1FFPA

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/signaling protein
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
source organism Mus musculus
total genus 72
structure length 273
sequence length 273
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ffpA01
2AXJA 1EFXA 3S5LA 4OZFA 4KK6D 5ILTH 3WCYA 3UAJD 3MV9B 4Y5VA 1WIUA 4P46A 2JIXB 3MACL 4ZYKA 3OJDB 4YHIA 1DBBH 1J86A 4E42B 1FGNH 4ZODA 4FFWC 4OCRL 1CL7I 5JPNB 1YEKH 1CD1A 3M1BA 3WNPA 5EOCJ 3DV4A 3FQNB 1UZ6E 3VFUA 1MCBA 1CN4A 3RX7A 4ZS7H 5GGVY 4JFOA 3RPIB 1O7VA 4H0IA 3S3JA 4RMWA 3VFVA 1ZLUH 4OGZA 2WUBH 3G08A 4OCWL 1GC1C 2Y07H 4X4ZA 2VIRA 5IFJA 4RIRB 3PWNA 4HIEB 2DWEB 1LE9B 1C16B 1OB1A 3T0ED 3L3OA 4DUVA 3U9UA 4Y5VC 4I4WA 2VR9A 2DBLH 1N5YL 1UFUA 1CR9H 1Q0YH 1RJLA 3AMLA 3ARGD 3KPNA 4MQSB 2I9LA 1WTLA 1YUHA 2ESVE 3SDCA 4R6UA 1ZA6B 3JWDH 1CFSB 4MJIB 5MERB 1ZGLB 2W0LA 1S5HB 2X4NB 1JWSA 2OTWA 5SWQB 5BMFH 1S9KC 3N1QC 2CIIB 1EX0A 4DGVH 1ZVSB 1A6PA 1WFOA 1YQ2A 4LQFH 4MNQB 2W07A 1NSNH 3LN5A 4ONHB 4UZGA 4HV8A 4XPBL 3X12B 3IU4H 5AZEL 1NKRA 4QRUA 1MPAH 4OZGE 4M5ZH 4NBYB 2CGRL 2OQJB 2I5YL 1JTTA 4U1JA 4P9HL 4HMDA 1ZT7B 4LLAA 1SEQH 1RZGA 2J2ZA 1T22A 2AXGA 3QIUB 1CU4L 1MF2H 3FL7A 4ZQKB 2CXGA 4HKBA 3WYRA 4I13B 3BWUC 5F71A 2XKSA 3PWJA 4YO0A 5CHNB 5DA4A 3BW9B 3RU8L 1TZIA 2A1WL 1XGTB 1QSZA 3UTZB 4YHYB 1P4BL 5FA4B 2A6KB 5HGGS 4L3AA 3PQYB 2YRZA 1INDL 1UC6A 4KUZH 1EFXB 3S5LB 4OZFB 3VE0A 3VXRE 1MJJA 1AO7E 4P46B 1OF2A 2HT2D 4JN2B 3MA9L 3CIQA 5AWNL 4YDKH 1PEZA 3VWJA 1R3LA 2ED9A 5DJAA 4I0PD 1CK0H 3IKKA 4JKPL 4LPCA 4R0LC 3M1BB 1I7UA 3DV4B 4YHZH 1RQ5A 2YBRA 3VFUB 4PR5A 3BD4A 5ELIA 2DDQH 4XWOD 1H5BA 2Q3AA 3D0LA 2JK5B 4MD0A 2FWOB 1JL8A 3G08B 5DGQA 2KZWA 1D5IL 2YD1A 5BZWA 5IFJB 1MFEH 3KDMB 4Y4FD 1OB1B 3CJJA 3CZFA 2N56A 3HAEG 4FTVE 4I4WB 5AUMA 1MNUL 2H2PD 1JGVH 3BKCL 3M8OL 5D2LA 4DK3A 2M1KA 4HEPG 4NOFA 3WFDH 3QXAA 4PREA 3VWJC 1DBMH 1OARL 2I9LB 3PV7A 1P53A 1U58A 4NZJA 1YUHB 3SDCB 1MWAA 2VLRB 3TBSA 2VZVA 1YPZF 3KJ6H 3CXDH 1JWSB 4MA1B 4Y19A 5JZ7D 3ZLQC 4OFVA 4WEMB 2C3VA 3HNSH 1JGDB 4WV1C 4KK8C 5F7YC 2PYEE 4LFHD 4JPKL 2BRRL 5IVZB 2J8OA 2BY3A 3FQUA 3LN5B 1NUDA 4RFNB 5CLWA 4QRUB 3DARA 4NC1C 5FYKH 3QWOA 2GSGA 1KN2L 1NGPL 1GL4B 5I1IH 5FO9A 2NW3A 3WE6B 1N59A 1WV7T 1T22B 2AXGB 3QUZA 43CAB 3T2OA 1A3RH 5IHZA 4HKBB 1UQSB 4KTYA 4DCQB 1RZKH 3U4AA 3PWJB 2ZCKH 4XP5H 1QHPA 2XRAH 4LSVL 1TZIB 2PF6A 1QFWH 3GMOB 1HQRB 4GS7C 3QAZC 3VE0B 5EOQL 2MTPA 4XXCA 1MJJB 3GMQA 4AIXA 4KDVA 2LTQC 3CH8A 4I0KA 1MCIA 1YN7B 5FYLE 4JQIL 5FGCE 5FM5M 4KHXL 3BIAX 3JV4A 4Y7MA 2WUCL 4PR5B 3OMZA 1T21B 5FYKU 3QDMD 1H5BB 3SDDB 3D0LB 1TETH 3BXNB 5E9DE 2YSSB 3BO8B 4NWTL 5BZWB 5DR5L 4BQBA 1RURH 3D85D 4XH2A 4XXCC 4XWGH 1YJDL 3IRPX 5D2LB 5AUMB 3BD5A 3QXAB 3U7WL 2DLTA 2ZPKH 3R8QA 1MWAB 2EC9U 4X8JA 2OR9L 3TBSB 5FHAL 5EU6D 2E7MA 2UYLA 4RGMC 4KXZI 1NC2A 4Y19B 1J9CT 3SE9L 3S97C 3GSUB 4ZUSA 2GQHA 2XTJB 1WFTA 3BPCB 3CCHA 2VTFA 3N1FC 5JXEC 5ISZD 1L7TL 1E4XL 4EN3A 4QWWD 4MNGA 4FG6D 4D0CA 3ZDYE 3WDJA 1MI5A 2O5ZL 5DFVC 3TJEL 4P2QE 4ODVL 3BD3A 1G7HA 5EO9B 1CVRA 2IH3A 2EYRA 5DRNB 2IG2H 5I1DB 1DE4A 1FN4B 3OWEA 4NQEA 2JCCA 5FO9B 2NW3B 5IBLD 1EUTA 1ZEAL 1N59B 3MRNA 5HI4C 2DMKA 2A0LD 3QUZB 4HKZA 4MCZA 1OP3H 1KNOA 3ROLB 1NUNB 5GJTL 4CU8A 4MSWB 2ARJQ 4NKQB 3RVTD 3CSYB 4L3EE 3HHRB 4JN1L 3QCVH 2DM4A 4R4FL 4MAYB 3BZFA 4X6DE 2EDFA 2BVQB 3VDAA 1RJYB 4KHTH 3UC0H 3U36A 3VRLE 4Q0XL 5JUEH 5GGTA 1ZLWK 3VD5A 3N1GC 1K4DA 1S7UA 5A2IH 4KVNH 4MXVE 4WWKD 1KPVA 1FNGB 4UAOB 3QQ4A 4TSCL 4JVUA 1YEDA 3OSKA 3A0OA 5GJSH 5C3LD 4KU1A 3DVFA 5F89A 3CDFA 5JDSA 4LCWD 3W0WA 5I1KL 3KPOA 2RR3A 3MV7E 3S4SB 1DDHA 1A7BA 1EVTC 5HDOA 4PP1C 1DFBL 2YN3A 4XP4H 4LARH 4XH2B 1WZ1L 2BDNL 5E1AB 2H9GB 3BKJH 4IIQB 3HG1D 1P9MA 5J6HB 1RZJC 1U41A 3OGOE 2AQ3A 2IPTH 2NYYD 4OQTA 5HGAB 3KWWB 4R2GB 4X8JB 4LL9A 2UYLB 3HNTH 1AC0A 3CVIH 3KLAB 3VFSB 1PSKL 4R96B 4UT7H 1XIWC 2DTSA 1ZTXH 1MFNA 2ZKHH 1CLZL 3CCHB 4R90L 5E2TL 4PGEA 3C6LA 2A38A 3SDXF 4Z7WE 4EN3B 1A22B 2W9DH 1JV5A 1CE6B 2ADIA 1XGYL 3HFMH 1G7HB 1AC6A 2D7QA 2DLIA 3TVMC 3WKMH 1LO4L 1IE5A 4RSVA 1Q9WA 2EYRB 2HG5A 3DX9B 2QQKH 2YRPA 1DE4B 5MI0B 2E9IA 4OM0L 5D2NA 3M07A 4GQPH 1MCOH 4NQEB 2JCCB 2Q8AL 3DSNA 4BFGA 3O4OB 4OUUA 4TPRH 3V5HA 2EDRA 4HKZB 4QRPA 1LO2L 3ECBB 3TPUB 2X1XR 1T03L 5DD5H 1FYTB 1WLHA 5DF0A 5DC9B 3T04D 4QRRA 3D6GA 1LVEA 1OD9A 4FFVC 4LIQL 3C6LC 5KG9A 3I84A 1KGCD 1UJ3C 4J3SA 5IVXB 1WTGT 4NO0D 2IQ9L 3K2MC 3OAZH 3U36B 3RZCC 2R56L 2EEDA 2NY4B 1T2QH 3IFPB 4TNVF 1I9JL 4MZ3A 5GHWH 4LRIC 4GKZA 1I9IH 4KJWD 4JRYD 5C7XL 4QRSA 2PETA 4G8EA 4F57L 5BW7A 3UO1L 1X5GA 1EMTL 1YEDB 4K3JH 4G59A 1BQHG 3MLWH 1ZHNA 3U4EA 4E0RB 4UOW1 4MB4A 1QACA 5CEYA 5JDSB 3W0WB 4KK5D 2CRYA 2DQEL 3KPOB 3HI6H 2Z31B 2VN4A 2WK2A 2F58L 5CJXC 3CFCL 4U1NA 4ETYA 1JZ5A 2I60H 2CKBA 3SKMA 1OY3B 4YEFA 1JPGB 1EJOH 4FQQB 3QEQA 5CGMA 5BW7C 4X7DC 3EYUL 4RA0C 4V2BA 5L7XH 2PTUA 2DAVA 1F4WH 1MHEA 2ADGA 2GJJA 4XGZA 3ULVC 1CDGA 3FRUB 5IBUB 4WUKL 3CH1A 4Y2DA 5LCVH 1AY1L 4PJAA 3IDYB 3BRFA 3TT1L 5T1DL 2OTUA 4PJGB 1CXHA 5FOBA 3LV3A 5MENB 1UB5A 1BZ9B 4GG6F 1TIUA 4YC2B 4PGEB 3V9FA 2MPAH 