1HSBA

Different length peptides bind to hla-aw68 similarly at their ends but bulge out in the middle
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
270
structure length
270
Chain Sequence
b'GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68.1)
publication title Different length peptides bind to HLA-Aw68 similarly at their ends but bulge out in the middle.
pubmed doi rcsb
molecule tags Immune system
total genus 77
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 1993-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hsbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1hsbA01
1XT5A 5DD3L 1WSST 1I1AD 5FYJD 4UIMB 3RTQD 5D72H 4HWEH 3ZHLA 5IK3B 4A2LA 1N0LA 1S3KL 2IWGA 4Y4HA 1QA9A 3BUYA 4QHKJ 2R4SH 1URLA 2FD6L 12E8L 4L8CA 5HHOE 1JWUB 3MV9E 3L3KA 4WWKB 4HK0A 5BW7C 4A6YH 5FYKH 3IJSB 3ZKXC 1TFHA 3LHPL 2EDNA 4YDIH 1CD0A 3ARBB 1A2YB 5ACMA 4GQ9H 2YUVA 5ESQA 5HGDA 3ZT6A 4HLZG 2F54D 3I6GA 2YSSB 1KXTB 4UV7H 5HHXH 3THMH 3OKLA 3HG1D 2EC9T 4OUUA 3CFKB 5FUZL 5ITBH 1J8HD 2AJZA 3QIUA 5GGRB 3VE0B 2A83B 5D1ZD 1BGXH 5ICYB 1F58H 4RQQB 1RQ5A 4RAVA 2XXMB 1MUJB 3CLFH 1JGVH 4PV8A 5DURD 4QWWD 4TPRH 4OM1H 1RJZB 1AGEA 3T4AB 2H2PD 2YUXA 5D2LB 4KV5F 5GZOC 4KKAC 2R0ZL 1LNUA 1SY6L 1JZ4A 4LLQA 2IAMC 3GMRA 1ACYH 1G6RH 2X4OB 4NOBA 4ODTH 3HPJB 5DMKA 5F3BA 1TJHH 1JYVA 4JHBA 1KN2L 2NY2B 5J13B 1D6EB 4ZO8A 4H88L 3PHQB 4UV4L 2Z31D 4ODXB 4LDEB 3RKDC 2GSGA 4HKZB 1ES0A 4GS7B 1MF2H 5IB4B 3NPSB 2HFGL 3DX7B 2HLAB 1FC2D 3VXPA 4B0MM 1BM3L 1FVEA 1RUQL 2HWZH 1GCFA 3VFTA 3LKSA 4K8RC 5K33A 2NXYD 3KLDA 2ZKHH 2BK8A 5E4IA 4HJGA 4QKXB 4I3RL 3PHSA 4PJGE 3DRQB 4HGKC 2DQHL 1Q8MA 4UIKH 1S5HB 1J18A 4OFKA 5C2BL 1OAXH 1K3ZA 1QVOB 1A7OL 5DJCB 5J11C 5EO0A 3RWEA 2J6EA 1WAAF 5DD6B 3B9KA 1NEUA 5FGBA 2FSEA 1OLLA 4POZD 5IHLB 1KPRB 3HZKA 1INQA 3GMMA 2V2WB 3WD5H 5EU6B 1NJ9B 2P49B 3IU3B 4QRRA 4UNTA 1IEBB 4GW1A 1KPVB 4KQ4H 4U6TA 3RWJA 4P23B 1QLEL 4R26L 5C0GB 4YNYB 1CTOA 3BDBA 2FECI 2R1YB 3OPZL 2PW1A 4V3EB 3L3IB 3MLYH 4HIIB 1KIQA 1AGDA 4ZNEA 4GKZA 1QLFB 3GMOB 5FCUL 4YX2H 4PJHB 1U8NB 3MV7D 2EECA 3C60C 3STZA 2D4FA 5HHNB 4UQ3B 5GRJL 1RUML 2VB5A 3QEHB 2AJSH 4H1LB 1GXEA 1U8IB 1ORSB 1JHTA 1R3IH 3OXSB 4A6YA 2QQLH 4I2XB 3LD8B 3P77B 1DQLL 3D3VA 1T2QH 4OCYH 4X6BA 1MI5D 1MWAL 1KELL 3BD3A 3MLRL 5HDQH 5DUBA 4PDCE 1AO7A 3VD5A 5T33L 4OGAD 1CICA 3LV3B 4X7DC 2P43B 3LB6C 1TJIL 43C9B 2EYSA 1SEQL 4F2MB 3IDXH 4JFXA 2MCPL 1K6QH 2HKFH 2WM0A 3CVHH 5CWSB 2XWJB 3M8OL 5GS1C 2BNQD 1N7MH 4X6CB 4DKAA 3C2AL 1IRAY 3LKOB 4KHXL 4XX1E 3SDCB 3CSYB 3MRLA 1IGTA 1KCLA 2HVKB 4MNQB 2F15A 2HFEB 5F44A 4JKPH 3E6HB 4BSVB 5KSVA 4PJDF 2ICWJ 4MXVE 3WYRA 4G43A 1J0HA 4OGXH 3BRDA 4KKLD 2LFGA 4AY0A 4PJ8D 4ZFGH 5EBLA 3MV9A 3ROOA 1R3HB 3QCUL 1A02N 4HCRH 3GBMH 1NUGA 2VLKE 3U36A 5DUPH 1ITBB 1B6UA 4NZTH 3IKCA 5I75B 3HZMA 3QIBD 1MJ8H 3KAAA 1JWSA 3CDYA 3Q0HA 1J05A 1CGWA 2LU3A 4U05A 4K3JL 4XXDA 1U3HA 1MCWM 1MOEA 1RFDH 1T0PB 1CT8B 5FO8B 1IARB 5M94B 1CD1A 5BXFA 1QNZL 3HAEA 5KANI 1PYWA 1LK3L 1JNLL 3N85L 1YDPA 4DUWA 1PKOA 4P2RA 4MA8H 4JZJA 1ZLVH 4OQTH 1CG9B 1NCBH 4CDGC 3IDNA 3MJ8A 4K9EL 4P49A 3MFFA 5DYOA 5EOCH 3FB5A 4EVNB 4H8WL 2P5WA 4XCFL 3GI9L 3LPWA 4K07A 1UENA 5TFSH 3C5SA 3C08H 4JM2D 4LRNH 2FCBA 4LARL 1QFHA 4NQTA 5JPNA 1BJ1J 4TSCL 1HSAA 5JHDA 2ZOLA 4WFEE 3TLRA 3QNYB 1AIFA 4ZAKB 1TJGH 2DB8A 4EDWH 3T65B 4OLXH 1QBLL 4IRJB 4EN3B 1T5XB 5EC2A 5K9OA 1F3JB 5GGUB 3SE8H 1EFXB 4GBXB 4F9LA 4GSDH 1JTOA 2GUOB 5D2LE 1JGEB 5JLZA 4NO3B 1OGAB 3QUYD 1FRGH 3ERYA 4ZFFA 4I8DA 4U1IB 1NMBL 2B39A 3F62A 3O2WH 4YDVB 4TQEH 4MD0B 3MLWH 3R0MA 4PJGA 2JJWA 4WY7H 4UILH 4DGIL 1ZHLB 4HMCA 4G8IA 2AERT 3AAZA 5MERA 2HJFB 5GGTA 4Z7QE 3IFLH 1XR9A 5C0EA 4JRWA 1RZ7L 4IDJH 4L5FH 1FZJB 1F8TL 2YUWA 3O3DB 4XP1H 2KBGA 4TULL 5F6HI 1WZKA 3FTGA 3ZKXB 5CZXC 2KL6A 4OLUL 3PUCA 4KRMB 3CVHA 5I0DA 3R1GL 1YQVL 1T2JA 2EDOA 3BKCL 1GZQB 3KJ6L 4OI8A 2VDPL 4QF1A 2ZOKB 3QCVL 2CDFA 4OFIA 6FABH 1KIRB 3QHZL 2B5IC 1KN4H 5SWQB 1OW0C 1QSZA 5MP6L 2AEQH 3HMWH 1QR1A 2W0FB 1ZHNA 1M71A 1S9XB 1WICA 4E42B 3E2HB 5IVZA 3QNXB 2FO4A 3BIAX 3UTPD 1TQBC 3TBYB 1KCUL 1L0QA 1NEZG 2AI0L 4OCXH 5AWNL 5HDOA 5I8CA 3ME0A 1KEML 1BLNA 3DYOA 4P2OA 5CIPH 3I9GL 4HD9A 1LVEA 4RGOH 2W91A 1C1EL 2MKLC 3OR7B 1YNKL 4HLJA 1N3NB 4P57B 4RBPK 3QULB 4NRZA 4ZMAT 2Q8BH 5ADPL 1BIHA 2XPGB 3BKMH 4PJHE 4AH2B 2CRYA 3VA6A 5GXBB 2CJUL 2EO9A 4N1HB 3WSQL 3LPGA 1H8OA 1MFNA 4JAMB 3WJJA 3QUKB 2Z35B 4HKXB 1OQOA 2HAZA 3TYFB 4I2XE 5JPMA 1F11A 2NY6D 1TQCC 1B0WA 4OQTA 5SV3A 1CIUA 4MJ6A 2NX5B 5E7BA 4HMEA 4JFZH 1MCPL 3MLSH 5IHUH 2FBOJ 2VDQL 4G9FB 1NLDL 2AQ2A 3WIHH 5A16B 3SE4C 1CBVL 4GRLB 4LPXA 1U8QB 2VLKA 4X6CE 3JV4B 3TCLA 4MZ2A 4NPYB 4QRTA 4QNPF 1T04B 4ALAL 4L4VB 1NANI 5FM5O 4D3CH 1A7RL 4MNQE 1MPAH 3MTRA 2VLJB 3GHBH 4XP4H 5IK3A 5L8JB 1JNNL 5ADOH 3SJVE 1CFNA 4YFEA 4Z7UA 1FNFA 4FQIL 1JWUA 1EVUA 4XCYB 3BP6B 3F58L 5GQBA 3VFMA 3IJSA 4JN2A 3QDAA 5BO1L 3ARBA 3O6ML 3GB7A 5F7EH 3REWB 1FJ1B 25C8H 2CIKB 1DE4A 1U8PA 2A6JB 1G9NC 2ZSWB 2VLME 2FGWH 1MAML 3KDMA 1IQWH 4JJHA 4LCUA 4XHJC 1EAPA 3B9KD 3OKNA 4YGAB 1A4KA 5CSGA 3D18A 5ILTH 1J7VR 4XPTH 3JSSA 5B8CC 3P73B 4HLZH 4QRRD 1UJTA 4GG6A 