1FFPA

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
source organism Mus musculus
molecule tags Immune system/signaling protein
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
total genus 72
structure length 273
sequence length 273
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ffpA01
2H2PC 4NQCA 4P9HH 2RR3A 3R06B 3G6JE 5MENB 1NGYB 1UKQA 4PJHF 2CUIA 3RL1B 3LN9A 2WBJC 4G9FB 4HHAA 2ZG2A 3KPMB 4GRLD 4M3JA 5E8NA 1FQ9C 2GW5A 5M95B 4QYOB 4NQUA 1LNUB 2W92A 1SVCP 3EJZD 3ERYA 4WW2F 5TH2B 3C2AH 1FZJB 3HZMA 3QUMH 5F70A 3TJEL 4NCC1 2ATKB 3ZYZA 4L8DA 3GRWL 1MCPH 1INDH 1RJZA 3JV0A 4ELMB 4EXPX 1ZHKB 3FRPG 3LS4L 1AD0A 5TF0A 1RK0A 2Y07H 4ZPTB 1GPOH 3GUTB 1TENA 5J06A 1G7QB 4F7EB 4N0CD 3BZDA 1WWAX 1MIEL 4RDQG 1NAKH 3MRDB 4P2RE 3D69A 5ICXA 1FAIL 4M1GL 2Z8VC 1T2QL 5J57B 5EU4B 3ECBA 4Q6IB 5L2JA 1FNSH 2HKFL 1HQ4B 1FE8H 2LAGB 1UT9A 1PG7L 1U93A 2X9YA 5FGSA 4P2YA 3C60B 1NUFA 5KVDH 4QXTB 3VMOA 4L29B 4YBLB 3JWNC 4GQ9L 3QUXD 1M7DB 3CFJB 4Q0XH 4GKNB 1OCWL 4NZDA 2ERJC 4MSWA 5J1AB 1J1OL 3D85B 5TPWH 5I30L 3U0WH 1PJ9A 3MUJA 1KACB 2UVEA 3D39D 4CKVX 4Y5VB 2ZCLL 1LEIA 1N6QL 3I6KB 4U1SB 1EAJA 1JZ4A 4K55A 4P2RB 5ILTL 4Z7OF 3OKEB 2C26A 4BSJA 1HHGB 4L9DA 1BAFL 4CNIA 4WFGD 4MA3A 4NKDA 4ZS6C 4UT7H 3QQNA 4ODUB 5B8CB 4NQSA 1T20B 4RMTA 4WUUA 5BVPL 3QXUA 3U1SL 3UTTE 3W0WD 1HHKA 1RZGB 2FYYA 2YEZB 5I73C 4U1GC 1N0XH 5CD3B 1IC5L 4NWTL 3CLEL 3VXNA 5CEZD 4MS8A 3BO8A 4IDLA 3H8NA 3LB6D 1R5VA 2QADC 4UDTB 3OR7B 1BOYA 1D5BB 3CZJA 5JA9A 3SCMC 1QFWI 4I2XE 4WFFD 1FNLA 4PJ5D 4WFHE 3BZFA 4WJ5A 5FOBB 1EEZA 1FH5H 5LXGH 3NPZB 4JKLA 2AV7A 2DLGA 5C0DA 3LPGA 5IMLA 1SY6L 1AO7A 4LF3A 4FNLL 3BH8B 4GBXD 4QTHA 2NY4B 1AFVH 3DOSA 1KEMH 1CIUA 1TVBB 1W2KT 1GYAA 1IGIL 4CW1A 3NACL 5D6DC 1GH7A 4LNRB 3SDCB 4E41B 4Y4HA 3L9RB 3RAJL 4NGHL 3SDAB 4IOFC 3T65A 1YNKL 2N1KA 5DJ2B 2CDFB 1N7ML 3P11H 1OGTB 1NGWA 5T3XD 5GS0C 4X7DC 3X17A 4JANA 1RZ8A 2GJZB 2XWTB 3L5IA 5IB4A 2DJSA 4Z7VE 3CMOL 4ODHL 3C5ZC 4JN2B 1H0DA 2BMKB 1JGDA 4OM0H 3QYCA 2EXYC 4MDIA 4LLYA 1VDGA 3OJMB 3OKKA 3CZFA 5JMOC 4NZJA 2NQCA 4WWID 2P8PA 1AH1A 1AHWC 4HIIA 5KSVA 4UV4L 2DI9A 2P5EE 4ZD3H 4P57A 1F3DH 2GJ6B 1DVFB 4KTDL 3GMQA 5F93C 2Y4SA 4YFEA 1T7WA 5F7WC 2E6QA 4X5XA 3T2QA 3CC5B 5J13B 1MFDL 4HCRH 4JR9L 3MV9A 5HTSA 3KJ4C 3VXQB 3FB5B 1EK3A 3CK0L 4TUJA 4HWNA 2QR0A 3FQWB 1RZIB 4G43B 5DRNA 5LGKA 4P5TA 4EI5A 3MJ8B 5L7XH 4YHIA 3OMZA 4DGIL 3L3OB 1WFUA 5DSCA 1IC7H 1AQKL 2VDQH 2AEPL 3L3GA 4CMMA 2LE9A 3KPSD 4O2CB 1KJ2A 3AY4C 3BPOB 4MZ3A 1PQZA 4PJAB 1A5FL 2YHGA 2ZJSL 2DQEH 3GSWA 1RULL 4KK6D 3DUSB 1UM4L 2XTJD 3HE6B 3U0TA 1NAMA 2YPLE 1FVEA 4MX7B 2IAMD 4GAJL 5EC1A 1LD9A 5D1XA 1AIFA 1R3HA 3FB7A 5SX5H 2X4TB 2DKSA 1NGXA 1A1MB 4CL7A 3FOMB 5IMMA 1NJ9A 4UNVA 3AY4A 4Q58C 3GSVA 4NZTH 1UZ8B 1MRFH 1J86A 2FX9H 1BZ7A 4N9GB 4H1LH 5IFAL 5IP4A 2FZ3A 3MLXH 1KTKE 2IGFL 4ODBD 4KI5E 2C3XA 3E2HB 4LARH 4LCCC 1TJGH 4LAQH 5D1XC 1UB6A 3TFKA 3O11B 4GRLB 4CN1A 5I76B 4HWEH 3X14A 3QQ3A 1P7KB 4HXAL 2EE3A 3DMMA 2IBGA 3QUYB 2PTTB 1DQQA 4P2CG 4JFEB 2B7DT 4HS3B 5IHUH 5HDQH 1T0NA 3FMGL 5L6YH 4PB0L 4B7LA 5C8JB 1A3LL 2XY2A 3MRCA 4KZEL 2AJVH 4J1UA 5JIIA 5LQBH 5EZLA 1JMXA 5KS9A 3DTXA 3HC0B 1AGCA 2OYPA 3K8LA 1QBAA 5GZND 5EPMB 1KENL 3UTSD 1RUPL 1W72B 2PR4H 4KPHH 4UINH 2UVFA 5KG9B 4YDIH 1Q0YH 4ONOA 2FH6A 2VTFA 1QR1B 3BGMB 1MHEB 3LDBB 2Q6WB 1ZGLP 2DYPA 1WBYA 5D7IA 5L2KD 1EMTH 1IEAB 2EDYA 1T22A 1E6JH 2Y5EA 5AG9A 3CH1B 4DUWA 4QTIH 5E7FA 4OZ4A 3LKOA 4HT1L 3CVIL 1EO7A 1O7VA 5GRUH 1GOFA 3IDUA 4U1HB 4GXVL 4MD4B 3RVTD 4UILH 1MEXH 4WNQB 4U1JA 4RMSA 4NKMB 3H9HB 4P46B 1GCFA 3H7BA 1T1ZB 1OF2B 4PJEB 1FIGL 3R4DA 5BJTA 5ID1A 4PJBB 2YRPA 3A67H 5BQ7A 1NMBH 4I0PD 5DI8B 1K2DB 1C5CH 5HYJA 1EJ6A 1UH4A 1MFAH 4JO2L 3C9NB 3MYJA 1A6WL 2B2XH 3T3ME 4GKOA 3OGOE 2F54B 1D5MA 3F12B 5IHUL 2A0LD 4JFHD 5JXED 4K7PL 5DR5L 3HC4H 3PL6B 1ED3B 4GMSH 4QXGL 2V7NB 5EU3B 1U58A 3ARPA 3OF6A 4NRZA 5E4IA 2OXGA 1UGNA 1JNNL 4KVNL 1RUPH 4HZLB 1KLFA 5IFJA 1NEZA 1FYTE 4OLUL 4OGXH 4G42B 5JR1L 3BQUD 5CIPA 3DBXB 3TLRA 1WIOA 3F5WB 2LVEA 3W0WB 3RL2B 3EGSA 4E0RB 3VGAC 2DJ4A 3DETC 3FT3A 3WDIA 4IRJB 3MRBA 4LCYB 2AERT 4MDJA 2YA2A 4JM4L 1U8MA 4O5LL 5DK2A 2OR8A 1GGBL 3CLFL 5HGDB 4POYA 1R6VA 5A2KH 3MCG1 4AIXA 1KJ2L 1KPRB 3RVWC 3RZCD 1JPGA 3B3IA 4KKBD 2KQMA 2X05A 5TGBB 5FFLA 1OQOA 3MLTB 3HLAA 5GGUB 1YA5A 4RX4D 1NSNL 5I8EA 4P4KD 4XCFL 2J3SA 3BH9A 4Z0XA 3HRZB 4NN6C 4E41E 5D7LA 4L3ED 1JZ6A 1N59B 5GGSB 5IVOA 1CI5A 1D5ZB 4YNYB 4E5XA 1MIML 3VFUA 4YFLI 4U0RC 1IT9L 4Y7MA 4JZNB 3CXHK 4Z77B 1X5JA 4QNPE 1LP9E 4Z78A 3MREB 1HEZB 3V6ZB 1J8HA 3V4PH 1RUAH 4NM8L 5L2KB 5JLZB 4X6BB 1JNHB 1UWXH 5L7XL 1Z2KA 2HT2D 2YMXH 2NY3C 3LEVH 5IV2B 1EGJA 4PRAA 3K4ZA 4QY8A 2L7JA 4JPKH 1FZKB 4MNHB 5I0DA 2ADFH 4QXUH 4XPFH 4HD9A 1HSAB 1D7FA 5DRWA 1OP5H 4MXQC 1OAUL 3D39E 1L9NA 5KW9H 3MACH 2Z31A 5D70H 4KFZC 3V6OA 1U8KA 1DEEB 5AG8A 3VE0B 25C8L 2CKBA 2HT3D 4OCWL 5ITFA 4QHNA 2W0FB 5GRVK 5C3TA 5KVGL 5GGSY 1U3HB 4OZGA 4PTUA 1A7NH 2Z91A 5CWSB 3PIQA 2R0ZH 2BFVL 5MERB 3IVKA 3MGTA 1RZKL 2AJUH 4B41A 1HH9A 5FF6B 2EYSA 3EDFA 4RGND 2Z31C 1CG9B 1D6VL 4ZPVA 1QZ1A 1V3MA 4FQPA 