1FFPA

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
source organism Mus musculus
molecule tags Immune system/signaling protein
total genus 72
structure length 273
sequence length 273
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ffpA01
1JZ5A 5GGQH 4UILL 4DEPB 3BGFC 5TQ2L 4WTZA 1PG7X 3A6CH 3VW3L 2EDBA 1SYSB 1U3YA 2QHRH 3RWDA 5LBSH 4Y4HA 1NAMA 3E6FB 4GAJH 4QWWD 4PV9B 3D85D 5GS2D 5FHAH 3B5GA 3RA7H 3O6FA 4Y5YB 5IG7A 2IANE 4EEEA 2APWA 2D03H 5HBBA 4LLWB 3OJVC 4M6OL 4EIZC 5I73C 4G9FB 1XGTB 3ULUF 3LDBC 3VWJC 5IUSA 1JGUH 3FJTA 5C0BD 3AXLA 1S7WB 2KUTA 4W4NA 2OYPA 4RNRB 1TIUA 5A43C 4XB8A 1IC7H 4XPAL 1YECH 2Z31D 4I18B 1JWUB 5B8CA 2Q7NA 2HVJA 4V2BA 5CAYB 1SJEA 2GSIA 3ARWA 4KV5F 3OWEA 1GGYA 1W72B 2OQJB 4HUNB 3HC4H 5E7FA 5IVXF 1R3LA 3QRGL 3BPCB 3VFRB 1A7RH 1GZQA 3MGTA 1D5XA 4HBCL 4CU7A 1ZA6B 4M4RA 5EOTA 2R56L 5KBNC 1HILB 4AQOA 4YHLL 1JBJA 3VFPA 2EC9T 5FGCE 3BO8A 5LKNA 4GG6E 1J8HD 3FQWB 3MBEC 4UOW1 5IHZB 3OSKA 1FFNB 3P77A 3PV6B 5CCKL 1U8PB 1BD2D 4CW1A 2DMCA 1JPGB 2BNQE 5AYUL 3Q6GH 3SCMD 1EO5A 5EU5B 1BX2A 3DV6B 3EYFB 4I0KA 3BFOA 4NHCL 2OJEA 4G7VL 2DLGA 3MZTA 1CTNA 3DVNB 4KI1A 3GSNL 4DZBB 1HKLH 1MEXL 4PLJC 3U9UA 1J12A 3NBNA 5TGBB 4F3FA 3UZEA 4OF0A 5FO8A 5F96L 1AXIB 3GB7A 2A1WH 2GJ6A 3D2UB 3QHZH 3MUGB 4R2GB 2OL3H 3PP4H 4P46A 5HYIA 4KDVA 3DSFH 1JHTA 1MY7A 5CSBA 1A1OA 5HPMA 4I9WD 4JFDA 4UAOB 1WVZA 4FQQB 4KQ3H 4D8PB 3V4UL 1GZPA 2JKXA 1A6AA 2GSGA 1MJ8L 4JFFA 3QUYD 2P8MA 2HLFC 3ARDA 4IM8A 4YDLB 2O5XL 1NCUA 2B39A 4Z76A 3HG1E 3LN4A 4RMTA 3KS0H 3G08A 1H3UA 4JO1H 4WHTA 1CWVA 5HSFA 4NM8H 4GLRI 3EJZD 2XN9D 1N4XH 2XTJC 4JRYD 4UIKL 4OFYD 1BBDL 2ZUWA 1YJDH 3QIUA 3BDYL 2FLRT 2VABA 3GMPA 5EPMB 1B0GA 4ODHL 4KMTL 4OD2A 1YN7B 3KLAA 4JN1L 1WTGT 5DQDL 4HKBA 3K81A 5CGYD 2VTFA 2DQEL 1X5FA 1BVZA 5HJ3A 1KC5L 1CD8A 3EJJX 2BSRA 1DZBA 2ATPA 3MRCA 2RBLA 3TYFB 2PUQT 2WBJB 3QAZC 3RAJL 5FXCH 4ZTPL 4PYGA 5BVJB 5BQ7B 1HI6B 3N1PC 3MGAA 4P4RB 3ULSA 2OCFD 3LV3A 1T5XA 3VFMA 2Q7YB 5LGJB 4M7LT 3TP4A 3IDMA 2OLDA 4Y4HB 3HB3D 1NAMB 4U1GC 4XXDA 1T7YA 3FOLA 1SMOA 5I1GH 4KGJA 4JRXB 1SEQH 2W92A 4AEEA 3O6FB 1DL7H 1P2CB 2YRPA 3QHFH 4HWZA 1H8OA 5EU6B 3QCVH 1P7QA 2BXZA 5DK3A 4OD3H 3NFSH 3DVFA 2I9LB 3BN3B 3FZUC 2N7BA 4JJ5A 3SDYH 3T1FA 1HCVA 3EOBA 3QI9A 5CSZA 3LRSB 4IHOA 4JM2C 2IBGA 4PRIE 3GI8H 4NNPL 4L8BA 1OAYH 5C1MB 1KEMH 3NAAL 1MWAL 2IBZY 1LO2H 2P49B 2EZ0D 3KPRE 3JWDH 5D7JD 1MREL 1T0NA 1BQUA 3BSZL 4U4BA 5T33L 4YXKH 4PLKD 3PHOB 4WRLA 1RVFH 2E27L 3K3QA 4W6YB 3RWIA 3KPMA 1R3LB 1JP5A 2DLTA 5KSUA 4UOJA 3LKSA 2BNRA 1NAKH 3LMJL 3DETC 1NCCL 2Q3ZA 1TJIL 3FQXB 4HC1A 5EOTB 3OZ9H 3VXSA 1N59A 1FQ9C 1BBJB 3MA7A 4FMKA 2FCBA 1FYTD 2VAJA 1DCLA 3LQAL 1TZGH 2BDNH 4YPJA 3GRWH 3BGMA 3BH9B 5EO0A 3QCUH 1T66D 2ICCA 3FCTB 1CXIA 3P77B 4PB9H 1FN4A 4IRJD 4CW1B 1LP9F 3UCRA 4A2MA 3K1DA 5C9KA 2W0KA 5KSVB 1GGCH 5GS0L 3W11C 2A9ML 1FNFA 3BDXA 1MNUH 2FEDC 2OJEB 2VQ1A 4KQ4L 3QQ3A 1QP1A 2H8PA 1FV1A 1XAUA 3O9WC 4E41E 2NX5D 1PKOA 1JPSH 1VFMA 1YQVL 2YN5A 4L8DA 1KXQE 3H3KA 2G2RA 4Q97A 3IETA 1INDL 5JA9A 1JHTB 3DIFA 5IHBA 2N7AA 1AE6L 5L2KA 1K2DB 5HYQB 1C7SA 2DM4A 3WS3A 3TPUE 2RGSA 3DWTA 3LZFH 1U58A 4DGVH 3OB0H 4K2UH 4DVBB 4LARH 4RMWA 1Z9OA 4PUBL 3CU1A 4LEOA 5CUSL 1A6AB 4JFFB 3U0TB 2P8MB 3RWEA 3ARDB 4ENED 5J13B 2VIRA 4GH7B 1TZIA 4LOUC 2EXWD 2DQTH 4M48H 1JGLH 1WQVT 2P8LA 4WHTB 5BV7H 4FXGA 4U1HA 3KJ6L 3VJ6A 4XBEH 3C8KB 1OHQA 3CFJB 3QIUB 3QUZC 4MCZA 4R90L 2VABB 3GMPB 4JR9L 1AC0A 5ISZB 4NQDD 3KLAB 1D5MA 5KVMC 1RIHL 5HHNA 4WW2F 3RU8L 2AI0L 3R8QA 4TOYH 2DRUA 2B4CL 1NCBH 3OG4B 4Z7VF 1KIQA 5HJ3B 5ABDE 4MNGE 3UDWC 3QJHA 1C5BL 2BSRB 5FB8A 2AABL 2XA8H 4LSTL 5ITBL 2DQIL 3VGFA 1RZ7L 3BN9C 3MJ6A 4ODVH 1JZ6A 1T22A 5E5MA 4ZTOH 1FDLH 3OPZH 4N8PA 5GRZA 3WXVH 3LV3B 4QTHA 1T5XB 4OCRL 3VFMB 1Q0YL 2WP3T 5IESH 5GRJL 3N1QC 2N1KA 3MMEA 1MAJA 1CVSC 4PJ5E 3F6IA 4KKAD 4PPTA 3BPNC 1P7QB 1X3DA 2PW2A 4K7PY 1INQA 5SWSD 4I0PA 3ZZ1A 3F12B 3NIFE 4GAFB 4JJ5B 3VGAB 1PX3A 1RUMH 5D8JL 3VXQB 3EOBB 3T4YB 3VD9A 5CSZB 3SO3B 1DUYA 3O45A 4L29A 3QO1A 4L8BB 4OLXH 1NUDA 7FABH 3DX6A 4AM0A 4AIOA 1JCKA 4WUUA 1M05A 5HHPA 2O61A 3FO2A 4LVHB 3TVMB 2X1WL 4GKSA 1TJHL 4K3HA 5D1QD 3PIQA 3KPMB 4LPUA 5CEXA 5D7LA 5FUCC 3DECA 5KSUB 2BNRB 4XVJH 1SY6H 2E9JA 3LQZB 3K4DA 1HYSD 4MA7H 1KACB 5HDQL 2X4RB 4KRMB 3LD8C 1WTLA 4Y4KB 2VWEE 4R0LA 2QQLH 3LB6D 1U8IB 1K4CA 4NSKA 3AC0A 2FX9L 3MA7B 2ENSA 5I1IH 4XP6L 4Q58C 5T1LD 3QIWA 1IEBB 1J7VR 3TT3L 3EGSB 3WUWA 3UJJH 5EO0B 3WFCH 4V1DE 5IMOA 4Y5VB 5E4EC 4NFBA 3VFOA 2DQJH 2NY1C 3TGXA 4M7JH 3C8HA 3CFBA 5C0AA 1MOEA 3QDGD 3PWPD 3B9AA 5TE7L 1QBLH 1Q8MA 3CLFH 1FV1B 3HPJA 3SE8H 4UQ2A 4U0RB 2PO6A 4S11A 4Z7OE 3RWFB 1UM5H 4CN1A 1L8JA 4L8DB 2IEPA 3CX5K 4LVNB 2G2RB 4MB4A 4DKEL 3SE3C 3L9RB 3IETB 4Q6YA 4MZ3A 4BSJA 2YMXL 3FHQA 4PJBB 1XIWC 3RKPA 4G6AC 3ZDZE 1ROWA 3HC0A 4XNZC 5HHXL 2QHLA 5B4MC 1RUAH 1MSPA 1S9XB 4OF5A 1JZ2A 1VFBB 4WNQB 1QEWB 5F6IB 3RWEB 3GSWB 2VIRB 4XGZA 4HFUL 4N1HB 2D7NA 1V05A 5CJQH 1BIHA 2P8LB 3OAUH 3V4PL 1R3IL 4G8IA 1VPOH 2VLME 4ORGA 4KROD 4U1HB 3BRDA 3KPTA 3O3AA 4MCZB 1X9QA 3MRBB 1HXMB 1NBYA 4NO2A 4BSVB 