3NFNA

Recognition of peptide-mhc by a v-delta/v-beta tcr
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of human CD8 alpha alpha binding to peptide-HLA-A*2402
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nfnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3nfnA01
4LVEA 4YC2C 3T3PF 1JYVA 3KYMB 5FFLA 4HH9A 1U91B 1KUMA 1U58B 4Z78B 4XVSL 3V0AC 4CGTA 2VISB 5FV1L 3EOAA 1MCBA 3L3GB 1V7NL 3G6JE 1OHQA 4M48L 3DV4A 4U05A 4YQXH 1Y18A 1AGBA 4JQXC 5DHVB 4ZMAT 1DP0A 4GRMB 4FNLH 5CKAA 3IT8D 3DX9A 1WGOA 1IEBB 2HT4C 3RL1B 5IT2H 3SGKC 3Q3GB 1FNGA 3PDDA 3U7WH 4WJ5B 1QLFA 2VDPL 3QA3B 4NSKB 4OCNC 3WNKA 3QUKA 5EC2B 3MYZA 1IAKB 4WWKA 4I3GA 3AREA 3QNXA 1CDGA 4LOUD 3MRHB 1U8HB 3TCXA 3WNPA 1U92B 1EEUA 3E2HC 3JZ7A 4XVSH 1UEMA 4GMTL 2EECA 4M9OA 4OKVB 2NW2B 3VXPB 4DCQB 3EDKA 1KJ2L 4PPTA 1HNGA 3MYJB 3UZEA 2NY4C 5E5UB 3B2UC 5LQBL 3L95B 5I73B 2OI9A 5L2KA 1RZJH 3L5HA 4PTUA 3MJ8A 1N5YH 1VENA 3QPXH 2A6KB 4KRNA 4P3DB 1NCTA 2BVQA 4LHUB 2ICES 2P48B 2E8YA 4CADA 4EZMA 3O3BA 4FQJH 5BVPH 2KKQA 1U8QA 3N1MC 1Q72H 3NN8B 5IG7B 4Z95L 1OLLA 2OI9C 2BX5A 3S9DB 4ZFFB 5DJCA 1Q9KA 4O4YL 3HZMA 1NAMA 4PTUB 2EIEA 5ITBH 1CDJA 1HHIA 3L95A 3S34L 2PR4L 1V05A 4L4JA 1OQOA 2IQ9L 3MYJA 1GIGH 4Z0XA 1MAMH 5D7KE 4XNMA 1EGJL 4IJ3C 4PP1C 4U1GC 1P4IH 1EHLL 4NDMB 3OPZH 3SDCB 4U1KA 1TTGA 2Q76B 3PGCB 3V2AR 1A4JB 1OW0C 2PO6D 2NY2B 4Z18A 1G9MC 1AGCA 1FH5L 4F3FA 3EYOA 3MV8B 3D85B 4OZHB 4GLRI 1JBJA 1RJCA 2FSEA 4S11A 4FQXB 1R0AH 2VYRE 2B2XL 3X3FH 1A64A 1KNOB 1GGTA 2VABB 3N06B 2DMKA 5KVGL 4X5WB 3X3GH 5I1IL 1ZLSL 1VESA 3F62A 3EIFA 4WVRA 4JFYA 3FQXA 3P0YL 3C6SB 3F7PC 1X5KA 3O2DH 3SPVA 3RWJB 1FYTA 2DYPD 1T03H 3NIGF 4DGVH 5I8CA 3KDMA 1JHTB 5F7KC 4EN3D 3V4UL 3B9KC 4OGYH 4OZGF 4LDOB 2NY0B 5J12B 1WBZB 2AGJL 3IDUA 1RUPH 5DD3L 1TITA 4I13B 4UUJA 1MCDA 4FMKA 1OGTA 5FB8A 4CNIB 3WIFA 2BHUA 3HG1B 5E2JA 1TZIA 2DQJH 2ICWA 4LF3A 1T21B 5E70A 4Z7VE 4MS8C 4U6TA 1YEHH 4NBXB 3V52H 1WEJL 3H7LA 3OR7B 3PWPE 3CPLA 4ZG1A 1NDGB 3KLDA 5E2UL 5FGCB 1KEGL 4QOKB 3PXJA 4J23A 4OCRL 5BVJA 2F8OA 5SWSA 2VDML 1UKTA 1MCOH 3TVMC 1JI1A 3WD5H 3I2CH 3RVXC 2VTFA 1T7XA 3GHEL 2Z8WC 1FE8H 1JGDB 2RR3A 1GAFL 3MROA 3WIHH 3MJGX 1AD9A 4BFEA 2V7NA 3B3IB 3KAAA 1WZ1L 5C0NC 3STZB 1QFHA 1MELA 1J1OH 4IRSA 4KI5E 2IFGA 2FRGP 3LKQB 3HCVA 1MCIA 3O6LL 2X4PB 4NN5B 5HVHB 3PGFL 3TA3B 3BGAA 4HF5H 4P2OC 4GKSA 1NCDH 4FFZH 2Z8RA 1J0YA 2BK8A 1CR9L 4WFGE 1JRHL 5KSAB 1TNNA 5JDSB 4JJHA 4BZYA 1WWBX 1UADC 1M71A 5B4MC 3PWPB 1RK1A 1G9EA 1XCQA 5C6TL 3FCTB 2OSLA 4OCWH 5D7JB 4C59B 5I0DA 4BM7A 4OF8A 4RIRA 4HUVA 3F8UB 4DGYL 1UA6H 3J7HA 5DK0A 1J1OL 4WI5A 1X5HA 3JTCA 4JO4H 5T5NF 1NGPL 3PQYE 1EZVY 3MNVA 4RWHA 1ZOXA 4OFDA 3QEHA 4KJPD 1JPTL 4PREA 5C09A 4KKCC 3K0WA 1CVRA 4QTHB 3UTQA 4OZ4A 4RMWA 3DXAD 4Y2OA 1W72A 4I3SL 3HAEH 4G42A 4U1NA 2WANA 3VFRB 4ZUUA 4B7LA 2P42B 1MHPH 5LWYH 2G9HB 1QYGL 4JG0H 2Y07H 3TT1H 5CGMA 1JWMA 2GUOA 5E8EB 5IB1B 1U6AL 4GUPB 1JNHA 2VRAA 4KKNA 1GH7A 4RZCB 1CCZA 2PKDA 1T1YB 4PJDE 4ERSH 2W9EH 4PD4K 1KTRL 3HLAB 1LO3H 4MVBD 2WINB 1SY6A 4KROC 1NANH 2VXVL 4KI1A 4M7JH 1I1AD 4FFVC 3CIQA 3GSRA 3BP6A 1CFNB 1ZLVH 4O9HH 2LABA 1V3MA 1MRCL 4F33A 5I1JL 4MA3B 4JY6B 2R2BA 4JQVA 4LAQH 3RWEA 2WUBL 5IKCB 1QFWL 1MHHB 2GEEA 4ZD3H 3O81A 3JUZA 3SO3B 4AQOA 1KC5H 1B6UA 5JXAL 3VJ6A 4ORGB 2AEQL 2FZ3A 3OXRB 1F2QA 4GO6B 3VFOB 1CLYH 4G6JH 5DMIH 2MFNA 3AMLA 5F7FA 1I7UA 4HHAA 1MHEB 3OGOE 3TBSA 3VFGH 3HFMH 1VACA 5MEPA 1IGYA 1KCUL 1XIWA 1EV2E 2QQNH 4NKMB 2R1XA 3NCCB 3MXVH 1MEXH 1JGUL 2H32B 2VITA 3MODH 1U8OB 2AK4D 4Y19E 5HD8D 2APWA 1A21A 1X4ZA 4NJ9L 4XMPH 3CD4A 3OSKA 4N5UA 3G6AA 2W1NA 2YR3A 5E00A 5C70A 2V17H 3FFCA 3WXWL 1ZLWK 2ESVE 3U6RA 2FHFA 3OPZL 2DKMA 4EUPA 1NGXB 2Y1VA 2G60L 5KN5B 4KRPD 4OZHF 3VRIA 3FL7A 1CXFA 1RIVH 5B3JF 3D25B 3QDJA 1NGYA 4KK5D 2BVOA 4NHUA 5KVGH 1TENA 5DJZB 3QWOB 4H20H 3QPQD 5I66B 2D0HA 1IQWH 5TE6H 3UJIL 2XXCB 3MPCA 1G9NH 1XF5B 5HJ3B 1RQ5A 1AXSB 3MO1A 5F3HA 1T20A 5IW1A 1MLCA 1W0WA 4M62H 4A6YB 4XCYA 4Z7VA 1UXWB 4JANA 3IJHB 1W72L 3VE0A 1CN4A 5D7IB 3F7VB 5IMLA 2BNRA 1XGUB 4Y5YC 1G9NC 3F7QA 4GRWE 4LSUL 5F21B 4HFUH 3O3EA 2CKBA 5JQHC 5EZOL 1NDGA 4L8CA 3R1GL 1ZANH 1S7RB 4ZPVB 3ARGA 3VRJA 3OG6B 2J6EA 4HAGA 4DGVL 5I8OH 1ZHNA 4N0FB 4P2OA 3LSOB 4OD1L 2FO4B 5I8KH 3FQUB 4MJIA 3BDXA 1ONQB 3S3SA 2JJTA 3T8XA 2XG4A 4W4OA 4GH7B 5C86A 4OLZH 1CWVA 1FGVH 4BSVB 4KU1A 2GCYA 4N0FA 3NGBC 5EZIH 4XP1L 2JIXA 1Y6MR 3ZDZE 3ARGB 2P24A 3GMRA 2OQJB 3ARBC 4JFDE 4LRIC 3OV6A 2PCPB 3EJZD 1HCFX 3S88H 2EZ0C 5JR1H 1LD9B 3EKCA 1J87A 15C8H 1H0DA 2HJFB 3BVNA 4P9ML 4ONFL 4Q2ZA 1NGWB 5IEKB 3QIBA 3SKOB 3UC0L 1L0XA 1E6JH 5JOPE 4LCWA 4G8EA 5TQ2H 2GCYB 4BSVA 4XWGH 3RWHA 2GSGA 1Q9WA 4AIXA 2P43B 3CFDA 2HFGL 4G7VL 2J8UE 5J6HB 3MLZH 4YUEL 5D71H 1BECA 4HUMB 4DVBB 4KJWC 5F9OH 5FUZL 2NY0D 3A0OA 3HMXA 5L0QB 5ISZB 2DM3A 3AY4C 5DJ6B 4GLRH 4YFDB 3H0TB 3MRCB 1AR1C 1NEZB 1P5VA 1R24A 4ZPVA 4BZ1L 2PYEB 3KPRD 5I18L 2ZNWA 3LHPL 4HUUB 5DZNA 1P7HL 3SKNA 1F00I 1ZVYA 2P47B 4H1LH 3CLEH 3KPLA 1D5MB 3LS5L 1G7LB 1PKQB 2DKUA 1U3HD 4PB0H 2JCCA 3BGMA 5FYKU 1T66C 2HRLA 4R4FH 5D6DC 3GSQB 3ZDYE 4DN3H 3SDXB 