1JHTA

Crystal structure of hla-a2*0201 in complex with a nonameric altered peptide ligand (algigiltv) from the mart-1/melan-a.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Crystal structures of two closely related but antigenically distinct HLA-A2/melanocyte-melanoma tumor-antigen peptide complexes.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 273
sequence length 275
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jhtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jhtA01
2X1PA 3NIFE 3NIGE 4KTEH 4IBLT 1RZ8B 1IGIL 4R4BB 5C6PB 1CGUA 2DQJH 4PV8A 2R9HC 3GKWH 5KSBE 5CINH 1YN7A 1QPXA 2JELL 3GIZL 3S88H 1FFOA 2DYPB 3I9GL 5ALBL 1ZT7A 4Z8FL 1U0QA 2XY2A 3FO2B 4IRSD 1KFAL 5JNYB 1AGFB 3QWQB 4ENEC 4TPRL 1JV5B 5BZWA 2MJWA 1DQJA 1GHFH 3TYGH 5ICXB 1PLGH 4HH9B 2EDFA 3QDMA 4N5EC 5IVNA 5DJDA 1INDL 2ARJB 1BBJA 2XG5A 5DMGD 2MHAA 4W70A 4M7JL 4U0QB 2Y5TA 4APQD 2QQNH 3PL6B 4WNQB 3U4BL 4LCUA 3W11C 3PXJA 4LLWB 1EO8L 3AM8C 4DAGH 1FFQA 4KUZH 4I3GA 3L1OH 2AJVH 1DL7H 3R06B 3ZT7A 1FZMA 1OB1A 1IC4H 3FO0H 3O4LB 4TRPH 4P2OC 4PJGB 2F58L 4C83B 3DGGA 4GW1B 4ODSL 3I50H 3G5YB 1NAMB 5E5MB 3RGVA 3AU1A 1YMMA 4GFTB 2BRRL 5I9QC 3ZE2F 5HVGB 5MERB 3T1FB 4I0PB 5CJOH 5D6CB 3IETB 1K5NA 4ZD3L 4MNGA 3S34H 1AGEA 3K2UL 4RWYL 1QFWM 4X9FA 3A6BL 1BBDH 2BVTA 1S9YB 3WYRA 4NKOA 1NMAL 1A6WH 1S9XB 3BH9B 3QHTC 5IVXE 4EQ3A 5I16A 1N4XL 4XVJH 2W9DL 1YEGL 1IAIM 2AV1A 4P2RB 4RX4D 2EDQA 3LAFA 4FXKB 2BSSB 3Q5TA 3L5XL 2E7LC 2WBJB 1RZJH 5JA8B 1HN1A 1DQMH 4PGDB 1BFOA 1BVKB 1OGTB 2XPGB 1UM5L 4LSRL 1NH6A 2FSEB 4X6CA 2D7TL 4QHNB 1X6LA 1CVSC 1KPUB 4GT7A 3P4OB 3G5XA 4HJJL 3WLBA 1N5YL 4WCYH 2DQIL 1OAZL 4KRPB 1ZANH 3IU4L 1MCFA 3Q1SH 5HDQH 4JFOB 1QPPA 4AH2B 1I7UA 1QFOA 4NQEE 4JFFE 5CWSB 4LIQL 2AK4B 1KT2A 4FTVD 4NCC2 2FECI 1N0LA 3FN3A 4J4PA 4XRCA 2XZZA 4J1UA 1OGAE 4B0MM 1F8TH 4HUKB 4OFVA 1FGNL 3CLEH 4PJEE 3BRDA 1LO2H 4FQLH 3FRPA 3MRPB 5FA3B 1MCOL 4P2QB 5FYKL 4ETYA 2OJEB 3QUKB 4NDMA 4GG8A 5E6IB 3HPJA 4F37F 1WAAA 3V6FB 5EU6E 3ME0A 1U92A 4PJXF 4J3UA 1U8KB 1DQQB 3WKML 5CEXA 3DX8B 2W60A 3QNXA 4JO1L 4N9GA 15C8H 1FFNA 3MLYL 1WLHA 2OK0L 3ZTNH 4OZHE 5TFSH 2R69H 1RZKL 4L4TE 4LPCA 4RDQG 1O5DT 2YPLD 4N68A 1X3DA 5M7QA 2FEDC 4S1RH 1FFRA 3FMGH 1U8HB 4YC2B 3MUGB 4N0FB 3CGTA 1BIIA 1D3CA 4P5KB 3WEXA 5J6GA 5DZNA 4EUPA 4OSUL 3JV6B 5D7LB 2D03L 4M3JA 3OR7A 4R0LA 2Q8AH 4UV4H 4DFHA 1H15B 4M4PA 4WTWA 3X13B 3RWDA 4OCRL 3GNMH 3UCRA 5F7DA 3HNTL 4XNUL 1A9BA 3F12A 1JPTH 2RAMA 1MCSA 1MSPA 1E27A 3KPNB 1BPVA 4AZ8A 1QLEH 4F7EA 4H8WH 5IMOB 5J57B 3NFPA 3VFNA 3I3DA 4KRMB 4JR9L 5GXBB 1KLGB 1ZLUH 4LCWA 3MCLH 5C0GA 5BVPH 3HE6D 3GMNA 4KJPD 3VXTB 1XR9B 1KJ3L 1J0IA 2F53A 4I9WE 3RY6C 4PRNB 4BZ2L 5KTEH 3DXAB 2KPNA 4ISVA 4JDTH 4H20L 4I3SH 2OMNA 2VERN 4WHDA 4F9PC 5HHVL 5IBLD 1MCLA 4L4VA 4N8VA 1UH2A 5DUPL 3TEUA 4NN5C 4JO4L 3H0TA 5T1KA 4DEPC 3WO4B 4Y19D 3MRDA 1QLFA 2QR0B 5EIIB 1TZHA 5MEQB 1MAML 2R8SL 5JO5B 1CBVH 5CGMA 4UAOB 1JGVL 1NCWH 4UQ2A 3CDFA 3VFMB 2AERT 2VQ1B 4LOUD 4X6EA 4NZUL 2EC9U 4Y16D 4BSVB 1OY3B 4I13B 1EEYB 2NCMA 4WI7A 1KG0A 2A83B 1LDPH 3O6FD 3CVHL 4R2GD 2KQNA 5BQ7B 1UACL 4NRZB 3ULVF 2D9QB 3SKJH 5CBEB 2MQCA 3NIDE 1MF2L 1XZ0B 1T80A 5IV2A 4DN4L 5IW1A 1I4FB 5DJ8B 1DLFH 3O6LH 4NC2B 2UYLA 1F13A 4LCCC 4GRMA 4YWGL 4Z76B 2M2DA 4RFEA 2BNQD 5D70L 5C6WH 4PLJD 4P46D 1RZIA 5DTFA 2EEAA 1A6UL 4QCIB 3EDEA 4NQCA 1Z6JT 3OKKB 1JHLL 1L7TL 1RVFL 2Y36L 3WL9A 3B3IB 1FLTX 3NCMA 3ZMRA 2P5ED 1MOEA 3MR9A 2Y7QB 4X4MA 4UB0H 3EOBB 4PG2A 4ZS6D 5IOPB 5GZND 4F2MB 1NEZA 2KZWA 4HPYH 3FFCD 1HHGA 1FL3A 5IUSA 5DGRA 1RK1A 4I4WB 4PJ5D 2DQDL 2GHWB 4M6NL 4PR5A 1Q8MA 1QYGH 5C9JA 2W07A 3PP4L 4Z7WF 1BD2A 4G9FD 1JGLL 3WDJA 2PXYD 2EH7H 5GRZA 1MCIA 5ISZD 4AYFA 2XRAL 2VO5A 3BXNB 4PJAF 4RRPA 2GTWA 4EDXB 3T8XA 1Z5LA 3QEQE 1M7IA 3ULUD 5DMJB 1OAUL 4WVRA 5E2TH 2D4DA 5GHWL 4HEME 3BOVA 2KQMA 2R56L 4JREB 4JRYA 1RJYA 2NXYB 5JIIA 2QSTA 1A2YB 3S4SB 4PJ8C 4FZEH 2NY2B 1YQVH 3N1FC 3TBYB 4XH2A 5IF0A 3BO8B 3LRHA 3QIUB 4NFBA 5D71L 5TQ0H 4O4YH 2WIMA 5LGKA 3U0WL 2PYEB 1QA9B 2J8UF 2H2PD 3QQ4B 2E5EA 4CJ0A 2I25N 3SBWC 3UO1H 2VDLL 5KVEL 2VDML 3CVIL 3L3DA 5DRNB 2B1AL 1CFQA 1CIUA 1LO4H 2QSCL 3RDTC 3VXRE 5HHQB 1HI6A 4NQVA 1D5ZB 3D1MC 3S7GA 4GRLC 4ODWA 4CVXB 4JRWA 3DVGB 1HWGB 2ZSVB 1RZ7H 1BF8A 5HI5C 1HKLL 1IGFH 5SX5H 4I2XE 4G6JL 2BSTB 3QUXC 4AEFA 3QWOA 5D7IE 3NN8A 1N0XL 4UOW1 4C58B 4ZOCA 2EE6A 4FN0A 3TCLB 1T3FA 1TVBA 4OF7A 5JXED 4GG6A 4PGJA 1RD6A 1DANT 4L8SC 5HSFA 1C5CH 1RUKH 4XHJD 2E27H 1MFCH 3IDIA 3LS4H 1FIEA 2JJUA 1E4XH 1T0PB 4HMCA 2Y4SA 1NFDA 3O2VH 2DDQH 4JY6B 1UWGL 2HFEB 5MEND 4QOKB 5F7FA 4RGND 3VGFA 3LN4A 4D9LL 1QFWL 4WUKH 4E0RA 1MIML 4AQOA 1UJ3C 2YPKA 4LBEA 3GRWH 1CFBA 4LLYA 5SWQB 1EGJH 3QYCA 4UTAH 4QRPB 5HYJA 1IAIL 4JFQA 4W4OA 3VFTB 4HKBA 4L3CA 1MFBH 5IK3A 1EXUB 3W5MA 5BS0D 1JJUA 3L3IB 1MCPL 4D0DB 5ETUB 1R3KB 1HXYA 4X7EC 5BV7L 4F57L 1EV2E 1CICD 1QFHA 1YYMH 3QBTB 1BWWA 2J8HA 1OOAA 1YJDH 1C5BL 4X6CF 2VLRB 4IRSA 5I8OL 1JFMA 3C60B 3MOQA 4JZOA 2E6JA 5C3TA 5IJKC 3O8XB 1B3JA 3EOTH 3IKKA 1WBXA 5K9KA 4PUBH 4APQA 4KJQC 3BKJH 3FQWA 4PB0H 1CL7L 4XNQB 4R96B 2E9JA 1N26A 1QSFA 1RIUH 4IJ3C 