1T1XA 4OM1H 3IVKA 1RHFA 4MQSB 1WAAA 3RTQD 1NL0L 4OTXH 5D93C 5E9DD 1JZ3A 2B1HL 4R8WH 1KLUB 3QJHB 3MACL 4M1DH 1MFCL 1P53A 1RD6A 5FB8B 1ZSDA 5FUOH 1VA9A 1LDSA 1ZVSA 4LLQB 1R5VB 5DVMA 1RHHB 5IK3A 3VD4A 5CINL 1T22B 2ORBL 1I3GH 2B7DT 2Y9RT 5HI4D 4MX7A 4LIQL 3MRFA 4QTHB 1ED3B 3S37L 4OZHE 3QG7L 1B88A 1DQLL 1VADA 1JTOA 2XXCB 3VXTA 4ZUWA 5A2IH 2NTFA 1W0VA 2FDBP 3KLHD 2BSSA 5GJTL 3MRGA 2V2XA 1W0WA 2HKFL 1AFVH 4HWEL 4TSAL 5JZ7D 1EGJH 2AXGA 4YDJA 1X5KA 4I0PB 5DR5H 2QADB 1Q9WA 5F7LB 4AMKL 4OFVA 1V5JA 5K9JH 1QLRA 2V7HB 2WNGA 4RIRA 3BYTA 3NACL 3QEQE 1DUYB 3O45B 1SJVA 1CE1H 3KPOA 1GL4B 4X4XA 4ZDHA 1KENH 4HJJH 5GIRA 4JO3H 32C2A 4WUUB 1M05B 4ODTH 4JY6A 3FO2B 3U0PB 4D0CB 2O61B 5MHSE 4XVSL 4GKSB 4JFZH 5FECB 2OBGA 4D9LL 1KG0A 2LV4A 2EDYA 2R0ZH 3WN5B 1P4IH 2W9DL 4PJGF 5EOCH 2R69H 4WI5A 5D7LB 3MJ8A 3F65A 4TUKL 1T3FA 4NJ9L 5KS9F 1KIUA 3IDYC 1QSED 3GGWB 3MRRB 3P73A 3T0ED 2XZAH 3MV9E 5BMFH 1I8MA 4DZ8B 4YX2L 7CGTA 5GZNC 4KTDH 3FQRA 5IP4A 3R06B 1JNNL 4XX1E 1J8HA 2VLRB 2X40A 1FIGH 1JF1A 5I66A 3QISA 4NN6B 1BD2A 5ALCL 1IAMA 4TULL 5TDOB 3WUWB 4P5KB 3KLDA 3O4OC 2R2EB 4IRZL 4QRQB 2QQKH 1X5ZA 1U93A 2Z92B 3VU2A 3VFOB 3GMMA 3CFBB 4DCQB 4XNUL 4FZEL 5C0AB 5TDNA 1DBJH 4FQLH 2CIIA 4RMUA 2CJUH 2PKDA 1MCQA 3RUGE 2P45B 1AO7B 2W59A 2VOTA 4PJAE 2XY1A 5AG9A 5T3XL 2BMKB 2PO6B 1MQKH 4KKBD 5IBTH 1FVEB 3CMOH 4DTGL 4M7KL 4APQD 4H25A 1UZ8B 5DXWA 1ZT1B 2R1YB 4O2FA 3UYPA 3C6SA 2EIDA 5D2NE 2H9GA 1U95B 4ONHB 4NQVA 5DO2D 1MCEA 3QUYA 4NNYA 4OCWH 3A6OA 3NCBB 5DZOA 4OCSL 4MA8L 5C3LD 1QKZH 3IFNH 2Q87A 3D39A 1Q72H 4GRLA 4X7SH 4AIZA 1KN2L 2FJFA 4G8IB 1BPVA 1E28B 1CGUA 1OAKL 3VA2C 1OB1A 2VDML 4P9ML 3O3AB 5C07E 1FC2D 4PJHF 4KUZH 1NBYB 4ZAKA 1XGUA 2JELH 3TBVB 5FV1L 1T1XB 2BJMH 3P0YL 3IVKB 2BVPA 2YSSB 4K3EH 5FV2A 4QHKJ 3UBXB 5I0DA 1I7ZA 2I25N 4OCXH 4JKPL 1TLKA 4G6KH 3VXME 3BQUD 1ZSDB 1V3KA 4CVZA 4NQEE 1JHKL 4Z7NF 1X44A 4U49A 4HUWA 3F5WA 3QBTB 2DBLH 3SGEH 1JZ4A 3QDJE 4WI2A 3VWKD 2LTQC 3D85B 4JFPA 4B50A 3OKOA 1VADB 2B1AH 3U9PH 4YDKL 4RGMC 4U31A 5MI0C 2RFXB 3MRGB 5F96H 2V2XB 1GC1H 2QQNH 2FJGA 3E3QC 3MLTA 3QFJA 1MCRA 4YDJB 1OQOA 3KR3L 3PL6A 1B9ZA 1KCVL 1T5WA 1Q9WB 1S7XA 1QLEL 2AJSH 2DM7A 1HE7A 4M61A 1N7MH 2L4OA 3BKCL 4P57A 4ORZC 1CN4A 3V4UH 5E56A 4NN7B 3KPOB 2D7MA 4N0UA 1IGJB 2Q76A 4YXLL 1OSZA 5ADOL 4TNWK 32C2B 3JTTB 3ZE0F 5C0CA 1CXEA 1F6FB 1KG0B 4BM7A 1HOCA 4DGIH 3T3PE 1L6XA 3B2UC 4MJ5A 4ALAH 1T3FB 4I3SH 2FX8H 1H3PL 1FYTA 1YY8A 2EDLA 4KKLC 5DQDH 3SN6N 3RKDC 1I8MB 5EZJA 4NQSA 1JGEA 2DQEH 1J8HB 2W0FA 3PQYD 4EI5A 4FQXA 1QR1A 1OM3L 1IKFL 2OX5A 2GTWA 5I66B 2ARWA 1OP5H 5L7XH 3NCJL 1BD2B 1JWSA 5HGDA 2CUMA 3LS5H 3FTGB 1LWRA 1UWXH 4M7ZC 2MJWA 1U93B 3E3QA 2IPUG 3VXNA 3WNLA 3GMMB 5F93C 1A7NL 1MQ8A 2NY3B 1CZ8H 3CNKA 5FM5M 2HT2C 3QPXL 1A22B 2H41A 5M7QA 2CIIB 4KK5D 3BESR 5GGSA 4B41A 2Z91A 2XKSA 2CDFA 2HFFA 4TSBL 1NGPL 4JPIA 4OF6A 2GFBA 5CZKA 5T5FL 1ORQA 4ELMF 5IW1B 5FA3B 4HUVA 3VE0A 2R29H 4MD5B 3NIDE 2OMBA 5D2LF 2IALB 3NZ8B 4S1DC 4NKOA 1E6JH 3NA4A 4L3ED 2NQCA 5FO9A 3RX7A 5IW6B 3TJHA 3C6SB 4Z7WA 4G6JL 2H9GB 5FDWB 3HUJF 4NQVB 3VCLB 1FE8L 3GI9H 3QUYB 4WW1A 1H15A 4IIQC 1C7TA 1WCQA 1F4XL 2AJVH 2NY4D 2Z35A 1DLHA 1Z9LA 4M03A 2F19H 1BGXH 3QQ4B 1HQRA 3CK0H 2XN9B 4HK3N 4JRYB 1SJHA 1NMAL 1X5YA 4GRLB 1WLHA 2KQMA 1EO7A 5E6ID 3VFGL 1D5IL 1KCSH 5T1DH 3ZLQC 4X6BA 4ZOEA 3UPRB 2VZOA 2YXMA 4W4OC 3PWUA 3H9SD 1EEYA 4JDTL 5JOFA 4ZAKB 5IWLC 1ZHLA 2WLYA 5HGBA 5IFHL 3EYUL 5IHLB 3CSYB 4MQ7B 4CU8A 1YQ2A 2ZUUA 5DJDA 5GSRA 3RVTD 3WE6B 2VL5B 3MQIA 4CVZB 2J12B 4I3GA 2J8HA 4F2MA 3IFLH 3KPLA 4NFCA 3WIFB 2E6JA 4ZG1A 3RPIA 4LCWD 3OKOB 4P2RE 3UYOD 5ACZA 3EOYG 1JZ7A 3Q1SH 3KS0J 5CBAA 1GRWA 3QEGL 2X1OA 2ZNXA 1YQVH 1FNEA 3OR6A 1YEDA 1BIIB 2FJGB 3MLTB 4OM0H 4X9FA 1F3JA 1AHWA 4HPYH 1GAFH 4DKDC 2EDDA 3PL6B 1T5WB 4M6ML 4ZFZA 2X4TA 1RMFL 4M61B 3ARFC 1YEEL 4OZGA 5F1NB 4P57B 4ODSH 5BVPH 2P48B 4EUPH 3MNVB 2X70B 2GCYB 4JFEE 4LBEA 4A6YH 5D7JB 4PUBH 3MLZL 1CDBA 4N0UB 4C56E 4NQXA 8CGTA 3LRHA 1NLDL 4S10A 5IBUB 4GAGL 1YPZE 2J4WH 5GXBB 3I3EA 4F7CB 1IM9A 1MHPL 2KZWA 3GHEL 5C0CB 2IBBA 4QXUL 4XP4H 1HQ4A 2FWOA 2IFGA 4AT6B 4NO0D 1HOCB 4WWKD 3L5XH 4BJLA 1OTUC 3ZT6A 3EYOA 3SDAA 2X4NB 1FYTB 3OQ3B 1YYLL 5T1LA 1PD6A 2VLKD 5EZJB 5C08D 1U8MA 3H3PL 3KYNB 3NTCL 3RQ3A 3DVGA 4EI5B 1F8TH 4FQXB 2GTWB 3T08A 4IRJB 5J1TC 4WI3A 2J5LB 1IC5L 5GJSL 2RQ8A 4PRHE 2P46B 1RZ7H 3EHBC 3EOTL 3Q5YA 1KJMB 3VXNB 1RZKC 2JJSA 5IT2H 5DC9B 5EZLA 3GMLB 3WIHH 3QXUA 1OT1A 3H9HA 4CGTA 5F9DC 2J88L 4YDLC 4BQ6A 1I9RH 1EIBA 2NX5B 4KWUA 3Q0HA 1R6VA 2GFBB 5GGTA 1ORQB 4QRPD 4YJZL 3UTPE 3VE0B 1WBZA 4HX1B 5C09A 4QGYA 3CZJA 4NKOB 4YHMH 1MFBL 3SDCD 3IDNA 1CGXA 1AIFA 1TETH 3DXAE 1INEH 3R1GL 3NPSC 1AD0A 4YHIA 3LIZH 3PDGA 2ITDA 2BY3A 5ID0A 4M43L 2R0LH 1KTDA 4ZXBC 4X98A 5ICZA 4WW1B 4I3RH 3REVA 3HE7A 2V5YA 4K3GA 4EVNA 3OTTA 4UT7L 4AEIL 3QDAA 3GJFH 3ULUD 3PABB 3GK8L 4K23H 2HT3D 4H0IA 5HHME 3EYQC 2BVEA 1UCTA 4IMKA 4LK4A 4KJYB 1ACZA 4NQDB 3BH8B 4X6BB 4ETYA 4D3CL 3KHOA 4PJXA 1ONQA 3G6JA 3RTQA 1OWRM 2QSVA 1AR1C 3LCYA 3MNWB 4XWOC 1MRFH 2EICA 3TN0D 4J3SA 4OLVH 4PD4K 3RZCC 4L4TA 1BJMA 5HGBB 