVFD 2D7PA 4QF1A 5L2KD 5GRUH 1NBZA 2R2HB 1BEYH 1A14H 3IRZA 3LQZB 1FO0L 1WTGT 2XXCB 3UTSD 2NY2D 2CUMA 2Q8AL 3QXAB 4D0DA 4MYWB 5ACZA 1MCCA 2Q7YA 5SWSD 3D0LA 3LKQB 5FGCB 1LK3L 3VXMD 2ZUXA 3FB7A 2V5RA 1NDGB 2NX5A 2F5BH 4UT7L 4WNQA 1A02N 4HPOH 1CGTA 1GOFA 4ZXBD 4M93B 1BD2A 5CP7B 4Y16A 4QWWD 2LU4A 5ESVA 4FQXC 5A43C 4TNWF 1W0VB 5EU5B 5IGXH 4QTIL 5IW1A 4YO0A 3V52L 4QRPE 3GMLA 4QHKI 1CGXA 3O2VL 2NY4D 4MQXC 4HJ0D 5DA0B 2V7HB 3QEUA 1A3RH 5DYOB 1CFTA 4X5LA 1P7KB 4GXUM 2CRMA 2ENYA 2VH5L 5AZEH 4HWUA 4O2FB 5DI8A 1G7PA 4YX2H 3BGMA 3QEGH 1ZLUH 2Z91A 5T5FL 4WFFE 4Q9QL 3MLXL 1QO3A 2A9NH 2CKBH 2CUHA 2BC4A 3GIZH 3LD8C 4U0QB 3DUUA 2BZDA 2C4FU 1NGPH 1UADC 1JN6B 3HI5H 4H5SA 4OCXH 4Z78A 3K0WA 3WE6A 2X4UA 1AHWB 2A6JA 3ARDC 5IUSA 1IEAB 5F21B 3TFKA 4X9GA 5C08B 3PHOA 3QQ9D 4O02H 3V6ZA 4F7EB 2O26U 1C1EL 1KT2A 2ED8A 4OCMC 1GVIA 4X6DE 4HX1A 4QXWA 2P24B 4GKNB 4L8SB 4JN2B 1G1CA 1CCZA 1IILE 3UDWC 1TENA 3BIBX 3NA9L 1J0HA 1NCBH 3FL7A 2NLJA 3ULUC 3QNZB 3MRIA 2QSTA 4YHMH 3W0WE 3QIUA 3NTCH 4YEFA 2I5YL 3FHAA 5E8OB 2RCSL 1T7WA 2Z31B 2X4NB 1CXHA 3I2CL 5SWQA 2FHFA 2CXKA 3ULVL 4NKIL 3BP5A 3R0NA 4UTAL 3I6LD 1IZKA 2GFBA 3GGWA 3VG0H 4LLUA 4EDWL 3ZSSA 4UIKH 4R4BA 2BY3A 5ANMA 2HG5B 4F2MA 4P5MB 3O4LD 2J5LC 4UT6L 1MREL 2VLMD 5F93C 2BHYA 3T2NL 3DHJA 4Y5VB 5CCKH 1I3VA 4P4RB 2Y7QB 3M17B 1S7QA 3Q2CA 4NBZB 5F89A 4HEME 1LD9A 1OTTD 4LMQI 4EUPG 1CIUA 2V2WA 2Y5EA 2ADJA 4MAUH 3CPLB 3F7QA 3HNSH 1GGBL 3MUZ1 12E8H 2JIXA 5IVZA 3SGJC 4GQ9H 5CSZB 3LS5H 1BGXL 3C9NA 4N8CL 5A3ID 3ZE1F 5C92A 3WUZA 2J2ZA 2VYRE 3LRHA 1HDMB 3RA7L 5IT2H 1DE4A 4NN6C 1I4FB 3CFDB 4MJID 1C5DB 4FQXA 1JPSH 1TTGA 4XNMA 4MJ5B 2WQRA 3CX2A 4NO0A 3NVQA 3RU8L 3KG5A 2C3WA 4YDVA 5DJZA 5E9DB 1DQDH 3ARYA 3D25A 1QBLL 4R90L 4ZAKD 4KUZH 1BFVL 3VXQA 3O3AB 1IRAY 3EJZC 5TQ0H 4YJZL 3R06A 5C8JB 3SCMC 3FMGL 4L3ED 1KCVH 2A77L 4QHLA 1G0DA 3VXUB 5J13C 3DI2B 3IJSB 3I6GB 4AT6A 5FYJD 3BXNA 4K7FA 4XCFL 4XVTH 4I3SL 5AG8A 3G08A 1E0OB 3CFBB 3P3YA 5E99H 1JIBA 5CP3H 5IK3B 4KDWA 4X6DF 3EYSL 3MJ9H 1RJZB 1Q0XH 4JRYD 4PGJA 1ZLWH 3ZL4L 4PV8A 3N9GL 4AEEA 2YKLH 2HT4D 3PGCB 5GS1C 1NPUA 4FQLL 4K3EL 3AREB 4OI7A 5HPOA 4KJQC 4TOYL 1OTSD 3EO1A 4O51A 4MCYB 2BVOA 2BVPB 5KS9E 1G6RA 3MZGB 2RFXA 3UXFA 3GSRB 5DD5L 4C83A 4K2UL 5GS0D 4MXVE 2CSPA 4WJ5A 3PQYA 1FRGL 4ELKB 1T1ZA 4OZGA 5IVXA 3UDWA 3N1PC 5KVDH 4OLUH 5I71B 4PP2B 1D5XA 2HJFA 1YY8A 1NMBL 1OAZL 5DMYA 1E6JL 2VXUL 4JPVL 4LLQB 1BOGB 5C0AE 2F74B 4U1KA 4PP1C 2F15A 1TZHA 5DR5L 2J4WH 4LPUA 4PRPE 1DBJL 1GHFL 3AFLA 4NBYB 1XGYL 4OZIB 1K85A 1XF5A 3H9HB 3QIBD 5E7FA 4DKEL 2UY7A 3O3DA 5GRXG 3O11B 5C0DA 1SYSB 2J8UE 2DMBA 4DWHA 1A1OA 4YHLH 3FQNA 2XN9A 5IMMB 2NX5D 1BAFL 3TJHD 3U1SL 1M1SA 1MVUB 4NQSB 5CUSH 1B4RA 3RJQB 1XCTB 1NFDF 1ORSA 5MEPB 2CO6B 1YEFH 4F3FB 1AKJD 3NCFB 2FX9L 5D2NB 3M07A 5FKAB 3GFUA 4HCRH 3X3GH 4QHUA 4AH2A 3JUYA 1U8MA 1KJ3L 3ALPA 5TE6H 3WV0A 2XZAL 3T65A 3WHE1 1C08A 3FO0H 4XWOC 4OQ1A 1FC2D 2WBJC 4JDZB 3BH8B 1I1AC 3N06B 1W0YT 3P4OB 3FB8A 4ENED 3SGJA 3TO4C 4FMKA 2VR4A 5CJQH 2QADD 1GIGH 2QL1A 1AE6H 1WSST 1RD6A 5GS0H 1KN4L 3BE1L 2IMNA 1LWRA 1TPXB 4OBRA 4HS6A 2LTQB 4OT1L 3KYKH 5CIPB 4NQDB 5D7IF 4ZFZB 4M1DH 5BOZG 3HC3H 4E41E 1KB5A 2YS4A 2E27L 2X89A 5JPNA 2X4QB 1IAIM 2PTTA 1ZEAL 2IG2L 2ERJC 2GYSA 3DBXB 5JOPE 3KLAB 1NAMB 4RWHA 4FZ8L 1XMWA 3F8UB 4JGJA 1X4XA 3GMOB 3ZKXB 2E6PA 3WHXB 1F4AA 1RZFH 4Z7VA 1JFQL 1MCNA 5IP4A 2WIIA 5HDQL 3NIGE 1LK2B 1T89C 3F58H 4J4PC 1AI1H 5DVKA 3SCMA 1P84K 4XH2B 1CFQA 2JELL 3QUYC 4P23D 3P9MA 1VERA 1ZGLP 5HYSG 1A4JA 2NXYC 2UZYB 4TUKL 3DWTA 2OTWA 4DVBB 4X7TB 5KS9F 4ERSH 1S5HB 2AJ3A 3EDEA 3GMNB 1CXEA 1K4DA 1MOEA 4I3RL 5F9OH 1FL6A 4KI5F 4ZO9A 5SV4A 3HI6H 3P30L 2FO4B 4JFYB 4NP4H 5GS1A 1S9YA 3ZYJA 3EOBB 3I50L 1P1ZB 4QXTB 3CDFA 5AUMB 4TULH 3ZT5A 2VL5B 4PD4K 4NGHL 3SDCB 3DROB 3JV4A 3ECBA 4R96B 5CBEB 1YN7B 3MNVB 5C0BE 4JREB 4LU5L 4KFZC 5CZXC 3ZKQD 3F7RA 2YXMA 3MBXH 5EZLA 2DYPD 1RJLB 4OZIE 2VR9A 1XH3B 3MFFB 4N0UB 3LB6C 4ODSL 4I13B 4U1SA 3B6SA 3WYRA 3LMJL 3VFMA 1WEJH 2ZUSA 1S8DB 4WU5B 1V5JA 1MH5A 3QA3A 1T1XB 4CMMB 4G59A 3QXUA 1AC6A 4I0CC 2MCPH 1YEEL 2BOBB 1ETZA 2F5AH 1X5JA 1LMKA 1IMHC 3VJ6B 2JIXD 2R8SH 4BQ6A 4QLRA 2Q86A 1L7TH 4KTDH 3HA0A 3AB0B 4UILL 4WV1B 1C7TA 