4OV5A 1U42A 3SKJL 3V6OE 1VERA 5EULV 3D39B 4Z7QF 3D3VE 2MQ3A 2ADIB 1OP5H 3TO4D 1F4HA 3G6JE 4X5WA 1UM6H 1UVQA 2XA8H 4F7MA 3DTXB 1Q9WB 1S7WA 4R8WL 1K3ZA 3JTCA 2M2DA 4MA8H 4NUGL 4PJEF 5D2NB 2CO7B 4B0MM 2OZ4L 3CFDA 3PHOA 4OUUB 1BX2B 1DVFD 4Y2DC 4QRPB 4J12A 4JO2H 5F70A 1C1EL 1IC1A 3UZQA 1H3UA 4XNQA 2VJXA 2VLME 3U7AA 4PUBL 5HYJA 2E7BA 1MEXH 2V17L 3HUJA 4KPHL 4OLYH 1B0RA 5DK0B 3SGJA 1JHLH 3NFSH 1IQWL 3VG0L 3DXAE 1G7IB 3WO4B 4JO1H 4D9LL 4GKZB 4EIZC 5L2JA 1KFAH 4LSQL 4UT6H 4PJ9A 4G8EB 2AJ3B 1MHCA 4G7YH 4HMCA 2VZUA 1ZHNB 1A1OA 32C2A 3RGVA 3ZT7A 2RJMA 5HVGB 3VU2A 5IEHA 4NHCH 5DXWA 5DC4B 4PRPA 3MFFA 3DV6A 2ESVD 2AI0L 1I1AA 25C8H 2GTZB 2DD8L 2HKFL 5E6IA 2HT4D 3OB8A 3W9EA 4PJXB 4U1NB 5I1JH 2CKBB 3KPRE 3QI9D 3SKMB 3IS1X 2EXYD 1MCWW 2X4SA 2ZUXA 4JGUA 2F9BT 4HJJL 3QG7L 5J0BA 3GHEH 3SJVA 1J0YA 3MJ8A 5I15H 4HCRA 1MHPH 3MLVH 3WS6C 4ZD3H 4HUMB 4QTIH 1MAMH 4XPAH 3GUTB 3SDAB 2J6EA 1MREH 4NKOA 5C0BA 4OTXH 4WUUB 1T7WA 2QSCH 5F9JA 4PJAB 5C0JA 5C08A 5FOBB 4ODBD 3LV3B 1UB5B 3WFBL 5E6IC 4MJ5A 4OKDA 4YZFE 5DDHB 4OV5B 5HYQB 4TVPH 5HGDA 4X5WB 3BSZH 1RK1A 3VWKD 1SBSH 1KB5A 1UVQB 3LB6D 3EO0A 5DWUH 3LEYL 5TQ2L 1N4XL 1S7WB 2GK0A 4NP4L 2Y25A 2VISA 4BFIA 4X6FB 4X99A 4JY5H 1I4FA 2D9QB 2CLVA 4YX2H 1Z6JT 1IL1A 1F8TH 2LAAA 2VXSH 3PHOB 3E3QA 3VXSA 4KJQC 3ZE1E 3VXRD 2O61A 2KH2B 5M95B 4XNQB 2HJKA 1H3TA 5FECA 2V5SA 3HUJB 4WFGE 5IJVA 2R4RL 1P84J 4UTAL 4ODXA 1WICA 2D31B 3P0VH 3UJJH 2DYPA 4DKAA 4MLSA 4OGYH 5L2JB 4CJ0A 1G9ML 3T09A 5DJYA 1AGCA 1MHCB 5J9PB 5I75C 3EOTH 3GMMA 2A6IA 2BXYA 3TCLB 1OPGL 1HHGA 4FTVD 4I3RL 5FDYA 1B4JL 4W6XB 1A1OB 2F5AH 32C2B 3RGVB 1H8SA 3TNNA 3VXUE 1T66D 4KI5E 1GAFH 1A6AA 3DV6B 2ICWI 3DO3A 5LBSH 4ERSH 1OAYH 2RIKA 1I1AB 4MQXC 3TNMA 4XI5D 3RVUC 3W9EB 1RZIA 1J5OL 5ANMA 1NCAL 5EIQA 1UXWB 4NN6C 5C0FA 3L3KB 4KTDL 1G6RH 4K94C 4WI6A 3SJVB 3MJ8B 1I9RL 5D1QD 2IJ0C 2H6PA 2HMID 4MJ6A 2HTKC 5F88A 4NKOB 2B2XH 4DN4L 3P73B 4G6MH 1FLRH 3TBWA 2APVA 3ARBA 5C0JB 4M6NL 3EFDH 4R9HA 1E4WH 2BVPB 2Q3ZA 3WMSA 4F58L 4PBVC 4KRLB 3MXWH 5I1EL 3C60D 2BERA 3DYMA 1PZ5A 3L3HA 2VXQH 1TNNA 2QEJA 5FKAA 5HDLA 1KUMA 1RK1B 2B5IC 1KB5B 1KJ2A 1C5BL 1MRCL 1WIOA 2DQHL 4XAWH 1OTTD 4CUCA 1TVHA 3DUUB 3REWA 3WFHA 5EZIL 5IHUL 4Z77B 3O8XC 5KVFH 2YXFA 3UJTL 3RY6C 1X4ZA 1I4FB 2CLVB 1T89C 2R2BB 3EJJX 5KSUB 4M5YL 3VXSB 1MWAL 5HI3C 1MELA 3WUWG 5IESH 4KH2A 1A1MB 2W9LA 2HJKB 2NLJA 5IJKC 4KUCD 3G6AA 5FECB 2J1KA 2CLRA 4TQEH 5EUOF 4ODXB 5T3XL 3QFJE 2MHAA 4YPJA 1MHHA 2YD4A 2DYPB 4IRZL 1VADB 1OSPL 5LGKA 5GZNC 1KCUL 3I50L 2E7LE 5CEZL 3QRGH 5E9DD 3Q5TA 4MD5A 4XMLH 4POYA 1JNLH 3NA9H 1IARB 2A6IB 2Q6WB 4XPHH 4KTEH 2AJYH 3TH3T 4QNPF 4KUCF 4JO3H 4U1SB 5KSAD 2OP4L 1I1YA 3K1DA 2EDQA 3T3PE 2B0SL 4O58L 5DFWH 5IT2L 2DQUL 4JG1H 1A6AB 1NLBL 3HPJA 5JQ6H 5K59E 1IC4H 4OFKA 3X13A 3WXVL 3TNMB 1JZ2A 4LPYA 1RZIB 4YXKH 3LHPL 5ANMB 1X5XA 1HKLL 3MUZ1 4UV4H 4J6RL 3HR6A 3MZTA 1IKFL 5EG6C 2HRPL 4RFOH 2J8UA 4YAQB 3VMNA 5C0FB 2YPVH 4LHQB 1CDUA 4EI5B 3EYFA 1KJVA 2EKSA 2F53B 3JWOC 3FT4A 4OZIF 3VRIA 4M1GH 1ZMYA 4WFFE 3UTPE 3GMRB 3BRDA 4P2QD 5F88B 3FB7B 4KC3B 2QTEA 3LMJL 1NGWA 4P3CL 1LEGA 3ARBB 5HJ3A 4PJCE 3EYSL 3O3DA 2NXZD 3V4VL 4RFEA 2VABB 3FO9A 5HHVH 4G6AD 3TO2A 5CP7A 5D6CA 1PZ5B 3L3HB 4L3ED 3UMTA 2HJLA 1W0VA 4K3HA 5HVWA 1KJ2B 2WBJC 1UM4L 2AK1H 1TVHB 2X05A 5JOEA 1ADQA 5I6XC 2UZYB 3QCUH 1UYWH 2P8LB 2NXYB 2CUHA 3AY4A 3BIBX 3B2UC 1XMWA 1SBBA 4BZ1H 5CINL 3HAEB 4JFYB 1OWRM 3C5ZA 2E9JA 3QHTC 2HVJA 4FZ8H 3BQUA 4Y5XC 5E94B 3I6GA 3W11D 4H88H 3G6AB 1PD6A 2JE8A 3TJHA 2ORBH 5EC2B 1NUGA 4CN4A 3MBXL 1I8LC 4P2OC 3CFEA 4XPGH 1C5DA 4N0YH 5CIPB 4PY8J 1MHHB 3I6LE 4UT9H 4OV6F 4HLJA 3TBVA 3EZJB 4KK8D 3OV6A 4JQVC 4J4PC 3OXSA 3MV7D 4PY8I 2Y36H 2XKNA 3MJ9H 5DK2A 1M7XA 3V4UL 1CCZA 3VFPB 4PJBE 3T3MF 4NQSA 3O3EA 1JZ6A 2Q7YA 2GFBA 3NABH 4MMZC 3TJHC 1BD2A 3H9YA 3HPJB 1RMFH 3RDTC 1A7RH 3CU1A 1FH5L 4M03A 4X98A 3X13B 2YEZA 5HHOE 3Q3GA 5C0AE 4P5TA 2CK2A 1O5DT 3MRBB 3RX8A 3WLWC 1I8KA 1DBAH 3MOAH 1J0JA 2MOVA 2WWMC 3B8SA 4N8CH 3D69A 1SJHB 4PS4L 5E00A 4CDGC 1MCHA 4PJ5D 1KYOK 5GGTL 5IW3A 1WZLA 1QSEE 1A14H 1N6VA 3FT4B 5GZOC 1I1FA 2IAMD 1EEZB 2ED7A 1AGFB 1RZJL 1KCRL 1LDPL 4P2RE 3HE7C 2YD8A 1NH6A 1LEGB 35C8H 5HJ3B 1C7SA 3KXFE 3ARXA 1YEFH 3FO9B 5D5ME 4ZUWA 2ERJB 3TO2B 5E8OB 4IRSD 4RA3A 5CKGA 3ZYZA 4Z18A 4MYWB 2YD9A 1T1WA 4M7ZB 4LVHC 5J12C 5FO8A 1HNGA 2PKDA 1FAIH 4P59H 3IJSA 4GRWF 1A7NL 5T5FH 1WJ3A 5L2KB 2VZOA 1K4CA 5CILL 4OQTL 4M7LL 2LAGB 2YUZA 1MRFL 4CW1A 3G5XB 5ICZB 5I18L 1R24A 2W92A 3W2DL 4NRZA 2AEQH 4OD1L 4OBRA 4IDJH 3BQUB 5BRZA 2K7QA 3I6GB 2I26N 2ITDB 3B9KB 3WO3B 2FGWL 3AAZA 1F97A 4LLWA 3CFEB 3CUPA 1C5DB 2KKQA 1H3PH 3MV8E 1IC5L 4YBHA 5GSVA 2VLJA 4XP1H 4JY4A 3TBVB 3ABZA 4G9FB 3AU1A 2AGJL 3BDXA 4OCXH 4BKLA 1L4IA 4Y4KD 5JA9A 2XN9A 5JXED 4FABH 5DK2B 5J1TC 1AXTH 1Q94A 3H6JA 5DFVD 1DSFL 4QXUL 1A4JB 2Q8BL 2EZ0C 4F9LA 3O3EB 4LSPH 2GFBB 4NDMA 1JTPA 1OLLA 4B5EA 3OGCB 4JDVA 3CZJA 3KVQA 2Z35A 4X98B 4UNUA 1T0NA 3K46A 5FK9B 5HI4D 2NY1C 4HD9A 4HZLA 4OD3L 2GJ6A 2R9HC 1I8KB 4EOWL 2XWTA 3D69B 1FV1A 4Y2OA 3HMWL 5I9QB 3TZVD 1I1FB 1KCKA 3R0MA 4GG6E 3OB0K 1FG2A 