4BQBA 3NZ8A 4YNYB 2ORBL 4X9HA 1H5BA 2OTUB 4LGPB 5TDPB 3HC0B 1RZKC 1UWGH 4KK9D 4PGEA 2FLBT 3FOMB 5BV7L 3JXAA 2KPNA 2NW3B 1FSKB 1MFEL 3ME0A 3AXLB 5E9DD 4ZFGH 1NGYB 2J5LC 4D0BA 3C5JA 3OKEA 3SE4A 5HY9B 5DTFA 1OARL 4L4VE 2CR3A 2VQ1A 4NT6A 5K59F 3ARVA 3WO3B 1C7TA 3VWKB 4Y16A 3UTSE 2EYTA 1QLFB 2F53E 1R6VA 3HA0A 3DUUB 5DDHB 1ITCA 4PGBB 4O58L 2AS5M 3DX9B 4ZTOL 5ESQA 1T4KA 3QUYA 4PRBB 4XNZB 4OLXL 3LCYA 4GAFB 1YEFH 4LLAA 3OKMB 5KVEH 1DBKL 2VQ1B 1A7QH 4XNUH 4V1DA 1KIPA 5B21A 3OJDB 3IKCA 4AEHL 3HI5L 2EDHA 5E8PB 3LQZA 3L3KA 3UYPA 5C8JA 3ARDB 1VKXB 3M1BA 1EHNA 3VFOA 2AV7B 4G8FB 5FYJD 2Q8BL 2R9HD 4ZOEA 5TDPA 4ZFOB 3VH8G 2A1WL 4JHAH 2AAVA 4OCXH 4YX2L 3BP5A 4MNHA 5GJTH 4HEME 1WBXB 3KLAA 1WIPA 2C7UA 4JY4A 4C56E 5FK9A 1I7ZB 5JQ6L 4ZUVB 2H2SC 3QDGE 2ESVA 4NFBA 3MNVB 1G7PB 5E8PA 4Z7UB 4M93B 2ADGB 3DARA 3DXAB 5T1LB 5MI0B 5F71A 2DWEA 5DJ2B 4JHZA 4Y4HB 1IM9D 1DJSA 3U0TB 5BMFH 5DD0H 2ADJA 5EIIB 4UAOC 4YHMH 4G8GD 1DLHA 4FFYL 3VA6A 5FGBA 3OJMB 4PGBA 2R1YB 4G7YH 3L5WB 4L29A 5BMFL 1PQZA 3DLQR 3O3AA 2NY1B 1I9JL 1WC7A 4H20L 2QADB 5F1OB 4L9DA 2ZJSH 1LDSA 1XR8B 1NAKH 3MRKB 2F74A 1DFBL 5IJVA 1G7QA 4XAKE 1QRND 3ZDXE 4C4KO 1SJHB 4BSWB 1CG9B 2VZVA 4N8PA 1EDQA 3FO0L 2NXYD 1GL4B 3I2CL 2E3VA 3QDJE 4G8EB 3E2HA 2DRUA 3HCVB 4FRWA 4EBQL 1JFQL 3CXDL 1KJVB 4BJLA 3HC0A 3BI9X 3R8QA 2AEPL 5E8OB 5C0BE 1V3JA 2P44B 4PG9A 5CWSB 5EPMA 3U36B 4MMZC 1TJGH 4IDJL 5GRJH 3N85L 4ZXBB 5CS7A 1IARB 2VL4A 4XPFH 4Y19A 5HI3C 3U7YH 3IDNB 1YEEH 3O2WH 1RUKL 3IVKA 2XN9E 3B9KD 4Y1AE 5AZEH 3V6FB 5B39G 3SBWA 5HYEA 4IIQC 4WFGD 4LIQE 1AC0A 1FE8L 2QKIA 2EYRB 3JWDH 2X89D 3JTSA 1KEGH 3D39A 5HXMA 4DWHA 3PF2A 4L3EA 4OFYD 1HSAA 4RNRA 5JHDA 5I1KH 5GS2H 4U7MA 3RI5K 2E9WA 3RTQA 2YPVH 1UZ8A 4JFZH 5EU7E 4WHYH 5TF0A 3MMEB 1K3IA 4GXUM 5T5FH 3BEVB 1YEEL 1SJXA 2ORBH 4YHOH 2YBRA 4OLUL 3ARED 3F7VA 5EOQH 3FB8A 4WUKL 2Z92A 4RGNB 3FO2B 4UT6L 3GMLA 3NCJH 3BEVA 4NO0A 2WBJA 1KNOA 4OLYH 5HJ3A 1WWWX 4O5LL 2GTWB 1FRGH 3D85A 3P11H 2VL5A 5ECJE 5JHLL 3HAEG 1H3PH 3OKOB 4L8BA 5E9DE 1CGTA 4NZTH 3NA4A 3TJHD 5AG9A 4NHUB 3DHJA 4PLJD 1J5OH 1P1ZB 4KZDH 3VI3F 2NY5L 2OJZH 5JUEL 5HGHA 4LSSL 5E5MA 1F3RB 3BDBA 3AS3A 3BPLC 3VXNB 2RCSH 3LDBC 3GJFA 4B50A 4PY8J 2M2DA 3G6AB 4XBEL 4X7DC 2PO6B 2F58L 5DJDB 5I8CB 3I75B 1EPFA 4L9LA 1KPVB 4ZPTB 1QSEA 2VLRD 1C5CH 1GGCL 2EE6A 5FDYA 1T1XB 5I19H 2DBLL 4RQQB 1T80A 1ZHBB 4HIHB 5FECB 1T0MA 1H3PL 1SM3H 5GGTA 3KPRE 5H8DA 4F57L 3HC3L 3L3DA 1MJUH 4HHAB 1OWWA 3HMWL 3W0WD 1U8IB 5TF1L 5FO9A 4HV8B 3QI9B 4XAWH 5L2KB 5F3HB 3VFWA 2VOTA 4XBPA 1I9IH 2VAAB 2C1OB 3TN0A 1BMGA 3CFKB 1JPST 4NQCB 3NH7H 4JVWA 4NDMA 3B6SA 3K1DA 3CX5K 4YWGH 1AKJD 5KSBA 4R0LA 1J05A 1I3RA 1M6OB 1S7TB 4LQFH 2Z0BA 1LP9F 1B0WA 3BW9B 5D4QA 1VEPA 4DZBA 3VRIB 4OLXH 2FYYB 3UP1A 4EUPB 3SDAA 3GJFK 1BM3H 3ARYA 1HK6A 3P4OA 2GK2A 5IMOA 2BJML 2QQKH 3HE7B 3U2SA 4LSDA 3ARPA 2QHRH 5I1EL 3TYGL 1OSPH 4D9QD 4YAQA 4PRIA 4KROB 1RZFL 4TSAL 1NH6A 2BNUA 2H3NB 5DEGB 2APFA 1FBIL 5T3XE 1QRNE 4GKNA 2PNDA 5DURD 2FX8L 2WSKA 2EKSB 4V3DB 3STBA 4G42B 4U1NB 4JN1L 4ZFOA 1QBML 5HHOE 3S3PA 2R4RH 4R4BB 1Z3GL 4GG6B 4R4BA 5FF6B 3NPZB 5I1LB 3HC4H 4N0CD 3FN3A 4PJ5A 3REWA 4X9IA 4L3AA 3LZFL 2R0LL 3WFHB 1EXUA 2X40A 2DLFH 4PRIB 2WIMA 3MACH 1I7TB 2AVGA 2B5IC 3HRZB 3HR5A 3SDXE 1K6QH 2XN9D 2WMPA 3O8XB 2EE3A 4Y1AD 3C6LA 1FFPB 3FCTA 5B38G 5D7SH 5I1AB 1X5XA 3RZCB 5I1CL 1R5IA 1EAJA 3GO1H 2HJKB 2KH2B 2WBKA 2FHBA 2EDLA 2HH0H 3EYSH 4HIIB 2VLKA 4KTEL 5L8KB 2PTTB 1J05B 2CJUH 2XA8H 3OKKA 4TN9A 1QOKA 2X2YA 1LE9A 2Z93B 2BHZA 4LASH 1EVTC 1OGAD 2MPAL 3GBNH 3U30C 2E6PA 4P5TC 5IHUL 1A9EA 1KB5H 5CBAB 5TFSH 2ENYA 4QXGL 3QFJB 3M17A 1FL3B 3EOYG 5EUOE 1CDYA 4NQSA 3QDJD 5DQDL 1ZHBA 2R4SH 2XWJA 4NGHL 3VFNB 4UZGA 3GSUA 1L9MA 4RAVB 5FM5O 4NKOB 2DM2A 4KUCF 5DRXB 2HFFA 4MA8L 4PJCB 3IDYC 3G5ZB 4K9EC 4FQQB 5J4MA 1OGAB 4JFFE 2V5MA 2Q8AL 4QCIB 4TNVF 1Q38A 4PJ8C 3P4MB 2CLVA 1BBDL 2EDWA 2E7LA 1MFDH 1XF3A 2E7LC 4PB0L 1FIGH 1QBLH 1DBAH 1VHPA 3U4EB 4ZS6D 1WWAX 1DQQB 1JVKA 3L5IA 5GZOD 5CSZA 3BPCA 4XBGB 1PFCA 4PJXA 5HPMA 3GMMA 1MCHA 3OMZA 1ZEAL 2X4TB 5E8NB 4XVUD 4UDTA 3P9MA 4N5ED 4RAUB 4GAGH 4PJHF 4MJ6B 3TPUA 3VWJC 3BAEL 3HTLX 5C2BL 4DGYH 3TEUA 1IAII 2ATPB 3OJ2C 3UDWA 4NZTL 2YUXA 4ZS6C 5D9SB 3RDTD 2XI9A 3MNZB 2BCKB 1XF5A 1N5AA 3L3HA 5L7XL 4DN3L 3RA7H 4Y4FB 3UC0H 1SQ2N 5CBEB 3FB5A 3AUVA 4FQ2L 4WGVB 1YEGL 4LLUA 4RGMC 4MB3A 2BVOB 1HINH 5JDJA 1M4KA 3HI6L 2EDXA 4FQ1H 3QCVL 3LSOA 5GGTL 4LBEA 4U6HB 1AR1D 5D71L 5EG6C 5HI5C 2K1MA 2ZUWA 2VZSA 5JA9A 1OAKH 2CKBB 4M02A 1WBZA 3JV0A 1OVZA 3MJ9A 3FO1A 2PW1A 4W4NA 4LLYA 2GJ6E 2C5DC 3C2SA 2H32A 2F54D 5C07B 2QSVA 5K9JH 3ARSA 3P0VH 2M26A 5DJAB 4RFNC 1G0DA 3L5XL 1AI1L 4WI7A 5I1EH 1T20B 3ZKXC 1G7MA 2P5WB 2R0LH 2F8VA 5BO1L 5ID0A 3QDGD 5DUBB 2FD6H 3HUJE 2J7LA 4YLQT 5CGTA 5CZKA 4J6RH 2BOBA 1AGCB 3QHZL 5EOTB 1NC4A 1RVFL 4JZJB 4LCIH 3U48A 3S8WA 1A7RL 1E4XL 3ETBF 4R6UA 2NR6C 4GBXD 5CD5C 2B1HH 3DOSA 3WS3A 3AROA 2W60A 4ODUB 1FC1A 1W72H 1AQDB 5ID1B 1FHGA 3WHXA 1PW3A 4GW1A 5E00B 1BOGB 4ZDHA 4U0RB 2BRRH 2BNQD 3WDIA 5HHPB 5JW5B 1BQHG 4LARH 1HNFA 1KJ3L 4X6BA 5GS0C 4G6FD 5I73C 1QD0A 