1IZJA 3UYOD 4M5ZH 3IAPA 4W4NA 3TBTB 5FKPA 3GBNH 2B2XH 4TQEH 3TVMC 2AXFA 1GAFL 3BEVA 3HG1E 2EDRA 4OZIE 2B20A 1NC4D 4UT6L 4RAUA 2P8LB 1WAAF 1J7VR 4J8RB 1K8IB 3QUZC 3ARZA 2ORBH 2J88L 1EBAA 3FRUB 4K94L 4AIZB 2Q6WA 3WFEH 5MEPA 1NAMH 3QEHA 1VFAA 5GGRY 4M8VA 1JL8A 2JJTC 2JB6B 4RMQA 1X7QA 4HWUA 1ODAA 1EHAA 2V7NB 3IFPB 3BPNB 3KLAB 3G04B 5SWZD 1K4CA 3ARBB 3WMSA 5I66B 5A2FA 4LVNB 5F9AC 4ZODA 5IMLB 3KPPA 2EXYC 1T7XA 2EDEA 3FONB 4P59H 5FEBA 1B6DA 4JFDB 3MLUH 5DEGB 1BQHA 3BW9A 4NM8L 2BVEA 4M02A 2DIAA 3MRRB 5DD6B 4YHZL 3HRZB 4GAJL 4HH8A 3E3QC 4BJLA 3CXDL 1IEAA 4XNMA 4ZPTB 1RI8A 3W39B 3HMWL 3VXQB 4Z77A 3QISA 1Q9KB 4K9EH 1F2XK 4O2CB 3IJHA 3BWAA 4X7DC 5D1QB 4BH8B 3LV3A 3C5ZB 2R23B 4HPOL 3LOWA 3OKLB 3DOSA 5D8JH 1KN2H 1ZEAL 5DEFA 4WJ5A 1AKJD 4YQXL 3U9UB 1H5BB 1U3HB 2HRLA 2YC1A 4NT6A 4DUVA 1WICA 4X6FA 3MRHB 5IIEB 2HT3C 1F4XL 4JHWL 1ZHLA 4R6UA 1S7WA 1P7KB 3QIWC 5HHMD 1A6TA 1FZOB 5C6TH 2CKBA 3QEUA 4OCSH 2Z31C 4HQQL 1H8OA 1P1ZA 4RAVB 2A9NH 2XTJC 3KNBB 3KYAA 5I19H 2PCPB 3TF7C 1N64H 4WW2B 3HZVB 5IFJA 5IESH 4YZFE 5A3IC 5IBUB 3UTOA 4ODBD 35C8L 1KJVB 5CJ8A 4IRZH 2GKIA 2BSED 3MBEB 3MLVL 1NCDH 1Z3GH 1FPTL 1T1XA 1XGYL 5CCKL 3G6JE 4WEBL 5ITFB 3TT1L 1X5AA 2BMKA 1D5MA 3VXSB 4NO5B 3EKCA 3V6BR 4XMKH 1BGXL 3NA9L 2WK2A 4FQ2L 2F5BH 3BZFA 4PGCB 3MBXL 4NO3B 1IFHL 3G08B 3EYUH 1WIUA 3N9GL 4M43H 4OV5B 1CS6A 2OMBA 4NQTA 9CGTA 4UIKH 5L0QC 2J7LA 1OCWL 5DJAA 4HFWB 4QF1B 4F7CB 3GSRA 3B83A 3T4YB 1EO7A 1YN6A 4KROC 3OKDB 1SQ2N 1U95B 1Q94A 3WN5C 3PABA 3M45A 1TCRA 4XP5H 4PBVC 2OZ4L 3SE8H 3U36B 4JO2L 4WFED 1R3IL 4YH6A 3EGSA 4OQTL 3AREC 4KI5F 3HE6A 5E9DE 1EEZA 1RK0B 3STLB 1A7NL 2AJ3B 5I2IA 3VI3E 2Z8VC 4C56B 2FGZA 3EDKA 1CDBA 1BLNA 2VIRB 3BIBX 1CLOH 3RWJB 1EEQA 4LSSH 4JPVL 4RZCA 3IJSB 2Q87A 2YZ8A 3BN9C 4PRHB 4PJ9B 4KDVA 4LSTH 4Y5VB 1D6EB 1CK0L 2FR4A 5HJ3A 3TWCL 5HYSA 3LEVL 1A7RL 4KJWC 4WENB 1I3GH 5E8NA 3D69A 1WSST 4F37K 5FECB 3F65A 4MA1C 1WV7T 2LE9A 1VFBB 2CUMA 5JORA 3WJLC 1IEBA 1XF3B 1XGRA 4TTDD 1N2RB 4Y1AA 1DSFH 2WINA 1NANH 3TFKD 4G8GD 3PWVB 2WUBL 4OCMC 4YHYB 2CLVB 1QHPA 5H8DA 3WD5H 5I1IL 1L9MA 4WHTB 1H9VA 3O81A 2B0SH 2VRAA 4M1DL 5KS9E 3O3AA 4HHAB 4BUHA 1NMBL 1IM9D 3P9LB 3C6SA 2E7HA 4QXGH 4RBPH 1OP9A 4E5XA 3O6FA 3GSUB 2J6EH 2VLJE 2YA1A 3X3FL 4XWOD 1XGUB 3WUZA 4P9HL 4YDKL 3C09C 5EOCH 3IDJB 1Y6MR 1SBBA 3W2DH 3E6HB 2OM5A 1DN0A 4P46A 1TVHA 1HYRC 3BPLB 4XPFL 4OM0H 1PG7W 1X5ZA 1EFXD 2BX5A 2G5BA 1II4E 3OKNA 4LPVA 5LGHL 1U58A 3UBXA 4U33A 2VB5A 3RBGA 1NDGA 1KGCE 5ID0B 5D96C 2C1PA 3VWJD 4WTXA 4CL7A 3PNWA 4XCYB 4FQPA 1G9NC 2MQ0A 1H3PH 3OGCB 1S9WB 5FB8B 3GM8A 4EQ2A 1IAOA 4LRIC 4WU5B 3RY4A 4PJ5A 3CFJA 2A1WL 3F7YA 3CAFA 4OIAA 4BFEA 5CGYD 4GAFB 5ADPH 1ZLSH 4PP1D 2L7UA 2R1WB 2AK1L 4QHUB 4YHLL 4JB9L 4GG6F 1MY5A 3PDOA 3VFGH 1INEL 1FBIL 4FQHA 3PWPE 4QEGA 3VFVB 1FH5L 5DDHB 5EZOL 4K3EL 2ICWA 1VHPA 5ISZA 3VWKD 4Y8DC 4YXHL 2F74B 4QLRA 3KAAA 5MEOB 3EFDL 5D1ZC 2MSPA 5ERWA 2DL2A 2Z4QA 3KPLB 4M1GL 1NFDF 1CFVL 1VDGA 5EC1A 3B9KA 3MLSL 2QLVB 5JW3H 1FZJA 2YBRA 3BSZH 5DRWB 2VISA 3NBNA 2PO6C 5AYQA 4I5BB 2ZOKA 1W0YT 5FGCE 1WIPA 2I24N 3MA9H 5DQDL 1NBVL 1NGWB 2P5WE 4U1KB 4ZUVB 4ZSOA 1FNSL 1XR8B 32C2A 4JVWA 5HHOB 2R2EA 4QGTA 4XVSL 1MJ8L 1LQVA 4HKXB 2VAJA 3LY6A 2CDFA 4U2ZA 2YMXL 2GTZB 1AR1C 1MQKL 2ZJSH 4LMQE 2GI7A 1RJLB 5EC2A 3VH8G 2CLZA 4MAYA 3ZKSD 4HXAL 2Y07H 3NCBB 3GK8L 3KXFD 3RDTB 4WI3A 1FSKB 2Q20A 3RJQB 1UWXK 5FO9B 3O11B 5EA0L 3FQUB 7CGTA 1A3RH 1EDQA 1HZHH 4LFHG 4NPYB 4IDJL 4YDJA 4JPKH 1M05B 4ZOAA 1PEWA 5DA0B 5JDSA 1DBBL 5F70A 4LP4A 1TJGL 4PP2B 1U6AH 2AEPH 1V05A 3I75B 3WIIH 1UCBL 5TE6L 1C12B 3IKCA 1OARH 3TC9A 4KHXH 5JXEA 5CAYB 1KIRB 3RPKA 5IT2H 1A6ZB 3N0PB 3WE6A 1JZ7A 1I7ZB 4L3EB 1S7UA 2WQ8A 4TSBH 1OAKL 2YK1L 3DVNB 1JGUL 1VEMA 3C5SB 1KCGC 3PJSA 3RVXC 4IIQA 1GGTA 5I17A 1RIVL 5J11C 3X3GH 2NW3A 5D1XC 3WNMA 4Y88A 2GJ6D 5FCUH 5H2BA 5MENA 3VW3H 4ZDHB 2Y5EA 2GEEA 3OPZL 3W82A 4MD5B 3IVKB 1T5WA 1I8IA 3FT2B 3ARGD 5I0DA 1CFSA 1JTPA 3LHPH 2X05A 3ES6A 4TVSa 5ABDE 4TUOA 4MD0A 4P4KA 2C26A 2A73A 4M6OL 4HWEL 4PJHF 1KB5A 3HMXA 4GXVH 3MA7A 4XMPL 1CDHA 1SJEA 4YNYB 5HDBF 4KVNL 2ADGB 3FTGA 4HUXA 3BDYL 5KSAB 1FL5B 1I8KA 1RQ5A 1ZLVH 3SQOL 4GSDH 1U42A 4GAGL 4Q9QH 3ARDC 4OFIA 2ICEA 3MCKB 5D7JC 1CICA 2Q86A 1QSED 5JHDE 2CMRL 3MXWH 3GBMH 1S9VA 2XY1A 4L8CA 3CUPB 1AGCB 4U6TA 3O3EB 1WZ1H 3L3KA 3C8KA 2NY6B 2F54A 3HZYB 1OSPL 2JIXB 3FAWA 1RU9L 1CXHA 3GGWB 1HH6A 4JDVA 2YD5A 4KDTC 3BP6B 1J0ZA 4N8CH 1MNUH 3QCUH 4N0YL 2FIKB 1WUNT 3NOIA 1I3UA 1LE5B 4O9HL 4EXKA 1FAIL 3DI3B 3QUYA 3ZKQD 3HI6H 4LFHD 1AXSB 1U8OA 1ORQB 1Z9MA 3DX7A 1OF2A 5HI3D 4OZGB 3SDAA 4NOFA 4HBCH 1KCRH 2VDQL 1T66C 4BZ1H 3BGFC 3H7LA 1I7RB 5FYKD 5I1CH 5HDLA 4Z6AT 1IAKB 3KPQB 3KWWB 5SV4A 1AHWC 2OTUA 4V1DE 5C0AB 1ZVYA 1F42A 4G3YL 4OAWB 4RNRA 1BQLH 5EU3A 4OF3A 3VRIA 1LEKA 2R0ZL 5DJ6B 2JKXA 2CR6A 4YFEA 3T0DA 3B5GA 5JW5B 5T1DL 1S7RA 5BOZG 1G7LA 4X4XB 4ZUTA 3PWJA 3HNVH 4QRRB 1UXSB 3HB3C 4MVBD 3SO5A 1NCAL 2BDNH 2EDJA 3PHOA 4PJXB 1DBAL 4HV8B 2HVJA 4X80H 3FJTA 3MRJB 1XIWD 3GHEH 4IRJB 2IPUG 4OB5H 3L3HB 1VACB 3W0WB 1VADB 2P8PB 5DXWA 3KPRD 1NC2D 1B0GA 4PGEA 5EZLA 5CSBA 3J7HA 1A9EA 5EO1A 5A16B 