2CO7B 4HK0A 2IBZX 4L1HA 1OWWA 1Q38A 3FQTA 1AJ7L 2FO4A 5E8EA 5DJDB 3AUVA 4PJFB 3TV3H 2E9IA 3QQ9C 4HIIA 1HSAA 4F2MB 4HD9A 2A2QT 4M1GH 5DGQA 4PJCE 1U3ZA 3L3IA 3BVNA 3X3FH 3JV6A 4BQ8A 2WWMC 3JVGC 1A3RH 1Q9OB 4MSWA 3MLSL 3U46A 2HTLC 4L4VE 4AY0A 1YEDB 3V6OC 1TCMA 5HYJD 1F3JB 5LGHL 2NY7L 2YPLD 4HF5L 2PCPB 4MVBC 4YIQB 5HHQB 5IVXE 2MQ0A 1BFVH 2X4TB 3VGEA 1BREA 4K7PH 4TRPH 5IEKA 3RY6A 3D0VA 1QFPA 1VCAA 2X89D 1ACYH 1T20B 5E2VL 1J5OL 1AI1H 4NQCA 3MXWL 3KPNB 4PG2C 4F33B 2XACC 4J8RA 2Y5EA 1EHLH 2VERN 3TZVA 1IM9B 5TPWL 5D1QB 1Q0XH 1HQ4B 1IGIL 4O2EB 3FRPG 5JIIA 2ADJB 4NC1C 4WFFD 5HHVH 3QUML 5TF1H 5D5MB 3TFKA 3I2CH 5B39A 2HFGL 5GRYA 2DMKA 2DQDH 4LFHG 2OZ4H 4X5XB 5C8JA 3EYOB 4FXKA 4JDVB 3UPCA 5DK2B 4QOKE 5DD3H 5HYEA 5T1LB 1IVLA 1MJUL 3FONA 2UVEA 3OXSA 3U36B 1I8IA 1B0RA 1FZMA 3A0OA 2VXVH 5IOPA 5E1HB 3N0PB 5F9AC 3S35H 3GMQA 2F5AL 4LIQE 2H6PA 2OTUA 3GIVA 1BHGA 3H6JA 4NHUA 3QDGB 4PRAB 5F97E 1QRNA 5J06A 3VXRA 3HCVA 1S3KL 1TNMA 5EZLB 4QRRA 5EZIH 1DQLH 3H9HB 1TDQA 1ZGLB 4HWBH 3ZKMD 5ECJE 3OKEA 3Q48A 4MAUH 4UV4L 2ICWI 4X9GA 3AREA 4MS8D 1QFWI 2CKBA 2GITA 3MREA 5A16A 3IDNB 3CUPB 4ZPTA 2UYLA 1AIFB 4P5MA 3V52H 2PXYD 2KPNA 4WI6A 1Z2KA 2ITDB 3PE9A 5ID0B 2CDGB 3MRHA 2Y72A 3M07A 2XQYG 4E5XA 4LAQH 4X98B 3REVB 4O00A 4U1LB 2ZCLL 4Z7UA 2VH5L 4EVNB 3FB6A 3TA3C 5E5RB 1R3HB 3NABH 4KROB 3AAZA 4K9EC 5JDSA 3O8XD 4WCYL 1F4AA 2EH8L 2ZP0T 3GJEB 2OR8A 3OAZH 4NKDA 3RFZC 4LU5L 5KSBE 5EULV 1IGTB 5MENA 5HI3C 3SQBA 4GS7B 1U3HD 3LPFA 4YE4H 1LEGB 3RTQB 4PJEE 3TYGH 5E9DB 5FYKE 3RVWC 4UU9B 1Z0MA 2WIMA 4M3JA 4DOHE 2P5WA 4I0CC 1NCWH 1QACA 5B21A 5TFSH 5EOQH 4BFEA 1JNLL 5FYKH 3C9NB 1KXVC 4S1SH 4Q9QL 3VGAC 2E5EA 3FQTB 5E8EB 1A7OH 2FO4B 1A0QH 2ZUSA 3SO3C 4MAYD 4P9HC 5E08H 3D6GA 4KI5F 3L5JA 1A7PH 2C3HA 1YEKH 3IJHB 3C6LD 1FG2B 3OV6A 4F15B 1BLNA 2CMRH 3JV6B 2UV3A 3TVMC 4U0QB 4OZIA 3VXUE 3DRTB 1A7QL 5CZVH 3S35X 3I3DA 4M8VA 3IFOB 4H26B 2EE3A 2V9TA 4P2QD 2F54D 4UMGA 1IAOA 1FAIH 4G9DA 3TH3T 3OB0K 1KB5A 4OIAA 5E7BA 3S37X 1B4RA 1J9CT 4MNQE 3TO2A 5IEKB 1H3WM 1PKQE 4JFHD 3D0VB 1YEFL 1MI5D 5DUPL 4XPFL 3V2AR 4JHAL 3SGKA 2BHYA 5KN5A 3QFDA 4HT1H 2A73A 4NQCB 2EDRA 4GXVH 2VKXA 3LH2L 4LF3A 4Y5VC 1VENA 3HPLB 3UO1H 2Z93A 4C4KT 1RUQH 4U2YA 2XTLA 3ZHDA 1BAFL 1WFUA 2VQUA 1PY9A 3KG5A 4QY8B 2HVKB 2VAAB 5B39B 4PRPE 1S78D 4H88H 1WWWX 4FXKB 4G8FB 3FKUS 3CJJA 3T2QA 3FO9A 2ESVE 4U0RC 2WW8A 4BZ2L 5LQBL 3F7VB 3OXSB 5I1HH 4OIIL 1I8IB 4LVOB 1BF8A 3MUY1 4LVNC 4BQ9A 3GMQB 4GOSA 5I8CB 1M7IB 1MAMH 3S5LA 3N1FC 5TE6L 5JW4M 3RPKA 2H6PB 2OTUB 3LKOA 3KXFD 2X44D 3FB5A 4NHUB 5F7DA 1Q1JH 1S7TA 3HAEG 5E8DL 2V9QA 5DSCA 5I1JL 4NT6A 3T1WA 5EU7C 4ZFFA 5HYSA 3NZHL 1N0XH 1FGNH 4E41D 5F6IC 2R23A 5DHYB 5F21B 3ISWA 1MFDL 4WY7H 3OKEB 1PYWB 1A1MA 2P5ED 5D1XD 4LSDA 4OQ1A 1J0KA 3AREB 2XV6B 2GITB 1EHAA 5A16B 1NC4D 2APXA 2H3NA 3RHWF 4ZPTB 4P5MB 4HKZA 1BVKB 4Y1AE 5EN2B 3C60D 1ULVA 3NFNB 4RFOL 1IGFL 1CDUA 3WLBB 4WV1A 3BP4A 1P4BL 2RJMA 3MRHB 1I8KB 3MV11 2BCKA 4JQXC 1J1OL 4OQTL 4H5SA 5AAMA 5ERWA 5L9DL 4Z7UB 4P3CH 5DC4B 3Q2CA 1JYWA 1FFPA 2FX7L 5JHDE 5FCUL 4PJIA 3AAZB 3WNMA 3S96B 1GJIA 4NIKB 1NH6A 1GIGH 4NKDB 4IBLT 4LNVA 5E2WH 3ULVC 4XCFL 5MENB 4PGDA 4JG1H 1WWBX 3VFVA 5D6CA 1H3PH 1CICC 4DGYL 1YMME 5L8KB 1KJ2H 1CU4L 4S1QH 3BQUB 3C5ZA 3RVUC 5AG8A 2QADC 4LHUG 5IGXL 3HC3L 2XTJE 1QLFA 3FFDA 3VWKB 2VLJE 5C0GA 5E99H 2GUOB 1MPAL 3W0WE 4DN4L 3G04B 1HHJA 1QD0A 3MV7D 4U6XB 3HMXA 4JY5H 4LSPL 1IJ9A 1DEEB 1NDMB 1NGPH 3CH1A 5EUOE 4WO4D 4NZTH 3WN5C 4XAWL 1IAKA 5L88L 3FQUA 1XFPA 1A4JA 3CFEA 4YHZH 5EBLA 4KZEH 1KB5B 5FHBL 2OI9B 5BRZA 1FNHA 3AFLA 3PWNB 5JOPD 1QSFA 1RK0A 5D71L 3TO2B 5B38G 1NGWA 4N0YH 2DD8L 4JFXA 3MOQA 4M5YL 3EDJA 2VDQL 1FL5B 4NN6C 1HXYA 1JTPA 3QFDB 2DI7A 1NCNA 2A73B 3SBWA 2BVYA 1MVUA 1CGTA 2JCCB 3DX9A 1UWEL 1OAZH 1N6QH 4NO0A 3GSOA 3GMNA 2FR4B 4R26H 1IKNC 2RR3A 1FC1A 4IOFD 4M7LH 2W0PA 1ZMYA 3RGVA 5EA0H 5JW4Q 1UXSA 5C08A 5DVKA 1JNHA 5I8EA 5JORA 1Y0LA 3PQYB 5CILL 3ILPB 4LL9A 5LWYH 2MCG1 4P3DB 4PP1C 1EA9C 3K7UA 4L8CA 3MFGB 1ZLSH 4QRSB 4IRSC 2LABA 4G59A 4KVNL 3IXAB 1J0JA 4JVUA 3MJGX 2FH6A 3CSGA 4JQIL 1C12A 1AGBA 1OAQL 2OTWA 5TDPA 5DHVH 1CLYL 2YOCA 2ADGA 3WLWC 5DSCB 5AWNH 2B8OT 4JN2B 3LKQB 4NT6B 5CIPA 4ZFFB 2J3SA 3WFHA 3PV7A 5H94B 2R23B 1QR4A 4Y16A 2QR0A 1N5YL 4NNXB 2PTTB 4OAWA 4MJID 5ALBH 1A1MB 3H42H 4WFHE 4L3EB 3BD3A 2HT4D 2IGFH 5E8NA 2CQVA 2WZPD 2NCMA 1IZJA 5IR1B 1TMCB 2H3NB 1TTFA 3ME0A 1QFWH 5IVZB 3BP6B 4ACPA 4HKZB 3OKLA 4NN5B 5D1ZA 4MQXC 1F4WH 1I1AC 5GRXG 1MJJB 4WV1B 4XC1H 4Q6IC 3BP4B 4H1LG 1CLCA 2NY4B 2AKRA 3RWCB 2BCKB 1IEAB 4H5SB 2PF6A 2E8YA 4OF3A 5FDYA 4IMLA 1NPUA 5C0JA 3IGAB 5DYOB 3GHEH 1FIEA 4QXUH 5E6IB 1BQHA 4U1SA 1DFBL 3GSUA 3PWLA 3DV4B 4QWWC 2FECL 2BVOB 4XHQA 2MTPA 1H3XA 3H9SB 1VERA 4NJAL 4XCCL 5F89A 1F42A 5AYQA 3FO0H 4WHDA 4L8SB 1ADQH 1FGVH 4GBXC 3O0RL 3WDHA 3IRZA 3W81A 2Y5TB 3ZE1E 5J9PB 3C5ZB 4WDIB 1OAUL 4NKIH 3BZ4A 5KSAD 2DTSA 3BUYB 3GFUA 3SOBH 1KPVA 4Z0BH 4UT9H 3CPLB 4BSWB 1L0YA 3FFDB 4OI8A 2Z31C 4UTBL 3JSSA 5C0GB 2IANA 4LCWB 4NN7C 2BRRH 5EWIH 5MP6L 3HFML 1EFXA 2HH0L 1T1WB 1VDGA 2AK4E 2JJTA 2GI7A 2BK8A 