4XAKE 43C9A 1CLYH 3IFPB 2Y07H 4BK5A 4YHOL 1IL1A 3CAFA 3HB3C 2FGWL 5J12C 2BSED 5HHMB 1DSFH 1EHLH 5GQBA 1CG9A 4P9HL 1CLOL 3NPSC 5EA0L 1T1WA 2CKNA 3OPZH 4HDIA 2GSIA 4XHJC 5LVEA 1URLA 4XMLL 4G7VH 3GSWB 3WS3B 2KL6A 1D3CA 5BRZA 5LQBH 2ESVA 4PJAA 3PL6D 3C2AH 4MNQA 4P2QD 1ACZA 5FYJU 4YDJA 1KJVB 4DKAA 4Y2OA 3HCVA 3MLWL 2WBJA 5TDOA 4M43L 1I1AA 2JK5B 2V2TA 1DJSA 2HAZA 4FQHB 2FIKB 5GSRA 5L8KB 3CVIH 1BLNA 1RFDH 3H9SE 4PJHE 3TO4A 3Q6FB 1NKRA 3BPOB 3U36A 1EEYB 5TDNA 2EKJA 5EH1A 3TCLA 1ZHLA 4F58H 5DRWB 5EULV 1S9WA 1ZSDA 2NY5L 4NCDA 4XC3H 3NIGF 5HI5C 3TT1L 4XPFH 4LRIC 4NFDA 4V2BA 2XPGA 3BSZL 4LSPH 3LHPL 2F9BT 4JZJA 3FQXB 2BK8A 1EFXA 3RJDA 3I3BA 3FN0L 3S5LB 1U93A 1OGAD 3V4PL 4U3CA 1YA5A 2A6KA 5HHOE 4NT6B 5CILL 4HKBB 4ODTH 3WIIL 3NFSL 5I6XB 5IR1A 2CDFB 1MCSA 1BVKB 1CLZH 1T89A 5JXED 1KG0A 4G5ZL 3OZ9H 1DQLL 5HGBB 1SJXA 4MJ6B 2O5YL 2EYSB 4CMHC 3QUYA 4PY7A 4KPHH 5JTWA 4WHTB 5DQ9B 4N8VA 5B3JE 1T03L 3TJEL 5EOCL 3NAAL 4W6XB 5IVNA 1NUNB 1EO8H 4OUUB 1BJ8A 3KLSA 2QR0A 4G80A 1UWEL 1ED3B 5J6HA 3BKML 4YUEL 4P9MH 2DQHL 1MSPA 4WCYH 3ZHDA 4XPAL 2GKIA 2V6HA 4KKAD 5ADPL 43CAB 1S9KC 4QYOA 2I60L 4BZYA 1UVQA 1E4XL 4ONGH 2O5XH 1IGIH 2I9LB 2XV6B 3LKRB 3F12A 4G6FD 3VMNA 4Y4FC 4UV4H 4XVUD 4RWYH 5E56A 2FH6A 4HZLA 2M26A 2FBJL 2V9QA 1MHCB 3SJVB 4KQ3L 5IBTL 4DVRL 5I66A 4RISH 5FYLH 1JWSA 1KPUB 1MEXL 4YHPB 1CK0H 4ODBD 2JB6A 5EO1B 4ZTOL 1N64L 3I9GH 1JGDA 3HI1B 3SGEI 5F7EL 2YPLE 2A0LC 1G6RH 2ICEB 3NABH 1O7SA 3KVQA 4GSDH 3SKJL 4L4TB 2E7HA 2F19L 2YRLA 2Y36H 1UQSA 5D7SL 1YPZB 4GOSA 2CR3A 2N1KA 3FTGA 1NC2B 4NQEE 2ZP0T 1Y18B 1VGEL 3UZVB 3ULUH 2Q3AA 2JCCA 1JP5A 1MJUL 1I3RB 2D31A 1D9KC 4PUBL 3S3SA 2X4TA 4UUJA 1AO7D 4DZBA 1ZT4B 4BM7A 3IAQA 2P49B 2WUCH 3WFZA 3W9DB 5DQJA 5I8OH 3NH7L 1DBKL 4JFDB 3GSUB 3RY6C 1VENA 2P7TB 3OKDA 2JF1A 4X9FA 3MA7B 3PNWA 3ZE2E 3DX7B 1FORH 1OSPH 1BBJB 4PLKD 1T21B 2ADGB 3ARXA 4DAGH 3DVNA 4HWEH 1CGSL 5D70H 1NDMA 3FO2A 3WFHA 4F7TB 2WANA 3H9ZA 4XC1L 3DARA 3C5SA 4XVSL 2F54D 3OHXA 4CADA 5JLZB 3L5XH 5B38B 2ADFH 4AIOA 4WU7B 2X4SA 4TNWK 4BFGA 5E5MB 3RWFB 3OXRA 1QHOA 3H3PL 4LRIA 2GUOA 1UACL 2BXZA 3BP4B 1FSKB 3V9FA 3N50A 4NOFA 5CLWA 1WBXA 4NM8H 2E9WA 1D7FA 1L9NA 5B3JF 4KTEH 2EDWA 4NWUL 3FRPA 2X6MA 4JM2B 4XZUA 3TH3T 4HXBL 2UVFA 1HEZB 2FJFB 4AM0B 2EXWD 3BW9B 3AS0A 3M8OH 2CGRH 3HG1E 1ZK9A 3SE3C 4DUXA 5DRXB 5E8PB 2X70B 2FRGP 1ZA3B 2X1QA 4FTVE 1FO0A 3MV9B 4GG6E 5E00A 2DD8H 5DMJB 3MLZL 5J8OA 3STLA 3MNWA 3QDME 4WI7A 1IGFH 1EV2E 4CGTA 2YN3A 4X6CA 3DETC 4TSAH 3BWAA 3H7BA 3SDYH 3AXLA 5FM4A 4S1SL 3HAEB 4ZO6A 5I74B 5IQ9A 2AEWA 2RBLA 3DXAE 4ZOAA 2BY1A 4CU6A 4PJBF 2DL2A 4URTB 4HK0B 4Y4KC 3WSQH 1U95B 1MCFA 3P9LB 4Y4FA 1WTLA 3BP6A 2I9TA 4HXAH 1WAAA 2QSVA 1NAML 4G8FA 3G6JB 3RFZC 1GPOL 2VDLH 3ARUA 4LF3B 4YHZH 2E7MA 4PIRF 3QWOB 3NN8A 5CKAA 3LEYL 1C5BH 3D2UD 4HGMA 4LPTA 3X13A 3VWKC 4IRJC 2VDOH 4XNYH 3TH4T 3HC0B 1A1NA 4QHMA 3THMH 5H35A 2VMFA 4TPRH 5ISZA 1PD6A 4MNQD 4HUNB 3CFKA 4IRZH 5EU4A 3MODL 3V5KA 2QSCL 1PY9A 1JWMB 4LBEB 1J1XL 5IOPA 2E8ZA 2VC2H 4N5UA 5D2LB 3PP4H 3OJ2C 4NKDB 1H15A 3JUZA 4G3YL 1FDLH 3MLRL 3MXVH 4P59H 1E4WH 2CO7B 3C8KB 1PKQE 1LQVA 3CLFH 5KW9H 4ZUVA 4WW1B 3TT3H 1MCWW 4DOHE 1UM4L 3MXWL 5JW3H 4WDIB 1IGTB 2Z92A 3FQRB 4IOSD 4B5EA 3C60B 3UYPA 2ITDB 1D9KA 2ZOKA 3MPCA 4F8TA 4M6MH 5DMGC 2VN7A 3UZQA 3Q5YA 4P57A 1BVLA 4HW6A 4JO2L 3RY6A 2VLJA 4S11A 2XQBH 4KRNA 3WD5L 1U8NB 3O8XD 4TUJB 5AWNL 1EERB 4D9LH 4DGIH 3JV6B 5F96H 5E2UL 2CQVA 4IIQB 4NRZB 4PJ5A 4KK9C 2HFGH 4HKJB 1S7UA 3GBML 4NO2B 2YUWA 4ZNEA 3KPPB 4EN3C 3D85D 4XMKH 2D3VA 4KVCL 1VFMA 1NCDL 5D1QD 4P5TB 1I7TB 4BUHA 1Z5LB 4X5XA 4IJ3B 3E1F1 1J8HD 1QRND 4PB9L 3GMQA 1Z0NA 3IU4L 4PRNA 2HVJB 4TUOA 4YBLC 5L7XL 4K71B 4GG6F 3VDBA 1P5VA 2CK0H 4MAYB 5LGHL 2DM4A 1QRKA 3C5JB 2A73B 5C0FA 3DTXA 5HXMA 5E03A 4EI5B 1NLDL 4XPHL 1IJ9A 3LQAL 1RIUH 5DFVC 5TDPB 3HE7C 5J89A 5GGSY 5F9DC 2PCPB 3FT2A 1ULVA 3SE3A 1Q38A 2IC2A 1IKNA 1Q1JH 4I0PB 3VWJB 3KPSB 2F8OA 3P4NA 1I9JH 3Q1SL 4LSVH 3LIZH 4HIIB 2IFFH 4WI4A 4K3GA 4NHUE 1PG7H 1DANT 4L3AA 2EYRB 1JUFA 5T3ZH 3WKMH 1ND0A 5EPMB 1KSRA 4A6YA 4YK4B 3I3DA 4X7SH 1XGRA 3ZE0F 2X9XA 5FUOH 5C0EA 1T1YB 4JY6B 1NCAH 4YXLH 1I1YB 2H8PA 1CE1H 4KRPC 5J1SC 4MA1B 1X5IA 4O9HL 4NRXA 3QZWG 4Y4KA 