1HSBA

Different length peptides bind to hla-aw68 similarly at their ends but bulge out in the middle
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
270
structure length
270
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68.1)
publication title Different length peptides bind to HLA-Aw68 similarly at their ends but bulge out in the middle.
pubmed doi rcsb
total genus 77
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 1993-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hsbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1hsbA01
2X44D 3MROA 5ANMB 5HXMA 4C56B 2DOCA 2B20A 2X4PA 5C7XH 1T89A 3KHOA 4MDIB 4PJ5A 5K59E 3MSPA 1NDMA 1R5VA 3U6RB 2IH3B 3RWCA 1G7PB 2VRAA 3CIQA 4J4PA 4YHNA 4XC3L 3E3QE 5DJDA 2FBJL 2DMKA 1Z9MA 5JNYB 2BNRD 5IVZB 5EIIA 3NAAL 4KROC 4M00A 1FNEB 2XZQL 5SWSB 1QSFD 2DQHH 3KG5A 1F45A 2FBOJ 1ULVA 1A6ZB 3IDNA 4OAWA 4X83A 5T33L 1UM6L 3X13A 4WU5A 2Z4QA 1AXTL 1U0QA 4M1GH 4M8VA 2V17L 4PP8C 3GSXA 3L7FB 1JNNH 5JXEA 4UU9A 5I18L 3BUYB 1N6QH 3SHSA 4UAOB 5IV2A 4HHAA 2APXA 5J13C 5C0RH 4TUOB 3QPXH 5BRZB 4RGMC 3OG6B 1LDPH 3ULVL 5F1KC 4P2CG 5DMGC 3I3BA 5HI3D 5IK3A 3FRPA 3C9NA 4UNUA 4G8IB 4Z5RB 1HILA 3W39A 5FFLA 1F4XH 1RVFL 1GGIH 2AXGA 1QTYT 1PQZB 1AIFB 3EDEA 5JIKA 1D5IH 1NAKH 4X6CB 1P2CA 2XXMB 3OKLB 2EDBA 3WFBL 5I8EA 3PE9A 1LNUA 1JPSH 1A6AA 1A9EA 4K9EH 4PRHD 4WTZG 4ELMF 1ZA3A 4NCDA 3B2VH 4MNHB 3T1FA 3I84A 3UTSB 1UACH 1WK0A 8FABA 4K94H 1FH5H 4JKPL 1F6AB 3RDTB 1TVBA 2NNAB 5F72S 3JVGC 5GGTL 2LABA 3T08A 2GEEA 5K9QG 4KKLC 3ARGB 4WHCA 3CX5K 1PG7H 4L9DA 3K7UA 1WAAF 4R2GD 5DLML 1PY4A 2X6MA 4KXZH 3BN9C 4NUJB 1MLBB 2N1KA 2NY0B 3PABA 5DRNB 4U7MA 4F8QA 3FOLA 3OGCB 1AFVH 2VZVA 2BVPA 3FO9A 4W68A 3P9LA 3QG7L 4DN3H 4QTHA 4Y4HA 4YQXH 7CGTA 1C12A 3N1PC 4OFYD 4I77H 5MEOA 4Z0XB 5BCAA 4K71B 1FJ1B 3FHAA 3HZKB 2B1AH 2O5YH 1A6PA 4JFOB 4LSUL 3OBAA 5I2IB 5B4MD 4JVUA 2DQCH 2BMKA 2R0LH 2DM7A 5BZWB 2ERJB 1YQ2A 1PYWA 5C0AB 2R39A 3VE0B 3BVNA 1EVUA 5ICXA 2Q7YA 2XN9A 3MBXL 5LAXA 2XRAH 3KPMA 3BIKA 5IROA 5FUOL 2Y06H 4G5ZL 5DUBB 3MA9L 5TH2B 3V0VB 4URTB 5ENWA 3TM6A 4ZFGH 3W11C 2Z8SA 4OFIA 5E1AA 3I6GB 4KV5F 5E9DD 2D7QA 4ONGL 4B5EA 1IAMA 1WFUA 4Y2DA 5T1KA 4NQCA 3VFVA 1WBZB 2MCG1 5BMFL 3NACH 3BPCB 2XPGB 1QRKA 4BELD 1T80A 1UXWB 1YNKH 1YPZE 1G9NC 2H45A 1N2RB 3NCCB 3W81A 4NZTL 3OKEB 4X6FB 2K1MA 4WHTA 4Y7MA 1FFPB 1I4FB 1IM3B 3RDTC 3WFEH 2IH1B 3W9EA 3MJ9L 1O7VA 4Z77A 2D03L 4K7PY 3ARGC 5DUPL 1K3ZA 3QI9D 3Q3GA 2WINA 3N0PB 2P45B 3AC0A 3DTXA 1I3RA 1O5DT 3RWFA 3G6JB 3VGDA 1AGBA 1MCEA 3V4VH 3KPNA 2NY0C 2Q1EA 4LCUA 1D5MA 1EFQA 1HWHB 3G08B 5DMIH 2PTVA 3GI8L 4KAQH 4M1DH 4WW1A 1CFTA 1GOHA 4KDTC 1MFEH 1IEBA 3F5WA 4JO3L 1HE7A 4PJHB 5HGDA 1KC5L 3EGSB 3IFNL 5J6HB 2A9ML 3PWPD 4UTBL 1MAMH 2IBBA 4JB9L 1JGEB 5MEQA 3DI2B 3GMNA 4M93C 4AT6A 4P4RA 1YNTB 1QFWM 5TJWK 2ERJC 2DJSA 1E0OB 4JO2H 1RUQL 1YJDL 4PV8A 2WWMC 1UJ3B 1J5OL 3VFWA 2Z8VC 1RK0A 4TYUA 3H3PL 1O0VA 1OP3K 4XCCL 3S96B 2EZ0C 2AJSL 5D1ZB 2FX9L 5F7KC 4NGHL 4GMTH 5H37H 5JZ7D 4NOFA 3MGOB 4JVPA 3IU3A 4PUBL 3MRLA 4J8RB 4F9LA 2VUYA 1T0NB 4MNQA 3H6JA 4YFDB 1IGCL 3K3QA 5LBSL 2GSGA 4FRWA 4O58H 4GO6B 4JY5L 4HS8H 4NZRH 2O26U 4MA1B 4L8BA 4LLWB 4OCWH 3W82A 5B38G 5IMOB 1A21A 1T4KA 4BFEA 5GS2H 4LDEB 5DEZA 1MCRA 4HK3N 4X6CF 1QA9B 3OF6A 2QADC 2ZOLA 1FZJB 5BO1H 4OFPA 5D7KE 5TE4L 5GRWA 3QIBA 4DW2H 5E6IA 2VITB 3EO1A 4X9GA 2YK1L 1YN6A 1I9JL 3CFEA 3GMMB 4DEPC 4FQXA 1I1AB 1RSFA 1E28A 1M4KA 1A22B 3RA7L 4QWWD 2HN7B 1FLRL 2IADB 4ZS7L 3IRPX 4N0UA 4D9LH 1HWGB 5DHVA 3ZHLA 4XCNA 4XHQA 2ZPKH 3UDWC 4WWKA 3SY0B 4HUWB 3VWJA 3B6SA 5FV1L 4LBEA 1QD0A 2W0FA 1KIQB 2FRGP 4HFWB 3MUY1 4R97B 5CJOL 1DVFA 5CP7A 1UJ3C 4PRAB 1FV1A 3CFBB 4YEEA 4L3EB 5C0BE 3ZE0F 1LK2B 3TYFB 1G0YR 3AS0A 3BXNA 1EPFA 2UYLA 4I0CC 3HMXH 5DZOA 5HYIA 3IDMA 2Y6SC 4P2OA 2AJYH 2YD7A 2APWA 3DIFA 1BQHG 4YC2B 3SGDH 3QA3B 4PJFE 1JZ4A 2HKFH 3D0VB 3HC0A 5TGBA 5I1AB 3E6HB 5I66A 2MQCA 1J1PL 3IVKA 3UPRA 1X5HA 1KFAL 4HFUL 3QFDA 4B0MM 3GSNH 3R06B 1RFDL 5D1QB 4K7FB 1J1XH 4OKVB 3VXSE 1FVEA 2YMXL 2EYRB 4MA1C 4Q7DA 1HKLH 1VDGA 1NJ9A 4IHOB 4EN3A 4I2XE 3QWRD 1IGJB 1BJMA 4P23B 3TN0C 3ARFA 5L2KB 2Q20A 4WO4B 5ID1B 3T4AA 2VLRA 1B4JL 5MENB 3MLWH 3MV01 2FNBA 1UCBL 1IRAY 3BKYL 4NKIH 3RWJA 4KMTL 2EO9A 1CFVH 4ZS6C 5C6TL 2R23B 3RX8A 4X4YA 4IRJD 4N8VB 3EDDA 2CR6A 1I1AC 4B41A 5GRYA 4QF1B 1YC7A 5DJAB 3EYFB 5J1AB 1F90H 1TFHA 1JZ6A 5DHVH 1OQOA 2I60H 1KLFA 1ZTXH 1AQKH 4PGCB 4PJ9A 2DLTA 3G5XB 5D96C 3VGHA 4NO0A 3E8UL 1RJYB 5KW9L 1NCDH 4EDWH 1CXLA 3Q2CA 1X5FA 3G6JF 3EFFA 3KNBB 2VLLB 4PJAA 2RHEA 4F2MB 1KGCE 3LS5H 3T0WA 3MJ6A 1U58B 5KJRH 1ORSA 3BRGC 4PJDA 3DETC 3EOAA 1AC0A 1UB5A 2X1XR 3PP3H 4GMSH 1OPGH 5L6YL 2P44B 5HHMA 4PJHF 3HB3C 4QRTA 4ODWB 1J0YA 4GAYB 3TFKA 3LKPA 3QUYC 4XBGB 2QSQA 1RHHB 1NC4D 4NUGH 1PSKL 3U1SH 3SCMB 4OV5B 5EOCH 1NANH 3MO1B 5CD3B 1MJ7L 1NCWL 1QKZL 4ZOAA 2VNCA 3PGFH 3RL2A 3MRKA 5SWQB 1R3HA 5I8CA 2H3NA 4U3XA 5GZNC 1A1OB 1AP2B 4NQSA 3KPRA 4ELME 4F3FB 3MACL 1KEGH 2W07A 2C5DC 4P23C 1MCIA 4NJAH 1SJXA 3UTQB 1TLKA 1OCWL 4M4RA 1XT5A 4EUPA 1H5BB 4W4OA 2NY3C 2CO6B 3C09B 4BSJA 4JZOB 2V9QA 3BPNC 2X1WL 3R8BB 3JTTB 3UO1H 