1JHTA

Crystal structure of hla-a2*0201 in complex with a nonameric altered peptide ligand (algigiltv) from the mart-1/melan-a.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
273
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Crystal structures of two closely related but antigenically distinct HLA-A2/melanocyte-melanoma tumor-antigen peptide complexes.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 273
sequence length 275
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jhtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jhtA01
2IFFL 2VITA 4K3GA 3PP3H 5DRWA 5MEQB 1OTSD 1TQBC 4JFOB 3BZDA 5MERA 4KJQC 2R2BA 3MRKA 4E0RA 4OIIL 5F9WC 4NFBA 2HJKB 1U3HB 5IFJA 2YD4A 3OKDA 4OFYD 3FQUA 3SGEI 2A74B 3VG0H 4P5MB 4NKIL 4I77H 1YZZA 2VITB 2NTSP 4B50A 5CUSH 5DRWB 3TJHA 5MERB 2R2BB 1EFQA 3MRKB 3BT2L 4E0RB 2I9TA 3G6JA 2ARJA 2BOBA 1MY7A 1KCRL 2Y36H 1XF2A 4CRPA 3AS1A 5JIHA 4LLVA 5IFJB 3OKDB 2KL6A 3NACL 3FQUB 4XCFH 4YDIL 3QXAA 1HHGA 2EEBA 5CKAA 3O6LH 3V4PH 3WDJA 5IBTH 3ZE0E 2I9TB 5BV7H 3G6JB 2ARJB 2BOBB 3G6AA 2ZNWA 4FQLH 1XF2B 1JRHI 4S1SH 5FUZH 3QCUH 3TBVA 4M6OL 4YWGH 2R9HC 3N06B 1UWGH 5I1JL 3QXAB 2YRZA 4N68A 1HHGB 4MA7H 1KPRA 4HMDA 1JL8A 1CFQA 3WFHA 3BDYL 3G6AB 1NMCB 5IM7A 3KDMA 5T1DL 5GRVL 3TBVB 3AB0C 1JFQH 4LMQE 4NQEA 4ZO7A 4M1DH 1BPVA 2LABA 3ULVH 3HE6C 4YFLI 3FKUS 4KZEL 3RDTC 1MCWW 2ZUUA 4PGEA 3QULA 1KPRB 4LEXH 3ZZ1A 2C7UA 2R56L 4EN3C 1CFQB 3WFHB 3ZYZA 2AK4D 3ZTNL 2BRRL 4X9BA 5CJOH 5IM7B 3EZ8A 3NIFF 4NQEB 4G8EA 4PJFE 3NN8A 5DRZA 4UNVA 3KLDA 4NKMA 4RFOL 1IGML 1GYAA 4PGEB 5AZ2H 5GQBA 2OZ4A 4H8WH 4H25B 2IJ0C 2C7UB 4HBQA 4X80H 4AMKL 3SY0B 2X42A 2FJHA 4O58L 1FQ9C 4OFYA 1MEXL 1P2CA 1LDSA 4G8EB 3NN8B 5DRZB 4NKMB 2LQRA 2YXFA 1QBLH 4AEIH 4DGIH 4KQ4H 4LIQH 4AZ8A 3CXHK 4ERSH 1LO3H 1LNUB 1X3DA 3G6JF 5C0CE 2FBJH 5BV7C 5GJSH 1KBGL 2FJHB 1ZGLA 1P2CB 4DGYH 4IOFC 1GGIL 3NCBB 4UT9H 2YN3A 1F3DH 4HJ0D 5DI8A 4UBDD 2ED7A 4XXCA 1NCWH 3MCKA 5J11C 3ARRA 2Y25A 1K8IA 4LARH 1N7MH 3O0RL 3HZYA 4HSQA 3CVHH 1ZGLB 1M1SA 4MS8D 1FDLH 3S98A 3NH7H 3ULVC 1QR1A 3WFDH 2DQEH 5DI8B 3GNML 3RVWD 4XAKD 3MCKB 4J2XA 1C7SA 1JHKH 5I1EL 4DKEL 3HZYB 4HZLA 1ZLWK 3LPWA 1WBZA 4YH6A 1QR1B 3PL6B 3BYYA 2HKHL 3QDJE 4RMRA 4H8WC 3H7LA 4X7FC 5IB5A 2AK4A 1OCWH 2YUVA 1KOAA 3WFCL 4JVWA 4P46C 1Z0NA 1ZE3C 1KACB 5CGMA 4HZLB 1ZWIA 1WBZB 3Q3GB 1ODAA 4FQ2H 2WUBH 3REWA 2ZCKL 3ZHDA 5F7UA 1AXSA 1MCFA 5C92A 2YKLH 2C26A 1KCUH 5IB5B 2AK4B 2R4RH 1Z9OA 1WTLA 1QNZH 4DAGL 5BQ7B 4PRPD 3ZYJA 1Z9LA 1QFWL 1T4KA 2W60A 3BP4A 4HMEA 3REWB 4N0YL 3U7WH 1AXSB 2N7BA 4QRSA 5EOCH 2CQVA 4JO1H 5JW4Q 2WBJC 5HGHA 1NCBL 3TYFB 4GKZA 3WXVH 2HLFD 2BERA 2F5AL 3SO3B 5I75C 5F7LB 3V5HA 1TIUA 1T4KB 2W60B 4RMTA 1MRDL 2MSPA 3BP4B 3E6FA 4FQXC 5D2LA 4KK5C 2EDHA 2J8OA 4K7PX 3IS0X 1T0NA 3HZKA 1MQKH 1QACA 1CFNA 3EDJA 3PG2A 4QRSB 1JF6A 4XMKL 1NAKH 4K8RD 4F7CA 1MJJA 3OR6A 4Y2DD 1RIHL 5HGHB 3RZCC 4GKZB 4MS8A 5EORL 5CGYC 4HPYH 4M9PA 4JFED 4NM4L 4OLUL 4P23C 5EG6C 3E6FB 4NUGL 4PGCA 4Y5XA 3UYOD 2VH5L 5D2LB 5AG8A 1F6FB 5J8OA 3SJVE 3DO7B 2I07A 1CDYA 4M7LH 1CFNB 5JDJA 1SY6H 4YHMH 4JM2F 2Z8VC 2A6IA 4F7CB 1MJJB 3U9PL 1FPTL 1MFCH 1YEIH 2FHCA 4LSVH 1EVTC 5DQ9A 2BHZA 2Z9TA 2CIKA 1AC0A 4XVUD 3EYFA 4NJ9H 4YBLB 5JIIA 2VABA 4Y5XB 1L7IH 4U1GC 2KUTA 5T3ZL 3MSPA 2BK8A 4X6FA 2I07B 4O02H 4PJ5E 3QWRD 4Y19B 3ZT6A 3B3IA 2WSKA 4PLKC 1X44A 2A6IB 3VFSB 5KAQG 2VR9A 3M1BA 3V52H 3HPLA 3ULUE 5DQ9B 2CIKB 2E7MA 2X1QA 1SBSL 3WS6A 1IBGL 3EYFB 2O26U 2NTFA 2VABB 3GMNA 5GRZA 5I1LA 1HSBA 1WICA 3VRLE 5FYKH 1P4LA 2JJSC 2D2OA 1A02N 4X6FB 3S37L 4I18C 3B3IB 5A3ID 3GEWB 3M1BB 3OBAA 3O2DA 3HPLB 2A9MH 4PRPA 5DEFA 4P2RE 3GMNB 3RI5K 3W9EA 5I1LB 1S7WA 3JTSA 1HSBB 3SDXA 1P4LB 3OB0H 2A83A 2IFFH 3F7YA 5AYUH 1FFNB 3BX7C 3QZWG 3BN3B 1IFHL 4LK4A 1VKXA 1D5XA 3VI4E 1TZGL 3WBDA 4OIIH 5DEFB 1FCCA 4ALAH 3DSFL 3BIKA 4PBXA 5D2LF 3BRFA 2CGRL 3W9EB 5DFVD 1S7WB 3PJSA 4K2UL 2DI9A 3SDXB 4FHBD 5HDLA 2A83B 3BKCL 3F7YB 4G6JL 3CSPA 4J4PD 1VKXB 1D5XB 4Y2DA 1XCQB 2VZTA 5JMRA 3QUMA 4LGPB 3RVUD 5TE6L 5E6YA 5HHXL 4EDWH 4JFEA 2DMBA 4F8QA 5I73C 2EC9T 3GRWH 4ZQKA 1CN4A 4L3AA 4OZGB 2ADIA 4FXGA 3NACH 2X4OB 1B0WA 3D3VE 4MNGE 3PJSB 3FN3A 4B7LA 1MY5A 5HDBF 3D6GA 4Y2DB 5ANME 2H9GA 3ZYIA 1YY9C 3TJEL 3QUMB 3HC3L 3SDCC 4JFEB 3LS5L 3WO3B 2X4TB 2QSVA 5K9QI 2VOTA 2OL3H 4ZTPL 2ADIB 4FXGB 4JVUA 3DMMC 3QWRA 1T83A 5I30H 3SKNA 2DM3A 5TDOB 3ILQD 2H9GB 2W0KA 4PGBA 2I24N 3BGFB 3DXAD 12E8H 4Y5VC 4NOBA 4FFYL 4QXUH 2YA1A 5MHSE 2EDRA 1A0QH 2ERJC 5T1DH 3GKZA 1R3LB 3MRGA 5IFAH 3CMOL 3IXAA 5HI3D 5KANI 3SKNB 3TZVD 5GS0L 5DMIL 1HYSC 1YEEH 3ZSSA 4PGBB 3EDDA 3R06A 3UTQA 5JW4R 4LOUD 1YNTA 4Z9KB 1V3LA 2XKSA 2PW1A 3DTXB 1CK0H 4P48A 3MRGB 1EUTA 2Q6WA 3IXAB 5GRJH 1CT8A 3EO0A 3P4MA 3DRTA 5DZNA 1MCKA 4XPGH 2VDLL 4KRPD 1NCAH 2BVYA 4OZ4A 3R06B 3UTQB 4M4PA 1YNTB 4KI5D 2PW1B 4OZGF 3IJHB 5D7JC 1DEDA 3JTCA 5H35A 5EPMA 4KJWD 3GMPA 2Q6WB 4ZNEA 1BHGA 1AQKH 1CT8B 1TVBA 2BNUB 2W9DH 2XG5A 3EO0B 2FGZA 3OG4B 3P4MB 4J4PA 2LVCA 3LEYH 3VFGH 3DRTB 4LBEA 3GKWH 5IMMB 4OZ4B 2R1XA 1EEUA 4M6MH 5HI4C 5FA4A 2MCPL 1KBGH 3S3SA 1FSKC 1T1ZA 5H35B 3GHEH 5EPMB 4DK3A 1GGIH 5DSCB 