5CD5D 1YEHH 5I19H 2DQCH 5HYQA 2JB5H 4ONFL 2ZUQC 5JDSA 1BQHA 1UB5A 3EYOB 4X99B 2WLZA 5T3XE 4P2OD 4L8DB 1I3GH 2R2BB 4YHNB 4M7KH 1M05B 5EOQH 4F7MB 1RU9H 1G7HA 5LGJB 1NANI 1BJ1J 1MJ8H 1ZWIB 2G2RA 1DUYA 4FQQB 5GGSB 3U79A 1KJ2B 4ODXB 1F11A 4IDJL 5MEND 1S7SA 2FX8H 4L4VE 1Q9OA 4IRJA 4YFDB 3VWKA 1UH4A 3BI9X 3FFCA 4ZS7L 3MTRA 3WJLC 1CGVA 1QSED 2P5WD 3BO8A 3GNML 1WK0A 1Z0MA 1AR1C 1F4YH 4HK3N 4UV7L 1QQDA 1ZANH 2LABA 4UT9L 5I8EB 2FHCA 1R6VA 5FHBL 4OD2B 3ORJA 2R9HC 2HFEA 4ZQKA 3GSVA 3BZDA 4OM1H 4UIMB 4LGRB 2IQ9L 4M93C 1LE9A 2Q76A 1ZHBB 3MACL 4XP1H 3HNTH 4Q9RL 4LLVB 1LO4L 4Y19A 1SMAA 2JE8A 1MFDH 3IXAB 3O41B 1GGYA 5DT1L 2ADIA 4OF7A 4LSUH 1XF3B 5E6IB 1LO0L 3QPQC 1EHXA 1CGWA 5C0IB 2EYTA 1J11A 3D3VB 5GS2H 5ITFA 3P9WB 4HFUL 5F9WB 1U42A 4PREA 3RWCB 3CZFA 1TZGL 4MD5B 1D5MB 5JOEA 2VIRB 2K7QA 3L9RB 4GRWE 4J8RB 3TCXA 3TYGH 2PNDA 1MCBA 3B2VH 4BFEA 3CC5B 4XBGA 5EC1A 5HGHB 4J2XA 3GM0A 4P3DB 4U6HB 3RWEB 4EN3A 1T22A 4HUKB 1EUUA 4PGDB 4UTBH 3MCLL 5DTFB 1OARH 2A74A 1S9XB 4P9HC 3PABB 1N6QH 4LHJB 4KROB 3CCHA 2Q87A 2VABB 1KTLA 1AHWC 3Q6GH 1DQJB 2RR3A 4OFYD 3S4SG 1OW0C 3KXFB 4CVZA 4W4OC 3RPKA 1A6VL 2RJMA 1UZ6E 5GJTL 4S10A 2VDQH 1U8IB 2R1XA 1UENA 1AGCB 1FJ1A 2YZ1A 4P2RE 4YFLI 4L8SC 3HE7A 4R0LB 4BFIA 3K2UL 5HYFA 5DGRA 5BZWB 4Z0BH 1A2YB 1EXUB 1ZS8B 5I2IB 2KQMA 1BJMA 3PWUA 2QEJA 4PJGA 4EEEA 5I1HH 1KBGH 1FNEB 1KEGL 1IE5A 1I8IA 4OLVL 2NY5C 2XT1B 3TN0D 4MX7B 4Y4HD 3IDIB 4EZMA 3QO0A 3QFJD 3FO9A 3PHQB 1EVTC 5DK2A 3VE0A 3ZO0A 1FYTE 2XOTA 3DO3A 4M61A 1JZ7A 3PWLB 2VAJA 3ERYA 1Q94B 5IW3A 5E4EB 3W0WA 2HKFL 3DGGA 3RZCD 2X4PA 3KDMA 5D1ZD 1VDGA 2FDBP 1ORQB 1FO0H 4X8JB 1QFOA 1QD0A 2YA0A 4Y5VC 1MHPL 4K3DL 1U8KB 5DD0L 1T6VN 4QOKA 1FL3B 2DF3A 3L3GA 1TZIA 4UT7H 1O0VA 2SEBB 4RMUA 2PW1B 2IAMD 4HFWB 1HQ4B 2R2HA 3SBWC 1YY9C 4QTIH 1MI5D 3TA3D 1O5DT 3LQZA 3N1GC 4MS8D 3WJLA 3QXAA 2VDPL 1MAML 3DX9B 4GRLD 1KB9J 3LKQA 1J05B 1FNLA 1H8OA 4RBPK 4M6OL 1GJIA 5CP7A 2EE2A 4WTXA 5GGTL 5JZ7C 2VUOA 5T5FH 1W0VA 5EU5A 2OYPA 4GRWF 4Q9QH 3ME0A 3MLXH 4JAMB 5JA9A 1QLRB 3HMXL 1DFBH 4KMTL 2V7HA 3NCJH 3VDAA 5DVOA 5DYOA 2MCG1 4PJFF 4E9LA 3P0VH 1P7KA 2Q8BL 1NFDB 4OLZH 2YBRB 1MF2H 2Z93B 1MFNA 1P9MC 2EIDA 1C1EH 3CXHK 5DJAB 5I76B 1I1FA 4OGYL 3VD9A 3BFOA 1UZ6F 5FECB 1U8QB 2FD6L 1B9ZA 4OCRL 1JN6A 1NSNH 3SDXE 3IS1X 4ZFFB 3X12B 3FHQA 2I5YH 1KCKA 3CJJA 1I9EA 3AREC 5IMOB 4XWGL 1AHWA 4MJ4A 4J12A 1IAKB 4OZHB 1IEAA 1WC7B 1RZJL 1FNSH 3I2CH 3OKKB 3MV7E 4HBCL 2X05A 5D7IB 5C08A 1OW0A 4UB0H 4MNHB 4F7EA 1LNUB 1XGQB 1MQKH 1DQML 2X9WA 3EDKA 3FRUB 4LK4A 4NKIH 5LKNA 4LCWE 4P5KB 1DN2A 4UTAH 2P24A 4GKNA 5DVMA 4L8SA 4JN2A 6CGTA 3DSNA 4EDWH 1J1PL 2CMRL 1CD9B 3QNZA 3QDHA 5I71C 2AK4E 3TBSB 4I0KA 2PXYB 5E8OA 2JJWA 5L8JB 2NY1B 2Z31A 2ZNXA 4UT6H 3CSGA 4FQPA 2X4NA 4DKFH 3FFDB 4ZUWB 4YHIB 4PJEE 1M4KA 4LASL 5EG6C 3S6CA 2N7BA 3EYFB 2IAND 2VRAA 4NRYB 3F5WB 4RMSA 2NY6B 2EDXA 1QFUL 1IEBB 5IFHL 1K6QH 4I18B 3T0EB 4YIQB 3QCUH 3KJ6L 4KQ4L 2HG5A 1OP5H 2UV3A 4RGNB 2Q6WB 3LSOB 3UROR 3OAZH 1F2QA 4PG2C 3KYNB 4WGWB 4U1JB 1BGXH 3D0VB 1N26A 4Y5VA 5C0CE 3LH2H 4P4RA 2Y7QA 3M17A 5D2NC 4PRPA 1VFUA 4D8PB 2GTWB 4XP6L 3VXRB 4NCC1 4HWBL 3CPLA 1WF5A 2ZG3A 1UA6L 4A6YH 4G6AD 3MUY1 3SBWA 1SVZA 3PG2A 4N68A 2QTEA 4GXUN 3RU8H 4PFEA 3T08A 1WFNA 2Z9TA 5CSZA 2HFTA 4R90H 4UQ3B 3DURB 3GJEB 1BFVH 1TPXC 3QUMA 2LTQC 1AP2B 3IU3B 4MCZB 1MCHA 4QRPD 3UJIL 3EZJB 3BMWA 4JFPA 3TIEB 1HDMA 3H42L 2VZ3A 4C57C 1I4FA 3IDMB 1IGYB 2YUXA 4CDHA 1C5DA 3U9UB 4JDTH 2ZJSH 2IBZY 4MJ5A 4PJ7B 1XAUA 4E5XB 5IBLC 3GHEL 3ZKXC 5E9DA 3EYSH 3IETB 4FNLH 3OKMB 4B7IA 4PGEB 4WFFD 3O3AA 4BUGA 5C8JA 4OCSH 4FQLH 3U2SB 3RWDB 2CDEB 1WZMA 2DQEH 3VXUA 5DGQA 3IJSA 3I6GA 1D5IL 3A6OA 3CFBA 3TO2B 5IESH 1P9MA 5DD5H 2HTKC 3PV7A 4J6RH 4K2UH 1FAIL 2PF6A 1FRGH 5IK3A 1N59B 1LEIB 1RIVL 1RJZA 1UJTA 5IKCB 4O5LL 5DUPL 1TCMA 5HYJE 1RMFH 3PGCA 1AQKL 4N90E 3FZUC 3SQOL 4JFXB 4ODWB 3AREA 1AGDB 2VDMH 3QCTL 3BKCL 1OAZH 4MCYA 1E6JH 2VXUH 3SDCC 4JHAL 2BVPA 5JIKA 2CUIA 3OF6D 4IOFD 3W0WD 5FDYA 5FIEA 1NFIA 4BSVB 5DR5H 3GSRA 5D7JD 4JREC 2W60B 4PJEF 1GHFH 2DB8A 2XWJB 1XGYH 4ELKA 2D7NA 1INDL 3NZHH 4DKEH 3B9EA 3VGEA 2KKQA 3VRIB 1B2WL 5IEHB 2R23B 3MCG1 4PP2A 3N1MC 3U4AA 3B9DA 4BQCA 1BAFH 3U1SH 3L1OH 3A67H 