3H9SD 5HPMA 2RBLA 4GRMA 4AMKH 1PY9A 2ATKA 3FTGB 3NIDE 4ZUWB 4NZUL 2B1AL 5F7MC 3ARZA 5E08L 4FFYH 1BQHA 1VEPA 1WCBA 4ELMA 4EDWL 2XYCA 2VLMD 1BZQK 4RQQB 1T1WB 2VERN 2CKBL 3O3BA 4Y1AE 3R0NA 1M05A 3QDJB 4DEPC 3IJSB 1KV3A 1QSFD 3BAEL 4HXAL 2VQ1A 2V9RA 3C09B 4PIRF 5JLZA 4PB9L 1EHLL 1DZBA 2QQQA 5TJWK 1K4CB 4GG8A 5D7KD 2HWZL 3P11H 5F7UA 4N1CA 1FP5A 3P40A 4PP1D 4CW1B 1IEAA 1OAXH 1QLEL 5C0RL 4NRZB 3KPQA 4GW4B 5I1CL 3GEWB 1JGLH 5FYJH 4J3OC 4OCSL 1J7VR 3AAZB 2QR0A 4LLWB 1ZKAA 4QHUB 4X9IA 2YXMA 2D4DA 1J8KA 1E27A 4E5XA 2VLJB 1AI1L 1IM9B 1XIWD 3AU1B 4BKLB 4LCCA 1XR8A 2A77L 1DLHA 4JB9H 2NY3B 3UYOD 3FZUD 3O6ML 1TQBB 1DQJB 2JJUA 4XVJH 5EU7E 1Q94B 3G6DL 4JO4L 1P7HL 4HIHB 4PJFA 3RWJB 3TVMD 3BKCH 1U0QA 5HDBE 5BCAA 5ITFA 3K81A 4JDVB 4L5FL 4OB5H 2FRGP 3GBNL 4DVBB 2Z35B 5EU4A 3VMOA 3K2UH 5LXGH 3KPSE 4OCLC 3CFJA 2GJ6B 4M7KL 1ORQA 1TXKA 4LCCC 4RGNC 5FYJU 1FV1B 3ARYA 4LCYA 4H8WH 1KCSH 4WTZG 4WU7A 1SEBA 4ZTOL 5IUSA 1DL7H 5IFAL 2VWEC 3RZCD 4IHOB 4LIQE 1TDQA 3ILQD 4KMTH 2EYSA 5ALCL 3TA3C 2Y5TA 3QR2A 4LSUL 1LNUA 3OJ2C 2XWJA 5F8RC 3S35H 2AABL 2APWA 4Z7VB 5IVOA 2DQIH 2AEPH 2IPUK 3TP4A 1GPOH 2P4AB 1UCBH 2VR5A 3QO0A 1V7NH 2SEBA 4PYGA 1BQHB 2FB4L 4NQCD 1WCBB 3LS4H 4ELMB 4N5EC 4J1UA 1A9EA 3DGGA 4KRPC 3O3BB 3ZMRA 4LCUA 1M05B 3AC0A 4NKDA 4F15C 4WFGD 3PGCA 1ZK9A 1MCRA 1CFTA 1QBML 2VQ1B 4OFIA 3IKCA 5JLZB 4MA1C 4HCRL 5GISL 3BZEB 4FQXC 4ODWB 4JE4B 4J3UA 4JG0H 2J6EL 3O6FC 4Z0BH 4YHNB 5EFIB 1YY9D 1LEIA 2XQBL 4DN3H 1PG7H 2DM7A 1AJ7L 4RFNC 5IMKB 4YQXL 3O6LH 3ULVD 5IB3A 2QR0B 4ACPA 2ZG3A 3BI9X 3MV9E 5CZXC 4G6FB 3VXUD 3RWFB 1E27B 4DGYH 4E5XB 4KI5D 1XCTA 4HS6A 5E8PA 4Y0GA 1J87A 1XR8B 1KB5L 5GRVK 5JW5A 1DLHB 4PRNA 2I9TA 1FNEA 3H0TB 5KVDH 3EO9L 4NJAL 4Z76A 2ZZUT 1MJ8L 3IXTA 5DR5H 5DD0H 5DQJA 5M7QA 3FAXA 3ULVF 2PYFB 4XP9H 5FCUL 1LK2B 3WSQL 1MFCL 3A6CH 1P5UA 4MDJA 4XC1L 5DO2C 3SO3C 1WWBX 1Y0LA 5LAXA 2BNQB 1G7JB 1JNNH 1BBDL 1OCWL 1UZ8A 5SWSB 1FVEA 2OR9H 3MOBH 5EWIL 3AGVA 1FFPA 1IZJA 1ORQB 5IB2A 4TSAL 4Y16C 3MJ7A 3QPQC 4LLVA 1Z0NA 5E5RB 4LCYB 3U0WL 1U91A 1S7RA 2VC2L 3I02A 4MJIE 3UTSA 4WU7B 5TQ0H 3MX0A 1SEBB 4FFZL 3VH8G 1E6OH 4UQ2A 2CDEA 1IJ9A 4EEEA 2UVFA 1HILA 1T04B 4EXPX 2XWJB 5C0CA 2VDRL 3BESR 3TGXA 4AY0A 2SEBB 3UJIL 4GXUN 1A9EB 3MRCB 1JWMA 1NDMA 5BVJA 4NKDB 5DZOA 3VDBA 3UTQA 1CFTB 3HPLA 1LP9F 3VXNA 3QFJD 2IANA 5FKPB 4HSQA 3ZKXC 2HVKB 5IW6A 2XTJC 1HYSD 3DUHA 4Z6AT 2VLLA 3PDOA 4AEHL 4HJ0D 4ZNEE 4Q0XH 3U30C 1LEIB 4F7PB 4Q6YA 5DSCB 3TV3H 1RZ7L 4HC1H 3RWIB 4APQD 4IRJC 1GH7A 3CD4A 3HRPA 3PQYE 5IB3B 2ZUVA 1EZVY 3IDIA 5ID1A 4HS6B 3TIDB 4LSSH 4G8IA 4NRYB 2IALA 3ULSA 3PP4L 1KJ2L 5JW5B 4PRNB 3PDDA 1NANH 2BK8A 2DQDL 2V5MA 2I9TB 1CTOA 2QQNL 4FZEL 4NO2A 2DLGA 3WD5H 1P7QD 1L6XA 5DQJB 2R69L 2BVOA 5CD3B 2J88L 2KZ1B 5FA3A 2OS7A 2QKIA 4WFFD 3UTPD 1CDCA 4Y4HA 1Y0LB 5LAXB 5T1KA 2FBOJ 4RZCB 5A16A 4XBEL 5EO1A 5CJ8A 4KJQD 1FVEB 4DZ8B 3WUWA 1MLCA 4G3YL 2X4TB 4J3VA 1DANT 1FFPB 3RHWF 4O5LL 4U3HA 5FGSA 1QBLH 5IB2B 2CR3A 3MMEB 4LLVB 4XPFH 3RWGA 3ESUF 4AEEA 4ZFOA 4AIZA 1U91B 2VLRE 5KANI 1S7RB 3I02B 4U1HA 5CLTA 4I3SH 5DQ9A 5T1MA 3UTSB 1U8JA 1Q0XH 1QPXA 4FQCL 4L1DA 3F7YA 2G60L 3JWOL 2YOCA 1LILA 3IJHB 1KACB 1DBJH 1HILB 2Z8WC 3S3PA 4N8VG 5JTWA 5C0CB 4HIXL 1WF5A 4KRNA 4U33A 2VDML 4LNVA 4W4OA 4ZXBA 1TCRA 4WEBL 4IIQC 3BGFB 1JWMB 1RUAL 1P7KA 1MRDL 1U36A 1SJVA 1NDMB 2XZQL 3AMKA 2BXZA 4L8DA 3U9PH 3T8XB 3EIFA 4MQXD 3MGAA 2IANB 2MCG1 3WFEL 3RVWC 2IQ9H 3ARDB 3ZHLA 3JV0A 4H25A 1KCVL 2APTA 4LU5L 5DS8B 3Q5OA 3IDMA 4YEEA 1I9JH 1ZHBA 5DHVH 3HRZA 4ZXBC 2JJSC 5EU3A 4PV8B 4PLOB 2VAJA 2VXVL 1CE1L 3RWEA 4O2CA 4KY1H 4I18A 4WGVB 2FBJH 3KJ4C 5D70H 4P23A 3NH7L 3KLHC 5HHOD 1NAMH 5C0AD 1ADQL 4AK1A 1CL7L 1FZMA 2RCSL 1QLRA 1VFBB 1KJ3H 1JGEA 3D87B 1G6VK 1CBVL 5C07D 5EOCL 3DYPA 1F3DH 2BVOB 3RFZC 3R06A 4QHLB 3TFKC 2QKIB 5DJDB 3O8XD 2BSRB 4JKMA 3ULUC 4UDUA 1JN6B 4Y4HB 2R1YA 2G5RA 3LY6A 2VDPH 4P2RD 4HX1A 5D2LE 1YNLL 2C3XA 1RPQA 2DQTH 5FF6B 4P23C 3WIFA 1VKXB 3KXFD 1ITBB 1KLFA 4L4VA 3RWGB 5J1AA 4AIZB 4NFBA 4XMKL 5T1MB 5D7LA 5K9JH 1U8JB 3L3JA 3SKJH 3F7YB 4Y19E 1RUKH 3LIZL 3VFTB 2Z31C 5GZND 1QR4A 2NY6C 4IOFC 5T3XE 5L88L 1Q72L 3NVQA 3DMMA 1NBZB 4PRHA 4F2MB 3B9EA 4LPVA 1YZZA 1TCRB 1JZ3A 2AV7B 1HK6A 2HH0L 5CEZE 4D8PB 3QIWC 1C1EH 4X80H 2DKMA 3RA7L 4PBXA 4XB8A 5J13B 4GT7A 4HKXA 4QGYA 4UTBL 1HIMH 2F54A 1L7IL 2DQGL 1ZWIB 4U6TA 1YY8A 1W72B 4HAGA 4ODUA 4H25B 3LEVL 4V1DA 3IDMB 3WN5A 3DMMC 1ZHBB 3MLYL 1A6ZA 1WT5A 2P42B 1MVUA 5I8OH 3HRZB 4BZYA 1XR9A 4JM4H 3FOLB 2GIYA 1DQLH 3VI3F 3GMPA 1I3RA 5BV7H 3FT2A 4O2CB 4M1DL 4I18B 5TFSL 3MUY1 3C6SB 1UKQA 3MODL 4W6YB 1U8PA 3NPSC 3GIVA 4M48L 2X44D 1RK0A 4Z7NF 2CIKA 2VE6A 1FZMB 2EECA 4LDEB 1BVLB 3G5VA 4UBDC 3KPLA 4LHUG 5IQ7L 3WN5C 4P0DA 4EKXA 1VCAA 5ERWB 3STLA 2WBJD 1GC1H 1GXEA 1U8LA 3F7QA 5IV2A 1RJCA 1WCQA 1IAMA 2XACC 3R06B 3QG7H 4GRLA 4UDUB 2R1YB 3B2UD 2MCPH 1PX4A 4KJPD 5J89A 1UM5L 2BNRB 4HX1B 5KZCD 3DNKA 3O6KH 4JPWL 1CIDA 3KHOA 1AGBB 5FGBA 5D1ZA 4L4VB 5J1AB 2Z9TA 1FSKC 2PO6A 5AZ2L 1TMCA 1H3VA 2J8UF 5D7LB 4NGHL 4P2OD 1CTNA 3L3JB 1N5AA 1S5IH 1VFOA 4X6BA 3QXDA 3BN9D 3QWRA 4NIKB 4Y1AD 