4NQTA 3HMXH 1HIML 3DX6B 1G9NL 3RIAK 3VRJA 5J11C 3U2SB 2B39A 4ZUTB 3MUGB 3NIFE 2VKXA 3MX0A 5T3ZH 5TE7L 1WISA 5ICYA 3V0VA 2X4NA 3MLWH 3F7YB 3V0AC 5E00B 1A47A 1FNEB 1RIHH 4M6MH 4TSCH 1HWGB 4XVJL 1VA9A 3ZT7A 4LHUD 4PJGB 3THMH 1I1RA 3MRFA 3P30H 4Y16D 1BBDH 2G2RA 1ZHBA 3ESVF 4KUCF 4EI6A 3EJJX 1BLNA 5EUOA 1FL6B 3RQ3A 4ODWB 2SEBA 3Q48A 4RCAA 2YD2A 5IUSA 2X4UA 2X4QB 5LG1A 3KGRA 3GHEH 4NWTH 3V79C 4P99A 2ESVB 4KMTH 3UBXB 5JHDA 1LO0H 5F1NB 3MV11 4KZDH 1KB9K 1UM6L 5INDA 3SO5A 5IF0A 5JNYA 3OKYA 3QNZA 4FMFA 1R3IH 3CSYB 1JGUL 1ITBB 3BQUA 2J4WL 4F2MB 5EOQH 1FO0A 3QCVL 3PXJA 4OLXL 5C09E 1L0QA 1JUFB 3WYRA 3QDGD 2F5AL 4U6XA 3NVQA 4RSVA 3TN0D 4X5WB 4RFNB 5I1GH 4JZJB 1P7HL 4RZCA 3VFRA 4LASH 5GRYA 2AK1L 3AFLA 5F7LB 2HKHL 1EUTA 4DFIA 4UOW1 4O9HH 4PPTA 3O4LD 3BZEB 4UUJB 1FZOA 4N0FB 1NKRA 3RRQA 4PJBF 1FRGL 2PTVA 4WWKC 4DTGL 3VG0L 3WMSA 3AM8A 1R3JB 1TIUA 2AQ2A 5IEHB 1SBBA 2CIKB 3DRTB 5ESQB 3UJJL 2Z4QA 4NO2A 2J6EH 1TJIH 3DURA 4J4PC 4X6DE 1FPTL 2HKHH 4PJ9A 1CZ8H 1FYTB 1ZEAL 3QWOB 4NHUA 1K4CB 4ZNEA 1XF4A 4KRNA 1NCTA 3BD5A 3RBGA 3ZL4H 4R4ND 5MEQB 4ZUWA 5C09B 4U33A 3UTZA 1JN6A 1OCWH 4HS6B 2DICA 2GSGB 1OAXL 3QEUA 3RNQB 1J8HD 4RMQA 2WQ8A 4PJ9C 5MP6L 1AI1L 3G04A 4YHLH 2MCG1 3RDTD 5FA3A 3UPRB 1NSNH 5HHXL 4DJMA 4O2EA 3TYFB 5GSVA 4KZDL 3QUMA 5F96H 3GRWH 5DJDB 3WUWB 3MMEB 3DGGB 3Q1SL 4YDVB 2DQDL 2YBRB 4F33B 5GJTH 3C2AL 1SYVB 4DWHA 1KFAH 4R0LC 1A7RL 5CJ5A 1NEUA 1F13A 5MEOB 1MLCB 2V2WA 4MMXC 4HS8L 5HDOA 2C3WA 1CXKA 3O6FB 1ZTXL 3KYOB 5I1EH 4L3AA 1J0IA 3U7WL 5HXMA 1BVKB 3P30L 4O4YH 3O3EA 5DJZA 5KVMC 4F7TA 3I50H 2XT1B 4PV9A 5IJVB 3GI9L 2ARJA 1TZIA 2ED8A 4NRYB 5HPOA 2ZSVB 2NX5D 2OL3L 3S4SG 4G7YL 3QDMD 3OJDB 4HEPG 1CD0A 4S2SA 5DD0L 1XGQB 4JHAH 3T0BA 3ARQA 3BP4B 7FABL 2JJTC 2FJFB 3DO3A 3OB8A 5E6IA 1WCBB 1AGFA 1PY4A 4ZUUA 5DK0B 2NXZC 1IL1A 4NN7B 3MJ7A 2GIYA 4JKPH 4S0SD 4YBQD 4LCIL 3DVFA 4HDIA 5D71L 1S5IL 1YEKH 4JPWH 3TV3H 1HDMB 2JJTA 3GFUA 1A7QH 4JLRB 4YPJA 1L7IL 3QHFH 4XNYL 5IWLC 4G6JL 3F6IA 5LCVH 2B1AH 5EZIL 4M43L 4MXWL 2X4RB 4FXLA 2JIXA 4J6RH 3LEYL 2R23B 4AMKL 4XB8A 1AQDA 4NP4H 1INQA 1OHQA 3NA9L 3LEVL 3FO9A 3BGFC 1AY1L 3OKNB 4UU9B 2K7PA 5HGAB 3DX7A 1XR9B 3WD5H 3FO2A 1OLZA 5C09D 5DTFA 2PO6A 3DVGA 4F80A 2WINB 1IGJA 1MFCH 3SO3C 1K3ZA 2OS7A 1ZA3A 2VXQH 2VLLA 2EKSB 3UTQA 1BD2A 5C0AD 4NC2B 3BE1L 1NMAL 5L9DL 1NC2B 1X5KA 3C2SA 1I3GH 1UZ6E 1VFAA 4OKVA 1QFPA 1XGPA 2X4PA 1QRKA 4G5ZL 3U9PH 5E2TL 3HA0A 1K5NB 3S96B 4LCWB 3ROOB 3MROA 3ARBA 3RUGB 1KEGL 1H3VA 2H32A 3TEUA 1WWBX 5CEYA 1J0ZA 3TESA 3ZYIA 5IFAH 1OARH 1ZS8B 1HHHA 3L6FA 4KJPC 3C5JB 2HFTA 2VR4A 3PGFL 5LBSH 3RWGB 2DQUL 4MB4A 4GBXC 4MAYA 1CR9H 3PGFH 5LBSL 1DBKH 2X1QA 4RGOH 3WXWH 3SCMA 1IRAY 2YPLB 3TBSA 4PJDB 5C0JA 4PGBB 4OGAD 3LHPH 3FN0H 1PX3A 4WU5B 1UM5L 1MQKH 4XNQB 4MXVE 1NBQA 4RGNC 3RDTA 1JI2A 2Y72A 1LE5A 5GSRB 4Y4KB 5F71A 3UZVB 2QSQA 3QH3A 4G8EA 1HHIB 3IDGB 3JUZA 3P77A 3NA9H 3TN0A 4QXGH 1WWWX 3MLZH 4UB0L 4F37K 3IFPB 5GGTL 1UJTA 4Y4HC 1AJ7L 1ZLUK 5L8KB 3PWPB 5IROC 4ZXBA 4UIMA 5AAWA 3WFDH 4JO1H 3TNNB 2EE6A 3GSOA 5IOPB 3PNWA 3LN5B 4JM2F 5ITBH 1J12A 4PREB 4I0PC 2CDGA 3KXFD 1NFIA 4Y88A 3KWWB 1N8ZB 3TYGL 3GKWL 1KIRB 4WO4B 4NSKA 2Y23A 5B3JE 4WW2B 1MI5E 2C1PB 1QFUH 1QSED 4XMPL 4G6AD 5F89B 5HDLA 4BFGA 2VDPL 3SDCC 1X4XA 1MWAH 5C0FA 4DKEL 2I60L 5BW7A 3IJSA 3W81A 3IDJB 5KN5B 1TPXB 1EVUA 4U6YB 2W59A 2DIJA 3E6HB 1JPTH 4LEOB 1G7MA 3C6SA 1EO5A 4G7YH 2VZUA 5CBEB 2GITB 2YWZA 1LGVA 1IQDA 2O5YL 4APQD 4LBEA 5F7DB 5I15H 3PUCA 5JPMB 1FDLH 1U8IA 5F7EL 3IDMA 4LLVB 1YPZE 3SKNA 5I17A 3C8KB 3JWOC 4I9WE 5GIRA 3T8XB 3VXPA 1T7XA 2E9JA 3RAJH 5F7NC 3B9KD 3PJSA 4NHCH 1BF2A 4KK5C 1S7TA 1YJDL 3ULUF 4OFIA 1AFVL 2D7QA 4P5TD 3L3KA 4LU5L 3VFPB 2EZ0D 4DZBB 5F9OL 3QDJA 4JDVA 4MNQE 1QFWM 1HXMB 3OG4B 2AW2A 4GH7B 4O4YL 1F6FB 5I1EL 1B4RA 1ORSB 3STZA 5ALBL 4ERSL 4UTBH 3SPVB 2N4IA 5FEBA 5CINH 1XGRA 15C8H 1IC4H 5IBLC 5DRXB 5GPRA 2WY3A 2FIKB 2XQBH 1IGFL 1RPQA 3ULVL 3PQYE 4XP1H 4Q2ZA 5GGQL 3UTSB 4H1LA 5BVJA 2XQYK 2EIDA 2XKNB 3W2DL 1S7VB 3U1SH 3SKMA 1NGZA 2C3GA 5BVPH 4XPTH 3PWJB 3S5LG 1QVOA 3MLUH 4LCCA 1OSZB 5FGCE 3E6FA 4GKSA 3TFKC 1XZ0A 5ENWB 1RZJH 5HHOD 4NIKB 3AROA 3KXFB 1GOHA 1T4KB 4O02H 1RQ5A 1G6RB 4GG8B 3F7PC 3DMMC 4J8RA 4YHYC 5CHNB 4M61A 2DB8A 4PJ5E 2X44D 1N5AA 2WBJD 3EHBC 3NCJL 3GSUA 1MWAB 1U8HB 1OD9A 2Y25A 4CADA 2CRYA 4PJCE 4Y0GA 1TETL 2NY6C 3VXRD 3QUXC 5FK9B 4NO3A 5C0BE 3VRIB 5GGTA 4AT6A 4GQ9H 5D1XD 4FXGB 3ARDD 3P9LA 4X6CE 1S78D 3K8KA 4PR5B 3LN4A 4ZNCD 4X7SL 3O9WB 2VZ3A 1MLBB 3HI5H 1V05A 4JQVA 1RU9H 2H26B 5ERWB 1QFWL 3K74B 5CEZE 5CMAB 4FFZL 4FZ8L 5CKGA 2VR5A 5CD5D 5I1JH 3BWUC 2ADJA 4CN4A 5J9PB 3D85D 2Q8AH 2PYEE 2XG5A 4HK3N 3RWEA 4A6YB 4F7CA 4PUBH 3DROB 4RFEA 3ZTJG 3ZMRA 3S35H 1M1SA 1R5WB 4NT6B 1H5BA 2FGZA 3BP7A 4JN1L 3K2MC 2APXA 1PFCA 3VWJD 1HQRA 5D2LE 1DBAL 4YO0A 3VXSD 5IM7A 3HRPA 4PG2A 3AS3A 1FL3A 5H94A 3HE6D 2Q86B 1I3RA 1A6AB 2OTPA 4Y5XC 3ZE1E 2A74B 4G80A 3WFZA 1AGBB 2I9TB 4JGMA 2AK4B 4YHNB 4Y5YB 3GSNB 1XGTA 1KN4H 1HSBA 2YZ1A 1HI6A 2ZUYA 3RWCB 3W82A 2E9IA 3MODL 3M07A 1QNZH 1NAML 4P9HL 4JPIB 1WFTA 4HFWA 1PG7W 5DC9B 5ADPH 4PJGE 