4N5EC 1S78D 4R2GD 4RRPG 4LLQA 5JOFB 1BOGA 3QDGE 2F74A 3VFNB 4MMXC 1S5IH 2Y5TB 2W38A 2D0FA 1MCOL 3AB0C 4WV1C 3OXSB 4U1LB 4DCQB 4OZIA 1KJ3H 3H8NA 3H9HA 4OF0A 5IB4A 5I1KH 3IDNB 3VGGA 3O9WB 3B5TA 2CIIB 3O11A 5EU7C 1SYSA 3EZ8A 1OCWL 2V9RA 4S1QH 3LQAC 3QULB 4NN5B 5IMMA 3QR2A 5E2VL 1MVUA 5F44A 2IEPA 4NQSA 4PG2A 2R1WB 4M7ZB 4CJ0A 1RHHB 2WMPA 1XCTA 1KN4H 3BE1H 4JKPL 5MEPA 3IDJB 4Y2DD 4OT1H 1HCVA 4LNRB 4I77H 3RIFF 4F3FA 5D2NA 4U1MB 5FKAA 2KQNA 4FFEX 4WI6A 2BHUA 2E27H 4HK3J 5DD1L 4S0UC 1ZEAH 2IG2H 4RDQF 1MELA 1MAKA 4WHYG 1QUNA 3E6HB 4M3JA 4FZ8H 4JDZA 3BH8A 3P4OA 2PTUA 1DEEB 1ZLSL 3LVEA 1MAJA 4PJCB 3W5MA 3BPOC 3QUXA 5CEZE 2OP4L 5HDQH 2XZCL 3ARRA 2VQ1B 5CIPA 4NQDA 4ZFZA 4O2EB 2N7AA 3QI9D 2K9UA 2JELH 4JFOB 4OGXL 1YN6B 1CZ8L 2X4QA 2ZZUT 4XP4H 1CR9L 3RQ3A 1UWGL 3DBXA 1OQXA 4FFVD 4U49A 3KLAA 1NAMA 1DBAH 2DMKA 4OBSA 4TUKH 5IFAL 3GMOA 4S1DD 2RGSA 4PJHA 3WHXA 1T7XA 4PTUB 3MOBL 4M7LT 3RBSA 1NH6A 1OAKH 4PJIE 3MV8E 5I6XC 1FV1B 2AXFB 3OB0H 3O6FD 1LK2A 1A7NL 1Q0YL 1IFHL 3JV5A 3P30H 2DLGA 1A3LH 3VFWB 3DX8B 4XH2A 2BDNH 3LEVL 2QHRH 3EAKA 3I50H 1X44A 3CDCA 1C16B 4ZYKB 4G42B 4NGHH 4U1HB 1QFPA 1NC4D 2AJXL 5D96B 4JCLA 4C55A 1UCBL 1U8LB 4N9GA 2Z31D 4X7TA 3EDJA 2WLYA 1S5HA 4U2ZA 4QTHB 4NPYB 3GMNA 2DM7A 1OWWA 1FL5B 5A2KH 1K3IA 4UOW0 4C56B 1HXYB 4XMPH 5DO2D 2ZG2A 2FO4A 4JFYA 1CU4L 1IBGL 3EOBA 3LMJH 1RUKL 1P1ZA 3OKYA 4QXTA 3L3KB 5AUMA 1YMME 2VL5A 3SDCA 3DROA 4G7YL 1YEEH 2BNUB 4R96A 5CBEA 1YN7A 3MNVA 1WV7T 2OMBA 3CVHB 1G1YA 3V5DB 1TVDA 5IJKC 1N5AB 1RJLA 5C0AD 3ARFB 1K5NB 2VDRH 4N0UA 5LG1A 5F9JB 2FGWH 5D1XB 4DTGL 4LPWA 4PRPD 4G9DB 2G5BB 4P9HH 1OP3H 2DQFB 1S8DA 1CLOH 3AAZB 3VXOB 3NACH 1G6VK 2VLKB 4N5EA 5EA0H 1T1XA 4CMMA 5DLMH 4FP8L 2BOBA 3O45B 1VPOL 3DLQR 3VJ6A 2XI9A 3HS0A 3L5WB 1I8LC 4PRDA 3L7EB 3GSXB 4WV1A 3IFPA 1S7TB 4Q58C 2HKHH 4NNPH 2C4FT 5HHMA 3MLWH 3V6FB 2PW2B 1NGWB 4PLOB 5SWZB 5CGYD 1A7PL 2K3TA 4MQ7B 3I84A 1MLCB 4PJ9D 4WTWA 4GS7B 1M7IB 2WBWB 4PJBB 3SKOA 2R56L 3WS3A 3ARGA 3QDJE 3V0WL 1JI1A 3TT1H 3K4ZA 4OF5A 3IDGB 3LHPH 1OTUD 4UQ2B 3QWRA 4WI9A 1KJVA 2X1PA 1I85C 3FN0H 5EUOB 4E41D 4GG8B 5AAWA 1BM3L 1RZKL 1E28B 2JK5A 4FQHA 2FIKA 3L6FB 5JOPD 5CILH 3Q6FA 3QIWB 3WIIH 1EEYA 3PF2A 4KKCD 2D03H 3ETBF 5DRWA 4PJIF 4G5ZH 1DQLH 5CJBA 1RUAH 2O5YH 1JTOA 1SY6L 5DUMH 5HD8D 4WEUD 4O2CB 3FQXA 1TDQA 4V1DB 1FSKC 4DN3L 5E1AB 2FLBT 5A1AA 2PYEB 3TJEH 4PRAA 5EOCH 3S5LA 3PV6B 1TQCB 2Y23A 5EU6E 2GY5A 2HT3C 3GK8H 1P7QB 4JM2C 3ZKMD 4YUEH 4NT6A 5KSAB 4HKBA 2KBGA 2CDFA 1AGEB 1FGNH 1BVKA 4XPAH 4QY8B 3BGAA 2YK1L 1TETL 5HGBA 3S88H 4MJ6A 1B88A 2HT2D 3QUMH 2EYSA 5JORB 1C7SA 4WHTA 3C6LD 1NGZB 3QNYB 1DQQB 1KCUL 5DQ9A 5I1IL 4HQQL 4Y1AB 4PJXE 4BQBA 3W39B 4XB7A 4OCYL 1JRHI 4OUUA 3HZVB 1ED3A 4JN1L 3SHSA 3UO1L 3KR3L 4X5WB 4YWGH 5C0BD 2XKSA 5I74C 4DVRH 5TFSL 2VDNL 3V2AR 5GGVY 4XBEL 43CAA 4AL8L 4U6XB 1MEXH 1A9BB 4MB3A 2ZCLL 4ZFOL 2I9LA 4HJJL 4Z7UF 3LKRA 4JR9L 5DK0B 5KTEH 5F7EH 3X3FH 2UZIL 1WISA 4XI5C 4DGVL 4OGAD 1NGYB 5IJKA 3ZT7A 2F19H 3HMWL 1ZOXA 4KH2A 2AV1B 1MHCA 2X4OB 3HPJB 3SJVA 2J6EL 2DIBA 5GZND 1TVBB 1IC4H 2NPLX 1WZ1L 3DSFL 4XAKD 1EHNA 1VGEH 3OAYK 1KPUA 5FDWB 4YHPA 3B9KC 3S36X 3U4BH 4PUBH 5EO1A 1HYSD 1CFSB 6FABL 5IIEB 3HI1A 5ACLA 5IVOA 3VG9B 4OQTA 5F1KC 4WI8A 1I8LA 3HUJB 2ICEA 4KJWC 1MCRA 3MLVL 4LSQH 4FN0A 3S37H 5H8DA 4L4TA 3QUXD 3TPUB 4X7FC 4P4KD 1NC2A 1CGSH 2CDGB 3HLAB 1Y18A 2J8OA 4BH8B 1QLEL 1G9MH 3WFCL 3DGCR 4IOIB 4OV5B 3C60C 1I3RA 2FEDC 4OF3A 1UKSA 4XVSH 4R26H 3ARVA 1UG9A 1ZT4A 4JPWL 4YHKL 2RHEA 2WV3A 3W9DA 2YPKB 5D9SB 3O2DH 4JFDA 4QRRE 3H9SD 3GSUA 3UC0L 4HG4K 5C09E 2P7TA 4BKLB 5JIPA 3MA7A 3H3PH 4HZAA 5FYKE 3DX7A 5D93B 5CKGA 1BBJA 4IIQC 1T21A 2ADGA 1PGRB 4CVXB 1I85A 5E94B 3ZZ1A 5GSVB 3ZHLA 4F7TA 4NWUH 3BIKB 3QZWB 1INQA 1IGML 5FO8B 5JO5B 5JLZA 1IC7L 1AD9B 4I5BB 3RUGB 3F6IA 3ZDYE 4P5TC 1PVHA 2VJXA 5B38A 4ZTPL 2BXYA 4WU7A 3LS4H 1H5BB 5HHOD 1EAPB 5E5MA 3RWFA 5BS0B 4IJ3C 2DDQL 2BVYA 3QP3A 4K71C 3BP4A 3U83A 4MAYC 1BFOB 1FBIL 4G9FE 4Q0XL 4PJXF 4AEIH 4JM2A 3SDAB 1HEZA 2FJFA 4AM0A 3BW9A 2G60H 3OTTA 1VFOA 3RZWA 4GRMB 3W82A 5DRXA 5E8PA 5IQ7H 2X70A 5KSVB 1G9EA 1ZA3A 4GW1B 5CIPH 3MV9A 4I0PC 3VWJC 3BYTA 1EMTH 1X7QB 2DWEB 3NMEA 2ZCKL 2DBLH 2XKNB 1HWHB 1NAMH 