5BZDA 1IKNA 3RVUD 2WY3A 1FORL 5F7HA 4I0KA 3AS3A 3T4YA 1XGTB 3ZYIA 2ZCHH 3C09C 1YMHB 2MQ3A 5FUCC 5ETUB 4OFPA 4LSSL 2J4WH 1G7LB 2WK2A 1K8DB 2HJKB 2KZ1B 3QO1A 2VLLA 5FKPB 4NZDA 5E8OB 1WC7B 1YY8B 2Z4QB 1QHOA 4Z7NF 4OLVH 3OB0K 1AD9A 4Y2OA 3WXVL 4ZD3L 5KW9L 1H3GA 1DN2A 1UCBH 5HPOA 1BZ9B 1NL0L 3ARDB 1D5ZA 2XKNA 3D3VD 5CIPA 1OP5H 3VXRD 2A9ML 1RZKL 4XMPL 1AO7D 3QPQD 1CICD 4JO4L 1PZ5A 5EZJA 2DI7A 3NPZB 1MFEL 4G6MH 5DK2B 1S7XB 3JUZA 3E8UL 4N8PA 1MCHA 4GW5A 5I76A 3G5YB 1NEZB 2UY6A 5I1LB 3SDYH 4GUPB 3RDTD 4LIQL 4NT6A 5JR1H 1M7XA 3SOBL 5ALBH 1MHPH 4LHUG 1T21A 2XQBH 3I02B 3OAYK 4LSVL 2Y6SD 5BJTB 4YHOH 2R0WH 1IT9L 5LVEA 2Q7YA 3V4PH 3AROA 5CP7A 4TSBL 2OJZL 1OAYH 3MV9D 2RBLA 4CN4A 4D0BB 3MLXH 5DJXB 1QRNB 3MGTA 5C9JB 5I1IH 1XCTA 1IEBA 5T3XE 2NY4C 1RULL 2G2RB 4IMLA 2CLRA 3SQOL 1WBZA 1X4YA 4TRPL 4RIRB 3HB3D 4P59L 3TA3A 4HIIA 5HYJB 2X4SB 5F1KC 1VACA 1U3HD 4PGDA 4P46A 5DD5H 5D93B 5HGHB 4Y5YC 1TETL 1BX2B 1GH7A 3PWVA 1UYWH 1CLZH 5KVDH 4XAWH 4E5XB 2AQ1A 4P2RD 4RFEB 2B0SL 4OJFH 3V4VH 1NGZB 4QT5A 5C0ND 3GSRA 4H20H 5AYQA 5J8OA 1T3FB 5CLWA 1D6VL 2OQJB 3QUMA 1XH3B 2DQCL 1HDMB 1U0QA 4J7RA 2P5WD 4U7MA 4C58B 1VKXA 3OMZA 4URTB 1F90H 2PXYD 1OM3L 4ZTOH 4NCC1 3BP4B 5D7IA 5T3XH 1KTLA 4X6CA 5EO1B 4MHHG 3TVMB 5JHDD 5I19L 4K9EC 3TT1H 3KPMB 3MNVB 3S34H 4FFVD 4H8WC 1A6ZA 2PTUA 5AZEL 5HYSG 5IBLD 4OF0A 1BAFH 2HFEA 2NX5E 4M9OA 5ERWA 4JKMA 2CXGA 2UVFA 2YA0A 3MBEC 4XCNA 3SJVA 4WV1A 3FT2A 2QQKH 2WUBH 3BE1L 2VAJA 5DMIL 2Y07H 3P0GB 1GOFA 1R24A 1MAJA 1SJEB 2KDGA 5IB5B 4Z77A 4Y16C 5BVJB 2A6KB 2B5IB 2R2HA 4PJIA 4L4VE 4YIQA 2R23B 4XC3L 4HDIA 1OP3H 4JFEA 1BOYA 4R2GC 2VLJE 5FYLD 2VDNL 1ZXQA 5I18L 1SHMA 1HILB 5C0DB 1NDMA 1B4JH 3SGDH 2CIIA 3IJYA 4M7ZB 5IFJB 2PR4L 5I1EL 2Y4SA 2XQYK 4ONGL 3D0LA 2JK5A 5L6YH 4LSUL 4BJLA 5HI4D 1XIWC 1CVRA 1T6VN 3CSBA 3ZKMD 1SM3H 5DJ2B 3O3EB 3QQNA 5F1IB 5MHSE 1JPSL 3UDWC 1I9IH 5IIEB 4XI5D 1MHEA 2ATPB 5DQ9A 3B9VA 4G5ZH 4K8RH 1J0ZA 4EVNA 4FQ2H 2SEBB 4IRZL 5ELIA 2A9NH 1UWEL 3JXAA 4LQ1A 4N5EC 4EQ3A 4G3YL 4QRQA 4PR5B 5TPWH 1H0DB 2JTDA 1FYTB 1RHHB 1RUAH 5HY9B 2A6IA 3JV5A 3IDJA 2W9DL 1S7SB 2WLYA 2KKQA 3QIWC 3CLEH 3FJTA 4KJQC 3QNYA 4YHLL 4XP6H 5CGYD 4NFBA 5DJ6A 1QBAA 4H25B 2APVA 3T65A 1YEDA 4EN3A 5FCSH 1B4RA 1KULA 1XEDA 5HVHB 4LHUB 1JF1A 4P2OD 4KV5E 1N2RA 4YXKH 3CVIH 3X11A 3LSOB 1ADQA 2DMBA 1WEJH 4L1DA 5F96L 4Y2DC 4ZS6C 4C83B 3WIIL 1JGEA 4NC0B 4DAGH 5C0JA 4XNMA 2DTSA 3DUSA 3BZFB 5T5NF 4X4YB 5JXAL 3BISA 2OTUA 3QJHA 4ZUVA 5INCA 1KENH 5SX5H 2FNBA 1LEKB 3PDOB 3PGCB 2VIRB 2VQTA 4IBLT 3W2DL 3NIGF 4HMDA 1H3TA 3IXTA 4G7VH 3TNMA 4OCSL 1AGBB 1DLHA 5FA3B 2H3NA 3LQAL 3WNNA 1KJ2B 2XZCH 1ERNA 3PWJA 4JFHE 4LSRL 1NC4A 4RX4A 4LCCC 2BC4B 2IH1A 2VLKD 4PLJD 1FC1A 1EGJH 3J7HA 2V7NB 2DD8H 1MCOL 2VYRE 1WAAE 4IIQA 1GZQA 3OHXB 4NSKB 3GKWH 1SBBA 4GKSB 2JJTC 4YK4C 4NUJA 2EDBA 5SWQA 3QYCA 1JI1A 3HPLA 3SDXA 2D9CA 5EU7E 3L5JA 1JZ3A 5IQ9A 2OL3L 1R5WB 1WTGT 1AP2A 2UZIL 2X09A 3BGMA 1R3KA 3KYKL 2MHAA 4K3DL 1MCSA 1V7NL 1INDH 5I1DB 4U1HB 3DBXB 2ED8A 1HZHL 2ADIB 5DT1H 1X6NA 1EUTA 1OCWL 1CFQA 3FO1A 3HMXA 3GMQA 2ZCLH 1RIVH 1ITCA 3TO4C 5I9QB 4QXWA 4JG0H 5HYSB 3N06B 1QSFB 1SYVB 2F53E 1U8MB 3ESUF 4NQXA 3S35X 1IFHH 4UNVA 3SKNA 1UZ8B 3UJTL 2EZ0D 1OTUD 4PRBB 5E6IC 3VH8G 1F4AA 2ZPKH 3P3YA 3SO3C 4LHQB 4K3GA 1F6LL 4OKVA 2ID5A 1T89C 2QKIA 3GKZA 5H35B 4ZODA 1NKOA 2DIJA 1A7NL 4M6OL 4NP4H 1JCKA 3WNMA 3QQ4A 4OZIF 2OMBA 4JPIA 4PRAB 1A0QH 4TYUA 2DDQH 8FABA 1SEBA 1AGFB 2W38A 2Z8SA 2ZZUT 3SE3A 4AENA 43CAA 4P4KC 5HHPB 2YRZA 2C3XA 3AXLA 1ZA6B 4ZXBA 2R2EA 1AJ7L 4MX7A 4UBDC 2E9BA 2DYPB 5T3ZE 5I8OL 2HTKD 1RZGB 2RAMA 4NZRH 3B6SB 4CU7A 2ENSA 5J57B 4ZO9A 1QP1A 1EUUA 4PJDE 5IEKB 4L4VA 4QY8A 4R3SA 2UZXB 4F8TA 2VLJA 5F7DB 2GITA 5IBTL 1F6AA 2D03L 4OD2B 2AJXL 4XP9H 1S7RA 1KTDB 4NC1C 1JFQH 1FGNH 1ZANH 2DQTL 3ZSSA 2NZ9C 4WDIA 3V0AC 4KJPD 4AEIH 4WW1B 3DUHA 3C2SA 2E9JA 4WFHD 4PBVC 1FJ1A 5IB3A 2BMKB 5CSBA 1RZKC 4F58H 5F9OL 1OSPL 5C1MB 3IB4A 4PJFA 1U93B 4IS6B 5CJBA 5I74B 5E8NA 2N7BA 4CADA 4WW2F 3U4BH 2JCCF 1TPXC 1AC6A 1N6VA 2A74A 3HE7C 5T3ZH 1FAIH 1F3DH 1KLGA 1M7IB 5FDWA 2Q87A 2NY0B 1EBAA 4FABH 3Q6FB 2X4UA 3I6KA 3V95A 4LK4A 4IRSA 2OK0L 2A1WH 5BMFL 5HBBA 5CINL 2D7OA 1I3VA 4YE4L 1U91B 1S9KC 1A8JH 2EE9A 2P5ED 3L3OA 2WWMD 1QKZH 3HR5A 4KK5C 4S0TD 2OSLA 3TA3D 3HFML 5C7XL 1IC7L 4XMLH 4P46D 5E70A 1FYTE 1G7IA 5EC1B 4PP1D 5EU5A 2CLZA 4WU5B 2Q8AH 3VFUA 3VFGH 3VI4E 1N6UA 4PRDA 5K9KB 4OD3L 4OZHF 4L4TA 1DL7H 2N1KA 1ED3B 5CSZA 4OLEA 4EKXA 4Y0GA 1YNLH 4HKJB 4PB0H 1BZ9A 4HK3J 1TVBB 4D2NA 1FN4B 5B4MC 3MBEB 4P5MA 2VXVL 5EN2B 1CLOL 1QHPA 4Q9QH 3UAJD 2OR9H 2YPVH 3DLQR 5T1LB 1FZKA 2GEEA 1YEIL 4NO5A 4ZUUB 1VFUA 3X12B 2UYLA 5ACZB 3WDJA 3T0WA 1PLGL 4UOJA 1WAAA 3UO1H 1TCRA 4U33A 1U3YA 3M1BA 2DMKA 1T0NA 4HV8B 5DRZB 5DJ8B 3S37H 4N0CA 4LP4A 3VH8B 3U30C 4ZUTA 1U8LB 1A1NA 1WBYA 5T5NG 3D48R 3ARGC 3RU8L 3T77B 1KPUB 3SJVD 3L7EA 3C6LC 1CK0L 2PYED 4O2CB 5C6WH 4CVXB 2CLVA 2Y36L 3G5VA 4MCYB 5DJXA 3SDAC 2EEBA 2YK1L 3EOBA 5FUZH 3CU1A 3KLHC 1QZ1A 1MCNA 2Q6WA 2F53A 4FQHB 3MOBL 3OBAA 5I1AB 3AU1A 5DWUH 1U8JA 4JFED 2VLMD 2E6QA 5EORH 4W6XB 1I8IA 1XR8A 5HGHA 4OFYA 1BD2B 5C0CA 3MV8B 2R0ZH 