5K93A 3PUCA 5AZEH 1XH3A 1Y6MR 2HTKC 2YZ1A 2DYPB 2KZ1B 1DBBL 3HE6A 1N0XH 4KVCH 2I5YH 3HMWL 5GPRA 4MSWA 2BHYA 1TJIL 3OSKA 4OF8A 5F88B 5FYJU 4RRPA 1JRHH 3F58H 1KB5A 3BESR 4IIQB 3RVUC 1DN0B 1J18A 2WBJD 1DLHB 4HV8A 4KI1A 5C92A 2GUOB 1BFVL 1FNLA 3C87A 4QO1A 3HZVB 1VHPA 4BH7A 3NIDF 1D5BA 4ZOBA 3BP7B 3NN8B 5D7KD 3RIFF 1QVOB 3KJ4C 1KJ2A 4PG9B 3DUSA 4Q2ZA 2L4OA 4Q9CA 3VFTB 1GZPB 3AREB 1VFMA 5MEPB 3D1MC 5I75B 3HFML 3NPSB 3MR9A 35C8L 4LDOB 4TVSa 3QFJB 4JFDA 3ARVA 3SDAB 3V5KB 3SCMC 3FRUB 4JRYA 3WDIA 4Y4FD 1X6LA 4KV5E 3JUZA 5J0BA 1NAMA 1JV5B 4GXVL 1ZANH 1A4KB 4OV6F 3GJEB 3HRZA 4LIQL 1J10A 1ZHNB 43CAA 4S1DD 4OGZA 3X3FL 5C0BD 1S7TA 4GXUN 4RFEB 1JF6A 3SE3C 5DEFA 3CVIL 2GJ6A 3OB0H 3PGCB 5FKAB 5I30H 3KYNB 2P8LA 3OHXB 1PX3A 1JF5A 2Y7QB 4QHMA 3C09C 1GCFA 1I9EA 4JE4B 4PJIA 3VFRA 3MUHL 3L3JA 4X7DC 3SE4C 1WZ1H 4YWGL 1INQA 1DQML 4P5TC 5DT1L 1L0YA 1PDKA 5TDPA 2CIKA 3RY6C 3V5DB 4HIEA 3QIUB 3DXAA 2ADFL 3VXSD 1QNZL 4NM4H 4A6YL 3HI6H 4OTXL 4KJQD 5HDQH 4YIQA 4C56E 1CFSA 5I1IL 3K8KA 4LLQB 5IKCA 4HDIB 2B2XH 2VLJB 3SN6N 2R0ZH 3TA3D 1KJ2H 5DURD 5DS8B 1SBSH 3RZCB 4GKZB 3CMOL 1REIA 4OSUH 5T3XE 5JUEL 5DD3H 3L3IA 4P9HH 4QRSB 3DX8A 5E94A 2R9HC 1P6AB 1DANT 5D7LA 4D0CB 5KTEL 1CVRA 5SWSE 2HFGH 1T66C 2XT1B 1XZ0B 1KLUB 1RJZB 3DJ9A 3OKOB 1NAMH 4IRSC 4HCRH 1CDBA 4HMEA 3QSKB 5BXFA 1MIML 4C55A 3AFLA 1M05B 3QRGH 5B39A 4PBVC 1GGCL 2GSIA 3TZVC 1MNUH 2ZOKA 1VPOH 3FQRB 3P4NA 1XGUA 3TNNA 3HE7C 4U6TA 5CLTA 1KGCD 1FNAA 3A67H 4LEXH 4NWTL 1GGBH 3SDDA 2EE6A 5BRZE 3MRMA 3NZ8A 4UQ3B 3MRHA 3C2SA 2R4SL 5J57B 2IALA 4O4YH 3HZMB 5D7JD 5DJ6A 3DYPA 1ORQB 4X6CE 4X4MA 2BSTA 3NZHL 3O3BB 1P4IL 4HAFA 5C0GB 3F7VB 1KNOA 1ETZA 4X5LA 4EEEA 4FQ1L 4FXKB 2E9WA 2H32B 1HYRC 3P9MA 2Q86B 3BP4B 1TCRA 1QBBA 1HZHL 5I8OL 2XWBB 3H9SA 4JFFB 2PW1B 3CFKB 1DBAH 4R90L 3EOYG 2WUCL 3P0YL 3D0LA 5EU5A 1U3ZA 4JGUA 2DB8A 2DQEH 5KSBF 1MF2H 4XHJC 3WS3B 5IQ7H 1U3HA 3BPOC 2F53A 1HQRA 1YDPA 3RZCC 4XPAH 1I8MB 4LSPH 5E5MB 4DZBA 3CLEH 4MDJB 1C5BL 3RPKA 2P8PB 1FZOB 4HGWB 4R96B 3RWIA 4B50A 2ADIA 3ZE0E 3MLTA 1KG0A 1OP5H 3SPVA 1OTTD 4OF6A 3QUXD 1BM3H 4HULB 3O8XB 2CLZA 5C0JB 1UZ8B 2HP4A 3VDCA 1X5JA 5E24E 3FZUC 2PXYD 3O45B 3W0WA 4UUJB 3UYRH 5DA4A 1S7QB 1T1ZA 1ZA6A 4OM1L 5C0AE 5F1NA 3W9DB 4CVZA 3FT3B 2MKWA 3LHPL 2YC1B 1P9MA 4OCNC 4P9ML 1J0KA 3HS0B 1EXUA 3TBTB 1S7VA 1EHLL 2Y36L 3VXTA 2W38A 1IL1A 3STZB 3OWEA 5FO8B 5CBAB 2AJZA 1N6UA 4R26H 4TULH 2LE9A 3GBNL 4B7IA 3HNVL 1OLLA 4JG0H 4JM2A 4G8GB 4KROD 4JRXA 5HYJA 1G9EA 5EN2B 1T6VN 2BCKB 2BJMH 1HCFX 2X4SA 1S3KH 2WP3O 3G5VA 1TTUA 3DX9B 4EI5B 1IAOA 2Z91B 2HJKA 4RGOL 2ZCKH 4WV1A 3VWKB 1JUFA 4DKDC 2PR4H 2QSCH 4HS3B 4POYA 4PLKD 2Z31C 1RU9H 4PJXA 4TNWK 4RIRA 1KTLA 2XG5A 2Q6WB 1FO0A 1KCVL 1CLCA 4TQEH 2B8OT 3G6JE 3QIWB 1QBAA 2BFVH 4H5SA 4Q0XL 5F8RC 1MFCH 1R24B 2UZIL 2Y72A 5FDYA 4KQ4L 1A1NA 1M7DA 4U1JA 3BI9X 1ACZA 1YY9C 3G5YA 1BLNB 4G3YH 3DO3A 3FQXA 3LKSB 4PJHE 5JTWA 3WFHA 3GMRB 1T0PB 4PRBA 4NCC1 3MLSL 1FL3B 2OP4H 4OJFL 3ES6B 4B7LA 3O2WL 4C56D 3O2DH 5CJ5A 3U0WH 3LV3A 3VD4A 3MYJA 1XGPB 3WE6B 5E5RB 1AXSA 4C83B 2CLVA 2EDNA 3OR7A 4LPWA 3KLHC 3P30H 5T3XD 2JK5B 3SKNA 4W70A 4HLJA 3MRIB 3EYSH 3ZYOA 4NRXA 1MH5A 5C0ND 3CVHL 5SWSD 3KLAB 3R1GL 3ZKND 2P5WB 4LCWA 4FQPA 4N8CL 1J1OL 4O2FA 1IM9B 2QQNH 4H8WL 3BISA 3IAQA 4KXZI 1BHGA 1IKFH 4F33A 3P0VH 4RWHA 4JDTL 1MEXH 5A3IC 1LWRA 1K2DA 2ZSWA 3DVGA 4NHUA 5I15L 1KJMB 3QEHA 4JQXC 5EZOH 2F54B 4XPTH 4Z7NF 5GIRA 4P2YA 1MI5B 5BRZD 3QQ9C 4OZGF 1A9BA 4XNMB 5HGAB 1IILE 3QPXL 1VFUA 1BBJA 3MZTA 4ODHL 5FA3A 1MCPH 2W0KA 3WFZA 2MOVA 4JG1H 4WFFE 1U8PA 3MLXL 4R4NC 3NIDE 5JHDA 3BW9A 3V6BR 1NAKL 4OB5H 1JFQH 2P7TA 4PGBB 1WCBA 1YEIL 3JV6A 1AKJB 4NQDB 4N0RA 3WD5H 3OG4B 2QQQA 4P3DA 3RI5K 4PREA 3ZO0A 4OIIL 2NMSA 1NFIA 1OGTB 4MWFB 5JW4M 1RY7B 2DI9A 4G6AC 1CFNA 5F97E 3L9RA 5ICYA 2FGWH 3ARGD 1DQTA 4F8TA 3VFMA 1AD0B 3PWVB 2NY0D 3P2TA 4MQTB 5EBLB 4NN7B 3ULVC 1S8DA 4GS7B 4LQFL 4PTUB 4N0YL 3TWCL 1IKNA 5DMKA 4NZUL 4HH9B 4MX7B 1KULA 4DVBB 1Z9OA 4U6YB 2PYFB 2B4CL 3EUUA 2FL5B 3FO0H 3U36B 3ESVF 5AAMA 4BQCA 1NGYB 2VDOL 2B1AL 1IFHH 5J9PA 5FHBL 3EW3B 5C0AD 4X80L 5J56B 3CH8A 4GW5A 3TPUE 1CL7I 2WWMD 4U1LA 1IZJA 5IW6B 5JQ6L 3I02B 2R29H 3BD3A 4RZCB 1F58L 4O9HH 3DI3B 2Y06L 5MENE 2F19L 4IMLA 1BF8A 4BZ1L 4TSCH 2VLKB 4DGIL 3FFDA 3PWLB 1IC4L 1VGEL 3HA0A 2WV3A 5FYLE 3MRFA 5IHLB 5ETUB 3QXAB 2E6JA 5CIPA 3RWHB 4AM0A 5C1MB 5EH1A 3N9GL 4HJJH 2A6IB 2WIIA 2VXQL 2OQJA 3TC9A 2ED9A 5IB2B 5KSAB 2ATPA 4HWEL 4TVPE 4ZNCD 4WRLA 5E4EC 3KPQB 1CIUA 2E7HA 1K3IA 4WI7A 2AQ2A 1EFXB 5EC1B 5FYJE 2GAZA 4ONHB 5E2UH 5A2KH 2IQAA 4KY1H 1CFQB 3Q5TA 3MV7A 4LAJH 4TSAH 2KZWA 5C0DA 2R2HB 2X9XA 2I9LA 3FN0H 5GGRA 4WJ5B 1RJLA 2YBRB 2YPVL 5HYQA 2D7OA 1CS6A 1UXSA 1I1FA 1IAIH 4BZ2H 1RZIB 2FSEA 4Y16B 4Y4KD 4LLMA 1U8QB 2C1OB 1CL7L 5IVOA 2YRZA 1KIRA 2X7LB 1OAZH 4BQ9A 1NBYB 3GM8A 1SM3L 4UV7H 4WGWB 5D71L 1LHZA 1CGSL 4ZUSB 5CD5C 3ALXA 1VCAA 5B21A 4IJ3B 1K9TA 1MIEH 3RBGA 5CEYB 4ZXBA 1I1CA 1HOCB 2DLFL 5TF1H 3AY4C 4Q97A 4ODVH 4JM4L 1S5HA 4JN1L 2D3VA 3KWWA 4MHHI 2DWDA 1ZLUH 2IEPA 4OLXH 2YRPA 5I1GL 3MZGB 5D1ZD 1MPAH 5CZXD 3HPLA 2Y6SD 2AJ3A 5CIPH 3OZ9L 5KSBE 4I5BA 3OKDB 