1TVBB 3VFOB 3WYRA 2XZQH 5EBMB 4R4FL 2EZ0C 4LBEB 1QRKA 3QO0A 4FFWD 3BDXA 4WHDA 1JIBA 3CLFH 2R1XB 5ETUA 5FA4B 1NDGA 2Z92A 4HIXL 1P4BL 1T3FA 1T1ZB 4BFGA 2VXUH 3D39D 4G7YL 3GK8H 4IEFB 5JO5A 1MELA 3HB3D 2WW8A 3FOLA 5FCUH 3DXAA 4PV8A 3W9DA 3QO0B 2FO1A 5B39G 5I1EH 5ETUB 3VFMB 3PWVB 4D3CH 1NDGB 1P4IL 2Z92B 3MUGA 3B9KD 1T3FB 3ZDZF 4P3DA 4YAQA 3TZVA 5TQ2L 5JO5B 3FOLB 4HBCH 3DXAB 4PV8B 3W9DB 4FQQA 4Q9QL 4PP1D 4Y4HD 2EDNA 5DK2A 4Y4FD 3MUGB 4YR6A 3QIUD 4P3DB 4YAQB 1QFWM 2NY2C 4O2FB 4PRIE 3TZVB 3MA9L 3VD4A 2NY1D 4YK4C 2X05A 1INDH 1F2XK 4WEMB 4FQQB 4NQUA 4H0IA 4OFIA 3HC4L 1DQLL 3W39A 1DZBA 1AR2A 3S5LA 3QHZH 5DK2B 1JZ6A 3HRZB 4YR6B 2D7NA 4FQCL 3K3QA 4MNQE 2YZ8A 3V8OA 4UI2A 3V0WL 4KRPB 3U82B 4ZO8A 2FO4A 1YPZA 2XKNA 1A3LH 4R26H 1BF2A 1FFOA 1N4XL 1JV5A 1NMAH 2VC2L 4WEBL 2F5AH 3TBWA 3TCXA 3W39B 1I1YB 4V1DE 3S5LB 3F5WA 4OLYL 3J7HA 4CMHC 5CD3A 2CRYA 3QRFM 1S9XA 5IB4A 2DB8A 4X7SL 4F57L 3ARFC 1AXIB 3TT1H 3UJTH 2XKNB 5EO1A 1FFOB 2VDKH 1JV5B 4LHUG 3SO5A 3TBWB 5EORH 4YDVA 3FCTA 1V05A 3TPKA 1KN2L 4LVNB 3F5WB 3D39A 3VD9A 5FUCE 4K9EL 5CD3B 5SWSD 1S9XB 3FONA 5F6HJ 5J6HA 4OGYL 5IB4B 1WT5C 1XAUA 3RL2A 2QKIA 1JWSA 2K3TA 5I8EA 1HZHL 1BGXL 5F1OB 3EAKA 3MR9A 5EO1B 4YJZL 5I1GH 2PYED 1PAMA 3KPRD 1LE9A 3B9KA 4YDVB 3FCTB 3NMEA 3D39B 2W0PA 2V9QA 4FG6C 4K3DH 4NRXA 2BVEA 5T3ZH 2PR4H 3FONB 5J6HB 3NTCL 4P4KD 5T3XL 3RL2B 3PIQA 2QKIB 4QRPD 2XN9D 1JWSB 5I8EB 4Y4HA 3MR9B 4J6RH 2CD0A 1A9EA 3S37X 4F37F 5D7LE 3UMTA 1ITCA 1LE9B 1N0LA 4Y4FA 2R1YB 3QIUA 1MNUH 4JG0H 5EWIH 2X9YA 1T20A 4NRXB 3F7PC 1F4XL 4WTWA 5JLZA 1MAJA 1FLRH 4DVRH 4CADA 3PIQB 1A9BA 4KI5F 4OTXL 2BHYA 4Y4HB 3G08A 4DN3H 2FDBP 1A9EB 3L3IA 1NSNH 3Q6GH 5C2UB 5GGQL 1KTDB 4JEGB 4Y4FB 2QSQA 1ZGLP 3QIUB 3VMPA 3BVNA 1T20B 2HT3C 35C8L 3X3FL 2NY1B 5FGCE 2CDGA 2D03H 5JLZB 4CADB 2FECI 1A9BB 1TZGH 1ZEAL 1EAPA 3G08B 1C16A 2YA2A 1KG0A 3L3IB 3SGJA 4JY6A 1JTOA 4N8CL 3RX7A 1UWXK 1UXWA 4WFEE 5D6CB 4WWKB 1AP2B 3S4SG 1IE5A 3DYPA 2CDGB 1RZ7L 4NCDA 2KZ1B 4XPFL 3P4OA 1EAPB 3MV8E 1MCNA 2B1HL 4HUXA 1KG0B 2DLFL 1A6WL 1KTRL 3K8LA 4JFHE 1UXWB 4ZOCA 5SWSA 4JPIB 1A6AA 3GSNA 4PLJC 1WUNT 5E8NA 5A16A 3V5KA 1HH6A 2HN7A 5JPNA 3P4OB 3R0NA 3TJEH 2PYEA 3KPRA 3V4VL 4Y8AA 3BZ4A 3I9GL 4HUXB 4RFEA 3BN9D 2JB6A 4GBXD 5SWSB 1A6AB 4P4KA 3N85H 5E8NB 5A16B 3A6CH 4QRPA 2XN9A 3V5KB 1CGSH 1HH6B 2HN7B 1F45A 2EDTA 1AIFA 5JPNB 1EPFA 2PYEB 1NBQA 3KPRB 3MXVH 3SE3C 3BZ4B 5ILTH 3X3GH 4RFEB 3RY4A 5DVLA 2JB6B 3CU7A 4OLZH 1OTUC 1J1PL 4P4KB 4F9PC 1KT2A 2RB8A 1MREH 4MCYA 1KCSL 3GI8H 4QRPB 2LTQC 2XN9B 3QDHA 4JANA 4MXWL 5GS0H 1BAFL 4ZNCD 1AIFB 3WKMH 1MCHA 5JW4N 4U1HA 3U4BH 1NCTA 2NXZC 1MWAL 1AD9A 2J8UF 4LDEB 4APQC 3NVQA 3L3JA 4OD2A 1UYWL 3EYUL 4UQ3A 2W0LA 1KT2B 4MCYB 2CDEA 2V5SA 1KPUA 4JANB 5CLTA 4KY1L 3OGOE 1ZLSL 4EXPX 4U1HB 3QSKB 4U2ZA 4YHPB 3BKYL 3S88H 3L3JB 3ZL4L 4OD2B 1RJLA 2LE9A 4UQ3B 2DMKA 1BFOA 3BO8A 1FZKA 3OAZK 2CDEB 3SBWA 5IJKA 1KPUB 3CPLA 4FFZH 4BZYA 4O2CA 2MCPH 1DANT 1KFAL 2OP4H 3TV3H 1B88A 3S34L 2VXQH 4LFHG 4MJ4A 4YIQA 5ALCL 4R7NA 1FZJA 5F72S 3TH4T 4S11A 1N26A 5B8CC 4OF6A 1RJLB 4WENB 3E1F1 2I9LA 2N56A 1BFOB 3BO8B 1FZKB 4LLMB 3FHAA 4HFWA 1CFTA 3CPLB 4XWGH 2H8PA 2HFGL 4O2CB 3TYGL 4NP4L 5DHXB 4GBXA 4X99B 4XPAH 4GS7C 5HHVL 3UEZA 4YIQB 4R7NB 1FZJB 2KPNA 3NFSH 1SVZA 4LPUA 5JQHC 2I9LB 1LILA 2ZCLH 1GZPA 4U1NA 3LKQA 4NT6A 1VSCA 4HFWB 4J3VA 1CFTB 1S7VA 1CLYH 2H8PB 5IHBA 4UT6H 4G80B 1A7QL 4U3XA 1JI1A 2MPAL 2EIZB 1BM3L 2O5ZL 3KG5A 5I15H 2ZUXA 4U1NB 3LKQB 4NT6B 4XI5C 2WQ8A 3LQAL 5EFIA 4YDKL 2E7CA 4EI6A 4JG1H 3RIAF 1NAMH 2YA0A 5EO9A 4UB0L 4ZYKA 1I3UA 1HDMA 3ES6A 3O8XC 5I17A 2LU3A 2ED9A 4DW2L 1FAIL 4OT1H 5C6TL 2XZZA 5EFIB 2H6PA 5LWYL 5BRZD 4LHQB 3IDMA 4YGVA 3HC4H 4UAOB 4EI6B 4QXTA 5EO9B 4PJEA 3VXRE 3EOTL 2QQKL 1FIGH 4ZYKB 4U6XB 1PKQE 4P99A 3ES6B 3EDFA 4NN5C 4UT7L 5I17B 1S5HA 4UTAL 2NW3A 3V0WH 3U7YH 1DBBH 1DLFH 4WW2A 3AM8A 1G84A 2H6PB 1RK0A 2P48B 3IDMB 1VA9A 4YGVB 3GB7A 1HE7A 3V6OC 2Q1EA 1MJ8L 4L29A 3U2SA 4Q74A 1J11A 4QXTB 2JB5H 4PJEB 2AXFA 2PXYC 4UV7L 4BUHA 5HHQA 5L88H 2VDRH 5KVGH 3HS0A 2NW3B 7FABH 3CSGA 4WW2B 1AO7E 1RK0B 5JR1L 1GIGL 1V8HA 3GB7B 3O6KH 4L29B 3U2SB 1FE8L 5T33H 4C57C 2R2EA 3SE9L 3BPOC 5ELIA 2AXFB 4XTRD 2CSPA 5HHQB 4MQ7A 1A6UH 3WCYA 3U0WL 4K7PY 1B0RA 4PB9H 4F37K 1BGXH 1CDIA 1REIA 4R97C 1TQCC 4MWFA 1QOKA 5ADPH 3I6LD 4HULB 3SDYH 4GAGL 4OZFH 4P57A 3MRFA 1JHTA 3LN5A 1Q0YL 5B3NA 1U8NB 1P7QD 4MQ7B 4NSKA 2YMXL 1BD2E 5T3XH 2EDWA 1B0RB 5HYSA 1L0YA 4JPKH 3VGBA 1MCEA 3V6FA 4K23L 5GHWH 2BY2A 3LKOA 1FCGA 1YECL 4MWFB 5KZCD 4XMPH 2HA1A 4ACPA 5DHVA 2CMRH 3T1FA 4P57B 3MRFB 1JHTB 3LN5B 1DVFD 4NSKB 5DWUL 4U6VL 4OZIE 2XTLA 4P9HL 5BRZA 4HCRA 2GJ6D 3WLWD 3V6FB 3SE8H 2K7PA 4LRIA 3FT3A 3LKOB 1I8LC 3MBXL 4YHLL 1FIEA 2EH7L 4PJEF 1HHHA 5DHVB 1UEMA 4LPVA 2I27N 3VRJA 3T1FB 1CU4H 3C60D 1QBBA 4M8VA 1OP5K 5HSFA 5HD8C 4OKVA 2ICWA 4OLVL 5BRZB 2EDOA 1XGPA 4X4ME 3UTTE 2WY3A 3ERYA 3C5JA 1RVFL 3DETD 1UACL 3FT3B 3VXMD 2J1KA 4JFXA 4GXUM 1HHHB 5B3JF 3UC0H 1MHHA 4HG4K 2XQYG 3VRJB 1DANU 1NJ9A 1DQJA 2E27L 2VE6A 3QR2A 2V2WA 4G5ZL 4OKVB 2ICWB 1NUFA 2NLJA 3FTGA 1F3RB 1XGPB 3OJVC 4ENEC 1U8MB 3LQMA 4OCSL 4WI7A 