4RFEA 3EZ8A 1QSFE 1NCDH 4HSQA 1HH6B 1T3FA 1EH9A 3CXDL 3NTCL 4I9WD 1KJ2H 2YHGA 4GMTL 1HDMA 3KPOA 2EDQA 4UV4H 4NRYB 3GGWB 1KYOK 2Z91A 1JHLH 4OB5L 3BP4A 1BM3H 5F88B 1FP5A 1UWGL 3GUTA 3ARUA 1VA9A 4PJDA 2ICES 2R15A 2FZ3B 5A1AA 4ONHA 3WNOA 1IAKB 3QDMB 3LRHA 1EEYB 1I8KA 3H0TA 5C2BH 1DBMH 1A7OH 5H8DA 4OGZA 4FQXC 1MLBA 2EDHA 2Z8VC 3UJJH 3KPNB 2R1WB 3ARVA 1AGCB 5C3LD 4KWUA 3ES6B 3I50H 1I75A 4X9IA 4NQEB 2IJ0C 2QHLA 3G5XB 4MA3A 5BVJA 4G6FD 1S9WA 3O41A 4M62L 1MH5A 1IBGL 4O2EB 3TIDB 4J1UA 1LO5A 1J0KA 4AQ1B 2IF7A 4R26H 3Q6GH 4OT1H 3OPZH 5D1QC 3FO9A 4GRMB 4OD1L 3L3JB 3EOTL 1IGYB 4AZ8A 3TBTA 5FCUH 1NC4D 4RX4D 5F1IA 3S3JA 4L3CB 5KSAC 5ANME 4KJWC 4EIGB 5IIEA 1AHWA 4NN7C 2W0LA 1RUMH 2DQUL 2VJXA 3ARQA 5FHBL 3LQAC 1L7TL 3SO3B 5EUOF 1T66D 4K7PX 3QG7L 1B2WL 3SBWA 1DQLH 3BO8A 3GSNL 3RNKA 1FYTA 1KELH 3Q3GB 3QXDB 4YDKL 2Z93A 4PS4L 4LFHG 1W72B 2OXHA 2F74B 1TJIH 1MCRA 1SEQH 3O8XA 5H37G 2MCPH 1KT2B 4P4KB 2RFXB 1D9KC 1C5CL 3C2AH 4LGRB 5DSCB 4KHXH 3VRLF 3BKYL 1V3JA 3E6FA 1G1YA 3H9ZA 4WTZG 1X4XA 2W9LA 4Z7NE 3NFPA 4JDZB 4EQ2A 2IANA 3SE9L 2A6DB 1UM5L 3IETA 3WLWD 1YJDL 4DOHB 2QTEA 3RPIB 1R5IA 2X89A 3UCRA 1S78D 3OR6A 3NCJL 2FYYB 1HHIA 1OF2B 3AY4C 5D7KE 2R56L 3LMJL 3IU4H 4HXAH 4WWID 1QSEB 1QLRB 3JWDH 2Y5TB 5FA3A 5DEFB 3MOQA 2BNRA 1KJ2A 1G9ML 3NGBC 3RKPA 4K3JH 2WBKA 4ZXBD 5KSUB 1NMCC 4ODVL 3P9LA 2OI9A 5FOBA 2P8LA 2PTTB 2YD1A 3GRWA 3S98A 3BZ4B 4RMQA 1BWMA 1I7UB 1QNZH 3CGTA 3T0ED 1LK3H 2X70B 1JNLH 4HF5H 4NQCA 4PG2A 4JDVB 3IRPX 3QUZB 4WI4A 1TPXB 3S36X 1T1WA 3ULVD 1FNSL 3MRGB 2GKIA 1A7PL 2X4RA 2GCYB 1EJOL 4JRYB 2PN5A 4DUXA 3IDIB 3OKOB 4L3EE 2IALB 3OGCB 3GI9H 1KCRL 4CMHC 3FFDB 4TNWK 2K7QA 4KK6C 4LARH 3VXMA 2E9WA 1IAMA 3LPFA 1OOAA 3RY4A 4TSCH 1LK2A 2JB5L 5MHSD 2XTLA 4PRNB 3QPXL 4PREA 4X6DF 1YEJL 1HOCB 5B39G 5L2KB 4OV5A 5GIRA 3U9PL 3KR3H 2YPKA 1G7MB 5F1NA 4H0HB 1GAFL 1QYGL 5JMOC 5FK9B 1QBLH 4DKEL 2CH8A 5ID1A 4K71C 1RZ8B 3CFIC 4OZIB 4LLUB 3MV8E 5CJXC 4N8VA 4JANB 4XPHH 5CD5D 2O5YH 1NMBH 1PKQE 4IRSD 5IM7B 1A6TB 2FRGP 2IMNA 4Y5XC 5J6GB 3HC4L 3GK8L 1YA5A 4DGIH 5AD0B 1E4XI 5H2BA 5HYEA 1U58B 1RZJL 4GW4A 4U1SA 5EIVA 1Q9WA 3TBSA 3TFKC 9CGTA 1CGTA 4XWOC 3FQXA 5CEXA 4XVJL 1U6AH 5FDYA 3TP4A 4HWZB 2HT2D 3QSKB 2IPUK 1RZ7H 3O6FA 4PRHB 2VZUA 4AM0B 1OL0A 2IH3B 2BNUB 1MRCL 2UY7A 4KK8D 5JOEA 3BDYL 4L4TD 2X4TA 5EOCJ 3SKUD 3FZUC 4U1MB 1YC7A 5FYJL 1U95B 3VWJC 5IEKA 1FO0A 3F7YA 4TOYL 4OLUH 1HNGA 4U0RC 3S35L 1R3JA 3R1GH 1EK3A 3QDME 2ZUTA 2B1HL 5GGVH 2XTJE 3BKCH 3PJSA 3KJ6H 1BBDL 2P8PA 3H9YA 1K5NA 3QCVH 3OXRB 3QHZH 5I17A 1NBZB 1QBBA 3RVWC 4UU9A 4JFHD 2PO6C 4WW1A 5GJTH 3QWQB 3LQZB 2FJGB 5ANMA 4ENEC 2E27L 5GJSH 3IYLW 2BX5A 2DBLL 1UJ3C 4WW2B 2YPLE 3I3DA 3DX8B 3HHRB 1MVUA 3FFCE 1NKRA 3BMVA 3MXVL 5AWNH 5LGHL 2X9XA 1ACZA 5EWIH 1OP3K 5I73C 4HGMA 1U2HA 2E6JA 4N0CD 3I9GH 1W0VA 4QRPA 1C1EH 1YNKH 4J8RA 5MEQA 3N1PC 4Q6IA 5LGKA 4X5WB 3PDDA 2E7CA 5I71B 1FVDB 5JNYA 5HHVL 3R06A 2ED9A 3UTSE 3VXNB 4EJ1C 3N9GL 5DDHB 2CJUH 3WSQH 4KRPB 2F53D 3LDBC 3ZYZA 3GJFB 1JZ6A 2WMPA 4OZHB 4HGWA 3U7AA 4JFQB 1TLKA 5K9KA 4NZUH 2FWOB 2HLFD 2F8XC 2V2TB 1MCPH 1JMZA 1LD9B 2FEDC 4OFYD 1BZ7A 1DBKL 4XNZB 3SN6N 5C0CD 1NLDH 3GSOA 3PXHA 3PP3K 4HPOH 5IFAL 1DEEB 1HK6A 3C5ZD 4YBLC 3IXAA 5I2IB 5DK0A 1BVKA 1DCLA 2CKBB 4XPFL 4QGYA 1T0MA 5MEPA 4FP8H 1YYML 3G6JF 1FSKB 5GSVA 4FQXB 1MFCL 4PJCF 1HHGB 2X9WA 3RAJL 1A7RH 1YNTA 3KPRB 3PV6A 2HN7B 2HG5A 3CH1A 4OSUL 4APQA 4DOHE 1VFMA 1BQSA 2WP3O 3NIGE 5CZKA 4NRXA 4FQIH 5F3HA 3HI6L 1AI1H 4PRIB 1S7UB 3QP3A 3F58H 4CMMB 5B39B 5FO7B 1HCFX 5F72S 1QSEE 5FFLA 3B9EA 4ZSOB 1HWGB 4EI5C 4FQLL 1KF9B 1UWXH 1W72H 4TVSa 4L3EA 1MAMH 3QQ9C 5DD0L 2GAZB 1EHAA 4K3EL 5FO9B 4GKOA 4NN7B 3TWCL 4PG9B 4XVUC 3H9SE 3EKCA 2YEZA 1KLUA 2H8PA 4MWFA 1RY7B 5ID0B 2BVQB 1OAKL 1NSNH 5GZNC 4E0RA 4JEGB 1OB1A 3SY0A 1FORH 5E56A 1I8MB 2E7LC 1MNUL 1IM9A 4UNUA 4XH2A 3QJFA 4JRYE 2BJMH 2C4FT 4M02A 4C56A 1FV1A 5IROC 4OCMC 4LIQE 1A6AB 4R0LC 3KLAA 1DQQB 2CXKA 3B8YA 1D9KB 4W70A 1PKQA 1I7RA 2WINB 3CDGB 3MUZ1 4P5TC 5L2KE 2F19L 4OLYH 3HCVA 4ZD3H 5KW9H 2EICA 4NRYA 1BF2A 5EU3A 2VL5B 4EDXA 1NL0H 1HH9B 2ED7A 1FCGA 3HRPA 4RMWA 2A9MH 2AGJH 5DLML 2P45B 1RZKH 4XMPH 1LWRA 4OZIE 5KSBA 4KK9D 4C4KO 3P30H 3CX5J 4C55A 1MFEH 1B88A 3V7AG 3O8XD 1T22B 3BP7B 3LKQA 3NGBB 1GSMA 1ZS8B 4PJEF 5E95B 5IMMA 2P4AB 1H8SA 3MV11 5ALCL 5CKGA 4LIQH 5J0BA 1W0YT 1KB9K 1NMCB 3CH8A 1P84J 1KJVA 3ZT5A 2FL5A 3VGBA 3UTZB 4S1SL 2W65A 1YPZF 5JW4Q 4PRHE 2IAND 5D7LB 3FN3A 1IT9H 1NFIA 3G5XA 2X89D 4CW1B 3W11C 2CUHA 4TSBH 5T5FL 2HT4D 2YPLA 2IG2L 2DM7A 4LLVB 4O2EA 2EKSB 4MB3A 1KJMA 3FFCA 2ADFL 5J6HA 3DMMB 2PTVA 4L8DB 4N0YH 1H8NA 1HYRC 1R3LA 4TRPH 5CJQH 1YJDC 2BNRD 2VO5A 3L3JA 3MPCA 3U7WH 3QXTA 1PQZA 3Q48A 3DTXA 4GMSL 4RAUB 2QEJA 3I2CH 3VFSB 1KGCD 4KI1A 4ODUB 4L3CA 3UTSA 3OX8B 3D2UA 3DUUA 5BS0E 4CN6A 2AJUH 2XV6B 5CILL 4GAYA 1IL1B 2JCCE 4XPAL 2BVYA 4K23L 1Q72L 4NQCD 1G9MC 5ICXA 1A3LL 2C9AA 2DBJA 3GSQB 4NN5C 2IADA 1NAML 5E1AA 3TN0A 1QUNA 1YYLL 4N0UB 4JKKA 1W72A 2DQCH 1VPOL 1IC1A 4M7KL 2EYTA 2H6PA 1X5HA 3O11A 3BKJL 3OZ9H 2VITB 3PQYE 1X5IA 4MAYB 1OM3H 3VXMD 4HUUB 3CK0H 3M17A 2C1OB 3CPLB 2W0KA 2A73B 4OZHE 1MAKA 1IC5L 