1C5BL 1CFVH 1I8IA 3G6JF 5HVGB 4Z7UA 3V7AE 5C07A 4XNZC 1LO2L 1R3LB 3VG9C 1UJ3B 3MRFA 4JFFA 1WBXA 4LSRH 1D5ZA 2AEIT 5HTSA 5I76B 2IPKB 3SE8L 5HYQB 4TUJA 2CRZA 1EO8H 3KPTA 3IJYB 3D69A 1C12A 5D93C 2CH8A 5T1DL 2G75A 5CJOH 1DQML 2DLIA 2NW2A 1S8DA 3EYQC 4Y7MA 3UTOA 4AK1A 3MNWA 1OAYL 1OSZB 3EYSL 4D94A 3OJDA 1U2CA 3C60D 2IG2H 5HYJA 1FZMA 2V9RA 1MCFA 4F9LC 3GSRB 1CFQB 1FNGB 3D2UD 4K8RD 2QADD 4O00A 3VU2A 1BQLH 3PWVA 1EO5A 2DQFB 5I8EB 4Y5VC 2GFBA 3IDIA 2VXQL 4PJFB 1VFBB 4NO2B 4MJ6A 1JGEA 2YWZA 1V5JA 1I9JH 2UYLB 3I3DA 3QDHA 3MV9A 1C08B 3HUJA 1D9KB 5T1DH 4CDGC 4GMSL 2DIBA 3KYOA 4JFHD 4OZ4B 3T08A 3WKMH 3ZTNL 1B0RB 4PGEB 5SWQA 1OCWL 5F7WC 4YPGA 2AKRA 4MVBC 4EXPX 1BFTA 3TN0C 4ONFH 4CMMA 3O45B 4EN3B 3G5VA 3S4SG 1MUJB 2UY7A 4JZOB 5CIPB 3IDMA 2UZIL 5D2NE 1NBQA 4YHIA 1KFAL 4I18B 4FQXC 2VDKL 4HX1B 2GJ6B 3SE9L 2C4XA 2WBJC 4FFWC 1P5UA 3ULUC 1PSKH 5KS9E 5CINL 3V8CA 3MRNB 4JJ5A 5F9WC 3U7AA 3WUWB 1CICC 5E6IC 4QOKA 4NC2B 3LKPB 1C1EL 3CPLB 3EYFA 4P57B 3UXFA 5IROC 5HHOA 4WI2A 3GK8H 4Y4FD 3VXSE 1IL1A 3KPNB 4KVNH 4YXHL 2EDNA 5MENA 2ADIA 4QHUB 1E27B 2B1AH 3HB3C 1EBPA 3RTQC 1UWXH 3VWKD 4WTZG 1OGTB 2X4SB 5A2KH 4IRSB 4XVTL 4IRJD 4BK4A 4DZ8B 4ODBD 1EERB 1FG9C 1UWEH 4EXKA 4IOIA 3FB6A 5HGAA 1JF1B 3HC3H 1FJ1A 3L5XH 3QEUA 1RURH 1X6LA 1YJDH 1KACB 2DQTL 1JMXA 4UQ3B 2FATH 3CFCL 2A9ML 3MCG1 4JY5L 4YEEA 5ACMA 3TBTB 3WFDH 1TQBC 3MLPA 5E7FA 5AYQA 5H35B 1NGPH 2IAMD 3GSNB 1QR1B 5BVJB 3W2DL 4KZDL 1MPAL 4E5XA 1R5IB 2P24B 2I24N 5B8CB 2CKBL 2RCSL 3BUTA 4V2CB 4JJ5B 1RY7B 3QRGH 3BMWA 5BXFA 12E8L 4NQDA 1CICA 5E6IA 3P11L 1QHOA 2ICWB 4PRIE 4YHIB 1X5YA 5AZ2H 4R4NC 4XPTH 5F6IB 1J1XH 1FO0B 2C1PB 2UWEE 5FM5M 5TH2A 4AH2A 3OAZH 1A6TA 2D31A 1GOGA 3C2AH 1OT1A 5DK2A 5IJKA 3VXTA 4KKAD 1IILE 2YEZA 4JGMA 4Z0XB 1S3KH 4KQ3L 3SN6N 1Y0LA 3VXUE 1S7XA 1ADQH 4U1LA 3W11C 5K9KB 2YD1A 3CSGA 5I75B 4XMPL 4XWOC 4HSQA 2CDEA 4JN1H 1A8JH 2IH3A 4FQJL 3KXFE 5BVPL 2PO6C 2BY3A 3MXVL 3CVHB 2BNUB 5E08L 1FGNH 1HI6B 2VUYA 4LU5L 3B5TA 2X4QA 2CLRA 4J8RB 2LE9A 4JN2B 4M4PA 1MWAA 1YEFL 5E9DA 2AJSL 2LTQC 5F9JA 4CJ0A 1F4AA 3TM6A 4WV1B 5E4IA 3K74B 1D5XB 1EA9C 2Q87A 2H6PB 4X6CE 4F37K 5DJZA 3DI2B 2ED8A 2XTJD 1L7IL 4ONGH 4HS3A 4UB0L 1IAIL 4FHBD 4WW2A 1BVKA 3HNVH 2ZSWA 3O41A 1MF2H 5I1IH 5HHMD 2EZ0D 3T1WA 5GRZA 5E2VH 3U6RB 3LRSA 1UXSA 1TETL 3FFCB 3NZHH 3OB0K 3QEGH 4GFTB 3VFWB 5I76A 4H88L 4QRPB 5CJXC 5CZVL 3VXQB 4HWBH 3RPIB 4JKPL 2PXYA 4PY8I 4M8QA 1AIFA 1OTTC 3QDAA 1U8QB 3G04B 2D7QA 1D5IL 2AP2A 3MFFB 4K3DH 2R1XB 1U3HC 3GO1L 2XKSA 4NPYA 2ICEA 1KIRA 3L3JB 3B9VA 3G6JB 3L5JA 3UPRB 1FPTL 5K9KA 2Y72A 5GRWA 5KVMC 3REVA 2YD9A 4N0CC 2COQA 3PP3K 1M05B 2HP4A 3PHSA 1D6VL 1UXSB 3BZEA 3MUJA 2LU7A 4ORGA 1CZ8L 3IS0X 3VJ6B 4W6WB 4R90H 4XC3H 1P53A 4XT1C 4LNVA 2OR7A 4X6FA 4IDJH 1MHHA 2X4OA 4U1SB 1DQMH 5JORA 3MA9H 4G3YL 4YHOL 4R90L 4PJIA 4NWUL 4L8BB 1A7PH 3RL1A 3BP6B 2XKUA 3RWDB 4MX7B 5DD5H 2B5IB 4WCYL 3LKRB 4LIQH 4WNQB 4OLYL 3UZVB 1OY3B 1BQHB 1DN0B 4OLVL 5I15H 5EU3A 1QA9A 1UZ6F 2Z92B 4J8RA 3WBDA 1GC1C 1EBAA 3CNKA 1XH3B 1FQ9C 4HDIB 1MIML 2GK0A 5CJ8A 1I8KB 4X7SL 3EHBC 3T4YB 1FZJB 3INUL 1QO3A 4FQIL 1MOEA 3VW3L 1NLBH 1BWMA 4Q9RL 5EZIL 5SX4I 4WHYG 5IHZB 5IM7A 1TVHA 2Y36L 4KK6D 1FAKT 4KZEH 5D7KD 5E94A 5EZJA 3KGRA 3DO7B 1A6TB 2I26N 1NMCB 4NM4H 1I85C 1NKRA 2XRAL 2JELL 4WHTB 1C1EH 5CBEA 1MRDL 3QUMB 4KQ4H 5DA4A 3VXSA 3T0EB 4OUOA 2SEBB 1II4E 2GITB 3IXAA 5HDQH 3RFZC 3O4LA 1B6DA 2YXFA 2DQGL 3ULSA 4LEOB 3HUJF 3GSXB 2AABH 2GTZA 2B1AL 3FMGH 5E2WH 4CW1B 3S7GA 5D1QC 5ESVA 1XGRB 3QBTB 4CN1A 3IDJA 3M07A 1KJMA 3KPSE 4FTVB 3V6BR 5D2NA 5I2IB 4V1DE 4ZUSB 2WY3A 2IADB 1UVQA 4PJXB 1I4FB 1T1WA 4PBVC 4ZYKA 1N6QL 2BVTA 5IW3A 5E0QA 5C08D 2W9EL 2OJZL 3EO1A 5GSVB 1EZVX 2VQTA 1LEIB 5ESVB 2Q20A 1K3ZA 4FQ2H 4JPKH 2DQTH 3U4BH 3QQ9D 1RJLA 1KF9B 2HFEA 4YDKH 5E03A 3G5ZA 1WCBB 3PWVB 12E8H 2PUQT 3CH8A 2VLRE 5HI3D 1BD2E 4LHUG 1RU9L 1BREA 2V2TB 3RRQA 4BELD 5JOFB 4PLOB 5EU6E 3KVQA 3LY6A 2LV4A 1QBMH 2DWDB 2AJVH 4PJ5D 4CVZA 1TZGH 3BJLA 5DZOA 3GSWB 1RULH 1GGIL 5M7QA 3AGVA 3MRRB 1T2QH 1MCWM 1YEGH 1LEIA 4HZAA 4IRZH 2FECL 5IOPA 3T3ME 1A14L 2Y06H 1EJ6A 1RD6A 2GJZB 3P73B 4PJEF 4JHAL 3IAQA 3QIWB 2HLFD 3VD9A 5GPRA 4YC2B 4XH2A 3QH3B 1MIEL 3MUZ1 3KXFD 1I3UA 1U8MB 3HI5H 5D1ZD 4G6AC 4Y4KA 2N7BA 5FV2A 3RWDA 3NA9H 1JYNA 1N0XL 4QEGA 4FXGB 3EYOB 3MV8A 3MJ7B 1AKJA 1UB5B 2C4FU 1T7VA 4J7RA 4LRNH 1IMHC 3BXNB 4UT7H 1CLYL 3VXMA 2XV6B 4RFNB 4CJ1A 1LEKA 1A6VL 3LN4A 1R3KA 3OKNB 5IBLD 1FFRA 1XF2A 2UVFA 1U93B 4PJDB 3BD4A 5HY9A 3TLRA 5GS0L 1H3UA 2D4DA 1OSZA 1CXHA 5E6YA 4S1QH 2YPKA 4ISVA 3FAXA 5I15L 2J5LB 5F7DA 5EU4B 3PABB 2QTEA 4KJPC 4JM2A 3RIFF 5IR1B 4N8CH 2XZAL 4NNYB 1R0AL 3K46A 2JF1A 1JWUB 4MNGE 4GXUN 5B3NA 1NGQL 5HGGS 2X9XA 3VGHA 4OZIB 4X6EB 4PIRF 4NWUH 4DTGL 1MCSA 4M7LH 2I5YL 2QV2A 3DNKA 2VKXA 2Z9TA 3SKJL 2VXQH 5M94B 3ZL4H 2FJFA 4NRZB 3SKNB 5MP6H 4G43A 2OI9B 4F7PB 5IR1A 4WO4A 3T0ED 2IALA 2XYCA 3F7RA 1E28A 3RDTB 3QQ9C 5BRZE 5C71A 4Y4HC 2VC2H 3WFZA 3GBNL 3OR6B 3LN5A 4KV5F 1Q9LB 1I3RB 1S7TA 1UACL 2W60B 4OBRA 1BBJB 5EOCH 3QXAB 2NY1C 1NCDL 3GSNL 1U93A 2XA8L 4PJDA 3H9SD 4JFDA 3SGKA 1H5BC 