3NFNA

Recognition of peptide-mhc by a v-delta/v-beta tcr
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Plasticity of human CD8 alpha alpha binding to peptide-HLA-A*2402
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nfnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3nfnA01
3VRIB 2AABH 2FGWH 4UAOB 4AENA 5HI5D 4UDTB 2A74B 3C6LD 5DJ6A 1J8HD 3LQZA 1BJ1J 1J0IA 3U0WL 5GGQL 1ACZA 4MJIA 3SCMB 1Q38A 2BFVL 3PDOA 3IDNB 4PJ7B 5JXEA 1RZIB 2X89A 4L3CB 3THMH 4IJ3B 1BQHG 3GRWH 1CFTA 4U0RB 1IC7H 3RTQC 5TE4H 3RPIA 1G6RL 1YEGL 1WBZA 3P9LA 3L1OH 1K3ZA 2H26B 4XWGL 3GM8A 3CC5A 4LVOB 4LHUD 5M94B 3JV0A 5FHBH 4F7EA 1UVQB 3KGRA 3QXDB 3VFRA 1NCAL 4C4KT 2IBZY 2W60B 1N2RB 3SDXB 3TBSA 1PSKL 4D9RE 2CUIA 1RUKL 3UYRL 1MFCL 3FQTA 4ORZC 4WHTB 3MLSH 4Q9CA 3TT1L 4KDTA 2HKFH 2BOCA 3C87A 3JV6A 2HKHH 2A1WH 4JY4A 5CP7B 1QBBA 3KNBB 1OP3K 1T5WA 4U2YA 3S4SA 4XVJL 1KTRL 2IQAA 2VUOA 4OAWA 5GRXG 2IANB 4MJID 3LH2H 1NC2A 4P2CG 3ME0A 3ALXA 4F57L 1MFBH 3C5SB 2MTPA 5E56A 3X11B 1ZGLA 2OSLB 2Z91A 5JXED 1JUFB 2X89D 1Z0NA 4WO4B 3ILPA 5B39G 1A14H 2NZ9D 1IC4L 3BP7B 2P8MA 4MNGB 4D0CB 4AM0B 5GGSA 1ZHNB 1H3VA 2C9AA 1TDQA 3GRWA 3HRZB 4JANA 1KN4H 2OMNA 4NSKB 3U2SA 2CSPA 2WZPD 4D9RD 2EH8L 1KT2A 2P5WB 3GHBH 3KWWB 1F3JA 4YDLC 3A6BL 1XAUA 3ARGA 2DIJA 4FQXA 1XF5B 3DI3B 2P8PA 1OOAA 2CJUH 2E7LC 2FIKB 4OKVB 3NBNA 1A3LH 4LCCA 2RFXA 2Y07H 3F5WA 2AK4A 3B9AA 4L8DA 4YAQA 1FZMA 2BERA 1UM6H 4X6CF 1A5FL 5L8LB 2XZCL 2V2TB 1ZWIA 1KIPA 2GSGB 3M17B 2AV7B 1DBJH 4XC1H 2NYYC 5ECJE 5EOQL 1MCDA 5JOPE 4MD0A 4CVWA 4CW1A 2GK2A 1Q9KA 4YHZH 1O0VA 1NC2D 2VKWA 2YR3A 1BM3L 3OXSA 4I0PC 4OD1L 3QIUC 5HYSG 2L7JA 2B7DT 2VSCA 1CFNA 4GRLD 4W70A 4N0UB 2DWEA 3AU1B 4WI3A 4FOMA 1FV1A 4Y8DC 2PW1B 2Q7YA 4L29A 3B9KB 2B2XL 3IYLW 1H15A 5JXAL 3CCHB 3DIFA 