5T3ZL 3RTQD 1WGOA 3GI8H 3DI2B 5KANG 3BT2H 1P1ZA 2MJWA 1KEMH 2FX7H 4LFHG 1PQZA 1GOFA 1RHHB 3GB7A 3VGGA 4MNGE 3QUXD 4WY7H 1OSZA 3IB4A 4WO4A 4CL7A 3P77A 4PJDA 4S0TD 3HC0B 2XG4A 3UYRH 4UUJA 2D7TL 5FGBC 3ZDXE 5D1ZC 2F5BL 1V05A 2X1WL 4ONFH 3EFFA 4N0CA 4BFBD 4NQEE 1PFCA 2JCCE 3S3SA 3RDTD 3KHQA 4Q2ZB 3NAAL 1JMXA 4HK0A 3GGWA 3TPUE 1FYTE 1L9MA 2F54B 3LRGA 5GGUA 2X1QA 1YY8B 2D9CA 3FO2B 3NIFE 3WLWD 4PG2C 2ICWB 2FO4A 2WWMD 4V1DB 4K2UH 4M6AA 4WI7A 5AD0A 4HHAA 4XNYL 5IVXE 3PP3K 3BKML 1MVUB 3ZE0E 2CMRL 3VCLA 5GZOD 1XR9B 3FO1A 4YDVA 5IM7A 2P24A 5DFTA 3ULUE 3HI1A 2QL1A 3Q6GL 3PDGA 3FT2B 3ZDZE 1FL3B 4PJIB 3HE7D 2ZUTA 1NFDF 4HLZH 1GVIA 1FFQA 1NMBH 1U8PB 5IEKB 2NY0B 4MB5A 4DGIL 1DEDA 4NWUH 5EA0H 4CU7A 1RK0B 1KELL 2CIKB 4LK4A 4NCDA 2VE6B 4G9DA 5DHYA 2VLKD 3KPSD 3LD8B 5TE4L 1HXYA 3W0WE 1KTDA 1UWGL 2IADB 2ZUQB 5IV2B 2D03L 5H2BA 1OAZL 4GRLB 4AIOA 4X6EB 2GCYA 1DANU 2VRAA 3I6KA 5TE6L 5KJRH 1QFOA 2WWKO 4PRIA 3NFPB 4JKKA 4GBXA 1SM3H 1IGTB 4DN4H 3FN0H 1WAAE 2ZJSL 3BUTA 3GHBL 4FA8A 1GOHA 3GSQA 2PO6B 3U7YH 5JW3H 5T33L 1YNTA 1QG3A 2OJZH 1N5AB 6CGTA 5LGJA 1KPRB 5I1EH 2EH7L 1IGMH 3QXDB 5JHDD 4PJ8A 4PJGE 1XF3A 3RQ3A 5MENE 8FABA 3CC5B 3GIZL 1MRCH 3GZKA 3OG4B 1UWEH 1NANI 3GB7B 4JM2A 3ZT6A 3D39E 3ESVF 2OI9A 4WO4B 3MC0A 3B43A 3CX5J 4PJDB 1IAKA 5C0EA 4HMEA 4LCIL 4UOW0 3EFFB 1HHJA 5D2NE 1WZKA 4HT1H 4CADB 3U0PB 1ROWA 4FQLL 1LK3H 3O41B 3VG9B 4QRPE 3GGWB 1ED3B 3MV9D 1X5LA 3BPOB 2UZIL 1DLFL 2JIXD 1DQDL 4XX1E 1K2DA 5C09B 2FO4B 3IETB 1AE6H 4HHAB 5I66A 4X0KA 4GRWH 3SDYL 3VCLB 4XTRD 4YDVB 3FO1B 2H1PH 2P24B 3LSOA 1MCQA 4UV7H 2H3NB 1JNHA 5GGQL 5KVGH 3BPLC 3KYOB 2HFGH 3NACH 2OP4H 1IAIM 3UBXG 4XPTH 2IPKA 2GITA 5GRVL 1IT9L 2R23B 1NLBH 4LPUA 1ZLSL 3REVA 2VKXA 1NCWL 4G9DB 2ICES 2B7DT 1TJIH 4FXLA 2ILLA 1HXYB 1IBGH 2H32B 2ZG1A 1S7SA 4NYLA 4XNZC 4D3CL 1KTDB 3HNVH 3K8KA 4QXTA 5H2BB 4MJID 1JRHH 1HHIA 4DAGL 4L8BA 4XCNA 4PJXE 5DYOA 2P5EA 4BH8A 2KBGA 4Y8DC 3OAUH 3GSVB 1INEH 1A7PH 4GBXB 5EZJA 3JXAA 1TVBB 3LMJH 1KIUA 3BEVB 3BOVA 4MNQD 1U8KA 3H42L 1HHHA 4L4TA 5KS9B 1VGKB 1YNTB 3V52H 1BQUA 4FXKB 5DEFA 4WUUE 1NBQA 4YDIH 4PJAE 5ILTL 5LGJB 4FFEX 1B2WH 4YNYA 3VFNA 4GW5B 4LSDA 8FABB 1DBBL 3WIIH 1RUMH 4K7PH 1ZVHA 1FGNL 5DMJB 5A2KH 4TTDC 4KDTA 3RPKA 4FQIH 4PGDA 1F4XH 4JM2B 3CSBA 1NGXB 1YEKL 5E1HB 2OI9B 1F3DJ 1M7IA 2JJVA 2ARWA 4RX4D 5HXMA 1LMKA 4ZS7L 5EOTA 1AR1C 3X14B 1FVDA 2WUBL 3BP4A 2Y07L 3PQYD 1CDYA 2D4FA 2E8YA 2X6MA 1EFXD 5DVMA 4HF5H 1BOGA 5EUKA 2DBLL 1FO0H 1FCCA 4KRMB 1CR9L 1Q0YL 5C86A 5JNYA 4ZFZB 1K2DB 4RGND 1AIFB 6FABH 3HUJE 4C83A 2Y9RT 4OLVH 5I66B 1PKOA 4X0KB 3JWDL 3V6FA 5JMRA 3H3BC 4XCEA 3LSOB 4ODHH 3PUCA 1JZ7A 3VH8A 1NMCC 3IYLW 3QH3A 2YKLH 5BMFL 4C54A 3TH2T 4DGVL 1JNHB 3D18A 3QDGA 5KVMC 2WLZA 4L4JA 4MA7H 4LQFL 4K9EH 2IPKB 3QXVA 3RBGA 3IU4L 4LEOB 1MPAL 4M5ZL 4N5ED 4JFEA 1S7SB 4NYLB 5CEXA 1AXIB 2VLRD 1VSCA 5A2FA 1ONQA 4N1HB 1NCNA 1HHIB 1SEQL 2OTPA 3O4LA 4L8BB 4PJFF 3QA3A 4JRXD 4XCNB 1MF2L 1IMHC 1UKSA 3BJLA 5DYOB 1HDMA 4FQXD 2P5EB 4Y5YA 3MV11 3O6FD 5IKCA 4PGBA 3SJVE 1KXTB 1NQBA 1U8KB 4L4TB 2AK4D 3KLDA 2DQJH 1L9NA 3VXMA 1MLBB 4KUZL 2B1HH 2AJVH 2P5WA 2E27H 1G6RA 1XCQB 3H7BA 2IBBA 4YNYB 1BAFH 4QYOA 3VFNB 4BQ9A 4YDKL 2EDBA 2YA2A 5C0ND 1CK0L 1A3LH 1JGUH 1NJ9A 2C1OA 2DKSA 2V2XA 1SVCP 1M7IB 2YA0A 5CSZA 5EOTB 2DDQL 5GIRB 1A1NB 3TEUA 1WUNT 1C08A 2FEEL 3HS0B 1KIRB 3B9AA 3WL9B 3BP4B 3NFNB 2FZ3A 4ZFOL 1MFEL 5FM8A 3E3QE 1FPTH 3VXSE 5DMGC 1BOGB 1FORH 1QR1A 5FGRA 1JGVL 4B53A 3VMPA 1U3JA 2QV2A 4DZBA 3WFDL 1JPST 2X70A 1DBML 2H41A 1X5JA 4C83B 2X7LB 1GHFH 2MFNA 5CZKA 3TH4T 4IJ3B 3DX6B 3C9NA 3KJ6L 2JTDA 4M7ZC 4L8CB 3CXDL 3QH3B 4NPYA 1G84A 3HNSL 1A7OH 1EJ6A 4Z7UA 3SDDD 4L29A 1S9YA 3SE3A 3D18B 3EYOA 4QXUH 4X4YB 4IMLB 5GS0C 1CICA 2YZ8A 1B88A 2FH8A 4N8VA 1U3HC 5DTFA 2P45B 4M43H 3C2AH 4G42B 2V7NA 4G80A 2RFXB 2BSED 1QQDA 5ICXB 1R3KB 1QVOA 1HSAB 1HEZA 1X7QA 1U95A 3QIBC 3FQWA 5FYKL 3RWDA 2A6JA 5CEXB 3SEPA 3B9KC 2CO6B 1KBGH 4BSWA 3EGSA 1ONQB 3DBXA 3MJGX 1VEOA 3O4LB 5E2UH 5ANME 4GQ9H 4JFQA 4Y19D 1HWHB 4NT6A 1A3RL 4EUPB 1HDMB 1D9KA 3MGTB 4AG4H 1RZKL 4Y5YB 2XTJD 4LVOB 5IKCB 2ZCKL 4XP5L 5CUSH 5T3XD 3ULVH 1U8OA 3WDIA 2F53E 2XRAL 1OGAD 2WP3O 3IDGA 5DMYA 2Z0BA 4IRJD 3H3PH 1UG9A 1QFWL 4NZDA 4YH6A 5DZNA 1BEYH 5IW1A 4XP6H 4HGKC 5CEZD 4P5MA 1LO3H 4LVNB 1G6RB 3JTSA 3SPVA 1I8IB 3OKOA 3F7VB 4HFUH 2YD5A 4XHJC 3SKUD 5F7EH 1LO0H 4MAYD 3MA7A 2IBZY 3V4PH 4CJ1A 4B7IA 1C08B 1TETL 3IDNB 2FZ3B 5FM4A 5FUCE 4F7CA 3PL6B 1RURL 4JPIB 4XWGL 3AS0A 1ZHLA 4KK6C 4DZBB 3T0EA 3UAJC 1DCLA 4WU5A 5I71B 1D5MA 3ZE2E 3ARGA 1M6OB 3DETD 1OTUC 3NZHH 1CYGA 3INUH 3C9NB 5SX5K 2WNGA 4H26A 2E3VA 1Q9KA 4IEFB 3B9VA 4OCNC 4NPYB 4P2YA 4HWEH 5L9DH 3AXLA 3D3VB 4M8QA 1FNSH 3RX5A 4L29B 1OP9A 1CICB 2AJUH 4HIIB 3O9WC 4N8VB 3JUZA 3CXHJ 4G80B 2R2CA 3QQ3B 1FGVH 3Q2CA 5DRWB 1QVOB 3T0EC 1NUFA 1RIUH 1X7QB 3QUYB 3FQWB 2IG2L 3MJ9A 2A6JB 4OFYD 2YPLA 4R2GD 4BSWB 3EGSB 3EO1A 2C9AA 1J10A 3QULB 5L0QC 4L9LC 3MUHL 4LOUC 4Y8AA 1CGVA 1K3IA 1V3KA 5LGHH 4JANA 4PJHF 3IF1A 3EOBB 3SE4C 3KPPA 4MWFA 4NT6B 4O4YH 1D9KB 4AT6A 2YA1A 2EEBA 4FP8H 1I7TA 1DUZA 3QCVL 1CGXA 