4OLWL 1MCFA 3OR6A 4PS4L 4HZAA 3MPCA 1GIGH 3GBLA 4X4XA 4QY8A 5JDSB 4Y5XB 1IT9H 3F12A 4XVTL 1RZ8A 1YQVL 5A2IH 1NFKA 2F58L 1OLZA 2Z35B 3QDAA 1VACB 5LXGH 2I9TA 3S88H 1INDL 1RK1A 4X0KB 2CRZA 5GGSB 4L3AA 2C3XA 5HVWA 3WJJC 3ME0A 4ZMAT 1RZJL 5E8OA 1ZHLB 1YJDC 2F8OA 3IJSA 4FABL 4Q6YA 4LLYB 1D6VH 4NQEB 1C08A 1U36A 1MJJA 3O6FC 2RAMA 2W9EL 4L9LB 4RFOL 2R4RL 3PWJB 5IESH 1S9WB 4WFFD 3CCHA 2CUIA 2J88L 2CDGB 4JLRA 5CUSH 3QFJE 2CDFA 2XWJB 2ZCLL 5ACZB 3OAZK 5DRXA 1HXMA 1KV3A 2CKBL 3EJJX 1FZMB 5C2BH 1UWXK 5F9DC 1I7ZB 5HYEA 4FQJH 5GISH 1JJUA 2Q8AL 5D5MA 3QH3A 5IT2L 4FQCL 5H2BA 2ZCHH 4IJ3C 3NMEA 5C70A 4L3CB 4R4FH 1K8IA 2EEDA 4P3CH 2CK2A 4O5LH 2YOCA 1N64H 1LGVA 1MQ8A 3ZSSA 1N5YL 5DFTA 1BOYA 3FT4A 4G9FE 4NO2B 4L8DB 3AAZB 3MRQB 3U79A 3CDGB 1B3JA 4H20L 1T22A 3MMEA 4NQXB 4V1DA 1LEGA 3JWDL 3RGVB 2ARJB 1A7QL 4GOSA 2D7NA 1ZLSH 4I0PB 4AEIL 5F7YC 5IEKA 1N4XL 4NOBA 4K3JL 2UY6A 1MRCH 2ARJQ 3D25A 3MRNA 1OHQA 5J3HC 5I73B 1C8PA 1NGPH 2QR0A 2MPAL 5DI8A 3GSVA 4HD9A 5D1QD 4ZAKB 3S7GA 2OZ4A 1A0QL 5LGKA 5FO7B 4QXTA 5BVJA 1CD8A 5GZND 5ITFA 4M43H 4YHPA 3O3AB 3RNQB 5SX5H 3QCUL 3QDGA 2WANA 3CUPB 1VFAB 2VLJE 2HLAA 4KTDH 2YSSA 2FIRT 3FONB 1OVZA 4Q6IC 1TNNA 2R1YB 4WO4D 3R8QA 3X12B 3JVGA 4ETQA 3QPQD 5MEND 3CFDB 4G6JH 4X8JB 4L9LC 2J8HA 3K1KC 3DV4A 4FA8A 3SKOA 3FAXA 2FX7L 1Q1JL 4HUUA 5FYLD 3ZLQC 1CFVL 1FFNB 3SDYH 1IC7H 3PNWB 5TE7H 3WFDH 2YD3A 3BEWB 1HH6B 2DM4A 4YXLH 5KZCB 3MNVB 3TCLB 3QT2A 2QTEA 3MV11 4KI5C 2R0KL 1JN6A 1CIDA 5TQ0H 4TVPD 3WXWH 5JHLH 3TO4A 3D18A 1B4RA 4XMLH 2GTZB 2W9DL 2GI7A 5BOPA 2J4WH 1FFOB 1I7TB 3NGBB 4HG4J 3W5NA 4M62H 3WXVH 4ZTOH 1FPTL 5KVGH 3QB7C 4GAGH 1CTOA 4JHBA 1MSPA 2Y5TB 4X9BA 4OCLC 5FYJD 1NBZB 1MELA 2YPLA 4HWNA 4OZ4B 5LG1A 1YYLH 3GJFA 1DUYB 4MAUH 3GHEL 3O0RH 3U9UB 4ZTPL 4XI5D 1L7IH 4HMCA 2WQ8A 3HC3L 4NYLA 4Z7NE 4YDVA 3Q1SH 2E7LE 3ULUF 2V2TB 4GUPB 3BEVB 4OZGE 2KQNA 3W2DL 5EZIH 4CN4A 1C16A 3SCMD 5I73C 2OZ4H 2W91A 4NUGL 3RGHA 1T0MA 3I2CH 4JDVA 3RIAF 2R69L 5EFIA 1QLEL 2NW2B 1JWUA 4R7NB 4D3CL 4JFFE 4KJPC 2QHLA 1OF2B 4KUZL 4U1NA 4LCCB 2C7UA 2C1PB 2CSPA 2FO4B 1H3PL 5DHXB 5FK9A 1MOEA 2J8UB 1B2WH 1RUPH 2V2XB 3H9HB 3WJLA 3KHQA 5EA0L 3SKMA 4XVSH 5F7LB 4APQB 2CH8A 2DS4A 5HDOA 5KANG 3U2SA 4CDHA 3IFLL 4RGNB 5B3NA 1Q9WA 3CXDH 5JR1H 1D5ZA 1NLDH 3BUTA 3OX8B 4AH2B 5JPMB 3GFUA 3LN9A 5DRWA 2DYPD 2HJLB 2FIKA 1BAFH 4JGMA 4LASH 1MFAL 2R2EB 4YDKL 3RBSA 2I5YL 4KDTA 4RMSA 5CKGA 1K4DA 2H8PB 2HYMA 1FG2A 4N9OB 1QSEB 5I1DA 2WY3A 1X7QA 5T3ZE 1D9KD 4G80A 1RIVH 2NY7L 4MD0B 2JIXB 1YEJH 2IANA 32C2B 2DIAA 4D9QE 3FQTB 4LSVL 4X6BA 1UWGL 1I1YB 3UZEA 4F9PA 3ARED 2A2QT 4TRPH 3ARYA 3QXDB 1G0DA 1A02N 2VDNL 3QFJD 3ARBB 1UA6H 3SDAD 1MCWM 2X42A 3T2NH 3C8HA 1E4KA 1F4YH 3V0WL 2AABH 2XA8L 4ONFL 1JZ8A 3G6DH 1NH6A 4GG6A 3LDBC 1G9NH 1FRGH 2UWEA 3HN3A 4XNQB 3QUKA 1S9YB 3I9GL 4JFQA 5MP6L 5DUMH 3SGJC 4R8WH 4ORZC 3G04B 1KELL 1WVZA 3GJFK 4G9FD 1WBYB 4MD5B 1I7UB 5SWZA 3BZ4A 4KKBC 3O6MH 3RKDC 4PGEA 2O61A 1MCWW 3QAZB 4APQC 4NM8H 3AXLB 3SQOH 2BSSA 5EU7C 4E5XB 1QZ1A 3IS1X 4D9RE 4KWUA 5LVEA 5D2LB 5HI5D 1IARB 4XB8A 5KN5A 2D7MA 1CK0H 3QIUD 3T0EB 4WDIB 3N1FC 1TZHB 3LKRB 3INUH 1KB5L 1DBJH 1HHJB 1Z3GH 3HI6L 3MGAA 4PJCF 5IMKB 3FB5A 5F3BB 5HDQL 2VLJD 2P47B 4XHJD 4M6NH 2HH0L 5IB3A 2B2XL 3KAAA 3UDWA 5D1XB 3IT8D 3RZCD 1TJGL 4KZEH 1W0WB 5HGHB 3D48R 3FQNA 5HVHB 4OCYH 4HIIB 2DLEA 5INDA 2ZUQC 4F57H 1A14L 5IMLB 1ZWIA 3IXAA 2OJEA 1UZ6F 4ETYA 5DTFA 2HFEB 4K23L 2VDRH 5HDBF 4M5ZH 4MJ5A 4GKSB 4UOW0 2R1WA 1NAML 4RSVA 4HSQA 5ALBH 1A6WH 4ALAL 1Q72L 5IB1A 1HNGA 4S1QH 5EORL 1CDHA 2DMCA 4IRZL 4QYOA 1RUMH 4M61A 1NFDB 3Q0HA 5IB4A 1JI2A 3MCKB 2F54E 4LLUB 4QTIH 4XPHL 5GRUL 4NNPL 1MI5E 1DBMH 5CINH 1AY1L 1JGUH 3AM8A 4LLDA 5DRZA 2EXYC 3LH2L 2RFXB 2HT2C 4U6VH 3CDCA 1T1XA 3IDIA 5HHPA 4Q9QH 4UQ2A 1H8SA 2ADJB 1V7NL 4MQ7B 3TN0A 2A6DA 5D4QA 5JIIA 2X4NB 4LEOB 1FYHB 1GZQB 1ND0B 2A0LC 3LQZA 4OCRL 1I7RB 3T2PA 4KGJA 1QRNA 3QJFA 4WU7A 1CTNA 4QHUA 4ZQKB 3P73B 1N26A 4NQDE 4P57A 3FCTA 3T0EC 1ZSDA 2A6KB 2D0GA 3QJHB 4W81A 3CSYB 1J88A 1LO2H 2J8UF 4JFFD 3V52L 3R0NA 1AHWC 5F9OL 5BZDB 1OTUC 3UJTL 3PL6C 1NL0L 4YUEH 4N9GB 4DTGL 4G7VH 2Q76A 1WIPA 1B0RA 1Q0YH 5F9AC 1T7VA 2V7HA 1ZHBA 2FECI 2VDKL 5D1XC 3IFPA 4C57C 4RAVA 1DE4B 3OKKA 2G60H 5ISZB 2B0SL 3QHTC 3RTQC 4K3DL 3RVTD 1P5UA 1VADB 1T1WA 5DHYA 1DQQA 2NLJA 3BIAX 3HUJA 1FZKA 1OT2A 2YWZA 1Z2KA 3O8XD 2P24B 4YR6A 2XZAH 1BREA 3I75A 1DFBL 1DQJB 5BJTB 3QUYA 1YEFL 2LQRA 1T1YA 4PBWD 3EO9L 3PF2A 4GW1A 5IHZA 4ORGA 1VB9A 2YS4A 4LVOB 4JHAL 3D85B 5T3ZD 1AO7B 5C0EA 5DQ9A 5JQHC 3KYOA 5JO5B 5IQ9B 1TMCB 1W2KT 3LQAL 3CH1B 4NCC2 3GMQB 5DJ2A 4D9QD 4ZPTA 1KJ3H 1G7QA 3KYKL 1S9VA 1LO4H 2OSLA 2VLKE 3DO7A 2AVGA 5DJCB 5GJTL 2A74A 2J3SA 4MCZB 3NOIA 3HNTL 4P2RA 2YD2A 4KDVA 5B3JF 1XCTB 4XP4H 4CKVX 5C6WH 1W0VA 4GQPH 5AD0A 2HRPL 5HDLA 4FFYL 3BGAA 3MA7B 3SDCC 4EI5D 2FECL 4CU7A 2GTWB 4OIBA 1JGVH 3VWKD 1JFMA 4YNYB 1IGYA 2H1PH 4AG4H 2NTSP 5E2JA 5BV7L 3CXHK 3H7BB 3S37L 1I8IB 5C0CE 2PR4L 1LEKB 2FB4H 5EOTB 3S9DB 4JPVL 3TBWA 3OV6A 3QQ9D 2F5BH 1V3KA 4EJ1C 4ZFOL 2AJUL 2DF3A 2YD1A 4Z7UA 4HBCL 4ZFFB 1S9XA 4YHKH 5IBUB 2OL3L 2FEEI 5L7XL 3QIWD 3WHXA 1N59B 3PP3K 