5HY9B 1GPOH 4WEMB 4BZ2L 4WUUB 4Q9CA 4BSJA 5GGTA 3B3IB 1R5WB 4YK4C 3HAEA 4NZRH 3TZVB 3IF1B 2I27N 3LEYH 5FO7B 5F1SA 1CXIA 5CAYB 2EXYD 2X1WL 3WXWL 1X5XA 4MA1C 3E8UL 4HULB 4Y8DC 4HK0A 1UH3A 1U95A 4TYUA 4ELME 3P9LA 3MQIA 1QFWL 1J1XH 1W8NA 3HZMB 3G6JA 4U4BA 3Q5TA 4PYHA 4NC1E 1NL0H 3MJ8B 4LF3A 4G3YH 3BQUD 2YPLD 1YZZA 4D94A 1DLHB 5D7KE 3MUGB 3ARGD 3K8KA 1UM4H 2L4OA 3P0YL 2DQDH 3HC0A 1PG7W 4KJPC 1T7ZA 1VCAA 4HT1H 1BREA 3WNPA 1LEKB 3S4SB 5GS3A 4MXWL 5HHVH 4HF5H 2ZKHL 4NQED 5HI4C 1JWMA 1T0NB 2DQIH 4LBEA 4OCWH 4OM0L 4JO2H 5D2LA 3SGKC 5J1AB 1IGJB 3WD5H 3V6OC 4NKDA 2NY3D 5CSGA 2XTJE 3AY4C 4PY8J 3C8KA 5I1GL 5GJSL 3U7WH 3IFNL 1BD2E 4WW1A 5IG7B 3H7LA 4L4VA 1YMHB 1L6XA 4WDIA 4JB9L 4JEGB 1IGTA 3FQRA 3T09A 3C60A 2XACC 2ITDA 4ZD3L 3V4UH 1RULL 4MA7L 5IFJB 4M5YL 4FFZL 1U3HD 5E6IC 2R1YB 4X4YB 5HVHB 1A3QA 4X6BB 5F9WC 1U8NA 4PB9H 4LARH 3CVHL 3CXDL 3IU4H 4TUJA 4PRHB 3JV6A 1K4CB 2XQYK 5F70A 3UTTB 3HHRB 4IIQA 5BMFL 4NRZA 4G6MH 2IGFH 4ONOA 5LGHH 4HKJA 4NO2A 4MXQD 2Y6SD 4XPHH 3LQAH 3KPPA 4LCUB 5B21A 4APQB 4WTZG 2KPNA 3PP3K 3RVVC 3LOWA 2VUYA 1JZ4A 2Y4SA 4P5TA 1I7TA 1XCQB 4LSSH 4U7SA 3EOTL 1Z5LA 4KROC 5IM7B 2CRIA 3NCCB 3AS3A 4UMGA 3QHZL 4RA0C 3Q1SH 2HVJA 3SEPA 3HG1D 1J9CT 2V9TA 2W9EL 4MAYA 5F7FA 3C5JA 3OG6B 5F9AC 2A73A 4FTVD 4GMTL 4I48B 2BJMH 3HRZB 4NOBA 3S9DB 4EI5A 4YPJA 5C9JB 3SE9L 4HWBA 4BSWB 5IF0B 4OIIH 3DV6B 5TDPA 3QDMD 4R0LC 5K93A 1OB1B 2PCPA 3SKUD 4L5FH 3EOAB 4H88H 1P5UA 4I0PA 2HTLD 2VDKL 3VWJA 3KPSA 2ITCB 4HIIA 2KZWA 3QJHB 4PJFB 3DXAD 1GOHA 2UUDH 4QHNB 2A6IB 1TNMA 4ONFH 2EYRA 4ELMF 3FAWA 3W11C 1MCKA 3WHE0 5EPMA 2LVEA 4MLIA 2WWMC 5GGRB 4NJ9L 1AGBB 2NY0B 4MGXA 5C7XL 3ZHKA 1T1YA 4JY6A 5DK3A 1I1YA 5E4EC 3IFLL 5I1JL 5A40E 4YR6B 3BRGC 3BKYH 4JLRB 5I30H 1KELL 4ZS7H 5C07B 4YNYB 2XZZA 4UV7H 4UT9H 3X14B 3K4AA 3REWB 4AMKH 5FHBH 5HPMB 3EYOA 3INUH 4FQ1L 4NHCH 1MCJA 4X99A 4L8DA 4YHNA 2R2BA 1YNTB 4JFQB 1M05A 4F7MA 2D9CA 15C8H 5LGJA 3GEWB 2OJZH 4PBWD 4FQQA 5GGSA 1KJ2A 4ODXA 1LO4H 4LGSB 4LLMB 1OP9A 3QXDB 4P46B 2P8LB 5KSBF 3SDDD 2FJGB 1LO0H 4PJ8B 4R9HA 5I8EA 1T2XA 4JPKL 3L3JB 4OD2A 3SGKA 5T1KB 3V6OA 5E24E 5C3TA 5IHUL 4M6AA 4UIMA 2AJYL 3AY4A 4PGCB 1ZHBA 3C08L 2VISB 4LLVA 1U92B 3RIFK 4MWFB 3PXHA 2L7JA 1A6AB 3IXAA 4D9QE 3O41A 1DTUA 5JDJA 1N6VA 5E6IA 1A4KB 4PGBB 2R4SH 3LKNB 3MCLH 4QKXB 1F02I 1EUTA 5C0IA 1INEL 4OQTH 3D3VA 4HGKC 2NR6C 2GJ6E 5F7WC 3RWCA 3DYPA 4MD5A 4QCIB 1D5MA 3BEWB 3MFGB 2VIRA 5FOBB 2AQ2A 3L9RA 4J8RA 1R3KA 5HGHA 1A6VH 3CC5A 4TRPL 4JGMA 4J3OC 1OF2A 4P3DA 2N56A 1UGNA 5TPWH 4U6HA 3RWEA 4HIEB 4KMLB 2ZUVA 1OAQL 2V5YA 4OLWH 4OJFL 3DIFB 5J57B 3K2UH 3TIDB 1LGVA 4PGDA 5ICZB 5DTFA 5FYLE 1J86A 5GXBB 1S9XA 2GK2A 3MGOB 3PABA 3F7YB 1U8JB 2V5MA 3AC0A 2VABA 1GGCH 4HD9A 3VFVB 3QUZB 4NC2B 2RIKA 3B43A 1DQJA 1KEGH 5IWLC 4PRIB 3KXFA 3V7AE 1U8IA 5KSUB 3O3EB 4Z8FL 3MRCB 1AGCA 1CF8L 2FCBA 2B39A 2D7OA 1TJIL 2BNRB 4TNVF 2IBZX 3PQYE 4R0LA 5GGVL 2P48B 4OZGE 5BZWA 5IVXE 2EE3A 1A2YA 1EXUA 5CSBA 4HLZG 1ZS8A 5I2IA 5J3HD 4WO4A 3ULUE 2HKFH 2PXYC 1ZVSB 2NY1C 5A2IH 2BVQB 3G6DL 1LE5B 5BVPL 3WXVH 3KJ4B 1FNEA 4JFEB 4J3TA 4H20H 4LSRL 1MHPH 4GBXB 4POUB 5DD0H 4FXGB 4PLJC 1T0MB 3IDIA 2NY6C 1AC0A 4NQCB 4TQEH 3PHQA 3U0WL 4I18C 3T0EC 5ITBL 1X5ZA 7CGTA 4G6JH 3PWLA 2O61B 4JKWA 3RVXD 1Q94A 5T3XD 4RGNC 2XN9E 1R5VB 4KI5C 1ORQA 3P73B 5KVEH 1IAII 2VDPH 3KPRB 1MAMH 2YD2A 2YWYA 4L4VD 1U8KA 2FSEB 3ZKNC 4KHXL 4FG6D 4XCCL 1FL3A 1L0XA 4NUGL 4X80L 4M6OH 3FCTB 1MRCL 2SEBA 1FZJB 3RVUC 1JRHL 3N85L 5GGTH 2PW1A 1CDGA 2ENSA 4HFWA 1XR8B 1P4BL 3HAEH 4IHOB 5DFTA 1HQ4A 1A7BA 3LRSB 4R4ND 4K8RC 5I1CL 3SOBL 2KZ1B 4KMTH 2C5DC 3MUJA 4XGZB 2R39A 3DX9A 4WY7L 2R69L 2VLRB 2OZ4L 4Z7WB 4X9BA 4F57L 1J05A 3D6GA 1N5YH 2CJUH 1VESA 4R8WH 3SGEH 3GSNB 2VZTA 1DL7H 4HIHB 1QNZL 2EC8A 1HN1A 2M2DA 2DM3A 1U8HB 4P2YA 1DDHB 3RWGA 3LKOB 4JAMA 1AD0B 1QLRA 4OGYH 1ZT1B 4KV5E 4WWID 1NCTA 1WWWX 2FD6H 3VD4A 4B53A 4OCRH 4Z7VE 3S35L 1UWXH 4EI5D 2HWZL 4L29B 1JHKH 3H2WA 3OJDB 4LQ1A 5I75B 2YBRA 4U1NA 3T3PE 5T3XH 1AXTH 4NYLB 4HBCH 2Z93A 3BUYB 5EZJB 5LCVL 2F8XC 5DJAA 5GRJL 5I76A 1IQDB 3DO7A 1BQLH 3MYJB 1FG9C 5FECA 1U8QA 4NQTA 3K74B 1OLLA 1P2CB 4J7RA 1CICB 3KYAA 1TLKA 3V79C 4NM4L 4OZGF 3ILQC 2YMXH 3IAPA 5IVXF 3X12A 