1SEQH 3C5JB 3CZJA 3S3JA 3MOAL 5DYOA 4JFXB 3R1GH 1C1EH 1MHHB 3HFMH 4F7EA 2AEPH 2GUOA 1NJ9B 1DQJB 2VE6B 4YHZL 1X5AA 2V2WB 3MLWL 3ROOA 3BGMB 1JGUH 2B20A 2NLJB 5E1HB 3CMGA 2OJZL 3DWTA 1AJ7L 4KTEL 1PDKA 1Z2KA 5DYOB 5LAXA 1IEAA 4F7EB 4M1CD 1P7QA 3HZMA 4P5TD 1UENA 2GUOB 5EC2A 5HHOE 1DSFL 2A38A 3ROOB 1KXQE 2XQYK 5CCKL 3A67L 4YDLC 1UM5L 4FABL 3EDKA 3PDDA 3SGKC 5EU6D 4CNIA 1F58L 2P8LA 5LAXB 1DBJH 1P7QB 3HZMB 4P49A 1FGVH 2OM5A 4GXVH 1DVFA 5EC2B 4XRCA 3I50H 1KCSH 5IROC 3UP1A 4E42A 2GJ6A 3CD4A 1W0YT 2PTUA 3LHPL 3SDAD 4R4ND 1NBYA 2CLRA 4F15C 4PJAF 5KZCB 4M5YH 1BREA 1RUQL 4CNIB 2P8LB 4B53A 5I18H 4CJ1A 3C60A 4ZXBC 4NUJA 4KQ3L 1DVFB 4XRCB 4EVNA 4WHTA 5F7NC 1QVOA 4E42B 1NBYB 5IW1A 3VXMA 1RMFL 4GAFB 5D7IA 2CLRB 5FHAL 2P24A 4FP8L 3BKYH 1KYOK 3C60B 3H2WA 2WZPD 3E8UL 4U1KA 1L7TH 4NUJB 3CLEL 4TPRH 1BEYL 4LCUB 2NPLX 4NZRH 4NO0D 4EVNB 4GAJL 4UIKL 2DAVA 2FEEI 4WHTB 5FK9B 4ONGL 4TVPL 1DUZA 1II4E 4PY7A 3NCEB 1I8IA 5IW1B 3VXMB 2CJUH 1RIUH 5D7IB 1KFAH 2P24B 5ALCH 3EO9H 4LGSB 2HMID 3QI9D 4U1KB 4RWHA 3HNTH 5IUSA 1N6QL 3DV6A 1BVZA 5KJRL 2V6HA 1DUZB 1O5DT 3HRPA 2VDQL 4PY7B 4I3RL 2BFVH 1I8IB 1BJ1H 4HH8A 2HKFL 3BZFA 4GG6E 1EZVX 1UA6H 4P5TA 3L3KA 4M43L 4EBQH 3JWDL 1UH4A 4Y89A 4ZD3H 2AXJA 4L1DA 2Q8BL 3DV6B 5L8LB 2VXTL 4HT1H 2BNRE 1PZ5A 5EU6A 3BZFB 1A7QH 2ZCHL 3RIAK 5GGTL 2R69L 4P5TB 2NY0C 3L3KB 5DR5H 4LPWA 4NWUL 5LXGL 2D0FA 1AI1L 4PYHA 3SDAA 3QP3A 4HX1A 4BFEA 3T04D 4NC1E 3WEXB 3LV3A 1I1AD 1QZ1A 3H9ZA 1PZ5B 2D9QB 5EU6B 5IVXA 5GS1C 4PRAA 4BZ2H 3FMGH 4FMFA 1LQSR 5MEOA 1NFDA 5C8JA 1RULH 4QLRA 3ROLA 2J88H 2HJLA 2HTLC 1BQSA 2XT1B 4M6NH 4M1GL 2C3WA 2GYSA 4S1QL 3SDAB 1FAIH 4HX1B 4G7VL 3MV7E 3G6DL 1NGQL 3DYMA 3LV3B 5D7IF 1MFBH 5IVXB 4PRAB 5CJ5A 5MEOB 3DBXA 1NFDB 5C8JB 4TTDC 3ROLB 3L6FA 3EOTH 2HJLB 4NO0A 4F7MA 4M3KB 3BWAA 5D8JL 3NCYP 3VFPB 1KCKA 4UT7H 4QNPE 3VXSE 4IJ3B 1I75A 4YE4H 4JGUA 1T1WA 1J88A 1MJ8H 2FGWL 4WDIA 3QI9A 2A6KB 3DBXB 3ORJA 3L6FB 4PJIF 4NO0B 2DJUA 5DFTA 4F7MB 3BWAB 4KPHH 1ZLWH 5ALBL 5AEAA 4OGXL 1BQHA 4RRPG 4X6CF 3PABA 4U2YA 2Y07H 2FNBA 1T1WB 3GBNL 1SM3H 4WDIB 3QI9B 1IGJA 4WNQA 1A7RL 1T7ZA 3VXUD 1EERB 4UNTA 5GGUA 5F7EL 2VDPL 5HI5D 2YZ1A 3HE7D 1P69B 1G6VK 5I6XC 5K9JH 1BQHB 1PSKL 3LDBB 1QBML 1TVDA 4BZ1L 3DO3A 4DCQA 5LG1A 3VFNA 3PABB 1LQVA 2UUDH 3JBG7 3WO4B 1JPFB 2FATH 4L4VE 1IGJB 4WNQB 3Q5OA 5GGUB 1G7PA 2DQJH 1T03L 1VEPA 4P3WA 1U58A 1VB9A 1WZKA 1I1AA 2QSCL 4DCQB 5HYIA 4XNZB 4PTTA 3VFNB 3T0XA 4H1LG 1F90H 2P49B 1JPTH 3BDBA 5DVOA 3CJJA 4UU9A 4FA8A 3P11H 5CEZH 3EZJB 5GSRA 1G7PB 3UO1L 1IEBB 4S0SD 3U4EA 3WHE0 1NFKA 1KXVC 3LKRA 1I9IL 5IWLA 1U58B 3ZLQC 1I1AB 1P6FA 2W9EL 3BPNC 4PTTB 5CZVL 3P4NA 4UU9B 2EH7H 1TTFA 2B0SH 5GSRB 1TJHL 1Q0XL 3P0VH 3SGDH 3U4EB 2PN5A 5HPMA 5EU5A 4GQ9H 3LKRB 4YPJA 4Q0XH 2R8SH 5C3TA 5DD5H 4NN6C 4XNUL 3UZVB 3CU1A 3OQ3B 1I9JL 1U2CA 3P4NB 1QA9A 4HXAH 5DD0L 3RVTD 5FCSH 3QPXH 4RISL 3KYKH 5I8KL 1MIML 3T3MF 4XP9H 2FH8A 2AJSL 3BD4A 4X6BA 5GGRA 1CQKA 1TJIL 4RWYL 1P1ZA 5GGSA 5IK3A 3NBNA 4DKFH 3VXUA 1QA9B 2Y5TA 4GKSA 5KVDL 1KEMH 3HE7A 4MJ6A 4LCCC 2GT9A 3CXDH 1SEBA 5IHZA 1OB1A 2DQGH 2QQNL 3QG7L 1I3GL 1VFOA 5TFSH 4EI5C 4X6BB 2P8PA 5GGRB 1U8KA 2AXGA 1F11A 1P1ZB 5GGSB 5IK3B 3H9HA 1B6UA 3OJDA 2K9UA 1AJ7H 3VXUB 1D6EA 2Y5TB 1S7RA 4GKSB 5ISZE 3HE7B 2R15A 3OSKA 4MJ6B 2GT9B 1SEBB 3IU4L 5DRXA 5IHZB 1OB1B 3AB0B 4IIQC 1DSFH 4MAYC 5TPWH 1Z9SA 2P8PB 1U8KB 2EE9A 2YR3A 5GJTL 1ZAGA 3H9HB 4Z5RA 3OJDB 1MLCA 1UM5H 2AK4E 2VLMD 2C3HA 1JTPA 1D6EB 1R3IH 3BD3A 1S7RB 1KN4L 5E9DD 3GM0A 4KTDL 4QRRD 4Z7VA 3RJQB 3TIDA 5DRXB 1HINH 1JYXA 3OPZL 4ORZC 1HNFA 2DBJA 4Y88A 4M48L 2NY4C 4WCYH 3V8CA 1OW0C 4OQTA 3VD3A 2RGSA 4Z5RB 3ARGD 4JB9H 2H1PL 5DQDL 2OLDA 1MLCB 5BO1H 3RQ3A 1EGJH 5I1HH 4Z7VB 3T77A 3TIDB 1HWGB 2P5EE 1KXTB 5D6DA 3ARPA 5EA0L 1K6QL 5DURD 2ATKA 4KK5D 3WIHL 2OR9H 3O9WD 4YXLL 3QEHA 4LPYA 3FB8B 4P2YA 5D9SA 1GGYA 3T77B 4JRXD 1RSFA 2OXGA 3HR6A 2ATKB 2GEEA 3O2DL 5F9OH 5AD0A 5DVKA 5C0NC 2BY1A 3QEHB 5J11B 5D9SB 2EXYC 1LDPL 4MAUH 1MAKA 1EJOH 2DM4A 5CBEB 3RPKA 5HYEA 4FFVD 4QTIH 3VFWA 3BI9X 3K2UL 4I1NB 3C2SA 5JOFA 2CK0L 2R0KL 1AH1A 2MQ0A 2AK1H 5BMFL 2F58L 1EDQA 3AU1A 1A6TA 4YXHL 2Y5EA 3T0ED 5ITBH 3JWDH 1I85C 4DTGL 4RBPK 5I8OH 4NNPL 4D8PA 5I19L 3VFWB 5JOFB 1F4WL 4K8RL 2YPLE 4JHAL 1X5ZA 4PS4H 2VR5A 4LLQB 3O3UN 3QUML 1BVKB 4JFYA 2BVPA 3AU1B 1BOYA 4MJ5A 2CXGA 4HEPG 5E9DA 5DLML 4QRRA 4J7RA 1AGFA 1MAMH 4Z7VF 4POYA 5E08H 3MRLA 5DJDB 3MRBA 4D8PB 4KZDH 4OD3L 3KYAA 3VH8A 1XMWA 4MVBC 3ARGA 4XVTL 4X6EA 4JFYB 4JQIL 1PLGH 2BVPB 2PYFA 3GJEA 3QDGD 4LEOA 4MJ5B 1Y6NR 4PRPE 5E9DB 4ZFZA 2HFTA 4MHHG 2DQTL 1AGFB 4G3YL 4M7KH 4ZODA 2B2XH 4XP6L 4M1GH 3MRLB 4RSVA 4HS8H 4PJHE 4I13B 3O6FD 1VEMA 2ZP0T 3SDXE 3VH8B 1UKTA 3ARGB 4G7VH 2JIXD 3DARA 2O61A 5EU7E 3O9WA 2IAMD 1CLOH 3SOBL 4BM7A 4DQOL 3EHBC 2C9AA 5I71C 2PYFB 3QO1A 4LEOB 4ZFZB 1IGIH 2WBJB 1TZHA 4FN0A 4RA0C 2PO6D 1DR9A 4JRXA 4R3SA 2CLZA 1HKFA 3ULVF 5DURB 1XGQA 2A6DA 2O61B 1XGUA 3HI1A 1CFSA 4PRNA 4JY5L 2R0WH 1EVUA 3N1QC 3IDYC 2QQLL 2NY6D 3QO1B 4LP4A 4TNVF 3OKNA 3MV9E 4KVCL 1TZHB 5DMYA 4GSDH 2DQHL 4OGXH 5DJ0A 4HG4J 1CD8A 4JRXB 3WN5A 2CLZB 1DQDL 1XGQB 2A6DB 5EBGA 3HI1B 