1JHTB 4LLVB 3TVMB 4LU5L 4S10A 3S3PA 5D7SL 2CLRB 5CJQL 1MFCL 4KRLB 2FHCA 4X7EC 3L3HA 4D9RD 2V5YA 2AKRA 4PJ7F 2OTPA 2CD0A 3REWA 1VFBA 3CVHB 2ZUUA 3ULUE 2KUTA 1HYSD 1JWMA 1N3NA 2FHFA 4LSRH 4S0SD 1ZXQA 1XGQA 3C60C 3IF1B 4MS8D 3WN5B 4LHUB 4G6AD 3MXWL 4YHIB 5CCKL 2AJXL 1T5XA 4MJ6A 4S0TD 3TBYA 4WUUB 5MERB 5HY9A 1F11A 3WIHH 5HHQA 1UWEL 4BFBD 5GGUB 4JFZL 4MB5A 3QDMA 1RZGA 2VXSH 3GSQB 3PWUA 4ZFZB 2A83B 2RB8A 4HKBB 1KPVB 1LE9A 5FECA 3QEQA 3RVXC 3CFCL 4K7PH 3DROB 3IKCB 3DUUA 3SE3A 5GGVL 3V6OA 3NA9L 5IBTL 5HI4C 1NFDF 2P48B 3DX6B 1IM9D 4J12A 5E9DA 1UYWH 2IBGA 3EYVA 2FEEL 4X5WA 3WIFA 1QR1A 3C5SA 3TNMB 3SE4A 3MLPA 2J2ZA 3DARA 4Z7WA 3MROB 4P5TA 1MFBH 1TENA 5HHNA 5I8KL 1MEXL 2XACC 3QWQB 2F54D 2DQIL 4TVPH 1A3QA 1D6EA 2X4PB 5FUCC 1FO0L 1MI5D 5DK3A 4PJ5B 1A3RL 3HC4L 4M9PA 3D3VA 4NQEE 4MLIA 1NDMB 1R5VB 1MREH 3RWCB 3V8OA 4YBQD 3TVMC 1RZFL 5DJDB 5T5NG 2EE3A 3FO1A 1PEZA 1F02I 4JY4B 5EIIB 2IG2L 1OAUH 3RVWC 3JV5A 3VD3A 4P4KC 5LGJA 4MZ3A 1AKJD 1YYMH 1DZBA 4KTEH 4NQDD 4XC1L 4X7CC 5CJ8A 3IDNB 1BECA 3X13B 4WU5B 1AD9A 2Z4QB 5J8OA 4N0CD 4ZUTA 3WN5C 5FYKE 4H8WC 5JORA 3GSXB 4OGYH 4IRSA 4KKCC 2P46B 4ZPVA 4UU9B 4NN6B 2FCBA 1MJUH 1I3UA 4XP5H 1TIUA 5IV2B 2FZ3A 2V5TA 3TZVA 2IPKA 2FH6A 1EJOH 1MVFA 5EU6A 2J6EH 3HE7A 1FVCA 5IK3B 1HILB 3W39B 2AXGB 3U7YL 1HEZA 1SJEA 4JHZA 4N5ED 3BKML 5I8EB 1LNUB 2ARWA 1V8HA 3S4SG 1A6AB 1A9EB 1EERB 4U1MB 3T77B 1ZA3B 4AIOA 3T1FB 2JELH 1NGZB 1GSMA 8FABB 4JREC 1A7PH 3DYMA 4MXQD 5IMMA 4CVXA 3RHWK 5A1AA 4MGXA 1KN4H 3EIFA 1DSFH 2YUXA 4MA7L 4MAYA 3I6KA 4OQTL 1T89C 4LSSH 2AV1A 2VXVH 1BBDL 4ODBD 1G7HB 1QEWA 2YEZA 1XGYL 4L29A 5FHAH 4ERSH 4Q58C 3RPIA 4PJCE 5DFVD 4O9HL 5E56A 2VLKD 3EOTH 1IC5L 4W6WB 4JFEA 3FOLB 1JPST 4WI3A 2BVPB 3FO9B 4WHDA 3P9LB 2EYTA 3FL7A 4QTHB 4Y4HB 3LEVH 1C12B 4PB9L 3U46A 5MEOB 5E2TL 5KSAD 4PJGA 4FOMA 4WY7L 2B4CC 3L3DA 1OGAA 1UZ6E 2BRQA 2BMKB 4XMKL 5HDBE 5JXEC 1PYWB 3DHJA 3OPZH 5C0CD 4MMZC 3BVNB 1P5VA 5ICXB 1QFWI 3KJ6H 2XN9B 3N1MC 5LAXB 3QEUA 3KPMB 1NQBA 4G8FA 1NBQA 2Q7YB 1EFXD 3BIKB 1PKQB 2HWZL 3KPPA 2VDQH 3MRJA 1RUKH 4HC1H 3SJVA 3ZE1F 5ENWB 2H6PA 1MUJA 3TGXA 2AI0L 4BQ6A 3F6LA 1KOAA 4KK8C 4KDWA 4WI9A 5E1AB 5EC2A 1R0AH 1KPUB 4UT7L 4Y16D 2AW2A 5I1JL 3EZ8A 2JB5H 3IS0X 5T1KB 4QRUA 4NQCB 3O2VH 3VFVB 3DLQR 3EJYC 2W60A 1M71A 1K6QL 1W0YT 3ULUD 5FB8A 2AK4E 1FHGA 4OCSH 1QG3A 5HSFA 4WHTB 3WO4B 1YEKL 5JMRA 5SX4I 1NUFA 2G5RA 3T04D 3W9EB 1E6JH 3UTTA 1HIMH 4Z77B 3MOAH 5TF1L 2FJHA 2J8UE 3C5JA 4WEBL 3Q3GB 1D7FA 1F3DH 4NSKA 2O5ZL 3DTXB 3RWFB 1AGBB 1FNHA 2Z31A 3KPNB 4QRRA 4H0HB 1FIGL 4RGNE 4LCUB 5EBGA 1D5MB 5T1MA 5EU7E 1P7HL 5DJXA 4NKQB 1NCBL 4WW1B 5FCUH 4OQ1A 1CFTB 2Y9RT 2AEQH 1QFWL 4HIXH 4R4BA 1OP5K 1FGVH 1J05A 5I1EL 1IEBB 3F5WB 3SGEH 4BM7A 5HGDB 3P4MA 1EEZA 4IRJA 1PD6A 5KVEL 3BSZH 5MEQB 4FXGA 4CVWA 1U8KA 2AK1H 2EC9T 4AT6B 2WBKA 4P4RB 1QSEE 1HINH 1YPZA 3DRQA 4WW2A 5E2WH 5D72L 4KHTH 4YJZL 4FNLH 2B5IB 4PV8B 1T2QL 4JPWL 5IROC 2W59A 4OZFG 5IFAL 3BAEL 3VFWB 4ZNEA 3UJJL 1RK0B 4NQED 4UINL 4Z9KB 4UTAL 3DUHA 3BP6A 3NFSH 4JJ5A 1OOAA 4AMKL 5IFHL 4RWYL 4GLRI 1T04A 1V5JA 2BVQA 1TITA 4JPIA 3LMJH 4LKCA 2EH8L 3RWGA 4LGSB 5CEZL 3IU3B 4NO5A 2JJWA 3TV3H 3MRLB 3ARPA 4Y2DC 2Q8BH 3U4AA 5CJXA 1CWVA 5GGQH 1LE5B 4F7PA 4MNQB 3WKMH 3LS4H 3SE8H 2DQDH 3OKMA 3GSWA 1KEML 1FORL 1NC4A 4PJBA 1BVKA 2GSGB 5FYKD 5B3JE 2QQLL 3GSNB 3MYZA 1XF4A 2ZCHL 5DR5L 4L8BB 4JEGB 2XWTA 1QLFB 1A6TA 4O5LL 4HT1H 4D0BA 1T4KB 1MCOL 4Y5YA 3WDHA 3MLUH 1RZJC 5ADOH 3U0PA 1S7UB 4YDIL 2ZOLB 3ZL4H 5FGRA 3RGVD 3MODH 3QIBB 1T03H 1KLGA 2ORBL 4I0PD 4KQ3L 5E6IB 4EDXB 2AP2A 4RAUA 4EOWH 1YN6B 3CFEB 4FQXB 3PDOA 1E28B 4NHCH 5F71A 3L3OA 3ZKMD 3HR6A 4LOUC 4O02H 2Y07H 2VISA 5I19L 3KDMA 4NZJA 4YPGA 3FN3A 3T0EE 4ZAKD 4NFCA 1NEZA 1WWAX 2QEJA 1BD2A 4OLZH 5DHVB 3QCVL 4PJ7E 4XCNB 1T7ZA 4MNGA 4P46C 4PG2C 5ERWA 4HMDA 4RFNB 4WWKB 4G6KL 3VWJB 1UVQA 3B6SB 4LBEB 1SEQL 1CDUA 2W0FB 2MQ0A 1UGNA 4CJ0A 5CP7B 5IJVA 3S97C 3V6ZA 2EEBA 1FV1B 4FQLL 5F44A 1C5CH 4M7KL 1QR4A 1KCSH 4ESKA 2FJGA 3BXNB 2DTML 2UYLB 5GRJH 1CE1L 3S98A 4G6JL 3IDMB 4P2OB 3DIFB 5JDJA 1V05A 4OZIF 3E6FA 3K2MC 3JWDC 5EIVA 3HC0B 5FM4A 5TGBB 5I66B 4F9LC 1EZVY 5KZCD 1IBGH 1CF8L 3V4UH 5TE7L 3IVKB 3UPRB 1CDIA 1OM3L 4JAMB 3S3JA 2NY2B 3QFDB 2YPKA 2ILLA 4K3EL 3BHBA 5I1CL 1LO0H 4XCYA 4S11A 1NFDE 1FVEB 2DN7A 4Y4FA 5JHLL 1PLGL 4FFZL 1J12A 1NJ9B 5I1KL 4EN3B 2J4WL 1VFOA 1LO3L 3B5GA 2Z93A 3ARFB 3VJ6A 2C4FU 2BP3A 3QULA 1N8ZA 2E7BA 3ILPA 1VGKA 3T8XA 2CRMA 3T4AB 2VLRB 4I0KA 4ODSL 3SBWA 2VXUL 1D5XB 3QIBC 5C0BA 4PD4K 2Q3AA 4BK5A 5CGYD 4OI8A 3RWJB 5E6IC 3Q1SL 3ZKXB 3DOSA 4FQXC 2UUDK 4X4YB 1HHKA 2IBZY 4XC3H 2FBJH 1AR1C 1NGWA 3NAAH 2DAVA 4PJ9B 3VXRA 1H9VA 2AK4D 2XZQH 4NO0B 2WQRA 4RFNC 4WWKC 2DJUA 2PETA 3LSOA 5T33H 4PJAB 1UM6H 3EFFB 5E8PA 1GGTA 1QLRA 3PWNA 4JZJA 1AXTH 2Z92A 1DVFC 2V17H 4KHXL 1ORSB 2IMNA 5I18H 4PJDB 3K2UL 3EOAB 1UB5B 2X5PA 4GSDL 5ISZE 4W6XB 5EUKB 4QOKE 4BH8A 5HHMB 4RGND 1S7SB 1Q9LA 4QRTB 1KCGC 1UEMA 3ULVH 4FQHA 1EVTC 1LEIA 3LKPB 5IF0A 5ID0A 1A6UL 5L88H 2OTWA 1RVFH 5J7CC 1NDGA 4PRPA 3LKQA 1W8OA 5C0IA 3WFBH 1WEJH 2WP3T 3RL2B 3MRKB 1KUMA 1R3HB 1LP9A 3GKZA 2H3NB 3ARXA 3GSUA 5I8CB 