2KQMA 4U1GC 1Z5LB 4G6AC 4Z5RA 4HUWA 5H37H 1X5GA 1LP9F 1OAUL 4PJ9C 3QWOB 2BVOB 3BWAA 1EEZB 5EZIH 3BE1H 5D6DA 3H7BB 2J5LB 5DMIH 3DROB 3VXQA 1IC4H 1GPOL 3PWPB 5GRZA 3ARPA 1I85A 3RX5A 1QSEA 5J1SC 1QQDA 3LH2L 4K7PL 3G6DH 3IDMA 2GSIB 2GTZB 4ODWB 4XC3H 1JV5B 2PO6B 3WIFA 5GSRB 5KSUA 1MJ7L 2VDNH 5I18H 2IPKA 4OBRA 4PJXF 5F93C 4MD5B 1CGXA 1TZIA 4GAJL 2PTTA 3O6FD 3EHBD 3H9SA 1UJ3B 2NY5L 2PR4H 3Q1SL 5CMAA 5JUEL 5I1EH 1N59A 1I7UA 5LGJB 4LSUH 3GJFH 5HPMA 4K94L 1IKFL 4HIXL 2MPAL 4ZSOE 2ESVB 5DMJB 3LKNB 1GGCL 1I1YB 2GCYA 4Y4KB 3RA7L 5EO9B 1UFUA 4EEEA 4GLRH 3OGCA 5C0AD 4IRZH 1PGRB 2YUZA 4GG8B 5I8KH 2AXHA 3OAZH 4LEXH 4X6DB 3LZFH 3S9DB 2CKBH 4J4PA 2DWDA 2W9DH 3KJ4C 4PRNA 2C3VB 4U6YA 2WNGA 5LXGH 4JZNB 3SKMA 5FECA 3K7UA 3VFVB 2BHZA 3WHE0 1G7MA 4MXWH 3BPOB 4ZYKA 1ZV5A 3GI8L 4X99A 3VXUB 2HRPH 3FL7A 4LF3B 1RZIA 3GHEL 4MS8A 3GBNH 5HJ3A 1PSKL 4QRPD 4YHNA 4F33B 5BZWB 3EW3B 1WK0A 5F96H 2EXYD 4XVTL 3WIIH 4L8BB 1KIUA 1Z2KA 4JANA 4MAUL 3FQTB 2AKRA 4YR6B 5ESAA 1WGOA 2L7UA 3S36L 4RFOL 2EDLA 3DX9A 4FFZH 1RK0A 1P1ZB 4PRPB 2J1KA 5D1ZC 1RV6X 3RVXD 4QHLA 2BOCB 2YD3A 4WGVB 5TDPB 1WLHA 4TUKL 4S0UC 5DFWH 1WQVT 2G9HB 5DEGB 2HMIC 3U6RB 2WLZA 4KY1L 3OKMA 4EBQL 4HS8L 3WN5A 4LSRH 4JVPA 3V0VB 4Z7WF 1T5WB 2BOBB 2VR9A 1HI6B 3TIEA 3K2UH 2AXJA 3MRPB 2Q3AA 1MCOH 4P4RB 2PYFA 2DWEB 3MLVL 1NAKL 4HKBA 4MD4B 1IQDA 2AXGA 4OM0H 4WI6A 3MCLH 5HI3C 4RGMB 3LN9A 5DJAA 4APQD 3LQZA 1UACL 5DVMA 5BS0A 2UZIH 3KYKH 1QO3A 1V7NH 1E28B 1HCVA 3ARFC 2J8OA 4W4OC 4WW2A 5E9DE 2V9QA 2JCCA 2XY1A 3BVNB 3MACL 1OCWH 32C2B 2J6EL 2GTWA 2NXYC 4OIIH 2BSRA 3OKDB 4RGNB 2QQQA 4O58L 4R0LB 3KPTA 3TYGL 3S8WA 5CAYB 1XZ0B 1ZT7B 1E6OL 1FE8L 3ALPA 1U9KA 2DQJL 4L3ED 5F9DC 3W0WE 4QO1A 5JO5B 2EDTA 3PQYA 3L9RB 5FB8A 1Q0XH 5L8KB 3NCYP 5EUOE 1WTLA 4LU5H 1FDLL 4R8WL 4JPWH 3W81A 2NY3B 1A9EB 2R0LH 4GLRI 4POZC 1A7NH 4FXKA 1WCBA 5F6IC 5JZ7C 4YHMH 2YBRB 4L29B 3K4DA 4PGCB 5D9SB 2XWBB 4GXUM 1IM9D 3U0PA 1F4HA 1EMTL 4N0UE 3TJHC 4C56D 2R4SL 4J3XA 1E6JL 3DX6B 1SQ2N 2FECL 2H26A 1AJ7H 2X4QB 2YKLH 4YZFF 4MXQA 4A6YL 2IQAB 5FYKL 3VRLE 3G6JB 1HXMA 4YDIL 3T2QA 3AREA 4PJCB 3PWNA 5DHVB 4JM2F 4CBPA 4GQ9L 5C8JA 1RK1A 4G6KL 3RGVC 5D71H 4F7CB 2YZ8A 2OBGA 2DI9A 4UV7L 1S9VA 4QGTA 3QA3A 4L8SA 5IBTH 3TBWA 3THML 3ZO0A 4POUB 3F7VB 2AJXH 5JW3H 1YN7A 2Y23A 4F7EA 4YJZL 3RFZC 1BWWA 4V1DA 3ARZA 4X0KA 1PX4A 1U3ZA 3HLAB 3PWLA 4OGAC 2W1NA 3ULUD 2W9EL 2F9BT 1UB6A 1JGVL 3HE6C 1XGYH 3VGEA 3G08B 4TPRL 2XTJD 4AYFA 3P4OB 2M2DA 3LVEA 3L1OL 5BOPA 4IHOB 3DGGB 2GAZA 1LO0L 5LQBH 1J12A 1CTNA 4PG9A 4J6RH 1WVZA 4JPKH 3JTTA 1P7KB 3SDDA 3X3FL 1KV3A 3BPNB 1G6RL 2BVQA 4KJYB 1EO8L 3D39B 2YR3A 2XNAA 4F15C 3TGXA 1S8DB 2YPLD 3L95A 4B7LA 5GRWA 2OK0H 4PJ8C 1Y6KR 2ESVE 1G7JB 5EPMA 3FFCD 3WO4B 1MF2L 3VFPB 4FG6C 5CINH 1YEEL 3WE6A 3KYNB 2EC8A 1ZSDA 5C7XH 4IDLA 5HGBA 4PJ7A 1MIEH 2B8OT 4RISL 2GY5A 5MENE 2ZKHL 4X6DE 3V7AE 3U7YL 5LJYH 4NZJA 2H9GA 3S5LG 3UTSD 4MNGA 1VSCA 2IAMA 3D2UD 3NACH 4OD3H 2FX7L 2ZUYA 3PABA 1I1FA 4KXZH 4UIKL 1UADC 5F7FA 3EYOB 4XTRD 3O3UN 4Q2ZB 4F57L 2YOCA 4TVPE 3KPLB 5KG9A 3C9NB 1IAIM 5GHWL 3V0WH 3VXUE 2VXVH 4PJ9B 3T08A 3S96B 3DV6A 3TN0D 3EYQD 3MCG1 5HHMA 2DQEL 3BGFC 4PJEB 4XHQA 3WXWL 3CXHJ 5EU4A 5ESVA 3NCEB 1TMCB 1OTTC 4JM2C 3QISA 1F3DJ 3FOMA 4PRPE 1N64L 1YPZB 3OAUL 3BYTA 1EO5A 3BQUA 3TNNB 4ETQA 1JK8B 3EYVB 3UTTB 4YX2L 2ARWA 4FXGA 3RU8H 2YN5A 4HUVB 3GSVB 5E9DA 4P3DA 1R3IL 4WJ5A 5DQJB 3R0NA 5D7JA 2Y36H 2QQLL 4JE4B 4TVPH 5B21A 2YK1H 2OP4L 5GGTL 3P9MB 1X5AA 1VFAB 4L8DA 4MJIA 3NN8B 4OCYL 1CU4H 2BSTB 3FN9A 5HDQL 3MOBH 5K9QI 5ABDE 1I1AB 1DDHA 5FGCE 3RTQB 1T1XB 2R1XB 4U1JA 1VFBA 1X7QB 3W0WA 4N1EA 3CVHL 3BSZL 5SX4H 5DRNA 1KBGL 3H9SD 1N7ML 3C60A 5EUOA 3T0VA 4WFFE 2AS5M 2DQFB 1H15B 2LV4A 3IDGA 1YEKL 2AABL 2EDEA 4KHTH 3T0XA 4NKOB 4RGNE 4JKPL 2Y5EA 3MROA 1MCWW 1FNEA 3CXDH 4OGXL 4OF5A 4GMTH 2NY5C 2F54B 3C5JB 1F13A 4LAQL 4D0DA 1C5BL 3NMEA 3WS6A 3GMPB 3HG1B 5MI0B 1LEIA 2KPNA 5A2FA 1LE5A 4HH9A 4MAYA 4GFTB 1S5IL 3UC0L 4OB5H 4DQOL 1K4DB 4DVRL 3VD3A 4S11A 1J8HB 3BHBB 4J4PD 2OS7A 5GS1A 3VRJA 1C08A 4NZTL 1UWGH 1KTKE 4TNVF 4Y4HC 1MJ8L 5L0QB 4MMZC 1XGUA 5D1ZB 5LAXA 1B90A 2GJZA 4G9DA 1LP9B 1Z5LA 3HUJA 1C16B 3B2UD 2FH8A 4MS8D 1RFDL 5DURB 1JN6B 1BFTA 5F7NC 1EEZA 3V79C 3KPQB 4ZQKB 3G6JE 4MA8L 5TDOB 2A0LD 4PJCE 4OQTL 1NUFA 4XP5L 3MRQA 2D7NA 1Y0LA 2GSIA 1A7BA 1IBGH 2VXQL 3QIUC 1JV5A 5DJZA 2Z31B 2X10A 4UQ2B 5TFSL 4BFIB 3ZKNC 3JV0A 4LRNL 3QBTB 2NY6C 3O4LE 3SKJH 4OD1H 1I3GH 1KCSL 3S5LB 3N1GC 4Y4FC 3EOTH 5E7FA 2DN7A 2EKJA 4XPGH 2NXYB 1TJGL 5FA4B 3RNQA 5HHQB 3QEUA 3L3HB 4DGVL 2NLJA 1WT5C 1IE5A 2IFFL 2EDFA 5IOPA 1U8KB 5F9WC 4RMRA 3O81A 2LABA 4I77H 6CGTA 1G0DA 4FZEL 2DQUH 5FHBH 2D7MA 3RI5F 4GSDL 3MGAA 3QG7H 1B2WH 2VH5H 4K7FB 3KNBB 3HI5L 5MENA 4KQ3H 3O2WL 4TQEL 3MLWL 4WUKH 3GNMH 4R9HA 5DHVH 4D9LH 3D39E 3EO1B 3V8OA 5BS0D 4PY7B 1S7WA 4I0PA 1HEZA 4JN1H 1TTUA 2QADD 5IG7B 1H5BC 2CUIA 1F02I 4D0CB 2VWEC 1P7HL 2DM4A 3IFLL 3STLA 4Y19E 1CFTA 5SX4I 2FLBT 1YMMA 1C5CH 3LS5L 5JW5A 4ELME 4XP1L 4MLIA 3BKYH 4P5KA 3LN4B 4JB9L 5BVPL 3MRNB 3DIFA 1CFBA 1FL3A 4HG4J 1T83C 2Z92B 3IKKA 5E8PB 3SE9H 3PQYD 3MV7B 2HVJB 5FGRA 1JWMB 3SEPA 3EDDA 