5IQ9A 1KB9K 4DW2L 3PQYE 3ZE0F 3D0LA 1DQLH 3LKRA 2E9WA 3RVVD 2LTQC 4QYOB 2E6QA 2W0PA 4HDIB 4HKJB 4WRLA 3H9SE 1L7IH 1R3HB 2CD0A 2DQHL 2E9BA 1UB6B 4NFCA 1QFPA 4X0KB 5I75B 4X8XA 1AKJA 4OV6F 4HK3J 4M48L 1BVLA 4WI2A 2UZIH 3GSNL 4RMVA 3RGHA 3S35X 1FN4B 5HHMA 3JWOL 3HC4L 4IMLB 3STZA 4KRLB 5I8CA 3W9EB 4HS6A 1AFVH 3ULSA 3QDGD 1F97A 3HUJA 5IFHH 1TMCB 4LAQH 1BF2A 1HK6A 1A7QH 3SPVA 3T08A 3H3BC 4CDGC 4HZAA 1BM3H 4Z7NF 3DLQR 4Y5XC 2YA0A 3BT2L 3BMVA 3ILQD 2OI9A 3BP5A 2HG5B 3S9DB 3O4OB 5IVZA 4HC1A 4Y4FB 3RJDA 1LP9A 3DSFL 1S78C 5CZKA 4JG1H 2YUWA 4WWKD 5FYLH 4CU8A 4TSCH 5IB2B 3HZMA 3HNSH 5I1GH 3A6CL 1VERA 4HF5H 5GSRB 2ZPKL 4KKAC 2GSGB 1S7XA 3RWGB 4P99A 1W0VA 3QPXL 3MYZA 2H26B 3UYRL 3TN0C 1DQDH 1JWSA 3LQZA 5JHLL 2RBLA 2R0LL 2XXCB 4UNVA 1CQKA 2I60H 3GSQA 5D5MB 1TJIL 1H3TA 4G9DA 1KTLB 2OQJA 4W6WB 5KVGL 1T2JA 4GBXC 4XP9L 2DM4A 1RIHH 3EYFB 4PRID 4GUPA 2CIIA 1T2QH 5F7HA 4NBXB 1KLFA 4PRAB 3SCMA 2PR4L 4JQVC 2E7CA 2DQEL 1EIBA 5B39A 2CK2A 4NP4L 3ECBA 3SY0A 2NY1C 2LU4A 5DSCA 3I3EA 1BZ9A 4B53A 5E94A 2P43B 3WXWL 4E41D 5E8DH 3IF1B 2C4FU 3LKNB 4G8GA 4ZO7A 5KW9H 3DMMC 1RJZB 2BNRE 5KOVC 1PY9A 2NZ9D 4C4KT 4FQIL 2HT4D 3MOBL 2NW2B 5DD3H 1RZGB 3BAEH 3KPOB 1IM9A 5FYJU 2FD6L 2EH8L 5DI8B 1FNEA 4HUWB 4Z7WB 4XBPB 1GC1L 2ZCLL 1MCNA 5I8KL 5KG9B 1FO0A 2H1PH 3MJ9H 5E00A 3NGBC 4U1GB 3O6KH 3P9MB 1C1EL 5FUCC 1D9KB 3DV6A 2AABH 1HEZB 1J0YA 5I74C 2P48B 4GKZB 4PJAB 1GZPA 3WNNA 1KF9B 4I48B 5F21B 4P23A 4JFEE 4MJ5B 2WANA 3MOAL 1AQKL 2EDXA 2PYFB 3WCYA 1ND0A 1A4KB 4G80B 3HLAA 1A6AA 3LCYA 2H32A 5FHBH 4ZFOA 3JTSB 2Q3ZA 2EE3A 2ICES 3QNZA 3VWJA 3QNYA 5I71B 3WXVL 4P5MB 3TPUA 5TF1H 2ATPB 4CBPA 5DD0H 2NR6D 5C71A 2HJKA 4WGVB 4WO4D 1QLEL 3VD9A 4PV8B 1J9CT 4G6MH 4LKCA 4O5LL 5A40E 1DUYA 3SKNB 1QBLL 1FFOB 1WJ3A 5A1AA 3S37L 1J1PL 1PEZA 1ZT7B 5JR1H 4Y4KC 2XYCA 3PL6D 5EBWA 4PD4K 3HZKA 4U7MA 3VWKA 2J1KA 4XPHH 1DQJB 4N0RA 2EDHA 3QDMB 4ELKA 2ADJA 5GGTL 1DQTA 4Q0XH 1MCJA 5DJDB 5I1EL 5DMGC 1NKOA 1BBJB 2MHAB 3GSWA 5IGXL 2D2OA 2Y5TB 1QBMH 4LCUB 5J9PA 1G6RA 3HR5A 5SX4H 5DK2A 4ERSH 1XT5A 5E2WH 2NX5D 4DVBA 1FZMB 1OB1B 2HFGL 4Y0GA 4NJAL 3QCTH 3DGGB 3CD4A 3WFBL 3TJHC 3VFOA 3RGVB 3AU1B 1YMMB 2M26A 1PZUB 3GMLA 2VC2L 4P2RD 3VD3A 1K5NB 3KXFA 5C0CA 4MNGB 1AGEB 5IB1A 4HIIA 3U0TA 1DCLA 1K6QH 1OT1A 4NKOB 1XF4A 4CU7A 1A14L 4LDLB 1NMCC 5B3JE 2HFFA 5I16B 2AV1B 1MFAL 4IMKC 5CZXD 2W9EL 2G9HA 4U1IA 2W92A 1BFOB 1J11A 2AK4D 3TYFA 3OF6A 1AY1H 3AMLA 4X6CB 2DBLH 2LVEA 3G5XB 3WLBB 5FV1L 3FB6A 1YEJL 1OM3L 3QXTA 4YXLL 3QUML 1GL4B 2CKNA 2GJ6A 5CD3A 3RUGE 3TH4T 1F3DJ 2VAAA 3F6IA 1I7UB 4JEGB 4ODTH 1KT2B 2IQ9H 3ARGA 4ZO6A 5CBAA 3TLRA 2OL3B 4XRCB 1NUNB 2QL1A 3NFNA 5SWSB 5E6ID 3KLDA 1B4JH 2IADA 4K71B 5I1KL 2R1YA 2DKSA 4KK6D 2R4SL 4NM4H 2YA2A 2QQLL 2X9WA 2DQUH 3CK0H 1G7HA 4WI6A 3MC0A 4NDMB 2JK5A 1X5FA 2X1WL 4GG8B 2XZQL 3RAJL 1QSEA 3HPJB 5D7JB 2ERJC 4OT1H 2CPCA 4ZPVA 1WT5A 2AS5M 1U92B 4ZXBC 4QRQA 2ESVA 1QRND 4CMMA 2W60B 3QNXB 4N9GB 3VA2C 1FFNB 3DYOA 1KBGH 3RP1A 3KYNA 2VABA 3EZJB 1EHLH 2NNAA 4XPBH 1AC6A 2XTLA 5J13C 1IBGH 2AJYH 1A0QH 3MNVA 3GO1L 1JWMB 1BIIB 4KKBD 3WEXB 4JGJA 5J6GB 4EUPB 5F9OH 1S7SA 1RHFA 2N56A 4NKIL 4XNYL 5K9JH 3OR7B 2P24A 3D9AH 4R0LB 1NPUA 5ESAB 1E6JH 3RWDB 1BJ1J 5F7DB 5AD0A 3LIZL 1A9BB 3F12B 1Q0XH 3AUVA 4PFEA 4MHHG 2P7TA 1E27B 3DX6A 1P4BL 3G6DH 3QRGH 3X11A 1HDMB 4F7EB 3DXAD 5C3LD 2Z8SA 3NFPB 2JE8A 3VFNB 1B9ZA 4POZD 1VPOH 4ODHH 2VZ3A 1BFVL 3LRSA 4NQED 4FQCH 4LCWB 1AHWB 5C0GB 1FV1A 5T3XL 4XP4L 3HUJF 3T0BA 5FO8A 4KJPC 3GMNB 5EU5A 4WFHE 2X9YA 2F53B 5IB5A 2DLFL 2MPAL 2FGWL 3S4SG 2JJSA 1GGYA 4ISVB 4LASL 3O2VL 3UDWC 4R4FL 4EDWL 4Q9CA 1J05A 4KK9D 4L4VB 4UV7H 4N8VB 3Q6FB 4MVBA 4J3SA 3H0TB 3B9EA 4ZTOL 3MZGB 5T1KB 5ESQA 4M61A 3H7BA 3MRDB 5C0IA 1QLFB 5GSVA 1XIWA 4HSQA 3RNQA 2IEPA 3QA3A 4DKEH 2ADFH 1TZHB 4CADA 4FZ8L 4YBHA 4WI8A 3KPRA 1NC2A 4UQ2B 4YGAB 1VEOA 1ZTXL 1YEIH 3VI4E 4JANA 3BESR 4X6EB 1YY9D 4Y16C 2R4RH 5IB4A 4WY7H 2LTQB 3HI1A 2IALA 5L2KE 1KG0B 1K9TA 2IANB 4R2GC 1M6OA 4AL8L 4HT1H 1NFKA 2BC4A 4Z7OE 1XF2B 1QO3A 3V7MA 5IV2B 4X7SH 5IW1B 5FF6A 4MNQA 5J8OA 5KVDL 4UTBL 4GKOA 3SDXE 4AT6A 4GRMB 3QIBD 4RFEB 2EZ0C 5HYEA 1RZIB 5DTFB 1FYTA 1JHKL 1IGTB 2A38A 3QDGA 4NQCB 5E2UH 1P7HL 4TULH 5TF0A 1INQA 1NLDH 3WL9B 4YXKH 2ZNXA 4X4ZA 3R0NA 1J5OH 2HWZH 3MR9B 2IJ0C 1NUGA 4M7LL 3TT3L 3WO3B 1NEZB 5BO1H 1HHGB 1FL3B 1RK1B 2C9AA 2HRPL 1GGIL 3IT8D 4RGOL 1YEHL 4K8RH 3PGFH 1IILE 2BXZA 5I1JH 2PUQT 3QDJA 5C9JB 3VG9B 3KS0H 3QFJA 4J6RL 1BD2B 4L9LA 1IQDA 2PXYC 5ADOH 4WEMB 3TO2A 3P0VL 1S7TA 3CVHA 2NXYD 1KV3A 3ZDZE 4S1SL 3LKPA 2EYRA 1IGMH 3AROA 2E7LE 2GTWB 2EICA 3QIUD 3T8XB 5DJXA 3HC3H 3ULUC 1Z5LB 1M7IB 1QLRA 2PYED 2AGJH 3EYQD 4NZRL 2WW8A 5B8CA 1NKRA 3D85D 3NPZB 3TO4D 4JRYB 1RJYB 1JYXA 3LS5H 4HEPG 4YHMH 4IDLA 4ZFGH 4ONHA 4XH2B 5GGQH 5IF0B 4F3FA 4PRIA 1QR1A 1KSRA 1FNHA 5CEYA 5TH2A 3MROA 1T1YA 4MB5A 4ZAKD 3T3PF 1T04A 2H2PC 4WI9A 3RIFK 2DRUA 5F3BA 4TNWF 4UOW0 5CMAA 3MRMA 4F33A 5AEAA 2QEJA 1CI5A 3H42L 3L3DB 4LU5H 1CFQB 3QZWA 3WUWA 4NQVB 4NZTL 1KJ2A 4WHCA 4DVRL 4ODWB 3ULVH 2NY5C 2MCG1 2X1XR 2HTLC 3WNKA 2BCKA 2CK0L 4XNZC 2DS4A 1V5JA 4X5WA 5KBNC 3VRJA 4JM2C 