1QSED 2OTUA 3GNML 4NQSB 3KPRB 2CPCA 4EN3C 2NY1D 4JKPH 4NJ9L 5GGTH 4H26A 4Y19A 4JRWA 1HNFA 3AY4A 4UDUA 4WHYG 3BYTA 5DLMH 5E5UB 1RZKL 3ARBD 2DQFA 2OMBA 3WLWD 12E8L 4L1HA 5TQ2L 3O4LA 2VYRE 4R3SA 5D7JA 1XH3B 3C6SA 4U31A 1KYOK 1BPVA 5EG6C 4PLJD 3HE6B 4L4VA 4F37F 3QG7H 5KS9A 3H3BC 4MSWB 5F7MC 1HHGA 3FO2A 5TDNA 1MQKL 2A9NL 4LSUH 5FUCE 1KB5B 2VL5A 1G7IA 3DMMC 4HXBL 4HV8B 1OY3B 2H41A 1Z9SA 4AQ1B 4S0UC 1J7VR 3M07A 4LPYA 1H15A 5FXCH 5FKPA 3MBXH 1CXFA 1LD9B 2JCCA 4XRCA 3WJJA 1QBML 4BH7B 4ELMA 1D5BB 5FUOH 5C71A 1KJ2B 3DUSB 4Q2ZB 2A0LD 4G5ZH 3MA9H 3IU4L 2VO5A 3DURA 3ZE1E 4YHOL 4TUKL 1DLFL 3O6FA 3MR9B 1U2HA 3D6GA 2F8XC 4FQQA 4JFDB 4PY7A 1IGTA 1OW0C 4ONGH 3T0ED 1WAAA 4JRYB 4MJ2A 5FA4A 2FEDD 3VGAB 3MV8A 1UCTA 4CDGC 1NAMB 2CRYA 5BMFH 2EDWA 5GSVA 5FGBC 1UT9A 3INUL 3P77A 4WUUE 4NZTH 2PXYA 1WV7T 3HRZB 3QUMA 2VMFA 1BEYL 4M6NL 1S7TB 1P4LB 3MJ9H 2D03H 4I4WA 1YZZA 5DUPH 2GJ6B 1SJHA 4W4OC 2P8LB 3PDGA 1EA9C 2WW8A 3K80A 3VW3H 4QHMB 2EEAA 4NT6A 3V7AG 4LNRA 5BW7A 1XF3A 4PJIB 3VFRB 1CR9L 1BFOA 3K8LA 3L3JB 4KFZC 1DUZA 3GI8H 1INQB 2E5EA 5FIEA 5TDPB 3U7WL 3SKUD 2CIKB 4HIEB 1A6WL 3DXAB 4JO3H 1KC5H 2IAMD 4GRMA 5F9WB 3IFNH 2DQTL 4UTBH 3VFNA 4YIQB 1CFSB 4JDZA 4JB9H 4M1CD 1IGML 5IKCB 4PJ5E 1JZ3A 4MJIE 2W9LA 4XX1E 3TP4A 1RUQH 4DZ8A 1YJDH 3PHOA 1S7WA 3KXFE 2IPTL 4U6VL 3F7RA 1J5OH 2NY6B 4Q6IA 2A1WL 1EV2E 3L3IB 3H3PH 4PP1C 5E94B 3A6CL 1M7XA 4XCCH 5D7LB 4GAFB 5DC4B 2X4TA 4NZDA 2FX9H 4FFWC 4NGHH 4U7KA 1EAPB 2UZXB 4PJAF 4PUBH 3TBSB 3V5HA 1NSNL 4ACPA 5EPMB 5MI0B 3D87B 5BXFB 2HT3C 5B39B 4OLUL 2FLRT 2ZOKB 2JJTC 4LP5A 5IIEA 2VSCA 3P4NB 5DEGA 1XGUB 4M7LT 1IGCH 3TNNB 3CXHJ 4KMQA 5LBSH 3SDDB 4JY5H 1Q0YL 1YA5A 4C56A 3MRMB 5ISZD 3NZ8B 3MRHB 1ZS8A 2HKHL 4QOKD 4HPYL 2IALB 4FXLA 3VMPA 5E00A 3RY4A 4N68A 5DJ6B 4AL8L 1CQKA 2I25N 5TE4H 2BOCA 3V2AR 4YXHL 1AI1L 3S8WA 2YK1H 3C5ZD 1KNOB 1I9JH 1S7RA 1I9IL 4J7RA 3RA7H 3P9MB 1FN4A 1TCRB 4QCIB 1FLRH 4Y1AA 4AENA 1CGXA 4ZS7H 3D0LB 3D85D 5EU5B 5LCVL 5BV7B 5JOPE 2R0WL 1R6VA 3UAJD 3K81A 4JQIL 2YHGA 2VKWA 1U3HB 2F53B 3BMVA 1HQRB 3V7AE 1YDPB 5CJOH 3MV9E 5DK0A 1LO4L 2NY6C 1NGXA 4DZBB 1BQLL 1C5DB 3QHZL 2G5BA 3QNXA 3RWIB 2ADIB 3Q48A 2FD6L 4BKLA 1KG0B 4P5KB 4XT1C 3SPVB 2HTLC 2YN5A 1AIFA 2CLZB 1S78D 3OKLA 1RQ5A 4OZIE 1CZ8L 4K8RL 3W0WB 3HLAA 4IM8A 2HMIC 1JGVL 1T1ZB 1ZA6B 3GSRA 5F1NB 2LAAA 1BQSA 1KFAH 2WZPD 1RFDH 2XN9E 1R5IA 1PKQE 3ZHDA 3SDDC 3BGMA 1S7VB 2YMXH 4XNUL 3P4LA 3N06B 2F5BL 2H2PC 3VXTB 1IL1B 4UDTA 5ESVA 3LQAC 1KTKE 2AJZB 1DBKL 5HJ3A 5CZVH 3ZDZF 5E0QA 3ZT6A 4JM2B 3GMLB 3FQUA 4JRXB 1J87A 1T7XA 5HYJB 1EEQA 1B4JH 1GOGA 5E6ZA 1UCBH 4KMTH 3RWEA 5C6TH 2X4SB 3WLBA 2EDHA 3G5VB 1JK8A 1IAOB 2HJKB 3OJDA 4HUVA 4LHUD 2R56L 4JR9H 1VA9A 4WV1B 5J11B 1JUFB 1JGDA 3GIVB 4RNRA 4PJEA 4BQ8A 1PGRB 4WUUD 5BV7C 3E8UH 1Z9LA 3UYOD 2EO1A 2XY2A 4PJXB 5KW9H 4RDQG 2XQYK 4RIRB 1KTLB 1FO0B 4PJIF 1Y18A 5I9QB 3X14A 3IDJA 4WI6A 2CUHA 4H5SB 3K46A 1A1NB 1M7DB 4U1JB 5L6YH 1O7SA 4CBPA 3G5YB 4U0RB 1KPRA 1DQLL 3FQXB 4AEFA 3QHFL 2C3GA 3NABL 4ENEC 3BD5A 3WFHB 3S4SA 1HXYA 4PRBB 4NP4L 3Q6FA 3IDUA 5ICZA 1ZT1A 1CDYA 1PSKH 3NIGF 3FMGL 3VA2C 1ADQL 3L5HA 5GGRY 1WIOA 5IM7A 1P9MC 4DQOL 1MFBL 1NCWH 3LV3B 3OKEA 4BZYA 4PJ5D 5KG9A 2BHUA 3MYJB 1INEL 4MJID 4Y5VA 3MLYL 4GXUM 5DJZA 2C3HA 1JYWA 3JTCA 1AXSB 3HNSL 2CLVB 3BE1H 1BWWA 3MACH 1ED3A 3OR7B 3KXFD 4J4PD 3AU1B 1R3KA 3SKNB 4JM2C 1NCCL 1UKQA 4MVBA 1B90A 4NRXB 1MH5B 4UILL 4MJ4A 3HPJA 4LCWB 4MNQE 1Y6KR 3RVVD 3TH3T 1TZIB 1YYML 4O2FB 4Y4KA 4RA0C 2R2BA 5F8QC 4F33B 1Q38A 1XEDA 4M7JL 1DBBH 1R3JA 4MYWB 1SVCP 4U6XA 3HMWH 4PGDA 1K2DB 2ZSWB 3DVGB 3I50L 4NHUB 4UBDC 4BK4A 3QEHB 3WKNA 4CGTA 4J3XA 2DQJL 1N6VA 4WFEE 5GIRB 3UPAA 2GW5A 4M7LL 5IHUL 3U30C 1A9BB 2YA0A 5DJ0A 3U48A 1BBJB 1BFVH 1M6OA 3Q6GL 4Y2OA 3GMPA 5FA3B 4HEME 3GIZL 3DHMA 4MXWL 4TOYL 1U8PB 2NXZB 4XVUC 5JHDB 3BW9B 2RGSA 4U0RC 4M3JA 2P7TB 1WCBB 3V95A 2VH5H 3JV6B 1X5AA 3EO0B 4U1KA 3MJGX 3HFMH 2AV7A 35C8H 1B0WA 1T0NA 4P3DB 4PREB 1G9MH 5EU3A 1NFIB 5KVDL 2VN7A 1CFNB 1PAMA 5ICYB 5DGQA 1Q8MA 5JOPD 1ROWA 4RMRA 4GXVH 4BFIA 1AHWA 1X4ZA 1IGIL 1AGCB 3EOBA 3PL6A 4RMWA 4XWOD 4LIQH 5FHAL 3WV0A 4ERSL 5CEXA 1WUNT 3MV9D 3EOTL 2WNGA 5IFJA 1S8DB 5ESAB 5D2NC 3T0XA 4NNXA 1XCQA 3CVIH 4I1NB 4EUPG 5DMKB 3ORJA 1BP3B 4Y4HD 3RTQA 5F9JA 3C8KB 4YWGH 1GH7A 5DJ8A 5C9KA 1DQMH 1GAFL 5DT1H 5J9PB 5F1SA 4LVHC 2XN9D 4GW5B 2ADFH 4Z95L 4F7EA 1QNZH 4U1LB 1YN7A 4A6YH 4AEEA 4E41A 4NC2B 5C07A 3SO3B 4OTXH 4OZFA 4RRPG 5I1IH 2VLRE 5C09E 4IMLB 2VDLL 1U8HA 1EO8L 3FFDB 1Q0XH 3CJJA 3CMOH 2E6QA 1MWAA 5T1KD 3MRFB 1CE6B 5I71B 1U3JA 5J6GB 2ZUXA 1IVLA 5JUEH 5CIPB 4AM0B 4UOW1 2M8XA 4C58B 4JKKA 1MHCA 2WIIB 2D0HA 2ZG1A 2OQJB 5KTEH 2EXWC 1ZV5A 2ATPB 5TE6L 3P40A 1G1CA 4YHZL 1CYGA 4PJAE 4YBHA 3SDCA 1MIMH 3DX7A 4I18B 4OGAC 3D39A 5HPMA 5JOFA 3G9VA 1UM5L 4WCYH 1MCLA 1U92A 2GAZB 2ADGA 2IQAB 4JFHE 4JFXB 3TPUA 3MV7B 4HJ0C 5C0DB 2MWCA 3F7YA 4UT9L 5GS2D 2I9LB 5GGRB 4NWTH 5HHME 1RJLB 4YFEA 1ZHKA 5HYQB 1UXSB 1JHKL 1I1FB 1JZ2A 1A8JH 1AGDA 4FHBD 3WL9A 2KBGA 2FSEB 2RIKA 1IKNC 2R4SH 1VKXA 4LLMB 4U1GC 4LOUD 2ESVA 2DRUA 4ZODA 4FS0A 3VG0L 5GHWL 2GITA 4QF1A 6FABL 3BRFA 4OBSA 1FNGA 5KOMC 