3RY6A 3QA3A 4DKFL 1LQVA 4LCWB 3QI9A 3KS0H 1QRNB 4J4PD 4J4PA 5CSBA 4WUUE 3DYOA 1Z2KA 4OJFH 3FHQA 5DUBA 5C6TH 2DYPB 4XNQA 4M7ZB 4PUBH 2YPVL 1RZJC 3OX8A 1KTDA 4HPYH 1T0MB 5C3TA 4MQTB 2QQLH 4ZPTA 2ENSA 4Z0BL 4P23D 4F37F 2JIXB 3QQNA 2GJZA 4S2SB 2W0PA 4H0IA 4IS6B 2H26A 2VDLH 2P5EB 4Z77B 5IFJA 1AQKL 5EFIB 4MA8H 4PJ9C 2HKFH 4HWZA 4KPHH 1FO0A 1BGXL 2KUTA 1E6OL 4EJ1C 4M1GL 3T8XB 3CVHL 3PE9A 1A02N 4X5XB 3IU3A 4QRPE 3EJJX 2EEBA 4J12A 1JV5B 4WFHE 4ZAKD 1Z9SA 3LKOA 5DFVC 1NLDL 3QPQC 3UAJD 1FNLA 2LQRA 1ZXQA 2ITCA 3ARFD 1X5JA 3ILQC 4NZDA 4ETYA 1QBLL 4E5XB 2OZ4A 4X6CB 4N8VB 3STLB 3GSVA 2WBJB 5EU7C 1IFHL 4UMGA 1XFPA 3OKDB 5FGCE 3QUZB 3WNMA 5KBNC 1U6AH 2H41A 3TBTA 3FB8B 3VMPA 4EQ2A 3VXSD 5J13B 4X7EC 3T2NL 4PJ7E 1WCQA 3UO1L 4YFLI 1RZ7L 5DFVD 1EHAA 4YGAB 3RKDD 4ZUWB 3ULVL 4F15C 1D6EB 2VLJB 1NMAL 1W8NA 4XMKL 4AENA 4PRHD 4V1DD 1NBYA 1WFTA 4PJIF 5D7JD 2D31B 4ZNEE 4WU7B 4JFOA 3LKNA 5DF0A 2QQNL 2GKIA 1RHFA 5C08E 2YS4A 4XPTL 3RVTC 5IB5A 4XTRD 3BZ4A 3LKPA 1LO0L 4HIXL 1J88A 1WSST 5EBLA 5DJ0A 2J12B 5EBLB 1N0LA 2E5EA 2WIIB 4EVNB 3LDBB 1E4WH 5C09E 3WSQL 1HIMH 1MJJA 3RX5A 4HJJH 4J4PC 1K85A 5CJQL 5T3XH 1HHKB 1K5NB 5I1GL 4YHLL 1KIUA 3WS6A 1MHEA 1SEQL 3G6DH 1U36A 1I7UB 1BFVL 4HS6A 5TPWL 2OJEA 5F1NB 5CCKH 3H3PH 4PS4H 1NCCL 1C7SA 2BSED 1YNTB 4JZNA 5F1IB 3DWTA 2XZQL 5JO5A 5J6GB 4Q7DA 1BVZA 2VNCA 3WXVL 3MRKA 3UZQA 4P5TA 4N1CA 3WLBA 4AMKL 4QHUA 3VXOA 3TFKA 1F45A 5C08B 4Q9CA 5B38B 3WEXA 5DYOB 4OZGB 3AVEA 3JBG7 3U2SB 1QLEL 1OP3H 2EXWC 5A2FA 3P4OB 4QOKD 1X5ZA 5GRUH 5FGRA 5J11C 4U6VH 4K7PL 4RGOL 3I84A 3VMNA 1S7QB 1T1YA 4MQSB 1ZT7A 4PLNC 4G6KL 4LCCA 4R2GD 3F5WA 4R0LB 3F58L 2P5EE 4ELMF 1YUHB 1OAZH 3UTPD 1JNHB 2Z31D 3C6LC 2BDNH 1C5BH 1CFVL 4XP9H 4QRRB 1TZHB 1P4LB 2UZIH 1YEDA 2ZUSA 3VXUB 1G7IB 3UJIH 1M05A 2YKLL 3HHRB 3MXWL 1OD9A 3F12B 3QUXD 1U8IA 1KTKE 1KLGA 3MGTA 3HNSL 4NQXB 4FQXD 3EJYD 3W0WE 3L3KB 1P6AB 3B4NA 5FECA 3MFFA 5LXGH 1S7SB 5GISL 3WE6A 1JE6A 1OAYH 3G04A 4MCYA 2YA0A 1LE5B 3QJHA 4NKIH 1YC7A 2XQYK 4H25A 4Y88A 5DJDA 4HBCL 4GMSH 4GRLA 5D7JA 3R0MA 5D72H 2RFXB 3SHSA 4OB5L 1JPSH 5CFHA 3PHQB 5SWSD 4JO3L 1Q0YL 1S7VA 4QYOA 3RIAK 5L88H 5HGHB 2W92A 3I6GB 3V7AG 4F80A 1BVKB 3O41B 4LOUC 2IANE 5DJYB 4DZBB 1M7IB 1YNKL 1JIBA 4OI7A 4JGJA 3S88L 1DEEA 3Q6GL 5F9OL 4HXAL 4APQD 4APQA 1WT5A 4WY7H 3NCJL 6FABH 1YZZA 1KPUA 1R3HB 1P7QA 1NGZB 4NKIL 5IFHL 4HC1A 1B4RA 2LAAA 2VE6B 3MLZL 4YUEH 3ZKMC 4MDJA 4JRYB 1Z6JT 1HI6A 3B2VL 4HZLA 3GMQB 4NYLB 3U4AA 1VFAA 1A6ZA 1NUNB 3CLFL 5GIRA 1KULA 1S7WB 1KIQA 3BKML 1MCWW 3I75A 1CGSH 2CIIA 4M6AA 1FG2A 4E9LA 4R4ND 1O7VA 4GSDH 1WWCA 3P4NA 2VWEC 3CX5J 4XP4H 3QJFB 4DW2L 5E5MB 1IFHH 4LLUB 1FVCB 3DUHA 4P9HL 3TGXA 1HHGA 3K4AA 4ZFGL 4YXHH 5EO9A 2NY2C 2N7AA 3CFDB 1F4WL 1DDHA 4V3EB 4NRYB 4Z8FL 4MNGB 5DMJB 4PJ8B 5C0JB 3V5KA 3HRPA 3LRGA 2H45A 3VWJA 1AP2B 3IFOB 3LKSB 3FB7B 1MFAL 4B41A 3NCBB 3P2TA 5I1GH 4OBSA 4AG4L 3DV6B 1DE4B 3QXWA 3F6IA 1KCGC 2QHLA 1X5IA 4KQ3H 3P9MB 3O6KH 2Y06L 5DJAA 4NRXA 4IRJA 2VZUA 3FO2A 4JRWA 2X7LB 4M43H 5FAAA 5HYSA 1RHHA 1FZOA 2GT9B 4JB9H 1LO4H 3RWFA 3FB7A 2KBGA 3C60C 4Q9BA 1RULL 3VWJB 5DLML 4DZ8A 4PJ8A 5BJTB 4ZOBA 3QCUL 1ERNA 5GS2D 4ZFZA 4Z95H 1NAML 1LNUB 4I48A 1A3LH 4M5ZH 5E8DL 4ZXBD 3SGDH 5KANG 4DVRL 2VSDA 4XMKH 2JIXD 1EHLH 1GZPA 3AMKA 1I7RA 5GRVL 1NMBH 4JFPA 5ICXA 1ZHNB 3NABH 4RGMB 4PJFF 4OQ1A 1I3VA 2WUCH 2V2TA 3E3QA 4RWYL 2ADJB 2BCKA 2YC1B 2A0LC 2HTLC 2PW2B 4DOHE 1IKFH 2ADGA 2N1KA 1XGUA 1G7PA 1AGFA 2BNRB 2GY5A 4KDTA 3O11B 2FX9L 1A6PA 1FDLL 1IEAB 2XQYG 4JFED 4PJXE 5HHXL 3RWCA 3O9WC 1BD2D 4ONHB 1MLCB 3DMMC 4XB8A 4U49A 3VG0L 1KELL 3CFBB 1RZGA 1KXVC 2YWYA 5IV2B 3BN9C 5D2LB 3ZKXB 4G80A 4BQ9A 3Q5YA 4OKVA 2AJYL 4XCNB 2A77H 3LQZB 3C08H 1EEQA 2EDDA 3BRFA 3P4MA 3M45A 1E4XH 5GS1C 5DRZB 4I77L 1TJGL 4N8CL 5IBUG 4JZJC 5SV4A 4CW1A 3L7EB 5GS0H 4NO3A 1K8DA 2NY7L 4WFED 2BNQE 3TF7A 4EBQH 1QBBA 2MKLC 2LFGA 5BS0D 5BS0A 1IC4H 8FABA 1WF5A 4RA3A 2JLLA 4NFCA 4QRTA 2BDNL 1QKZH 5C1MB 1Y18B 4CRPA 3JTTA 2F53A 4WW2F 3QEQD 3C09B 4Q9RH 1JHLL 2BMKA 3GKWL 5AWNL 4IOFC 1NAKL 2BY2A 2HMIC 4XPFL 4D0BB 1X3DA 3QAZC 2O93L 3RY6C 1V7ML 3CH1B 4WU5A 4J2XA 5E4EB 1DTUA 4P2RB 2VXTH 3RQ3A 3B2UD 1FN4B 4LPVA 2WM0A 3BO8B 3VGAC 2IH1B 4TQEH 4JDZA 1BQLL 4KHXH 1MCPH 5DD5L 4Y2DC 1PG7W 3M1BB 1DUYA 5CUSL 1OTUC 4KTDH 4XI5D 1TTUA 2NXYC 5J1TC 1HXMA 3RKPA 4NWTH 4MJID 2AW2A 2X4NA 3ARBD 3ZSSA 3BPOC 3F65A 4LIQL 1D5MA 1U8PB 4YGVA 2PYFB 5C2UB 5MEQB 4EIGB 5JW5A 3BE1L 1CFNA 4C56D 4Y4KC 3RZCA 1BQSA 4LFHD 3QFDB 5IUSA 1IC5H 1F97A 4JG1H 4Y5XB 3E3QE 4UAOB 4X7SH 2E9IA 1H15B 1WTLA 4N1HB 3ZT7A 2R2HA 4R4FL 5D96C 4XWOD 4P9MH 1CIUA 3OTTA 3BQUA 1GZQB 2XFXB 5KSVA 4HMEA 3EUUA 4KTDL 5KVDL 1DVFC 4OIBA 3O6KL 2BOBB 1EK3A 2DM4A 3KXFA 3LRHA 4TNWF 3RP1A 4PJEE 4C57C 2RIKA 3HPJA 2VLLB 4G9FB 3DBXA 5FUOL 5KVFL 4PBXA 2C3GA 1EAPA 1YEIH 4OGZA 4M6NL 5F7MC 2BHYA 5D2LF 3V6ZA 4RQQA 2Q8AH 2DD8H 1PD6A 3MCLL 2FHCA 4GAGL 2DN7A 1SJVA 2APBA 2D7NA 1J5OL 1MFAH 3L9RA 2EDYA 3QCUH 4QRRE 4KAQL 1K4CB 1QFPA 4KHTH 2A9MH 3I50L 4POZC 3QFJE 4E42B 1E6JL 2PO6A 4GXVH 2FEDC 3T4AA 4ELMA 5C0FA 1QFWM 1UWEL 4D9RE 2XIDA 5F9WB 2BXZA 