4MCZB 4FQ1H 4NYLA 5E94B 1S7QA 3DVNB 1ORQA 4PRPA 6FABL 1P1ZA 3LMJH 2WUCL 4KROD 4JY4A 4JRXA 4LGPB 1IAII 4NHUA 1MI5B 3RVUC 4X8JB 2E6PA 1XCQA 2G9HA 3MRIB 4CGTA 2DLGA 3GM0A 1T7XA 4Y8AA 1NPUA 2VXSH 5J3HD 4Z7WB 4PJEE 2GHWB 1QR4A 3FHAA 3U46A 2EIZB 3KG5A 4MXQD 3V5KA 3H7LA 2WANA 1TITA 1CCZA 3FONB 3MRKB 1D5BB 3MR9A 2H32B 1FLTX 3CFDB 2BNQB 2ILLA 3ARED 3MRPA 4G8GA 5T1MA 2FEEI 4BK5A 4JREC 1KC5L 4Y1AD 4NKDB 4HS3A 4U6XB 1MLCA 4BH7A 3F65A 1FNSH 1UCTA 3WL9A 4NOFA 3WHE1 3UTTE 1A7PH 1AXSA 5DC4B 3CFJA 1N5AB 5IB2B 4F15B 1OT2A 4NCC2 5DRXA 5IMKB 1XF4A 4L9LC 4WTWA 1FG2B 2OJEA 4PJ8B 1N0XL 3BVNA 1DUYB 1BFOA 4V1DD 3SGKA 1NGPH 4R7NB 1CICC 4NO2A 1RUPH 3S3SA 4YAQB 5IHBA 1K2DB 4NQDA 2QSCL 3QIBB 3QPXH 1B0GB 3MNWB 5FYJE 2BP3A 1LQVA 3U9PH 3KHQA 1QRKA 1GAFH 1K4CA 3CU7A 4PP2B 1I3RA 4HIHA 4HXBH 5M95B 3VWKC 1FQ9C 3GSXA 3SDDD 3GEWB 1UXSB 2O61A 1IGJA 1P6FA 4XGZA 2G5BA 1A9EA 1RJYA 1DBBL 1XF1A 2NMSA 2YBRA 4L29A 2APFA 5HD8D 4D3CL 3IVKB 4UB0H 1NC2D 3FB6B 1MPAL 3FB8B 2ADGA 4XAKD 4XP4L 4I48B 3GK8H 3O4OC 3LIZL 3GIVB 5ADOL 4M5YL 5CEYA 5F89B 2F54E 2OR8A 1RZJH 5A3IC 2K7PA 2GT9A 1FZMB 3HG1E 2FGZA 4XWGH 2C26A 5GZOD 4XNQB 4JM2B 4I18C 2M26A 1J8HE 2NZIA 4ZUSA 1U3HC 4JZOA 2JLLA 1MRCH 5DHVA 2IAMD 4Z78A 5DJDA 1YUHA 5TQ2L 3QUML 5FYJH 1GGBH 4TOYH 2FGWL 1LP9E 3VFWB 2ADJB 1TENA 1JP5A 2J8HA 3ZT7A 4CU8A 3RZCC 1HHHB 1SY6A 4ZFZB 3IDUA 3O4LA 5HHMD 4XPTL 3GFUA 1FVCA 3QUYB 4ISVA 5FIEA 4XXCA 3OQ3B 4YHPB 1INEH 1ZA3A 1J87A 1BBJB 5GGSB 5DJ0A 4JQIL 5F1SA 4MDJA 2E27H 4S2SA 2P48B 4PJXE 3S37X 4GXUN 3OF6A 4JM4H 5IW6A 4PP8C 4G80A 4OLWH 3MXVH 5LGHH 1OWRM 2J4WL 5TGBA 3DARA 4XNYL 3BQUD 1CFSB 4WHTA 4FFVC 3LEXB 2WIIA 5IBUG 4WHYH 2G75B 2E9IA 5DA0B 5DMGC 1YECH 3D39A 4OLVL 2EH8H 1UQSB 3ZKSD 5INDB 4C57C 5E9DD 3KWWB 1CS6A 1UCBL 5HHVH 5B8CA 3ECBA 5D7JD 3V5DB 4F9LC 4GJTB 2GYSA 5IFHL 3I3BA 3N9GH 4M8QA 4U1LB 1DVFC 4MJID 4Y19A 2ARJB 4MQ7A 5AUMB 3T8XB 4FZ8L 4JO1H 4ELMA 4HUXA 4KI5E 4ORZC 2C4XA 2DLIA 1FL5B 1BPVA 4WNQA 3W0WD 2ICEA 5C92A 1C7TA 1QA9B 1E4WH 3BUYB 3C60D 4UDTA 4L8CB 5B3JE 1DBKH 4R4FH 3CFCH 3IFOA 3L3KB 5IFAH 1HKFA 4LVNC 3P4MA 4HK0B 4Z7UF 1MHPL 5E2WL 3QXAA 3MMEA 4YPJA 3S96A 4I4WA 3ILQC 3WNLA 2KZWA 5ESQB 4Q7DA 2ICCA 4YHOL 1FPTH 3EDEA 4XI5C 3I6GB 1OT1A 1BQLH 4YPGA 1L6XA 4U49A 5JW4N 3OKLB 3V6ZA 4OUUB 2AJZB 2YN3A 4S1DC 3QI9A 3AMKA 3HI6H 1ADQL 1JTPA 1N8ZA 1WUNT 2OMNA 3KXFA 5DZNA 5J12C 4OCNC 2NY6B 4JHWH 2MTPA 4RAVB 1MI5E 1JUFA 3UTTA 4GXVL 4HC1A 4GG6F 4PV8B 2UUDK 5ENWA 4FQLH 4LPWA 1AGEB 5JORA 4OCWH 1UYWL 5DD0H 4XAWL 4K3EH 3EO9L 3PNWB 3TWCH 1DQJA 1LNUB 5F9WB 4WI7A 3P9MA 5E00A 3TT3L 4OJFL 4LLQB 4ACPA 3GMRB 3HAEG 3FAWA 1OAKH 2BHUA 5F3BB 2H1PL 4R4BA 2J3SA 3ISWA 3PHOA 3RTQA 1RMFH 3WJJC 4MLSA 1ES0B 3WS3A 1F90L 3CCHA 4ZTOL 3VXPB 3EFFA 2GI7A 5T3XL 1HSBA 3H42H 2CKNA 5KANG 1FVEB 2NW3A 2FJFA 3ALWA 2DKUA 2XZAH 3LKSB 3VFTB 4PD4K 5HDBF 2D3VA 3PWUA 2W60B 4HJGB 2GK2A 1CDCA 4HT1L 4S10A 1DBAH 4CRPA 3BI9X 1T20A 3ZYOA 2F19H 3FQNA 2QSQA 2VN4A 3CFEA 3E3QE 3L5IA 4UDUA 1CI5A 4I13B 2F54A 4PLJC 5IMLA 4BH8A 5EO0B 3RWEB 2YD4A 3RL2A 2ZUQC 3G04A 4NKIL 3B9KB 5EBWB 5MEND 3HMXL 2H32H 1OVZA 3BHBA 5CUSL 3MJGX 1YN6A 4X6EA 4GO6B 3ROLA 3HZKB 1INQB 3GMMB 4M93B 3T09A 1FNGA 4I0PD 4QRRB 3EJYC 4ELKA 3T1WA 2ZCKL 4OFDA 4TVPD 5BOZG 4GW1B 4WWKC 4WI5A 1B4JL 1JRHH 3RWJB 1YMMD 3QFDA 5L88H 2I5YL 2V5RA 5IBUB 3ARBC 5I30L 2WV3A 2PW1B 4M5ZL 4YWGL 1KIQB 1AGDB 4Y88A 2ENYA 1L4IA 4ZQKA 4GKZB 1HKLH 3AMLA 5TDOA 2MFNA 1SM3L 4PGBB 2K1MA 3STZB 1I9IL 1U3JA 2W92A 4Y16A 4G5ZL 1J8KA 5LCVL 4PJXA 5T5FH 1P2CA 1JHTB 1I1CA 2IG2H 4A6YB 5CEZD 2JELH 1EZVX 5DHXB 3D3VB 3VXRB 4JRXD 5D1XA 4X6BB 1NCUA 1IKNC 4TTDC 4YHIA 1I4FA 2XZZA 5DUBB 3CFBB 1AO7B 1CICB 4D9QD 1XF2A 2WWKT 1XIWA 2EYSB 3ELAT 4JFXB 2ZWLT 1MQ8A 1IGFL 3HNVL 4G8GD 1OGTA 3RDTB 2HTKC 4YXKL 1FZOA 2HTLC 3CVIL 4L9DA 5CILH 4K23H 3TO2A 5D7IF 3T2OA 3VW3H 1KG0A 1A3LH 3MRLB 4WO4A 1IGTB 1J0YA 4LPCA 2NY1B 3KNBA 5J13C 4N5EA 5KSVB 5ITFA 2E7MA 1GGIL 4V3DB 4G43B 4JY5L 1YYLH 1ZT4A 1KENL 3RX7A 4PY7A 2WWKO 3QIWA 4G8EA 3JWOH 4D8PB 5EBLB 1JBJA 3MV9B 2UVEA 5I66A 2CRZA 3BKJH 4KDTA 3ROOB 3BIBX 5EOTA 5IV2A 3U36B 4Q9BA 4OUOA 4G7VL 4B53A 4NQDD 3JTSA 1DQDH 1XF3A 2XZCL 1J05B 4Y2DA 4XXDB 1T6WA 1ND0A 1U3HB 4DN4L 4PJIF 5JDSA 1A4JA 1PD6A 1P4LB 2ZUVA 5DTFA 1OAUH 3HKFA 4MCZA 1CD1B 1EGJL 5BXFB 3K4AA 2DD8L 4BFBD 5SWSE 3HAEB 3KPSD 1PYWB 1YDPB 4P2RB 1MREL 2P46B 4JZJB 4HJ0C 4QXTA 3VD7A 3IDNB 3LH2H 3MJ8B 3MFFB 5DYOB 2NYYC 3FB5B 3RJQB 2P5WB 5L2JB 3GIZH 4AIZA 1MJ7H 1KXVC 4OTXH 3WUWB 3C5SB 4NDMB 2ZNXA 3TA3C 3MRKA 2PXYB 4NNPL 2XG4A 4LCCA 3WFEL 4GAJH 1JRHI 3Q1SH 4JG0L 4P46C 5JUEH 1DANU 1HSAB 5JHDB 4LCWA 4PP1C 4MB4A 1IFHL 2ZOLB 4QCIA 2YD9A 3HZYA 3QRGL 4K94H 1AIFB 2HH0L 2ZPKL 4N0FA 2X42A 4QHMA 5C09E 5EC2B 5K9OB 3LD8C 5CGTA 3RA7H 5IMKA 3O4LD 2H2SC 4LNRB 3UAJC 3OKKA 4ZS7L 5JLZB 2J7LA 4NP4L 1IAOA 1QTYT 2I9TA 2R9HD 4BM7A 4ZFFB 1X5JA 5TQ0L 2XG5A 3OL2A 3UBXI 5E99L 1D5MA 3EJJX 4PJGB 1AFVL 5GS0D 4G8IB 4X9BA 2B2XH 5I6XB 2EDKA 5MERB 5E6IA 3UJIH 3GI8H 3A67L 5AAWA 3X3GL 2QV2A 2CR3A 4XHJD 1FFPA 1XR9B 3UBXA 5C0EB 1MFDL 1CLYH 3BEVA 3PG2A 4LVNB 3MRRA 4NZRL 1T89A 1FFNA 3FTGB 2JJSC 3NZ8A 1JZ5A 2XXCB 4MAUH 