3NZHH 1P4IH 3O4OC 2OXGA 4FQ1H 1H8OA 3U9PH 1WF5A 4YZFF 5LWYL 4GFTB 4ZXBB 3KPRE 4OZFH 2VXTL 5I74B 3VXOA 5I8OH 3RJDA 4KHTL 3C60A 4QRPA 1S5HB 2DQUL 1VEPA 3SO3C 4R90H 2WUCH 3P0YH 4ELKA 3NFNA 3KWWB 4I13B 3HI5L 4NBXB 4F2MA 3RJQB 2IQ9L 4PJ8A 1H3VA 4KJYA 1MWAH 2DBLH 2AJ3B 2VZUA 4HS6A 2NXYC 4U1HA 1CGYA 4I5BB 3WIIL 3FTGA 3OR6B 3BH8A 2WSKA 3VMOA 5I71C 4X98A 4X4XB 4QY8B 1C5BH 4MNQD 3F12B 4XP9L 1RZ8B 3NH7L 1Y6NR 3LS4L 4JO4L 2I9TB 3SE8L 1RK1B 3RIFK 4HX1A 2JTDA 3TJEL 4LPTA 5B39G 2LAGB 1FL5A 1JF1A 1OWRM 5E8OB 4WFED 2KQMA 4OM1H 5IEHA 5JW4R 4LVNB 2QJDA 3IJSB 3OF6D 3LHPH 2LU7A 4GAJL 1C08B 1MJJB 1EHLH 2Y36H 3EFDH 1EEYA 2FX8L 2ID5A 3KPSA 4FQXD 4CN6A 2JB6A 3CCHB 3C2AL 3CMGA 1QUNA 4JLRB 3GBNH 1AR1D 1MY7A 4JFDE 5T1LA 1WC7B 2CDFB 4OD1L 4A2MA 3ZDZE 5CMAA 5KSBA 1HXMB 3C6LC 3O6KL 4JRYE 1ZT7A 3JTTA 2WWKT 4DWHA 4PR5A 1KXVC 4X99A 3B9AA 2V9RA 3QH3B 4WWKD 4WFGE 5H2BB 3VWJD 2XZZA 5I76A 1SMAA 4RGOH 1I3VA 3H8NA 5C2UB 4RMVA 1E4XH 3FT4B 3QNYA 2GJ6E 3RY5A 1D9KA 4MB4A 4P2OD 4MZ2A 1T22B 3MMEB 5J13B 4V1DB 1LEGB 1G6RA 5ESQB 1KCVH 3VH8G 1AQDA 5IEKB 4Q9RL 4PJIE 3GHBL 2NZ9C 5CILL 3D25B 4Q0XH 2UZIH 4KQ4H 3AREA 3MRNB 3QBTB 2QR0B 2NY2D 1MHEA 2VAJA 5DI8B 3DRTA 3GSVB 3DXAE 3SDAA 4R0LC 1LO0L 4QXTB 4DK6A 1J8HE 5BVJB 2CKNA 1MCSA 2NX5E 5ITFB 4YHPB 3S36L 2VUOA 2GCYA 2Y1VA 3F7PC 4EN3D 3QDGB 3MLSH 3IDYC 3BO8A 1JV5A 4OJFH 2HLAB 2YSSB 3ARFD 4LVNC 5A2LH 3O2WH 3NIGE 4ETQB 1RJCA 2VLRD 2XICA 1ZLVH 5C09D 5DMJB 2X40A 4DOHB 3VRIB 5J06A 3DV4B 3HRPA 4G9FA 3EDKA 3SKOB 3GSOA 2Q87A 4HUUB 4KRPD 2O5XL 4CMMA 3OXRA 4PJ9D 3CVHH 1KYOJ 3R1GH 4NO0D 1JN6B 1F42A 1OTSC 1UENA 4N8CH 1J1OH 3TO4B 3D18B 1TTGA 4H8WH 1MCQA 3QIUA 2AXJA 4PB0L 3QDJA 2DL9A 3HR5A 4JDTH 3IJHA 2E8ZA 2YPLB 4JFHD 5I15H 2P5EE 2AJVL 3GJFB 4WTXA 4DUXA 4Z7VB 3NTCL 5HHMD 4NYLB 4YDVB 3TFKD 3VA6A 4X4ME 3ARTA 4ODHH 4HQQL 4GT7A 1C16B 5HPOA 3EDJA 3WBDA 5L88L 3DVNA 4KK5C 3MLXH 2B7DT 1T0MB 3I3EA 4JDVB 1XZ0A 3OKOA 1CLOL 3QXTA 4X8XA 1JWUB 1YEIH 1G84A 1WEJL 3S5LG 3B3IA 4CU8A 5FCSH 3V7MA 1M05A 4U1NB 2ZNXA 1SEBA 2C7UB 3KPRD 4FZEL 5I1LA 3MNZA 4CNIA 1L0XA 5EO9A 4OIIH 4PPTA 5FK9B 3GZKA 2F53E 3MRCA 3GBML 4WHYH 3ARZA 4V3DB 4XBPA 3SKMB 1MFDH 2X09A 2XKNA 3OJVC 3U2SB 2VN4A 1TQCB 3WMSA 4LVEA 4G43A 1Q9WB 1AGEA 1U8NA 4NQVA 5EUOA 4CN1A 4XCFL 3IDXH 4LMQI 2E7LA 3ROOA 1GHFL 5DRWB 4LQFH 4OZGA 4N0YH 3TWCH 3HE6D 1G1YA 4NZUH 2PO6A 3W0WE 1Q9KA 4I3GA 4L8SA 2VDPH 3FQWA 2B4CH 1K4DB 2G9HA 3TO4C 3T2OA 3QXUA 1FG2B 5I1DB 2VDOH 2XKUA 4G80B 4JFFA 4M93B 5FHBH 3E2HC 4X80H 1U6AL 4ZO8A 2NTFB 1I85A 2EDTA 2IANB 3MBED 1HQ4A 4X6BB 2ZJSL 4G9DA 5JQ6H 1FAIL 4WUKL 2EE9A 1F58H 5IUSA 5E1HB 3VCLA 1I8MA 4JRXE 4S1SL 4PIRF 2F19H 2H26A 4BZ1H 7FABL 1U3YA 4DGIH 4JFDD 1IC4H 1VGEH 1RZKC 4R96A 4JRYD 3BWAA 1F8TL 1X9QA 1CD1A 3ZTJG 4JKMA 4GG6B 1CD9B 3N9GH 4WFGD 1UZ8A 2UWEB 5ILTL 1K8DA 2VXQH 2CO7B 3QUKB 2EKSA 1S7QA 3KR3L 4HWEH 1A1MA 1VSCA 3X17A 3LB6C 5FUZH 3CK0L 2L7JA 3GM0A 4OFVA 3BZ4B 4PGEB 1OSPL 5SWZB 5FF6A 2O61B 2GJ6D 2FHBA 3WJLC 1XF1A 5AYQA 2XKSA 4TNVF 2MSPA 2ZUVA 4YK4C 1TQCC 3TIEA 4S2SA 4OM0H 4PTTA 2BSSB 2CIIA 3B8SA 5FO8A 5D70L 3VW3L 2OJZL 5F1IA 2QADB 2YPVH 1I3GL 1A7OL 1WFNA 4QHNA 1QFOA 5KN5B 4HK0A 2YKLL 5EN2A 1E4WL 4DEPB 5L0QB 4FMFA 2XZCL 3DXAD 1CL7H 2VLME 2IGFL 4HGMA 4AIZA 1J8HD 2NX5D 3ALPA 3BZDA 1SM3H 3H0TA 3TJHD 5D71H 4AYFA 4ZDHA 1CGSH 4EIZC 2CKBA 3PP4H 5IB3B 4P46A 2N7AA 2VDML 4PG2A 1F6LL 2DLFH 4YZFE 4JM4H 1EGJA 1KTDA 2NY6D 3FQNB 1SHMA 2Q6WA 4YEFA 4JN1H 2XA3A 1KTRL 3C08L 4F9PC 5INDB 1ZKAA 4JKWA 3QIWA 2DWEA 5I1GH 1ZWIB 1QYGH 3IXAB 4J2XA 2HTLD 3RRQA 4KK6C 4LCWE 3OZ9H 4MJ5B 4OLWH 4PS4H 3ARDD 1E4KC 2R1WB 1KB9K 4HIJA 3F6IA 4M8QA 5I16A 4XVTH 2X1OA 5IB1B 1FFRA 1YQVH 1RV6X 4CW1A 5HYSA 3JBG7 3P0GB 4KTYA 2BVYA 5BS0A 2F58H 1W72A 1RPQA 3QUML 2F5AH 3FFCE 4Z7VF 1F2QA 1NKOA 4M61B 5IB4B 1INDH 4NHUE 1GPOL 5IB5A 3SDDD 3VGGA 2ICCA 4GRLA 2J5LB 1QFUH 4LLDB 3EDFA 3IXTA 5DRZB 3PQYA 5CGTA 2P5ED 3D2UD 2J7LA 1RZJH 3M8OL 3DBXA 3VXUA 1PFCA 3LN5A 1T1XB 3IDIB 2VKXA 4UQ2B 1JHLL 3TN0B 1GYAA 4FABH 2A6DB 3ILQD 2ZKHL 1II4E 2C4XA 3LQZB 1I8LC 5JHDE 2W9EH 3NCYS 3UXFA 4XAWL 4RFOH 5KBNC 2R4RH 1QRNB 3QJFB 4WU7B 3WSQL 1BX2A 1LO5A 1TJHL 4K7PX 4QHUB 3OAUL 2J88H 3A6OA 4P57B 3FCTB 5L0QC 1ZSDB 2ZCLH 5GZOC 2AXFA 2CKBH 3D5OF 4ZUVA 1TXKA 4U4BA 3V9FA 2Q8AH 5D96B 1FDLL 4IDLA 5IT2H 4FQCH 3PHSA 5ECJE 2Q76B 1B0RB 5EBWA 1EGJH 1AH1A 1U3HD 2F53D 2V7HB 1ZHBB 1FQ9C 3IFPB 4RAVB 1BFSA 4Y89A 3O41A 3OKKB 5TF0A 4HH8A 4IS6B 1N5YH 1HSBB 1U8JA 2UVEA 4BSWA 1T1WB 5DHYB 1DQQB 2NLJB 3HUJB 1YEHL 4H20H 1FZKB 3JWDH 3GRWA 3DGGB 1A7QH 4ODUB 1AC6A 4AEIH 4M7ZC 4ZSOA 1N4XH 3MFFB 4K3JH 1WZMA 3I75B 3W0WD 3UX9B 3QUYB 3T3PF 1FAKT 1CLYL 1AKJA 2ENYA 1NMAL 4GW1B 5CHNA 2MPAH 5HHXL 1X5GA 5IHZB 4ORGB 3NCJL 4M6AA 1A0QH 1Q94B 2HVJA 3B9KD 4N0CA 5C0EB 5DQ9B 1CI5A 3KYOB 4XPFL 2J5LC 3AM8C 1H3GA 1U91A 3PIQB 4UIKL 3QCUH 5DJ2B 4ZPTB 1G7QB 1MRDL 2VWEE 2OSLB 3AS2A 1AD0A 1MLCA 1K4CA 5HHOA 5CZVL 4JRXD 5T3XL 2VL4A 4L4TE 2VZSA 4WNQB 4GG6F 2NYYC 4P2RB 2ZZUT 2G75B 2UWEF 1D3CA 1BGXL 3WNMA 1N5AA 3B2UC 2NY3B 2FX7H 1Q1JH 1W0VB 5AD0B 5AZ2L 5D8JL 1CLZL 4WTWA 3U0TA 4P5MA 3BPNB 1IGYB 3O9WC 4JR9L 4K8RC 2GKIA 5LJYH 