4JKLA 3FQXB 2C4FT 2R0WH 1GJIA 3MCLH 4J2XA 3IDGB 3UDWA 4WI5A 2Y5EA 2Y7QA 4KHTL 4HFWA 3UC0L 2F8OA 4XXDA 5JUEL 4P5MB 4S1QH 3RVXC 3JTSB 5J06A 4XNMA 3OKOB 5JR1H 4PLJC 4LASH 4QF1A 4XRCA 3KLHD 5BQ7A 4FQPA 3DLQR 1JYXA 3LKSA 5GJSL 1FYTD 2FLBT 1V3JA 4I0PA 4HCRH 5DHXB 3LH2H 3MA7B 4KV5F 1GGBH 1S3KH 2FR4B 4RMVA 5B3NA 1JRHI 3TIEA 1A7QH 4F7CB 4DK6A 5L2KE 3ULUD 4XNUH 1MY7A 2NY4D 5DUPH 2YZ1A 4RAVA 2GTWB 1SVZA 4QY8A 5FV1L 4XP4L 4LARL 5ITBH 2OL3H 1ZHLB 4Y4FA 2D7OA 3BDYH 3BKJL 5E99H 1S9XB 2LU7A 4MGXA 1IGFH 2Q1EA 1YMHA 2HT2C 1IKNC 2IPTL 3ARGB 3GSXA 2UUDH 3QNXB 4JFPA 5GGRA 2GHWB 3CVIL 3I85A 1Q9KB 1VACA 4UT7L 1DQQA 3CFBA 4L3CB 3AXLB 5GS2D 1ZTXL 5EIIA 5DVNA 2ZKHL 2Z31D 4FOMA 1FVCA 4XWOC 1X44A 2NY6D 3BPNB 3FRPA 4ZS6C 3AREA 3FCTA 2W9DL 5H35A 3V7MA 3QXUA 3HFML 4WI4A 1U8NB 1MJUH 4MDIA 2ATPA 5KSBF 4MXQC 4C56B 3WKML 4I9WE 2HTLC 3QIWD 2QQKL 2UY7A 2YPLB 4ZUVA 1T3FA 4G7VL 3E2HC 5HDQH 4TPRL 5B3JF 2IMMA 4XCFH 5E2WH 4JANB 2NY7H 5K9QI 3KPPB 5DD5L 1JUFA 2VUYA 4FFZH 1JPSH 1CF8H 1I7TB 3AS1A 3EUUA 4K94H 5TH2A 5MEND 4KK9C 4GUPB 3MLUH 5F7LB 4YHLH 5DJ0B 3KYMA 4RBPK 5GQBA 3D39D 1JIBA 5I19H 2FSEA 4M1CC 1OAQH 1GGUA 4HFWB 4HWNA 1ND0A 2C5DC 4XXDB 1T2QL 3WDHA 4WTXA 5GHWL 2WV3A 1I9IL 2COQA 3P0YH 4OKVA 4U6VH 1TVDA 1B0GA 4JQXA 3C5JA 4LPWA 4QF1B 4XRCB 4QRPD 2N1KA 2BZDA 4K3JL 3MLWL 1U8IB 4HLZG 4X9FA 1FFOB 4OF0A 4UBDD 4LHUB 3QDJE 1DJSA 3SBWC 3HI6L 4UDTB 1CFQB 4U1GC 3SY0B 4FQJL 4I0CC 1YPZB 3QG6A 3QDMA 4HIJA 4PGJA 3V0WH 2I60L 5JW4N 3GMLA 4QY8B 1EJOL 1GIGH 4PP8C 4RAUB 3D85A 5D6DA 1PYWB 1F4WL 3GNMH 3UYPA 3U46A 1BGXH 3GSXB 1CD8A 3PP4H 4POZC 3KNBA 3MRDB 1YN6A 5LCVL 2VLJE 1VACB 2DQDH 1CIUA 1DQQB 5EU6A 1AKJD 4GKSA 4JDTH 1JMZA 4DKEH 5EIIB 4I48A 3PWPB 1FVCB 4FXGA 2MPAL 3QQ9D 1KPUB 2OX5A 4U7KA 2B4CC 3AREB 5T3ZE 5ISZA 5GS1B 2ATPB 1UM6L 2XA8L 1PX3A 4JREB 4X5XA 4DW2H 4MA8L 3SDAD 3V8OA 1T3FB 4HAFA 3HI5H 4V3EB 1SJXA 2FJFA 3D0VA 4WUUD 2X4PA 2X4OA 4JO2L 5JHLH 3GBMH 3MRKB 5EO0B 2GJ6E 1UADC 1RSFA 5K9KA 4X6CA 5TH2B 3JWOH 3QNYB 1MEXL 2B8OT 3QPXH 2QJDA 2UZXB 1XF2A 1ZHKB 3KYMB 1WSST 4HH9B 4OLYL 3O11A 4K8RD 5F3BB 1MFBH 2FSEB 3RL1A 1ND0B 1JHLL 3NFSL 4QWWC 1K6QL 2FX9H 2RQ8A 5LJYH 3BISA 4JO1L 1A21A 4Z7VE 5GRXG 4UT6L 4P4RA 1B0GB 4K71B 4HG4K 3C5JB 1HHKA 2Z4QA 1I7ZB 2LU4A 4WWKA 5I1AA 3UBXA 4G7YL 5C0DA 1YA5A 4P9MH 1SYSB 4RDQF 2ZUWA 4RNRA 4ELME 3UZEA 2A0LC 3Q1SH 3RP1A 4PV9B 3QT2A 4NHCL 1VFAA 5DI8A 3IXAA 4OI9A 2X4QA 2XZZA 2IH1A 25C8L 4LCWA 2HP4A 4QXWA 4R26H 3F8UB 4QHMA 5I1JL 4N8PA 2HFTA 2HRLA 3ZTNH 1MQKH 3QQNA 3SDXA 3GHEL 4HBCH 5I15L 4PJ7A 1MHPL 3FOMA 3MLVL 4ZD3L 4OIAA 4QTIL 5DT1H 1MAML 2V2TA 4XPAL 1XF4A 3KNBB 2NCMA 1MREL 2G2RA 3MNVA 3BGFC 4OTXL 2QSCL 5DA0B 3F6LA 5KW9H 5KOVC 4S1RH 4EDXA 4GKSB 2OLDA 2QSQA 3ORJA 4FXGB 1G0XA 3ISWA 3IVKA 1NAKH 2QADC 4TVPL 5ISZB 1X5YA 1L0YA 3BSZL 4QOKD 3RIFK 5IB4B 1SBSL 3D2UD 4OQ1A 4ZO7A 5DWUL 2PTTB 5E7FA 1UGNA 4WRLA 2YWZA 1WWWX 3IFOB 4JY5L 2BNQE 3BGMB 4YX2L 4P49A 5B39A 2UWEF 3MRPB 12E8H 2NYYC 1F8TL 2VXSL 3D0VB 4HPOH 5SWSE 2X4PB 5F21B 3TN0C 2EE3A 2NQCA 4QRQA 1ZVYA 3SO5A 2C4FU 2NNAA 3VD7A 1TPXB 4XCCH 4FQ1H 4NUJA 1SMOA 2YD3A 5JORA 3NCEB 4M02A 2FJHA 2HLAB 5K9QG 4S0UC 3RL1B 5EORH 3P0VL 3UJJL 1F6AA 1E6JH 3D9AH 3QO1A 4NO0A 2PXYC 1LD9A 5ENWA 2A6DA 3RUGF 4IM8A 4OGYL 4P4RB 3OTTA 4ELKA 5B8CB 1HHKB 2Z4QB 4WWKB 4U0RB 1TQCC 4JRYA 1OLZA 3EOTL 5I1AB 5C0DB 1FYHB 4TNVK 4BJLA 4RNRB 4MS8A 2F5AL 4QHNA 1RUQH 5HVHB 4J23A 4EBQH 2W91A 2QSVA 1CS6A 1GAFL 4XBPB 3N06B 4KKAC 1VFAB 4Q9RH 5DI8B 5LBSL 4E41B 4ERSL 1OAYL 2X4QB 4HH8A 3QJHB 4N0UA 4QCIA 1NCCH 5GRWA 4MX7A 3MRJA 3MFGB 3RBSA 1DBKH 4QHMB 3BP6A 3ZSSA 2X5PA 4AZ8A 3GSRA 1JF6A 1QRND 3SDXB 1G6RL 4P57A 4KJWC 3BZ4A 4AEFA 1FL6A 2CUMA 3MSPA 4WW2C 3RWCA 1IM3B 2V2TB 4HUNB 5SWZB 4YHKH 4DFHA 2B2XL 3MNVB 1BFSA 2G2RB 4G6ML 1FLRL 4PY7A 3EFDL 4HC1A 4XBGA 1G0DA 5HI5C 5IHBA 3MXWL 5IB5B 1YECH 2IQAA 5IOPA 4TTDD 3SKOA 3N9GH 3IVKB 4X9GA 3X3GH 2VXQL 5FDWB 1IRAY 4XAWL 4YLQT 3T4YA 1CQKA 2V7HA 3ZL4H 4EI5D 5DD1L 2F53D 4ZSOA 4ZFFA 5KVFL 5JPMB 2VB5A 3O45A 1F3RB 1DR9A 4WCYH 1KIQA 4QRQB 3P4MA 2NNAB 1DVFA 5J11B 3EDDA 5DUMH 2QBWA 1JTOA 2ARJA 3DX7B 4ZUTA 5JORB 2FJHB 1MIEH 3UTSE 4TQEL 4NZRH 4EQ2A 1QLFA 1T7YA 3K1KC 5D1XC 1F6AB 4NO0B 5ENWB 1HQ4A 1LD9B 3TO4C 4RMRA 4V2CB 4OCYH 2WANA 5C0CE 3OJMB 3QRGL 3T0BA 4YHPA 4XMLL 4EZMA 1JNLL 4JRYB 2IEPA 3KPMA 5HGHA 1J1OH 2AJYL 4YHMH 1DVFC 1R5IB 4QHNB 4JO3L 3ZKMC 4OT1H 3MLXL 4Q6IC 3CX5K 5IWLC 4JG1L 5JQ6L 1IC4L 1J8HA 3FONB 4N68A 4LLUB 4N0UB 2R0KH 4QCIB 3WJJA 2IANE 4MX7B 2ESVA 2W0FA 4UV4L 2A9MH 3GI9H 3BP6B 4ALAH 4AM0A 4GG6B 2YPVL 4PRBA 1SYVA 4TUOA 4P57B 3BZ4B 3QI9A 1VENA 1FL6B 4M1GL 3RWCB 3HZKA 4XB7A 3CDCA 2NTFA 1MCCA 2ZSVA 5DHVA 2JB6A 4PY7B 4PJEB 2GK2A 3KYNA 1MCSA 4JFDD 4ZPVA 1X9QA 1Y18A 5HHVL 1F2QA 2WBWB 1UWGH 2IQAB 5IOPB 3P2TA 5HBBA 1OAZH 3HZMA 1G7LA 2HT4C 3P4LA 1WBXA 3T2PA 5BS0B 1FJ1A 4N5UA 3MNZB 1AD0B 1ES0B 5INCA 2E7CA 1T0MA 3ELAT 1FHGA 3UEZA 5K9OB 3OAYK 2V7HB 5IG7B 1UENA 3SGDH 2AK1L 5C0IA 4NNYA 2EXYC 1NAMA 2CDFA 4JJ5A 1D6EA 3EDFA 3VWKA 3QCUL 5I16B 3O45B 3H7LA 1Z9LA 4KZEH 4BZ1L 5DMGD 3BIKA 1MJ7H 3RWHB 3T2NH 2GI7A 4QRTB 