1FNAA 2CQVA 3D0VB 3DX6A 2UWEF 5DWUL 1CGSL 4TOYH 4OF7A 1A1NA 3VGGA 1KG0A 4NJAH 5C7XL 1ACYL 1C5DA 2DBLH 1YMHA 2HFTA 5C0RL 4ZUWA 5IV2A 2HJLA 2C1OA 5BW7A 3C8DA 1N2RA 3RY5A 2IC2A 4M7JL 1BWWA 1H3WM 4J3WA 1YECL 4IRSC 4XAWL 1KCKA 3I9GL 3TO4D 2RBLA 4YQXL 3L3DB 2OL3A 4YHYB 2O5XH 4LEXH 3TPUB 2H32H 2C4FT 3MC0A 4XPGH 1PKQE 3C2AL 3PDOB 4HWNA 1JMZA 3LVEA 4NP4H 3E6FB 3QULB 4XBGA 2FD6L 3MMEA 2HJLB 1S3KL 4JO2L 1CLCA 2NMSA 4JRXB 2PR4H 1NC2A 2BSRB 3BISA 4RWYH 2DI8A 3A6BH 3CDGA 4PJHA 4FTVD 3G6DL 1GJIA 3TO4C 3D25A 3QDJB 1EJOH 1T21A 2C1PA 3GIVB 4M5YL 1P1ZA 1HHGB 4HK3N 1X7QA 4FABH 4G6ML 5E8DH 1JGUH 2EYRA 4O02L 1AR2A 1NFDE 5AEAA 3RJQB 5F6IC 4F8TA 1JF6A 3RL2A 1UB6A 1UM6L 4I0KA 3S5LA 4NJ9H 4PJCA 3AS1A 1YA5A 1IAIM 1MCRA 4Z9KB 1SEBB 3IDNA 4FS0A 4B5EA 3BD5A 5ANMB 5E2VL 1NJ9A 1Q0XH 5C3LD 1FL5B 3GMQA 4UOW1 2YPLE 1CGYA 3HE7D 1U3ZA 4ONGL 4UB0H 1MSPA 1KEML 2ZUVA 4G9FA 3U79A 4KMLB 1IM9A 1G7HB 3LH2L 1UXWA 4JANB 5DS8B 1PZ5A 4HT1H 3DUSB 2ATKB 3X17A 4RX4A 3MLUH 2IPTH 4XP9L 4NHCH 3AU1A 3ZDXF 4I2XE 4JFEA 3RAJL 3BP7B 3SDCA 5A40E 1JWSA 4OD3L 1E27A 2APTA 1BBJA 2DQJL 5EORH 4DN4H 5DQ9B 3D39E 2XPGA 4XB7A 1U95B 4YK4C 4DEPB 4JY6A 1U0QA 5FKAA 3HNSH 4KVCL 2EXWD 2X1OA 3BQUD 3MOAL 1G0YR 1FYTD 4NM8L 2DMCA 2HJKA 4S1SL 5SWZD 3ARTA 2X70A 5EDXA 4ELMB 3MBEC 4ODVH 2A9NH 3QDMB 3P9WB 2DJ4A 3PWJB 1G6VK 1KOAA 4WO4C 5GGUA 5ISZD 1Y6NR 2LTQB 4RMRA 1U8OA 3K7UA 1ZTXH 1EXUB 2EH7H 4GG8A 1HILA 1G6RH 4G9DA 4MWFB 4TRPH 4NKMA 1JHLH 2G9HA 1QTYT 1E6OH 2FBJL 1TPXC 3WKML 1U8NB 3ZTNH 5FF6A 2YOCA 4U7SA 3EGSA 3GJEB 5EULV 4FQPA 1YQVH 1OAUL 5CINH 3GRWH 3SGDI 4HH8A 5HHNB 3CSYB 4GKNB 1JUFA 2CGRH 3C5ZC 4WY7L 6FABL 5DEGA 5TDOA 1DLFL 3CCHB 4JY5H 3IETA 1A1OA 3EOBA 2AI0H 2FJGB 1DBJH 5ESQB 1XCQB 4BH7A 4ZSOA 4H25B 3D0LB 1N6QH 5GS3A 3QXUA 1DANT 1WQVT 4OZGA 4WUKH 4JQXA 5EH1A 5MEOB 2XPGB 2MJWA 2XWBA 4C56A 2H9GB 3BN9D 1F3JB 1OAUH 1XF1A 2HVJA 3WIHL 4U1IB 4GBXC 1CD1A 3RBGA 2X4PA 3LD8B 4MXQA 2DICA 1U91A 5TQ2L 3FZUD 4J3VA 1YYLL 4FG6D 1R5VA 3ARWA 4XBPB 1FORH 2ERJC 4U1GB 2CO6B 1HXYB 3QNYA 5JW3H 1HILB 3UYRL 4Q9QL 1Z0MA 3OXSA 1EEYB 2JJWA 7CGTA 4MQ7A 4L5FL 3L1OL 4LCWD 3F5WB 1G7LA 1PKQA 1X5AA 1AD0A 2DTML 2X1XR 4AG4H 2VXUH 4YR6A 3K8LA 3FRPA 3O4OB 1SEBA 2HAZA 4EVNA 2PYEA 1W0VB 1T4KB 1RZ7H 3GBLA 2ZUUA 4CUCA 4Z8FH 1HDMA 2UWEA 5H94A 3I50H 4NC1E 4WEUD 2J88L 3VFSB 4KROD 1MJ8L 4ZAKA 4DVBA 3VGFA 4MQXD 5CHNB 3G9AB 2ZCLL 1MJUL 2HT2C 4OUUA 4LSVL 4X7CC 1AI1H 1RPQA 4X80L 2HG5A 1IGJB 2OX5A 2AJZB 5EOTA 4O2EA 4X4YB 5K9JL 2AXGA 3D2UB 4H8WC 1MI5E 4JFHE 5D2LA 4JO1L 43C9B 4D8PA 4X9BA 1AO7E 4Z76A 4L4TB 4IRZL 5F6HJ 1N0XH 4K07A 3O2VH 5TE7L 3T0EC 3T77A 4QY8B 4YZFE 1TMCA 4YHPB 2X4UA 2W9DH 2NZ9D 4X4XA 3O11A 2XN9B 3O8XD 4Y1AB 5T3XL 2AV1A 1F90L 4K9EH 2OQJA 3W39B 1IKNC 1NBZA 3S35L 4LEOA 2C3VB 4OZHA 5D1QB 2O5YL 3GSOA 4C55A 1H3XA 1UENA 2OLDA 3KPRB 5C0BA 5GZOC 4JR9L 1FDLH 1GIGL 3EO0A 2X89A 4LCUB 3UCRA 3MRCA 3RJDA 3N1PC 4U1KB 4OF0A 2J8HA 4JFPB 5ACZA 5JHDB 5ISZA 4QHKJ 1NC2D 5C0DB 2Y7QA 3BFOA 3A6BL 1FFQA 4W81A 3DURB 1I3GH 1RIHH 4NN5C 3VRJB 1Q9WB 3EO0B 3KJ4B 4FP8H 3MNZA 2BRRL 1NMBL 3HMXH 3IFPB 5BRZA 1MJ7H 2QL1A 4S2SA 1KXTB 5L2JA 2YD2A 3BEWA 3VD7A 3L3IA 2V5YA 1NGWA 4P2QA 5CEXA 4U7KA 3OGCA 3C6SA 2E6QA 3JWNC 2EE2A 4ZXBA 3SGJC 1NCUA 4JRYD 2B1HL 1LO2H 4FMFA 3MV7D 2J8UB 2A38A 4HUXA 1JF5A 4YE4H 2F5AL 5HVHC 1FPTH 3TA3C 2WV3A 4D8PB 3UBXA 4APQB 3ZT6A 5IBLC 4X6DA 4S1SH 2H8PB 4X4ZA 5CEYA 4H8WH 3O9WB 4KI5C 2WLYA 1CDUA 1A4JA 3P0YH 1E4JA 2Q76A 3PGCA 5B3JE 3PP4H 5DJYA 3RUGA 1JPGA 3O2WL 4MJ5A 1S5HA 1OW0A 5D1ZA 1KG0B 5EC1B 5T5NG 1XR8A 4DTGH 3WJLC 3QIWC 4G8IA 4QTIH 1J8HA 1SY6L 2P4AB 2V5TA 3CXHJ 1F6AB 4P2QE 4UU9A 5AWNH 5D7JC 4ZAKB 5JXEC 1H15A 2BZDA 3T4AB 4NCDA 4NNXB 3VXMD 2AEPH 5DJXA 1W0VA 3VFUB 2YKLH 5J0BA 4QF1A 4I8DA 1G7JB 1DBML 1MI5A 1DUZB 4JGUA 1GGUA 4N9OB 2DWEB 5IVNA 5J9PA 2XY1A 2BNRE 1J1PL 2AK4E 2R0WH 3MBEA 1YY9C 4NQEB 4OI9A 4BFBD 5EZLA 4JPVH 4P59L 3HPJB 4Y16D 3OAUH 4XCYB 1FNEB 4HQQH 4YDJA 3MLRH 4XPAH 5IVZB 5MP6L 3HI1A 3ZKNC 4RFOH 3QAZB 5B22A 3VH8A 1RZIB 4KH2A 5CJXA 2ADFH 4JQVC 4PUBL 4N5EA 3QFJD 4ISVB 4WW2B 2NY1D 1IT9H 3QHFL 3QNZA 5DMKA 5DQDH 5HYFA 5JW4Q 3MJ6A 4C56B 5IQ7L 1LK2B 5EOCL 3E6HB 4HPOL 4X99B 5D7IF 4XHJD 2AJ3A 1E28B 1KENL 3QUKB 5EC2A 2NXYB 4F7PA 3ARXA 4UOJA 3H9SB 5MERA 4O5LH 1RUQH 1AKJB 1UB5A 1FL6A 2F58H 2DJSA 4QXTA 1TVBB 1U8JB 5DHVA 3HR5B 2AK4B 4TSCL 4ODXA 3RPKA 1TDQA 4Y4KB 2D03L 2P49B 4GS7C 1KC5L 4DAGL 1B4JL 1T3FA 5L2KD 4A6YH 4X5LA 2ADFL 1KSRA 1TTFA 4OGAC 4YBQD 2L7JA 3CMOH 3I9GH 2IH1A 3JSSA 4HIJB 3QXTA 5I1LA 1U58A 4Z78A 4P46A 3V4VH 4HH9B 1RZJL 2ICWJ 4L8SB 1S7XB 4U1LB 3EGSB 1XGYH 3P73A 1HH9A 1A4KA 2KQMA 4WU5B 3MA7B 5MHSE 4PDCE 1KCRL 3CMGA 5GGRA 4BQ6A 5HPOA 4P23B 4ERSL 1S9KC 4TSAH 3SDXA 2WWKT 4NUJB 3DIFB 4XRCB 1T7WA 4LPWA 1GSMA 4PJ9B 4QLRA 4HIEA 5J1AA 4F9PA 2LVEA 3NMEA 2EYSA 4XNXL 5C0IB 3C6LD 4ODWB 3T0WA 4X83A 3SDDB 2Q8BH 2JJVA 5IMOB 3NOIA 4W6XB 1NLDH 5D5ME 4PY7B 1M1SA 2HLAA 4O9HL 5L9DL 3DROB 1I75A 2ZNXA 1KELH 3BH8B 3WO4C 5E2TH 4WU7A 1FGNL 4XNUL 5IFAH 4LLQB 3AS2A 4QRRD 2Y23A 4HKZB 1AHWB 1D6EA 2Z91B 3LKQA 1URLA 1MCKA 1RZGB 1Q9OA 2NR6D 