3V52L 3ZDYF 3T0EB 3OR6A 2VDOH 4PRIB 4XH2A 1RURL 4Z7OE 2UZYB 5CGYC 1RD6A 4XXCA 2P7TB 1EERB 5CBAA 1KUMA 4LDEB 1KGCE 1F3JA 3H9SA 5GISH 3S37X 3IXAB 3RJDA 4K3EL 3FFCD 1CQYA 2GCYB 5MHSD 5K9OA 4JPKL 1UXSA 4H25B 3JSSA 4QHMB 5FYLD 5HYJD 1EX0A 3QP3A 5D7JD 4WEBL 2AXFA 3LMJH 1NCCH 3LV3B 3VDCA 5DJ0B 1JWSA 3OG6B 1VEOA 4HUUB 5CS7A 4FN0A 2JB6A 4XAWH 5I1HH 1CXHA 1KBGH 1RIVL 4Y19E 4UMGA 2G75B 4ZO8A 3UTOA 2V17H 4LSPH 4K94L 3GMPB 1LO4L 1A64A 2R2BA 3IDXH 3UYRH 1PSKL 3QXVA 4JDTL 5I2IB 4XT1C 2NLJA 5ALBH 5K59E 5T5NF 4Y2DB 4EBQH 3VI3F 1JWMA 4DK6A 3HZVB 3N9GH 5I1DB 1FC2D 1VPOL 3L5HA 5F7MC 4M62H 5FCUL 4X5LA 1WICA 2HKFH 4KK9C 1JF6A 1L6XA 4G8GE 2VZTA 3VG9B 5FO8A 5FHAH 5AUMA 4NHCL 5F9JA 2F19L 5DHVA 4AL8L 1DBMH 5J1TC 4JM2D 4X83A 4I1NB 1PZUB 4XPBL 3TPUE 3CUPA 2DYPD 1BWMA 2HG5A 5BO1L 4FTVE 4POZC 1J5OL 5E8DL 3GMNA 4OFPA 4PJHE 1P7QD 3D5OF 4HK0B 4YIQA 4WU7B 5CJOL 3IRPX 1KJVB 1O7SA 2NY2B 1NGQL 3BKJL 1JPTL 1CFVH 2HN7A 3WFHB 4MD5B 1H3TA 3KPSB 1LILA 2QQQA 4F57H 2IFFH 2ZNWA 1A4KA 5I1LB 1JGVL 4DN3L 3PV7A 2I60H 1P1ZA 2JB5H 4KU1A 4WHCA 2BERA 4MA7L 4G8GB 3UJTH 1QEWB 1EFXA 1U3HC 1X7QA 3GB7A 4BUHA 4GS7C 4Y5YC 3W39B 5I0ZA 2J5LB 4AEFA 5K9QG 3TA3A 5CEZL 4ODSL 2WBWB 4PRBA 2N7BA 2ADGB 4PJHB 4YDJA 5LAXA 4ZMAT 1TPXC 4MMZC 2EH8L 1CICD 1QBML 1S9YA 1YMMD 1X5HA 3MCKB 4DAGL 2A83A 5GGTH 3VFSA 1T6WA 2DD8L 1SEBB 1I9JH 4YR6A 3SDDB 3BPCB 4Q7DA 1IM9A 5LWYH 2GK0A 4HBQA 2CJUL 1T5XB 2WK2A 2HA1A 3DUUB 4DQOH 4YUEH 1QSEE 4P9MH 4XCYB 3MNZA 4LLUA 2A6KB 5JW3L 2D9CA 5FUZH 5EG6C 4L4TB 1CBVH 3VXTA 1S3KL 2D7PA 3DWTA 4OZIA 4UQ2A 4U31A 3RY6C 1JRHI 5SX4I 1AJ7H 5SWSD 4GUPA 4WCYH 3TVMD 3PHQA 5MHSE 2XTLA 1FJ1A 4WWKA 2Y36H 4O2FA 2VXSL 4JAMB 4RAVB 2FX8H 3JV5A 2CKBH 4PBVC 3U4BH 1GXEA 2CO7B 3I2CL 1CU4L 5DUBA 3LVEA 4J4PA 1SVZA 2AK4E 4EUPH 3U4BL 5LQBL 1HINL 5FAAA 1UA6H 4GAFB 3DX9B 1E4KA 2HTKC 3EAKA 1IKFH 5EU7C 5FYJL 3LKPB 4DZ8A 5I18H 4S10A 2DQUH 3UTPD 4D3CL 5E4EB 3DVNB 1ONQA 2B0SH 5I1IH 1XGYL 2AXGA 3FO1A 3MRIB 4BKLA 5JW5B 5F3BA 1FGVL 4OTXH 4CU6A 1OT2A 4ZSOA 2Z31D 2ZKHL 4NQCD 4XBPA 2FX8L 2AJ3A 3I02B 1ORQB 3QQ9C 1IGCH 2BVPA 2IH1A 4LOUC 2MKWA 4L8CB 4LEXH 5C2BL 5I73B 3P4NA 3FQNB 4MJ6A 4HKBA 2EDEA 2Q7YA 3NGBC 4L9LA 4AEIL 3AS2A 3B2UC 2OLDA 1RVFH 1BECA 3U4AA 3SKOB 1CFNA 1XF3A 3CFDA 4W6WB 4NYLB 3HAEB 5J0BA 5JIHA 1BQHB 4U1IA 3WLWC 4Z8FL 3BW9A 5ISZA 1AQKH 2OMNA 4M3KB 1D5IH 1XF2B 2QKIB 4FQXC 1XCTB 4IRZL 1BX2A 4NJ9H 4QHKJ 3KNBA 5EU6E 1KIQB 4DEPC 3O3DB 4HULB 1MHPH 3D18A 2EH8H 3P3YA 3QI9A 1KLGB 4KJWC 3ARXA 2EDJA 1QHOA 2DF3A 2DQGH 1DTUA 1U2HA 5C07B 1MVUB 4NKOB 4PLKD 7FABH 1FL5A 3EDJA 8CGTA 5CILL 1F90L 1YYML 3IDIA 3ARFB 4BSVA 5A3IC 4L4TD 3EOTH 4FZEL 3D1MC 5J3HC 2VL4A 3IFNH 3WCYA 1Y6MR 2X1WL 4M1CC 4H20H 3SKJL 1HH6A 5CFHA 3FONA 2D31B 4KROB 3BGAA 5D1ZA 3ARED 3B5TA 4P48A 5IWLA 2FJGB 4HS8H 2CLRB 4LSRL 3VXOB 1FORH 3O45B 1OP9A 1WBZA 4HMCA 4F57L 1SJEB 3KG5A 4E42A 2YK1H 3HG1D 3H9SE 2Y7QA 4V1DA 4KTYA 3CMOH 3SY0B 4ODSH 3A6OA 3O4OC 1EDQA 4P3DB 3LKSA 1G7LB 5AYQA 3GI9H 3MUY1 1ZGLM 2PYED 3IF1B 3HN3A 4R6UA 5F6IC 5C3LD 2BDNL 1RK1B 3WNNA 3SDXA 1J9CT 2MQ0A 4JQIH 2HRLA 2Q76A 3T2NH 1X44A 3CFIC 2BY0A 5GJTL 5ACLA 5FUOL 1V5JA 1OW0A 2NY7L 3O3BA 5L88H 5EH1A 1KT2B 1IAOA 2HLFC 1LEGA 3PDOB 4KY1H 4RIRB 4HPYL 5FA4A 4L1HA 1ZLWK 3ULVF 2VWEC 1SEQL 3SQBA 5F44A 1YPZA 3LQAL 5HI5D 4J4PD 4L8BA 1AP2B 1H3PL 4RISL 1R3KB 4GG6A 3ELAT 3UBXG 1EEYA 4U7SA 4K7FB 2ICWJ 2Y6SD 5EBMA 4MNQB 4PP1C 2EDWA 3C6LB 2DQJH 4GBXA 5GRJL 5ILTH 1NBYB 1FFPA 2Y1VA 2EDKA 4AL8H 4OF8A 2KL6A 5DJAB 5FM5O 1A7OL 4L8SB 2APWA 4WO4D 3TPUA 1BD2D 4PGDA 2EDDA 4HIXL 3QA3A 1RZ7H 5FKPA 5C6WH 1UEMA 1Z9LA 5DEGA 1SJXA 3RDTC 4NCDA 3RI5F 2GT9A 5EOQL 3A0OA 1MQ8A 4HUXA 3MCLL 5IB1A 1FG2B 1S7XB 4LSSL 1NCBH 2GUOB 1CT8B 2W38A 4K23H 4ZXBC 5JORB 4QRRE 2ICEA 2R39A 2WUCH 1LO4H 2NZIA 3QDGB 3QEQA 2W9DH 3QNYA 4LPUA 4DK3A 4NPYA 1FNSL 4MWFA 4LHUA 5ALCH 3RY5A 4MJIB 3LEXA 1A1OB 2AV1A 2YC1B 4M03A 3MOBL 3RPIA 1IGTB 4OM1H 2YD1A 4X4XB 3SE9L 1NCNA 1UYWL 3EO0B 4MHHI 4HF5H 5DD1L 1PBYA 5DS8A 4P2RD 1FC1A 4ZFOA 1JRHH 1UM6H 4HC1H 5SX4H 1DFBH 4JJ5A 1YEDA 1MCKA 5DQJB 4K71B 4U6TA 5F1IB 1IEHA 1Q9LB 2QSVA 2ZUWA 4R26H 4F9PC 2JCCB 2W07A 2FLBT 5HI5C 3L3DA 4OIIH 2OI9B 2V5SA 4RNRA 3B9KC 1NC4A 4BA8A 1BBJB 5SWZA 2VDNL 4KK8C 4J7RA 2AEQH 4P5TC 2EXWC 3ROLB 1YEJH 3MV8D 1WBXA 3U82B 1KN4L 3UZQA 4R4BB 2MHAA 2ZOKA 5J4MA 1KN2H 4QRUB 3STLB 5HYEA 4D9QD 1G1CA 4MAUH 2XZCH 4P0DA 4M7ZC 3MRGA 4OFYA 4K3GA 3TVMC 1MJ7L 4XX1E 5ANMB 1T3FA 4LLQB 2BSRB 3VFWB 2EDHA 3QXAA 3D48R 3DV6A 2NY0B 3BAEH 2KZWA 3TPKA 3PWVB 4JO3H 1U8PB 3U4EB 4BSWA 3BVNB 2AJUL 1HYSC 4NZRH 4UI2A 2I9LB 2MSPA 2HT2C 2VL5B 3NCEB 3QEHB 3TVMA 4H0HB 5CJQH 3NCFB 3L3IB 2E8YA 1P6AB 3G6JB 1P6FA 1BZ9B 3GM0A 4YZFE 1I7ZB 4I13B 4L4VA 1ERNA 4WHYG 5E2JA 3N1QC 1DANU 5FECA 15C8L 5CJXA 5INCB 1DFBL 1M7IB 2VDLH 1FO0H 3I9GL 3C5ZB 5T1LA 4X7SH 1FN4A 3EOAA 3RZWA 3OAUL 4CVUA 3LRHA 4D94A 5IB2B 4I0PB 4ZAKA 1MCLA 3KAAA 3SQOH 2EEAA 3B2VL 5T3XE 1I8LA 4ELMA 1G7HA 5DEFB 4NZUH 3RHWF 4I4WA 4FG6C 5EIQA 1KNOA 2CLVA 4MA8L 1MIMH 2IQAA 5HYSB 1FFOA 3PHSA 3H0TA 1AXSA 3QIUA 3LKQA 3OKLB 2E7LE 3TZVA 2CGRL 4M9PA 3TJHD 4PLNC 