4ODSH 3ARTA 3DMMD 1CFSB 5FYKD 2FBOJ 3AS2A 4PRNB 5C1MB 5E99H 3GBNH 3TPUA 2XRAL 5IVZB 3T0EA 1YJDL 1A7RH 3OKNB 5F8QC 3RKDD 1KB5H 1ZGLM 1MCBA 2BZDA 4U3HA 5DJ0B 1T1XA 4ZAKC 1MHEB 2AJZB 1QHPA 3VA2C 4U3CA 5A2JH 1RJCA 3U83A 4U1GB 2JJSA 3N1FC 1UZ6E 3TA3C 5ICYA 5EIIB 3L3OA 3BE1L 4YUEL 3T0EB 3CCHA 3GSXA 2FWOA 1HYSD 1J10A 1LO2L 1CZ8L 4ZUWA 5H37H 3S36H 1T03H 3C6SA 5FYJU 4Z7UA 4QTHA 4OI7A 1SYVA 4HWBH 3WFEH 3BEVA 2ICCA 3QDGA 3L3OB 3G9VA 3CCHB 3K8MA 5F7WC 2FWOB 2MKWA 4ZUWB 4H0GA 1X7QA 3QH3A 4OCYH 3C6SB 4Z7UB 3MUHL 3O6FA 4PJ7B 4C4KT 1DBKL 4QTHB 1SYVB 2JIXA 1NEZA 4QO1A 1EXUA 3GFUA 2IAMA 4KMTH 5D70H 3BJ91 5DRNA 3TFKC 5FYJE 3BEVB 2VL4A 3QDGB 3AY4A 1SY6A 1RZFL 1FFQA 2Z4QA 1X6LA 4GKOA 1KEGH 1N59B 3FB7A 4MLIA 5IV2A 1MRFL 2WUCL 5DA0B 1Q0XH 2PO6A 1X7QB 3QH3B 4PJCF 3O6FB 5FGRA 1E27A 3RWHA 4W6XB 4NNYA 2JIXB 1NEZB 5GRYA 1EXUB 4ZNEE 2IAMB 3L5XL 2FZ3A 5DRNB 1F6AA 2Y9RT 4GMSL 3GSQA 3KYNA 3PGFH 4Q9RL 7CGTA 2D0HA 3OF6D 5IV2B 3EOAA 4RISH 2PO6B 5J12C 5I73B 3FB6A 1KYOJ 3SN6N 1MIMH 4QWWD 1IGCL 3DUHA 1SQ2N 5L6YH 1E27B 3RWHB 4J3WA 4NNYB 1R3KA 3KXFE 3DMMA 3UJIH 4DN4H 3ULUH 2FZ3B 4JKWA 5I1DB 1F6AB 5LQBL 5KOVC 2A0LC 2NY6B 1JNLL 1UG9A 3KYNB 3NABL 4WUKH 4XT1C 4UV4L 4OV5A 1HHKA 4MYWB 1AKJD 1TXKA 1YDPA 3OGCA 1JGLH 3WFBH 4ODVL 2EKSA 3RP1A 1R3KB 3DMMB 4JDTL 5CJXC 3C9NA 2L0DA 4I5BA 1B2WH 3C09C 5EZLA 2YD2A 4MJ2A 4K71C 2C4XA 4OV5B 1HHKB 4Z7UF 3EFDH 4GRMA 4PJ7F 5C0BE 2ERJB 3OGCB 1YDPB 5DD3L 2VJXA 4FQJH 2B4CL 2EKSB 2FLRT 4P2QE 1YQVL 1EEQA 4YGAB 2AJXL 3C9NB 2Y7QB 4I5BB 4NBZB 3UXFA 1S7XA 5EZLB 1FBIH 3FQXA 1IM3A 4LCWD 4HJJH 4KGJA 1UWXH 4KTDH 4LU5H 2IH3A 4Z7QF 4LF3A 2EC8A 4M48H 1ZHLA 3VFTA 1JGDA 4G6AC 2EXWD 2VISA 2X7LA 1LO5A 1MJUL 5KTEL 1U92A 2XQBL 4XPHL 1S7XB 3P2TA 3FQXB 1KLFA 4JVPA 4TSCL 1ADQH 2VZVA 3GO1L 3RUGA 3BH9A 3QJHA 4LF3B 4WI2A 2OL3A 1ZHLB 3VFTB 4YHOL 5D5MB 3I84A 2VISB 3ULUC 2X7LB 1LO5B 4X4ZA 2QQQA 5J7CC 3FN0L 3D0LA 4WHCA 1U92B 2IPUG 3NZ8A 5D93C 3BP7A 3WIHH 2P1YA 2PUQT 1YPZE 3OF6A 2VXVL 3QUZC 4CVZB 4W4OC 3LS4H 2IBZX 1QKZL 5HYJD 3LRHA 3RUGB 1V7NL 3ZKMC 1QFWI 3BH9B 4OCNC 3OKMA 3QJHB 3SKOA 5KVMC 2OL3B 1XGTA 5SX4H 3RWGB 1TNMA 3D0LB 3NZ8B 2ZUSA 1T04A 4JCLA 4BQ8A 1IQDB 2EYSA 4I2XE 2QV2A 2BHUA 1AKJA 1U3ZA 5F7HA 2HT2C 3SKOB 3ZKND 3OKMB 1WWAX 1XGTB 5D1XC 2VXSL 4FG6D 2CXKA 1T04B 1WCQA 4NHCL 5KW9L 4Z0BL 2EYSB 2IEPA 4YXHH 3BP5B 1YEHL 3BPLC 1AKJB 2IPUK 5HDQH 1CE1L 2YK1H 1XR8A 5GPRA 4R9HA 5AAWA 1A3RH 5I19H 4ZPTA 4H5SA 2JCCA 4N9GA 5FKPA 3CX5K 3MREA 4BQ9A 4LCWA 1WF5A 3WUZA 1KCVL 4YQXL 3WIIL 4DOHE 2DQUH 4Q2ZA 4NZUL 2V7NA 1XR8B 1QBAA 2FX7L 3W11D 5D5MF 4H5SB 4ZPTB 1Q38A 4N9GB 5FKPB 4YK4B 2IGFH 1CWVA 3ZKSD 1F4YL 1PEWA 2FLBT 2VDML 4ZUUA 5IESL 1OY3B 4Q2ZB 3RUGF 1LP9E 2J6EL 3KR3H 2V7NB 1N0XL 3ZDYF 5L7XL 5KS9F 3JV4A 1EAJA 5JW3H 3KPMB 3MLUL 1N3NB 1JWUB 3UYRL 5HYJA 1CGWA 4TNVK 4PB0L 4ZUUB 5ID1A 5FV2A 1IILE 4IMKC 4F58L 2AV7A 5A1AA 3JV4B 5DK0A 3TO4D 2P44B 4POUB 5T3ZD 1WT5A 3EJYD 1IQWH 4PLJD 5TF1H 3HPJA 5HYJB 1WC7A 2GHWB 1JGEB 5GGVL 4N9OB 4LSPL 5ID1B 3MC0A 2AV7B 2UZIH 5DK0B 1XFPA 4QRUA 5LBSL 3WMSA 3LVEA 3HPJB 3KPRE 4DUVA 3HC0A 1WC7B 4KJPC 1OD7A 4XMLH 1MF2H 5DD1L 2JELH 3EGSA 1OAXH 3BQUC 5A40E 3E3QA 1F6LL 1OTUD 4NZTH 4QRUB 2ZG2A 3M45A 1GHFL 4MSWA 3BE1H 3HC0B 4LKCA 4LCIH 5ECJE 1I1CA 4TYUA 4HIHA 4OSUL 3Q1SH 2FB4L 4D9LL 4Z6AT 3EGSB 3RTQC 5M7QA 4U1LA 3P0YL 4LQ1A 2B1AL 5BW7A 2EEAA 4DKAA 2OI9C 2VZ3A 1DP0A 1NFIA 4MSWB 2FHBA 4LKCB 3OKLA 1ZOXA 1FNAA 4OUOA 2YD9A 3TCLA 4X6DA 2OK0L 2HRPL 4HIHB 3WS3A 1JF1A 1HXMA 1HH9A 1IC5L 3LZFH 3MLTA 2ICWJ 5E70A 4U1LB 4JRYD 1Q9LB 3D9AH 1CLZL 4NC0B 5E2JA 3KJ6H 3KPNB 3TCLB 4X6DB 3H0TA 3WS3B 2YUXA 1JF1B 1HXMB 1HH9B 3TO4A 4RFNC 3V4UH 1OAKH 5C0RL 3CH8A 1RZJL 2K7QA 5DT1L 4HQQH 4OKDA 3SE4C 4D9QE 2EDXA 1WWWX 4NGHH 3U30B 4ZS7L 3QEGL 2WLYA 5E8EA 4KK8D 4Z7OE 5E00A 5IW6A 1T22A 1OGTA 1YEKH 4HAGA 1VERA 3KPPA 4Q9CA 5K9OA 4JFZH 5C2BL 3TO4B 3BMVA 3WSQH 2YS4A 4IDJH 1YYMH 3T4YA 5K9QG 1AGEA 5E4IA 3RL1A 5DTFB 1DN2A 4WO4C 4Y16C 1NGXB 2IMNA 5E8EB 1GGTA 5GS0D 5IW6B 1IC1A 5BS0D 1GOGA 1ZHBA 1T22B 1OGTB 5E8PB 3KPPB 1FJ1A 5K9OB 4N0CD 4S1DC 4OCXH 2NQCA 3DUUB 4YZFF 3T4YB 3D69A 2VAJA 1AGEB 1KJMA 5DZOA 2NX5E 3RL1B 1X5IA 4ZFOA 4EKXA 3OR7A 4KUCD 5A2IH 5KANG 1FC1A 1ZHBB 4AT6A 5J1AA 5DD3H 3ET9F 3O2VH 4PJDF 1FJ1B 1B6DA 4L5FL 2VLRD 1YQVH 4NCC2 4PLNC 4BH7A 2YPVL 2MQCA 3D69B 3HAEH 1EFXD 1KJMB 5E8DL 3O8XD 3RY6C 4ZFOB 3OR7B 4XH2A 2VZ1A 3DX7B 4L8SA 1OL0A 1UVQA 1RUPL 4AT6B 5C09D 5J1AB 3LPFA 5H94A 5J9PA 3G5VB 4JRYA 3QEQD 1MFDH 3AVEA 1LGVA 5K33A 1CFVL 3QPQC 3AUVA 3RWJA 4XH2B 1K8DA 3P3YA 3LIZL 3F62A 4L8SB 1UVQB 2Q8AH 3BAEL 5ADOL 4BQCA 4IS6A 5H94B 1H8OA 1E4KC 5HXMA 5J9PB 3OV6A 4JRYB 4XCYA 1MHPH 3VDAA 1OSZB 2W92A 2X10A 3STLA 5T5FL 1G7MA 4GFTB 3QDMD 1FVEA 3RWJB 3C6LC 1QKZH 5I1IH 3B6SA 1LMKA 1VGEL 3LPGA 2BVQA 4L9LA 5IB2A 1T6WA 1DLHB 1V7NH 1BF8A 5FF6A 5FYLL 4EDXA 5F7FA 4IS6B 3QFJD 3QXVA 5IOPB 4O9HL 4NQCD 2GCYA 1NGWA 4F7PA 1XH3A 3STLB 1G7MB 1AFVL 1N5YH 1H3UA 1FVEB 4WTXA 3BEWA 5BS0A 4PUBL 3B6SB 3FO1A 1B0GA 4L9LB 2BVQB 1I7UA 1IGFL 4KKNA 5IB2B 4GS7B 5FF6B 5KG9A 4EDXB 2YWZA 4N0CA 1LVEA 3RX8A 1JN6A 3MRPB 4GRLD 8CGTA 2GCYB 3P9MA 1GVIA 