4EJ1C 4PGBA 4XCEA 5B3NA 3QWOB 4GQ9L 5CJXC 5DRZA 5EO9A 3GKZA 5C08A 3S3JA 3EO1A 2LAAA 1UWXH 1T3FB 1TVBB 4QOKD 4GG6B 1GRWA 4DTGH 1IRAY 3U4AA 3DYPA 5T1LA 4GMSL 5ENWA 3FOMA 5F1OB 3IDIB 4KTDL 3F5WA 3FQXA 3OAUL 4QRPD 1ZHNA 5LXGH 2WQRA 1NFDB 2JB5L 5DVNA 2IH1A 4RGNC 2GUOB 1ZSDA 2X4SA 4E0RB 1BFSA 1QNZH 3G6AA 3MLZL 3V9FA 3QEQD 4MJIA 2YPKB 1OVZA 2FHFA 3OXSB 4LLYB 1RPQA 3OSKA 5I15H 4JRXB 5HYJB 3B2UC 2H2SD 4U6XA 3JTTA 4JFQB 5DURB 4HKBB 4L3CB 2G60H 2O5YL 5IK3B 2I9TA 3C60D 4XX1E 3WIHL 3W5NA 1NEUA 5ICYA 3OKOB 4G8EA 1HXYB 4LKXA 4KY1H 5T1MA 1LK3L 1TJHH 3L95A 4NFDA 1BP3B 1NAKL 5TPWH 5JQ6L 4C56E 1TQBB 1NGPH 3D5OF 1PDKA 3V4UH 1JPSL 4IRSB 1CD0A 3ZO0A 3MCG1 3HCVA 5L2JA 1CXFA 4MXVF 1MPAH 2XA8L 4JZOB 3LKSA 3LSOA 4O02L 4QTIH 4YBLC 5C09A 2IGFL 4QXTA 1U9KA 5F9WC 2UV3A 4OZ4A 1WBXB 5K9KB 3KLSA 2NY3B 1FNGA 2J2ZA 4QRUA 3MJ7A 3O3DB 4APQB 3FQWB 1QZ1A 3ZZ1A 2WWKT 3KYKH 4MXWH 3T3ME 2NX5A 4NGHL 1QSFB 1PYWA 1G9MC 4XPTH 5FKPB 3ARYA 4Y8AA 1OQXA 4G43A 2F8OA 3JWDL 3NPSB 4O2FA 2FJGA 4HXBL 2AXFB 3BEVB 1KCLA 1ACYL 4XTRD 4RAUB 3U30C 2Y6SC 3QAZB 5CJQL 4XX1G 4DCQA 1A47A 4X8JA 3VU2A 1AP2A 2RB8A 1J0HA 1YNTA 3MJ6A 3BPCA 4PJHB 1DE4A 2Q6WB 3E8UH 3O41A 5MEPB 4OCLC 3QEHB 4KMTL 3FT3A 1VFAB 2YN5A 4HK3N 3SE4A 4JFDD 2RHEA 5FUZH 2Z8WC 3EYVA 2HAZA 1ITCA 2HKHL 3RX7A 5E4EB 3DWTA 1X7QB 4JFPA 5FUOL 3WS3A 4DKFH 2B4CL 5LCVL 5KSBA 1K4CB 3VRLE 3VJ6A 1Q72H 1XGQA 3KPPB 4S10A 3E2HC 2CJUH 3FQRA 3OHXA 4XI5C 2X41A 4LL9A 5D1QD 1BQHB 4XB7A 5IHLB 5M94B 3C5ZD 2AQ1A 3DO3A 2DKMA 4UQ3B 4AM0A 3C08H 4MA8L 4HBQA 1U3HD 4FTVB 3LN5A 2DLEA 5FA4A 1IEAB 5E2VH 1C7SA 1G1CA 2Y23A 4XNMB 2UZYB 4YK4B 4F9LA 1U91A 2YXFA 4HK0A 3SGJA 3MLTA 1UYWL 5JUEL 2ZCHH 2X4QA 2DWEA 3IJHB 3BWAB 1T0NB 1AE6L 1MI5E 1SJHA 3LV3B 1G0XA 1DUZA 1WBZA 4WJ5B 2PETA 1A6VH 4JKPH 3DROA 4Q9BA 4NT6B 4X6FB 3TZVC 1ERNA 1G9EA 1ZHLB 1S7WB 1ZHBA 1A6TB 2OL3H 2CKBB 1NLBH 3QEUB 1YQ2A 1JRHL 1P1ZB 3HG1D 4TVPE 3VXSD 1DDHA 3WSQH 5I73C 3QI9D 4M4RA 5IFJB 2VLKE 4V2BA 2VH5H 1R24A 3WFCH 3D0VA 1NL0H 3T0EC 3EJYD 3SKMA 3OG6B 5AZEH 4V3EB 3GSXA 3QQNA 3AY4C 1T1XB 3V5KA 5CD5D 5IVXA 2H9GA 4D3CH 2BMKB 3VD4A 1D5MB 1WFUA 2OX5A 1CR9L 2W65A 3WFZA 3H9HA 3K46A 3BZFB 5CZVL 1WWCA 2ED8A 4Q2ZA 4OTXL 1FNAA 1OTUD 2JCCE 4CVZA 1KTRL 2ZCKH 2HKFL 7FABL 4KWUA 5DJAB 4K07A 2PF6A 3GSRB 2ZOLA 3MV8E 4HGKC 1YN6B 2V9TA 4N0CD 2YKLH 4CW1A 4XAKE 3VFUB 1Q94B 3PABB 1EMTL 1TCRB 4GKSB 4NSKA 4PRHD 4PJ9D 4NQEA 4JFFA 1CU4L 1KLUA 4PV9A 3EGSB 5GGVL 2I9LB 3HE6B 1EEZB 1FJ1A 1A7PL 5I2IB 5IW6A 3BD3A 3WKNA 1BLNB 1OGAA 2APBA 4KPHL 1J87A 1FRGL 3IDMA 4R90H 1CZ8H 5DQ9A 1WTGT 2J12B 3ZDYF 4EI5C 1CGTA 2A6DA 4PJEA 4RZCB 4FABL 5L8JB 3SDCA 1SM3H 2X40A 4WDIA 4Y4HD 5HJ3B 3U7WH 2DQGL 5HYSB 2YR3A 5E8NB 3EO9L 3RTQC 3D69B 4WFFD 1EEUA 5IM7A 4PJDE 5DZLA 3EJZD 5JORB 3GSVA 1IEBB 4URTB 4TTDC 1XGRB 3DPBA 3H2WA 5EU6A 3MYJA 1HIMH 4Y1AB 3TFKC 1R5IB 1RURL 2UWEE 2MQ3A 5GGSA 3WFHB 4OZHA 2XT1B 4L4TA 1JTOA 1JFQL 3BZ4A 3V52L 3IDUA 4YHOL 1RFDL 3IFOA 1KOAA 2NXZB 4KV5E 3O3AB 1TZIB 3C6SB 4FFZL 5EWIL 4E5XB 3O6FB 5I1DA 1XF1A 1FNLA 6FABL 4JE4B 4NC0B 3H3PL 4OQTA 4XWOC 4EVNA 3VG0H 2BSRA 4OF0A 4XVTH 2GT9A 3NAAL 4W81A 4M62L 1RAMA 2XFXA 3QIBA 4OGYH 5FYJE 4CGTA 2BNQB 4GMTL 1MREH 1DN0B 4P46B 1P6AB 1TVHB 3H8NA 2A6JA 4AG4H 4UINL 2G5BB 3WJJA 5K59F 3OKNB 3UAJD 5GS0H 1U58B 3UBXB 1OAQH 1QFUH 4Z95L 4EBQH 3FHQA 3CFCL 1NDGB 3IRZA 2C1PB 3NACH 4PJIF 3M1BA 1EJOL 3MODL 2FB4L 1SEBA 3PNWB 1KENL 1MCCA 5L88H 5ESVA 4PJBE 5BXFA 1IAOB 5DJYA 3I6KA 1SMAA 4PJ5B 5CGYC 2Z35A 3F7YB 3CSBA 43C9A 2Z93A 1BMGA 4PRDA 3TA3A 3PDOB 4FQHB 1UJTA 4G9FB 5L7XH 5C0ND 1X4ZA 2ICWB 1SY6L 5ISZB 1MHEA 2CQVA 4R4ND 5D9SA 3DX9A 4RGMB 4BQ6A 2Z4QB 3CMOL 4HS8H 5DT1H 5HHOD 4NQDD 4R97B 5T5NF 5EC1B 3B9KB 4XP1L 3I6LE 1FHGA 1FZJB 2YBRB 2VISB 3D85A 2ZOKB 4LSQH 5IWLA 1EUTA 3TO4A 1H3WM 2P46B 3K1KC 3MXVL 1RZJC 2IFFH 4OLUH 5ELIA 1XF5A 1PX4A 1J12A 32C2B 3VXNA 4UT7L 2R2EB 2VLJD 4IEFB 1XFPA 1OPGL 2X4TA 3MLXH 3NA4A 1FORL 2CDFB 4NKDA 4ACPA 5EC2B 4K7PH 2B8OT 2QADB 2VUYA 2DI8A 2CLZB 4MAYB 1K2DA 1J1OH 5HHXH 4OBSA 2BY0A 3WFDL 3KHQA 4YFDB 1DBJL 1KEGH 1RUMH 3BQUC 3U79A 4XNZB 5E08L 2Q8BH 4LPYA 5EUKA 2EDBA 3QHFL 4L3ED 2JJWA 1I3RA 1YEEL 1Z2KA 5JDSB 3B43A 1KGCD 4MQSB 1ZHKA 3I2CH 2IAMC 2XTJE 3HE7A 12E8L 3IKCB 3UEZA 2VXUL 4QNPF 5C2BH 1D6VH 1LO0H 2D3VA 2A9MH 5DD5H 2JTDA 3WE6B 1KCSL 4G8IA 1QQDA 1S7UB 2CRZA 5ID1A 2GFBB 3PJSB 5I17B 4IIQB 5C2UB 4KHTL 3PWPD 2NW3B 1GPOL 5KN5A 1AI1H 4OCYH 5IB3A 2GK0A 1RUAL 3KYMA 5H2BB 5MENB 3B6SA 1JNLL 4ZS7H 4LSUL 2IPTL 5KSAD 4NNPL 3MLWH 1U2HA 1T5WB 1I8IB 2X4UA 1CFSB 3IDYC 3QEQA 4J3XA 3ES6B 5CUSH 2X7LA 4TUOB 4MD0B 1OTSC 4TSCL 2A73B 1MLCA 3K8KA 4OD1L 1KB5B 5F72S 3V6OC 1SJEB 4FFYL 2NY6D 4G6AD 2VLLA 1L9NA 3FTGB 4HUXB 1G0DA 4JQIL 1I8KB 3DYMA 5GJTL 1WZLA 3BP4B 5T3ZH 1TQCC 4CMHB 4TNWK 2ICEB 3NIGF 1CICB 1E6OL 3PP3K 2Q86B 5EOQL 1WCQA 3PV7A 1H3XA 1AO7E 4H8WC 5KSBF 4L8CB 1UEMA 3L3KB 3C8KB 2IFGA 3VXRA 1NGQH 2F54B 4MCYA 1A7BA 1F58H 3PWUA 1YNKL 3DI2B 4GLRI 4I2XA 1HH6B 4JDVB 2VZOA 4RMTA 5D7KE 3A67H 2WUCH 4S1DD 5D7IA 3RRQA 2PW2A 3VA6A 5LKNA 1KPVA 4JCMA 2ILLA 3UTSE 3OZ9H 4ORGA 3QUYB 3N85H 3OR6A 4KC3B 4HG4J 1MCBA 3L6FA 3S35L 