2NY1B 4OFDA 3FB6B 4ONGH 1LO2L 4PGEA 4R90L 4HGWA 2NZ9D 2PKDA 4OCNC 2O5YH 5F9OH 1KCLA 3NGBB 2P5ED 3QIUC 4M5YH 5GS0D 3QCTH 3LRGA 4UIKL 3TZVC 5L8JB 3BGFB 2LTQB 4AM0B 4IRJD 3CPLA 4LHUG 5GRJH 3PHOB 3IKCA 1V3KA 1Y0LB 3HG1B 1SYSA 2OR9H 5DQ9B 2BCKA 2PF6A 1NUNB 1CDCA 5IBTH 4YGAB 1QHPA 1ZLWH 1IZKA 3BKCH 2XZZA 4LCUA 5I1KH 3IFNL 4XXDB 2A6DB 5JOEA 3D6GA 1C1EL 4WUKL 4NO5A 1FHGA 2JK5B 4GMTL 4B5EA 4N0UE 1CDIA 1MAJA 1FVCA 1Q0XL 1J1XL 3GBNL 5DD6B 1Q1JL 3S35X 2AKRB 1OP3H 3WJJA 1YUHB 5TDOA 2NXYB 2ILLA 3NFSL 4PJ8B 1BM3L 4CVZB 4JFFA 3REWA 1TFHA 1ZLUH 1IAIM 4JFDE 4JFFE 3QFDB 2DMKA 1T5WA 1U8JA 3TCLB 1CFSB 4F15B 4WDIB 3IFOA 4ZFGL 4X8JA 1KCKA 1G0XA 2Q3ZA 2QQKL 5DFTA 5IVNA 3KPPA 3ARUA 4U1MB 1KG0A 1QD0A 3FN0L 4KZEH 3GNML 3SDYH 3DXAA 3BZFB 4CDHA 5FOBA 3WFDL 4WI8A 4JFYA 4HJGA 4KKCD 4JRYD 1IC1A 1OTUC 3BP6A 1CGXA 2R1XA 4X9GA 4N5UA 4BYHA 2Q7NA 5BRZE 1QSFA 3DYPA 2WBJB 5KSBA 2F58H 1OP3K 5K9JL 3O8XB 3QAZB 2PUQT 4YHPA 4H5SA 4R8WH 4XPHH 5EC2A 4PS4H 4RQQA 5D2LF 5EA0L 5DMIH 3GMRA 3T0XA 2BSTA 3GHBH 2DN7A 5FO7B 5CGYD 3EZ8A 5HYQA 4S1RL 2FO4A 1Z3GL 4P4RB 5HHOA 3K1DA 1LK3L 5EO9A 2JELH 1UXWA 3FT2B 3T3MF 4BH7A 1MNUL 5EOTB 3RWJA 5K9KB 2VSCA 1P4BH 4M7LH 1S78C 2HMID 3HHRB 2IALA 3FO0H 1RJLA 3OKKB 4M7LL 1DR9A 3BD3A 4AIOA 1V3JA 1C7TA 4YDLC 1FNGA 3MLRH 4WI3A 3ZDYE 1OAYH 5D2NB 4G6FD 4N1HB 1RVFL 4TOYL 1GZQB 1QYGL 5DGQA 5E99L 1S3KH 2CUMA 4F3FB 1NMAH 1UCBH 3G6AB 1XAUA 5TDNA 2L7UA 1HKFA 2IJ0C 5E8PA 4XVTH 1GIGL 4RA3A 3TV3L 2V9RA 1E4XH 3O6KH 4JFPB 1L7TL 5T3ZE 5JW4N 1P4BL 3FB5A 3C5SB 3BKMH 4M00A 3LAFA 1X5ZA 1MCNA 1ITCA 4DAGH 3M1BB 1H3WM 4JRWA 3EO9L 3L3OA 1RIUH 2YUWA 5HHME 5EDXA 1DJSA 1MFDH 5FYJE 5IG7B 3QQ4A 2YD9A 4Y4FD 1MOEA 3QHFL 1PKQE 4XNYH 1L7IH 1KB9J 3O4LB 4QF1B 4JREC 1TVHA 3FTGB 4NFBA 1EBPA 2OL3H 3W9EA 5IGXH 4P9ML 1X6NA 4OZHA 3EYSL 3WIFA 5SWQB 3VXRA 1I7RA 2B1HH 4CMHC 1A2YB 3FB7B 4CRPA 2CKBL 1AXIB 2LQRA 2FATH 1HWHB 3F65A 4OGYL 1Q9WA 3I6LD 3UDWC 1MCFA 2QSTA 1NBVH 1F58L 1F8TH 1ZTXH 4ODXB 4A2LA 1UACL 5LGJB 4XNZC 2XPGB 1J0JA 2WUBH 1TQBB 3WSQL 1I75A 3GJFK 3PWNB 2IMNA 3NIDF 3HCVA 3E2HA 5B3NA 5HHNB 5EU6B 2VDRL 4X0KB 4A6YH 2E7LC 2DQDH 3JXAA 3VJ6A 3H7LA 5FUZL 2UWEE 4ALAH 2XWBB 5IK3A 1JPFA 3HI1B 4GMTH 5A16A 3EFFA 3X14B 3GGWB 3LKNB 5JDSA 5ACMA 4OD3L 3O2DH 4PJCF 1DQQB 1PKQB 4FFYH 1Q9KB 4HS3A 4DKFL 5HHXH 4JKPL 2CKNA 1BMGA 1T04A 1EA9C 1Q9OB 2QJDA 3MRCB 4JB9L 3BSZL 5DQDL 2VO5A 1T1WB 1MREH 3HC0A 2E7LA 5EPMA 3FFCE 1A7RH 3CFKB 5MENE 3HNVH 3RNKB 4UOW0 4QRTA 3PGDB 3Q1SH 4Y5VC 1NBZA 1QO3A 5DD0H 4I18A 1OTTD 5ISZE 1WBYB 1P7QB 1MCJA 3TWCL 4X6EA 1U8QB 4LVNC 1CZ8L 3I85A 5GS1B 5HDBF 5JXAH 4J23A 4GXUN 3ARTA 2R8SL 1TCRA 2AJSH 2VUOA 3VH8B 2NY1C 3WS3B 1E4KC 1OAQL 4Z7UF 4Z95L 2HMIC 2C5DC 3TNMA 3ZT5A 4PJEE 4IOIB 4CVXB 4I18C 5IB5B 4JM2C 1OVZA 3RIAF 1BGXL 4G8GD 2AK1H 5KTEL 3TO4D 3BUYA 1KFAL 5I1HL 4F7PA 1NGQH 3BKJH 4FQIL 1FCGA 3MA9L 1BJMA 5I8OL 4PJDF 3ZO0A 1J1OH 3DUHA 2DTML 4XZUB 4FABL 5DVLA 2BNRA 4HZAA 3UJJH 4Z7VF 1I1AB 2MKLC 4NN5B 4R90H 5C0CE 4DTGH 1GGCH 1TZGH 5F9WC 3ES6B 2DQCL 5KVDL 2NW3B 4UAOC 1FNHA 4WWKD 4H8WL 1YMMB 4JRYA 1NLDH 4L5FH 3FOLA 5IFJB 1N26A 3U7YH 1RHHA 3SDCD 5A2FA 1I85C 3VFGH 1QSFD 3W0WE 4I3RH 4Q74A 3DJ9A 4WGVB 1QTYT 5C08A 4Y16A 2GSIA 2W9EL 2F8VA 1AO7D 1HE7A 3L5XH 1O5DT 3MRBB 5E5MB 2OK0H 4MDJB 4MS8D 1M05B 2FH8A 5EORL 4P23B 4U1NB 2Q8BL 1OGAD 2IBZY 1HN1A 2NY5L 2PW1B 4XVJH 1I1YB 4M6ML 4ONFL 4NOFA 3B3IB 3LIZL 4TSCL 4WFFE 5HJ3B 1FE8L 3T1FA 3M17B 1CGTA 3HLAB 3ULVD 1WUNT 3EYVA 1LE9A 2A73A 5DJ6B 1S7SA 3DPBA 3OB0H 3JV6B 2FHBA 1E4JA 3RVUC 1ZHLA 5FYKL 5C0BD 1YMME 1J05A 3FQUB 4GW5A 4RA0C 5JO5B 4XCEA 3TBTB 1A6UH 4NZRL 2PCPA 4EZMA 1XF1A 3E3QE 5CZXC 1DQML 3B9VA 4UZGA 2Y07L 3HUJA 1XH3A 3CSGA 4XAKD 2QHRH 4PYGA 4Z7WA 4I2XB 5E9DA 1J8HB 3T0VA 5L2KA 3OXRA 5JLZA 1T21A 25C8H 4OCWH 4OBSA 5F21B 2OCFD 3X12B 2BP3A 3JTSA 1YEGL 5MEPB 3SOBH 3U6RA 1MCHA 3GJFA 5DRZA 4EDXA 3ARBC 3LSOA 4NQVB 1DCLA 3IS1X 4PJAE 1CD9B 1OP5K 2YN5A 2EIZB 4ELKA 1G9MH 1DQMH 5HYFA 3WIHL 4LVEA 2YMXL 1OB1B 5GZOC 1VACB 4F8QA 4UOJA 1JHKL 3OB0K 3SE9H 1D9KB 2DQTL 2Z8RA 1T0MA 4NQCB 2P8LA 5DA4A 4X7EC 4WI5A 1E6OL 5IIEB 3WS6A 4HKXA 3MACL 5L0QB 2RCSL 4NQEB 4HWZA 3V4VL 4NQXA 3AMKA 4L4VE 1KJ3H 1RZJL 4QYOA 3P0VH 2YR3A 5JPNA 3MUGA 4U1KA 2UWEB 5DD1H 1Y6NR 3MRJA 3CGTA 4L8DB 1I1FA 3RWIA 1P4IH 2ADIA 1Z6JT 3WLBA 3P40A 4YWGH 1H3UA 3IFLL 4HWBH 4M5ZH 2MQCA 1GAFH 1UC6A 3L7FB 1OM3L 4NO0A 1A7PL 4EI5D 5F72S 5DMYA 4O5LH 3MRFB 4OZGE 1G7QA 4Z7UA 3T2PA 4NQCE 3B8YA 3S3SA 3GBLA 1MFBH 2G2RB 3UO1H 3KDMA 4LGPB 4OLVH 2V5TA 2KKQA 5A2IH 4XCFH 5L2JB 1TQCB 4HKJA 1VKXB 4PJXB 5BS0A 2R8SH 3LQAH 5F1NA 3VFNB 4OUUA 3G6JF 3C60A 5I8OH 5D5ME 1QLFA 3AVEA 2Z8SA 5BOZG 3OAZH 3N85H 1K8IA 5BZDB 3CSYA 5J6GA 1MCBA 4R4FH 3RY4A 2EKJA 4IMLB 2OJEB 4P49A 3QI9D 3O6LH 5HD8C 3IJYB 3WL9B 1E28B 2A1WL 3TT1H 3V8OA 5IQ9A 3T08A 2VITB 1RUKL 4NJAH 1MAMH 1MH5A 4UDUB 1MI5B 2AJSL 1KB5L 5FIEA 3BUTA 4P2RA 3GSXA 4M8QA 1GGYA 1IBGH 2O5XL 5KSAC 3W2DH 4OZFB 4X6DF 3LY6A 1JGEA 1ZT1B 1CD1B 1R3LB 3RWFB 4DGVL 5KSBF 4HLZH 2K7QA 4PJFA 1FGNL 1Z0NA 4IDJL 1QRNA 4GXVH 4PJXE 2XQBL 3IXTB 5IT2L 4EDWH 5B8CA 4JKWA 2W60A 1IC4L 