1NGWB 4F7PB 4HIIA 1XH3B 1OWRM 1IGTA 3JVGA 3VD5A 2UVEA 2IPKA 2HH0H 3BEWB 3L3GA 5BS0B 1BZ9A 4TRPL 3FO1B 25C8L 1B0GB 1I7UB 4CVWA 2P45B 2ZJSL 4OF8A 5KG9B 1P7HL 2VLRA 3RAJL 1JN6B 3HI5H 3SCMD 1EFXA 3O8XA 2FX8L 4OLXL 4HIIB 5C0DA 4YQXH 1IGTB 5IBLC 4EQ3A 3I6KA 3BWUC 3L3GB 5FO7A 1BZ9B 5C09A 3IKCA 2OS7A 2DLGA 1WBYA 2VLRB 3QEQA 4AEEA 1SJXA 4KHTH 5TJWK 1A7PL 1EFXB 4LVOB 3PWJA 5FHBL 3O8XB 1EIBA 2NR6D 1YYLL 4XNXH 1AY1L 1F4YH 1WWBX 3C8DA 4RGMC 3I6KB 1MFEH 5FO7B 5C09B 2J6EH 1KF9B 3IKCB 3MOBH 5DS8A 4BSWA 1WBYB 4PJBF 3QEQB 5L7XH 2E9IA 4MQXC 2J12B 1IKFH 1XF5A 4NN5B 3MLUH 3QDMA 3S3PA 1J86A 3SKJH 4TUKH 3RRQA 3UYRH 3W0WB 2ORBH 1JJUA 4KDTC 4PB0H 3KHQA 1PX4A 3ZO0A 1JHLH 2HTKD 1IAIL 1WIOA 3QFJA 4BKLA 4E5XA 1F2QA 3K1DA 5C07D 3QCTL 1U0QA 1QSVA 4NQCA 5C9JA 2PXYB 2VLJE 3H3BC 4S0UC 4MCZA 1XF5B 1QPPA 3QDMB 1R3JA 3IRPX 4EEEA 2DLTA 5JUEH 5T3XD 4NHUA 4WHYG 4DGVL 4ZOAA 4BKLB 2B39A 3QFJB 4E5XB 1QO3A 1CTNA 4X98A 4HFUH 3BPOB 1T1YA 4GRLA 4NQCB 3W81A 3WDHA 5C9JB 4XHQA 5MP6H 4LDLB 4MCZB 3FAXA 4FZ8L 4KUCF 2E9JA 1IM9D 2JJTA 5JORA 2GQHA 3UTOA 2X41A 4NHUB 5JZ7D 5ITFA 4Q6IC 2ZG1A 1UM4H 3I6LE 4R97B 1QO3B 4Y0GA 3SCMA 4X98B 3K7UA 5B22A 1MJ7H 1T1YB 4GRLB 4X9FA 1XEDA 3OZ9H 4E9LA 4V3DB 4H0HB 4N0UA 5CILH 4CGTA 4L4JA 5JORB 3EJZD 2IMMA 3WJLC 3L3HA 3DURA 1LEKA 4PJXA 3QUYC 1G0XA 1ZV5A 5ITFB 4P9MH 4OM0H 3SCMB 3BIBX 5F7YC 4V3EB 4N1CA 4D9RE 1AQDA 5F6IC 5CKGA 5FO8A 1EHXA 2KKQA 4ZXBD 4Y1AD 4N0UB 4JE4B 2AV1A 3RVXC 2GJ6E 4KKBC 3FJTA 2BCKA 3EJJX 3L3HB 3L3DA 3DURB 1LEKB 4JREB 4PJXB 1QLEH 1OTTC 2Y6SC 4G9DA 1AQDB 4P3CL 4NDMB 4YBHA 5JXAL 5FO8B 1BVLA 1C5CH 3L1OH 1IC7H 3O6MH 1XF3A 4JFQA 3QNZB 5J13C 1HHIA 2BMKA 2BCKB 3L3DB 3VXME 3UBXI 1ORSB 4K94H 2O5YH 2VZSA 1DJSA 3D1MC 3STZA 1YEGH 4Z7NE 4OCMC 5C07A 5EUKA 4G9DB 3SQBA 2AABH 5I1KL 1FYTD 3HNSH 3CDFA 3L5HA 4XPTL 3T3PE 5F6HI 2W38A 2OJEA 1NANI 5HHNA 4OZFA 2FD6L 1BVLB 1QSFD 3PWPD 4Z77A 4R96A 4IRZL 1XF3B 4JFQB 4XP5L 1J0YA 1HHIB 2BMKB 3FQWA 2AVGA 1ZT4A 5EUOF 2ENSA 5C07B 1GC1L 1G9NL 5EUKB 4PRDA 5KVEL 2DM2A 4GOSA 3UTSD 2EO9A 2DTML 4FQIL 2OJEB 5IHUH 5HHNB 4OZFB 3MLPA 1NL0H 1BP3B 2F8XC 1IM9A 4JM4L 4Z77B 4R96B 3GUTA 3GIZH 3B8YA 5IHLB 4L4TD 3FQWB 2EH8H 1KSRA 1ZTXH 1Q8MA 2D7TH 3C8KB 4ODTL 4POZC 4M62L 4KV5F 3SGKA 4PRDB 1OP9A 1E4XH 3QWOA 5FUOH 5HGAA 3R0MA 2J4WL 1T89A 1HI6A 2D3VA 1C08A 1UH2A 1UJ3A 1IM9B 3GUTB 2LFGA 2ZSVA 5IROA 4OCRH 5JHLH 4PJXF 2ARJQ 2BX5A 5F89A 5EU6E 5KSBE 4JZJC 3IDXH 4AEHH 2HT4C 1U9KA 3QWOB 4JPWL 5HGAB 4ZXBA 4Y1AA 1HI6B 1HKLH 4KUZL 4XC1L 1C08B 4Z95L 1AXTH 5JQ6L 1UJ3B 1KJ3L 3LQAC 3CX5J 2ZSVB 2WWMC 1FVCA 1F4HA 5F89B 4U1SA 5IVXE 4KDVA 4F15B 1AHWC 4TULL 5IT2L 1NFDE 4ETYA 4HW6A 4H1LH 3L95A 3FHQA 3K81A 2AGJL 4ZXBB 5L9DH 4Y1AB 1NLDL 3GMMA 5KSVA 4TQEH 4JN1L 4EJ1C 5CEYA 4JPVL 4FFEX 4U4BA 5DMGC 1WAAA 1FVCB 2DD8L 4U33A 5AAMA 2EDJA 4U1SB 4XVJL 1PGRB 1RZKL 1NLBL 1FYTA 4QF1A 1XIWD 3L95B 2Q3ZA 1QSFA 3PWPA 3GMMB 5KSVB 15C8L 1X5GA 3IAGC 1YEJL 5CEYB 3WD5H 2UWEA 5FOBA 5IBUB 3MXWL 2DQDL 3NZHH 1FZOB 1FYTB 4QF1B 4X5LA 5DJAA 4TOYH 4JKPL 3VXQB 3UTSA 1CL7L 1QSFB 5J6GA 2NXYC 3UYPA 4Q7DA 1W72H 4L4TA 5DF0A 4XPBH 2UWEB 1UADC 5FOBB 1IKNA 4W6YB 5DJAB 3UTSB 4YBQC 5TE7L 1B4JL 1E4XI 3BKJL 5J6GB 3S9DB 4D2NA 4JKMA 1XCTA 1QEWA 4L4TB 5A2KH 4PG2C 3V7AE 3QHFL 1OAZH 1WIUA 4N8VA 5GS1A 3DROA 1LK3H 2ZJSH 4YFDB 2E3VA 4EUPH 3WUWG 4O5LH 1XCTB 1X4ZA 1ZVHA 1WZ1L 1QEWB 4UILL 1F3DJ 1OT2A 2W91A 1JF5A 3AXLA 5GS1B 3DROB 3SDDC 5C7XL 2ZWLT 3SPVB 3TIEA 4XNMA 3DECA 1JUFA 2GIYA 4I3SL 4AENA 5CZXC 3JWNC 3BXNA 3RWDA 2OTUA 5FHBH 3PGCA 4FTVD 5EBWB 1WAAF 5SWZE 1CXEA 1AY1H 4OFKA 4R2GC 3VU2A 2E6PA 5K93A 1CF8H 1XIWA 5C08D 3AXLB 1J5OH 3CGTA 3TIEB 5HJ3A 4XNMB 4AENB 1JUFB 4QCIA 3ZMRA 1IAIM 1H5BC 3RWDB 3VG0L 4UMGA 2OTUB 2YC1A 4I77L 2UWEF 2X4QA 3PGCB 5CUSL 3QA3A 1JYNA 2AS5M 1OGAD 1XGYH 4LSRH 2V5MA 1J8KA 3T2OA 5D4QA 3IB4A 2ESVD 3BESR 1XIWB 4ZFFA 3I75A 2Y36L 5CD5D 4M02A 5HJ3B 2QADC 3OKOB 4FQ1H 2KQMA 5D2NA 4XCFL 2VAAA 1I7ZA 2YC1B 5E2WL 5D72H 3DV4A 3EIFA 2F54D 2X4QB 4OB5H 3QA3B 4OI8A 4B5EA 5C6PB 4M7ZC 2EO1A 5E2VH 3O6LL 3V4PL 3RWFA 3EKCA 4ZFFB 3VXUE 5BV7L 3I75B 4FQLL 4S1SL 5FUZL 3QCUL 5D2NB 4YWGL 3AREC 3H7BA 4P5KA 2VAAB 5CEZD 1UWGL 3DV4B 5I6XB 3NPSC 4A6YH 4WFHD 4FZ8H 4MA7L 3ARWA 5E6IC 4MAYD 2Z8SA 2NY5C 3TLRA 2X1WL 3RWFB 3LD8B 5EOCJ 2YD8A 4KKCD 5DXWA 2C4FT 3B4NA 4Z7WA 2NMSA 1E4WH 1U6AL 3UDWC 2XA8H 5JXED 1JFQL 3H7BB 4X7CC 4M1DL 5DJYA 4H20H 4P5KB 3ULVL 3D18A 2AERT 2LU4A 2COQA 4LEXL 2GTZB 1CDJA 4GMTH 4DUWA 4IRSC 3ARBC 2MKLC 4F9LC 2XWJA 4Z7WB 1CD1A 4G6MH 5CJOL 3S35H 5DJYB 1M71A 3RHWF 4FTVA 2XFXB 1CD9B 4TVSa 3D18B 5AZ2L 4H8WL 2DJSA 2Q7NA 4MXQD 3ZE1F 1RUMH 5C08A 3BPNB 4X80L 4FXLA 2XWJB 1CD1B 5HYQA 1PQZA 1MCWM 1FORH 3DI3B 4FTVB 1QRND 1OGAA 4RNRA 1QBLL 4AEIL 1WV7T 1T5XA 5M94B 4KQ4L 4LIQL 2ESVA 1DBMH 4ERSL 4X5XA 1S9YA 1LO3L 1QG3A 4NN6B 5C08B 2FBJL 1JK8A 5GJSL 3ZSTA 5HYQB 1NC4D 3T0VA 5I1KH 3QIBC 5L2JA 1PQZB 4NC1C 4DGYL 1P5VA 3T09A 1I1RA 5MEND 4J23A 2F54A 2HVKA 4UT9L 5EB9A 4UNUA 4RNRB 1T5XB 1EK3A 4MD0A 5HGGS 6FABL 1X5YA 2ESVB 1NCWL 4X5XB 1S9YB 4UOJA 2DMCA 1JGVH 3WHXA 4LARL 2Q76A 4S10A 1U3HC 1JK8B 2QHLA 3CVHL 5IF0A 2W07A 1J0JA 3IDGA 