4HGWA 1H8SA 1U8OB 5C0AD 1QSZA 4G7VH 3TZVA 3DX7B 1I1AD 1OF2B 4G5ZL 5HY9A 3SDAB 5L9DL 4LLMA 2YD2A 1EO5A 4QKXB 1PVHA 4DN3L 1MCQA 5IMMB 1HSAA 4LLDA 3RZWA 4DKDC 1YPZE 1CD8A 2BNUA 2OTUB 3L3JA 2GQHA 3BHBA 1UH3A 5C0BE 5EFIA 1MJUH 5JW4N 1GGCH 2XN9D 4RNRB 4LSPH 5EU3B 4EN3A 1E28A 4LEOA 3ARFA 3VRIB 1LEKB 2I5YH 4ODVH 5FM4A 4YGVA 4NHUE 1DEEA 2CLRA 1RZKC 2I07A 5IVXF 1S7RB 1Z9SA 3W0WD 1T20A 1G7LB 3BD5A 4ZUTB 3PWJB 2XV6B 1IKFL 4Z0BH 4MS8D 2R2BA 2YOCA 4ODXA 4F58L 3EYOB 5SWZB 3PHOB 2HVJB 1FLRL 4P5TC 5GZOD 1IT9L 2CUHA 4YDIL 2J8UE 4BK5A 1EZVY 1I8MA 3V4PH 2XQBH 1B0GB 4PGEB 5EZLB 2GK2A 1A9EB 1U8MA 1KCUL 25C8H 3K7UA 5EO1B 1BOYA 5IQ9B 1K3ZA 3K81A 3QHZL 3D0LB 3RVVC 3LKRB 2OP4H 4OCXH 3X14A 5CKAA 1V3JA 4KQ3L 5T3XD 1AKJB 2VN7A 1BVLB 4LEXL 5IVOA 1F3DH 2I27N 4PJEF 5AZ2L 1A1MA 5HHMB 4MXQA 1U3YA 3RTQA 2DM2A 2IF7A 4L1DA 3STZB 3MV9E 4DGIL 5IBTH 3M8OH 5I8CB 1A1NA 3HG1A 2A74A 2Y06H 4HS6B 4LVHC 4JJHA 1U41A 5GS3A 3UTTD 4H1LA 2AJUL 3QI9A 3ULSB 2PNDA 3U83A 3HUJB 3NFSL 4OF5A 1T83A 4Y4FD 4V1DD 4HIXH 3SPVB 4I18A 2AJXH 4OZHF 3UJTL 2BP3A 4XWGL 2CKBH 1HCFX 3T65A 3ILQC 4LF3A 2OI9B 5FXCH 3BP5B 1MRCL 5IVZB 1MJ7H 3Q6GL 5GS2H 1J86A 4DZ8A 1LP9B 5LBSH 4TVPL 2CUIA 2J4WL 2A0LD 4RISL 4WWKC 4XBGA 4GS7B 4M5YL 3AXLA 3LB6C 2AEWA 3HZMB 3QG7L 1CGYA 2LAGB 1BEYH 4HG4K 2VWEC 5EORL 3D18B 5C0JA 1KCVL 4N0CA 1SJVA 2V5TA 1S7XB 4CN1A 2RR3A 5C92A 3CZJA 1W0VB 5AAMA 3GHBH 2VZVA 1JWSB 3LQZB 3PIQA 3BFOA 3FQNA 3GSQB 2MKLC 1BJ1H 1PG7X 4G9DB 3EUUA 4DGYL 2OQJB 4OLXL 4G42A 4P2CG 1E4XI 3H9SD 2X2YA 4OI7A 2CIIB 3IRPX 2DLIA 2GAZA 1RULL 4P3DA 4XAWL 3SCMB 2D9CA 5F3HA 4Y4HA 4ZYKA 5B39B 3MACH 1S5IL 1L0XA 5SWSE 1FAKT 1HH9A 3ECBB 5D93B 1P4IL 5DSCB 3P2TA 2DTMH 5E94B 3F58H 5DQJA 2VXQH 1MY7A 1SVZA 2HT2C 3DUSA 4OCWL 3BVNA 1YEDA 2EECA 3AFLA 2NY7H 3Q3GA 4G8GB 4X83A 4BFIA 3MGOA 2NZ9C 2YS4A 2HT4C 4LPUA 1IGJA 2NY4C 1CYGA 5DC0A 1IM9B 3G6JA 5HVHB 4OM1L 3VXPA 3O2WL 2B7DT 4LCIH 4JM4H 4HIJA 1S8DA 1FO0B 1ZGLM 4I77H 5E00B 3WDIA 5F1NA 3RZCA 1UGNA 4LDOB 4JHBA 3DV6B 4JY5L 4MAUL 3BYYA 1GZPB 1N8ZA 2HH0H 2V5RA 2VDPH 4P23B 4Z7VE 3C6LD 1GCFA 4LVEA 3ALWA 4KVCH 3RWIA 4DGVH 1EFXB 3RFZC 3DUHA 5KANI 2HJFA 3V4VL 1ND0B 2NYYD 1A6AB 3HLAB 2H32B 3LQMA 4ZFOB 4ONGL 5J7CC 4P0DA 2ZNWA 1UQSA 1RSFA 2FBJL 3QNZB 3S6CA 3VWJB 3QNYB 5TE4L 3TPUB 4NBYB 3V7AE 2KH2B 5E9DA 3UJJH 2A6IA 2NR6C 3EYSL 3LDBB 4PY7A 2RCSL 5I76A 2IQAA 4WO4C 3RU8L 2HJKB 2OXGA 1DBKH 1V3KA 2JF1A 1Y6KR 4U7SA 5FYJL 3QDMD 2CDGA 4LKCB 1CDCA 3FRPG 1PG7H 1DUYB 4QRSA 4U1HA 3MO1A 5BVJA 4G8FA 2EDWA 1DBML 5DFVD 1IEHA 3PL6C 2OTWA 4L29A 5EBWB 3IDXH 4GW4A 3HZKB 3VWKB 4R26H 2OS7A 3KPSE 3DHMA 3Q5OA 3HC0A 4ELKB 4YHIA 2W9LA 2XZCL 2ADJB 1MFEH 4XMLL 5CLWA 5T5FH 3QPQC 4FNLH 3F7VA 3GSWB 3NABL 5J1TC 2HA1A 1T03L 2O5ZH 2VZTA 4OLVL 4JVPA 5J9PB 4TYUA 3T2NL 1G6RB 3HR5B 4I0PC 4ZNCD 2HTKD 3LEXA 2DLTA 1IAII 3OAYK 5KS9A 4DVBB 4EUPG 1KB5L 1EX0A 3HMXL 4ZUUA 4Q6IA 5DJZA 2VLJA 4W6YB 3T2QA 4TSAL 4MDIA 5T33H 1V3MA 2A2QT 3VFOB 2GJJA 3RIAF 1MEXL 1F90L 3GMLB 3RA7L 1KXTB 4AEIL 2AJSH 4QXWA 2IANE 3KXFB 5C0CB 5CEZL 3RKDD 5IB1B 2WBJC 4K23L 4JFED 1YDPA 2DD8H 3V2AR 1P7QA 4U6VH 4HIIB 3U0TB 4N0UE 3P30L 5F6IC 3FZUD 1HQRA 2HFFB 3TV3L 3GMMA 4HAFA 4UIMA 4WUUE 1ZVSA 5FGSA 1WCBA 4KRPC 5ILTL 4NCDA 1A3LL 1F5WA 2DKUA 2G9HB 4M7ZC 4U1IB 3VXME 3RNKB 1CL7I 2UY7A 2JJVA 4UT9L 3MSPA 3QXDA 5D7IF 1N6QH 3IXTA 2NY5H 3TYFB 3GIVA 2NY0D 4N8VG 4G6KL 2R0WL 2OSLA 2BVYA 5TJWK 1PSKL 3FB6B 1AIFA 3PWPA 2YWZA 3BGMB 1KJMA 4QXUL 2CDEA 4OLZH 5DMIH 2GJ6B 5CD3B 1I85A 1AJ7H 3PE9A 4DOHE 2VAAB 2I26N 1JZ8A 1T6VN 1UWEH 3ARGB 5IHUH 2DMKA 5CBAB 1NCTA 3AB0B 4HCRL 2APWA 5E6IC 1C08A 3NFNB 3O9WD 4NRXA 1SHMA 2IADB 4KK6C 2R1YB 1U8PA 3KVQA 1DFBH 1T22A 2P5WA 1LGVA 4U1SA 4HIEB 5KSUA 2Q76A 2DMCA 3MLPA 3RVUC 1G7HB 3IFLL 1DVFA 1Q0YL 2JK5B 2QBWA 4XPGH 1R0AH 1QSEB 5DR5H 4YIQA 4YC2C 3GMQA 4ZPVB 1GXEA 4YX2H 4QRQB 2ESVB 4YHML 4HWNA 4CMMB 2VXSH 3HAEA 3IB4A 1ULVA 2WIIA 3KYNB 1JZ3A 1ZMYA 2VABB 2NNAB 1AD9A 4LQFH 1NCBL 3MNVB 3KJ4B 1F4YH 3QUMA 5D7SL 4FQQA 3SJVE 4BKLA 1CGSL 5IEKA 4X7FC 4NWTL 1LHZA 3QO1A 1NEZG 3CXHK 1S7SB 3S36X 3LKOA 2P24B 2VXVH 5HPOA 1X9QA 2L0DA 4XXCA 3BKYH 4Y2DD 4S1QH 1NANI 1VENA 4LCWD 5F6HJ 2CSPA 3K3QA 2AJZA 3AAZA 1I1AA 4FP8L 5IROC 5GJSL 4WI5A 2E7BA 1I9JL 1WBYA 1LD9A 3DX6B 2F53D 3X11B 4RIRA 1MWAL 2LU7A 5DJ2A 3SO3B 4POZC 2VXTL 4RRPG 5EZIL 4NNXA 1PD6A 2OJZL 4HUUA 3LRSB 4UMGA 1FIGL 1J1XL 2OCFD 4FQXD 1FV1B 4PYHA 3GB7A 2XN9A 5FUCE 4IOIA 5FO8B 3WO4C 5HTSA 5EU5B 5T1KD 5J4MA 4LGRB 4Z9KB 4QWWC 5T3ZE 2BJML 4GO6B 4F8TA 3U7YL 4UAOC 4KK9C 4YHPA 3UJIH 1J05B 4MS8A 1BECA 3MRQA 3VXUE 3GDBA 4JRXE 5ESQB 4HC1L 3H7BB 5DC9B 4PY8J 5JHDA 2LV4A 3G9VA 5GSVB 1XIWB 1V7MH 3RNQB 2EO9A 3QA3B 4CADB 5GS0D 5IHBA 1CIDA 5ACZA 1GGBH 3KPRB 1NC2B 1LO3L 2EDDA 1ED3A 3G5VA 1YY9C 4JANB 5IQ7H 2APFA 2YHGA 2AP2A 3HI1B 5C07E 2XWBA 2IALB 2FIRT 1HSBA 1OAXL 4R8WH 1M6OB 1REIA 2VDRL 3EJJX 4O58H 2DJ4A 2BC4B 4XC1L 4NQCD 4X98A 1QO3B 4OLWL 4XBEH 1G9NL 4KI5D 5FHAH 5CILH 3K2MC 5FF6B 4MNQB 1ZS8A 3MGTA 3UZQA 4AT6B 3RX5A 3S36H 2OLDA 4DQOL 1PKQE 1WEJH 3THMH 4LVHB 3UTTA 5B21A 3RPIA 4NBZB 5K93A 2B1HL 3QDGB 4F7PA 4MHHI 3BWUC 4JVUA 4C4KO 4YBQD 