4WV1C 4ZUWA 4KMQA 3IVKA 4BA8A 3FB6A 2AEWA 2ERJB 3CVHB 4ZDHB 4PJBF 1CXKA 4Y19D 2AP2A 2IMMA 4XP9L 3S36H 1HQRA 1SVCP 3TPUE 1JFQL 4QF1B 4RFOH 1WWBX 2VZSA 4HFUH 2YD5A 4PV9A 1IZKA 3L3GA 1QR1B 4AEIL 1UG9A 1ZHNB 1M71B 1SMAA 2CO7B 5IVZB 3V6FA 3SDXF 3V5HA 1ONQA 4EBQH 1E0OB 2FO4B 3GO1L 2CO6B 4HS8H 4F58L 4QRSA 1WIUA 1V7MH 5I8CB 2MQ0A 1BLNB 2FH6A 3EDJA 4P2OB 4JQVA 5T3ZL 5I1HL 1FAIL 2KH2B 5C0BE 3T04D 4ZG1A 1MCKA 4NRZB 4KTDL 4YBQC 4LHJB 3VGDA 2NW2B 1ZHKA 3MUY1 1Q1JL 1UACH 4OLZL 5DVLA 5J7CC 3QI9D 4FQJL 3MACH 2YD8A 1QKZL 4TUOA 3KXFD 3MC0A 5JPMB 1E4KC 2IBZX 3D3VE 4JFPA 4ZAKC 3VXRE 2VZTA 5C71A 4O58H 4MJ6B 2G75A 2Q8AL 3OJDA 3TYGH 3VFGL 3QDJE 1BMGA 2VC2L 4EN3C 3BZEA 4ONFH 1AO7E 1E6OH 1FE8H 3W9DA 2DQJH 1KNOA 3KWWA 4B50A 5C9KA 1G9EA 3V7MA 3Q5OA 4O2FA 2VXTH 2VLKB 3MRJA 4CUCA 1KLFA 1YEHL 4Q9QL 4Q0XL 2NY4D 2OR9L 4R8WH 3TCLB 4QRTB 2ZUQB 4RRPA 2M8XA 4UUJA 3UYOD 4LKCA 2V5TA 3EIFA 1FL5A 2V17L 4MYWB 3NA4A 3ULVF 1EMTH 3QQ3A 4PLKD 4PLOB 5J1AB 1E6JH 1CFNB 4Z7UB 3K1KC 5SWSA 4CDHA 4WEMB 4L1HA 5GPRA 7CGTA 3UO1L 3VFMB 4WI8A 4JN2B 1LEGA 3RGHA 3S37L 2FDBP 3GB7B 5FUOL 5EZOL 4GAFB 4G6KH 4PD4J 2F8VA 4LSPL 1DE4B 5KVFL 1U8PB 4ODHL 2CDGA 2P24A 3BIKB 3KDMB 4NQUA 1A14L 5M7QA 4LCUB 1T66C 1EAPB 3OKNB 3ZE0F 1A4KB 4PJFF 1CDBA 5JIPA 1UXWA 3BJ91 3NCFB 3D18B 1CDHA 3TC9A 5DWUL 5DD1L 3E2HC 4P2RE 2AEPL 1Q9KA 4GG6B 5B3NA 15C8L 2W9EH 5BZDB 3GJEA 4WUUA 4LAJH 4X9HA 5EORL 5HI5D 3T4YB 4Y7MA 5C09A 4DN3L 3ARGA 3T1FA 1OHQA 2P5WE 1GRWA 2FR4A 3C6LA 1QPXA 3L1OH 4F9PA 1LO0H 1GIGL 3PNWA 4UI2A 3QO1B 3A6BH 1MEXL 2VLLB 3P4NA 4HZLA 3SDAA 4FXLA 3X3FH 5JQHC 4Y89A 1NCDL 5JHDE 5IWLA 5EA0H 1EO8H 3WLWC 4Y16D 1KJ2L 1AD9B 3FQRA 5IGXH 2XN9D 1S78C 3BP5A 1O5DT 4R2GD 1QG3A 4YXHL 4IMKC 3KS0H 3EYUH 3MNZA 1D5ZB 2XKNB 1JHLL 5CIPB 4Z9KB 1YEEH 5D1XD 5EFIA 5DZLA 3R4DA 1GZPA 3GRWL 1FIGH 4AIOA 3SE3C 3HAEH 1LMKA 1PZ5B 4RISH 5EZJB 3EJZC 2W60A 1XIWD 2IBZY 4ZXBC 4GW5B 3U7YH 5I76B 1U92B 5IKCA 4RWYL 2FX7H 3QZWA 5I1KH 4M6ML 4GRLC 2FIKB 1DBML 4NT6B 3MRFA 4GH7B 5FYLE 3TPUA 4F57H 2H45A 4X5LA 1A6WH 2O5XH 4KI5D 1BOGA 4WO4D 5GHWH 1T21B 5CD3A 2GFBA 1NGQH 5EBWA 4N5ED 3UJJL 5KS9A 1C8PA 4N68A 1Z0MA 3I50L 4HAFA 1IM3B 4EUPA 2Q7YB 4TTGA 3C8DA 4BQ8A 4Q6YA 3QIWD 4MSWA 5CP7B 3MJ7A 2DQEH 3WXWH 1CXIA 1AQKH 3MGTB 4DZBA 1XCTB 2XFXA 4HIEA 1BJMA 4WHCA 4R6UA 5JOFA 2UWEE 3Q6GL 1ZLSL 5BQ7B 4IMLB 2CLRB 2Y7QA 4OT1L 1WBZB 2P5EB 5C0BA 1N64H 3OAUH 5C08E 4Y2DD 3TA3B 4ZS6D 3RIAK 1BQUA 1VACB 3D0VA 3F6IA 4PGDB 2GJ6D 1C12A 4P46B 5DJYA 2R2BB 1J5OL 4PGBA 1PJ9A 5C07A 5MEOA 1KCGC 4MDIA 5H94A 2ZUWA 3E1F1 3PWVB 4CJ1A 1EHLH 2FHCA 5I1JL 2Q76B 4I3SL 3RJDA 5FYLH 2HT3D 3DVFA 3VGGA 4X4ME 2OP4H 5GGTH 4OZFA 1T7VA 4QT5B 3VXRA 4IOIA 2QJDA 3GSRB 3EYSL 1G7PA 5T1DL 2X41A 4P0DA 3QDJA 5D1QA 3QUMB 1E4XL 3CFBA 3BW9A 3DJ9A 4PYHA 1VKXB 3CZFB 3RWGA 4KZDL 1FO0L 4LDLB 4FQCH 5T1KA 3RIFK 3DHMA 3SCMA 4F37K 3BSZH 2EXWD 5D7IB 1GOGA 1KBGH 2A2QT 1KTLB 5KSAA 3RDTA 1AXTL 3BRFA 4LCWD 4KK8C 4AG4L 4QHKI 4F7TA 1IMHC 1YEKH 2AABH 4W68A 1A6ZB 1QD0A 5ERWB 3T3PF 3PGFL 4NQSA 1P5VA 3ARDC 3WUZA 1DQML 4XCNB 4OCLC 3SJVB 3G9VA 3FT2B 4WV1B 4L3AA 3RWFA 2IBBA 2PYEB 4LAQH 4PBWD 4YFLI 5DI8A 4D8PA 5F7YC 1C5BH 1TZHB 4NBYB 3S6CA 3I3EA 3DETC 4LASL 2V2XA 4Z76A 4OZGF 1I9RL 4JFDE 4DVRH 1S5IH 3IU4L 3UC0H 4DQOH 3FT4A 4HXAL 1R24B 3CNKA 5E2UH 2IFGA 3LY6A 3JWDL 3TO4D 3VXOB 4Z77B 3UPRA 1CDIA 1U36A 2R2HB 3LEYH 3DO7A 4PJIB 4YIQB 2D31A 2BVEA 4HDIB 4JFEB 4RMUA 4BUGA 5F9JA 2C7UA 3JVGC 5E6ID 1FYHB 5EIQA 1OAZL 1NDMB 4XC1H 2CIIB 3IJYB 1P4LA 2QHRH 3VCLA 1OAQH 1B9ZA 4Z7UE 4U31A 5JQ6L 4N0CC 2DQGL 2E7HA 2MQCA 5F7UA 3ZE1F 4X9GA 1ZTXL 3D0LB 2JK5B 4L4JA 5EU7C 4HF5L 4N90D 1EDQA 4FN0A 4DKFL 4LOUC 3AY4A 3EOAB 2MMXA 4P2YA 3ZYJA 3D1MC 2W07A 4X4XA 1PAMA 4XP5H 1MHEB 1SJHA 5EBMA 5DQ9B 3MBXH 1H3WM 4ZO6A 1ZLWK 5TH2A 2VXQH 3IT8D 4PY8J 5L2JA 1TVDA 3WUWA 4TN9A 4NDMA 2HKHL 1CR9L 4PTTA 2PXYA 4QRQB 1OD7A 5EBGA 4TUJA 3OJ2C 1BIIA 5D2NE 1AKJA 4AMKH 2A6IB 3IDJB 1AD0A 1KCSH 3CZJA 2VLRA 3PE9A 4DW2L 5D93C 2ATKB 1W0WA 2AV7A 3VI4F 5DFVD 4GG6E 3KR3L 2X5PA 3I6LD 5DJ6B 1OTSC 4F8QA 2C3HA 1YEDB 4DGVH 2IFFH 4S1RL 1JF1B 1N2RB 3X11B 1CDGA 2G60L 4FZEH 4LNRA 5C0JB 1NANH 4XNMB 2NZ9D 3DUSB 4XPHL 3HI5H 2O5YL 5IW1A 4WHDA 4JO2H 3TZVA 3V9FA 1MHCA 2OTUB 3QJHB 4ZUVB 5INCB 1BFVL 4G6FB 5CKAA 3K46A 1VGEL 3TVMC 5DS8A 1MFAL 5CP3A 5JIKA 1MJUH 1U6AL 3IXTB 3TNMB 4HWBA 1DLHB 1HQ4A 1U8OB 3HE7D 3LS5H 5HDBE 2H3NB 3LN5A 3O3AA 4YHYB 1LDPL 4JB9H 5BVPH 5CJ5A 5DA4A 3PWJB 4PJBB 5E08L 1NC4B 3BOVA 3SPVA 3E0GA 1YY9D 4LL9A 4WFHE 2IH1B 4Y5XA 4ZDHA 3S4SA 4QRUA 4DCQA 5GGVL 3RY5A 4IIQB 2UWEA 3MRDA 3EDKA 3ZZ1A 2IQ9L 4PJAE 3K80A 4KK5D 5C08A 4NUJB 1OY3B 4F3FA 2WUCH 5FKAA 3HPLB 3ZLQC 3SDXB 5GJTL 1QFWM 3VXSA 1MHHA 5IQ9B 1UM6L 1AP2B 2K3TA 2X1XR 3BGMB 1R3KB 1CDUA 2MHAB 5GJSL 4M7ZC 1OSZA 3ARYA 5SWSD 1D7FA 3VWJA 5HVFB 3WFHA 1CFQB 3FO1B 3GMQB 3MA9H 5EWIL 4X4MA 1KCKA 5KBNC 5C6TL 4UMGA 3MLPA 2P5EE 4NQXB 4FNLH 4R4NC 3SKNB 3ZE2F 2ZSVA 1KC5H 1XF5A 4LLYA 1AHWC 4X7TA 3UZQA 2XKUA 4RFNB 5GS2D 3ULUL 2NW2A 4EOWH 1RIUH 4YEFA 1IVLA 2C5DC 4OKVB 2ICWI 1N0XH 2QKIB 1NCTA 3VFRA 5KAQF 4KK9C 5J06A 4MVBA 1VDGA 3HC0B 4CVUA 4GRWF 4UINH 3QQ4B 4JPIB 3HI1A 