2MHAA 2BERA 1U95A 5JA8B 3RX7A 2R0KH 4FG6D 1B0GA 1VERA 4XTRD 4TTDD 3TBWB 2W9DH 4Z7UB 1TNMA 2N7BA 1S9XB 3WHXB 1NC2A 2FJFA 1FPTH 3PV6B 3LRHA 2D7PA 1XIWA 3DMMA 3SOBH 1PG7W 2E9IA 2BVEA 2RR3A 2BVTA 3GHEH 3L3HB 4ZTPH 4S1RL 3HC3H 2JE8A 2DD8L 2AKRB 4JANA 3REWB 3KJ4B 1VFBB 4ZUWA 4N8PA 4J23A 3W2DH 3RWHA 1N3NB 2VLMD 4FFVC 1XGQB 4DVRL 4JFYA 1T5XB 1OW0A 3DPBA 2R69H 4MJ6B 3T4YA 4CU6A 3TBYB 1QLEH 4D3CH 5IR1A 5HY9B 1F11B 3BDYL 3EHBD 4KUZH 5FGBA 1T2XA 5C0CA 5HHQB 2IFFH 1H3PH 4LSTL 4HIHA 3BE1L 2YWYA 3ZYZA 4HXAL 3QDMB 1RZGB 3PWUB 2D2OA 2AEWA 3CC5A 3O3DA 4RISH 1LE9B 3BOVA 3QEQB 4U05A 1UC6A 1H3XA 3EZJB 5EA0H 3QR2A 4XZUA 3DUUB 1JL8A 1QSZA 2VR5A 1J8KA 4LCWD 5J1SC 2GHWB 3IFLH 5E9DB 3DWTA 3L3GA 1U8QA 3EYVB 4X5WB 5T5FH 3WIFB 1QR1B 3C5SB 5ALCL 3KPOA 5C3TA 5JW4Q 2KL6A 2ZG2A 3EYQC 4Z7WB 3FFCD 4P5TB 5HHNB 4AK1A 1MFAH 4M5YH 4UIMA 4YDKH 2W0LA 3KVQA 4ZUSA 1WFOA 5FOBB 3VXPA 4QNPF 3VGBA 4TSBL 3D3VB 4YGVA 4KRMB 2OM5A 3SDXA 3B9EA 4KKAD 1CGUA 2NY7H 1URLA 2DL2A 3FO1B 4Q74A 4XMPH 2D7TL 4LSVH 4R2GC 2NXZD 1UWGH 5JHDD 2X89D 4X7TB 2ICEA 4GKNA 5D6DA 3MRPA 4NDMA 2OCFD 5LGJB 2VH5L 3ZT7A 3CD4A 2VDNH 1YECL 1AD9B 4QHLA 2CUMA 4ZUTB 3MLRL 1J86A 3KLSA 3ARSA 5T1DL 5JORB 3V0WH 4IRSB 4OGAD 4KMLB 1G9ML 2XA8H 1WITA 4ONFH 4ZPVB 2QLVB 4TUJA 4G8EA 5GGSA 4YPJA 2FZ3B 5B4MC 1U8LA 3TZVB 2IPKB 1JNHA 2JJTA 3I9GH 4HJ0D 5MP6H 4U33A 5EU6B 5E8NA 2VE6A 5B8CA 3HE7B 1C7SA 4XNZB 4OI7A 1BOGA 5CLWA 1FVCB 4V1DE 1KELH 4YDLC 2Y4SA 4EUPH 1H0DA 3QQ3A 3IJYA 5DYOA 2FWOA 2BC4A 5AYUL 3UJIL 1CN4A 4LQ1A 1CICA 1HEZB 1SJEB 5TPWL 2JJVA 3OQ3B 3V6OC 1Z0MA 1MHHA 2DQGH 2X4RA 3IFOB 1MCBA 2FR4A 4I3RL 4JHWL 3ZT5A 4TPRL 3MNWA 2OXHA 3NIFF 1A64A 3BZFB 4OF3A 4H0GA 4CVXB 2OR7A 1JVKA 4MQXC 1SMOA 4MAYB 3I6KB 3KPLA 2AV1B 3UCRA 4P3WA 1KB5H 5ANME 1QEWB 1F3RB 2YEZB 4L29B 1QHPA 3RPIB 1FNSL 4DOHE 2HH0H 1CVSC 1JP5A 4JFEB 1TJGH 4L8DA 3BPOB 1Q0XL 4L4TD 4DGVL 4XH2A 3NCEB 1KCLA 4UV4L 1G7LA 1LVEA 1U8MB 3JV4A 4X6EA 3L95A 4FQIL 2BZDA 4J3VA 1A14H 3U46B 3BYYA 2XXCB 3O3EA 4PJGB 1MHPL 4K23H 1OAXL 3L3DB 1OGAB 1YEEL 4Z7UF 3RAJL 1FVDA 2Q3ZA 1PZ5B 3HHRB 4NWUL 4ALAH 1Q72H 4DJMA 3BRDA 1QBLL 2EDRA 5FO7A 3QEUB 4G8FB 1XFPA 2C9AA 3ETBF 3VD5A 1AGFA 5KSUA 3RNQA 5EORH 2YPLE 3KPPB 4IRZH 3MRJB 4WCYL 4YH6A 3SJVB 3RIAK 1DDHA 4Z7VE 4XNZC 4XPHH 5GRUH 4L1DA 4NNPH 2H6PB 5DWUL 1AY1H 1MUJB 3X12A 5DQJA 5K9JL 2DDQL 5CKAA 3LH2H 5EC2B 4PJCA 2K7PA 4LP4A 1NGQH 4LRIC 1BVZA 5HGGS 1A6VL 4QRUB 1V7NH 3E3QC 3BZEA 3TYGL 5JZ7C 2W60B 1M71B 2VTFA 3DSNA 4OCRH 3STLA 5FB8B 3VXMA 4XGZA 3VI4F 4ZXBD 3ZKSD 1B9ZA 2X4OA 1ZK9A 2D9CA 2PW2A 3U9PL 5L9DL 3UTTB 3UTSE 3S6CA 5AUMA 4MAYC 3V52H 2GT9A 2FJHB 5F9OH 2GFBA 4J3UA 1SJVA 3C5JB 3CX2A 2GJZB 3UJTH 1E6OL 2Z8WC 5FOJA 1NL0H 4NSKB 4P99A 4DTGH 1WISA 4QRRB 2EE2A 2Z31B 2VDKH 1MWAL 2DBLL 2NZIA 5T1MB 4JPKL 1TETL 3VH8A 4ZFOA 3R0MA 2B0SH 4K3DH 2OL3A 4R4BB 4Z7WF 1J05B 3OKYA 4GUPA 1E4XI 3P4MB 2XYCA 1EEZB 4MD4A 2D4DA 3BQUA 3GK8L 3UC0L 4FXGB 1U8KB 2VSDA 4LKXA 4QWWC 4XNYL 3K0WA 1DFBH 3CSPA 3DRQB 4WW2B 5JMOC 1YEFH 1L6ZA 2AK4A 3GMOA 4J1UA 3T3PE 2QV2A 3EO9H 1OF2A 2C1PA 2IANE 4JHAH 3BP6B 4JJ5B 4EQ3A 1WTLA 4GBXA 1T04B 3MLVH 3LQAH 2BVQB 2V2XA 3L6FA 3EFDL 1EMTL 4LKCB 3RWGB 3KYKH 4NO5B 3WYRA 1MVUA 1A7RL 5GJTH 9CGTA 1P1ZA 1R5WA 4LF3B 1FIEA 3HNTH 4EIGB 3OKMB 3GSWB 3DYOA 4GG6E 1FSKC 3UPCA 4PJBB 2UWEE 4DFIA 1BVKB 2HRPH 4FFYH 1YEGL 2LU4A 4EVNA 1XF4B 1IQWL 1OWWA 4M03A 2XWTB 3RNKA 4XWGL 1A6TB 1DTUA 5BV7H 4D0BB 4Y5YB 5I1HL 2EDOA 4HKJA 3S37H 4FQ2L 5FO9A 5SWZE 1DP0A 3U0PB 1E4XL 3MJ7A 5IBLC 2VIRA 5D7IA 4JPVH 2NW3A 3C8DA 1VESA 4OD3L 4V1DD 2AJUH 4HBCH 5ITBL 2OL3H 3FQTA 1KLGB 2KKQA 5L7XH 2OX5A 5C86A 4RAUB 2Y23A 3PDOB 5DMGD 4LU5H 3L3OB 4UB0L 2XTJB 5D7SH 2VISB 5CJQH 3FB8A 3KDMB 2VOTA 4YPGB 4IRJC 1A5FL 4FTVA 4XBEL 1BD2B 5EULV 4MNGB 4BJLA 5ERWB 5C0FA 3S5LA 4Y8AA 1CDJA 4WW2C 2D31A 5E95B 1QO3A 5IJVB 3V6ZB 3MXWH 5CCKH 2AJXH 1UB6A 5LKNA 3VXNA 2FJGB 4YE4L 3IAGC 4KKLD 1FCCA 5EZLA 2ICWA 4PJGF 4GQ9L 3CX5J 3JTSA 1UWEH 3LIZL 3E6FB 3MTRA 2HFFA 3L7EA 3BN9D 4JFZH 2A77H 3VG9B 5E7BA 5CJXC 2V7NB 3LD8C 5AAWA 3CFCH 3HI1A 5D2NA 2DIBA 3TT1L 5GGVH 2A6JA 2CK0L 2YPKB 3BHBB 3NA9H 4XCYB 5IBTH 1IQDA 2BOBA 4TTGA 2EC8A 5ACLA 4Y4FB 4XP6L 1JNLL 5IG7B 4PJ7A 2AS5M 2YPLD 2Z93B 4Y5YC 5DVLA 3VJ6B 3LN4A 2BX5A 5I8KH 3QULB 3BIBX 1N8ZB 4FFEX 2QSVA 2DQIH 3ILPB 3QO1A 1VGKB 1G6RL 1FO0H 3T8XB 3HAEA 5ADPL 3TLRA 1ZGLM 1A3RH 3HC4H 4PV9A 5C0BB 4QNPE 1HI6A 1JPFA 2PCPA 3BFOA 4OQTA 1GC1L 1HHKB 3B9DA 5D9SA 2W65A 1QRNE 1JTTA 3LKNA 3W11D 1RZFH 2XTJC 5HBBA 3R4DA 2V2WA 3JZ7A 2NY5L 3MRGA 1NGWB 3VXRB 3DVFA 3ZTNL 2IG2H 3BGFB 3CDFA 3AS1A 1JGLL 4XC1H 1YEDA 3PJSA 3LSOB 3CU7A 4YDJA 5C08B 5E8PB 1QLRB 3PWNB 3UTSD 1WIUA 2XY1A 2I24N 4CJ1A 3WDJA 3RDTD 2IAMA 1UM4H 1JPGB 1Z0NA 5E4EB 4BH8B 2B1HL 1TDQA 2VC2H 1MFDL 4L3EE 1Q9LB 2OI9C 1RZ7L 4FQHB 1LEIB 5DVMA 1MCHA 3VG9C 5ID0B 4CADA 2OTWB 1YMMA 1RUAL 2APFA 3U7YH 4PYGA 4DN4L 4WW2F 3IDXL 1NDGB 4PRPB 4QXUL 4XCEA 3LKQB 3BKMH 5C0IB 4IBLT 5H94B 4KUCF 1LP9B 2VDPL 3GSUB 2MCPL 2OTUB 4Y4FC 4BYHA 2IPUK 4QKXB 3QZWG 3F65A 5F70A 4IMKA 2IAND 1JZ5A 1BFTA 3V6FA 3WFCL 5E08L 3NIFE 4OCXH 3MRRA 4H26B 4Y19B 3FAWA 4MA7H 4OQTH 1BBDH 1GOFA 