1INQB 3OKYA 4PRPE 1FGVH 4QHLA 1KC5L 5HI4D 3SGKC 4BSJA 1O7VA 4V1DA 5TQ2L 1BD2D 3Q48A 1JI1A 4DKAA 1B4RA 4PYGA 4WFHD 3RQ3A 3U9PL 4YDLB 3B9VA 2AVGA 3U48A 4TN9A 5CP3A 3G6JF 1R5VA 1TENA 1MAJA 5E99L 2L7JA 1ZOXA 4PJHE 2YRZA 2FO4A 5GISL 4P48A 3QFJB 2ZKHH 4L9LB 4JREC 3PDGA 1IQDB 4B50A 5KOMC 3TO2B 4U05A 2NXYC 4XCFL 1S7TB 3CVHB 4UUJA 2NY2C 3P0YL 4K7FA 1OD7A 2EYRB 3LKPB 4OLYH 3BKMH 3QIUC 2G75A 4ETQB 5DJXB 1AXTH 5GRJH 1F11A 1QLRB 3K0WA 5L8KB 2R9HD 5M95B 5B8CB 4JPWH 2OR8A 5C0EA 5F7EL 3PQYA 1YA5A 2CRMA 2DYPA 4D9QD 2H41A 5C7XH 1W72L 1RZFH 1HCVA 4ONHB 5L2KD 3STBA 4PRIB 1QR1B 5AYUL 4ENED 3H9SA 5FM5O 5CEYB 5TH2B 4ZAKC 3MROB 1T1YB 4AEHL 3VI3F 1T04B 5TGBA 4FTVE 5F3BB 1YMHA 4AIOA 5C0RL 2VDOH 3MRMB 4FQ1H 4FQJL 4F33B 4NQSA 2VDNH 5FCSH 4KMQA 2D7MA 3QZWB 3WUWB 2HN7A 4N1CA 1KJ2B 5BW7A 2BCKB 3V0AC 4K3DL 4G7YH 3RVTC 4X5WB 4ZFZA 3VRJB 1E4KA 3MLRH 4P2OD 4U7KA 4PGBB 4XCEB 1JZ5A 1IQWL 3LMJH 4CRPA 5DRZB 5EO9B 5GS1A 5C08B 5MERA 43CAA 2QQKL 4X5XA 1XGTA 1G6RL 1KACB 5DD1L 3T0XA 2R29L 5KS9F 3GBLA 5T1LB 4X9GA 2YPLE 5ENWB 3FOMB 1IC5H 4OIIL 1ES0A 2F19L 1YYLL 1T5XA 1HILA 3KDMA 3F5WB 3SOBL 3FQXB 3NTCH 1HKFA 1ZHNB 5HYJD 4L5FL 4PJ7E 4M7KH 4P49A 4XCCH 2VL4A 2WM0A 2E6PA 2IH1B 4ZTPH 1BQHG 3UC0H 1H8NA 4MMXC 1ZSDB 2L4OA 2W0FA 2X4SB 4NHCL 3ZDXF 3G6AB 3LPWA 3VFRA 4MJIB 5DHVA 1FO0H 3UZVB 4EOWL 3U1SL 1MHPL 1CE1H 2QTEA 3ZYJA 2H2SC 4U6XB 3JTTB 4OI8A 2I9TB 3C60C 5ALCL 4WW1A 4WO4B 1TDQA 5HD8D 4NQUA 1KTDA 5ICYB 2VDKH 3O8XC 4G8EB 5I1LA 4JQXA 4LKXB 5B38A 5T1MB 3L95B 4JAMB 4LSDA 1A1OA 2NY3D 2R39A 3KJ6L 3JV5A 3QH3A 3HCVB 5L2JB 4IS6A 3RVWC 4RFNB 2CXGA 3ZKMD 2KUTA 3LKSB 1FDLH 1QSFD 4EEEA 3LSOB 5C09B 4QXTB 5FGBA 3PP3H 4Q74A 1C16A 2Z8RA 3DO7A 3P11L 4OZ4B 5FO7A 4QY8A 1FNGB 2DMBA 4Y19E 4QRUB 3U7WL 2BNRA 5IFAL 3MJ7B 3Q2CA 5CHNB 3FN0L 3WNOA 2A6KB 4NUGH 5LQBH 3BH8A 2AQ3A 2NX5B 1PYWB 3IFNH 1ZWIA 4Y5YB 3MMEB 4XP6H 1VGEH 5F44A 4G43B 5GRXG 5D2LE 4D8PA 3CLFL 5BRZE 4O2FB 2FJGB 4ONFL 1YNLH 5HGHA 2AEQH 3JXAA 4GRWH 3CNKA 4XTRC 3HFML 3WIHA 4OGXL 4F15B 4JFZH 1DANU 1K8DA 4JFEA 4PB9L 5BV7B 3O3BA 4X8JB 1AP2B 2DQCL 5E1HB 3BPNC 1YNTB 5F6IB 3BPCB 3ARBC 1D5IH 5IHZA 1DE4B 4LVNC 1CF8L 1X5IA 4RA3A 1FE8H 3O41B 4LHUA 2BNQE 5MHSD 3FT3B 1PKOA 3LKQB 1IGIH 3EYVB 4OZGF 4RMWA 2IBZX 4I8DA 4M7ZB 3BKCL 3MRBA 4JFPB 3EO0A 5F8RC 3WS3B 3BE1L 3MRCA 1I9EA 2JELH 3GIZH 3PXHA 3SDYL 2V5SA 5KSBB 4R9HA 1MIEL 3GI8L 5HYSG 4EBQL 1SBSL 3I9GH 2P5EE 4L4JA 3VJ6B 5ALBH 4Z8FH 4ODUA 1XGQB 3QT2A 1UXWB 1JYVA 1QEWA 4Z7UE 3FQRB 1KFAH 3OHXB 5D1QC 4TPRH 3FFCE 3OAZK 2O93L 3C5ZC 4PJ5E 4WV1A 2VZUA 3MREA 4AM0B 4UZGA 1H5BC 1U3HC 1INDH 3LN5B 5FA4B 2KL6A 5JOPD 4G9FE 5FOBA 4BQ8A 1U91B 4HK0B 3O9WA 4X6DE 3U4BH 3MLTB 4YE4L 5ISZE 2EEDA 5INCA 1QUNA 3NMEA 2DWEB 1EO8H 2K1MA 4CNIA 1SJHB 4XC3L 4JZJA 1K85A 3CDGB 4WW2C 1DUZB 4JN2A 5GS2D 5EIIA 5DHYA 2EKSA 1WBZB 2F58H 3ULUE 3DROB 2ZUYA 1OHQA 3RHWF 4HWZA 4ODSH 3MBEC 3MJ8A 5BMFL 2BRRH 3RIAK 1ZHBB 4LDEB 5AG8A 3QCVL 1T89C 4ZD3H 2BK8A 4TUJA 3K2UH 4RWYH 4HWBL 1QRNB 3B8YA 2W91A 3A6BH 5JA9A 2Q1EA 2Q7NA 3DETD 3I6GA 4CKVX 1LEIA 4XNXL 1R24B 3D0VB 5CBEA 3UBXG 3SKMB 1NMAH 3LEYL 4GAYA 5C8JB 1I8LA 1N4XH 3GSXB 2V17L 2W9DH 1I4FA 1YEGH 2DQTL 4QHKJ 5DJ8A 5CD5C 3V5KB 3RI5F 5IVXB 1CGVA 2BOCA 3ZL4L 1CXIA 2H9GB 3MUY1 3L5XH 5ECJE 2VLME 3QO0A 2W65B 4OF8A 3H9HB 3LZFL 4ZG1A 5I1AA 4Q2ZB 4IOFD 2FX8L 4HZLA 1UM5H 4LSRH 2D7TH 4Y2DA 1J8KA 4HJJH 4CVZB 4A6YL 2X09A 1N5YH 2DQIH 4HUMB 1OAZH 2ZOLB 4JPIA 1NBQA 3IU4H 1KYOJ 4CW1B 1ZA3A 5I8EA 1Z0NA 4LIQH 5LWYL 3RUGA 4NSKB 4GLRH 3SDDA 4PJ9C 2DL9A 4Y5VC 1NSNL 3JWOC 1KN4L 4NQEB 4PG9A 1KLUB 4PV9B 4FQXA 1TXKA 3TIDA 4K3JL 4HUNB 5L8LB 1FJ1B 1D5BA 1Z9OA 5IW6B 2YUZA 5FKAA 4H26A 1FGNH 3FAXA 3IDMB 4UDUA 3RWEA 5DQ9B 1F6FB 1P9MA 4Y1AD 4RGNE 1DR9A 4MA7L 4TOYL 2A6DB 4PJEB 3SDCB 4AENA 4YHYC 1MCOH 5FYKH 3JZ7A 3OJ2C 4WDIB 3CPLA 2VL5B 4L8BB 1JK8B 4YLQT 1JZ4A 1DTUA 5I18L 4S0SD 4ALAL 4JGUA 3EJZC 5IM7B 2NXZD 4PS4L 3GSVB 2IG2L 1A2YA 3WKMH 5D5MF 5EU6B 3MYJB 4PJ8D 4TVPD 4JO1H 3BISA 5BS0E 3MLYH 2OK0H 1CFNA 1RZKH 2VLKD 5GGSB 4OZHB 2XZAL 4L4TB 4JKMA 3BZ4B 1ZKAA 2ZUWA 4J2XA 3PF2A 3IFOB 1IC1A 5L6YL 1A8JH 5F7NC 2NTSP 3BPLC 4OSUH 2D03H 5I1DB 2YPVL 4GRLD 4WU7A 3DVGA 4EVNB 2ZUUA 3G5ZA 4OCRH 4FFVD 2BSRB 3O3UN 2HFTA 4PTTA 3HNTH 4XNUH 1PZ5A 2GT9B 3UTPD 3UX9B 4ORZC 1QHOA 4X99A 1OW0C 3QIBB 3JVGA 4L9DA 2GW5A 1H3GA 2C3WA 2A6JB 4LLAA 5IMKA 2LFGA 3UAJC 4JR9H 5SX4I 2YWYA 1KJ2L 3P9WB 3I02A 3C2SA 1T7VA 5DA4A 5EU4B 1E4WL 3M1BB 1SEBB 3RWFA 1KJ3H 3E6FA 4LARL 4BZ2H 3FOLB 5ESVB 4HX1B 5DUBA 5BXFB 4H20H 1G0YR 1TTUA 3V0WL 5DJYB 3I6KB 2Z35B 5HHVH 43C9B 2Z93B 1LILA 2Y9RT 1L8JA 1MH5A 3B9KD 3CFDA 1N3NA 5DUPH 4JO4H 2MCPL 3ARXA 3TA3B 4KZEL 3QG6A 2J8OA 4R4NC 1MHEB 2SEBA 5D9SB 3DX9B 1EA9C 5AWNL 2CO6B 2H6PB 1UM4L 1MAMH 2Y72A 2R8SH 5AG9A 4YPGA 1JGVH 1F4WL 3INUL 1U8QA 1R3LA 5SWZE 1NQBA 4NZUH 3D85B 2QADD 1V7NL 3TO4B 5AUMA 1FYHB 4MAYD 1F6AA 1FSKC 3CVHH 3HPLA 3VXNB 1UACH 3D6GA 5L2KA 1RMFL 3ISWA 1MF2H 4FXLA 4ZAKB 4UBDC 1J8HE 1F00I 2X4TB 4DN4H 4NKDB 4MQXD 2AI0L 4N5EA 1ZT4A 4YWGH 1K2DB 4KGLA 5CIPA 5D70H 4CUCA 5KVFL 3OAYH 3SDXA 5EBMA 5FYJD 4KJQD 1A6UH 4NJ9L 1I7TA 3AM8A 1UADC 