4N90D 3QXDB 4JKMA 2VLKD 3TH4T 4LVOB 1JBJA 2EEDA 3QWOA 3BSZH 1ADQA 1CFTB 5CD3A 4KXZI 4GSDH 3GMLA 4TN9A 4BH8B 4G7VL 2JCCF 3UTZB 3VDBA 1MRCH 1KCSL 1A1NB 2DJUA 1IGYB 3OR7A 4QRQB 4M8VA 4I48A 1KLUB 2WWMD 3ILPA 3FB8B 4NC1E 1M4KA 2J8UF 5EO0A 4TSAH 3QEQD 2FGWL 4R4NC 1KYOJ 1S7QB 2AV7B 2ITCB 1U8NB 1CXEA 3ZKSD 3MV7E 3BH8A 43CAA 3QUMB 4TVPH 2VLJD 2ORBH 4AENA 1YEIH 4L3CA 1A6WH 2B2XL 2XNAB 4XPGL 1HXYB 4UQ3A 4CW1B 2HJKA 1U8LA 3DIFB 1ZT4B 3RWDB 1P69B 2B20A 4PBXA 2DWDB 3EFDL 2V2WB 1EIBA 1OD7A 3BIKA 3UYOD 3KYOA 4GLRI 4IMKA 5IVZA 3MYZA 4MAYD 3PGCB 5HGBB 1Y18A 3IT8D 3FMGH 4DUXA 4X6FB 1X5IA 1TTFA 2CDEB 2VDPH 3WJLA 5BV7L 1OWWA 5GHWL 3LH2H 1B4JH 1UFUA 3ZHDA 5SX5K 2BMKA 4G6KH 5HI4C 3NIFF 4Y1AD 3MV8A 1A5FH 2UZXB 1DN0B 2HFEA 1MJJB 3KXFE 4LLMA 3QUXA 1KV3A 1I8LC 1TMCB 1NFDB 1KEGH 3ULUD 3EYFB 3V6OE 2FLRT 3TBYA 1BQUA 1U0QA 1UM5H 1XIWC 2F5BL 1FZMA 1EGJL 1FAKT 5E2TH 2BNRD 4F7MB 4P57B 3QUKB 4HIEA 5DFWH 4I0KA 5EWIL 1RULH 5C0BB 5I75B 2H6PA 4X5XB 2XQYG 3B4NA 4KH2A 2H3NB 4LK4A 2DAVA 2X7LB 4ZUVB 1A3RL 2HLAB 4N1EA 1C5DB 3WXVH 2QR0B 4G43A 2VLKB 3BDBA 1KJMB 1H5BC 1S9XB 3VWKB 2NMSA 1KIPB 1XF5B 3MRMA 5GRVL 4P5TB 2B4CH 2FEDD 1GZPB 2PXYC 5TE4H 4PRHB 4L4VD 5EIIB 2PYEB 2A38A 4H26B 5JW4R 3BDYH 3ZDXF 2HJFB 4CMMB 2HTKD 3GSQA 3ABZA 4QHUB 3UC0L 2VN4A 3R0NA 5D9SA 3I6GB 4N68A 1BHGA 3SDXF 3BE1H 4KTDH 4LKXA 3AB0B 4WIQA 1B0GB 4MX7A 5C0CD 1YNTB 4LL9A 2PTUA 4DN4L 1MFNA 3ZKND 2WM0A 4DGIH 3HPJB 5GGRA 3ROOA 2XN9A 4GW1A 3JWDH 4NNXB 3RVXD 4TTDD 2R56L 2YKLL 5SWZD 1EHLH 2EYRB 1QRND 3QQ9D 6FABL 4TUKH 2CIIB 5JOFA 1A14H 5CEYB 3QIBC 4OZGF 3F58H 2UYLB 1KJ3L 3LEYH 5HHVH 1HHHB 3L6FB 5IEKA 1I3VA 2D7NA 2GYSA 4Y2OA 3QFJD 1VCAA 2ZUUA 2UUDH 2X4SA 3G5YA 4PJXF 5L0QC 3VCLB 2VZ1A 3QULA 4N0RA 1P2CA 3RWHA 3VXSA 3QIBA 2NX5A 3WIHH 1KXVC 4EIGB 1M6OB 2HVKA 4J1UB 4R0LB 4H88L 4WU5A 1K3IA 2DWEA 2FX7H 5ESAA 3QZWG 3MUHL 2GTZA 4EDWL 4YX2H 2I5YH 3O6MH 3ALPA 1KEML 4MXQA 1CWVA 1AD9A 5FO9A 5B21A 2VLRA 5C0NC 4P2OD 5IVXA 1D5XA 4X6DB 4XC3L 2QHRL 1OQXA 2N7AA 4Q9CA 3RX7A 4LOUD 1AR2A 5IBTL 4OF3A 4MD4A 4NJAL 4PY7B 3GBML 4N90E 5ADOH 2J12B 3TT3L 2LV4A 4OF0A 4WO4A 1JGVH 5D6CB 5C92A 3V5DB 3L5WB 3CX5K 1AHWB 3D2UA 1K2DA 1VGEH 1HOCB 4KI1A 2EDNA 3GJEA 5FHAL 3T0AA 4QRSA 2R9HD 1EV2E 3WHXA 5F89A 5KVFL 4M62L 4TTDC 3NA4A 1K4DB 2ED7A 2WQRA 4XNXL 1IEBB 3ESUF 1MY5A 3UZEA 3UPAA 1AI1H 1YY8A 1BAFH 4PJ5B 1VFBB 3OXSA 2R1WA 4XPBH 1QBBA 3LQZB 1A0QH 2AJYL 1EEUA 4G42A 4PLKC 4V3EB 2XICA 1ND0A 5DZLA 3IDMB 3OKOB 1IC5H 5HSFA 3KPOB 1X5AA 4KRPC 3O0RL 2RFXB 3VXMA 4L5FL 1X5YA 5EZJA 1NCUA 1RZKC 4N9OB 4WHTB 2XY1A 4LCYA 5J3HD 1MCWW 1KIUA 5DK2B 1UJ3C 1Z5LB 2IFGA 4XNXH 2R2CA 4DZBA 4EN3B 4PJAF 1NFDE 1XT5A 2CK2A 2ENSA 3BQUC 3QDJB 1DUZA 4KMTL 4D0BB 3MLTA 4RGMC 4JDVB 4JPVL 1J88A 1WFNA 4P2QB 5I8EB 1FVDB 3UAJD 3RKDC 3MFFA 4NCC2 2AJYH 1UB5A 1J1PL 4GAYB 4Y4HD 1ZEAH 1EJOL 1R0AL 3INUL 1ZK9A 3LMJL 4NQDB 2BK8A 3CDGA 3WNLA 4E5XB 2ICWA 3CCHB 2OL3B 4ZDHB 3KR3H 1HKLL 2QSCL 2P4AB 3NBNA 4JO3L 2VDKH 4JFDA 4RMVA 2DQHL 3AM8C 5I1AA 3FT4B 2V2XB 3SKMB 2XZAH 2IPUK 4HAGA 1BZQK 3V5HA 3TWCH 2BRQA 4NNYB 1VSCA 1RURH 3VGEA 1OSZA 3RY6A 2VSDA 2BNRE 3D39B 2Z93B 5EU5A 3VMNA 1TTGA 1A6TB 2VH5L 5KZCD 1DZBA 4WEUD 3GJFH 1ACZA 1JWUB 3T0EE 1YNLH 2IG2H 2AEQL 5IR1A 4OCYH 3VE0A 4XC3H 4XRCA 4WI4A 5KVGH 3MNVA 1U8HA 4JZOA 4CADB 5I71B 2NY5C 4PJCA 3TO4B 2C7UA 3O2DL 2DIAA 5HY9B 1U95A 3IVKB 1IAIL 5F97E 3BP5B 4OLZH 3V5KB 1GGIL 2XRAL 2M26A 3RUGE 5HHVL 1DDHA 3MZGB 1MLBA 3KLSA 4QLRA 4MQSB 3VGBA 2FX7L 4ZUTA 2Q1EA 3BDXA 1WC7A 2VOTA 4JN1H 4XCNB 1BBDL 1F6AA 2LTQC 5C0AA 5KANG 4F58L 5C0GB 1WK0A 5ICYB 3RTQD 3CFCH 4RGNE 3OGCA 3BZ4B 1JFQL 4JM2A 2N56A 2BVQA 3V0WH 3S97C 1WVZA 3E0GA 1AE6L 5I8CB 4PJDE 1N5YH 1CLCA 4KAQH 2V7HA 3OKDB 4K23L 1NCBL 2HVJA 3LPWA 3ZKMD 3WHE1 3HZKA 2VQ1B 1QUNA 1FL6A 5IMKA 2SEBB 1YYLL 1U91A 1UQSB 3MRKA 4M1DL 4C4KT 1H3PH 4K9EL 3BPOC 5E1HB 2KPNA 4FQ1H 1F2XK 2NCMA 4FQXA 1FBIL 1NGYA 5EU6D 1L0YA 3B6SA 1ZGLA 3GSNA 1I85A 2F74A 2P1YA 3OSKA 3B9EA 1HSBB 5E8NB 5IKCA 1AGEA 2EE2A 2VE6A 4FTVB 3O2VH 4MVBA 3BDYL 2BSED 2FBJH 5TH2A 3T2NL 1DLHB 1QLRB 5IW6B 1MRDL 1DSFL 1EGJH 4LSQH 3S3JA 4ZYKB 2DLHA 2DOCA 4P4KC 1ZHKA 4QEGA 2VXTL 5FM8A 5C6PB 4YEEA 4XPTL 3RA7L 1KELL 2YPKB 3ZYJA 4P46D 3BZEA 4LSTH 1I9RL 4GRLC 5CEXB 1A6PA 4JRXB 4KQ3L 4MVBC 4NN7C 4XP6L 4Y1AE 1IT9H 2X89A 4PRPE 4QHMA 1DVFD 2PO6C 4AEHH 2EEBA 5ICXB 3MXWL 2DBLH 3M8OL 1WIUA 2FWOA 4Q9QH 4LPYA 4QWWC 1MREL 4LRIC 4GXUM 5M7QA 4KJQD 2BOBB 4HAFA 1QLEL 4FFEX 4CUCA 1NMBL 5BOPA 5MEQA 3QPQD 4ZUWB 4P3CL 4FQQB 3VXUD 4P23C 5ACZA 2CRIA 2GSGA 1WTLA 5JUEH 4LU5H 2GI7A 1AGDA 4FFWD 2X41A 4ZS6D 5SWSA 5DJXB 5GGVY 1KTRL 4A6YL 5IFHL 3WN5B 1M7DA 3BOVA 4NDMA 3LH2L 1JWMB 4XWGH 4ZTOL 3HZVA 1HZHH 5I16A 3O6FC 4XWOC 1ES0A 1FORL 1KPVB 3CDFA 2XTJB 4Y4FA 3B9KB 1R24A 3NABH 3I6KA 4AH2A 2Q3AA 3DGGA 3QNXB 4HG4J 4YJZL 4MAYC 2P48B 5AUMB 3SKJH 3PABB 1SYVA 4QHLA 4EUPA 4PRID 3S88L 1EAPA 3IAGC 2ZUQB 3BHBB 3BYYA 3CUPB 4WY7L 3O6FA 2ZUSA 2QADB 1YEFH 5IMOA 4Y4FC 3QG6B 3FZUD 1T20A 1BM3H 4F7TB 1FFRA 4OFVA 3UBXI 1MWAL 3D3VB 3TN0C 1MJUH 3V4UH 2DDQL 1LK2A 4JFXA 3CVHH 3QUYD 3EOBA 1A22B 3MRHB 3QDME 