1MCKA 4HG4K 1KLFA 1QFOA 4FTVE 3HMWH 1GGBH 3BKML 3WFEH 3OKNA 2MSPA 1IAKB 3HE6C 1CR9H 2DQFA 3U82B 3QEQD 5EBLB 5MEOB 2Y6SD 1CG9A 1NEUA 3LN5B 3B5TA 1J18A 3KYAA 3P9LA 5AZ2L 1QSFB 3WXWL 1RK0B 1RZKL 1WISA 1FLRH 5HDBF 1RU9L 4F37F 1D6EA 4X6CB 5I15L 4JFXB 2VL4A 5IFJA 3BAEH 1YEIL 3GM8A 1HXYB 3QXVA 5MHSD 2BFVL 1OOAA 1LD9B 4FZ8L 1HDMA 1MVUB 3DX9B 5E8PB 2E6QA 3DMMD 3SCMC 4NO0B 1T2QL 4PV8A 3GMNB 1KELL 1CGWA 1T2JA 4U33A 4WWKB 1G7QA 1BJ8A 5EC1B 5H37H 1YJDC 2NY0B 1K9TA 4JZNB 4HZAA 1LO3H 2VUOA 2NXZD 1BF2A 2NY2D 4GG6A 2VLKB 1UXSB 5C08B 3QYCA 3ZSTA 5JORB 1EXUB 1Y0LB 4QF1A 1ZXQA 4ONGH 1RURH 2ZUYA 5GSVA 2BNQA 1FL6A 1P6AB 4L8CB 2MCPL 4XPGH 5FUCE 2QJDA 2OL3A 2ZOKA 4HIHA 4OSUH 5J57B 5T3ZL 4MCYA 1C12B 3MXVH 2OTWB 2DLEA 2JB5L 2ADGB 3P3YA 2R4SL 3IDIB 2GT9B 5CIPB 1HHKA 2RB8A 5JMOC 4E9LA 3QNZA 5CP7B 5D7KD 3NGBC 4QRPB 3LS4L 5LCVL 3EJZC 5ADPL 2L7UA 4Y16B 4OAWB 3MLSH 5HHOE 3T0WA 5E8NB 5C6PB 3JTCA 4HUUA 4FFVC 1WT5C 4JFOA 4D94A 1SYVA 5LGHH 3GDBA 5CGYC 3IAPA 1EZVY 4LVEA 3KAAA 1KGCE 3HG1A 3OKLB 1IGCL 1NANI 5D1ZB 5SX5H 2VDRL 2XPGB 1QA9A 5DZLA 5BS0D 1QHPA 3JWDC 4X6FA 4OFIA 3O3DB 2CIKB 1EK3A 4RFEA 4YBQD 3QEHA 5DUMH 5DF0A 3G5YA 3O8XA 3JWOL 1ZA3A 1DBBL 5C0JB 1FP5A 3FRUB 5I8OL 4U1SB 4WTZG 1A6ZA 3HB3C 4XP9L 3GSUB 4HIXH 3IKKA 4RISH 5IB2A 1DANT 3KWWB 3NCEB 1RJLA 5EO1B 4U6VL 3TN0B 1OP5K 4Y4FA 4XAKE 1F97A 3MJ9L 4YUEH 2AJZA 1UWXK 3G6DL 5BO1H 2B5IB 4YEEA 5E1AA 3STBA 2YD8A 5ID1A 4OLZH 2CKBL 3MTRA 4NQED 5JO5A 4G6MH 2X4UB 1MCSA 4I13B 4A2LA 1WAAF 3D3VD 5DFVD 1QSZA 2I26N 2WINA 1I9IL 2EZ0C 1QOKA 1WT5A 2BHZA 2EIZA 5D7JC 1QQDA 1MVFA 3V4VH 4TUJB 1VKXB 5CJXC 1EFXB 3CVHB 3TNMA 1F90L 4PLKC 4UUJB 2J8UE 6CGTA 4G42A 5KAQF 5A2JH 4FFZL 4RQQA 3H8NA 5HYJB 4HPOL 4JM4H 2EYRB 4PRIA 3OKNB 2YPLB 3WBDA 3VFWB 4R97B 5BOZG 5EBMB 5GZOC 3KPRA 3QIBD 3MR9A 4BKLA 1CG9B 4I77L 2GK2A 1S7UA 3BGAA 3IU4H 1CS6A 4YFLF 1CXLA 4X80H 1CFVL 1MIML 1T66C 4MB5A 4YHKH 2GTZB 3GSVA 3DGGA 3K0WA 3ARGD 4IRJC 2J5LC 3CXHJ 4ZYKA 1HDMB 3GHBL 1KN4L 4XVTL 5BV7C 1ZEAH 4PV8B 1VGEL 3NFPB 4L3CA 2HJKA 3WJJA 1MCCA 1OAXH 1XZ0A 4JKKA 4TNVK 5FGCB 2H32A 4JGMA 1QPXA 3BPLC 4GG6B 3QO0B 3QEUA 3P2TA 4B5EA 4HUMB 1NMBH 5DJ8A 5SWZE 5DD5L 5F6HI 5IMMA 1NFDE 2YD2A 5F9OH 3MLYL 5I1KH 2CK0L 1FL6B 3QJFA 1U8NB 4R3SB 12E8L 4Q7DA 4XB7A 2MMXA 5AUMB 4OB5L 3RX8A 4GMSL 4K9EL 4N0CD 2MPAH 4MCYB 1V7MH 4E41A 4WFEE 3MOAH 5JUEL 3QXDA 4ENEC 3PGDA 1C1EH 2EXWC 4FQ2L 1KT2B 3QNZB 1R3JA 2UUDH 5DJAB 4PJ9D 5DT1H 4OCYH 5INCA 3K8KA 2COQA 5ILTH 1NC4A 3ORJA 4WI9A 4PLNC 4MXQD 3TPUA 2OR9L 5KG9A 5JLZA 2VXTL 4F8QA 2PXYB 5ITFB 4JFOB 5DA0B 1SYVB 6FABL 3B3IA 4M93B 1I85A 3I6GA 4U7KA 4P9HL 1OTSD 1PBYA 3HAEH 4XPFH 2AXHA 1QA9B 1VB9A 1OTTD 5ENWA 4X6FB 1J1PH 1R0AH 5BXFA 3QEHB 3LH2H 3P30L 4K94H 3O8XB 4UINL 3GBMH 4PGZA 1ZA3B 1G6RH 4UB0L 3KPSD 1QRKA 2DQHL 5EZOH 2YA0A 4P23A 2H1PH 1LE9A 1A6ZB 3GO1H 2VYRE 1O5DT 1F6AA 1U3HB 2IH3A 4MNGA 4KKAC 1XGYH 5DD0H 4F7MA 1RJLB 1CE6B 2MNUA 3HNSL 5I71B 2DJUA 5KW9L 3OJDA 4LHUD 3IF1B 2ZKHH 3H3BC 1FBIH 2CKNA 2X4SB 3L3GA 4N9OB 4NZUH 3RVXD 2DWDB 1RJZB 1H5BA 4OCMC 3NIGE 4OIIH 3V95A 1N5AB 1K4DB 1IQDA 5E1AB 5GS0D 4Y5XA 1DLFL 1B6DA 5ETUA 4EN3A 5ID1B 5DK0B 3BW9A 5JO5B 2EE2A 1ZVYA 1UWGH 1CT8A 3MFFB 4L9LB 3AM8C 4PJ5A 4XZUB 3C6LB 3T4AA 1J0YA 4AENB 1IAIL 4HKJA 2V5MA 5I8KH 1OLZA 1NGQH 3QDMD 2G5BB 5I16A 3HZMB 1U42A 5EO9A 2R0WH 3C2AH 3O3EA 4PLOB 3TNMB 2WK2A 4WO4A 1U2HA 5TE4L 3V79C 5DJ0B 5D1QC 5FO7A 4P2QB 2F54B 4X7CC 5KVDL 4MXWH 1IILE 2R2HA 2XFXA 2Z8WC 1HYSC 2YD3A 4PRIB 5F44A 5JIKA 4YHPA 5GGRB 1JI2A 2AK1H 3EFDH 3FN3A 1MCNA 2HRLA 4UQ3A 3WHE0 1T0MA 3V7MA 4JFED 3LB6C 1MI5B 4GRWE 2IPTL 2R4RH 1LEKB 5C6TH 2OXGA 1T1YA 5FYLL 2APTA 5LXGH 4X7TA 3GJFK 4J3XA 3KYMB 1I75A 2F53E 3EOAA 5ESAA 3V0AC 2WUCL 5I17A 3DGGB 2BOCA 5J1AB 3T3MF 2B0SL 5TQ0L 3FFCE 1OGAD 5AD0A 4ZPVA 2CUIA 2ICEA 3JWNC 4AYFA 4ODWA 4L3CB 1QUNA 2IH1B 3H9YA 1NUGA 1Z5LA 2H32B 3O41A 1UH4A 4GKZA 1D9KD 1NJ9B 1FORH 4V1DA 4TVPL 5DLML 1B90A 2YZ1A 2NW2A 1RIVH 3SE9L 3WO3B 3CXHK 4AL8L 5IMMB 4HIJB 3I6KB 3RNKB 2IAMC 5IMKA 4QHLA 3KXFB 1MFEH 3K74B 4Z5RB 3M8OL 4EQ3A 1FZOA 1LO5B 3WL9B 4YDVA 2FHFA 4X8JA 1JGVL 4OKDA 3UTSD 1YNLH 4BUGA 4YQXL 4HSQA 4QHNB 3VH8A 2R8SH 4E41B 3WFDL 4CMMA 3ULVL 3AB0B 1QFUL 5ICXA 1JV5A 3PGDB 4Z7VB 5DJ2B 4N0FA 3UTPD 1K5NA 2Y07H 2P5EB 5D1XB 5D7IE 2ZPKL 4WEUD 5IROC 4K71C 4YR6A 3SGDI 1P4LB 4KROC 4KY1H 1NC4B 3HR5B 4Z95H 4QNPF 3TPUB 3O2DH 4U1JB 5FK9A 3ROOA 5JLZB 3C60B 4J3VA 1CK0H 1L9NA 3LKRA 5IJVA 4GAYA 1IBGH 1EBPA 3RIAK 2PYEE 3MODH 4TQEL 3O3BB 5FA4B 3VI3E 5ENWB 1FFOA 4LSSH 4JQVC 5BXFB 3QQNA 5JNYA 3PXJA 1P9MC 5IB5A 4LGRB 3EFFA 1YDPA 4P23B 1MIEH 1UKTA 2ZUQB 3BKJL 3SDDA 3INUL 4P48A 3U4EA 1UADC 4G9FD 3KLHC 2FIKA 4MNGB 4F7MB 5JZ7C 4HAFA 4Q2ZA 3L3GB 2YPKA 2P4AB 2CLZA 3UJIL 1IQDB 2CO6B 4PG9A 4Y5XB 4AZ8A 2VSDA 4PJ7E 4UBDD 5ETUB 4QHUA 3MV8D 1UGNA 2C9AA 4OZHA 4JHZA 4P2OA 3S3SA 1YMHB 3K2MC 3LRGA 1ZHNA 5DQ9A 4MD4B 4OT1L 3HI5L 3RWHA 1FO0L 4EI6A 4PJFF 4Y2OA 3OF6A 2YUVA 3WS6C 4UT6L 5EO9B 3O3EB 4QXTB 5DDHA 4WO4B 3GBNH 5F3BA 2NY6C 5FO7B 2FD6L 2XG4A 3PXHA 2AV7A 3QEQA 1XH3A 2R2HB 2XFXB 5IQ9A 3T0EC 1QFHA 1F11A 3B2VL 