4J6RL 1JHKH 5ITFB 3THML 3QDME 2OJEB 5F1NA 1UQSB 3TVMD 3MCKB 5EUOB 1JGDA 3TESA 4QGTA 4PJ7F 4AIZA 3B9AA 1NQBA 1HHHA 5FOBB 3NFPA 1DFBH 1BZ7A 3NGBB 4XZUA 1AJ7L 4PJAE 2ZOKA 3GM0A 4HKXA 2B2XH 1IGML 3CFEB 5D2NC 1NCNA 5GSRA 4JR9H 3ROLA 3X3FL 4DVRH 1IKNA 3GSVB 1TQBB 1T1ZA 4L9LB 4RIRB 2E7LE 3NABL 4JM2D 4OZFB 4JPIB 4OAWA 3SDDA 5ESAA 2GAZB 2YUWA 3WNNA 1JP5A 4LLWB 4RISH 1I3GL 2HH0L 3W5MA 2CKNA 3EDJA 2FX8H 3WSQH 4M7KH 1UM4L 4OLWH 5DUMH 1IKFL 4I0PC 3ARGC 4RDQG 5ICYB 1Q8MA 2H26B 4RMTA 3MA7A 5KSUA 2VL5B 3AB0C 4K23L 4P46B 4FTVE 2ZPKH 4TVPD 3UBXG 3VI4E 5LAXB 5HHQB 4DKEH 1CD0A 3WUWG 4MAYA 2VIRB 1PY4A 5ADPH 4M7LL 3DRQA 4HMDA 3X11A 2E9JA 1KN4H 2ED7A 4WHDA 1CZ8H 5DO2D 5SX4H 3ZE2F 1MF2L 1WFNA 1ZA6A 1DQTA 3H2WA 1TJIL 2VE6A 5J3HC 1I1AC 2VLKD 3Q2CA 4ZOAA 5MERB 2XTLA 1AXSA 3MO1B 4M6OH 2CDFB 1JZ6A 4POYA 4UNVA 5IW6A 1G6RL 1PKOA 2EEDA 1U2HA 3QXAA 4M6OL 3F6LA 1HOCB 4WI8A 2DS4A 5JR1L 1WEJH 2OTPA 3KYAA 4NOBA 4Z7VF 5F3BB 4N68A 4X5XA 3QNZB 5DMKB 4ZO8A 2AXJA 3MBXL 4KRLB 4JFDD 5D1XA 5GGQL 1HZHH 1OB1B 3NCYS 4CNIA 1GXEA 3KHQA 1X4YA 3LQAC 4MXVF 4G43B 2P5EA 4NN7B 1F8TL 5IVZA 4KAQH 5GGQH 2VB5A 4MDIB 5FM4A 3CMOL 3V6OA 4XMLH 3QJHB 4IOSD 1IZJA 3N85H 3SJVA 2J8OA 1CE1H 1N64H 4P48A 1ZHLA 1AQKH 2QJDA 1HQ4B 2XTJC 1WAAF 2PTVA 3FQRA 1X5FA 2CMRL 4M1CD 1AIFB 1QFUH 3SDAC 4NNYA 1I9RH 3W5NA 1UG9A 3QUMH 3EO9H 5GHWH 1VFMA 1XGTA 2JK5B 3LHPH 1NUGA 3QXDA 3VXRB 3F12A 1DBJL 2BOCA 2BSTA 4DK3A 1KENH 3FTGB 2V2XB 1JPSL 4KHTL 4O51A 3LEXA 4JM4L 5IQ9A 4BKLA 5JORB 3V5DB 2OCFD 1G7QB 1UJTA 1YUHA 1ND0B 4U1HA 3RX8A 3DJ9A 4PLJC 5D1ZC 4YHKL 4XWGL 3Q48A 5DHYB 3QPXL 3UTPE 3QXDB 1MPAH 3VXRA 5J06A 1CBVH 4J1UB 4PJEA 1XF4B 3UO1H 2VR4A 2VZOA 4XXCA 4HIXH 3K4ZA 3C8KB 1AXTL 1LO4L 5F9JB 2JJSC 4MD4B 2EC9T 5C0RH 3WE6B 4BZ2H 3VG9B 1JHKL 4ELKB 1WVZA 4NJAL 3SO5A 2ICWI 3O6FC 5FYLE 1QZ1A 4EUPH 5BOPA 1KCVH 4NC1C 5IB1A 2PW1B 5KTEL 3L7FA 3VXQA 4WIQA 4XVTH 4LAQL 2EC8A 4HS8L 4I0CC 4JDZB 4ZUUB 1CLOL 5BRZB 4DK6A 4Z7NF 4MSWA 4P4RB 3H9HB 1K4DA 5JXED 4LHJB 5KG9B 1KJ2H 2NXZD 5IP4A 1LO3L 4HS3B 5DUPL 4MCZA 4TULL 2ERJB 3RWGB 2ZOLA 4X4ME 3VI3E 4ZUTA 3CFJB 3RVVC 5D7LE 1I9IL 3KNBA 4I0PA 2R39A 1GRWA 2Q7NA 5IMMB 1N5AB 3L3HB 4WJ5A 1P4BL 1EMTH 4NUGL 1GC1H 2QADC 4OGXL 2EDKA 4TVSa 5DMGC 2VZ3A 3MRDA 1A14H 1IGIH 3BD3A 4HKJA 2XNAA 4Z7OF 2APVA 5HGDA 6CGTA 3WLBB 1JL8A 3O4OC 5KSAA 2NXZC 1OL0A 4LPCA 1J1XL 4RAUA 1F3DH 4NT6B 5I71C 3FQTA 4G6KH 5CZXC 2A74B 4JEGB 1VADA 2AJSH 1QSZA 2NW3A 3QQ3B 1RMFL 2VO5A 3NACL 1J0ZA 3BPCB 3ZHKA 1R5WA 2ZSVA 3ZSTA 3WFEH 3B8YA 5KSUB 5I1CH 5HHXH 3BWAB 4TTDC 3MOBH 5AYUH 5I2IA 3C60B 3BH9B 3HAEA 2WW8A 1MHCA 2BVPA 2DLGA 1UCTA 4UOW0 5DXWA 1CK0L 4IIQA 3QG6A 3UJJL 3ROOB 2OZ4H 2IG2L 4JM2F 1FV1A 2CRYA 4OIIL 3K8MA 4LMQI 2YC1A 3TBVB 1WJ3A 1MQKL 4NKOA 1XZ0A 2WWKO 1UM6H 5IMMA 5ETUB 4LRIA 2GQHA 4RGNC 2V5RA 3ARBA 4G6AD 2F15A 3LKNB 1RK0A 3MRIA 5BOZG 2XWJB 1LK3L 2HT3C 3DGCR 3TV3H 2NY3B 4YH6A 3IU3B 5DEZA 1BEYH 4Z5RA 4EI5A 4YHML 4CMHC 1KTLB 3QFJA 2DDQL 2DQHH 5FKPA 3JUYA 1T04B 4M00A 2NY5C 5F7YC 1AO7B 1T2JA 5FYJU 5EO0A 4HCRA 3L7FB 4G9FD 1R5WB 2YN3A 3I6LD 2CMRH 5C6PB 3RZWA 1MFBL 1ZS8B 4ZUSA 1H0DB 2HJFA 3BVNB 4DKAA 2X7LA 2ZCHH 1JZ7A 3QCTH 5CLWA 4LDEB 4IRJB 1YPZE 2ZUTA 2J4WH 4DN4L 2UZYB 4KK6C 2Y6SD 4YO0A 4XNQB 2HLAB 5F1KC 4FFEX 4PJEB 5DVOA 2ARWA 4BH7B 3ILPB 1WICA 3MR9B 5HBBA 3RKDC 3EHBD 1XMWA 1X5LA 4KRPB 3HRZA 1DDHB 1MAJA 2FL5A 4X6FB 4ZO6A 3K1KC 4P5MA 3DIFA 4CVUA 1MFCL 1G84A 1JI2A 3KWWA 3RWGA 5F96H 2JTDA 1RJYA 2QBWA 5J57B 4FG6C 4U0QB 4NM4L 1JNNL 3LN5B 5KOVC 5EWIH 3WCYA 1HH9B 3D69B 2FGWH 1MRDH 1N26A 1XGTB 2JK5A 4Z7NE 5A1AA 3MV9D 3HZMB 4MJ2A 5IVXF 3VXME 4EQ3A 4ZFFA 5IF0B 2UYLA 4JFQB 1J7VR 2ZZUT 5EU6D 1CI5A 5FUZH 4HDIA 4KUZL 3QUYC 2Z4QA 4X6EA 2DQFA 1B90A 4JM4H 3UYOD 4BZ2L 3NIDF 1JZ8A 3BE1H 3GNMH 3ULUL 5IESH 1NL0H 4OV5A 3ARDD 1FZMB 3LB6D 1ORSB 2FB4H 3EO9L 3PL6B 5GHWL 4L4TD 4DCQA 2J6EH 2HT2D 1LP9E 3IJSB 3ES6B 3VGEA 1U95A 1YYMH 1YY8B 4WFEE 1O5DT 3VMOA 4YHKH 3CFIC 3B2VH 5E08H 3QUYD 1U8HA 4FZ8L 4MNQD 4Y2DB 3QHFH 4XHJC 5HHMA 4LKXB 5HHOD 5LVEA 2W9DL 2IPKA 3NIDE 2CSPA 2EEAA 1GOFA 4ZTPH 2FNBA 3MRBB 5CMAB 1GGYA 4DGIH 4G59A 1HSBA 4CU6A 3O8XC 4AEHH 1Q94A 2CRIA 3OBAA 4LSTH 3VFPB 5CKGA 4JLRA 4HCRL 3VD5A 1OAXH 5IWLC 4OFKA 4MJIE 4NHUE 1AC6A 2AEQH 3O4LE 5AZ2L 1JTOA 3IFNH 2IANA 3U46A 3L6FB 4ENEC 2VISA 3X12B 5E1HB 3WXWH 1UM5L 2EIBA 3QRGL 1ULVA 2MNUA 1BQUA 3P9LB 1DN2A 3AFLA 1UB6B 3S5LB 1L6XA 5CZVH 2Z8VC 3TZVC 1HYSC 5FYKD 4UV7H 1MCNA 4PYGA 5HDLA 4LQ1A 2P1YA 5EC1A 1MJ8H 2D7PA 1GPOH 3MRRA 3MRPB 3SQOH 4RGNE 3GMPA 4QRPD 3QWRD 1IAIH 2OMNA 3IFLL 4UTBL 2I60L 4HUNB 2CXGA 3TYGH 2MSPA 4ODTH 4OV5B 2GTWA 3HZKA 4I2XB 2ZG2A 4O2FB 1RIUL 1KLUA 4L8DA 3HLAA 1L7IH 3GGWB 25C8L 1XR9B 4D2NA 3QH3A 4EI6B 5A3ID 1YPZA 3KLHD 4UQ3A 3E3QC 3TA3D 2IGFH 4QHKI 5EZOH 1PEZA 5EUOA 3GMMB 2VIRA 4X4MA 5TFSL 2Q3ZA 2CK0L 4HMCA 1N2RB 3P77A 1LK3H 4QHLB 1W72B 1NCWH 2F19L 4BUGA 5KSAD 5I1HH 1Q9OB 2O5YH 3HZVA 4TYUA 4AQ1B 1HEZA 1DR9A 1MQKH 3QEHB 3SKMB 3QIWD 5DK2B 2IF7A 2YA1A 1E4XI 1MREH 4P4KD 1EJOL 1EUTA 3KLHC 3BP4B 4NQDE 5DK0B 3MLWL 1J12A 3D0VA 3TO4B 2QKIB 4QKXB 2G60H 4PY7A 5C0FB 2XZCL 