3VXRA 4FZ8L 1F3JB 4H88L 3O2DH 2ORBL 4D9RE 1EO7A 3GIZH 4N0YL 1QLFB 4NKMA 2OM5A 3QYCA 3MO1A 5JDJA 4JKWA 3VGDA 3LB6C 5CSGA 3QUMH 3FFCA 4ORZC 3LQMA 5ABDE 1DQTA 5F3HB 2Y36L 1ORSA 2D3VA 5L2KD 3MJ9L 4OSUL 3V7AG 5HGHB 1CD0A 1ZT4B 3BP5A 5CZVH 4RGOH 3V79C 3SCMB 4TUJB 4H1LH 3B9KD 1RMFL 1F90H 1R5WA 1A7RL 2FATH 1J8HB 4ONGH 2C3WA 5EC1A 2ZCLH 5FYKE 3SDYH 4N9GA 1G7QA 3S34H 5LVEA 4NQVA 3BFOA 4G9FD 1YEGL 3MOAL 1DBAL 3I3BA 4AM0B 4LSRH 3PV6A 4N8CL 1HI6B 5HYIA 3PHQA 4HWBH 4PRBB 3LDBB 3X11B 3IAGC 1SYVB 1JK8B 1A14L 2JLLA 3T1FB 2GT9A 3DRTA 5D1QA 3ARFC 2NTFB 1AD9A 3DIFB 4I9WD 5DHVB 35C8L 4GMSH 4OCMC 5JIIA 2LVEA 3OR6A 4KQ4H 3KYNB 1YEFL 4ISVA 5I8EA 2DQFA 1W2KT 3L5WA 4XHJD 2FYYB 1I75A 4Z7UF 1QO3B 3HZMB 4XI5C 1WBXB 1FJ1B 2EDHA 5INCB 5I0DA 1J1PH 4YDLC 3C60A 3GJFH 1K5NA 5C0IB 1FAIL 4P59L 1NAMB 3NN8B 5EUOA 2CDFB 4JJ5B 1D6EB 4YGAB 3VWKB 1EERB 1B3JA 5B21A 5T5FL 3FQRA 4ZPTB 4YXLH 2HMIC 2Q76A 1JI2A 5L8JB 2BNRE 3ZHDA 3DSFH 3AB0C 3SOBH 3MLTB 5EBWA 5HHNA 2AEQL 4RMUA 4IDJL 4NN5B 3DVNB 4L4VE 4LDOB 3NMEA 5BV7C 2DM2A 1AFVH 2WMPA 5D7LE 4XVSH 1OTUD 2X9WA 1H3PL 1NGQH 4G43A 3C60C 4MQ7A 4NKMB 4ZG1A 1EAJA 4P3DA 4MCYA 4XP1L 3QDJD 2EDXA 4BH7A 1NCTA 4OCXL 4JGMA 1DTUA 3FFCB 1YQVH 2ZCHL 1OTTC 4AYFA 4OLUH 4FABL 4S2SA 3O9WD 3TM6A 1AXTL 5E9DA 3I75B 5FO7A 5HGBA 3MRIB 1B90A 2CJUH 3BP5B 4G8GD 4ZNCD 4F37K 2VDNL 2IC2A 1J0IA 3DVGB 4LSPL 3A67H 4YK4C 5FCSH 3T08A 4OZIA 1UH2A 2XQYK 3MR9A 1R5WB 1N8ZB 4AH2A 1KB9J 4K3DH 4LOUD 2ENSA 3I9GH 3QXTA 2F54E 2D7PA 4N9GB 2FL5A 1IM9D 4FRWA 2GY7B 4NQVB 3CDGB 4ZAKB 3PV6B 4V1DE 4LLDA 1V5JA 2HLFD 3PHQB 1RZ8B 2FIKA 3F58H 4NQTA 2KDGA 2GT9B 5I74C 1A9BA 5TDNB 4PJIE 3GRWH 3RVXD 1MFAH 4P2QA 1MVFA 2VH5H 3OR6B 5KSAC 4AMKL 1LQSR 4W70A 5I8EB 2DQFB 4O2EA 2BOCA 4PLJD 2DLEA 4KDWA 5LWYH 4IOSD 4FFYL 1RJZA 5INDA 1R5VA 2NX5B 2NW2A 2V5RA 4R0LA 1K5NB 4L3EA 1BPVA 2EE6A 5EUOB 3IT8D 4DTGH 1JFMA 3FB6A 3FQRB 5LQBH 5EPMA 2P44B 1H3XA 3P11L 4WHDA 3R1GH 1J12A 1OAXL 4JAMA 3S37X 4HS8H 5HHNB 2VDKH 1JGLL 4Y5VB 5FYJL 1EHXA 2NXZC 4GLRH 1F5WA 2DL2A 4KKLD 4ZYKB 4YHIB 2FD6H 3CSPA 5CD5D 4G6AC 5MHSD 3KR3H 4Z78A 2C26A 5E5UB 5D96C 3T1WA 4MQ7B 3UPAA 1WC7A 1CD1B 5C1MB 4NCC1 1UACH 4KMLB 2EIZA 4JFOB 2D0HA 1UB6A 4JB9L 4BK5A 4ZS6D 4WV1A 1BFOA 3UCRA 3VFVB 3MV7A 5F44A 4XVJL 2VIRB 2A73A 4JFXA 5HGBB 4PJDE 3PWNB 3L3OB 4MXQD 3U9UB 1FRGH 2HTLD 5DD6A 1WWAX 5CJ5A 4OZIB 1RJLB 5I1HH 3MR9B 3KPNB 1H15A 4OB5L 3W11C 4NQDA 4NO3A 4AH2B 1G1CA 3HE6C 1XFPA 3K2UL 4G6FD 4J3TA 5FXCH 5LXGL 3AM8A 3U82B 5HHMD 5ADOH 4Z0XA 5C09E 4KK9D 2OTWB 2P46B 1ZLWH 2J5LC 4JGJA 4U1MA 4BQ8A 4CN6A 4H8WL 3QCTH 1KCSL 1BVKA 2W9EH 4PJ5A 3IU3A 4M1CD 1DL7L 1N3NA 3F5WA 4Z7WA 2IAMA 4HV8B 3QBTB 4KMTL 3IFLH 3S35L 1BOYA 1DN0A 2DQIL 2O93L 2AEPL 2BNQD 4O2EB 1GPOL 3UROR 4U1JB 4ORGA 3MV01 1UCBL 4X7FC 5SWSD 4PG9A 1V7NL 5TE7H 1CDJA 3MRRA 3AM8C 3LS4L 1RZGB 1RJZB 2QHRL 4WWID 4IRSA 5INDB 1R5VB 1WIPA 1Z5LA 4KGJA 4R0LB 4FN0A 2AXHA 5D7IF 3ULUH 2ED8A 2XKUA 3K4ZA 2UV3A 4YO0B 1OTSC 4KROB 5EPMB 4KVCH 4WVRA 4D0BA 2IAMC 3FAWA 1NEZG 4JG0L 4AJ0A 1NBYA 3MLRH 3S98A 4JAMB 3BKYH 1AR2A 3LZFH 4Z0BL 5F96H 3R4DA 4DN3L 1PG7L 2LV4A 3WXWH 5KS9E 1OF2B 3NOIA 3O6LL 3V6ZA 5ACZA 3VWJB 1KLGA 1R3LB 4POZD 4Z78B 4IRSC 1QA9A 2BHUA 5DJAB 4HGMA 5FHBH 1WC7B 4DGYL 1I7UB 1MIMH 2YBRB 3PWVA 3K3QA 4WV1B 3N85H 1BFOB 1MCNA 1KT2A 4MD0B 2DRUA 5DLMH 1T83C 1HH6A 5KVDL 2A73B 4JFXB 5JXEA 4LVOC 3MJ6A 5ESAA 3CZFB 3SGDI 4OIIH 5DD0L 1ETZA 4OFDA 1J1XH 2K7PA 3N0PB 5HHXH 2FJGA 4U3CA 4XP9L 3GSOA 4R97C 2X4UA 4PREB 3A6CL 1H15B 4S11A 3OX8A 4NQDB 3V6BR 1U58B 2FHBA 1JNNL 4LVNC 5ESQA 3MPCA 2XZAL 3MOBL 3MRMA 5ADPH 4Z0XB 4JLRA 5F1NA 2C3VB 4C59B 4U1MB 1K9TA 3WEXA 2APFA 4Y4KC 1BVKB 4PJ5B 1FO0A 5TQ0L 4F80A 1IFHH 5SV4A 3U2SA 5AYQA 1EXUA 4Z9KB 3FQUB 1E6OL 4CNIA 2QLVB 3LRSA 4GRWB 3H9SA 1DN0B 4GS7B 4OGXH 4X5LA 3PL6C 1AGEA 1JFQH 3QWOB 5IF0A 4ORGB 1CLOH 1TLKA 2GSGB 2LTQB 4PG9B 1QD0A 5IQ9A 2BJMH 3MRRB 3C8KA 3BZDA 5JQHC 2P8PA 2ZUUA 2RGSA 4NHUA 4X7TA 4LRNH 1ZGLM 5IHZB 3B83A 2NY2C 2AV1A 5E4EC 1I3GH 4FMKA 3TZVC 5CAYB 3V6OC 1QSFA 3L1OL 2P5EE 4BK4A 4OZ4A 1NGZA 5FUZH 2DL9A 4F33A 4L4TE 5DMIL 2AQ1A 3ILPA 4HC1L 3GMQB 3TV3L 2LU3A 4YE4H 5FAAA 3QJFA 2DMCA 4X6CF 2X89D 1U8QA 1KLGB 1HOCA 5KVEH 1QA9B 2XZCH 1N7MH 2VDQH 4OZHF 4K9EC 5J8OA 2VOTA 5F6HJ 3DX8A 5IHLB 3JV4B 4LSSL 2UY6A 4RGMB 4YBQC 1HKFA 2LVCA 1XIWA 5F6HI 3C8HA 1KT2B 1F00I 2WBKA 3ARDD 2QADD 3MLSH 3WD5L 3O3AA 1X5FA 2KQMA 2XOTA 4ZDHA 5BO1H 2FJGB 2BSSA 2X4UB 3C2SA 4TVPE 3TVMA 4F7EA 3VXTA 4LEXH 1F58H 1TZGH 3TN0D 5E2VH 2VZ3A 2BCKA 2M8XA 3MRMB 3U1SH 3EOAA 1QBLL 1NC2B 4K8RH 1QEWA 4XPFL 2EEAA 1EUUA 4NJ9H 4ZUSB 3WEXB 3RRQA 4I3SL 1FO0B 3NBNA 1Q0XL 2WIIA 3FZUC 3L5IA 4AL8H 1EXUB 1UJ3A 4MNGB 4PJ7F 4JFFD 4D0CB 2PXYD 4CNIB 1DBJL 1MI5B 4FQHA 4GH7B 3RZCA 1X6LA 2IH3B 3H9SB 1OOAA 5HHQA 1AGEB 1XGQA 3IJYA 4LRIA 3U48A 4HS3A 5IF0B 4G7VH 4OJFH 3MRNB 1H9VA 1CDHA 4NHUB 3BN3B 4MCZB 1KNOB 3G5YA 5EH1A 2VXTH 4Z7OF 3WHXA 4NQCA 1ZANH 3RKDC 4KKAD 1I3VA 3OPZH 5DRXA 1FIEA 2VQTA 3U9PL 3BZFB 1FDLL 3O4LE 1QSFB 3O2VH 1D7FA 4OZ4B 2H26A 1UT9A 1NGZB 5IROC 1ZS8A 5CJXA 1FZJA 3ILQC 1HN1A 4F33B 4WNQA 1K4DB 