5IROA 4WEMB 1ZT7A 3GM8A 1R5VB 3P0YL 3MR9A 4OZIF 1A4KB 1IGCL 1FIGH 2KDGA 4K9EC 2FJFA 1C1EH 1P1ZB 2DQIH 1NEZG 2WP3T 1IBGL 2O5XH 1QPPA 1N3NB 2H41A 2VXTH 4ISVB 1QEWA 1C16A 2D7TL 4HH8A 4OZIE 4R9HA 4KHTL 3GB7B 1CF8H 1RUKH 2IANB 4N8CH 1E6JL 5HPMB 3CXDL 5I66B 1U6AH 2VABA 4FFVD 4YC2C 1G7PB 4AEHL 5ECJE 3SDCA 4URTB 4FXKA 4QRPA 4Y4HB 5D2LA 4NM4L 4PRBB 5B39A 5BW7C 1FG9C 3G5VB 1TJGL 1CGUA 3NPSC 3QCTL 3T65B 2E7BA 3D3VE 4JY5H 4KRLB 4EVNB 1FBIH 1X4ZA 1EXUB 1OGTA 4PGZA 3MLVL 1NCDH 1FGVH 2A83B 2YA0A 2BVOB 2YD3A 3W5NA 3LHPL 1IQWH 2VAAA 3MRPA 3QJHB 5GJSH 4C56A 1Z3GH 2QQNL 1PYWB 4RGOL 4OAWA 4X99B 4PB0H 4OGZA 1YN6B 5IB4B 1JHLH 2I26N 3TT1L 3CH8A 4P9HC 1OTSC 1MCWM 1MJ8L 1H0DB 2WINA 3TJHC 3EKCA 4L4TE 4DFHA 1DVFC 1N5YL 2NY0D 3GHBL 5E2UL 3MBEA 3ARDA 4QCIA 4LLYB 1MFEH 3CZFB 2X4PB 2NY3B 4YPGB 4AIZB 1QFHA 5KSAA 4XBEL 3MRLB 2HTLC 2OP4L 4GUPB 1K5NA 1P4LA 3WD5L 1IM3B 3MSPA 3KPQA 3TJHA 3OAYK 4OD1H 3DRQB 1DVFA 2VDMH 3GMQB 5C71A 5B8CC 5C0RL 2P49B 1CD8A 2IH3A 4Z7WE 1DQTA 4PYHA 5E9DE 5FGCB 3G08B 5DUPL 3C08H 3DX9A 1NLBH 2E7MA 2ZJSH 2VN7A 1E6OH 4KWUA 1WT5C 2IEPA 3FQWA 5I74C 5LWYL 3VFOB 3ZDXE 5DRNB 2EDTA 3DVNA 1IAKB 1ONQB 2F53E 4EI5B 1FV1B 1I3UA 3SCMB 1YNLL 3JTTA 3LRSA 1IAMA 4PJDA 5F3BB 3MV01 2FB4L 1UKSA 1CGSH 5DF0A 2WMPA 3SOBL 3GBNH 5LKNA 5EZIH 1GHFH 2Y06L 4Y1AB 3VMPA 1A7QL 4ODVL 3GRWA 3FQNA 5AZEH 4EQ3A 1T66C 4L9LB 2ICCA 3KPRA 4JFOA 4UAOB 3MJ9L 1A1MA 1BVLB 5F1SA 2BHZA 2DQTH 1CL7I 4O51B 5I19L 2PXYD 4DGYL 3KJ6H 1MCOH 2GFBB 1ZA6A 3DYOA 3CFDB 3RI5K 1OY3B 3GSVB 4ZAKC 4V3DB 1SM3L 3KWWA 1W0VA 4YK4B 4P5MB 4QT5A 1DBBH 4HMEA 4TTGA 1FIEA 1V7ML 5ISZB 4LPCA 4KKLD 3F7VB 3L1OL 1LO5A 3WJLC 4OLWL 4P5KB 1RUML 4JQVC 4PRNB 3QQ3B 4KTEL 5DJYA 1A6ZB 3DMMB 3QUYA 4EOWL 4YC2B 3UCRA 3CFEB 1B2WL 4V1DE 4ZTPH 1MPAH 3D18B 3L95B 4POUB 1KLGA 4ENEC 3P4OB 4YGVB 2BY1A 3KLAA 3AMLA 2P8MA 4XNMB 3I50L 3DTXB 4HFUL 1FL5B 4PRHD 2VB5A 1G7JB 4BSVB 5BS0D 1XIWA 2CGRH 3L5XL 1EJOH 2D9QB 3IU3A 3HZYB 4JDTH 1MHEA 1YPZF 2ZCLH 4LBEB 4U6VH 5F7DA 5ALCL 5DGRA 3SDAD 4JCMA 5D1ZB 1BF8A 1FYHB 3BN3B 4QRPD 3RUGF 1IEAA 2DI8A 3CH1A 2ZZUT 4OZ4B 2NTSP 4R3SB 4GW4B 2WW8A 1JV5A 5GIRB 1TNMA 5T1KB 1WLHA 4Y5XA 1SJEA 3MV9D 5B38B 4E42B 3KYAA 4MVBD 4QRRB 4MQ7B 1FO0L 3I9GH 4DVRL 1DQJA 5CSZB 4OV6F 1BJ8A 1BIIA 1I4FA 5AYUL 5FUCC 3C9NA 4XP9L 4PRDB 4YHMH 4Z7VA 3OHXA 1JF1A 4LNVA 3IF1A 5IJKC 2X1OA 4R2GB 4D8PA 2PW2A 4W4OA 2ZG3A 1TJIL 1SJHB 2DS4A 2J6EL 1FLTX 2X6MA 1ZLSH 1SHMA 1QNZL 3MODH 4UT9H 5HHPB 2RIKA 4BQ8A 4JFFD 5FB8A 1PX4A 4JY6B 5I6XC 4RIRA 5FA4B 1N6VA 2NY4C 1NEZB 3KJ6L 1MSPA 2FSEB 5FYLE 3A6CH 4O9HL 1A4JB 3S36X 3TCXA 1R5IA 2J5LC 1SEQH 1NGZB 5TFSH 5D93B 3VFMB 2E6PA 3ALXA 2NTFB 3QBTB 3IDNB 4GRMB 3EGSB 5TPWL 4E0RA 1CE6A 2VXVL 5ENWA 3D3VD 4YQXH 4NKIL 5JOPD 2AI0L 1KN2L 5EBMB 4Z76A 2ZCHL 4JZJC 1ZXQA 2XXMB 2X9WA 1CFQA 1WEJH 3ILQC 2FB4H 3VFTA 4A2MA 1JPGB 4HH9A 2AABL 3TPUB 4AG4L 3KHOA 1EPFA 2ZUVA 3FHAA 4HIHB 1LO0L 2B4CC 4HJJH 4ODVH 5AZEL 3GK8L 3RHWK 3BFOA 1OTUD 4AT6B 3D87B 3T2OA 3TO2A 2IPUG 3K4DA 2VDRH 2FJHA 2IQ9L 2ZUXA 4LFHD 1RJYA 4IJ3B 4OLWH 1KSRA 3VFUB 1P84K 4PD4K 4YDKH 4M7KH 1UACH 5C1MB 3X3FH 2APTA 3U48A 4FQJL 3MRQA 2XA8L 3VW3H 1WCQA 2NY6D 5B4MD 4H20L 1ZWIB 5GS2H 1IGTA 4RBPK 5ICZA 4FQCL 1DE4B 1YMHB 1DUYA 4OD2A 3SGEI 4G8IA 1KTLB 4NT6A 3HPLA 1HSAA 3MNWB 1S8DB 4MCZB 1ODAA 2PYFA 4NBYB 2FBOJ 5DEZA 4YAQB 1DEEA 2YRZA 4OIAA 4Z7NF 1EHLL 4PY8J 1WTGT 5HHMA 1ZSDA 1MHPL 5DDHB 2ITDA 2CK0L 5DD3H 3E8UH 3C6LD 3UEZA 2P5EA 3OZ9H 3BN9D 2HWZH 4DN4H 1CGVA 3B9DA 3L3DB 4ZFZB 5DJCA 5F8QC 2QL1A 1U3HA 3MLVH 4OZGB 3R06A 1MFEL 2ICWI 2H8PA 3MGTB 3ARBD 4Y5YA 2VLRD 4AYFA 5TDPB 1WBXB 2NY0C 4MXQD 3VRJB 4R4BA 2Y6SC 4PJIA 1CDJA 1WQVT 4HFWB 2BSSB 4RFOL 1OAYL 1MCIA 1IARB 1TTUA 4YE4L 1YEEL 5EOCL 3S36H 4CN6A 3V0VB 4HEME 1RJZB 3PE9A 2C1OB 4OV5A 5A2LH 4X7TB 4UBDC 1G6VK 1RI8A 2J8HA 5CSBA 1L7TH 1M71B 1RK0B 3V4PL 4BFBD 1CLYH 3U36A 3U83A 2OP4H 3SCMD 4QWWD 4F7EA 4J3OC 3V6BR 3U4EA 1KXTB 1UXSB 4NOBA 4XP1L 5DJ8A 4GRWF 4H25A 4TNWF 2D4FA 5FUOH 3PL6D 5E99H 3D69B 1PZ5B 2L4OA 5BV7H 5TF1L 5FV2A 2I07B 3VD4A 1WZMA 5FYKD 1DLFH 3ZDZE 4NUGL 4PB9H 4JREB 5JHDB 3ZTJH 3BPNC 4LPVA 4QXTA 2G5RA 4P2OB 3QHZL 1KPUA 3HB3C 4F2MA 5T1MB 4CU8A 4Y2DA 2BVYA 1IJ9A 1LK3H 4HXBL 2NX5E 4L8SC 3VFVB 1FN4B 3EOAB 3KLDA 5J6HA 4GKNA 1U8OA 4LRNH 2D3VA 4XCCL 4PG9B 3ZKXB 1TCMA 4WHYH 4PTTA 3CXDH 2LU4A 4Y5VA 5F7EH 1P53A 3REVB 3WEXB 5DWUL 5I15L 2CLVB 1RV6X 4UUJA 1JMZA 3A67L 2V2TA 4HLJA 3S88H 4MA3B 3OKLA 4NKDB 2DQFA 3RKPA 4AK1A 2F15A 2HT4C 3TBVA 4LAJH 4XB7A 4G8FA 5HI4D 4L3EB 2CIKA 5CILH 5ESQA 2Z4QB 3KPRD 3P73B 1XGUA 2CO6B 3HC4L 1HHKB 1RZGA 2YEZA 4LMQI 3QO0B 4F8TA 2X42A 4G3YL 1JK8A 2VR9A 3KHQA 3WO4C 2G9HA 4YFDB 2A6IB 3SJVA 3MXWH 3O2WL 3RIFK 4HQQH 5JW4M 3KPSA 2Y5TB 1CFBA 4ZOEA 2HTLD 3CPLB 4O00A 1D5BA 4YDIL 2YPLD 3TH2T 1T7ZA 1VEPA 2WANA 4OI8A 5D4QA 4KKAD 3HG1E 4OCSH 2DLFL 5E6ZA 3T4YA 4RX4A 4PJEF 5JA8B 1EEZB 3WIIH 1J8KA 3QWRD 4NUGH 4PB9L 3UPRA 3O2WH 4HT1H 1A3LH 3BEWA 4LCUB 4MNQD 3NZHH 4ZUSB 4QTHB 5HDBE 2X70B 5B22A 4OCRH 3SDDC 1NGPH 2RBLA 2GEEA 3QI9C 4R2GD 1F2QA 1XIWD 2JK5A 3L9RA 3NIGF 5HD8D 5IQ7L 2MFNA 2ADGA 