4WUUD 8FABB 1G6VK 1SEBB 2QSCH 1AQDA 3O8XC 5C09D 4AENB 2APXA 2DKSA 2VZOA 5DGRA 5HGAA 4NZUL 43CAB 4BZ2H 3ARGD 2ICWA 5HVHC 3AXLB 4ZXBB 1XGQA 3C6LD 2R2EB 2AJVL 4MX7B 4HPOL 5A40E 1JYNA 3MYZA 4JFDA 3NOIA 3SDAD 5D7IE 4XBPA 1EHNA 4YQXL 2Q3ZA 3C8KA 4J3SA 4FP8L 1NGWA 2CD0A 4JVUA 4NWTL 1EEQA 3QWRD 1DBBH 3T0EB 4JKLA 5EH1A 3UX9B 4QY8B 4R3SB 1NMAH 3Q2CA 3MSPA 1VFOA 2GITB 2HT4C 1F6AB 3DSFH 5CGMA 5IUSA 1J1XH 1M4KA 3LIZH 2P7TA 5BRZA 1I8LA 4M5YH 4XVSH 1BEYL 1S7RB 5J1AA 2PYEE 5TE4H 1AI1L 3WJLA 5E2TH 1KIPA 1RZFL 4WDIB 3ZDYE 5JTWA 1Z9OA 2C1PA 1XGPA 3MODL 1QFUH 3LKRA 1FGVL 1QFWH 5TQ2H 2OI9C 1FIEA 4PJIE 5IB3B 3QUMH 4OKDA 1W72L 4JFEE 1S7VA 2DL2A 3BIKA 4PJFB 4CADB 4M03A 5E8NB 3LKPA 5DHYB 4PG2C 3A0OA 2A74B 4OIBA 2P47B 5D2NA 1KLGB 3O45A 1OPGL 5FDWB 3QDGE 2VABA 1NSNL 4FQPA 2X4UB 5B38A 3I6KB 5E6ZA 3WKML 4IRSB 2D0FA 4JQIH 4PTUA 4O51A 4I9WE 3NCMA 1WBXB 2BJML 4JJ5A 4EI5A 1Q9LA 2WQ8A 5I9QC 1X5KA 2FB4H 4UZGA 3L3OB 5C0BD 3HR5B 2OSLB 2W59A 3UP1A 4DWHA 4XNYH 3VRIA 3FT3A 1G7IB 4QYOA 3WEXA 5EU5B 2CLZB 3AC0A 5C07D 2XKSA 3VFUB 4PRDB 1ZLUK 4L4TB 4HHAA 2WBJA 1KEGH 1CQKA 1I7ZA 3JV6B 4J3OC 4OLYL 3MRMA 1QBML 5CSZB 3MREA 2R8SH 5DUMH 5IFHH 1KCVL 1WIPA 4P5MB 4F7MA 2AJYL 2E7LA 2VXUL 2XWTA 2AGJL 2YXFA 4FZ8H 3QDJD 5D1QD 4HFWA 1FZKB 1M6OA 1RURH 2XA8L 3P30L 4NNXA 4YC2C 4NO5B 5T1KD 3SCMD 2D7TL 1U92A 2UYLB 5KSAD 4KJWD 4S0SD 3EHBC 2FIKA 4M1DH 1DBJH 5LWYL 4XNXH 2LAGB 1TCRB 1X5ZA 4PJAA 4XRCA 3M1BB 4MB5A 5E2WH 1T0NB 3DXAA 3K0WA 2NY1D 5KVEH 4ZUTB 1J1PH 1A1NB 1WBYB 4ORGA 1KSRA 1IM3A 2ZJSH 4LLMA 3L7EB 5FV1L 1DN0A 1PG7H 4PJBE 4J3UA 5GRUL 2CLVB 2BY3A 3G5VB 4RNRA 3EOBB 4N0YL 3MV01 5BQ7A 2Q6WB 1LO2L 2F53B 2P5EA 1ADQH 3AU1B 5CJQL 2EDYA 3U7WL 3L7FA 1G7QA 1U8JB 2VAAB 1CE1H 2R2BA 3SDXE 2HJLA 3I2CL 1S7TA 5IEHA 1BHGA 1I8IB 1XR8B 3AS1A 4GXVH 4XNUL 5L8LB 5I74C 4HIJA 1HYSD 1QFWI 4JDTH 4PLNC 2AJUL 3JWDC 3BX7C 2Q76A 5C0CB 2Y06L 2VR5A 2NY0C 3EO9H 5DQDH 2X7LA 3C5ZB 3MUHL 1O7SA 3TT3H 3TM6A 4F80A 2H1PH 1V3LA 4PGZA 1MIMH 1X5LA 2G5RA 3KPOB 4LLWA 3FQUA 3CZFA 2COQA 4Z18A 2BSSA 3OZ9L 3P11H 1II4E 2Z91B 2V7HA 4AEEA 1AKJD 3B3IA 2K9UA 3GUTB 2VLRD 3CK0L 1CZ8L 2Z9TA 5E5UB 4AEHL 2X4NA 3FOLA 4PJDB 5KSBF 1WV7T 1ZEAL 4HT1H 1UA6H 4ONHB 1NFDE 35C8H 4WU7A 3IFPA 3ULUF 2XQYG 5DVNA 1I8KB 3H0TB 2UZYB 3NIDF 4OZGB 4U1NA 2PYEA 5EZIL 1TZHA 2DJUA 1MCJA 4LRIC 1IC4L 4NKIH 1MLBB 3HMXH 3K1DA 1MY5A 5CUSH 3VXOA 3TZVD 1T80A 3T0EE 4MA3B 3P0VL 2PCPA 3G6DL 4N8VG 1S9WB 2VKWA 3O41B 4OF7A 5C0IA 1MH5B 2AXFB 3ULVE 4M4PA 2ZCKH 5A2LH 3OJVC 5FYKU 1MCQA 4J1UB 1LO5B 2XI9A 3WFCL 3GMLA 2I5YH 5I30H 2RGSA 4WTXA 2ZUXA 3B5GA 3FO9B 1S9YA 4M5ZH 2YC1A 4YWGH 5ICZA 2PNDA 3QDGA 3QXWA 3F5WA 3TBTB 5SWZA 1ZGLP 3EOAA 1CL7I 4P3CL 1AR1C 1AHWB 4ZPTA 4WI9A 4KMLB 5LCVH 3U9UA 3ZE0E 4PJFE 3TFKD 5C08D 5I8KL 3UPAA 5ISZA 1ZT1B 4LEXL 4W6WB 3BO8B 1RU9H 3LZFL 3RNKB 2CKBL 4R7DA 3VXSD 3Q5YA 1NCNA 1QPPA 1FH5H 1ZAGA 4P48A 2Z93B 1ZWIA 2ATKA 5LXGL 3FZUD 5C2UB 3BN9C 3MZGB 4PJ5A 3VWJD 2Y25A 4AL8L 3ULVH 1NBVL 4MXWL 3O8XB 2E8YA 1IGFH 2Z0BA 4MNHB 2HRPL 3HNVH 3GBNL 1T03L 5B22A 3F7RA 3E6FB 1BQHB 3MJ9H 4CNIA 4MA7L 1U41A 3NFPB 4M1CD 3RVWD 4OZ4A 1GGIH 2IANB 3IETB 4JY5H 4L4TE 1JF6A 1R5IB 3WFBL 3HN3A 5DVOA 3OR6B 3ALXA 3QCTH 2JB6A 5DO2D 1HHIB 4LLDA 3L5WA 4FFZL 1MFBL 3TF7A 4MVBD 4XPBL 4WVRA 3SGEI 1UVQA 2R0KH 2DTML 4F7PA 1U8OA 3OV6A 2VDML 1LE9A 4U6HA 2BNRB 1X5XA 3PP4H 2XTJC 2EH7H 5E6YA 4PJBA 3BH9A 4DN4H 3P9LB 4JFDD 2OI9B 4DZ8A 3QFJA 2P8LB 5FOBB 3R8QA 4YO0A 3K2UL 4HPYL 5D5MF 4OV6F 3ARWA 4NQCB 3IJHA 1MREH 1T1WB 4OM0L 3MCLL 3O2DA 4X7SH 5AG9A 5IR1A 5BRZD 2X4RB 1L6ZA 2NR6C 2FEDD 4RBPH 1GYAA 3FO0H 4G6JL 4NNPH 3WFEH 5TE6L 3VXMB 1T1YA 4OIIL 4NHCH 1LK2B 2GK0A 4FHBD 4M8VA 5E1HB 2M1KA 1QEWA 4PREB 3QDHA 4BQCA 4OV5B 2AVGA 2JJVA 5GIRB 3QRGH 1FNHA 1JPGB 1A3RH 2HH0H 2YPKB 5F1NB 1HHJA 2EYRA 3L5XL 3UROR 5D70L 1Q0XL 1ZVSB 4FA8A 5ID1B 4LU5L 1JPTH 4JPWL 5C0CE 4GRWB 4ZS7H 3ARFA 2R0LL 3BT2L 4JFFA 4LNVA 4W4OA 4ZNCD 3EYQC 4BSWA 4N8VB 1GVIA 1V8HA 1P9MC 4YHML 3HC0A 1MSPA 4ETYA 5TQ0H 4IOFD 5E99H 1CGSL 1NFDA 4ODSH 3C8HA 1AFVH 4M00A 3MJ6A 5H2BB 3NZHH 4EI5D 4GW4B 4U1SB 4YC2B 1Q9WB 3TBSB 3TH4T 2YKLL 3FQXB 5CEXB 3A67H 2FJHA 5J89A 3X3GH 3B83A 1B0RA 1JL8A 4NUGH 3V6BR 3O6FB 4LBEA 1MFDH 4XVUD 2CK0L 4YGVA 2X4TB 4YDJA 2WBJD 3T0EA 4JQXA 5BV7L 4LSQH 5GZND 3T3PE 5D71L 1RVFL 5E8EA 1FO0B 1P69B 2DKMA 3F7YB 3RWHA 4HQQL 1R3JB 3G6AA 4JKWA 2EE2A 2R2CA 1I85C 2VISB 4OZGE 5JW3L 1L8JA 3PJSB 3TJHA 1TNNA 1NBQA 5DR5L 2P8PB 5C0AB 1K5NB 5GRYA 1T4KA 3MJ9A 4JGJA 4M1GH 5I17B 2NY7H 1I7TA 4UU9B 1KXQE 2JE8A 1E27A 5CS7A 2MKWA 3GDBA 3QEQA 1B6DA 4EI6A 1XGYL 5ANMB 5KOMC 4P5TD 3GO1H 3RGVA 2VDKH 3KHOA 3BH8A 4X5XA 1MVUB 4HJJL 2YWZA 4HWUA 5JHLH 2J8UA 4CVZA 5LG1A 5DHYA 1AXIB 3DXAD 5LQBL 3ZE1E 3QUZC 1C5DA 1RUKH 4J6RL 4JPKL 2OTWA 1W0VB 4QRPB 5I1HH 4J8RB 5MEQB 1CFVL 4Q6IB 4JCMA 3B43A 4KTDH 1IJ9A 1A3QA 5JNYB 1NFKA 3R06B 1OQXA 1MCEA 4JLRA 1Q1JH 3V8CA 3VJ6B 4OLZH 3HE6A 1WBXA 3EAKA 1ZLVK 3D9AL 4FQJH 4I5BA 4J4PC 3OB0H 1VADA 4JVWA 1MIEL 5EZLA 3W82A 1SJVA 2AK1H 5CFHA 4HGWB 2I26N 1J88A 4TNWF 3QH3A 3T2NH 5GRXG 2E7BA 2VC2H 3NACL 1HE7A 1OARL 4MS8C 3JV6A 1BZ7B 3GSOB 5JIHA 4WCYH 3ARTA 3I75A 