4LAQH 3LKPA 1S7UB 3ALPA 4A6YH 1KPVB 3QJFB 3QQ4B 1U8QB 4LLMA 2VR4A 3RIAF 1HOCB 2CD0A 2P5WE 2EDYA 4KY1L 2FNBA 3SGKC 2FBJL 5D70L 5F93C 2E7HA 5HI5D 1S9VA 5F89B 1T1YA 5MP6L 4FQ2H 1NAML 4OI7A 1XIWB 1MCKA 1XGRA 4FQJH 1KJ3L 1DDHB 3IGAA 2KL6A 1H0DA 2F8XC 3O3AB 1CG9A 5F6IC 1JF1A 3CLFH 4WW2F 4ZDHB 2BSSB 1KTLA 1YY9C 1U6AH 4KWUA 4F7EB 2VDPL 3VXTB 2G9HA 4YR6A 4PD4K 4CVZA 2BCKB 2DQTL 1FLTX 1CXFA 4R7NA 3EOAB 4KI5C 1QEWB 4IMKA 3HR5A 1JCKA 4GLRI 4I77H 2ICEA 3MRFA 3WKNA 1WFUA 5DJ6A 5K9JL 2XA3A 3C6LB 3NGBB 3W5NA 1UJ3B 5D1XD 1JV5B 4MXWH 2GJZA 3MBEC 1RUKL 2DTMH 43C9A 4FQHB 1LP9A 3RZCB 4D2NA 5D7JC 2HKHH 1XGQB 2HG5B 1PAMA 2FEEI 4HS3B 1PG7W 3MREA 2BNRD 3WIHH 3V5HB 1K85A 3ZKMD 1YC8A 2YK1H 4IMKC 4NQCB 3HLAA 4X80L 4DVRH 2DLHA 4QRRB 4HWZA 2VO5A 4N90E 5DRXB 5D7LD 5KG9B 2X1PA 1HIML 4H1LG 5GRJH 2H26B 4F3FA 3QFJA 1YEJH 2WQ8A 1HCVA 1K6QH 4GW1A 3CMOH 4WNQB 3LKPB 2ZOLA 5I8OL 3HZVA 2E7LA 4QRSB 4JM4L 1DQLL 4LLMB 4APQA 5BV7L 4NN7C 4AQOA 3WS6A 3U4BH 2WAHA 5I1LA 3U4EB 4KMQA 3V5KA 4BSJA 5CEYB 3H8NA 1UZ6F 2X41A 2XI9A 4G5ZH 5C6TH 2FCBA 1H0DB 2FECI 2MQ0A 1PY4A 1JF1B 5MEOA 1GC1L 1HYSC 4HJ0C 5IP4A 2E7LC 4LSTH 1P7QA 1KTLB 3QEQB 5TDPA 5BVPH 1I85C 4YHOH 2DKUA 4APQC 1MHEB 2ADGB 2MCPL 4XGZB 2G9HB 1F13A 1QFWI 4NC0B 4YR6B 3O6KL 1CT8A 3CH1B 2NY0D 4Y2DB 5CBEA 1R3JA 3M17A 1J88A 3HR5B 2OTUB 2ICEB 5D7SH 4YBLC 1QBAA 3MRFB 2OL3A 1S5IL 3WS3A 4QEGA 1FFRA 2GJZB 4P9HC 3BUYA 3GI8L 43C9B 3BT2L 4C55A 2EDJA 1LP9B 4UIMA 4F7MB 3S35X 1KEML 5CJOH 2FX7L 1D5BA 5F1KC 3HAEH 4WY7L 1CGSH 3MREB 4LNRA 1BJ1H 4OZGF 2OYPA 3UYRL 1C8PA 4C56E 3CFDB 4JZJA 4ONFL 2VXUH 4Q97A 4MJ4A 5HYSA 3S37H 1AO7D 2YPLE 4NBXB 5CIPH 4HWZB 5HYJB 4RRPG 4O51A 3WNKA 2R4SH 4ZO8A 1ODAA 1B0RB 1ZE3C 3J7HA 1NCBH 1BWMA 4K2UL 3QUKA 3HN3A 1PG7X 5F1SA 4PJ9B 2VL4A 1J0KA 5DEGA 4O9HL 3VJ6A 2L7UA 4NM8H 4JZJC 3ARFD 2V6HA 5I1LB 1RUPH 1NMBL 5IEHB 5F7KC 3V5KB 2VDOH 5CS7A 4PRPB 4NWUL 5EA0L 3MFFB 3ARPA 1MUJA 3MRLA 4TULH 5E6IB 4MVBD 5HHOA 3W39A 1U93A 5C09D 3L95A 5E56A 3QISA 3KS0H 5MEOB 2WQRA 1G7MA 2PYED 2X4SB 1YPZE 1P7QB 3TBYA 3EOYG 2RHEA 2LABA 5C07A 4RMQA 3GM8A 4BQCA 1A6TA 1H3GA 3Q6FA 5KJRL 1JHTA 3O8XA 3RY6A 3IDXH 1BHGA 1T89A 1SM3L 5C0BB 5D93C 4P2RA 5F9JB 3FN0L 1OM3H 5DGRA 2D2OA 1R3JB 4LQ1A 5C08B 5JW3L 3U7YL 3KXFA 2JKXA 4NNPH 2OJZL 4MJ5B 2OL3B 5IJKA 4U6HA 3OL2A 3GJEA 2DN7A 1IGML 5GS0H 5HGDB 1DUYA 3PWPE 2X9YA 1X5ZA 2YD2A 4UIMB 1AHWC 1YEIH 3ALWA 3EO0B 3DYOA 4G8FA 2FHFA 2QQLH 5DD1H 1UWEL 3S96A 1U8MA 1A6WH 2GK0B 4LGRB 5TGBA 2VISB 4BFIB 3SQOH 4LNRB 3ET9F 5I73C 4X99B 1GZQA 4GBXD 3X3FH 1BIIA 1IL1B 4C58B 5A43C 1MFDH 2O61B 3VD3A 1OWWA 5EU5A 3UPRA 2HFEA 4EIGB 4HT1L 4JFZH 1LK3L 3HC3H 1KXVC 5L6YH 2ZWLT 5FYLD 5IJVB 1GCFA 1BQLH 3MYJA 4WI9A 1AE6L 4MQTB 1I9EA 3F12A 1X4YA 5D71H 1T1ZA 1QP1A 3K0WA 4NN6B 5DJYB 1AGCB 1PEWA 3FO0H 1XGUA 2H1PL 5DEGB 3VJ6B 3A6BH 4UV7L 1I7RA 4DKFH 2CK0H 3GMMB 7FABH 2XXMB 4Z5RA 1HHGB 3CDYA 5KVGL 2HFGL 2AJSH 3D1MC 2JJTC 2A83A 3NACL 3MLXH 2EE9A 3TNNB 3EBAA 4XPTL 1R0AH 1YJDC 3QSKB 3OKDA 1MUJB 1RI8A 3MRLB 1TJIL 1YDPA 2BFVH 4IOIA 1KF9B 3W39B 1IBGL 1U93B 5SV3A 2IF7A 3L95B 3HNVL 4TRPH 1QNZH 1G7MB 1JRHL 1S7TA 3TBYB 2B5IB 2WBJA 5C07B 2H6PB 4MJ6B 1A6TB 1ITCA 3Q6FB 3O8XB 4M3JA 4HZAA 3OAUL 5HD8C 1INEL 1JHKH 1A7PL 1NEZA 2YRLA 2MQCA 1T4KA 2XIDA 3QDHA 4DWHA 3TBWB 2PCPA 4OLXL 1BFVL 4MHHI 3V52L 2P8MA 4Y5XA 1ZLVH 3BYYA 3GDBA 3E6FA 3GJEB 4YDIL 5A2LH 5FYJE 1B2WL 5EU6E 4P2OA 1I8LA 4KQ3H 1DUYB 2ADFH 5FKAB 3TWCH 3TF7A 1OHQA 3WIIL 1RUML 4K7PL 4Y1AA 1MH5A 4JY6A 1CZ8H 2HT3D 3RTQA 2J8HA 4G8FB 1C5CH 3ZDYF 4FQIL 1F4XL 3REWB 2AKRA 4JQVA 3WFHB 4J4PA 5ISZE 1YYMH 4BELD 1GZQB 1FZOA 1BIIB 4KJPC 3QUXA 2DS4A 1RULH 5IFHH 3OKNA 4LMQI 5EZOH 4X8XA 4L4TD 5EU5B 2HFEB 2NLJB 2C7UA 1HZHH 5HSFA 2EXWC 4HF5L 5I2IA 3HE6D 2I07A 1NFDA 2CLRB 3RDTA 4CMHC 1FO0L 7CGTA 4X6DF 3TF7C 3MYJB 2MHAB 3BN9C 3RTQC 3OB0H 4HUKB 6FABL 4OLVL 3MCKA 2F19H 1T1ZB 3VRLF 5CJBA 1QPPA 1B6UA 4M93C 1XGUB 4ODHL 3QUXC 4MD5B 2DWDA 4OSUH 4MXVF 1L8JA 2YKLL 3ZKQD 4K23H 5ALBL 4JEGB 1GGIL 1PDKA 2FH6A 4Y88A 1QFUH 4MA7L 2A83B 4TVPD 3ZT5A 1I1YB 3HE7A 2R2HA 3BE1H 4K9EL 3HC4L 1JZ4A 3QEUA 3S88H 3ERYA 1FIGH 5E8DH 1UKTA 3OKDB 3L7FA 3TCXA 4IOIB 1YDPB 1RIHH 3JV6A 3VFMA 2VLKA 3KPSA 1IGYA 2J4WH 3THMH 1YEGH 4YWGH 4E41E 2J8UB 1WISA 3PWLA 5C70A 1WVZA 1S7TB 5CP3H 3L3IA 5JW4R 3EYFB 5JXAH 1KJVB 1OTSD 2EKSB 3CX2A 3VRIB 5I6XB 5EU7C 2OK0H 4MA3A 3NCJL 1IILE 4EVNA 3ROOA 2D7MA 1T4KB 3SDXE 3O2WH 1T7VA 5KZCB 1NGWB 2YUVA 4XNXH 2PCPB 3O3DB 2DQJL 4RFEB 5SWZE 2G75A 2YPKA 2P8MB 4Y5XB 2B1HL 2AJVL 5CP7B 2VSDA 2E27L 3SCMC 5IBTH 1FBIH 5D6CB 1CQYA 1BAFL 4QLRA 2HJLB 4EI6A 1W0VB 4CVWA 4Z7WF 4UNTA 3HZYA 4A2MA 5JHDA 4U3XA 1WEJH 4JVPA 1A3LL 1JGUL 1BF8A 3E6HA 4P3WA 5DD3H 1S7QA 4L8SC 5J7CC 1GGCH 2E9WA 4HXBH 5HHPA 3C5ZB 3TYFA 2HVJB 1VHPA 3GO1H 1FPTL 5I2IB 2I07B 1IZKA 1FORL 1NFDB 2FX8L 2L4OA 3RDTB 1G9EA 1BLNA 1NCDH 2NPLX 1AGDA 3ZSTA 1I3UA 3MV9A 4P4KC 5HY9A 2F8VA 1I1CA 3S36L 2JIXA 3OJDA 3QHZH 2VITA 4RDQG 1GHFL 3MCKB 3ARUA 3OXSB 5J6GA 2ZCHH 3VA2C 2XKNB 2F15A 3TPKA 2DWDB 3VGFA 3FQNA 1A7OL 4UOJA 1BJ1J 2CQVA 1E28A 4W68A 4NQSB 2VDNH 3VGAC 3OHXA 