4P2RD 5AZ2L 1CD1B 2P8PB 4ZNCD 4WI5A 5IMOA 1D6EB 3TVMB 1IAKA 4JRXB 4OZHA 3ULUF 1MIMH 3LZFL 4FQIL 1AH1A 1WC7A 3OKKA 1QSFB 1A1MB 5HI3C 5D7IA 1A9EB 5IWLA 4MNHA 5IJVB 1LNUA 1KIUA 1XGQA 1MCPL 1KXTB 3FRUA 5MHSE 5I0DA 1XF4B 4P5KA 2AS5M 3BRDA 4KKBD 1QFUH 5IFHH 4MB5A 4EI6B 1PX3A 3WIHL 3EDDA 4KQ4H 1Y6NR 5JPMB 4ODUB 3ESUF 1GAFL 3TBSA 1QYGH 5GRZA 5K9JH 2PXYA 5F3BB 1PQZB 1H3XA 1FYTD 1KB9K 4ZO8A 3SN6N 3FFDA 4ZUWA 2YD9A 4OB5L 2CR6A 2C3XA 3EYFA 3OBAA 4P3CH 5EZOL 3F5WA 2FNBA 1N3NB 4XP6H 3BT2L 2PO6B 1QFWM 1IEBA 5J06A 2VZ1A 4I18A 4YIQA 5D7LB 4HWBH 3O9WC 2XKUA 1BBDH 1UFUA 2Q6WA 4NN5C 3D39B 4A2MA 2XRAL 4Q2ZB 3LSOA 1F58H 3WO4B 1XIWD 4HLJA 2EECA 3SY0B 4V3EB 2AEIT 3KYNA 4M7ZC 4U1JA 3D0VA 2R0LH 1T5XB 4NNXB 3BHBB 5LJYH 2OCFD 5ALBH 4NNYB 1N7ML 3UJIH 1NCUA 4D8PA 4HS3A 4M1GL 2GTWA 1ZLUK 3H42H 3VXRA 3T77B 5BRZE 2ESVE 4TSCL 1XEDA 4PJAE 3PWPB 1B0GB 2P5EB 3DVGA 2OL3L 3TYFB 5F6IB 5GZOC 1KPVB 4H0GA 3MLSL 1JHTB 2HLFD 1T5WB 2PETA 2OR7A 3EHBC 1IC1A 3BPCB 4UQ3A 4ZDHB 3DURA 1VACB 3GJEA 5ADOL 5DDHB 1AP2A 3IU3A 4MCZA 3KLHD 2DN7A 3MV11 3TIEA 3STZB 5JMRA 1J0IA 4RX4A 1A64A 4OZFG 3IDMA 1IGYA 5HVGB 3U9UA 4YGAB 3MZTA 2D0GA 4HEPG 1N2RB 4PJ7A 1KJ2H 4E5XA 2J6EA 4P48A 3IETA 3HR5B 4TVPL 3RGHA 3ARBB 2V7NB 4FQ2L 3OKMA 2X44D 4PGEA 5CHNB 1ZE3C 5TF1L 3RDTB 3SQOH 5T1LD 2R4RL 3U2SA 4X6EB 3RWDA 2CDEA 3QCTH 3BKCH 4JHAH 3TO2A 4WO4D 5D96C 5JXAL 1FFRA 1H3PL 5HGAB 3MV7D 1N59A 5D5MB 1MQ8A 1LEIA 4HC1L 3MV8A 5IKCA 1X6NA 3RKDC 4H26B 4EQ3A 2BOCB 3HFML 4LCWD 4ODWA 2NYYC 1AGDA 1JYXA 2DQUL 1DBML 4ETYA 1KJMB 2AK4D 4JRWA 4BSVA 2EEBA 1RUMH 3MLUL 2WIMA 2W60A 4AIZB 3G5YB 3MREB 3ZTJG 2XWJA 3U4EB 1H9VA 4OTXH 3ARFC 5D1XC 1AR2A 3VRIA 1OCWH 5IEHA 2R23A 1Q72L 3QEQB 3QNXB 1W2KT 5E2VH 2AJZB 4HS8H 5ICYB 1HK6A 5JOFA 4JKPH 3VFNA 1BFTA 3BYYA 3VU2A 4OLYH 2Y5TA 5HDBF 4LSTL 3OJVC 3UTZB 2GK0B 3OXSA 2L0DA 4U1LA 4Z95H 5F88B 4DCQA 1JGUL 5L0QB 5C0CD 3IDNA 3O9WA 3ZT6A 4X7DC 3MGAA 2CIIA 2IWGA 3ILPB 3QXVA 3QULA 4PJAF 1T6WA 1FZOB 4J3WA 2NY7L 3MLYH 4JKLA 3BRFA 2R1WA 2P47B 4KK6D 3MBEC 2JCCE 4PTTB 1RHHA 1CI5A 4F9LC 1R24B 2DTMH 2OP4H 3IDJA 4GS7C 4ETQB 2XZCH 4U1MA 4R4FL 2BNQB 5AAMA 2AXHA 4LP5A 4Z7UB 1CZ8H 4PDCE 1CR9H 1CVRA 1XGTB 1L7IH 1BP3B 4NQUA 5D72L 3EYUL 3E6HA 1HQRB 5KOVC 5IFAH 3MOQA 1ZLWK 3VGFA 1UM5H 1NANH 4JFZL 5TGBB 1DEEA 3MOBH 4PJCA 3QIWC 5E5UB 3OAUH 1A7NH 1DUZB 1Q0YH 2VQ1A 2WQ8A 4OLXL 4MNGB 4N8VG 4O2EA 4XRCA 5JHDB 3LEVH 3ZDXF 4JFOA 2CKBB 1YN6A 3AUVA 1T66C 1TMCA 4W81A 2OK0L 2R0ZL 2IH1B 2DQJH 4IRSB 1DVFB 5DD6B 1TQCC 8FABB 2E3VA 1LO3H 3CUPB 4HKXB 4K9EH 4XP9L 3VXNB 5L2KB 2ZWLT 4PTUA 5KSAC 5ESAB 1QBMH 1FV1A 2AXFA 3JWOL 1TTFA 3DI3B 5FGBC 3UTSB 3O0RH 3VFWA 2NY2B 1IBGH 1U2HA 3DX8A 4N9OB 2ZPKL 5SWSB 2HJKB 1RJYB 1C16A 2FATH 2PKDA 4G42A 4ZYKA 1J5OL 3VXMB 4U1HA 2UVEA 3HTLX 4OF8A 4QT5B 5HYJD 2ZG1A 4HAFA 4G7YH 4KXZI 4N90D 3RTQD 4Q9BA 3NZ8B 1MFEL 1U8LA 3IS0X 4ZXBB 3L7FB 2IQAB 4X6CE 3K8MA 4QTHA 3ARZA 3RVWD 4NPYA 4K55A 3U0TB 2YR3A 1FL5A 4JPIA 1BQSA 4C56A 1HXYA 1OAXL 3OX8B 2NY4B 1ACYL 2BRRL 3ARQA 3MLTB 4XX1G 3BN3B 3Q3GB 3L3KA 4KJYB 5I16B 2DLTA 1U6AH 1DLFL 5EORL 4FP8H 3S35X 3GSNL 5L6YH 2BNUA 1VPOH 1P6FA 1U3YA 1WAAE 1I9IH 3V5DA 1N5AA 5T1MB 1YEKL 3QDGD 2XA8H 3ARFA 1K5NA 2A2QT 5F9JA 5D1XA 1F13A 4QGYA 5B4MC 5D4QA 3MA9L 4G9DA 2RAMA 2G5BA 1BX2B 3AAZA 1NJ9B 2DQFA 3VXOA 1C5CL 1CDCA 2VLKA 5ISZE 3RVUD 3GM8A 4M6NL 5I18H 3EW3B 3O45A 3VG9C 2CLVB 5FKPB 1WITA 3L5WA 3K80A 1EJOL 3L7EA 3GSXA 2CRZA 2QQNL 2YD3A 4K7PX 1NBYB 1S7TA 1TXKA 5CJOL 2BCKB 4XNZB 4DGYL 3GBLA 1MCDA 3V6FA 5LGKA 2PW2A 1LDPH 1NGWA 1A5FL 3C8HA 3IFOB 5SWZA 4KDVA 4NCC2 1BQUA 4KVNL 3OR7B 4PJDB 5KANG 1MLCA 4AG4H 4F9LA 4N1EA 1M7IA 1Z3GL 4O58L 4X4MA 2N4IA 4PJBA 3S96A 1NCNA 3GBNL 3AMKA 3LV3B 4R6UA 3JWNC 1HNFA 2VLJE 5CEZD 5HHXL 5D93C 3IDGA 3O6KL 4UQ2A 4HUVB 2A83B 4PJ5E 5EUOA 4GG8A 3U7YL 3VDCA 1F97A 1E28A 4BQ8A 4KRMB 3L6FA 5FCUL 1N4XL 4ZNEE 4R97B 3O4LB 3QIWA 4MVBC 1J10A 1IQWL 3O4OB 4V2CB 1J0YA 2YK1H 1QBAA 1ZLVH 1H5BC 1IAIL 1RQ5A 3JXAA 4U6TA 1AQDB 2UWEB 5I8CB 3MV8D 1KCUH 4RNRB 5I1IH 3MOAH 4O2CA 4YBQD 4HQQH 4YXHH 4V1DA 5E1AA 5EOCJ 2WSKA 2PYEA 3CFEB 5MP6H 2EC9T 5TJWK 3U30B 4OCYH 1NMCB 1IGCH 2AQ3A 3PV6A 1EBAA 1X5KA 1KPRB 1P7QA 1CDHA 4JN1H 5KSAA 3SDAC 4F9PC 