1JHLH 1CLZL 1L7TH 1BZ7A 3WIFA 5EUKB 1RVFH 2Y36H 4P2OA 1I3RB 1SY6A 4X6BA 4Q9RL 1KXVC 2R0KL 1HXMB 3O6ML 1ZHKB 2WWKO 1TZGL 2YD1A 5SV3A 3CC5A 3HE7B 4U6HA 1AR2A 2ZSWA 2DQDH 2P8LA 5HYFA 4M6NH 4X5LA 5GGVY 3T0EE 1UM6L 4MZ3A 1MRDL 3ESVF 4G8IB 1QQDB 3PP4H 1OLLA 4NZJA 5ID1B 1JGLH 4LK4A 4M6ML 1CE6A 1RUQL 1JF5A 4P4KD 2XRAH 1F02I 2FX9L 4OD3L 5IB3B 2GK0B 3KYMB 5F96L 3B6SB 1S7QA 2XQYK 2PTVA 2JB6A 2E7LA 4I3RL 5KSAC 1DLHA 1OAUH 4P2YA 2X4UB 5GHWH 3QEQB 3I6LD 2R56H 3PDDA 4RMSA 2X7LB 2ED9A 5CEZD 1BVZA 4RMRA 3ZKXB 5I30L 1MLCB 2VSDA 4NWUL 3F6LA 5LG1A 1N5AA 2NY6C 3FONA 4G6AC 4YHKL 3S3PA 5D71H 2F54D 2VLLB 3U0WH 2DBJA 3MRRA 4WFEE 1UZ6E 3T4AA 1KELL 4K7PY 1KIUA 4YUEL 3AC0A 1IKNC 5D6DC 5JMOC 2VDLH 5KVEH 2VDMH 3CVIH 2B1AH 3VXQA 2QSCH 5E0QA 1KEML 4KAQL 1K3IA 3VXRB 4MCYB 1PQZA 1HKLH 3SE9L 5H37G 3NH7L 1UG9A 3QUYD 3D3VE 3PWUB 2FL5A 4G6JH 4I2XB 5EH1A 3D39D 4M1CD 1OQOA 3RBSA 3VGAB 1HNGA 1N0XH 3SDAD 5J12B 3RL2A 2E8ZA 1UA6L 5D7IB 1UKQA 2PW2B 2QJDA 1KPVB 2XTJD 4KXZH 4PGZA 4ORGB 3BJ91 3OR6B 4UILL 3L6FB 4QRTA 4HGWB 5A3ID 3HI5L 5I1HL 2FX7L 2VKXA 3BP7A 5HY9B 3FCTA 4LLMB 5DK0A 1B0RA 1T1WA 1PGRB 1UWGH 3C2AL 1JTTA 3DRTA 4D9LH 3P0GB 1QFWH 1HSAB 4LLDB 1MIMH 3TPKA 2V2WA 5J1AA 1N7ML 4MZ2A 3TIEA 2OR9L 3L3JB 3BHBB 1ETZA 5D4QA 3NZHL 4S0UC 4EN3B 1XCQA 1E28B 1QG3A 4LEOB 3ARFB 1IAIH 1O7SA 3QQ9C 1A21A 4YGVB 4IRJC 1DEEB 5B3JF 2CLRB 2I07B 1Z0MA 1PY4A 1ZGLP 1T20B 3DARA 5E8PA 3WS6C 1MCPH 2R2BB 5E95B 4JKLA 4NQXA 3UPAA 5BV7H 4F57H 4ODXB 5DUML 2CGRL 5B39G 5CSGA 1C5BH 1SEQL 1B0WA 5I8OH 3UJJL 4J12A 1A5FL 5HGBB 3RY6A 1BFTA 1I8MB 3HR6A 5I75C 4XZUA 3IS1X 2BVPA 4TUKL 1U8MB 4F9PA 3ZE1E 3BN9D 2APXA 4KJWD 4JN1L 3TBSA 3MZTA 5GPRA 3CU7A 3KLHC 1CL7H 4K8RC 5DWUL 4HW6A 4P9ML 5D72L 4KQ4L 1Y6NR 2EC8A 3UTSD 3MJ9A 4K2UL 3B2VL 4GRWE 2HP4A 2YZ1A 1A1MB 1GAFH 3T0WA 1AD0A 4WHTA 4UT6H 4N5UA 1A1NB 3HG1B 2A74B 3V5DA 4KK5C 4H1LB 5JPNB 3QI9B 3O4OC 2J88H 2F5AL 4Y4FC 1MFDL 1S9KC 4K94H 1KIPA 4I18B 5TE7L 1HHIA 3ULUL 2F8XC 4LCCA 1ZV5A 3O2DL 3T65B 4LF3B 5GRUL 2WLZA 1LNUA 4DZ8B 4XBGB 3BI9X 3AXLB 2D7QA 1RUPL 5MP6L 1BAFH 1IGCL 4LSVL 3ULVC 5C0JB 1IGYA 3R0MA 4PJFE 4LNVA 4NM8H 3L3GA 3GSNB 1AGDA 1S7VA 4YHZH 4GAJH 4B41A 1KULA 4MLSA 3CXDH 3PIQB 5EUOE 2FWOA 4FHBD 3VDCA 3SCMD 3FQNB 5ITBL 3HMWH 4B5EA 2QHRL 5GRWA 2BHUA 3UPRA 2DOCA 3VFVA 4LRNL 3TM6A 3FO9A 3R1GL 4HPOH 4R3SA 3TH3T 1ZEAH 4OJFL 1MI5A 4YQXH 5D1ZD 2GAZB 1KNOA 4X9BA 5EZJA 4MJ4A 4BH7A 4P3DB 1EFQA 4HFUL 5F3HB 3RHWK 4Y4HB 1F4XH 1TCMA 4ZYKB 4YAQA 2X6MA 4JHWH 4HMEA 3MV7E 3LH2L 4HAGA 2NZIA 2PO6D 2DM7A 4HQQH 1J10A 1N6VA 3DRQA 3GI9L 3V6OE 5DQJB 1A22B 4PJ8A 2O5XL 3DUSB 1QKZL 3BVNB 1YEDB 1CLYL 2VLKA 2A77L 35C8H 1HHJA 5E5RB 4BFIB 3MGOB 4U1GC 2ZUVA 4MJ2A 3MLVH 1D9KC 1IGJB 3MRGA 1FPTH 1XGYH 5CCKH 4WEBH 3RI5K 3TT1H 3SBWA 4BQCA 1W0WB 3LQAL 3G6JB 4M8QA 4P23D 3UP1A 3RDTA 3DSNA 1BGXH 3NA9H 5DS8A 3RWHB 3Q5YA 4FQ2H 4GRLA 3MBXH 4HIJB 1IFHH 2V7HA 1S8DB 5D2NC 3N9GH 4JG0L 2P42B 5F1NB 3L7FA 2JCCA 3O45A 4Z7OF 1OCWH 1CGXA 1JPGA 5I71C 1Q9OA 3QUXA 3D25A 3ZT6A 4R7NA 5EN2A 1N8ZB 4PP2A 3C6LC 1FQ9C 3MV8A 1YC7A 3RWIB 3SDXF 1WITA 2OZ4H 4U3HA 4JO2H 1IARB 2HJFB 2H3NA 2NYYC 1R3IH 3REVA 2GY7B 4X9HA 1XH3A 5E8EA 4AMKL 4OQTH 1UB5B 1UQSB 4KUCD 1A7NH 4L8SA 5HHNA 1B2WL 3LD8B 5E9DB 2A6IB 5HGDA 3RVXD 4PY7B 5I76B 1IC7L 1LK2A 2IQAB 3T04D 1YEFL 2CIKA 2R2CA 4JPVH 1UT9A 2CDGB 1CK0H 3TWCH 3IVKA 1GIGL 3VD5A 3LEVH 1A7RH 3TJEL 2IBBA 4QRSB 4U1HB 3MO1B 5DLML 5BVJB 4G8FB 1UJ3A 5DFVC 1CWVA 1G9ML 2OTWB 3FB8A 4Z0XA 4NKQB 4L29B 4ZQKB 4P3CL 4GW4B 3K4ZA 4PJDA 1AXIB 3HC0B 1L4IA 4YHIB 1HINL 2WUBH 4NQDB 3ZDZF 1Q1JL 1FL5A 3DNKA 1VCAA 2UWEA 5I1IH 1EZVX 1CXKA 3F7VB 4FFWC 3ARDD 3RGVC 5JOFA 4M1DH 4ZUWA 1NMBH 2HTKC 1FC1A 1BOGA 3CSGA 1EVTC 3LEXB 1EHXA 3BIAX 5KS9B 1AGCA 5C0CD 5IKCA 3BUYA 3ARSA 3X3FH 4KZDL 4BZYA 4ZUUB 5F7UA 1MRFL 4Q6IB 2VLJB 5DJZB 5F89A 4JFYA 3S5LA 4MDIB 3SGEH 5IJKA 2HMIC 3CIQA 4P9HH 4YDKH 1QR4A 2XKNA 4OD2A 4FFEX 2EXWD 1NGXA 4XPFH 1YDPB 1P7QB 5LGHH 3VGHA 2X4NA 1H3UA 1DJSA 4RFOL 4IHOA 3OF6D 1HQRB 4M9OA 3GMMB 3AS0A 1ZVSB 3TVMA 3MNWA 1WCBB 3FHAA 4ELME 2VNCA 3R8BB 2B5IB 4HIHA 2BFVL 1T66D 3C8DA 4PJBA 2A1WH 4FOMA 5E24E 3QXDB 4PLKD 3IXTB 3GMOA 4JZNA 2AK1H 3QUZA 4YHLH 4YR6A 3GIVB 4JB9H 2EIZA 1INEH 2PTTA 3P4MA 1FBIH 4J4PC 5GQBA 4Q58C 1FH5H 2C3XA 2OSLB 1T4KA 5EZOH 4K3EH 4K71C 3ZDYE 1AIFB 1J0KA 3PWPB 1KJMB 3KG5A 4YXHH 2CDEB 4O51A 3EFDH 5JW5A 1AQDA 4M1GH 5A2LH 2JJTA 1CFVH 5C70A 4BUGA 3MLSH 1S3KL 4JHAL 3F7PC 2D0FA 2EYTA 1C08B 5FDYA 4NRXB 4NN7B 2FATL 5GRVL 5DQDH 5FGCB 2VWEE 2J5LB 1NBVH 3V5HA 4L3AA 4MWFA 1FNSH 4WFGD 4D9RD 1FCGA 1F3RB 1NCCL 1U8PB 1T22B 2D31B 3CH1A 2ESVD 4U1SB 4XVSH 5KSUB 1MJ8H 1I9RL 2Q76B 3KPMA 3MUJA 1DVFB 2YMXH 1MQKH 3E3QA 5ICZA 5EOCJ 2W38A 1T1ZA 3ARUA 4YIQB 4HXAH 4KDWA 3TNMA 4HULB 3GMQB 3QEGL 1OT2A 3GK8H 4PLNC 1YECL 2APTA 2KKQA 1YEKL 3PGDB 1OSZA 4JFHD 3FFDA 4R0LC 5EA0H 4BFGA 4N1HB 3I84A 3HAEB 4IDJH 4HD9A 5JXAL 1AD9B 3D39A 1DBBH 5KSVA 1TJGH 3QUMB 4BKLB 4PPTA 5F71A 3CX2A 3V8OA 1MLBA 4FQQB 3QIWA 5IEKB 5KJRL 4M93B 3KR3L 5TE6H 4E41E 3QO1B 2Z31A 3O0RL 3LKOB 4U4BA 3NCJL 1TITA 4HCRA 3TF7A 1BREA 1Z9LA 5F7WC 2E8YA 1T7ZA 4HKZB 4PJIE 