3BISA 3D0LA 4M6AA 4UQ3B 5FYJL 2R1WA 1JHLH 5GGQL 5DEFA 4FNLH 2YD4A 4XC3H 3IT8D 1T1YB 3A6CL 2BERA 4LPWA 3HNTH 2QHRL 5LBSL 1T80A 4LVOC 1UCBL 1KIPA 4GAJL 5J7CC 5DMGD 3WUWG 2J1KA 3FB7B 4JCLA 2CDEA 5FHAL 3OAZK 4OZGF 1JFQH 2BOCB 3DPBA 1OCWH 1EO8H 5BW7C 1W72H 1DVFA 4XMPH 2D03L 1A14H 2ZSVA 4POZD 2P8PB 3MV9A 1X4YA 1YN6A 1CF8H 4ODWB 4CNIA 4BFIA 3S4SA 2BSTB 4R2GD 4RMRA 1NCAH 1QVOA 4Y19E 1JGUL 1Z5LB 4GKZB 4HW6A 4KKBC 4X6DE 1EHXA 4V1DB 4XXCC 4APQC 1IC7L 1F4HA 3ZE2E 3DI3B 4HJGB 1FNSH 4Z77A 4FP8H 1NFKA 1KTLA 4DQOH 5CD5D 3OKDA 4F57H 3AS0A 4F58H 3UTZA 5DO2C 3HC4L 2X5PA 3RUGA 2NY5C 1FZOB 4XBGA 1FRGH 2R15A 4JZJC 2WP3O 4YDVB 4X8JB 4PJAA 3LEVH 1A7RL 2MWCA 3PHQA 4WHCA 5FOBB 4CRPA 3VH8B 5IIEA 5LVEA 1DQMH 5C2BH 3VXOB 4P5TD 5ICXB 3OAYH 1A6VH 4YO0A 1VEMA 4MJIB 3VDCA 4YZFF 4OUUB 3RBSA 5D2NA 4LLUA 1GC1C 1S7RB 2DKMA 1S7VB 5A2FA 2QSCH 5I6XB 1ZHKA 4O51A 3RVVD 3Q6GL 1NUNB 3UTQB 3LKRB 5I74B 1RZKH 1ZS8A 4FQHA 5HGHB 3MSPA 4GAYB 3CFKA 3OKMB 3BQUC 1HKLL 3ECBA 3G5VA 4EJ1C 4HK3J 1FFOB 1BOYA 3V6BR 4XBPB 2BZDA 4B7LA 5JNYB 5C07A 3QHZL 5IB5B 3VWKC 3EFFB 3ILQD 3O6FD 3PP4L 5KAQG 1UB6A 1M7DA 1YDPB 3ARBC 4P4KA 3SDDB 35C8L 1FL3A 1BEYH 2YEZB 3VFTA 2D0FA 5BZWA 3HRZB 5DRWB 3VXMA 4KQ3L 1HEZB 3W5NA 4ZUVA 3DUUA 3UYRH 1EVUA 4KFZC 4NQEA 2YPKB 1A6TA 3GSNA 2D31B 2CLZB 4KKCD 3QDJA 4ZS6D 5KSAB 4PJXF 3G6JF 2CLVB 4XH2B 4QHUB 4OZHB 2OI9C 2W9EH 2CXKA 1P1ZA 5KS9B 5FKPA 4UNUA 4NM8L 5T3XD 1ZHNB 1B2WH 5DQ9B 4JRXE 2QL1A 3RGHA 1T83A 1YJDL 4LQFH 4WI4A 4D0DB 3RWHB 1B4JH 5EU6E 1NAMH 3P0VH 4QYOA 4WFGE 5HVFB 3CVIH 3V6FB 3B9KC 2X4OA 5F3BB 1AC6A 3TF7C 3T77B 1JMXA 5DRZA 3QEQB 1XH3B 4PR5A 3LKNB 2V2WB 4DN3H 1XF4B 4NZRH 5IQ9B 4X7EC 3IAGC 2X1QA 1K8IB 1F11B 3D0LB 4FFEX 3IDGA 1VESA 2R1WB 3QUXC 2G60H 5DEFB 1T1ZA 5F9JA 1K8DA 3MLVH 3S6CA 1SEBB 2DDQH 3N85H 3U30B 2GQHA 2NR6D 4N5UA 1TPXC 5GS1A 4GW4B 4DW2H 1YEGH 4F9PC 4XNMB 3VWJD 3HNVH 1SM3H 5D6DA 5I1GL 1WBXA 2E9WA 3KPQA 3DMMB 4S2SB 4MLSA 3TO4C 4HH9B 3V6OE 1DL7L 1RJYA 2D7TH 1DVFB 2ZSVB 4OD3L 3NFSL 3H9ZA 3PGFH 3P4NB 3WKMH 4G43A 4NDMB 1YN6B 5DQJA 3SDYL 3BT2H 2NY2B 4CNIB 3PHSA 1E27A 3AY4C 4NCC2 2GJ6D 4GMTH 5CBEA 3S4SB 4BFIB 2ESVD 4P46D 1KPUA 2HRPH 3V6ZA 3T65B 3VRLF 1S5HA 2CRIA 3L7EA 3DURA 3GI8L 1OAYL 2ZG3A 2WQ8A 1KEML 3MJ9H 1J0ZA 5IEHB 4JFDD 1WWAX 4F7EA 1LO2L 4TTDC 3JWDL 4Z77B 4N5EC 2PYFA 4NC1E 3OKDB 4JFFD 3NPZB 3O2VH 4ZO6A 4FHBD 4YXKL 3SKJH 1RVFL 3RUGB 4NN5C 4PJHB 3FT4B 2APFA 4PJAB 1I9IH 1NAKL 3HA0A 4QLRA 3MBED 4FFYH 5J6HA 1QFWM 4NWTH 3OZ9L 3SKOA 1T7WA 4YO0B 5IB1B 1HH6A 5F7YC 3F7RA 4GO6B 5E6IC 5D2NB 1TZGL 3CLEH 2BDNL 3GRWL 3QCUL 4HUKB 4JE4B 3WSQH 4F80A 1YEJH 4HS6A 4Y1AD 5JDJA 4PB9L 4X5WA 1DN2A 1ZHKB 4O51B 3HZVA 3NCMA 2L7JA 5FM8A 5BS0B 4JPWH 3BHBA 4NC0B 4U3HA 4FQHB 1VACA 1ZS8B 3KYKH 1MNUL 2VZ1A 3MRMB 1CFVH 3CFKB 5K9KB 5GISH 4X9BA 3BMVA 3RVTC 4NO3B 3G5VB 1MLBB 1JPSL 2E7LE 5C07B 1WV7T 3TT1L 5ISZE 2E6PA 1CIUA 4Z7UF 1M7DB 1P7QD 3L3OB 3RY5A 2XNAB 3FN9A 1XF5A 1ZT4A 3TC9A 5L6YL 3JV4A 3VXMB 1G7JB 3QI9D 4LARL 4ZUVB 3DUUB 4HGMA 3ES6B 5F70A 4NQEB 1IRAY 3GSNB 3QDJB 5TJWK 1HHIA 1P6FA 3D3VB 4I5BB 2N56A 1IC4H 1I3VA 4HXAH 4P2RA 1JGLL 4F9LC 1II4E 4S0SD 5BV7L 2EYTA 5SWQA 4J4PC 1DBKH 3DYMA 1V7NH 1ZANH 4LPCA 3N1MC 4XBEL 3QWRA 1S7SB 3S9DB 1UB5A 1N64H 5IBUG 2DQCH 4KMLB 4QYOB 3DO7A 4EUPA 3BP7A 3U6RA 3ZKXB 5HI5C 3SJVE 1TJGH 2H2PD 2X4OB 4TOYL 3VXSD 1NCBL 1W8OA 4WWKC 2WANA 3K8LA 1SVCP 4WU5B 5CJBA 1KSRA 1JN6B 2OR9H 3T0VA 1XR8B 2XA8L 4JFEA 3QIBB 4OZIF 2VXTH 5K59E 4NP4H 4ODVL 4XPHH 1XF2A 4XT1C 4C56A 4ZTOL 1ZE3C 1FDLL 5IV2B 1YPZA 3OPZL 3D5OF 1T1ZB 1JI1A 5F9JB 5DMYA 3P9MA 3CZFA 2VDNH 1MHCB 1EPFA 4PTTB 5IESL 1MUJB 1BQLH 1WGOA 3ARGB 1TCRA 4RAVB 1KOAA 3MC0A 4E42A 4CVXA 1WIPA 3QA3A 5EH1A 3KPQB 5AEAA 3QNYA 3TIEB 1ZHBA 2LVCA 1ZK9A 1RJYB 3O6MH 2WWKO 1IT9H 3L6FA 4NRXA 1OF2A 3HUJB 2WY3A 1TENA 2XOTA 5CBEB 3SGJA 1RUML 1UENA 1ZAGA 2XQBL 1S5HB 3BYYA 5KW9H 4HC1H 2AJXH 3EDDA 1EZVX 4PRHA 1A9EB 4OLXL 4ZQKA 4XHJD 1JTTA 5L2KD 7FABL 4HWNA 3SDCC 4EDXA 4Y88A 1FJ1A 2PYFB 4XCNB 3FOMA 3MCKA 2QBWA 2OR7A 3MGOB 3WFBH 1S9YA 3THMH 2I07A 1E0OB 2HJFA 1KULA 4ZS7H 1R5IA 5IMLA 4XVJL 2XWTA 1SY6L 4MA7L 5I1DA 4LASH 2R2BA 4IJ3B 2F8OA 1G84A 5ESVB 5J6HB 3ULUC 3ET9F 1I8LC 3TBWA 2HT3C 3ZYZA 3DXAA 2QQLL 4O9HH 3KPPB 1MWAB 5I1IL 5JW4N 1FH5H 1AGCA 1FZKA 3BXNB 1EAJA 1T04A 3EAKA 4PJBE 4NWUL 2W0LA 5D72H 4EOWH 3UJJL 3WFCL 4YGVA 5FYLE 2FJHB 4F7PB 5I1LB 5K33A 5CEZH 5EU7E 1IC1A 2DQJL 3TN0C 5F72S 3O9WD 4M7JL 1CXKA 1LO4L 1X4XA 3PJSA 4LNRB 4N1CA 5CZXD 5FYLH 1GGUA 1NGZA 2B5IC 2A9NH 3LEYH 1DSFL 4M5ZH 4BZYA 5HHMA 1QBLL 4NKMA 2WUCH 4TNWF 3CLFL 4TSCH 3SE8L 4DFHA 4OV5A 1V3LA 2HFEB 2IC2A 1TNNA 4KJWD 4YC2B 1G6VK 3QG6A 1UM5L 2VUYA 4YLQT 1F2XK 1E6OH 1OW0A 2C1OA 2Y06H 4TVSa 1ES0A 4TVPE 5JW3H 2Z4QB 4LHUB 4I0PD 3U7AA 3AU1B 3HN3A 4LOUD 4PJIF 4TVPH 4KK9D 1LK2A 1G7IB 1G7PB 1S8DA 3VRJA 1RUAL 3QNXB 1AP2B 4HJ0D 5T1KA 4R97C 2DMBA 1PX4A 1HHIB 4PJCA 5IM7B 4HKXB 3VFUB 3ULVE 4WUUD 5CJQL 4P2RB 2Y4SA 3OAUL 3BWUC 3FO1B 4PJ8A 1VPOL 1CBVH 3QDMB 4HFWA 4D9QD 5JIHA 2I9TB 3VRIA 4LPXA 1J1XH 1AD9A 4L4VA 1VGKA 1UB5B 3WJLA 4JREC 2O93L 1CD0A 1MCDA 