5KVGH 2DQGL 3BVNA 2OTUB 3O3UN 3UO1H 4K8RH 3KR3H 5BVJB 3GHBL 5C6TL 1AGEA 4QHKJ 4S0TD 1JYVA 1HYRC 3PUCA 4QY8A 4N0RA 4PBVC 5FGBA 4GFTB 2EDBA 5JORA 1A7OL 1NGZA 3QNYA 4K23L 1DQQA 1RJCA 2ZCLH 5JW4Q 3EGSA 3QAZB 4JO1H 4JR9H 4NO5B 4L9DA 3W39A 1XF2B 1A22B 4HHAB 4MJIB 3ZKSD 1K2DB 5JW4M 1OWRM 4DGVH 3V5HA 2W1NA 3HZVA 1YMMD 5EWIL 3Q5OA 3HMWH 2X09A 2J6EH 3ELAT 4X5WA 1I8KB 1QFHA 3RGVD 5CEZH 1SEQL 4ZAKB 1V7NL 4LCIL 1WZ1H 5EO9B 3E3QC 4U6XA 5J6GB 1HIMH 4L3EB 4TNVK 2BSSB 3FB6B 3VCLB 2LE9A 4M5ZH 1CGYA 5DK0A 5C0NC 1YEJH 2DOCA 3UMTA 1J8KA 5GHWL 1NGYA 2YA2A 4GQPH 4Q7DA 2VSCA 2AI0L 2AV1A 2W0FA 2X4OA 4NC0B 3HPJA 5FGRA 4RIRB 4N1HB 2RB8A 1TVBA 3RNQB 4UNUA 4JRYB 3KPNB 5E8DL 5E2WH 1MWAL 1QLEH 3WFCH 5FDWA 2AGJH 3FFCE 1CFSA 5IIEA 2H1PL 4YQXL 1KN2H 4XPTH 3ZSTA 4Z7QE 1ZT7B 3MRGB 4BA8A 4JPWH 4YHKH 4HIJB 1QSVA 3HUJA 3UC0H 2AEPH 3A6CL 3DRQB 2VZUA 4M62L 1KIRB 3TPUA 2XWBB 4JVUA 5AEAA 2VR5A 2K1MA 2DICA 3QDJD 2CDGA 4RFOH 3HLAA 2VKWA 4BH8A 1B3JA 5C2BL 4Y19E 4IOIA 4OV5A 1EPFA 3C5ZD 1IGMH 3HNVL 1IC5H 3UJJL 2VLME 4ZTPH 4PP8C 5HVHC 2YPKA 5CJ8A 5D9SA 1N0LA 3WFDH 1F8TL 1H8SA 4BKLA 4WWKD 1DP0A 2DDQH 1BZQK 3LPWA 1G84A 1Q9WB 4J3VA 5BCAA 4CVXA 5E94A 3QIBB 4Y7MA 5HSFA 5GSVA 4Q0XH 3BIKA 4Z7NE 1AXIB 4APQC 3DNKA 3QZWA 5IB2B 3WLWC 5GRYA 3RBGA 1MJJB 1KFAL 5FO8A 5JO5A 4MVBA 1AD9A 2F58H 4I5BA 3RUGA 5D8JH 5EU6D 2V5SA 1E4XI 3RHWF 1H5BA 1EAPA 2VXVH 3BX7C 5BS0A 5JA8B 5KSBB 5DURD 1AKJB 3FQTB 4Z0XB 2C7UB 1T4KB 5INDB 4LHQB 2J88L 2NZ9D 5DQDH 1K8IB 5KBNC 5TQ2H 5L2JB 3CMOH 1BFOA 2ZCKH 1WJ3A 3DVFA 4YFEA 4NQVB 3L3HB 5E95B 4TTDD 3SDAA 4F9PA 1WFOA 2F5BL 2AAVA 1PSKL 2QADB 4HPOL 4GRMA 5KSVA 1DCLA 4GW1A 5E08L 2EE6A 4ACPA 1X7QA 4GXVH 5IGXL 4AIXA 3E8UH 1S3KH 2DWEA 1OAUH 2C4XA 1QOKA 1BQHG 2R15A 4PJGE 3S3PA 2IFGA 4U1IB 1E27B 1EAJA 2XKNA 2W0LA 5HY9A 4KK8C 3T4AA 3T0BA 3KPMB 1WWBX 5E8EB 4F7CB 4WUUA 4Z78B 3KHOA 4ZSOB 2H32B 3DOSA 32C2B 3B3IA 1R5WA 5AZEL 1OLZA 2NY0C 3TZVA 3IF1A 5FO7A 3VFTB 3CFJB 3P0YH 3E3QA 5FK9B 1I1CA 5BW7C 5KZCD 4LHUD 2A9NL 1OM3L 3TESA 2CKBL 4P23B 3GIZL 3SKMB 2ZKHH 2AVGA 2QKIA 1GC1L 4OM0H 5DHYB 3DMMD 3HZMA 2H2SC 5INCB 4LOUD 2D2OA 4Z7QF 4ORGB 4QOKE 4IS6B 3MJ8A 1ZA6B 5DJ8B 5I1GH 5GJSH 5I9QB 1DLHA 3IFNH 3MUGA 3CLEL 4LLYA 3QISA 1IT9L 5ALCH 3OKNB 4P46C 1WVZA 2GFBB 1Z9MA 1LEKA 3S4SA 4M5YH 4FFZH 5T33H 4UNTA 3VFGH 3T0DA 2EZ0C 1T0NA 4PJ8C 5DUBB 4M9PA 4WW2B 1NCBL 1R5IB 4MA3B 5J1AA 5ANMB 1IGJA 5FGCE 4YHML 5HYIA 3BN9D 3QIWD 3CXDH 1FQ9C 2XG4A 5DC4B 3QQ4B 2DYPB 4QRRD 5IG7A 5C09D 1YMHA 1WWAX 4I2XB 5FYKD 3RWHB 2ED7A 1KLUB 3T0XA 5IFJA 2HMID 3VG0L 1YNLH 2R1YA 4X4YA 1V7MH 4UIKL 2GQHA 3QHZH 4LLAA 4X6BA 4Z7OE 5DRZB 4FABH 2JIXB 3B9VA 1F42A 4PRHA 1K4CA 1F6AB 5TF0A 3UTTA 1L0YA 1HHKB 2W9EH 2XXMB 3FKUS 4KZEL 4K94L 3B83A 2OS7A 1HSBB 3SE9H 4LCUA 4APQA 2MQCA 3NFPB 4XXDB 2ZUWA 1P4LB 1H3GA 3EKCA 4DZ8B 4MAUL 2BVEA 1QPPA 1XCQA 4G9FD 1A6TB 4OD1L 2Z8SA 3HNSL 3FO1B 1SM3L 5IM7A 2GJ6A 2V2XB 2VDKH 12E8L 4N8PA 3QUZC 1CL7H 2WWKO 4GQ9L 5C08E 3PL6B 4R7NB 4P2QB 4I48A 3HRZA 4WUKL 3TC9A 4OCNC 3PDGA 5C9JA 1FLRH 3UZEA 4BSWA 5IF0A 3DV6A 4ODHH 3PGDA 2P45B 1OB1A 4EXKA 4HH9B 4M1CC 3RVTC 4FFYL 4NJ9H 4XHQA 3HE6D 2ITCA 1MRDL 1KELH 3ARDA 1UC6A 1DQDL 3KJ4C 5FYKH 4JANB 4PJFA 3WL9B 1R3IH 4GBXC 4QHNA 3FT3B 2A6IA 4PV8B 5F7LB 2FYYB 1X4YA 4OCLC 3BZEB 1FIGH 1OGAB 1DR9A 1OD9A 5GGRA 1AGBA 1FNAA 2AJSL 5JR1H 3CH1B 2C9AA 1G6RB 5E99L 1KULA 4YR6A 3S3JA 2ID5A 5BW7A 5C70A 1CD8A 4KAQL 3DUSB 3JWOC 5C07A 4YNYA 2GTZB 5D7KD 3MJ9L 2A9ML 1Q0XL 3X14A 1UM6L 2VQTA 3REWA 2YKLL 5HPMA 1FYHB 3MROB 4XAWL 3TBVB 2R29H 1JFMA 3UPRB 1YNTA 5DEZA 4JFQA 1A0QL 2X40A 1W0WB 3G5XB 5FA4B 3OGCB 1TIUA 2ICES 2H2PD 3B2UC 3NPZB 5JNYB 1TZHB 3ES6B 1Q8MA 4LLMA 4HC1A 1T04B 4P46A 2P8LA 2XTJD 3G9VA 3VXSB 1QLFB 3BJ91 3WFEH 1BD2D 4Y16D 2FJGA 3BDYL 4TSBH 2EIZB 2DJUA 5KVDL 4LEOB 3UTOA 1CN4A 1RVFH 3L3JA 4G6FB 2GIYA 1PYWB 3P40A 5T1KA 4Z7OF 4PGCA 4TRPH 1CWVA 3PGFH 2VISA 1RSFA 1U92A 4X4ZA 4MWFA 1IARB 4HBQA 2FGZA 1A6AA 5IHZB 1OAQH 4KK5C 1AGFB 4OJFH 5E9DE 1NGQH 4PB0H 3RL1B 1A4KA 4PGBA 3LKNA 4C59B 1SMOA 2BVTA 4YHLL 5FYJL 1KTRL 5I75C 1KIQB 5M95B 4QCIA 3FB8B 3BEWA 3VXUE 5FOBA 5DFWH 3G04B 1P7HL 4FRWA 1F90H 4HS6B 4HIEA 1CF8H 4HCRL 3X3GL 3QWQB 1TJIH 3VMPA 1MCLA 3H6JA 