1S78D 3AGVA 3T2QA 1FDLL 2DTMH 4PFEA 3NH7L 2F54B 2HVKB 1U93B 2DQEL 4MAYA 1ZSDA 4MD0B 4NRYA 3MROA 3GJFK 3I3DA 3WHXB 3I2CH 3OXRB 4LSQH 2Q76B 1JHKL 1A5FH 4DKDC 4M62H 5JXEA 3O3BA 5IF0B 3LEXA 4L1HA 3IDGB 1QFHA 2DRUA 3IF1A 4NYLB 1LEIA 1GGUA 3TJHC 2R0ZH 1IGYA 2DQIH 4OI9A 4MAYB 1ZSDB 4GRWE 4AL8L 4S1RH 4NRYB 3U1SH 3MROB 1YNLH 1OW0A 4MVBD 5JA8B 1A7OH 3O3BB 1RU9H 4QRRE 3BH8A 3LEXB 4JPWH 2EDLA 4KGLA 3IF1B 3Q5YA 1LEIB 2WUBL 4Z95H 1IGYB 1CICD 5F1NA 5JQ6H 5LKNA 4MXQA 5DEZA 1Q9WA 2YKLL 1KCUL 1Q9OB 2O5XH 4RMUA 5D96B 4KK6C 2R4RL 1QNZL 3BUYA 2EYTA 1MCOH 4OFPA 2DKSA 2E8ZA 4P2OD 1QRNA 2ED8A 3WHE1 2F74A 4G6KH 2GY7B 1DBAH 5KSAD 3X17A 1TMCA 5F1NB 4JPVH 2AEWA 3U7WL 5JTWA 2F53D 3QXWA 4ODHH 3B83A 5EOCL 4JO1L 5E2TH 1NC4A 3BUYB 3VI3E 2EYTB 3WXVL 3IFPA 3SGEH 5MENA 3BYTA 1QRNB 1XGRB 5E4EC 4OZHF 2F74B 1TMCB 15C8H 4KK9C 3QQ9C 1MQKL 3PHSA 5C86A 1JZ5A 4HK3N 4XCEA 4LVHB 1IRAY 1T0MA 1NC4B 1X4XA 2X9WA 1D7FA 1OM3H 4HPYL 1JTTA 3IFPB 5IBUG 5MENB 1OTSC 1WVZA 4M7JH 4UOW0 1I3RA 5CP7A 2X89D 32C2A 1A7BA 4M7LL 1YEDA 1SY6L 4ZAKD 4YHML 1CFBA 2RIKA 5DO2C 3V6ZA 4XCEB 1SJHA 5F21B 1MFCL 1T0MB 1YEIL 1JRHH 4LSVL 5C0CD 3LOWA 3TPUE 4QGYA 5F3HA 4NJ9L 4GW4A 1G1CA 3BKJH 3OMZA 1I3RB 1L7IL 5CP7B 3VGDA 4CDGC 4XWOD 4JO2H 3Q0HA 4RAUA 3ZYOA 32C2B 3QNXA 4O02L 4HIEA 1CLCA 1YEDB 4MVBA 3V6ZB 1SJHB 3TP4A 4U1MA 3V52L 1GRWA 2XACC 3IJSB 2A6JA 3ZHKA 3QZWA 4GW4B 5T1MB 2FJGA 1CICA 1SJEA 4XXCC 4JQVC 4BK4A 4RAUB 5SX5K 3QNXB 3CUPA 4HIEB 3UAJD 4JFOA 3NGBB 5HPOA 2D31A 3UTPD 3QDGE 2Z31C 5DC4B 2A9ML 4P2OA 3TFKD 2A6JB 5C7XH 1Q72H 4K07A 3V7MA 5I16A 2M1KA 2FJGB 5KSAA 1CICB 1SJEB 4F33A 3ISWA 1JWMB 2J2ZA 1QFUH 2ILLA 5AYUL 2F53A 3CUPB 1U8IA 4PY8I 2D31B 1TETH 4OGAD 4P2OB 4DVBA 2J5LB 4ALAL 1MCRA 5I16B 1K4CB 4N5EC 4OFDA 5KSAB 4F33B 3RI5F 3KS0H 1FL3A 2F53B 3STBA 1U8IB 3MLSH 1NCUA 1CI5A 5DJ6A 4EDWL 4DVBB 4XC3H 1EMTH 3HI6H 3GRWL 2E6QA 1VCAA 5GGTA 1SJVA 4HV8A 5GISH 2ATPA 3GSVA 5KAQF 2X89A 1FL3B 4OCWH 3OB8A 5E2WH 4ZAKA 2VLLA 2DQCH 2XG4A 5FYKE 5C0CA 2DS4A 3EYSH 3CH1A 1N6UA 4PREA 3SO3C 2NY3D 2DI7A 1U8JA 5DJ6B 5DFWH 4JR9H 2OL3L 4HV8B 2ATPB 1G9MC 3GSVB 4PBWD 5FXCH 3ARDD 3V9FA 4ZAKB 2VLLB 5I30L 3PL6D 3ZE0F 3QUXD 5C0CB 2BSSA 2WM0A 3CH1B 4PREB 5J56B 3TH2T 1QR4A 12E8L 1U8JB 4JM2D 3WNKA 4QXUL 1U41A 1IAMA 3HTLX 1A0QL 1U6AH 4HJ0C 3O3EA 4UBDC 3RGHA 3RHWK 5IFAL 3UPCA 1E6OH 4UZGA 1T80A 2OCFD 4H25A 5IB1A 1M7IA 2ZUWA 5FM4A 2BSSB 1YEEL 4WWID 3TFKA 1PJ9A 4XNQA 1PYWA 2QR0A 3GMOA 1QFPA 3X11A 4YBLC 4Z8FH 3SY0A 4Y5XC 3LRSA 1OSPH 4S2SB 4NFDA 3MFGB 1CK0L 3O3EB 1KELH 3RVWC 4AYFA 3MJ6A 4JHWH 5GRJL 5I1CH 1SVCP 5IGXH 5IB1B 1M7IB 3TGXA 2O93L 4XPGL 2EDBA 1NCAL 1LNUA 2RCSL 4XNQB 1PYWB 1UH3A 2QR0B 1UWEH 3GMOB 3ULUD 3X11B 3IDJB 4PJFF 3LRSB 4WU7A 2Z91A 3RFZC 3CFJA 3E6HA 2WANA 1KB5A 4MQTB 3HG1D 3P9LA 3QDJB 4KVNH 2W9DL 1AQKL 3ZKMD 4CL7A 3K0WA 2C3XA 2DICA 3LEYL 4LHUD 3VFGL 1FNGA 1RUAH 3GKWL 2XV6B 4WI8A 2V7HA 3WS6C 1UXSA 2JTDA 4M6ML 4WU7B 1FG2A 2Z91B 4FQPA 5J12B 3CFJB 3E6HB 3GHEL 1KB5B 4K55A 3RWEA 3P9LB 5B39A 1A6PA 4WW1B 1BWWA 2XZQL 2ZKHH 1FNGB 6FABH 2UYLA 3FRPG 2V7HB 4WFGD 1UXSB 3CLFL 3K8KA 3VXPA 1KCGC 4DFHA 1FG2B 1AR1D 3ARDA 4PGDA 1TPXC 2I5YH 2VXUL 1YC7A 5EU7C 3TC9A 1JZ4A 3RWEB 1P7KA 5B39B 3PL6A 3RZWA 3QUXA 3GK8L 1MFNA 4LRNH 2HLFC 2NY3B 4Y19D 5FCUL 2UYLB 4JM2A 2F5BH 3L5WA 3VXPB 3C09B 3RJDA 4D3CL 3NFPA 3UROR 1K3IA 3ARDB 4PGDB 3D3VD 3Q3GA 5FYJH 4U6YA 5LJYH 1P7KB 2JCCE 1HYRC 4PJGE 3QUXB 5EIQA 2AI0H 5AUMA 4AL8H 3MLXH 4HBCL 2D4FA 1TJGH 4JM2B 4LCWE 2MJWA 3L5WB 4LPTA 5BQ7A 1G9EA 3NFPB 3QXDA 1OT1A 2Z35A 3QAZB 5C0AE 3SJVB 4U6YB 3I6GA 2E6JA 5AUMB 3BGFC 4YHKH 4XVUC 1C7TA 3IS1X 4OD1L 1INDL 1BFVH 2UUDK 2ZPKH 3N50A 3KWWA 3TYFA 1JNNH 2FHFA 3QXDB 2Z35B 2GAZA 3T65B 3QHZL 1BZQK 3HG1A 1V7MH 3I6GB 4LHUA 3LH2H 2M8XA 4BYHA 5K59E 5HHMD 1A3LL 4R26L 3P73A 3EYVA 3KWWB 1NMAL 1GPOH 4LNRB 2GAZB 1DL7L 3HG1B 3ARXA 4JJ5A 5A3IC 1ROWA 4LHUB 3DO7A 3TT1L 3MACL 3UJTL 2XZAH 3P73B 3EYVB 2VDKL 4HWZA 1IC4L 4RGOH 4PJ9D 5DGQA 3S8WA 3IFLH 2XPGA 4JFDE 4JJ5B 4NZJA 3W5MA 5GZOD 3PQYE 3E0GA 3RNQA 4LQFH 4Y19A 1BWMA 4UTBH 1FNFA 3VFSA 4XNYH 1BJMA 2G60H 5DFVC 5EZJA 1MVFA 3C2AH 4HWZB 4ZUSA 5I1GL 1F8TL 3FO0H 3D3VA 4IMLA 3BPLB 1ADQA 2XPGB 4J4PC 3DRQA 3O2WH 3MNWA 4K3DL 1WZMA 2QBWA 2PR4L 3RVUC 3RNQB 3PWUA 5FIEA 3OG6B 4WTZA 4HKXA 4W70A 4RA3A 3E3QE 4U7SA 4ONHA 3IKKA 3RTQD 5DUPH 1ZHNA 4WI3A 2MHAA 5EZJB 4J6RL 3WIHA 4ZUSB 4G43B 4JFPA 1CDUA 1R5VA 4MNGB 3D3VB 3PXHA 4IMLB 5IQ7H 1MNUL 4JG0L 1EHNA 3DRQB 3MNWB 5EWIL 4FS0A 1WLHA 1FFNA 3PWUB 1FLRL 4HKXB 4O2EA 4DVRL 2XXCB 3ULUF 4ONHB 1ZHNB 1ZT1A 4DN3L 2MHAB 1VADA 3S4SA 4JFPB 1NSNL 3Q6GL 4QHKJ 1R5VB 2Y06H 3VRLF 4X6DE 3ILQC 2IQ9L 4MX7A 3TF7A 2D03L 5HHMA 1TNNA 4O2EB 2GSIB 4ZFOL 4LFHD 1XCQA 1ZT1B 3IFNH 1VADB 4JZNB 4HKBA 3S4SB 3ESUF 3CDCA 2D7OA 3PDGA 4OLWL 4OZGA 2N4IA 3TZVC 3PE9A 5IVOA 2X4OA 4C83B 4MX7B 1NGPH 4PRID 3VI4F 4LOUC 5HHMB 5T3ZE 4XBPA 4NN7C 3V79C 4PJ9A 3HNVH 1IMHC 4HKBB 4RMQA 4C4KO 2X4TA 4ZOBA 1TTGA 3KAAA 2R39A 4Y16D 1G0DA 1D5ZA 1GAFH 4KRPC 3BKMH 5B38G 4MNQD 3L9RA 4HHAA 5TDOA 4U1JA 4ONFH 4S1DD 4XBPB 4X9GA 1MSPA 4HPOH 4PJ9B 4KJWC 3MMEA 1EEZA 5I66A 1CCZA 1R3LA 3UZEA 5JNYA 