3BN9D 3WCYA 3DO7B 3BP7B 3U6RB 4OM1L 3SE4A 2BXYA 3B43A 3TWCH 4OTXL 1YC7A 4U6HB 5IVXA 2NXYD 2BVQA 3F62A 4LLDA 3BKYH 4M1DL 5SX5K 1E4XH 4JFEB 5FUOL 3CXDH 2NMSA 3IXTA 3TCLA 3QIWD 1XF2B 1I3GL 4C56B 5DRNB 4XPBH 4HULB 5JTWA 1MHEB 4PGCA 4KHTH 3P9MB 3CZFB 2RCSH 4PRBA 1NEZA 1S5IH 2VZ3A 2X05A 3PWJA 4ZOAA 3L3JA 2IQAB 5C0AD 4E42B 2VSCA 1OGAB 4MNHB 5KOMC 1BP3B 3QNYB 2VZVA 3ZKND 4QT5A 2PNDA 3S98A 1AFVL 1Q9KA 4BK4A 1W2KT 1EGJL 4QOKA 4HXBH 3S36H 3L6FB 2PO6D 3KDMA 5DR5L 4QRTA 1PEWA 1OF2B 5DVOA 1ORSB 3QDHA 1D9KB 3NA9H 5SX4H 4LCUA 2VLRE 5K9JL 3BZFA 1IGMH 2XQYK 3MJ7B 5FF6A 4MS8C 1M6OB 1WCBB 2DLHA 2GKIA 3BUTA 2OJZH 3P4MB 1FVDA 1CE1L 3IJSA 5F7WC 2AQ2A 1ZGLP 5CWSA 1KENL 4HJJL 3ZTNH 2R1XA 3SKNA 4JO3L 4EDXB 5L2JB 1XGQB 2PXYC 1FJ1B 4ODTL 4GG8B 1T7VA 3Q3GA 5ICYA 1UQSA 1AY1H 3UTSB 3QP3A 4JFZL 4M93C 1WSST 3FOMB 2R0ZL 3EO1A 3VFNA 1QBAA 1P4IL 1QO3B 1S9YB 2J6EH 2AS5M 1AO7E 2HJFB 5EOCL 1MAKA 2R69L 2DIAA 5F1OB 1N2RA 1R5IB 2XWTB 1EJOH 2R2BB 4MJ2A 5JR1H 2XZAL 5BMFL 4K7FB 3IU3A 4HLZG 3TBWB 4KTDL 4ODUA 3DXAB 4WTWA 2ERJB 3QB7C 1FIGL 4CMHC 5FYJE 2FD6H 1AGCB 3V5KB 3DOSA 2HN7A 4H1LB 4YNYB 1I7RB 5DMIH 1U3HC 1KGCD 4YGVB 3W9DA 3E2HA 1CL7I 3IDUA 5FCSH 4BQCA 2QQKL 1CVRA 4EIGB 5I71C 3RDTA 3EJYD 1PQZA 5I2IA 1JGDA 3H7LA 5C0IB 1T0PB 2BOBB 3DUSB 1NGZB 1DBJL 4FQLL 1I3UA 3WD5H 1UCBH 2CJUL 2YKLH 4NKMB 4XI5C 4Y2DA 4JVWA 5KSBA 3GNMH 4E0RB 5K9QG 4MAYC 4OV5B 3O4LE 1MQKL 4L9LC 3MO1A 5IBTL 4O4YH 3U2SB 3CMOL 3QG6B 4PJEA 4NBYB 2GAZB 3DROA 2C1OB 1ES0B 3Q5OA 1YNKH 4NUJB 3FAWA 3MUZ1 4OJFH 5CJOH 4LLMA 5F8RC 2IADA 4G8EA 3WYRA 4OCWL 4HGKC 4O02H 2B20A 1S8DB 3VRJB 3MRJA 3MV8B 3LAFA 2FEEI 1QKZL 3WDJA 4R6UA 3ALXA 3IFNL 3S36X 4PJCB 4W6WB 1EBAA 1FNGB 1Q72L 4X7SL 1MRDH 3VXUA 4KC3B 2UUDK 5F7EH 1BWWA 1H3TA 3IFPA 4HFWB 1Y18A 4LLYB 4D9RD 5GS2H 5CP3H 3BEWB 4XCEB 5I1CH 4L4VB 4KUZL 1XR9A 2JELL 5C6WH 1RUKH 2C5DC 2DIJA 2BJML 5C0BE 4K3EL 4MNQA 1I7UA 5GRUH 1JPFB 2GEEA 4OCXL 1PKQA 1S78C 2BVQB 1N3NA 2XWJB 5TH2B 3L3DB 4LLDB 1YEHL 4G6KL 5B39G 3D18A 5EC2B 3TCLB 5EIVA 2DBLL 4I4WB 3OKKB 3VWJA 1R5WA 1TZHA 2EEDA 1GHFH 3DUHA 4PRBB 2B1AL 3T2NH 3U9PL 2NY3D 2GW5A 5CS7A 4HUXA 4JHWH 3X13A 4M9PA 4PRPA 1KPRA 2AJ3B 4QT5B 1GC1L 1L9MA 5DJYA 1IQWH 2QQNL 5EUKA 1Q9KB 2ESVA 5C0DA 1AXSA 4UZGA 4WW2C 1L0XA 3AB0C 2AJSL 35C8H 1E4WH 4CADA 1N7ML 2JJUA 4PDCE 3BZFB 3E0GA 5D1XC 5F7UA 3B6SB 4XRCA 2ITCA 1FVDB 4XNXH 3IJSB 3L7FA 4ODXB 3CC5A 4BA8A 2ED8A 4GG6F 4BK5A 5BOPA 2R1XB 3SKNB 1DQJA 4V2CB 4ELKB 1JL8A 1Z0NA 3C60C 5DJZB 3BIKA 3T0XA 2DIBA 1MFNA 5GZND 5INDB 1SJXA 1UH2A 3MBEA 4PTUA 4DGIL 4Z8FH 3D39D 1ETZB 3HLAA 1UA6L 4J3TA 4GRLD 4P5TB 2JK5B 4MZ2A 3L3KB 5DJXA 1KEGH 1BZ9B 4ALAL 1N2RB 4I3SL 2FX8L 3EO0A 4D2NA 5I76B 4PY7B 4ZUUA 3DYOA 2OK0H 4I9WE 2MHAA 4ODUB 1F58H 2ZCHH 4ZAKD 1X6LA 2V17H 4Y1AA 1RK1A 1X7QA 5L7XL 1A6UH 4OKVA 2HN7B 2VDLH 3LS5L 4C58B 3TBYB 3W9DB 5I30H 3E2HB 2W65B 3KNBA 2X9XA 4G80A 4K8RD 3RDTB 1JGDB 2DQUH 5DWUH 1CZ8L 5DMKA 4LMQE 1GCFA 5JHDA 5IHUH 2XN9E 4JRYE 3RWDB 3OX8A 5CEYA 1KJ2A 5KSBB 4XP1H 3FQNA 3O6LH 1RY7B 5IG7B 2R29L 3MBXH 1YMMA 5K9OA 1E6JL 5IB3A 3DROB 1SBSH 2JIXA 4DOHB 3BEVA 3QFJD 4GXUM 1BJ1H 4LLMB 3UJTH 3PL6D 4G8EB 2D7QA 3AXLB 1T89C 3LKPA 3ZYIA 3GI9L 1A21A 5K9QI 4CKVX 4CBPA 2VLJA 3M1BA 3ZKQD 1HN1A 2AJVL 5B8CB 2HVJB 3TH2T 2F19L 1BGXL 3W0WA 1SJEB 1LEIA 3ALWA 1BECA 2GSIB 4K8RH 3CK0L 5BJTA 1RZGA 3BJ91 5E2TH 3ZT5A 5C0CD 1KCSL 4UIMA 5T1DL 1OPGH 5EUOA 1GZQB 3IFPB 3MGTB 4QXWA 1D5XB 4IEFB 5DFWH 5FUZH 4H20H 4WU7A 1D5BA 3IJYA 3BGFB 1XR9B 4NCDA 3VFPB 1HNGA 3SKMA 3BO8B 3I75A 2VDOH 4YFEA 2F8VA 1OARH 1GGIL 1N3NB 2ARJQ 2OTPA 4EI5D 4FQXD 1HZHH 4O58H 5T5NF 5F7KC 1AGFA 3CX5J 3R0MA 3DTXA 2CH8A 2HWZH 3IFLL 3VWJB 1R5WB 3B9VA 3FMGH 1BX2B 3QCTL 1QG3A 3GMOA 4JM2A 3Q1SL 3S5LG 3U9UB 5ESQA 4F3FB 2D4FA 5FO8B 3GB7B 2GJ6B 3TT1H 4OM0L 1FYTE 2ESVB 4P46B 1AXSB 4HPYL 1JVKA 4LSVH 1GAFL 5HYSG 1HKFA 3P4LA 2XWBA 1A1OB 5DHVA 2A6JA 5HPMB 1JRHI 4JFDB 5L6YH 4ODSL 5BVPL 2HT4C 2ZG2A 3TJHD 4A6YL 1GZPB 1OGTA 5GGVY 4FQ1H 4AH2A 2F74A 2GSGB 3CC5B 4PBWD 1P5UA 4NQTA 2J4WL 1IMHC 1ZVHA 1K3IA 4Z76B 3LN4B 4FA8A 5JXEC 3G08B 4XP4L 1QYGH 3BIKB 3BIBX 4JFYA 4NKQB 5I74C 2NX5E 5DI8A 1T7XA 3MBEB 3VGDA 3L5XL 1WUNT 1UJ3C 4H8WC 5GGUA 2DICA 5B3JE 2WUBH 3AS2A 1B0GB 1MHHA 4J6RL 2GK0A 1DE4A 4OD2B 4ZUUB 4HKBB 1CFNA 2LQRA 2ZOLA 4P2YA 2CRMA 1MCIA 5MEQA 3DYPA 1F8TL 1PDKA 1LO0H 1IARB 1HINH 4Y1AB 4Z7QE 1X7QB 1G7MA 3RJDA 8FABA 1PLGH 1MELA 2ATPB 3O9WA 3MRCB 2YRLA 4PY8J 3FT2A 2Z0BA 3GKWH 1A1NA 1MF2L 2PYED 5E00A 4G80B 3ULSB 5IT2L 3HZYA 1U8LA 3N9GH 3WIHL 1E4JA 3IDMB 5JHDB 2EDXA 5KSAC 1I9RL 2B2XH 4XXDB 1I1CA 5CEYB 3FOLB 2HKHH 1U8QA 1LDPH 1UEMA 4R7NA 5M94B 3TBSA 3ARYA 4NQDE 4HWZB 1YMMB 4YHML 1VFAA 1TETL 5IB3B 3VXPA 1INEL 3UEZA 3LIZL 3CFCH 3T1FB 2SEBA 4NO5A 1HK6A 3BWAA 1E4KC 3QI9B 1XF3A 1Q9LA 3BEVB 2XQBH 4IHOB 2R0LL 2XTJB 3QUZA 4PJFE 4I3RL 4CDHA 1RFDH 1JPTH 2PTVA 5EFIA 2Y6SC 3QWOA 2QTEA 1T0NB 4QHMA 1WBYA 3MRPA 4JZOA 3W0WB 3G9VA 4YHNA 5BJTB 4K23L 2AK4A 5T1MA 2OSLA 5CMAA 2V5SA 3UDWA 3OAYK 1IM9D 3RWIB 1S9WA 4FTVA 1RZGB 4N8CH 4BUHA 3QAZB 5EUOB 1P7HL 3LKSB 5SWSE 1I4FA 2DAVA 3DMMC 2ZG1A 