3TFKD 3DIFA 5C0GB 3TIDA 5GGQL 5TE6L 5ICZA 3T2PA 3WLBB 1CICC 3MGOA 3R1GH 3F7YA 1U8JA 5EBWB 3UJTH 1AO7B 3BIAX 4JVPA 3TVMC 1FZKB 25C8L 3G6DH 3VFVA 5BVPH 4CNIB 1VEPA 3TZVD 4PRIA 1AE6L 5GS0L 1QA9A 3QIUD 3KYKL 5KSUA 2PUQT 3O3EA 4M1DL 3MRCA 2BNRA 2DIAA 1RAMA 1CD0A 1TQBB 2Z8RA 4MXVF 2GITB 4I4WB 2F54B 4POZC 5EOTB 1RPQA 1RZ7H 1ZVSA 4OZFB 2BVQA 1LE5A 2B4CL 4QXGH 1RZFL 5ICXB 4GBXA 4FXGA 3F58L 1LILA 5EUKB 1T0MA 1TITA 3VA6A 4HMEA 4XP5H 4FFWC 4NQCA 2PO6C 4X80H 4NFBA 1MRCH 4LMQE 3MC0A 1JRHH 3N85H 2O61A 4U2YA 5J0BA 1QP1A 4GW5B 1JGVH 4FXLA 1FFOB 4MDJB 5FYKU 1R5VA 4OKVB 3WO4C 2J8UF 1GGIH 3SOBH 3P73A 3VXSE 5IV2B 4FZEH 3KPRA 3QO1B 2VITB 4H25B 4WY7H 2FSEA 4LRNL 4QO1A 3HI6L 5D2NE 4NP4L 3VFPB 1X6LA 4DW2H 3ABZA 5IHBA 5JIIA 1FZJA 4TULL 1RZGB 1NCCH 1XR8A 2MHAB 2NW3B 4IHOA 5F6IC 3VI3E 3NIFE 3LRSA 1J0KA 3MBXL 3QG7H 5JHLH 1F6LL 4XGZA 3HC4H 1JMXA 1IL1B 3UAJC 2C26A 3GUTB 4FQXD 2VLRA 4OV6F 4Z7WA 5LXGL 1ODAA 4NQDE 3CMGA 4NO0D 4D9QD 1LO5B 5TH2B 3GSNA 4HUMB 4HIHA 4MQXD 4XPBH 3FOMA 3DX6B 3EYQC 1K3ZA 5SX4H 3UTQB 1U8HA 2E7LC 1FGVH 4U6YA 1KCGC 3LKOA 5F1NB 1RHFA 2GJ6D 2F5AL 4ALAH 4YC2B 1XZ0B 3DYOA 1ZT1A 2R8SL 4KTDL 3D2UB 2P8MB 4RRPA 1JYNA 3ARBC 1SEBB 1HXMB 4MNQB 3RDTC 4NZUH 1Z2KA 3IVKB 4L29A 5DMKB 2AEQH 1DANU 3OJDA 4JKKA 5AZ2H 4LKXB 1EHLL 2V2TB 3LZFH 2D4DA 4NYLA 3WCYA 4ZS6C 5FYLD 3V0VB 5DS8B 3BUYA 3GI8H 2R0WH 5EZJA 1NEUA 4UU9B 3UYRH 3OPZL 3ZYIA 5TDNB 3LEXA 1MCPH 3E6FB 1IQDA 4Y8AA 5EN2B 3MYJA 4CDGC 1MCQA 4G7VL 3ARDD 1VA9A 4F7PB 5ETUA 1P2CA 1A47A 1CICA 4JZJB 4G8GB 1A7RH 4J4PA 1GAFH 5KJRH 3QQ3B 1CD1A 2P8PA 2VE6B 1D6EA 3O2WL 3PQYD 3TVMA 2A6KB 2VXSL 4JRXA 4H0HB 1QSFA 1A1MA 1YUHA 1A9EA 4HG4J 5IJVA 3O8XB 4LQFL 2COQA 3ULUD 1V05A 3K3QA 4QRTB 5GISL 1QG3A 4OB5H 5KANI 3NCMA 4F58L 1S7XB 1XF4A 1LP9B 3IAGC 5MEQB 4ODVH 3BT2H 4XC3L 1VFAB 5EB9A 4N0CC 4XPFL 4WFEE 2GJJA 3D85B 4LSPL 4BJLA 4N0UE 4XNQB 4N8VB 4OZ4B 4NKOB 3IKKA 4ODUA 5JPMA 3VW3L 3P4MB 4LIQL 4OZIF 2XRAH 5F3BA 5D1QB 1PQZA 4PBXA 1IM9B 3OQ3B 1VEMA 4GKSA 4PRBA 2VO5A 5JQ6L 1J8HB 1QRNB 4ODTL 3VRLE 2YRPA 1CLZL 2XN9D 5FCSH 1KC5H 1PZUB 1ZGLB 1N3NA 2PO6A 5L0QC 5D7LA 4TSCH 4CKVX 1QSZA 2FL5B 2WBKA 5EU7E 2J7LA 1JGEB 2DQTL 5HHME 3D39A 1HH6B 4Q2ZA 3AM8C 3TBTB 1EO8L 3MLSH 4OLEA 5E0QA 3SY0A 1XFPA 3TPKA 1HHHB 1PEWA 2JLLA 5I73B 3U46B 4GAJH 2OXHA 1HH9B 3VI3F 3NIFF 5F7HA 1T5XA 4JKMA 4NNXA 3BHBA 4P9ML 5ADOH 2ICWI 2HH0L 1JZ3A 2XY1A 4DEPB 4NNYA 2VXTH 4NDMB 4N0FB 3T77A 2YSSB 3VD7A 4G6KH 3EJYC 4Y0GA 5E2JA 3PWPA 4ONGL 1W8OA 2O5XL 1ZTXL 1B0GA 3EO0B 2P5EA 1NUFA 4HMDA 3TYFA 4EKXA 1KPVA 4AEHL 2X89D 3OR6B 4M02A 1JHTA 4RWYL 1BIIB 1T5WA 5DZNA 1B4JL 1OT1A 2HA1A 5ENWB 4ZDHA 3BPCA 1KEML 1VACA 1UQSB 2W9DH 4PJHF 5DDHA 3ET9F 2ZUUA 3EOYG 1UT9A 5E7BA 3D1MC 3MMEB 3CU7A 3FQWB 4Y88A 3I3EA 3MGTA 3NCBB 3ULVC 3H3BC 4P2OB 3PDDA 1GC1C 1ROWA 2E7LA 1IKFL 3I9GL 3EJZD 3SCMD 2W9LA 4IRSC 5JXAH 1DVFC 2RQ8A 1H3PH 1N2RA 2APFA 3GO1L 3D9AL 1WQVT 1G6RL 5MENB 2QJDA 3HR5A 4GSDL 1F4XH 3ARBA 4HC1H 2V7NA 5DSCB 3RL2B 5KG9B 2Y36L 5CHNA 3RDTA 3HFMH 4G8GE 1WIOA 1SBBA 2NY2C 3KPQB 1QSEB 2P5WB 4X6EA 3C09B 1NEZG 5L88H 1DBMH 1NLBH 2VZVA 4NO3B 3MLUH 1HZHH 4ZXBC 3RHWK 3GMMB 1LP9E 2WUCL 3BAEL 4QWWC 4KJQD 1MFAL 2EH8L 4LAJH 5HGAA 2MOVA 5D5MA 1MPAH 3OAZK 1OSPL 1HSAB 4H26A 1B0RB 4LL9A 4P0DA 2BOCA 2NY4C 3IJYB 5MHSD 3QSKB 2OX5A 4K3JL 4GUPB 4HJ0C 1CXLA 4DAGL 4P2CG 3V4VH 5DZLA 5KVFL 1OAYL 1KB5H 1KJMA 3CGTA 2ZCHL 2ADFL 4I8DA 2MPAH 4AIZA 3VRLF 3G5YA 3MREA 4H1LB 1DBBH 2OSLB 2FHBA 3U4EA 4N0CA 1WZLA 3MR9B 3LPGA 5GIRB 4PP1D 3SJVE 4K94C 5JUEL 1BZ9B 3QEQA 3QNXA 4E42B 1FNGB 2AJZA 4KTEL 1JHLL 4F37F 5ICYA 1KCSL 3E2HB 2CRYA 1YEIL 5EZIL 2XFXB 3KAAA 3M8OL 4JY5H 3UTZA 3QQ9C 2ICWB 2GK0A 1Y0LB 5MEOB 4G8IB 2DD8L 4HUXB 4L4TE 4M4RA 4WENB 3KYOB 4NKMB 3KHQA 3X11B 4XNZC 1YPZE 4FOMA 5C2UB 1CBVL 3ILPA 1TCRB 1O7VA 1IGFL 4FQCH 5HJ3B 1FZOA 3AM8A 1IAMA 2C3VB 4JFZH 4E0RB 5BRZD 2ESVD 4Q6IB 1OL0A 4TSAL 4PTTA 3B9KB 5FM5M 1R24A 1T0PB 1JNLH 2AP2A 2FZ3B 4XTRC 4XWOD 3SDYL 4ETQA 2WBJD 4OLXH 1I1AD 2BNQA 1JGLH 5CEXB 4JFDE 3FQUB 3TO4D 4Z7UA 2EDTA 5FF6B 3TN0B 4Y4HB 1RK0B 9CGTA 1XGTA 3QFJB 1YNKL 5FO9B 1HQRA 4JO4L 3ZE2F 2D7QA 5DWUH 1YYLL 4HXAL 4XP9H 5TGBA 3ALWA 4R97C 4LSDA 3RZCB 2GAZB 1EFXD 2EEAA 3H3KA 4DUW