5GGRY 2OTWA 4K2UL 1MLCA 1AR1C 4Y16C 5LAXB 3NFNA 3PF2A 3VGAB 3TFKD 1N6UA 4OLYL 4XVSL 5I1KL 4W81A 1BQHG 2WV3A 4PV9B 3H9ZA 5K33A 4LSQL 1RZ8B 4MJ5A 3HAEG 5I1IL 2OJZL 5F9WB 3SDDA 1DBKL 2XWTA 2WIIA 1T5WB 1U8JB 3HNTH 4HXAH 5BXFB 3DUUA 3FAXA 3KPTA 4XMKH 2Z92B 3F7RA 1XGQA 4XCYA 4C58B 1KG0B 4UT6L 4MDIB 2VIRB 2JTDA 3QRGL 4P4KA 5DT1L 1I8MA 1OM3H 4Q6IC 3NFPA 4NZUL 2BVTA 1BP3B 3RTQA 4XP4H 1I9RH 1AGFB 3QCUL 4W6YB 4HIIB 4HMDA 3NMEA 5KSVB 4HX1A 1I9IH 4DKAA 5H2BB 3MJ7B 4BZ1H 4G59A 3KPLA 4JAMA 3AXLB 1S9WA 5EOCH 4X6CA 3FFDA 5HI3D 5EFIB 4GRWH 2R4SH 3OX8A 5TE6H 12E8L 5I1CL 3CC5A 4HBCH 2J8OA 4NNPH 3GMRB 4JE4B 2LU7A 2BSTB 2A9ML 2V17L 2JIXB 1WAAA 4DQOL 3VXMD 1KCVH 1OW0C 4TUJB 4Z7QF 1RZIA 3ULUL 3RGVD 2CMRL 3G9VA 3N0PB 3LS5H 1AQDB 4GAGH 3KYMA 3FO9B 3OKNA 2FO4B 1JYNA 3CDCA 3X3FL 4H0IA 3T0WA 3L3GB 4YDKL 5CD5C 5K9KA 4Y8DC 4J3VA 1ZA3B 3T77A 3HFMH 3UTQB 1I1AD 3B5GA 3DUSA 2BVPB 2IH1B 1G7IA 1NAMB 4L8CA 1XCQB 1LEKA 2GK2A 4R7DB 5D7JB 3V0WL 1U92B 4JPWL 4U6HA 4LLWA 4YXLH 2GJ6E 3MROB 4MNGB 1KC5L 3FFCB 3T3PF 2H2SC 2XA8H 3VW3L 5J56B 5DD3L 5D1QA 4U1IB 1ZS8A 4PJIE 1YNKH 4JFPA 4M7KL 3O11A 3EYQD 3C5SA 5C7XH 2CPCA 8FABA 1BX2B 5F8RC 1NDGB 1BD2E 1CFVL 3RWGA 4ZNEE 4NHUE 1MUJA 5TFSL 4OLZL 4OJFH 3M1BA 2HFGL 3I75B 4EN3C 3GMOB 1C08A 2DQHH 3LIZH 4ONFH 2YPLA 2JF1A 1WZLA 5C0JB 5AWNL 4AQOA 2VZOA 1YEJL 1AGCB 4JFQB 4M93C 4QF1A 2GQHA 2VLJA 3PDGA 2VDNH 3QIWD 5FV1L 5GSRA 4G9FD 3HE7D 2R29L 2H32H 5JQHC 1F3DJ 3P77B 2DYPB 2F19H 1N2RB 3NACH 1ZANL 4BQCA 1TJHH 2F9BT 4Y19A 3NN8B 3PV6A 1N0XL 4FFZH 3GSOB 1YN7A 4F9PA 4JJHA 4N0UA 4NC0B 1JRHL 4HC1L 2XZQL 3SGDH 1ZMYA 4G6FB 4YXHH 2IWGA 3SEPA 3TIEA 4V1DB 3KPNA 1OF2A 1D6EA 3D0LA 5F3HB 4MB3A 5ID1B 4B50A 4PJBA 3GGWA 2EYTA 5KSUB 4XAKE 4OZHE 5JQ6L 4FQIH 3N50A 3KPRE 4OCMC 4HUWA 2F54A 1N6QH 3MBEC 3B2UD 4OCXH 3ZE0E 4ACPA 5JQ6H 3H9SD 3DI2B 1FPTH 1ED3A 3IJSB 4RMUA 4X6CF 2V7NA 5EU3A 4D0CA 2RB8A 5JTWA 1KCGC 2XA3A 4O02L 3C60D 5CUSL 2G5BA 4Z95H 3QCVH 1G7MB 3WHE0 3IU4H 1VHPA 1QO3B 1JGUH 1HYRC 5CUSH 4YXHL 2FL5A 4S1DC 2W0KA 1IQDB 1U8QA 1RZ7L 4TRPL 5H35B 3DBXA 4IIQC 4HUNB 5EZOL 5J11B 3IKKA 4W6XB 3BXNA 4G9DB 5EO1B 2FR4B 1BQSA 35C8L 3MZTA 3VGGA 3T8XA 3V52H 5K93A 3FT3B 4K7FA 4GRWB 4HG4K 4KV5E 3AB0C 4IOIA 1CTNA 1SM3H 1U8MB 1CXFA 4PJ8D 5HGDA 2O5ZL 3BMWA 5CJXC 3HC3L 4O58H 2ZOLB 3RP1A 1MCCA 3IETB 4OD3H 3MPCA 2BNRB 4JGUA 1INDL 5D8JH 4K3HA 2CLZB 3STZB 4LPWA 1GHFL 1N59A 4U6VL 2YD7A 4KK5D 4TSBH 2O61A 4OB5L 2NW3A 4LLDA 1E0OB 1YC8A 3MRNB 1G9NH 2FIKA 1YMMA 1FFNB 2ZSWB 4LSRH 4H88H 6FABH 3QUZD 4Q2ZB 3GBMH 4HUMB 4Z77A 3QJFA 5ETUB 1RHHB 3QDGA 3RKDD 3QAZC 4Z78B 4FRWA 4NO0D 4DW2L 3LEXB 5CSGA 3O3AB 4MB5A 5TQ0L 2ARJQ 1A7NL 1NMCB 2RGSA 2DMBA 1MPAL 4DGYH 2R0LL 3BJLA 4X4XA 1FP5A 4KTEH 1FZKA 5I1JL 4GG8A 5DRWB 3QUYC 2WUBL 4H0GA 4YX2L 1B0RA 1E4WH 3MA7B 2Z31B 4JJ5B 1V7MH 1U8KB 5DQJA 5KBNC 1MHHB 1D6VH 2BNQE 2A77L 2ZCKL 1W8OA 3EW3B 2BRRL 4QHNB 2DM4A 3UROR 4WI7A 1HILB 1UCTA 3BKML 4DCQB 1TETH 3ZT6A 4ZFFA 3VRIA 3PIQB 4GAGL 5C86A 1MCQA 3LKRB 3DGCR 4XCEB 3HR5A 5K9QI 4WI6A 1Q94B 1JZ5A 4PR5A 3FQTB 4BFIB 3LPFA 2PXYA 1RY7B 4QOKD 3HUJB 5FKAA 3L3HB 1IGMH 3DX6A 1XH3B 2AJZB 3U2SA 4Y19D 4UTAH 3UXFA 3OJ2C 2HFFB 4QXUL 4XPFL 3MGOB 1LQVA 3ZLQC 2ADJB 3ARRA 1S9KC 3S37L 5JZ7D 2WP3O 2F8XC 2R56H 2VLKE 1BFVH 2YKLH 3F7YA 4KQ4H 3CVHA 5DMJB 2HT4D 4LLQA 3GIVB 2W1NA 3O6KL 4KKBC 3DV6B 4S1SL 4JY5L 1EBAA 3LQMA 4KRMB 2GJ6D 4IM8A 5C07D 4TQEL 1CXIA 5DRZB 4JDZB 5KVEH 1UCBL 1HQRB 5SV4A 4UT6H 4LKCA 3HS0A 1YQVL 3FN9A 2MPAH 5IJKA 2B0SL 1A9BB 4B53A 2IPTH 3QEHA 4MHHG 4P23D 4UTBL 4XHQA 1OGAB 2H9GB 4MNGE 4PFEA 1FL3B 3G6JA 3PQYD 2AEWA 1I3RB 3UBXA 4D0DA 1A6AA 3AREB 4JRXE 5B38G 2X5PA 5MENA 5A2JH 5C0EA 1AGBA 2I9TA 4XNUH 4C83B 4PJ8C 5DLMH 5D5MA 1M7IA 4G9FA 4HHAB 1XGTB 3ILQD 4NC1C 5F7KC 4ETQA 2A6JA 3QRGH 4YHOL 4WI2A 3QUZB 3DV4A 2VXSH 3BN9C 1F42A 4YLQT 5EBLA 5C9JA 1I1FB 3DECA 3RWIB 2ATKA 4PLOB 5I18L 1OSPL 3P4LA 4X5WA 4G5ZH 4JZJA 1AD0B 1IAII 5JHLL 5GS0L 4ZQKA 2WLZA 1S7UA 4Q6YA 2BJMH 1FSKB 2YZ8A 4LDLB 2B5IC 5HYSA 3EFDH 1FZOB 3H3PL 4N0FA 4X7CC 4ZPTA 4XVSH 3X13B 5IB3B 1H9VA 5K9JH 5IEHA 32C2A 3DRTA 3P0YH 3FB6A 3NH7L 5B4MC 4UILL 4XBGA 2ZP0T 3HE7B 5DJ0A 3FCTA 3WV0A 5EULV 4WO4C 2DDQH 5GHWH 2VQTA 1W0WA 2R0KH 2G75A 3MFGB 2FGWH 4U0RB 5C09A 3IGAB 5E5UB 1P84J 4HS6A 4PD4J 5CEZH 3HMWH 1G6RL 3S5LB 4DVBA 3RNQA 4ONHA 1WGOA 4WUKH 3D9AL 3IKCB 3IJYA 3GIZL 1P9MA 4HKZB 3HMWL 3CFJA 5A3ID 5FOJA 2EIBA 1CE1H 4JHZA 2YRLA 5DQ9A 4KC3B 2QV2A 1BVZA 4U3HA 1WWCA 3HE6C 4XXDA 3GSXB 4Q9QL 2D03H 5HDQL 4FQLH 1YDPA 2OSLB 3OKEA 4JY4A 2LFGA 4KK8D 3VWJA 3QPXL 1I7TA 5DHVB 1V7NL 4PJFB 4TNVK 5T5FH 4FA8A 5C6TH 4DGVH 1QRNB 3I3BA 4LSTL 3Q5OA 4ODUA 5JUEL 4APQA 4NN5C 4R96B 5TDOB 3DHJA 1UJ3A 3T09A 1Q72L 4JFFB 4PP2A 2V9TA 3PQYB 4WTZG 2ZSVA 4C54A 2AQ1A 4WFEE 3BJ91 3X11B 2HLFD 2ZPKL 5JHDD 1FLRL 5E7BA 2B8OT 4QRQA 2QTEA 1CS6A 3EJYC 4KGLA 1VFOA 3N85L 3FB8A 5EO0B 3DXAB 5T1LD 2XN9D 3Q5TA 3QHZH 3E2HC 1ZHNB 5FCUH 4WJ5B 5DLML 2H2SD 1WCBA 3AREC 2VDQL 4ZUUB 3H9YA 1IC7L 3TGXA 5C0DB 2R1XB 5BRZB 4ZXBD 4LF3B 4MQXC 4L3CB 3FQXA 2X40A 4X4ME 3ORJA 5D7LE 1MY7A 2HJKB 1C8PA 1ZT4A 4YHPB 1DSFH 