3SBWC 4S1DC 5L2KE 4K3GA 1DE4A 1XGYH 4HWBL 2APVA 4P2RE 4Y8DC 4QOKA 4PJBF 1IC5H 4KK6D 2DQFB 2EZ0D 1RURL 1VADA 3O4LB 3ZTJH 1DL7L 1ZVSA 4R3SB 3C6SB 4RQQA 4XXCC 1XF2A 1MCCA 2QBWA 3BGFC 4L4VB 5KS9B 4AQOA 2P24A 1KB9J 1X3DA 1HHGB 3C5ZA 3FO2B 4XPGL 4PB9H 5TDNB 5E2TH 4HK3J 5GXBB 4WY7H 1WJ3A 3DNKA 4JZJC 2VL5B 1G7IB 4WI2A 4XMKH 4Z7UE 2QQKL 4MA3A 4OLYL 3O6LL 5FUZL 4KJQC 5SWZD 5AG8A 1WT5A 1Z5LA 1H15B 5FKPB 4ELMB 2JCCB 4XRCB 2HWZH 4C59B 5I0DA 3GDBA 1MFNA 4BFGA 2HVKA 2QADD 4OM0L 3DURB 3F7QA 5DJCA 4U1IA 3O6FB 3FB7A 2AI0H 4LLAA 1J0ZA 1VEOA 4UT7H 2IWGA 1IGTB 5I1JH 2N56A 5FA4B 1JWSA 3MV8B 3RL1A 3MA7A 1ES0A 1K6QH 4M4PA 5GSVB 3WNLA 2F8VA 1AJ7L 3C6LA 3T0VA 1DJSA 3P77B 4PFEA 2PXYB 3QUMB 5E99L 3RU8L 1BZ7A 3H7BA 1YEKH 1L9NA 1F3JB 3BX7C 3PP4L 4NQUA 1YNLL 3VI4E 4DKAA 4RBPK 4YXKL 4OUOA 4Z78A 1RIUL 2PYEA 3BJLA 5M7QA 4I4WB 3ET9F 3QDME 3ULVF 4ZFFA 1SJHB 4WEBH 5CJBA 1FBIL 3QEQE 5IGXL 1JHTA 5GS1C 4NT6B 2O5ZH 4LLVA 4DKEL 1WBXA 4LNRB 2JJSC 1XF3B 4X6DA 1FIGH 1QYGL 4X5XA 1BFOB 1B88A 5D6CA 15C8L 4MLSA 4ZUUA 1DUZB 2NY4B 5D7JC 2F9BT 3MCLL 1NCBH 4O2EA 3QUZA 3OAZH 1QFWH 5I1EH 2NR6C 1UWXH 2ZP0T 4Z7WE 4JGJA 4GRMB 1KN2L 4OLEA 3VFNB 5KVEH 4JDZB 2F5AL 4RA3A 4MXVF 1FYTA 4QXGL 4R0LA 5HGBA 2YR3A 4ODXA 4PLOB 5J4MA 5T3ZL 3D3VE 5JXAL 4RAHA 1FGNH 5IVXA 1QFUL 5D72H 4WUUA 4DZ8B 3U82B 3PHOB 25C8L 1S7WB 1T2QH 2E7MA 4JPWH 1NCAL 5IFAH 2JLLA 3TN0D 3BAEH 4Q6IB 3P3YA 3UJJH 4UTAH 4UINH 3CFJA 4GH7B 1S9KC 4AMKH 5IFHH 4RWYH 1OD7A 2CMRH 3MLZL 4NIKB 1KIPA 1QRND 3B2UD 1KENL 4LHJB 3AMLA 1J0JA 2EH8H 4ZS6D 3DROA 5SX4H 5CEZH 3V5HB 1EHXA 1I1AD 1OL0A 5IWLC 1OTTC 4EI6A 4K8RD 1P7QA 5DDHA 3RWDA 5IIEB 5M94B 1KEMH 1SQ2N 3WNPA 1FORH 2PXYC 1T5WA 2QQLH 3B9VA 2R8SL 1M1SA 3N1GC 3ALWA 5EU6E 5DR5H 1EBAA 1EGJL 3NBNA 4NRYA 4YAQA 1ZS8B 2E8YA 2AGJL 1K5NA 1MCOH 4MJIA 3T0AA 4L3ED 3DETD 2LU3A 5E00B 2SEBA 1VENA 4YDIH 1CBVL 3KXFA 5BW7C 1R3IL 2QL1A 1LP9F 3HB3D 2BOCB 4HAGA 2ORBH 4KQ3H 3MJ8A 4X9FA 2NY4C 4JY4A 1S7RB 5AWNL 3QUYD 4FFVD 3VRJA 5GRVK 1W72L 1FN4B 5I19H 4Z7OF 4Y1AB 2P8MA 1FP5A 5GS0L 4AENB 2CQVA 1RMFL 2BSED 43C9A 4GLRH 3QCVH 3OXSA 4OFDA 5CWSA 3GB7B 4NFBA 4G6KH 4H1LG 2XNAA 1SEQH 2YUWA 4PRIA 4NRZA 4PLKC 1ZLVK 4DAGL 4P23D 4FQLH 5DK0B 2RCSL 1WTGT 4JFEE 5L2KD 1NGXB 4M7KH 3TH2T 1MJ8H 2WMPA 2BY2A 5KS9F 4P2RD 2G5BB 3QNXB 2DTMH 4MCYA 1CE1H 4BKLB 2NY3D 4UI2A 4D8PA 4QGYA 5DD6A 3WEXA 2CR3A 4M48L 4PJGE 1OGAE 4QRQB 4AY0A 3HLAB 3VXQA 3NCBB 5HVFB 1CF8H 3EYQD 3BT2L 4U1MA 5JW5A 3GSRB 2JCCF 2HTKD 3T77A 1OM3H 5F7NC 3HCVA 4K3EH 1NGZA 5I1CH 4LGRB 1R5IB 3P11H 3TO2A 5EBMA 3BGMB 4WEUD 1NLBL 3SJVE 2XQBH 1PLGH 4FFZH 5I1KH 4UDTB 5ESVB 3JWNC 3K4AA 3RVUD 5I6XB 1RAMA 1LO3H 1GJIA 3RUGA 5HJ3B 4E9LA 1CD0A 1G7HA 3E2HA 3SOBL 2D0FA 1ZMYA 3FQUB 3GRWL 4KC3B 3JV0A 4ODSH 3MV9A 2VXUH 5FM8A 4PYHA 1RIHL 1N0LA 1IZKA 5DJYA 3RWEB 1FG9C 1JNJA 3WLBB 4HLZG 3ZDYF 5C0NC 1JK8B 3OJDB 4LPCA 4HUVB 3ZKNC 4HUNB 2EDFA 5BQ7A 3VI3F 4OZIA 1JGDB 4RNRB 3UTTE 4PJEB 1NEZG 4P2QA 5I17B 3LDBB 4YFLI 4F58H 5JLZA 2P1YA 1Y18B 4UAOC 1PKQA 1CT8B 4QRRE 3QDMD 3X14B 4KHXH 2GQHA 2IFFL 3IDJB 2EDKA 1DEEB 3K2UH 5J1TC 3QEQD 4GSDH 4RISL 1IGFL 4ISVA 2VZOA 5EZJA 4G42A 3TT3L 2CXKA 1KPRB 1KPUA 1U8IA 5CS7A 5H35A 3IETA 3L5WA 1MCKA 3ZZ1A 3S4SB 1P53A 5F3HA 4UNVA 1A6UH 1HXYB 3MQIA 3Q6FB 5ICZB 1ZT1B 5TFSL 5T5FL 1UG9A 4P5TD 4OLVL 5IM7B 4GKOA 4MQXD 2APBA 3S35X 1IAIM 4M5YL 5HD8C 1OAYL 2MNUA 5HHVL 4EBQL 5KG9B 4M6ML 4ZNEE 3D3VD 4Y5VB 1ZT4A 2H9GA 3AROA 4I3SL 5DJZB 3GNMH 1RHFA 5EU4A 1ED3B 3MFGB 5I6XC 3GJFH 4M6OH 5FV2A 4NJ9H 1V7ML 1R3KB 2I27N 2Q7NA 5CSZA 4XMPL 1FFQA 2EDXA 1G7JA 4F7MA 4IDJL 3GGWA 4F7CA 1ZEAL 2X9WA 3HPJB 3QO0A 5E8DL 3TIDA 3U4BL 2R9HD 4G8GE 4E0RA 4R7DA 2ZUQB 1RZKH 4Y4KB 3BH9A 4KI5F 5DK2A 12E8H 5TQ2H 2R2BB 4PJBE 1T66D 3GKWL 5CBEA 3MRBB 4R6UA 1OB1A 4IRSD 4K71C 3VFSA 1R3JB 3QG6B 4U6XB 4PGDB 2ICES 3BKCH 4YHML 3TZVD 1EX0A 1MQKH 2A9NH 5EU6D 1KT2A 2X1PA 1WICA 3LRSA 3HE7D 1TZGL 4GG8A 4A6YB 1PZUB 4HXBH 5DJ0B 3UBXA 4HUMB 1M6OB 2OK0L 3GMPB 1EIBA 1WWBX 3TH4T 3N1QC 3VDBA 1HHIA 1QBMH 4V2CB 5DF0A 3LZFL 5M95B 2XTJE 3BJ91 4U3CA 3CLFL 4O00A 1XF5A 1I9RL 3IU4H 4D0DA 1CQYA 1N7ML 3HMXA 5A43C 4YHOH 2DQGL 4TUKH 4U1KB 1DLFH 1I8LA 4F7TA 1BD2E 2AV7B 1LE5A 3ULUL 4MNGE 1BVLA 5EU3B 3MUGA 1EJ6A 1CXIA 4MAYD 5EO1A 3QEGL 1G9MC 3GSNA 2MQ3A 4BFIB 4Y5VC 1AHWB 1XGRA 3CZFA 3EOBB 1QLFA 3VFOA 1UKTA 3PL6B 4ZO6A 5DQDL 3P4OA 5CEXB 5L2JA 3JWOL 1BEYH 4JFED 5IFJB 2VABA 3OTTA 1P7KB 1NCTA 1S7UA 4NNXB 3X3GL 1XCQB 3LPGA 4MVBC 4LARL 1JTOA 4EDXA 3ULVE 3BKJH 4CL7A 3RTQB 4J6RL 1OSZA 1A2YA 3NFPA 1HCVA 4Y4KC 5F9JB 1OGAD 1CR9H 1T20A 5FDWB 4J3SA 2P5WE 5DJ8B 5IW3A 4AEHL 2WWKO 2WLYA 1HDMA 3U7WH 3FZUD 3L3KA 3KS0H 4F7EB 1YN7B 3L1OH 4E41B 1AE6L 2ENSA 5C07B 5T5NF 1IAKA 3SJVD 2DQTH 4OZFB 4OZHB 3H42L 4Z8FH 4KZDL 1IGMH 5K33A 1QPXA 4MXVE 1U8HB 1NBVL 4FZ8L 3MGTA 1U93A 4G59A 2BNQA 4U7SA 1MWAB 1NGQL 2EIZA 2IPTH 5CZXC 5D1ZC 5K9OA 2A1WH 3WHE0 2BXZA 4PJEF 3A6CH 1NMBL 3VXRE 1ZE3C 1MHCB 3SE9L 1WCQA 4NKMA 3AMKA 5BOZG 5GSRA 1JYNA 4JAMA 1NSNH 5C08E 4LHQB 3UTTD 5FYKL 3SDCB 3DX7B 3D39B 4U6HA 2AQ3A 5HPMB 5JOFB 4OLUH 1ZOXA 1ACYL 3O9WA 1U92B 2ADGB 3ZHKA 4X7SL 3TPUB 5IBLD 3F7YB 4QRRD