3ZYJA 3Q6FA 4WU7B 3VXSB 1MRFL 1N59B 4GSDH 3SDAD 5IJKC 1G7LA 4KK6C 4OLVL 3W9EA 1S7QA 5F1IA 4LEXH 3VFSA 1AGDA 2LU7A 1HNFA 4NWUH 5F8QC 1WF5A 3I75B 4KJQD 3NIFF 2NXZC 3BGMB 3O6KH 5CJ5A 3TV3L 3NN8A 1FN4B 3F7QA 3CGTA 3DX8A 1LO4H 3DTXB 4EDWH 4M1GL 3X3FL 1R24A 1DSFH 2PW1A 2VQ1B 1KIRA 3QQ3B 1A3RL 1ZLWH 2H8PB 4M62H 5D5ME 5MERA 15C8L 1BFSA 4KDTC 4I2XE 1WZ1H 5KVFH 4KHXH 1LE5A 3A67H 1UJTA 3V7AG 4OGZA 5C09D 3DIFB 1I1YA 1BFVL 2A6JB 4KVCH 4K7PL 4TRPL 5L2KB 2EDNA 3WS3B 1ACYL 4JY4A 4PB0H 1U58B 1U92A 5DUBA 3MA9H 1JIBA 1AI1L 4HIEA 4LEOB 3SDXE 1TQBB 4AH2B 3QDGE 4PREA 3PWPE 4LRIC 5IB4A 2ADFH 2VISA 1EHLL 3W39A 4J12A 2E3VA 4YAQA 1Q0XL 1TZIB 3FB8A 2KKQA 3RL2A 1T03H 3HE7D 1Z3GL 5HHVL 1A3LH 3EDFA 5FM5O 3CFDA 5TF1L 4FXGB 3AGVA 3I2CL 5D70H 4ISVA 4YBQC 2LAGB 2DQDL 3VJ6B 5HHOA 2OZ4L 4U6YA 5GGUB 2VZTA 4JEGB 4GLRH 1MHHB 5DD3L 2GK0B 2CGRH 1D5MB 5HHNB 5I1AA 1ODAA 1CFNB 2YBRA 4Z7OF 5GGTH 2WIIA 1BQHG 2ZCKH 4JG0H 2VXVL 4JDZA 2EYSA 1AQKH 3MLRH 4AEHH 5MEQB 3QRFM 1KIQB 3S35L 4FQIH 1G7MB 1TXKA 8FABB 1IAII 3WIIH 1PZ5A 3O9WB 5EDXA 4L4TD 3FT2B 5B22A 3O3UN 1C08A 5M95B 5E5MB 1A1NB 3QUMA 4X4YA 3ZDZF 3SE3A 5EZIL 1U8LB 2XZCH 1M7XA 1XIWA 4HWBL 2FH8A 2ILLA 5DFVC 3MMEB 2H45A 4X9IA 1U8QB 4R7NB 4MAUL 3TBSB 2I5YH 4HLZH 3CFIC 3H7BA 2FATH 4MMZC 3TNNA 1XCQA 1HH9A 1UM6H 2PW2B 1A6PA 1INQB 2DL9A 3WNNA 5E9DE 4V3DB 1VFAB 4YBLC 1J86A 2IMMA 1U8HA 5FKAA 5JPMA 3UX9B 5DGRA 3V52L 4NO5B 4RMSA 1G7HA 3ZKXC 1Q9LB 1EEUA 4HCRH 4L29B 5T3ZD 25C8L 1B6UA 3QO1B 4LAQL 2AEQH 2D0HA 3X12A 4B53A 5FOJA 3DX6B 4AM0B 5EFIB 3QIBC 3RZWA 3L5WA 5HHPB 4N9GA 4QHMB 1GVIA 1TQCB 1WBYB 2AAVA 4NQCD 3NABL 1OVZA 3G5XA 1NCDH 2MOVA 4RWHA 4XWOD 1SHMA 1J8KA 4LGPB 3S7GA 2J8UA 1RSFA 5CMAB 3TZVD 1PSKH 1TVDA 4K55A 1S9WB 3PIQB 4FTVB 3RZCD 4OZHF 1B3JA 5CEXB 3ARGC 3WNPA 3N50A 4YE4L 3TFKD 4X6EA 3EO9H 2YZ8A 3Q6FB 3TYGL 5GGRY 2NXYB 4R0LB 2AEIT 1K4CB 4NSKB 1TVHA 3W9EB 3DI2B 5F1IB 5MEPA 1NCWL 2M26A 1AGDB 4DVRH 3QIWB 1GPOH 5TFSL 5EOQL 3CU7A 2DL2A 5FYKL 2WWMD 4S1SL 3EZJB 1ZV5A 1A7OL 5IMOB 1A0QL 2H26A 5E08L 2VITA 3F58H 3L1OH 1A7PL 3X11A 5EIIA 1YEKL 4W81A 4TYUA 2VQTA 1QRND 3C5JA 2CMRL 5KTEH 3VXRD 1A5FH 5IKCA 1JNJA 4PP2A 4QRRD 2PW1B 4W6XB 3GMRA 4K94C 2APVA 3HPJB 5FYJU 1QSEE 4N0CC 4UQ2B 5CZVL 3T0EE 4PFEA 1F3DH 3LSOA 1NBZA 5SWZA 1FAIL 3ARED 5CD3A 1NFDA 5KJRH 4PJ9C 4IJ3C 4RWYH 5JMRA 1I1YB 4HLJA 3RIFF 4MXQC 4O2CA 5C3TA 4ZSOE 4FABH 3HC0B 4HZLA 3DGCR 3ARZA 1U92B 4HT1L 5DUBB 1ERNA 4HDIA 4HIEB 4QHKI 5GS3A 1JRHH 4R7DA 4GXVL 3LD8B 1REIA 4PREB 5IB4B 3UO1L 1PEZA 2VISB 3W39B 1YY9D 1OTSC 1RUQL 4XGZB 2V5RA 4WJ5A 1OTTC 4ZFOA 4PRNA 1WFNA 3CFDB 4WEBH 4ORGB 3STLA 5E4EB 2JLLA 4H88L 5HHOB 3RUGF 4U6YB 4M8QA 5EG6C 4RRPA 1S9KC 5MEND 4NO2B 4PJAF 1LK3H 5AZEH 5I1HL 1C5CH 5I1AB 4RGOH 5J6GA 5JW5A 2WIIB 5LGKA 5CLTA 4JDZB 4L5FH 4G8GE 1YEHH 4O5LH 1MAML 2P5WD 3HTLX 2R9HD 1ZVSB 5IK3B 3RVXC 2NY5H 4YK4C 1Q1JL 3GSXA 1XCTA 4GW5A 3QUMB 2D7PA 5GS0C 1IGYA 1RUPH 4MX7B 3OB8A 3MRFB 1FNAA 4Q9RH 1N0XL 4LCCC 5C0EA 2I60H 1FGNL 1XIWB 3AVEA 3HI1A 3VXTB 3ZDXF 4ZUWB 3LPWA 1KYOK 1IM3A 4WY7L 2NTFB 1H8SA 1LILA 1W0VB 2C3VA 2BSSB 1Y6NR 2AJUH 1Q94A 4LLVA 1W0WB 4K3DH 2AXGB 3BZDA 2ATKA 1U8HB 3QSKB 4IDJH 2VN7A 5JPMB 3TA3D 2O26U 3ZL4H 1QLRB 4RIRB 2Z8RA 5T5NG 2FHCA 1KFAL 3QULA 3E8UL 3S88H 4OUOA 5C0RH 2VDKH 3X12B 4X4XB 4ZDHB 3G5ZA 1JYXA 5GIRB 4P3CL 1BFOA 1LVEA 3LEXA 4JY6B 4N9GB 2VXUH 1ZWIA 4JGUA 4DKFH 5I0ZA 2KQNA 5D93B 2DLIA 5F9WC 2J8UB 4NBZB 1GIGL 3BPOB 2YK1H 1UA6H 1I7TA 5E2WL 3ZO0A 2W60A 4MDJA 3VGBA 2YUXA 3MJ8B 4JG1L 4CUCA 3QR2A 4C55A 3P73B 4IOIA 3LHPL 1KJ2L 4UI2A 2B4CC 4S1QL 2A6DA 3FQRB 5KVGH 2ZZUT 4OQTA 1JF1B 1TFHA 3EUUA 1D9KC 4LPTA 2F53A 3B8SA 1KB5H 1KCRH 2H26B 2X41A 3WNKA 5I19H 2VITB 2JCCE 5E99L 3FFCA 5TDNB 3C08H 3C5JB 4JY5L 4PP2B 2Y36L 3EKCA 3MRQA 4OGYH 3U0WH 5E70A 2VC2H 4KRPC 2WBKA 4NZTL 2V7NA 4PS4H 1GYAA 3LSOB 5HGAA 3PQYE 4H25B 1NBZB 4YHZL 3T3PF 4KZEL 1CLZH 3U4BH 2F9BT 4O2FB 4RGND 1W0YT 3CSBA 1WEJH 4N0YL 2ERJC 4O2CB 3WEXA 5A3ID 4NNYB 3BE1H 1RPQA 4NPYA 2AEPH 1I9JH 1KF9B 3I6LD 3AS3A 5E6YA 3VD3A 3OL2A 1KTRL 1OAZL 1N6QL 4PD4J 1MCOH 4KXZI 3D39B 1UG9A 1HHHA 4R26L 4AIXA 4N0RA 4DEPC 4WJ5B 5D7IA 4AIZB 2W1NA 3TESA 5I75B 4M7LL 2FJFB 3EDKA 4Z0XA 3WDIA 1U8KA 3O4OB 3RWJA 5EA0L 3IKCA 2P7TA 1LNUA 1OB1B 4L3EE 5CGTA 1L0QA 4S0TD 1XGUB 4Y5YC 3VI4E 4F37K 5LWYL 4Q9CA 3NIDF 2BVPB 5J6GB 3MRDA 3ROLA 5JW5B 2FBJH 3QXAA 4MXVE 1ZLSL 4ERSH 5DEZA 2E7HA 3RJQB 1U3JA 1I7ZB 4PRDA 4BFBD 3V5DA 1GGIH 2PYEA 2QQQA 4JAMA 3C5ZD 5C92A 2DLFH 3WNOA 4J3UA 5HVWA 2VXSH 5EB9A 4HUWB 3F5WB 3GSXB 1EVTC 4GW5B 5AWNL 4GKOA 4UBDC 3QCTH 4JFPB 4M4PA 4I18C 4IDLA 5C0EB 1FPTH 5E2UL 4GJTB 2UWEE 4WHYG 1IM3B 4ZD3H 3H9SE 4IIQA 5ALBL 3H42L 1Q94B 4LLVB 2IGFL 3QFJB 2R39A 1JF6A 5L0QB 2ATKB 1QFWL 5I18H 2FB4H 2ZSWA 1S7XB 1UYWH 2DOCA 4PJ7A 1SQ2N 1F4WL 5BRZD 4XC1L 1RZ8A 1NLBH 3E6FA 1QSFD 4W4OA 2GYSA 4PV9A 4PGJA 4UTAH 4CU6A 2Q76B 1OSZB 3O81A 1N8ZA 4LCWE 5IWLA 2ZUXA 1RZFH 1CICD 3LEXB 2P42B 4LLWA 2Q8AL 1QTYT 4YGAB 3NVQA 1NBQA 4OD1H 3PG2A 5DMGC 3U1SL 1I7TB 1MFAH 5GRVK 4MDJB 1U6AH 2NY0D 4MJ5B 1S7WA 3FO0L 4J6RH 4POZC 4PJDE 1YY8B 1NBVH 