3HE7B 2R2HB 2Q7YB 3PL6D 4XMPH 4JRYE 4M43L 3C2AL 5M94B 1BD2B 2YUWA 4RIRA 3L7FB 4HIEA 2YEZB 3Q3GB 2YN5A 4P5TB 3JV6B 3O0RH 1IGYB 1BVZA 4TNWK 2NY2D 1KBGL 3DHMA 3PGFH 5E00B 3L3DA 3PWLB 4N0UE 2WW8A 2HFFA 3L3IB 5E2UL 1DQMH 1CFSA 4GQ9L 1T5XA 4XTRC 1CDBA 5F9WB 1ZGLA 3D3VD 3WNNA 4AG4L 1O7SA 1S5HA 4EVNB 1JE6A 2EC9T 5EZLA 3ROOB 1KEGH 2ZUYA 5SWQA 5CUSL 3P9WB 3ULVL 1RFDH 2XWBA 4Z7QE 2OXGA 3H3PL 4MNQA 2G75B 2YPKB 1BEYL 2FHCA 4XP6L 3QUYD 2OR7A 1LO3L 1CWVA 3G9AB 2PTVA 2Q20A 4PJEE 2NZ9D 4X7CC 1A5FH 4MHHG 1EFQA 4Z8FH 1TENA 2OQJA 4EI6B 2R39A 4YBQD 2B4CH 3M45A 5FO8B 4HFUL 5JHDB 3WHE1 2W0KA 5F7EL 1ZT7A 1YC7A 3KS0J 5D8JH 3G6JF 1UA6H 5BS0E 1NGYA 1LO0L 4MMXC 3I3DA 4OLZH 4HGWA 3DXAD 4LDLB 3V4PL 4M7JH 3VW3H 1ZAGA 4PLNC 4ZSOE 4RX4A 1R24B 4ZNEA 5DJ2A 1RHFA 4M6MH 5BRZB 4ESKA 4PGCA 2R29H 1KTKE 3PQYA 4UILH 1BLNB 3CUPB 4H20H 1AGDB 3RAJH 5GSVB 2NY1B 5HY9B 4BUGA 2VITB 4JY4B 1KC5H 3H9ZA 4JN2A 5GRUH 5J6GB 3NZHL 2XN9B 3QIUC 4ODSH 3INUL 2EC8A 4HWEL 5L9DL 3O2DA 1OGTA 1FNSL 3KPRD 1E28B 4Y89A 3OHXB 2AJUL 1KSRA 2JK5A 5E6ZA 4NDMB 3TA3A 3GKZA 4YHYC 2FWOA 2AAVA 1FGVL 3KDMA 1T0NB 3IFNH 3QUMA 1GZPA 1RIUL 1HH9A 1ZOXA 2WY3A 1KYOJ 4HZLB 2YWYA 1Y6NR 4P46C 2Z8SA 4N5EA 3RKDD 5ACMA 2XWTB 1J8HE 3L3DB 2E5EA 3DROA 2HFFB 2HN7A 4I2XA 1PBYA 2VLRA 5LGHL 4DEPB 1T5XB 4O4YL 1Q8MA 5HYFA 4FP8L 4H1LA 4JRXA 4WHTA 5EZLB 4JHAH 1FG2B 1JGDA 4FQXA 2R0WL 5HPMB 3MCLL 4DJMA 2XWBB 3HA0A 5I8KH 3O6FA 4GRMB 4R4ND 3TBTA 5IVZA 2ATKB 2ADJA 5B38G 4C56D 2AK4A 5DURD 4DUXA 3B2VH 4S1QL 4HWBA 2YPLD 1IEBA 2QHRH 1YNKH 4GAFB 4YZFF 1H8OA 5JR1L 3CVHH 3SDCC 1TJHH 4LASL 1MAKA 4ZOEA 3WE6A 1IGIH 4M61A 1NGYB 1OW0A 1VB9A 43CAA 3HTLX 4GG8B 3LH2L 4HGWB 2NMSA 1UQSA 4QO1A 4DCQA 5A3ID 4JHBA 3Q5YA 4YIQA 1GGBL 1IEAB 1S3KL 4C4KO 1A7QL 3FQTA 3KPQB 5DJ2B 3ZE1F 4XNUL 4PGCB 5DUPL 1TFHA 1Z2KA 3CU7A 3GMOA 3GJFA 5ITBL 1HQRA 2OL3L 4V3DB 1G9MC 2GKIA 3BDYL 5E99L 4NZTH 3TT3H 2JB5H 3WJLA 1IGFL 3DRQA 3QHFH 4U6YA 2NY5H 4N1EA 4Y16A 4LCCB 1PLGH 1OW0C 4RGNB 4RWYH 5AYUH 5C0NC 4OF5A 1YN7A 3FT3A 4LHUD 2BHYA 3H9HA 3MBED 1BM3H 1CLCA 1OGTB 1T21A 3FFCE 5GS3A 3P0GB 4KROC 4PJFB 1F2XK 5D7JD 3SDDA 1HXMA 2FGZA 3TA3B 3BXNA 4M4PA 5ITFB 2YSSA 3BO8A 4ZTPH 1MJUL 1N64L 4KI5F 5EU4B 3GJFK 3QUMB 1GZPB 1P5VA 1HH9B 1EAPA 3WJLC 1PGRB 2XZAH 3CFJB 1AH1A 5T1LD 2R0LH 2X10A 3FB5A 3DROB 2JJWA 5HDQL 4KRPB 2HN7B 4RRPA 4I2XB 4F15B 4XCFL 5E2WL 5FV2A 2NY7L 3DJ9A 3OG6B 1NMAH 1JPSL 1CF8L 4H1LB 4K94L 4JRXB 4DQOH 3PWPD 4ONOA 5A2JH 4WHTB 3MLUL 4BM7A 3AUVA 1H5BC 4YHLL 3LKNA 4FQXB 5GRYA 1U2HA 3GSUA 3SDDC 2EYSB 2Y5TB 1LNUB 3ARED 3BPCA 3O6FB 4JDZA 3TBTB 5JIKA 5I19L 1OAQL 5KN5A 1IAIH 2ADJB 1OGAA 2R0ZH 2A74A 2AK4B 1NL0H 4IRJA 3QO0B 3P0YL 4U6VL 5EO9A 1IEBB 4J1UB 4HUWA 3DGGB 5DRNA 5I1DA 1ZLUK 4K7PX 2EO9A 1FN4A 1F6FB 1W72H 2R1WA 4LCUB 3VFGH 3D48R 3GRWA 3PGCB 2IFFH 5F1IA 4M61B 1IC7H 3IKCB 2NX5E 3ROLA 3EYVA 3L3GA 4MSWA 1RU9H 3L1OH 5C2BH 3CSYA 2W38A 5D9SA 4YIQB 2GSIA 5EUOE 4MAYA 1L6ZA 3FQTB 2BVQA 5DMIH 1T20A 3V0WL 1RJYA 4U49A 4TTGA 3GJFB 3SO3B 2DQCH 5E24E 1GIGL 1KLUA 5I8CA 1XCTB 4CVXA 5AAMA 3DRQB 3GNML 5E8PB 4GJTB 5CMAA 4U6YB 1BGXL 1FNGA 1MY5A 1FG9C 4Y16B 4QNPE 1VPOH 3QUZC 3FT3B 3OQ3B 2BVUA 3JV5A 1FNEB 1JI1A 3H9HB 4LPXA 4JDTL 4DKEL 4Z76B 4MAYC 3IXTB 2VAAA 4PJHA 1HXMB 2EDEA 4UQ3A 3S4SA 3FMGH 1P4IH 3W82A 4JPVH 4MDJB 4WDIA 3T3PF 1UZ8B 2CUIA 5K59F 1EAPB 5BJTA 3I2CL 4OZIE 4DW2L 2AEWA 5DVLA 5E1AA 4B41A 2H9GA 2OSLA 1T7ZA 4UAOC 4IIQA 1NC4A 1OT2A 4G6JH 4BZ2H 1A02N 3CFIC 3FB5B 3MJ7B 5J6HA 3HI5L 4OFYA 5HGAA 3ARTA 3KWWA 3DETC 1WWCA 5JHLL 3GBML 5FYJD 2RB8A 3EJYC 2IGFH 5E8NA 3KLAA 3VFSA 3L5XH 4R96A 3QPXL 4UQ2B 1MCPL 4X4MA 2CDEB 3LKNB 3ZKXB 3RNKA 4JDZB 3LQAC 4ENED 1MFBL 4X7SH 3U30B 2BX5A 3S8WA 5KN5B 1OGAB 2A74B 5CSBA 2FX9L 4PJCF 1CE6A 4IRJB 2JJSA 3JUYA 4YFEA 3QEGH 2DMBA 1CFNA 4HUWB 3DX9A 1VGEL 1RZFH 2R1WB 3LKRA 4R2GC 4YJZL 5BVJB 3UTQB 4P9ML 1Z3GH 4L9DA 1BECA 3HPLB 5F1IB 1FDLH 3T77A 3VXNB 1I8MA 3Q1SL 3ECBA 3BYTA 3TPUA 3EYVB 3L3GB 3I6LD 1FYTA 4Q9CA 5IW6B 5D9SB 1LO5A 2EKJA 2VLLB 2GSIB 2P1YA 1R3IH 3PDOB 5I1GH 2ITCA 4EN3C 4H5SA 4R26L 4TSBH 5IVXA 1T20B 3UZVB 2DI9A 3TFKA 4XHQA 3ZTNL 1MQKL 3IFPA 3OKLA 1KLUB 5I8CB 4WFEE 5MI0C 4HBCL 5B4MC 3IDIB 3S36X 4CVXB 5ID1B 5CMAB 5DT1L 4G8IB 2IALB 3ULSB 2PUQT 5GRZA 5MP6H 3T3ME 1B9ZA 3O4OC 5KSBA 4OGAC 2E6PA 1Y6MR 2PN5A 5KW9L 4S1RL 4E0RA 4M6OH 4D0DA 4E41D 4NO2B 3RL2A 5JMOC 1KCLA 3CNKA 2VAAB 1OAKH 1QSED 4QTHA 4PJBF 4PJHB 1V7MH 4R3SA 2Z31A 4UQ3B 1NAKL 5FA3B 3OF6D 5JA8B 2NY4C 5T1KB 4WDIB 5A16B 1TTUA 2MKLC 5EO1B 3P30H 5BJTB 3WUWB 1JPGA 1MLCB 4FQQA 2OSLB 1BJ8A 1NC4B 4NC1E 1WAAA 4NQDE 5SWZD 4PBWD 3QIWA 3CSGA 4ZFOB 12E8L 1WBYA 4HPOL 2VZ1A 3FRUA 3T0AA 3KG5A 3UX9B 1RVFH 5DQ9B 4U1HB 3PP3H 1F4AA 4QT5A 4FNLH 5E8NB 4XCCL 5TPWH 4FQ1L 4MNHA 4W6WB 4PJGA 3RIFF 4TYUA 4ZOBA 5MENA 3ALXA 3RNKB 1BZ9A 2PW2A 4PJ5E 1GYAA 2C1PA 5I30H 5EORL 3P4NA 1T6VN 1OL0A 1G9NH 2O5YH 4ZFGH 1E6JL 3D39A 3D9AL 3GSNH 4MZ2A 4UB0H 1NFIA 2GW5A 2DIBA 3WFZA 2DI7A 4ZXBB 4GRWE 5D5MF 3DPBA 2A2QT 3MYZA 4OLWH 1CFNB 3DTXA 1IGCH 1P9MC 1P7KB 1HWGB 3LKRB 3KJ4B 4L8DB 3LS5H 4GAJL 15C8L 1ACYH 1I8MB 1BX2A 3T77B