3MO1A 4KROD 1A3QA 1MFBL 5C08D 3CIQA 2VISA 3EBAA 4GAJH 1DBML 2BXYA 3GI8L 5E56A 1GL4B 1JZ3A 1OAKL 3HUJE 2WWKT 3PGCA 5DJ2A 4KGJA 4KVCL 3RX8A 2CDFA 2VXQL 1TQBC 3QIBD 4X6FA 4XVUC 4EEEA 1KOAA 3WIHA 1KELH 5DVNA 4BQBA 3L7EA 3RA7H 2CDEA 3JV4B 4HIJA 1J8HE 1AKJA 3DXAE 5AZ2L 1UXWB 1JYXA 4JN2A 4YHZL 5EOTA 1IGJB 4RFOH 1DN0A 3DO7A 1G9MC 2HAZA 2QHLA 3EYUL 3QG7L 3MNZB 2NYYD 4LLMB 3OPZH 4LLUB 3IDXL 3UYRL 4L4TA 1C12B 2P24A 1GGUA 1QOKA 3P9MA 2ATPA 1S7RB 1QQDB 1FZMB 4PJ7F 1A7PH 3VD7A 2OX5A 4MAUL 4F7MA 5D2NA 1NC4D 3DSFH 4HWBA 1OL0A 1GOGA 3ARBB 3QR2A 5H8DA 3RUGA 4F3FA 3ULUC 2GJ6A 2H32B 1L9MA 2YD6A 2R4RH 1A6UL 1LWRA 4RWYL 2WNGA 5HGHB 3BEVB 3C5JA 4ZO6A 1KJMA 2VLKA 1S9XA 3VWKA 5HI3C 1KIPA 1XF5A 2RCSH 3GDBA 5E1AA 3BX7C 5J7CC 5FHBL 4MAYB 4KKCC 1JFQH 2ID5A 2AXGB 3FO1B 3TBSB 5F88B 1BEYL 4OFYD 4FQHA 1LQSR 5DSCB 4KJPD 1PG7X 1O0VA 3OTTA 3ZHLA 4F58H 4XNQA 4EUPG 4O2CA 3OKMB 3P11L 3O81A 4V2BA 1PQZB 1SMOA 4I3SL 1K8DB 1ORQA 2VH5H 3VWKC 2YD8A 3INUH 1I7RB 5TQ2L 1OGAE 5IVXF 3TN0B 1AIFB 2R0WL 2VZVA 2X4TA 1WAAE 1Q9WB 2P47B 4ZO9A 4LQFH 4ORGA 4NNXA 5E08L 4ZXBB 4ODXA 3TA3D 3VA2C 3SKOA 1SY6H 5IOPA 1QR4A 1KB5A 3BMVA 4GKZB 1UZ8A 4TUOB 5EORH 2Q8BH 1NFIB 1NPUA 4Z6AT 4N9GA 2QLVB 3PWLB 5ANME 1N8ZA 3WFCL 1CLOL 1HKLH 2QSCH 2D0HA 5IK3B 1UB6B 2NY2D 4OM1L 3EFFB 3SE8H 3LKNA 4GRLA 5JDSB 1F4AA 4PJBE 1P2CB 5F7UA 5HHQA 3CLEH 4JFEA 1KIQA 3PP4L 1T04B 1J1PH 1Q9OA 3QI9B 2PETA 3WDJA 5C0FB 1ADQL 1TVDA 1ZVSB 2GAZA 5L8LB 2ESVD 4TRPH 1LHZA 2GTZB 3IS0X 4WV1B 3CFKA 2NNAB 3IDIB 3SGJC 4QRTB 1KTDA 3IU4L 1NBZB 3QIUD 5KG9A 5CBEA 3ZKMC 4P2QE 3K7UA 3QO1B 4DEPB 4X6EB 5FO9B 3JWOL 4FABH 3KYKL 2CH8A 5JMRA 4EXKA 3FONB 3ZTNH 3EUUA 2W9EH 1ZLVK 4LLVA 1T22B 1QACA 5DMGC 3A6BH 2M1KA 5DC4B 5L88L 4K8RL 1VADB 5AYUH 5E2WL 4LQ1A 1X5XA 3O45A 4U1HA 2UUDK 1CTOA 3WS6C 1SJVA 2VQUA 1YC7A 5D7SL 5GRWA 4U1JB 4DVRH 5IB5A 1YQ2A 1MIEH 3T0ED 3H9HA 4P46A 5D6CA 4ERSH 3IRZA 5DQDH 2R2HA 5BQ7B 5GS3A 4ZAKD 5JXAL 1F4XL 4P3DA 5A40E 1VFMA 3LS4H 4N8VA 1D5MB 3MV7B 4MYWB 4ZOCA 3FRUB 5BV7B 4IRSA 1I1AA 2JJSC 1ORSA 3PL6A 3I3EA 3D0VA 1VGEL 2EC9T 4K7PY 1B0WA 2XWJB 5KTEH 3FJTA 2EH7L 3TZVD 3GSRA 4JRYB 1NCAL 3CJJA 2P5WA 4HZLA 4ZOAA 3PDOA 5F9AC 1ND0B 1FDLL 2XKNA 3ZDZF 3WFEH 4I8DA 4IS6A 1QPXA 2X1PA 4MCYA 5F1KC 3WE6A 1BEYH 1SMAA 3RVVC 5FYLH 2HH0H 2YPVL 2RFXA 3F5WA 1JHTB 1QVOB 1AP2A 3W0WA 3KYNB 3E6FB 3EOTL 2KZ1B 1OAZL 3RGVA 1T4KA 4OQTH 3C60C 3VI3E 4MNQA 3BYTA 4XPAL 1JI1A 3G5XB 4DKEH 1BOGA 3ALWA 1I1YA 4EN3A 1KPRA 1DUZB 1KGCD 3ZSTA 3R1GH 1CGSL 3EYVB 2D7OA 4LGSB 3O6FD 1VGKB 2BNQA 4XWOD 1LE9B 5GGUA 1CICC 3K8MA 4PGDB 4NRXA 1ZOXA 3QA3B 2ERJB 4IRZH 1NANH 4ZS7H 4YBHA 3WUWG 3LS5L 1F02I 2GT9B 1KCVL 5GGSA 4IHOA 4JO4L 4YFLF 3TYGH 1NC2D 4HUXB 4ALAL 1LP9F 5E0QA 3C08L 3O3UN 5EUKA 5D5MF 2GUOA 1QYGH 3BESR 4HBCL 4RAUA 1CICA 2ICEB 3HFML 2CQVA 2FNBA 3V95A 4I2XA 1DL7L 2BY2A 4MWFB 1HEZA 3ARDC 4OD1L 1L0XA 3RWEB 4D9LL 5BZWA 3JWDL 2YOCA 1JPSH 2BY3A 5EN2A 4PRAB 3AS1A 1AC6A 4PJGF 4Z9KB 4PRPD 5IHBA 3U6RB 4MNHA 5EU5B 3GJFB 3BP7B 3VXUE 3GMMB 5DK3A 4PBWD 2WBKA 3K2UL 4ELKB 5E4EC 5GS0H 5I1CH 4X8XA 5FGRA 2EO1A 4JZOB 4YO0B 5IM7B 4PJCB 4HK3J 1Q9LA 4LHQB 1BFOB 4LMQE 2NW2B 1UWGL 5CCKH 4YH6A 4RNRB 2RQ8A 3MV7D 1WT5A 2AXHA 5IESH 1NC4B 5MERA 4HWZB 1HH9B 4XBEH 2AK4A 2NXYC 4PS4L 3RL1A 2F53D 2DMCA 3BIAX 2BOCB 4XPHL 3WO4B 1OPGH 4ZPVB 3T4AA 4KUCD 4LGRB 1HI6B 3PP3H 3RWCA 4PLJC 1LNUA 4MD0A 2GTWA 1FZJA 4EQ2A 3EDKA 4WCYL 1ETZB 4J2XA 4IMKC 2XFXA 4OCRL 4ODTH 3PXHA 5FYJH 1CGWA 1EZVX 3B43A 4KI5F 1FNEA 4NO0B 5CBAB 5DMIL 3K1KC 2BSRA 3VFWA 2F8OA 1T7VA 2IAND 4Z7UB 1S9VB 1UWEH 2JLLA 4PGCA 3GUTA 2V7HB 3PWVA 1FNAA 1A3RH 2GKIA 2X1XR 3FO0L 1DN2A 3U46B 4BSWB 4TYUA 3O8XD 4X9FA 4Z5RA 5CKAA 2BZDA 4EI6B 1RMFH 4MJ4A 1I9JL 2XN9E 5EU4A 3KS0H 3QPXH 3MRKB 3LV3A 2AP2A 2A9NL 1A9EA 3QFJA 4LHJB 1LDPL 1VKXA 4K7PH 2X4QA 1HQ4A 3V4UL 1H8OA 4N8CL 1U93B 1I7ZA 3FKUS 1Q0XH 2JJWA 4U05A 1JYWA 4HV8A 5C0IA 5IF0B 5INDB 5J6GB 3CX2A 4YHYB 4L3EE 4ZODA 4AJ0A 5CLWA 4L29A 1AGEB 4FTVA 2WLYA 2E6JA 5H37G 3D9AH 3WL9A 2OM5A 5KAQG 4JFDD 3H42H 2VITA 5IW1A 4D9LH 4ZS7L 4Y4KD 4GSDL 4U3CA 4UDUA 3LCYA 4MSWB 4Z7UE 5J1AA 4ZYKA 5I1DA 3VXME 5HYJE 2LU3A 3GZKA 1QBMH 1LEIB 1Q1JH 5ESVB 2JJUA 3RZCB 4I4WB 2O26U 4OFKA 1E4WL 1CD1A 4JRXA 2IFFL 4PRPB 3UMTA 3QZWA 2IAMB 1HHGA 4CNIB 2WWKO 3AUVA 3TBWA 4UIKH 4LSUL 4ODHH 4XGZA 4FFVC 4C56D 1KENH 3PWUB 4NBXB 4WUUB 1BFTA 4DW2H 5T1DH 5FUCE 1MAKA 2BOBA 3ZYOA 1FYTA 2FYYB 2V5YA 3GMLB 4G7VH 4OI9A 3R1GL 3NFSH 1DLFL 1KJVA 3Q6GH 3VXNB 3QT2A 1YEHH 2D7MA 2EH7H 3BO8B 1URLA 1K6QH 4I77H 4AM0A 1YY9C 4TSBL 4JFZH 5DFVD 2UWEF 1IGIH 4U2ZA 4W4OC 1QA9A 1BREA 4N8PA 4IBLT 3O41B 2ITCA 1ES0B 1XR8A 3BKYH 2HH0L 2YD4A 2BCKB 5FA3B 5IHZA 4RAHA 1X7QB 4O2EB 5GSVB 4AENB 5EBWA 1AO7B 4YXKL 4AH2B 4YHKH 3BKCL 2O5ZH 1TVBA 4U0QB 3MMEA 5LGHH 4YDVA 3QDJD 2DLIA 4PV8B 4NO5B 4XP5L 2DM7A 3ARSA 3BHBA 3BIKB 5MEOA 4PJHA 1V8HA 3SDAA 4K94H 4LSPL 5KVEL 4K8RH 3K0WA 5DD6A 2XTJC 3V7AE 5IMOB 3QB7C 1Y18B 4R4FL 4YK4C 1BVKA 1S9YB 3ULSB 2W65A 3O3EB 3NCYP 4JANB 4PJ8A 2P43B 4YHLL 5DO2C 3EO1B 3OV6A 1EVTC 4JFXB 3DMMD 3IAPA 3BPCA 3O2DA 3OJDA 2GK0B 2VKWA 2H1PH 4OSUH