5DC9B 5ESAB 5HVFB 1I1RA 2DDQH 2DQHL 4FQHB 4PJGF 5H2BA 3NTCL 1NSNH 1UCBH 2X4RB 5FA3B 2DLFL 4KJQC 2MHAB 3O3DA 1TXKA 1A6UH 3H7BB 3MV7E 4OF6A 1QR1A 3MA9L 4G3YH 2CJUL 4JFOB 3MLXL 1I1CA 4I4WB 4XC3L 3I6KB 4PRPB 2QR0B 4X9GA 4XCCL 5F7NC 4FFYH 1GGBL 1OM3H 5GZNC 4HBCH 5LGHL 2YMXL 4FN0A 2X44D 1ZTXL 1KJVA 5T5FL 5FM8A 4L8SA 4PJ5E 1B0RA 3T0DA 4PP1D 4D0CB 3STZA 4QT5A 2DQGH 5JIPA 3RNQA 4RA0C 4ODVL 4MJ4A 1A7OL 2R56H 4CU7A 1DVFD 1DVFA 5T1MA 5CHNA 4PJAB 4FXKB 1FLRL 3KR3L 1PYWB 2GHWB 4FQQA 4HK0A 4WTWA 4H5SA 1FNFA 4TUKL 3QUZA 2H1PL 4XMLL 3H9SA 4F9LA 5HHOB 1HDMB 3MZTA 5H94B 1ES0A 1DLHB 3MOAH 3PWNB 4JDTH 4S10A 1YNLH 3IDXH 3ZE1E 3K4DA 1ZT1B 2ARJA 1ZT4B 2PYED 3U7YL 3MV7B 2B8OT 1CFBA 2BY1A 3DXAA 4NQSB 2P5WD 4K71B 4HX1A 1PSKL 5F44A 2E7MA 3MRPA 3FFCE 4LVOB 5A16B 1KN2L 4PRPE 3N1GC 4XRCA 1J0HA 1IC7H 4JY4B 4XVUC 1UA6L 5T3ZD 4PB9H 3M17B 2VDMH 3D18A 1NLBL 1ZAGA 3H9HA 5C92A 5DC0A 5EFIA 4CMMB 2VJXA 4EN3A 2G2RA 5EBWB 4PJ5B 3REWB 5IGXL 1FORL 2F54B 3ULUE 5EBMB 1BX2B 4KK5C 1FYTB 4GXVL 2CLZB 2AEWA 2Z93A 3SDYH 1BPVA 3BJ91 5TJWK 1R3JA 3MBEB 2EDRA 2R0KH 3O4LD 2Y25A 2FEDD 3FQTB 4X98B 3SCMB 2ZKHL 3QISA 4KY1L 4CN6A 4GQ9L 1TNMA 5C0AB 4UV7L 1CXEA 5B39B 1XF4A 1LWRA 3SGEI 2AQ3A 3B83A 3BIAX 4Z7WA 3OZ9H 4PJGA 4NQTA 4FZ8H 5GGTH 3KNBB 1P84J 4Y16B 1P6FA 2X4OB 2FYYA 4K7PX 3G5XA 1JUFB 5ITBL 2P7TB 1DQDL 4GRWH 5KJRH 4U0RC 3BN3B 4IDLA 25C8H 3ECBA 3H9SE 5HDBF 2E9BA 1F2XK 5D93B 1D5XA 4UINH 2XT1B 3AREC 3T1FA 1U41A 3S35H 3TCLB 5MENE 3IAGC 4LLDA 4R96B 1Q72L 3EYQD 4NCC2 2X1WL 4JN2A 2XACC 1UJ3A 3MRFB 2CLRB 1UJ3C 2D3VA 4GG8B 4KKBC 5J89A 3WHE0 3RZCD 1NBVH 2YSSB 4BQCA 3CVHA 5DEFA 2NY6C 4IMLB 1SVCP 1KT2A 4N0UE 2V9QA 4Q6IC 4P3DA 5DA0B 3BHBB 3T3PE 3DPBA 3QB7C 1VGKA 3UTZB 1QSEB 1RVFH 4G6JL 5DMIL 3SKUD 1IRAY 1Q1JL 4N9GB 5DJXB 5L6YL 1PG7X 3OHXB 2I27N 5M95B 3TYFA 4LBEB 4GW1B 3QZWG 4N90E 1D9KC 5E7BA 4F57H 1M6OA 1GZPB 1VCAA 1L0QA 2DQUL 2FX7H 2VDRL 3I85A 3NVQA 4N0YL 4RMQA 5F7UA 3U1SH 5C0DA 4F58H 2O5XL 4LEXL 1T5XB 4WW1A 1TQCB 2FJHB 4NQEE 4I48B 1KYOK 3OB0H 4K7FA 2APXA 5D1XD 1SBSL 3TN0B 5EOCJ 3LEXB 5BXFB 3VXMB 3S36H 2AJUL 2AK1H 4LCIL 2IBBA 4J3SA 4F7CB 2AJXH 1BF8A 1RFDH 4JKMA 4XCCH 4NN6B 4TPRH 1IQWL 3T0XA 3BKYH 4HJJL 3ZKND 5K59E 3DRQB 2FX9H 3KHOA 4YHPA 1R3JB 3KPMB 1UKSA 3RWIB 1UCBL 5HPMB 5FIEA 1HQRB 3GMRB 2X10A 3L3IB 1DQQA 2EIDA 5L2JB 2NLJB 1AE6H 3NPSC 3Q0HA 4OB5H 3VXNA 3LEYL 4JQIH 2HG5B 3BT2H 3QR2A 1BZ9B 4Z7OE 5F88B 3GSWA 1YDPB 2FO4A 4JHWL 3BKCH 4K7PY 4YBLC 1CK0H 1NC2B 1MI5D 3HKFA 4ZNCD 4L8CB 5INDA 2VH5L 3QUZC 4PD4J 3UTSB 1BJMA 1MCPL 1KIQB 3HZYB 4M1DL 1QR4A 1I9RL 1VFAB 1MVFA 4MD5B 3U0PA 5EWIL 3MRGB 3MACL 3TPUE 3IVKB 2ZP0T 3DYPA 2XY2A 5KW9L 1TVDA 4GW5B 2IWGA 4HZLB 4PLKD 4WI3A 4PJAA 3S96B 3SOBH 5CJ5A 2R69H 5GRYA 5HGBB 5HYJE 3V0WH 1JF1A 3BWAA 4Z7UF 1R5VB 1CFSA 4ODSL 3WFBL 1F8TH 4GOSA 4OLUH 4OD2B 3QWOA 5I6XB 5LJYH 5E5RB 4KXZH 4PRHA 4APQC 2H9GA 2H1PH 2XWBB 4NWTL 1T7ZA 4UBDD 5FYLL 4QCIA 5LGJA 3SE9H 3IF1A 2ZG1A 2GSIB 1MCOL 1OGAA 4L4TE 1CU4H 3Q5OA 4LVHB 3WDHA 2H2PD 1PQZB 3TT1L 1FO0L 4XP6H 1QVOA 5E1AA 4UT9H 3G5YA 1N8ZB 1EFXD 3HNTH 4DKDC 3SDXF 1I7TA 3QUMA 3PWLA 1N3NA 1JGLH 3IRZA 4RCAA 5DJ2A 3F7YA 5CJBA 4LAJH 3OF6A 2CUHA 4KVNL 2J88H 1FVEB 2HVKB 4K3GA 1BZ7B 4WI9A 4L4VA 4IMKA 3WN5A 2D4FA 4KV5E 2WNGA 1CL7L 2XKNA 4ZUVA 1IE5A 1A3RH 5JZ7C 1JZ5A 5I75C 1ED3A 3BWUC 4RFEB 3IJYA 4ESKA 5EUKA 3QNYB 5A2IH 2IAMC 5HYQA 2DTMH 4XNXH 2P5WE 3KPOA 2FZ3B 4AL8H 1CU4L 4G8FA 3VGDA 2GW5A 3HUJB 4PRPD 4BSWA 3T2PA 5HVWA 4YBHA 4MWFA 4Q9QH 1YPZB 4EI6A 1F3JA 2HVJB 1AXTH 4HJGA 3ESUF 4H1LG 4F33B 2HWZL 4Y5XA 4QNPF 2CUIA 5HHPA 4LCCC 4FFVD 1CYGA 1PJ9A 1R3IH 1BP3B 4JVUA 1WIOA 4R0LC 3ULVF 5FEBA 3ESVF 1U3HB 4O2CA 4F7EA 3DUUA 3DX8A 4LSSH 1U8PA 5DDHA 3BAEH 3BW9A 3MODL 4HLJA 1LK2A 1HIML 3IETB 5DK3A 4PJ9A 3VWKA 3FRUA 1DBBH 5D1XC 1C12B 3PL6C 3KLAB 2D0FA 3JV6A 4U3XA 4U6YB 1H3GA 4JZJA 4GS7B 5DLMH 4TTDD 3BDYL 4JO1H 5KOMC 3P9LA 3D3VB 3VFMB 2WUCL 1EMTL 4CVXA 5E99H 3ARDA 3W81A 1R3LA 4IBLT 3L6FA 3QIBD 3T0EE 4NPYB 4L8SC 2EICA 4YHZL 3P40A 1MAKA 3IKCB 2F5BL 5DQJB 3PGDA 3V0VA 1OTSD 3AS0A 4JQIL 2R4RL 1DBKH 3BPNB 1TVBA 1U8JA 4OZFG 1RMFH 2BXYA 1A7RH 3PWJA 3KJ6H 5F1SA 4KKLD 3VG0H 4ZQKB 4HT1L 5ELIA 4NUGH 4XCEA 3HNVL 1W8OA 4NO3B 5JDSA 4NNPH 1AXIB 3QWQB 1QKZL 3G9VA 4WUUD 5FA4B 1JCKA 5DTFB 1CDCA 3RUGB 3RNKB 4AT6A 3WXVH 5DQ9A 1MFBH 2QQKL 3TZVB 1NC4B 1BD2A 4XC1H 3C5ZD 4G8GE 4PYHA 4PTTB 4G80B 4X6DB 1RFDL 4QXGH 3JWOH 5T1KA 5JMOC 5CCKL 3UBXB 4WV1A 3CFBA 2ATKA 3CZJA 3ALPA 4X7TA 1MWAB 3RBSA 2K3TA 3SDDC 1X9QA 1G9NL 2X4QB 3UTTE 3KS0J 4NQCE 1X5GA 4NQEA 5EU6B 2JCCB 3BGMB 3EFDL 3GSNH 3S35X 4M61B 4NCC1 2OTWB 4HK3J 3KPLB 1A47A 1A7OH 2R56L 3LEYH 1KPVA 2JJUA 5INDB 32C2A 3QG7L 1MRFH 2W0LA 3O2DL 5D7LD 2YK1L 5FDWB 1I1YA 4RRPG 1QFOA 5KS9F 1NC4D 5HYIA 3EYUH 3ALWA 4TUOA 3TIDB 1MCJA 2YMXH 4D0DB 4JAMA 4AH2B 5TGBA 4BSJA 4MAUL 3E0GA 4OFPA 3EYVB 3MUGA 3DRTA 3EYVA 3MUGB 4NZJA 5GISH 3DMMA 4J3UA 1RZKL 3WN5C 2B4CC 4Z77A 3OAYH 4IS6A 1I1YB 4XVJL 4EDWH 5EA0H 3V6FA 4K23H 5BZDA 5C9JB 3RY4A 5JLZA 3VDBA 4FQCL 1U3JA 3MLRL 4XPAL 1QBAA 4X4XB 4HKXB 3FQXB 5JW4N 1INDH 4OSUL 5DMGD 2AQ1A 