1PVHA 3WLBA 3K8MA 4OF6A 3IXAB 3V0WL 5DK0B 1BVKB 1YEHH 4Q0XH 2A0LC 1T0MB 5MEPB 3B2VL 5GSVB 1FAKT 4DFIA 1W8OA 2V5SA 1KACB 1YNTB 2V17H 3PV6B 2OX5A 2IANE 2HG5B 3CH1B 1J0JA 4BUHA 4APQB 4POYA 4M61B 3OAYH 4NRXB 4E41E 5F3HB 3IF1A 2DQIL 4QOKA 3EFDH 3WN5C 5FUOH 4FFEX 5EZOH 4Y8DC 2BNRE 1JYXA 4R96A 3H9HA 4LSPH 3FN0L 5KVFH 4ODHH 4L3EB 3DNKA 2MNUA 3HA0A 1D3CA 3WHXA 1KGCE 1A14H 4TVPL 4G59A 2YEZB 1KLUB 2H8PB 4MWFB 1CU4L 1DSFL 1NAMA 4NQCE 3RWDA 1A9BA 4E0RB 4ZPVA 5DD1H 2AEPH 1Q94A 1OB1B 2VAAA 15C8H 1HINL 3SY0B 4WW2C 3RL1A 3S97C 2QADC 1IM9B 3MRHA 2ITDA 4XH2B 3QJFB 4P2QE 4NO0A 4DN3H 4C56B 1FV1B 3HC3L 4BSJA 2MWCA 4KZEL 1H3VA 2LQRA 1EXUA 3KLAB 3QDGD 3VFNA 1GIGH 4BZYA 3C5ZA 1A5FH 5SWZD 1FCCA 5CEZL 3VXME 1MEXH 4KHTL 3ZE2E 3OKEA 1PKQB 3FQWA 5I71C 4PJ7F 4WGWB 3WV0A 2O5ZH 1I7RB 1RJLA 1Z9LA 2OXGA 1CF8H 4X98B 2VL4A 2XT1B 4ZTPL 3HCVB 4KRPC 4NKMA 4XT1C 5EU3B 3X14B 4YXHH 4EDXB 3RVVC 5E8DL 5ISZD 4UOW0 1LO3H 1A1OA 1RI8A 1IAIL 3GRWH 4NM4H 4GRWE 5KSBB 3A6CL 1MCIA 5EDXA 4Z0BL 1CN4A 3U2SA 4PJ5D 3N1QC 1DJSA 3MUJA 3V6OE 5J3HC 4XNZC 4Z7VA 4RWYH 2B1AH 5LKNA 2BVUA 3LKQB 4MXQC 5TF0A 5I8EA 4DGYH 1KB5A 5TDNA 4M6MH 4HH8A 5IMMB 2XTJB 2E3VA 4OZGA 2FEEL 5HVWA 4KUCD 1FSKC 1KJVB 4HS6B 1Z0NA 2FL5B 3DHJA 2Y1VA 2W65B 4NNYA 5IB1A 2LU7A 5AYUL 4L8SC 3VMPA 5IESH 1CGVA 2AJ3A 1NFIB 1EA9C 4P99A 3U0WH 4BFEA 2YPLB 2AXFA 4UTAH 1VEOA 1KJMB 3FFCB 3NABH 4XZUA 5J6HB 3ZDZE 5EOQL 1ZLSH 3G5ZA 2FATL 3IAQA 1R3LB 3JZ7A 5C0AE 3SKJL 1I3GL 2HFFA 4GRWH 4Y5VA 3FO2A 1PQZB 4XPGL 3DTXB 3KS0J 3ULSA 1J5OH 3UTSB 3EYFA 3QFJD 3D2UB 3DUUB 1P4BH 4JFYA 4BELD 1J9CT 4GAYB 1UH3A 4I77L 3SDDC 5I1JH 4I3SH 3HZVB 4RMVA 3MYJA 4U1KA 5ICXB 1ZT1A 2VH5L 3CX5K 5HD8C 2IADB 4QRPE 4KQ3L 3AB0B 3EYSH 5T1DH 5E1AB 2VRAA 3TN0B 4QXGL 4WUKL 3GNML 3MLTA 4D9LL 1E4XH 4O4YL 1UB5A 2W0PA 3CIQA 2VSDA 2HMID 4Y4FA 3FRPA 3EGSA 2EYTB 2H6PB 3MXWH 4KZDH 1ZHBA 4JN1L 1FO0H 2X1OA 3O11B 3PL6A 4JFOA 3HRZA 4JY6B 1VB9A 2CMRL 1P84K 4MNHA 4PUBL 1WT5A 4X4ZA 1AXTH 3CX2A 2EEAA 3DRTA 3HNSL 3M17B 4B7IA 4AG4H 1BQHA 4KC3B 1TZGL 5IVXE 2L0DA 4PPTA 4Z5RB 3X13A 3PGFH 1EAJA 3CUPA 4HUWB 4LQFL 4HZAA 5HI3D 1DQMH 2I25N 2LTQB 1KJ3H 2VE6A 3HUJF 4FQ1L 3BWAB 5GS0L 4MJ5A 3ARFD 4E41A 4JFFD 1P7QA 4LASH 3VXQB 1I9RH 1G9NL 4KU1A 5F7MC 1H5BA 5HYQA 1A47A 1JPST 1QQDB 1V3KA 1OP5K 3IDMB 4G7YL 1EEUA 2DICA 3WIFB 2J88L 2VXSL 2VZ1A 3D85A 4JPVH 4OFVA 2IPKB 2B4CH 3W39A 1T83A 2FX8L 1OAZH 3AS2A 5D5MB 4NN6B 3CJJA 1TZIB 3WFDL 3H9SB 3BQUC 5CMAB 2CGRH 5JQ6H 2DQGH 1N59B 2YD6A 1ZTXH 3U0TA 4NQVB 3W9EA 4DKFH 5HPMB 3PXJA 3DI2B 5JZ7D 4JCLA 1BECA 1CE6A 2EEDA 5D7JC 1X4ZA 4P2QA 3DMMC 3TJHD 3EDFA 3H3BC 5F6HJ 2XYCA 1ZVHA 5BV7C 3QG6A 2HKHH 1CR9H 2QQNH 4NWUL 1NGPL 4KMTL 5DFTA 3D25A 4PBXA 1RUPL 4MA1B 1A6UH 2X2YA 2DWDB 3BDXA 3QEQD 2EDJA 3QNZA 4DW2H 4U6YB 5GGSY 3SKMB 5E0QA 5FECB 3RGVD 1JPGA 1I9EA 5JXEC 4ZYKB 1F2XK 2IPUG 2IBGA 4X99B 4HXBL 3FMGL 3JBG7 1RZIB 4S1RH 3IRZA 4C56E 1ZVSA 4AQOA 5IF0A 2NNAA 5HJ3B 4YHNB 2G60H 1IZJA 3ARSA 5CHNA 5E5MA 2JKXA 4L9LA 5KZCD 2R69L 4LKXA 4QHUB 4K7PY 4PFEA 4O5LL 1N26A 2AK4E 3NFNA 1JZ2A 4UB0L 2AKRB 3V6OA 3WS6C 5DZOA 4HC1L 3HE6D 4MAYC 5ESAB 1BFVH 2D7PA 1VGEH 1MFAH 4OBSA 3DX9B 1RK0B 4QHNA 4R90H 4XWGL 4XCEA 1N6QL 5TE7L 3QUXA 3VDCA 4QHLB 5HYIA 2EIEA 3VWKA 3B5TA 3O9WA 5KSBE 4Z95H 1LDPH 3OKMB 3TEUA 3SKOB 5IHZB 3UTQA 3MUGA 3ULUE 3WN5B 1GGBL 5E08H 4KGLA 2J5LC 3NIDE 5D6CA 5HHOA 1F5WA 3QAZB 3INUH 3TIEB 4BK4A 3AVEA 2VISA 1HHKA 4FG6D 5IJVA 3RRQA 2PYFB 5C0AA 2IQ9H 1JZ8A 1G6RA 2CDEA 3L3DA 4HKBB 5I16B 4J12A 2DM3A 3F12A 4G42A 3PGDA 3I84A 4MZ3A 1IQDB 2AXGB 1INEL 2JIXA 4I18A 1A1MA 3BESR 5DJAB 5AAMA 7FABL 1UM6H 3CSPA 4KPHH 5BS0B 1JIBA 1QO3B 1FBIH 4JM4L 4NIKB 2JCCB 3IFNL 2QADB 4U6VH 4OLWL 4QOKD 1NGXA 1FFRA 1HN1A 2GTWB 2NTSP 1DZBA 2BSRB 5C6TH 1IGIH 5KVMC 3RZCA 2YZ1A 1YECL 4ZOBA 3N50A 2EH8L 4ZOEA 4JHAL 4Y4KC 5C0RL 3CSGA 1VGKA 5EG6C 1DFBH 3ULUH 3PQYB 5FB8B 1IEAA 3OG4B 3VJ6A 2WBWB 1OTTD 1V3MA 3GMNA 1FFOA 1WWAX 2I9LA 4JO1L 3MQIA 3RVTC 4FXKB 4Z0XA 4QEGA 4RSVA 1WCBB 4I3GA 3GBLA 2VDLH 5IVXA 1EVTC 4I0PC 4KROB 3LQMA 1F4WH 3MLZH 1J86A 3BPOC 3U0PB 4NO0D 1E4WL 2PW2A 1R6VA 4DVBA 5CJ8A 2H26B 3CFCL 4R4FL 2AJVH 1ZK9A 3DURA 5I15H 3VXTA 2IPTH 3DVGA 2Q86A 3NFSL 1HXMB 4YQXH 3AREB 1F4XH 5K9QG 5C6PB 3PWNB 5IJKC 1DVFA 5DRWA 4KKBC 5C8JB 4HK3N 4NWTH 1RK1B 4Y1AB 1FPTL 4CVWA 5D8JH 3REVA 1BQLL 3MCKB 1ETZA 1S9VB 3TBWB 3QA3B 4L8SB 5L7XL 3SGJC 2BY1A 4M61A 1BEYH 1YN7B 3W5MA 1NGYA 4KTEH 4F7EB 5SX5K 2XICA 4V1DB 4X0KB 3PWLB 1RZFH 2N56A 3JTCA 4JHWL 3BPCA 5A2IH 1M05A 3MODH 4RZCA 3KPPA 1UB6B 4U4BA 4BZ1H 3KYMA 1FGVH 1U8HA 3KYAA 1XGRB 2FBJH 4KFZC 5CZVH 2LVCA 3AM8C 3QHTC 3NH7L 4OCWL 1M7DA 5IP4A 5D5ME 2I07A 4FQQA 2CR6A 1VCAA 4D9RD 1EBPA 3JTTB 3SDDB 3L6FB 1OPGH 1CXEA 3QO0A 4RGMC 3FCTA 4Y4HD 1AH1A 2XNAB 5GGQH 3L95B 3WKMH 1RMFL 1NC2B 5CLTA 5EPMB 1HXYA 5EU6E 4OAWB 2RQ8A 3SGKC 2AQ3A 3H42L 4HCRA 3WE6B 1ZSDB 2BVPA 4NJ9H 4RGNC 5HGBB 4PJ7B 4WEBL 1WFTA 2XZAL 1SYSA 3VMNA 1HNFA 1QFPA 4ELMF 2AK4A 1JNJA 3MRBA 1NQBA 4LMQE 2X4PA 4DEPC 1DBAL 4KVNH 2H9GB 4MNGB 2IAMB 3B8SA 3PABB 4X98A 1I1FB 3RWIA 4E9LA 1T7YA 4PGEA 4ZFOB 2VDRH 5KJRH 1QBMH 4RA0C 4Q58C 2BCKA 2NY3C 3QIUD 3X14A