1D7FA 4RNRA 3HMXH 3W2DH 1ADQL 1FGVL 3RGVD 4NQSB 4JGJA 1JGEB 5C86A 3LQMA 2W0FB 4GRWB 4R2GC 3QWQB 1QR1B 4HGWA 2OQJA 2PR4H 1JWSB 4NKIL 5HGDB 4X6CE 2F53B 2IQ9H 3SOBL 5J0BA 1BJ1J 3IDXH 4XMKH 4UAOC 4Z0BL 4TN9A 4UT9L 1MF2H 3BPCA 5I1EH 4K3JH 5C7XH 2BRRL 1ZT7A 5EWIL 4EBQH 1PG7H 4ZNEA 3TM6A 1OL0A 3ARFA 1PAMA 1YPZF 2A83A 3JV5A 5GGSB 3U7WH 2Z91B 2CDFB 2HFFB 4Y19A 4JPIB 3HMWL 1GGBL 2DF3A 3WFEL 4AQ1B 4HUVB 2VLKE 4X6DA 4Y16D 3SQOL 3VH8G 1CR9L 1FFNA 4P5TC 2DN7A 3SO5A 1UT9A 5FO9B 1SVZA 4NRZA 5EU5A 4X99A 5J1SC 4Z7WB 5J3HD 1BM3H 2MQCA 1FLRL 1QBBA 4ZMAT 4FFWD 2JJVA 3DVNA 5KZCB 5D1ZD 3BAEL 1H15B 3GUTA 4NPYB 4XWGH 4KI5C 2RAMA 2WBJC 5TGBA 3RVVC 3STZA 2Z35B 1DLHB 3D2UA 5GGVH 3MUGA 1ITBB 1HQRB 3OGCA 3OGOE 1SJHB 4OLUH 5D7IB 4QRPE 1IE5A 4PP1D 1LGVA 4C83A 4Z0XB 4IRSD 1U8KB 4Y4HC 1LO3L 5CIPH 2P7TB 1LNUB 3PWUB 4D8PA 1WJ3A 2X4QA 1JZ8A 3HZKA 1EEYB 5D96B 3O6FC 4MD0A 5JOFB 4ONGL 1RURL 1ZHLB 4RAUA 4LGSB 3BMWA 4PRDB 2PYEB 4XPGL 1DBAH 4X5LA 5GSRB 3H2WA 1OP9A 1OSPL 4OSUL 2LU4A 4LRNH 3MXVL 3ULUE 4KKCC 1I1RA 4ZS6C 5EPMA 3KPLB 4ZFGH 1YN7A 2GIYA 3SEPA 2IAND 3RPIB 5B8CC 5ACZB 5C71A 2IF7A 3ULUH 4G5ZH 4KTEH 1EFXD 5CBAB 4ZXBA 4IIQB 2DTMH 4Y89A 3LY6A 3UZVB 1G9MC 2DS4A 1FNEB 15C8H 3OR6B 3T09A 1WICA 5BVJA 1AHWB 4KV5E 5BCAA 5BQ7A 1HI6A 4P4RA 5EIQA 3UTOA 5IVNA 4GT7A 2ZSWB 4G3YL 4ZFZB 4M6NH 4PJ7B 3P0GB 2Q7YA 1KJ3H 5LGJA 5KANG 2VDPH 4OZGB 4OGXH 3D48R 4YDIH 2UY7A 4LBEB 3P11H 1PW3A 4YHOH 2CUHA 1RZ8B 1VEPA 4JRXA 1VSCA 2YPVH 1FG9C 1DEDA 4NQXB 5DUML 3HHRB 1P2CA 2EKJA 5EU6A 1N8ZB 4BH7A 2APBA 2NR6C 1QBMH 3RZCA 2I9LA 2OM5A 4GBXD 2FWOB 1Z3GH 4HIXL 1CD1A 4WWID 4PJCF 4RISL 4ODBD 5IFAH 3QXTA 3LRSA 4M02A 5HYJE 3KYOA 3CVHH 3SDAB 1RZIA 2YPLE 4YUEL 1YA5A 3BJLA 5BO1L 1F4YH 1U8MB 3JVGA 5FGSA 1A7BA 3DVGB 4OLZL 4P46C 4NRYA 3V0WH 4HGWB 4XX1G 3ARUA 5JQ6H 4G6ML 3S4SG 1CFSA 2BNQD 3D9AH 2E7MA 2JE8A 3PHOA 4S1RH 1KXTB 4RMQA 4XMLH 4MHHG 1BQSA 3V6OA 1MCPH 4XPTL 3RIAF 3ARSA 2KZ1B 3V4VL 1NGXA 2HJLA 2WQRA 1ZT7B 4WFFE 3HE6D 3ARVA 1CQYA 4MVBA 3FQXA 3ARDC 1QSVA 3ARFB 3MJ9A 1BBJA 5J13C 2A83B 4DAGH 2WAHA 2UVFA 4Y19B 3EYSH 4JM4L 3BH9A 1C16A 1WBZB 4PG2A 4X6DB 5C09B 3FCTA 3QIUC 2AW2A 3UTTE 2E7LC 2BC4A 4HQQH 4XTRD 3ZDYF 1AD0B 4YHIB 1X5LA 5KSVA 2NYYD 2FGWH 4NRZB 3IU4L 4X99B 4OBRA 5FGBC 2XRAH 4HBQA 3RNQA 4X80L 25C8H 1KTDB 3GIZL 3HG1D 4YHKL 3Q5TA 3F7PC 5ICZB 3GUTB 2OP4H 5LJYH 1HHGA 1IFHL 3HE7B 1FNLA 2OXHA 3STZB 4R4FH 1ZEAL 4DK6A 1DQDH 3OGCB 1OAXL 1J11A 4K7PX 4C83B 2DJ4A 4KXZH 4ONFH 1K2DA 5HYQA 5DURB 4LP5A 4R4BA 1G0YR 1GOGA 4PJXB 1ONQB 3G6JB 4OZFA 2X4QB 4DVBA 3HZKB 1NMBL 4MD0B 4NQUA 4Y4FD 3U0TA 1T21A 4U7SA 2VZUA 2C4FU 4I8DA 5F9OL 4RAUB 3K2UH 5I1KL 4L4TB 4HK0B 4JO2H 3S8WA 2DQGH 5CGMA 3QI9C 3MOBH 2MPAL 2R0KH 1V7ML 3C8KA 3CFJA 3MOAL 1HSAB 4HIIB 2E7LA 3OJMB 3NPSB 1C1EL 5ISZA 3L3IB 3BVNB 4FFVD 5KVEH 2GY5A 4LVHC 5FGBA 5DT1L 4OCYL 5ILTL 4LSUH 4ZNCD 4MSWB 1EFQA 3A6BH 4ZXBB 3MLUL 1H3VA 3U46B 4P3WA 3O2WH 2YD9A 5KSBF 1CDGA 3TA3A 4ZFOL 1OP3H 4KZDH 4PRID 1L7TH 1RIUH 2H2PC 3VGGA 4LP4A 4PJEF 2AV1A 4Y4KC 3KPRD 4HS8H 3NH7H 1OQXA 1J1PL 3QT2A 1R0AL 4K94L 4J8RB 3WO4B 3GBML 3S34H 1G6RL 3K1KC 3TZVB 4BH7B 5EZOL 3RZCB 2H1PL 3MLWH 3F12A 3SJVA 4KUCF 3GO1L 3B4NA 4AJ0A 4G7YH 1CD1B 4P2QE 3VXQA 4U1KA 2F54E 3T4YA 3ZYOA 5KANI 1XGYL 5DD0L 5JXAH 1LP9E 3KYOB 5C8JB 5JHLH 4OGAC 1RZIB 2ZKHL 1FBIL 4NZUL 3FONB 2FO1A 1PZUB 4JFHE 1B0RB 1FZMB 2FRGP 1MI5E 3TVMA 1F45A 4NRYB 2WSKA 5IOPB 5AAWA 4YXHH 4OLWH 4R9HA 1CFSB 2O5ZH 3I50H 4N8VA 2N4IA 1RV6X 4BFGA 4OFKA 1UWGL 3GIVB 2AJYH 3DVIA 4XHJC 4NGHH 3OXRA 4QXGH 1QRNB 3IB4A 3LQZA 3VXRB 3HCVB 5C0FA 5I8KL 4QRRB 1NGQL 1NGXB 2HJLB 2X4RA 1TQBC 1DUZA 4XCYA 2R0WL 3C2AL 1IL1A 4UOW0 4Y4KA 3IDJA 1U8IA 5GZOD 3IS1X 2F58H 4MXWL 1IEBA 2Q6WA 2IJ0C 2QSQA 3EGSA 5GQBA 1MLCA 2CKBB 1C16B 5EOCJ 3MREB 1KCUH 4Y5VA 2AK1L 4MHHI 3EFDL 2Y7QA 1DBMH 2UYLB 2H32H 4FXLA 2BC4B 2R4RL 4XVUD 5C6TL 3ZTJG 1KBGH 4B7IA 1MJ7H 4LSRH 3KXFE 5LXGL 1OT2A 3RNQB 4PBVC 1KFAH 3E8UH 5J89A 4E5XB 4KK8D 1ZGLM 1HHGB 5L8LB 3RWFA 3FB6B 4DKAA 5CZXC 1HIMH 4Z7VE 5JDSB 3L9RA 2P5EE 1F3RB 4WGWB 2I24N 3MCLH 4PJBA 4P23D 1UZ6F 2XZZA 4JVPA 2QKIA 5D7SH 1FORL 4KJWC 4R4BB 2VR4A 4CJ1A 1RIVL 3LHPH 4OZFB 4NM4H 1S9XA 1F3DJ 1VFBA 4R4NC 1T21B 1EERB 1QEWA 3B8YA 1D5ZA 4WNQA 2P5WB 3GSWA 4I0PC 4HG4J 3UC0H 3J8F7 1MFEL 4KK9C 3CCHA 4EN3D 2XIDA 4AG4H 3CSPA 3S97C 1ZLWK 1YNLL 4HJ0C 5DS8A 2R8SL 3UMTA 3K80A 4PJ5D 1UM4H 3MRBA 1HXMA 3EDEA 3MLXH 4BSVA 1BLNB 2Y07L 2Y36H 1MRCH 1TQCC 4OZIB 5GHWH 4KY1L 4DK3A 4Z18A 1F6LL 3U48A 4JQXA 1KLUA 4Z95L 3SGEI 3O2DL 3ABZA 2HG5A 4LLQA 1R5VA 1IAOB 2EH7H 1RHHA 4YPGA 5C2UB 3TA3B 4G9DB 1RZJH 1CK0L 1LQVA 3WKNA 4EUPG 1DDHA 1ED3A 2NXYC 2AV1B 4R0LC 1IBGL 2Y23A 5EBWA 3MODL 3FAXA 5KN5B 3QIWC 1CICA 4NOBA 2JF1A 4LSSL 4WUKL 3MV7E 4LF3B 1M4KA 2ZJSH 4WHYH 3C87A 3T0DA 2Z93B 4GXUN 1MIEL 3SJVB 2H2SD 2FBOJ 4M3KB 4U1KB 2V7HA 5DD1H 3HI6H 3ZKNC 1SMAA 1IZKA 1NKOA 3FO9B 5CKGA 5JOPE 2PO6C 5EUOF 1CGSH 4V1DD 5IQ7H 4JRWA 3QPQD 4D0CA 3U0PA 4YEFA 4UV7H 3GM0A 4JO4H 4P59H 5IVOA 5FECA 1G9NH 3S5LB 4N8VB 4Z78A 3LKOB 1FFQA 3WN5A 3FB5B 5F7DB 5J56B 3OXRB 1S7TB 4LCIL 1JMZA 3B9DA