1D5ZB 3LKPA 4U0RB 4ZDHA 3N85L 3L9RB 4HK0A 1H15A 4HHAB 4AIXA 3A6CL 5TF0A 1HCVA 3RTQA 1KB9K 4U1JB 2V17H 1CGSL 3HMWH 4E41E 1QFOA 3MXVL 2YBRA 3MMEB 4LVNC 5ILTL 3X3GL 1LWRA 1EEZB 2M2DA 5I66B 1G6RH 3DTXA 5FGBC 3MYJA 4LAQL 1UKQA 4OLZL 2GSGA 5JNYB 3LKPB 2B4CC 4ZDHB 2EDDA 4QEGA 5CIPH 4HK0B 4FFWC 1JPSH 1P84K 1MREL 1H15B 1OAQH 3GI8L 3RTQB 3QDAA 3WKML 5IFHH 1CDHA 2SEBA 5GS2H 5CINL 5EZOH 2YBRB 3U4BL 3QEUA 1IEHA 2VSDA 3IJHA 2IG2H 3MYJB 1KGCE 2IQAA 3HB3C 2GSGB 3JTTA 2ZNXA 2BNUA 3IVKA 1A1OA 5IMMA 1NBZA 2RCSH 1JNHA 2I60H 3B9KC 2SEBB 2A1WL 3X12A 5GZND 4BQBA 2BXZA 3GSNH 3QEUB 4EOWH 2V2TA 1FLTX 4KKLC 3S88L 2IQAB 3D87B 3C6LD 1D3CA 3V6BR 4PRIA 4ZSOE 1A6VH 3JTTB 2H2PD 4QXGL 3D5OF 5EBMA 4UDTA 4PP1C 3G9AB 4O51A 3IVKB 4FFZL 1A1OB 2X1XR 5L2KD 1NBZB 1JNHB 3X12B 5FFLA 2OP4L 2V2TB 3TV3L 5JW4M 2VXQL 4Y16A 5GRVK 1F5WA 1EUUA 1I7RA 3V0VA 2NY1C 3OKEA 4MNQA 4PRIB 3VWKD 3OL2A 2WNGA 1EX0A 4UDTB 5CJ8A 4N5UA 4O51B 1OD9A 4XWGL 3ZT7A 1QYGH 1MPAH 4LL9A 3VFMA 3PWVA 4P0DA 4XPAL 4Y16B 1I7RB 3VGAC 3V0VB 3O41A 3OKEB 3NFSL 4MNQB 2G5BA 5IMKA 2ZCLL 4R8WH 4WHYH 2K1MA 2BJMH 1T2QL 1CLYL 3FQNB 4KRMB 3SGJC 5H37G 4UT6L 1YN7A 3MLVH 2FYYA 3QG6A 5FB8A 1HOCA 1W2KT 3QYCA 3L7FA 4JFHD 1RPQA 2R0LH 1QLRA 3O41B 2G5BB 5IMKB 5F9DC 5I15L 2VLRE 4O2FA 4LHJB 4YHNA 3CX2A 3M07A 2YN5A 1F97A 1YN7B 2P42B 2OMBA 2FYYB 3QG6B 4NQDD 1U91A 5FB8B 1HOCB 4NC2B 4JG1L 2V9RA 3L7FB 1NAML 2AJUH 2CR3A 4KU1A 1QLRB 1FL5B 4KFZC 3HRZA 4YHNB 4OT1L 4OD1H 2XA3A 1MUJB 3GIVA 1U91B 3VW3H 1I1YA 2AKRB 3VFRA 3C6LA 4PYGA 1O0VA 4DZBA 1FIGL 4WWKD 1RK1A 4J3SA 1KJ2H 3TEUA 5L2KA 4JO4H 2Y4SA 3U7YL 1CTOA 1DBBL 1DLFL 4XHJD 1CGVA 3GIVB 4X7TA 4IOIA 3N1GC 4AIOA 3VFRB 3C6LB 1DL7H 2JB5L 2C3GA 3VWKA 3QFJE 1A22B 4DZBB 1VESA 5L88L 3IGAA 2VDRL 1RK1B 4M93C 3VG9C 3ZDXE 5KVGL 1O7VA 5L2KB 5DJCA 7FABL 1LEGA 3JXAA 3MACH 4WRLA 3HAEA 3NCJL 4X7TB 4IOIB 3O6KL 1IC4H 5T33L 1KENH 3VWKB 5FGCB 3IGAB 2CKBH 2WMPA 5J1SC 1JYWA 1A6UL 5BVPL 5DJCB 5DJ8A 4DZ8B 1W0WA 1LEGB 4PB9L 2QJDA 3HAEB 5FOJA 4NO2A 1F8TH 1EBPA 1X6NA 4RMWA 1ZVYA 2R1YA 2UY6A 5ADPL 3SDYL 2FCBA 3GZKA 5BZWA 5IJKC 2P7TA 3BPCA 2ZUQC 5DJ8B 4AEFA 3NIGE 4NQDA 1W0WB 4JPKL 4U49A 5GRUH 3TVMD 4NO2B 3RVXD 1FGNL 2X40A 4JHZA 5GHWL 3VWJD 2AAVA 1KTDA 1HNGA 4M8QA 4XMPL 2DKUA 3SHSA 2CMRL 4HWUA 2VN7A 5DVMA 3A0OA 5ENWA 5BZWB 5ERWA 2Y6SD 1BOGA 4XCCH 5SV4A 1FO0H 4GQPH 2P7TB 3SQOH 4X8XA 3QT2A 3BPCB 3BN9C 2C1PA 4NQDB 1S3KH 4GBXC 5CJQH 1BJ1J 1V3JA 3SE8L 3I02A 4MB5A 5GGRY 4WTZG 3MBEC 4QOKE 4KDTA 4M8QB 4RGMB 5E03A 5GGSY 3BRDA 2J8UA 5D6CA 4WWKA 1AP2A 3H42H 5ENWB 1CU4L 2CO6B 1ACYH 2IQ9H 4ZG1A 2HJFA 5ERWB 3FT4B 1BOGB 2LU7A 3GMQA 3X13B 3ZE2E 3ARYA 5C0EA 3MO1A 2C1PB 3P30L 4LLUA 4NJAH 3MOQA 2I25N 3I02B 5E2UL 4GUPA 4OLWH 5C07E 3UC0L 3EBAA 1CDGA 2J8UB 3NFNA 3SKMA 4JPIA 3WXWL 1CVSC 4EXKA 2HJFB 2H26A 4ZOEA 1RZJC 3GMQB 4MXVE 5C0EB 1BIHA 3MO1B 2YWYA 3Q6FA 4UAOC 4LLUB 1SEQL 3CXHJ 5T3XE 3BRGC 3R1GL 1C1EL 2WIMA 4GUPB 5T5NF 2ITDA 3HFML 3NFNB 3SKMB 2AEPL 3RGVD 3ARSA 1QHOA 2H26B 3MCLH 4HS3A 5F97E 1H8NA 2HWZL 3IJYA 3ABZA 2BNQD 1JGUL 3Q6FB 3F58H 1U8HB 3WNLA 5KVFL 1FNLA 3C08H 5HY9A 2ITDB 3VGFA 3VCLA 2J6EA 1PG7H 2Y72A 4M5ZL 3OTTA 5CZKA 4HS3B 4WW2C 5BXFA 5ICXA 3IJYB 1ORQA 1Y6MR 1AO7D 3TVMA 1LO4H 1CYGA 3VWJA 5F7MC 4B0MM 5HY9B 4LAQH 3A6BH 4WI5A 2FR4A 1DBJL 3VCLB 1FGVL 4GXVL 5AZEH 1RIVH 3I50L 5BXFB 3MRIB 5ICXB 1LK2A 1K4DA 1ORQB 1F42A 3TVMB 3VWJB 3INUH 5CINH 2XZCH 4M5YL 1EA9C 4YHPA 5DD6A 5I18L 4NM8H 4OIAA 3JUZA 2FR4B 1HQRB 4OM1H 1HIMH 1BQUA 3NIDE 3P40A 1LK2B 1K4DB 2P47B 3ZKXB 2A1WH 4PRBA 1A14H 3QXUA 5J3HD 1RJZA 4GW1A 5DD6B 1INQA 1L7TL 4TPRL 5EOQH 2GK2A 4ZUTA 4PDCE 4NZRL 5KOMC 1R0AH 4QXGH 3PWPE 4LLMA 1T5WA 3H9SE 3IRZA 4JCMA 4JHBA 4M4RA 2NXYD 2WQRA 2CJUL 1RIUL 4PRBB 1N64H 4X99A 1RJZB 1RZGB 2MMXA 1X5KA 3EO9L 4GW1B 4YEEA 5AG9A 3RGVA 5B21A 1INQB 3HNTL 4ZUTB 1IAOA 2BNQA 4I48A 4YBQD 1T5WB 3U7AA 2BFVL 3S6CA 4LRIC 4PGZA 3UTTD 1AD0A 4LVEA 4G80A 2VERN 1RURH 4QXWA 2QEJA 3R4DA 4LASH 3ZT5A 1KUMA 1UA6L 1WFNA 4QT5A 2EIZA 5IW3A 3RGVB 4EBQL 1PKQB 4IBLT 4IRJC 4X8JA 1IAOB 4ZD3L 1VGKA 1UB6A 3CFBA 2VTFA 2BNQB 4I48B 3T0DA 5CBAA 2NW2A 1AO7A 4HT1L 1T2QH 5LGJA 1AD0B 4ODUA 2NY7L 4WV1A 4IDLA 5L8KB 5TQ0H 4QT5B 4JZJB 1AHWA 4YHIA 2MOVA 1BX2A 4NOFA 5DR5L 4X8JB 4W68A 5A43C 1VGKB 1UB6B 3CFBB 2WV3A 2ICWI 1R24A 1AC6A 2WP3O 2A9NH 5CBAB 2NW2B 1AO7B 5CZXD 3FAWA 5LGJB 4OJFH 4ODUB 3TBYA 1QUNA 4WV1B 4BZ2L 4TSBH 1OPGH 3FMGL 2E7LA 1CS6A 2LV4A 1KC5H 1RULL 3GM8A 4WIQA 2J88L 1AHWB 4YHIB 1BX2B 3GHBH 4M6NL 4U6XA 5EH1A 1R24B 5FYLD 1MCPH 1MFBL 3TBYB 2EIEA 1Z3GH 3V0AC 3MLZL 2DDQL 4RRPA 2CRIA 5BOPA 3PWNA 4LSDA 3U0TA 3V5DA 3MNZB 1QSZA 2XWTA 2H41A 5I2IA 4OZIA 4JO3H 3NA4A 4L3ED 3F7QA 3MLRH 4MA8L 1S7QB 4YE4L 2APTA 2WIIA 3GJFH 1M6OA 1VEOA 4R0LA 4BELD 4KHXH 2H45A 2X4UA 3PWNB 3U0TB 1YUHB 3V5DB 4WGWB 4KPHL 4U7MA 5D2NE 2XWTB 5EN2A 4OF5A 3B43A 3WLWC 5I2IB 4OZIB 4KXZI 3H3KA 2Q86A 2CUMA 3UTTA 2NXYB 5ACZA 5ABDE 1RUKH 3KLHD 1MCDA 2WIIB 4PG2A 2Y07L 3NCJH 3ME0A 3C60C 3MODL 1M6OB 1WK0A 1SM3L 4R0LB 1IAII 2X4UB 5FM8A 5T1KD 1U8NA 5EN2B 2R29L 4H1LA 3DETC 1UCBH 5BVPH 5K9JL 2Q86B 3UTTB 5ACZB 5IKCA 1ZHKA 1HWHB 1JFMA 3O4OB 4J3UA 