4C59B 1OAKH 2YK1H 1JGUH 2AJZB 3AAZB 1A7OL 1I1AB 4KJYA 1BX2A 1RIVH 1JNNL 4NN6B 2WP3O 1WBYB 1I9IL 1LD9B 3RKPA 4W6XB 4RIRB 4OKVA 1X5HA 4QO1A 3L5HA 5DJ2B 2HJLA 4XPAL 3OPZH 4X7TA 4XCNA 4HUUB 1G7QB 4H88L 1JBJA 4MLIA 1OAYL 5FM8A 3GB7B 3ZYZA 1X6NA 2XN9B 2NPLX 3BRFA 3DECA 4M6OH 4HWEH 3F62A 4XMPH 3BPOB 5GSRA 4KVNH 3TBVA 2GSGA 3BDYH 2PW1A 4KTEL 3SQOH 3WN5A 5JQHC 1M1SA 4GAGH 3MRQB 2DQJL 2OXHA 3GKWL 5CINL 2CMRH 3S88L 2NTFA 3AREA 1U36A 5JHDB 1M4KA 2VKWA 1AO7A 4MYWB 3QZWG 3WUWG 3UXFA 3VRLF 8FABA 5GS0C 1OSPH 3A0OA 5JW4Q 5ACZB 1RU9H 4GOSA 5IJVA 1GHFL 2VE6A 3TYGL 1PLGL 3RIFF 4ZMAT 4PBXA 1ED3B 3G5VB 3PV6A 1N59A 2X1OA 4MNQD 1CVRA 5EBLA 1MWAA 3VFSA 2XWBB 4N0YH 4N90D 4Z5RA 4LLQA 1HSBB 3NCYS 4EKXA 1F6LL 2QQNL 4O9HH 1FYTD 3WJLA 4JJ5B 1FAIH 5AAWA 4X98B 3T0AA 4PJCA 4DAGL 2MTPA 4KUZL 2GY5A 3O4LE 4KI5C 3L1OL 2AJVL 1DL7L 4PJGE 3UTSA 1IC4L 1TPXB 3FO0L 2M8XA 4TRPL 1ZS8B 3MGTB 3DMMD 1RJZA 4U31A 1GOFA 3VFPA 3I50L 5IG7A 2IC2A 2VDQH 4QNPE 4PG2C 4LVOB 2K7QA 3KPOA 3UTTB 5T5NG 3RPIB 5CJOL 4F7PB 3S34L 3QXVA 1UH4A 1YUHB 3QWRD 2C5DC 4YBQC 3QDJD 1YPZA 1BBDL 5HI4C 4G3YH 3VG9C 4QHLB 5A2KH 3L7EA 3EFFA 3QFJD 4V1DB 2Y25A 1ZAGA 3P9MA 5C0BA 1HYSD 1A6WL 1FZKA 2R0ZH 4P2RE 3CFEA 4XVJL 5KANG 5T1DH 2HVKA 2VQTA 5J3HD 1K4DA 4NHUA 4HMDA 1RZJL 4H1LH 1A02N 1R5VB 5E2JA 1Y0LA 1NCAH 3P73A 1DQML 2FO4B 3NZ8A 1DBAH 4PTUA 1MCDA 1JNHA 4WTZA 5BZDA 5E6YA 4UUJB 4OUOA 4WCYL 4K7FB 3U4EA 2DTSA 2MMXA 2G75B 1ZANL 2J8UA 4LRIA 3Q1SL 5HDQL 2AK4E 1F11B 4X9IA 3RL1A 4DW2H 4Z7QE 5J06A 4F7MA 1FVCA 3OX8A 4JFXA 3SKNA 5C0EB 3PQYB 3CU1A 1IL1B 3GJFA 3QULA 5C07D 4Y4KD 2DQHH 1F8TL 3IAGC 3H9SB 5DVLA 4M48H 3CLEL 5D1ZA 3IS0X 2V2TA 1NJ9A 3GSNH 5TGBB 1YMHB 3L5IA 4LNRA 4P2QE 1LO2L 4FQLL 3BGAA 4NQSB 3JWOH 3HC4H 3KPTA 2PO6A 2HN7B 3MV9A 5C08D 1GZQA 2HLFC 5HXMA 5DEZA 3ZKNC 1GJIA 1ZGLA 2O61A 1S5HA 2UVEA 4PJDF 5T1LD 4ZFZB 4OGAD 15C8L 3ZTNL 5TFSL 2R69L 4PRPD 1EAPA 3TJHD 2UWEF 4YHNA 5GS1B 4S1RL 3BT2H 43CAB 3FMGL 4KKCC 1QRNE 1UZ8A 4X5XB 5D7LE 1XGTB 3DHJA 4D0BA 4KV5F 5EULV 3DSFH 1MJJA 3W9DB 1OTTD 5D2NB 2Q8AL 4UV4L 2WZPD 1ES0B 1UFUA 1JGDA 4MJID 1W72A 1T5XB 1HILB 3KDMB 1U8NA 3A6CH 3GNML 2ZPKH 4W4OC 1JPTL 3C6LB 2EYSA 1RHHA 3PWNA 3DBXA 3QPXH 3UYRH 2W0FB 4H8WL 3FQTA 5JHLH 2P1YA 4ZUSA 3VFRB 3QDAA 1YN7B 2R0LH 4BA8A 1QBBA 5DHVB 4LPTA 1HWHB 1TJIH 3MCLL 1TQBC 1MUJA 3S98A 5BVPL 3L5WA 5KVGH 4IRSC 4XP9H 2V5MA 3S37X 3DXAE 5D1XA 1WK0A 4KH2A 5BZWB 5HD8C 2COQA 2YUVA 4WW1B 5KTEL 1CDUA 5F97E 4HGMA 1KTDB 2N4IA 4JDTL 1LMKA 4I3SL 5C09D 2PR4H 4ZNEE 5I1LB 4PJBF 2ZWLT 2DQEH 5B38B 1ZLVK 1A1OB 2NY3C 4NP4H 3HN3A 2OL3A 3ZTJH 5JW4R 5SWSA 4APQC 4BQBA 3QH3B 5JOEA 3WXWH 4NKMA 1MHCA 4IS6B 3OJMB 3ZKMC 3OKEA 1JVKA 3DURA 2FH6A 4Z18A 1CBVL 1C16B 3DO7B 3AGVA 1NCWL 3NPSC 3MOBH 4FQIH 5FO7B 1UENA 4QY8B 2AQ2A 3ARDA 2BNRB 5FV2A 5D7JA 1I3VA 4RAHA 5EO0A 2FD6H 2EH8H 3BH8B 4ZXBD 3QAZC 1GC1H 2ZCLH 1ZWIB 1LDPL 5I8KH 3Q0HA 1KPRA 5EU7C 1T6WA 4D8PB 3SKJL 4HLZH 1C1EH 5HGHB 5KZCB 1DLFL 3O6LL 1CDYA 4KDTA 1C5DA 1JWMA 3ARQA 2C1OA 1K8DB 3MOAH 1AQKH 4Z7VA 4JFEB 5E4EC 5F9JA 2BY1A 3O3BB 4CN6A 5ESAA 1VA9A 1UC6A 1M7XA 1P53A 3CFKA 2ITCA 3PGCA 3T0VA 5IHZB 2G2RA 3WXVH 4LHUB 4OFYD 3K1DA 3ARTA 4UB0L 5I6XB 1HDMA 3MRBB 4DUXA 4HPYL 3EO0B 3MPCA 3MRCB 4O5LH 2YEZA 4NO2A 2NY0B 1QBLH 1X44A 4YK4C 1QYGL 1AHWA 5ANMA 3S37H 1J1PH 4ODUB 2KDGA 4NC1C 4J1UB 2MNUA 1QEWB 1RJCA 5F9DC 2EH7L 1VKXA 4WV1B 5E7FA 3ORJA 4LAJH 5GGTH 4E42A 3KPSA 1QACA 3MREB 5I1EH 1GOGA 3HS0A 3Q6FA 5IGXH 5FOBB 5E2TL 3O9WB 5INCB 1DN2A 5HHPA 4CNIB 4NUJA 4JZJB 4FZEL 1YQVL 2HFGH 4JN2B 3SKUD 5DHYB 5CEXB 2BHYA 2EKSB 2Y1VA 4NJAH 4BYHA 1TLKA 2PYEE 5TQ0L 4O4YL 4HWZB 2GJZA 2YD6A 3WFBH 3N1QC 3MJ8B 5BRZD 2DJUA 2VC2H 4H5SA 5J89A 3UO1L 4TUJB 3U46A 2IANA 1LO4L 1NGYA 3T77A 2VTFA 3DETC 4U0RB 1KIQA 3I6GB 1XF2A 1LEIB 1A14H 1CG9A 1RZ7L 3CDCA 1CDJA 4N0UA 1IGFL 4GAYB 3P40A 1MFAH 1JZ6A 2BOCB 2W9EH 5MI0B 4WUUA 1A4JA 4GJTB 2ZUQB 3ZHDA 5JTWA 2EZ0D 3QO0B 5I1AB 1IGTA 4IOFC 3ARWA 3VXMA 2C7UA 4HZLB 3QRFM 1JF1A 2X4RA 4Y2DB 1EVUA 3M17A 3HAEH 4JFFD 4PJCF 3KHOA 5DFTA 3HE6C 1YEJH 1JP5A 3FT4A 1C5CL 1RUKL 4YXLH 2K9UA 1OM3H 2E27L 1MFCL 4JPIB 4M6AA 3QUMH 3LS4L 3TBWA 2MOVA 1OGAD 1E4XL 3UMTA 1BZQK 1CD9B 4QOKE 4Y5XA 1ZA3B 5I8EB 2DDQL 3C5JA 1U2CA 3RUGB 5IBLC 3SDDB 3SDCD 4PG9B 4HLJA 4WUKL 4S2SA 4FQXB 3TIDB 3U2SA 3HA0A 1D5BB 4OZFA 5I1KH 4JO3H 3GRWL 1LP9F 1YPZF 4QRPE 4HWBA 5FKAB 2R4SH 4H26B 1EGJL 4UTAL 2P4AB 4UDUB 1F2QA 3DUUA 5CGTA 3RWEB 5CJBA 5EU6D 3GZKA 1F4HA 2QQLH 3MFGB 4Z78A 1MFBL 1CGWA 3H9ZA 4AENB 3N1MC 3MFFA 3TN0A 3CPLB 2XZQH 3RAJH 4LOUC 1IE5A 4L4TD 3L5JA 4J3TA 4GXUM 1YYML 2NXZC 3C87A 2VLRE 3DTXA 3FO1A 4MNHA 1YJDL 3O6FC 4JLRA 4GBXA 1CFNB 1JUFA 3MJGX 4A6YA 4BSWA 2YSSA 2X5PA 3EZ8A 4JQVA 3EOTL 2UYLB 3GO1H 3UBXI 1OL0A 2AKRA 4PLJC 4P46C 3SJVA 5I0ZA 4PUBL 4Q7DA 4CJ1A 4UNUA 4NKIH 3BKJL 4XNYH 2VLMD 4PB0L 4R7DA 4WU7B 2HTLD 4FFVC 3G5ZB 1RIUL 2BOBA 4M5ZL 2D7PA 4MA3A 4PTTB 3LIZH 1PZ5B 3SKOA 3DMMA 4X99B 4GKNA 3GBNL 4JM2D 2B2XL 3CFBA 4TQEL 2IBZY 4F7TA 3MGAA 1P4BH 1ADQH 4ZS6C 5EOTA 5GZNC 5GGRA 1FP5A 5IMKB 3PG2A 4I9WD 2H8PA 4GW5A 4I1NB 2ICWI 4PR5B 1BFVH 3QWRA 3I02B 4NO0A 1ONQA 4MB4A 5T3XH