3PDGA 4ETQB 5DHXB 5FOBA 3FONB 5F96L 5DI8A 4FFZL 3D87B 5E8OA 5EUOF 3FN0H 5D7LB 1B2WH 4Y5YA 4RDQF 1FJ1B 4MNQB 4B7IA 4FQXA 2GI7A 3NFNB 2R15A 2BVYA 5EN2A 43C9A 3RVWD 1XGPA 3NCEB 1UQSA 4OQTA 1AO7A 3QQ4A 5K9OB 1SBBA 2MQCA 1KJ2B 5ITFA 5E6ZA 1QSFD 2X4SA 3GK8L 1WZ1H 2XRAH 1CL7H 1IEHA 3IDXL 2YD4A 2HRPH 4P46C 3GI9H 5TGBB 5HI4D 2G5BA 3RNKA 2DD8L 3MCLH 1IL1B 1ACYH 4L3EB 3RHWK 4KWUA 3D39B 3EYFB 4EDXA 3KPRA 5C0BB 5EBGA 3U0TA 1MLBA 2A0LD 4GMTH 1A6ZB 1B2WL 1Q9KB 3JVGC 1Z9LA 2VDKH 1J11A 1TCRA 4NO0D 5CEZE 1T2XA 3LMJL 3T0VA 4KJYA 2VDNH 4MQ7B 1SYSA 2E8ZA 4K55A 5FHBH 5JPMB 2Y07L 1T5WB 3TO2B 4CADB 3U7WL 4Z7VB 3BKMH 4I3SH 1MRCH 3O45A 4LLDB 4R96A 3ZYJA 1XGQA 4QHNB 4A6YA 3CVIH 2XTJB 1KPUB 1R3HA 4YPGB 2NX5E 4RBPH 4KK9C 1P2CB 2UUDH 3ARFB 5GGSB 4NOFA 1VKXA 1E4WL 1MY5A 3FAWA 5TF1H 1DEEB 4GAYB 5F89A 4KFZC 1MIEH 2O61A 1C08A 2OR9L 3S4SB 1A2YA 5K93A 3I6GA 3P30H 1TCMA 3MUHL 2YRZA 1IAKA 1C5CL 1GGCH 1IGFL 3VFSA 3LN4B 2GFBB 3C5ZB 5DR5L 5I1AA 4MA3A 1A3QA 4PLKC 3PHQA 2YPLA 2R1YA 1K8IB 1YYLH 2YPLB 5C0CB 2B39A 3SCMC 1CT8B 1LP9B 1CFTB 5CP7B 3H3KA 4E41B 3SE4C 4YR6B 3SDAB 4QHMB 1ZVSA 2VWEE 1D7FA 5JXAH 1U8MA 4JREB 1IGCL 3OZ9L 4JKLA 4YDIH 3V5HA 2X4NB 2P8PB 1WFOA 2DI9A 1IGYB 4NO5B 4LNRA 2FIKB 4GAYA 5F89B 3W0WB 4PV9B 4PP2A 2FR4A 2AERT 2W59A 3WNLA 3VH8B 2XZAH 3B5HA 1L9NA 4MSWB 1JN6B 5JW4M 3MRMA 3QIUB 2J2ZA 1EGJA 5D6DA 4GW4B 4Y2DD 2R2EA 4OTXH 3CH1A 1UYWL 2ESVD 2OL3H 4JKKA 3U9PL 1O0VA 3HE6D 1UH2A 4ELME 2YRPA 1LILA 3MOBL 5AYUL 5EU5B 3ZLQC 5MEOA 3WS6C 4LKCA 2YD7A 4TPRL 4JKPH 1CXLA 4MD4A 2QSCL 1ZVSB 3QI9D 4HUUA 3NH7L 3SE8H 4P46D 3OQ3B 8FABB 3GB7A 2ZWLT 3O6FB 4ZSOB 1CF8L 5C0CA 4MNQE 4PJ7B 1XAUA 5E1AB 5DJ6A 1K8IA 5DO2C 3PP3H 4Q6IB 5B38A 5D1QD 3PWPA 3PQYB 5L8JB 4RZCA 1A1OB 2VDQH 3W82A 1HKLH 4PR5B 4N90D 5EO1B 1S5HB 1DVFB 3UPCA 4E0RA 2FX7L 1JWMB 2GUOB 4N0YH 3BIKB 5GJSH 1RUPL 2D7TH 1MCEA 3RWHB 2I9TB 4I77H 4KDVA 5I8OL 4K2UH 4EN3C 2VAAA 2V5SA 3EO1B 4X0KB 3VD3A 5BJTA 4QT5B 3OWEA 1BJ8A 3S37H 1ZKAA 4NM8H 1NEZG 5GRXG 4YE4L 3FO0H 2BFVL 4PREB 2GT9A 5C6WH 1YEHL 1FAIH 1FGVL 4OZFH 3WL9A 2HVKA 2X9YA 3IDJB 1PLGH 5DURB 1DL7L 1AGDA 4HXBH 1T5WA 3ZMRA 3LQMA 3BT2L 3O0RL 5BV7B 2V9TA 1JNJA 1RIHL 2BSSB 1AH1A 5A2JH 2HFGH 5GGUB 3FO1B 4RMUA 4ZOCA 2W07A 4RGND 2JJTC 2R23B 5C0BD 1MIMH 2HTKD 4FQLH 3ZE0E 4LGSB 1N7MH 5GGVY 4WHTA 5FKAB 1UACH 4CL7A 4OZIF 1YPZF 1FVCA 4LLVA 2LU3A 1YDPA 5J12C 4PGCB 5DVNA 2Y7QB 1BZ9A 3CSPA 3P4NB 1JTPA 2R0WL 3C5SA 4YIQB 3TA3A 2BSRA 3WV0A 4KUZH 2IFFH 2V2WB 4X8XA 3FHAA 4OM1H 1VEOA 3TH2T 1BIHA 4D9RD 1WISA 2A83A 4CMHB 2Z35B 3OKLA 4PGDB 3GSOB 4C83B 1RZKH 4IHOB 1AD9B 3K2MC 1A3RL 2NY5H 3CVIL 5HGBA 4MHHI 5I30H 3K3QA 1DCLA 1OT2A 1F6FB 5GGVL 1OWRM 4TRPL 4GW5A 3T2NH 2Y6SC 1RZ8B 5F7LB 3OAZK 1BQHA 1N7ML 2AABL 4X5WA 3RGVC 4XNYL 4WNQA 4HQQL 2VLJD 2Z35A 3OKLB 4PGDA 4C83A 1T89C 1IQDA 5IGXH 5I1KL 2A6DB 3U82B 1YMMA 2WWMD 2AXGB 4S1RL 4XXCC 1NCAH 3ILQD 3NCFB 1KB5B 5KZCD 2BNQB 2HN7B 4OUUB 1RV6X 5HYSG 2VDPH 4M9PA 1ONQA 4OCSH 2IQAB 1FLTX 1FNHA 4G6FB 5D5MF 3O3AB 3MFGB 4P2OB 4PJHB 5AG8A 1CDHA 3LPFA 4GSDL 2CK2A 43CAB 1F11B 1K4CA 5C0CD 1RJZB 3ZHLA 2WWMC 4P9HH 3SE3A 3MLTB 1MFDL 5C7XH 3WNOA 5DJCB 4RAHA 3LS4H 5F8QC 3WL9B 1C16B 1NDMB 1Z5LA 5DEFB 1FFNA 1VACB 1ZLUK 3O2DA 4M3JA 1DQDH 5D70L 3VRLF 2IMNA 4LSTL 1YN7B 2Q7YA 2YD6A 3A6CL 1W0WB 3GI8L 5CEZD 1IGCH 3P0VL 1S9VA 4PJ8D 3FT2A 3KYKH 1T2QL 3MRLA 5D7IE 4HG4K 1RUML 1GGIH 2IJ0C 4OGAD 5DD0L 2IPUG 1KGCD 5CJQH 4D9LH 3TZVA 3L1OH 4DAGH 3MRJA 3QEQE 1KIPB 2R2BB 4WW2C 5FA4A 3VFGL 3RDTA 4WO4B 3QUYB 4PRBA 1T22B 4XX1G 5IB4B 3Q3GA 3MBED 1PDKA 4PJDF 3C6LB 2YD8A 3WMSA 4K2UL 4O4YH 2F9BT 2VR9A 3ULVD 5I74C 3VXOB 3D39D 3EFFA 5TDOB 2EIZB 4TVPH 2ZUQB 5DQJA 5FK9B 3PL6D 4L1DA 2EXYC 2V17L 3V6ZB 3L3GA 3BP5B 1CD8A 1JWUA 3H9ZA 3ZTJG 1EO8L 1JN6A 3BO8A 1BX2A 1NCWL 5ALBL 4HUWA 2AJUH 2AK1L 3D3VA 3VFMA 1FFOA 1VFOA 4P2RA 5F7DB 2R8SH 3EAKA 5C8JB 1EFQA 2YPKB 3T2OA 3NZ8B 4YNYA 4EOWL 4LSQL 3FN9A 1TZHA 3D6GA 4K3JL 4WWKD 3TC9A 3TO2A 1YQ2A 1EFXA 1S9WA 1D3CA 3F7YB 3FRUB 3EFFB 3H9YA 1XF2B 3LZFH 1UYWH 3J8F7 1N8ZA 3BXNA 3K8KA 3G5YB 3U0WL 1LMKA 1OP9A 2AJYH 3ILPA 3QFDA 2F5AH 4HEPG 1T22A 4ODTL 4WI6A 3H42L 1QFWI 4RGOH 1NEZA 3ZHDA 2IPTL 3MLUL 1IJ9A 3HB3D 4X99A 4LASL 3F58H 3DETD 1RAMA 3MRJB 4MS8D 4LPXA 4OD3H 5IHBA 3PP4L 4AENB 1OD7A 3WD5L 1IC4L 3MRLB 2A9NL 4IOIB 3HI1B 4YDVB 5EB9A 5DJ8B 4LHQB 2A2QT 4D0CA 2MCG1 4UDUB 2NY4D 3DSFL 3FN0L 3NFNA 3PV6B 4R97C 1AY1H 5EN2B 2I9LA 5BQ7A 4XNYH 5FYKH 2R9HC 3MX0A 5AAMA 3S96A 1SYSB 2R0ZL 2P8LA 1FVEA 4WCYH 3X13B 1MREL 1T1XA 2B20A 3I3EA 4N0UA 1MNUH 4DJMA 1VPOH 4PG2C 4MZ2A 3EW3B 1XZ0B 1FNSH 2MTPA 1G9MH 2WIIA 4NNXA 1I8LC 2ZPKL 3NIFF 3GMOB 1BIIB 2UZXB 4Y4KD 2UUDK 3CUPB 3HR6A 2EO9A 3QG6B 3BGFB 1NFDB 4G8IB 3EOTL 5LGJB 1OPGH 1ZE3C 3A67L 3GIVA 2Z31B 3EYUL 5D8JH 4JAMB 3CLEL 2CGRL 1CR9H 1ZVHA 4KMQA 1ZGLP 3ARRA 5FYKL 5LGKA 5IFJB 3CDFA 3SKMA 35C8H 1QSEE 1XGPB 3TJEH 2W65B 3MLSH 1FO0H 4XP6L 3DVNB 2ITDB 5DI8B 3B3IA 4XP1H 4FTVA 4PRNA 3KPMA 3GMLB 4I4WA 1F02I 4KJWD 1ZHKA 4A2MA 3N1QC 1VFBA 5T3ZL 3IJHA 3GSXA 3SDYL 3CFCH 4NQVB 1IVLA 1JGLL 5JNYB 2EDBA 1AP2A 3IFOA 1KYOJ 5I8EA