2FATL 4G8GE 5B4MD 4OUUA 4BSVA 4Z7WE 2DQJL 1NKRA 4IRSD 3RNKA 3ARBD 3HAEG 4HLJA 4JFFD 5IIEB 4H1LB 3E2HC 1RD6A 3GSWA 4N90E 5IKCB 1ZHKB 3THML 5T5NG 1KB9J 3MRMA 4DUXA 3DGGA 1F90L 1JPTL 1IL1B 1FGNH 2CUIA 4PRHE 5E5MA 2VKXA 3P11L 5CEZL 4OUUB 4BSVB 1WEJH 2FH6A 2VO5A 4HC1L 5HDOA 5E0QA 4ISVA 3RNKB 2JE8A 1WISA 3SKUD 1JBJA 2OTPA 3BGAA 2FX9H 3GSWB 1MFAH 4ELME 2Z0BA 1H3PH 3QISA 1T6VN 1W72A 2BNRD 3MRMB 1L6XA 4M1CC 4P5TC 1GGBH 3DGGB 2Y1VA 4PJAA 5DQJB 5E5MB 4MQSB 1F3JA 1KNOA 1DFBH 2WINA 4AG4H 2B0SL 3WNMA 5LGHH 3P0VL 1S5IH 4ISVB 4U7KA 1B90A 2VB5A 4GQ9L 4OZIF 4Q0XL 4L3EA 2R8SL 3QIBD 3WE6A 3VD7A 1OGAE 5DD5L 3KJ4C 4OGZA 3P30H 1U8MA 1W72B 4WEUD 1LO0H 2ESVE 1A1MA 1PG7W 4KAQH 4RMVA 3RU8H 4HXAL 4MDIA 5E2UH 3JWOH 4PJAB 1F3JB 1KNOB 2WINB 3QPXL 3WXWH 1KLUA 3KYKL 3SDAC 4R4NC 4B7IA 1VPOH 4L3EB 4XP9L 3WE6B 3BGMA 3MV7D 3MYZA 4DKFL 1A1MB 4M7ZB 4H88H 4JKKA 5TDNA 4MDIB 2RAMA 1KEML 5T1KA 3TNMA 1KLUB 4IJ3C 4N1HB 3CXDL 3MFFA 3VJ6A 1ZA6A 3VXSD 2DQGL 4MJIE 4EUPB 2G9HA 2AQ1A 5TFSL 2HWZH 2R4SH 3TN0D 5SX5H 4J1UA 4HGKC 4CVXA 3NPSB 5I74B 2APWA 5KVFH 1N6VA 3RA7H 5TDNB 1BQLL 1NCDH 5INDA 4U05A 4IRSA 3W82A 3ARBA 2ICEA 4NCC1 1GXEA 3HUJE 4JFFA 5T1KB 3TNMB 2Q87A 4HAFA 3MFFB 4M5ZH 3VJ6B 1ZA6B 5TGBA 2F15A 5TPWL 2G9HB 4XP1H 2IH1A 4R6UA 4Y7MA 5HVHB 4J1UB 3TT3H 3T0BA 4CVXB 2HMIC 4GG6A 3QI9C 1YMHA 3H3PH 2YSSA 2H32A 4HIJA 3B2VH 3OAUH 5INDB 1R3IL 3DUSA 4LLDA 4IRSB 5F9AC 2R2HA 2ICEB 3ARBB 4JFFB 1INEL 1HK6A 1K85A 3LDBC 1HINL 5TGBB 4WCYL 1ZANH 5A2LH 2IH1B 4I9WD 2BNRA 3WO4C 2FJFA 4K3JL 4GG6B 3QCVH 4JB9L 1YMHB 3LCYA 2YSSB 5BO1L 2H32B 1EO8H 4HIJB 4L4VD 3DYOA 3JWOC 3DUSB 1NMBH 4LLDB 3C5ZC 4RGND 2F19H 5JHDE 2R2HB 3N9GH 1EGJL 5I1HL 4LCUA 3QIBA 3UBXG 3ULSA 5HHPA 5FK9A 4XNZC 1TCMA 2BNRB 4C55A 2FJFB 4WI6A 4A6YA 2H2SD 1UC6A 3QQ9D 2OR9L 4KK9D 1RZKC 3IU3A 4ZPVA 3G5ZA 5HVFB 2V2XA 3QIWD 5FECA 3BSZL 2VWEE 3QIBB 5HGDA 3NAAH 4FXKA 3UCRA 4P59H 5HHPB 2VLKE 3ULSB 3MV7A 4NKOA 3D85D 4U6HA 5F9OL 4A6YB 1D5BB 3O4LD 4EZMA 2UV3A 3IU3B 4ZPVB 3G5ZB 4CU8A 2V2XB 1EO5A 5DO2D 2HLAA 5FECB 5IWLC 4MAUL 4PJIA 2YD6A 1EJOL 3VXSA 1NBVH 2ZUYA 4FXKB 5HGDB 3TN0A 4QTIL 4QYOA 3LKSA 4GJTB 3MV7B 1OVZA 4NKOB 1FG9C 4U6HB 4L8CA 2APFA 4X6CA 2AK1L 4LSUL 2CRZA 1P9MA 4HXBH 1CDBA 5A2FA 2HLAB 5ITBL 4D94A 2LAGB 4PJIB 3VXSB 4ZFGL 1CL7I 5I8OL 5CSBA 3Q48A 4QYOB 4OQTH 3ILPA 3LKSB 3TN0B 3WFZA 2XTJD 3FFCE 4PS4L 4L8CB 1OP3K 4GG6F 3R8BB 3WEXA 4X83A 2ZUTA 4X6CB 2NY7H 3CSBA 3O11A 1VFMA 4OFVA 4LLVB 1MAML 2DLHA 5E08L 5HGBA 1S7SA 2DWEA 2FSEA 2Z31D 5C9KA 3LEVH 3TBSA 3ILPB 4KZDL 1Z6JT 3DPBA 4HKZA 5LCVH 5FKAA 1F00I 4CU7A 3K4AA 4JKLA 1PLGL 4TVPE 5HI5C 3RIFF 3O11B 4L4VA 5L0QB 1J87A 1ND0A 3HE7C 4KJQD 2BDNH 4CN4A 5ISZD 1MIEL 4M7KL 1OARH 5HGBB 1S7SB 2DWEB 1QSED 2B2XL 2FSEB 1A64A 3VFPA 3TBSB 4HS8L 3NIFE 4N5ED 3VE0A 4HKZB 1T7YA 5FKAB 2F53E 1QTYT 1MRCH 1CLOL 4L4VB 4O4YH 1ND0B 3QIWA 4RGNB 1F4AA 2VUYA 3KDMB 1IGIL 2DDQH 2A6KA 3MLZH 4HJGA 5TE4H 5TDPA 3D85A 4LNVA 1UGNA 3VE0B 5JDSA 5E4EB 3QBTB 4RIRA 3QULB 2XIDA 3O4LA 4MA8H 1PY4A 5F71A 2CUHA 2R0WL 3LAFA 1UB5A 1H3GA 1KV3A 3QIWB 3G6JE 1GCFA 4QNPF 4HJGB 2RJMA 3KLSA 4GSDL 5D1ZC 3WJJA 4GRWH 5TDPB 3UJJH 3D85B 2P5ED 2P4AB 5JDSB 4RIRB 2R9HD 1C5BH 1K5NA 4HUNB 3O4LB 4ODSL 4YXKH 4K3EH 5E99L 4LSTH 1UB5B 3MODH 1JPFA 4O00A 1KB5L 5D6DC 2R29H 3GSOA 1J8HD 3RVTC 4JQVA 1K5NB 1NGZA 2CPCA 3HE6D 3RDTD 2WK2A 2XY1A 4NO5A 4K7FA 2Z31A 5F1SA 4EN3D 1IEBA 5DMJB 3S36L 4L3CA 5DK3A 3ZTJG 2DLEA 2XTJB 4NQEE 3GSOB 3PUCA 4X5WA 4HWBL 3WFEL 3THMH 1NGZB 2L7UA 1K8IB 3UTPE 4GKNA 1H9VA 4NO5B 5ISZA 4D0CA 4K7FB 2Z31B 1QSEA 3CIQA 1YNKH 4HC1H 3D2UD 4OCYL 3VDBA 4L3CB 4N5EA 2G2RA 2YPLD 4X5WB 4KMTL 1RZ8A 5D70L 3QFDA 4I8DA 4GKNB 1TQBB 4R90H 2VN4A 4UUJA 1HSAA 5ISZB 4D0CB 1KEGL 3ZHLA 2AQ2A 3B9AA 1QSEB 5F9WB 1RZIA 1X5LA 2R2CA 4PBVC 3VFUA 2G2RB 2VDNH 4XP4H 1RZ8B 1AE6H 4IOFD 3QFDB 3PGFL 1SMOA 4UUJB 1HSAB 2AXHA 1RZIB 1ZWIB 1XT5A 2P5EA 4QHUA 3ARGC 5L6YL 4YFEA 3VFUB 3P77A 1PEZA 1S9WA 4XXDA 5F96H 3UJIL 4DN4L 3ULUL 2A77H 2NZ9C 1I8MA 3ULVD 1OF2A 4WUKL 3LMJH 2BVUA 2P5EB 1BIIA 4QHUB 1JGLL 1JP5A 3WFBL 1J8HA 3O9WC 3P77B 4UOW1 1S9WB 3HE6A 3LN9A 4XXDB 1I8MB 3RDTA 4AH2A 2GJZA 2C5DC 1B2WL 1OF2B 4EUPG 1FH5H 1BQLH 4K7PH 1NH6A 4EN3A 3QB7C 1YN6A 3X14A 3MV9D 3V5HB 5EZIL 3MJGX 1MCSA 3EFDL 4Y5YC 1KIRA 1DEEA 1BIIB 3M8OH 4P46D 4TSAH 1CR9H 1T0NB 4FQJL 1J8HB 3HZKB 1X5XA 3HE6B 4OV6F 2RFXA 5F7DA 3RDTB 4AH2B 2GJZB 3OR6B 5F9JA 1RFDH 1FBIL 1EHLH 2IBGA 3AFLA 4FFVC 4HJJL 4EN3B 1YN6B 3D2UA 3X14B 4PJ8C 1ZLUH 3WN5C 5FEBA 1INEH 4PGCB 4LU5L 1KIRB 1DEEB 1FRGH 2YPLA 4HUVA 4M00A 3HMXH 5DGRA 1OAUH 1J1XL 2RFXB 2FIRT 5F7DB 4ZTOH 4K3JH 3T0EC 2B7DT 4M61A 5D7SL 5F9JB 3FB8A 3D2UB 1ADQL 5F1IA 2WBJD 1M4KA 4OCLC 1UQSA 4YX2H 4XVSL 2YPLB 3HG1E 4HUVB 1RQ5A 1BBDH 4KTYA 4FQXD 1Z0MA 1NGYA 4PV9A 4M61B 3LS4L 5F1IB 2PTVA 5BV7B 1HILA 2JK5A 2NTFB 3BSZH 3G04A 4PJHA 9CGTA 5CBEA 1UQSB 2V5YA 3RZCD 5AWNH 2GY5A 4YFLF 3HCVA 5CGYD 4P23D 5D2LE 1HCFX 2VMFA 1UFUA 3GGWA 1JE6A 5FYJD 1TVHA 2OR8A 1NGYB 4PV9B 3T8XA 2APBA 4PRPB 4WFGE 1EO7A 4S0TD 4BK5A 2JLLA 2X4RA 3ALWA 3O6FC 3RBGA 1HILB 2JK5B 3FL7A 3JSSA 4HKJA 3G04B 4PJHB 1YQ2A 3JTSB 2IAMC 3ALPA 4NKIH