5IB3B 4ODBD 1CU4H 2V7NB 2W9EL 3FQUB 4JN1H 3ARGD 5D6CA 1BQHA 1HEZB 2D7QA 1ZK9A 5IBLC 5CEZH 3WIIL 3QDGA 3TH3T 1JE6A 2O5XL 4M02A 4YHML 2AK4D 5F7YC 4M93B 5I1JH 1Q9OA 4MAUL 4C56A 1SHMA 4D9LH 5GRVK 3EHBC 1MREL 5I74C 1TVBA 2J8OA 5IR1B 5J6GA 3VMNA 3U9PH 1A3RL 4HS6A 1UJ3C 3GJFK 4DVBB 1MCRA 3QWRD 3UC0H 1D9KB 2PCPA 5D96B 1N6QH 3OAZK 4KVNH 4LGRB 4TSAH 1PGRB 5INDA 1FAIH 3CSYB 3EFFB 2AJ3A 3VGEA 2VDLL 4CADB 4GW5A 4OB5L 5IB5B 3T0XA 4K3DH 3FN0H 7FABH 1SBSL 1KCRH 4HIEB 4ZXBD 1JHTA 3HI5H 1NMAL 2FJGA 2B0SH 1T20B 3WD5H 5E5RB 1CK0H 1A7NH 3QDGD 4ONHB 1BQUA 2OS7A 3OJ2C 3O9WC 3VE0A 1HXMA 3RHWK 1QFWH 2K1MA 2UV3A 4PRIE 1IMHC 3TM6A 3V5KA 1ONQB 2C4XA 1YN7B 2R0ZL 2UZXB 4YO0A 5CEZE 3EGSB 2R4RH 3RNKB 1AXTH 1IT9L 2C26A 4OM1L 1NBVL 4U6TA 3D3VB 2I60L 1P7QA 3WFHB 5KSAC 4PJGE 1TIUA 1T5XA 1F5WA 4QYOA 1FNLA 2V9RA 5GS3A 1A6AB 1CXEA 3G9AB 2Y4SA 2XY2A 4TQEL 5BS0A 2X42A 2H8PA 3U0TA 5IMOA 5FK9B 5DZLA 1U58A 4FABL 4NHUA 1NCCH 5HYSA 3TT3L 1UWGL 4RZCA 4R97B 5J8OA 2VZVA 5C6WH 4MYWB 1I9RH 4WEUD 3U4BL 2HRLA 1AGBB 5T1KB 3P0GB 5EORL 2AV1B 4RX4D 5C0JB 1UZ6E 5I15L 4K2UH 5CEZD 1CXLA 1TETL 3FO0L 3JUYA 4LCYB 4GXVL 1DZBA 1VEMA 4O5LL 1EEQA 2MFNA 4YDIL 2AKRB 4WY7L 2YUVA 5AAMA 4P5KB 5JIHA 1J05A 1ITBB 4QT5A 1FE8L 1NC4B 5HHNB 5IESH 5SWZE 1MCIA 2NY3C 3VXQA 3LSOB 2HH0H 1HKLL 4LCWE 5EO1A 1MJ7L 1BGXH 4MGXA 4YXLH 5DRZA 5I75B 1XF2B 4XPAL 1NJ9A 3RX8A 5IROA 3HR6A 4F2MA 5I1KL 3BKML 4JDVA 3BEVA 2FEDD 1VFBA 5EPMB 4LCUA 3S96B 2A6DA 2YC1A 1J87A 3U30B 4XC3H 3IDGA 4LHJB 1VPOL 1FORL 4YIQA 3U7YL 4JQVC 4GLRH 5ADPL 1X3DA 3H0TA 1HZHH 1RUKH 1IRAY 4XCYA 4DGYH 1MFCH 3STZB 4UTAL 2Q3AA 2YEZB 2MHAA 4PRNA 1FFQA 4GFTB 4AENB 5HYQA 1PLGH 5DJ6B 3LQZB 2DQFB 2XRAL 4LL9A 4MJIB 2VXSL 4YUEL 2FEEI 3PDOB 5DQDL 4D8PA 2C3VA 1F90L 2CRIA 4LCWD 3UAJD 1XR8A 5EBMB 2FBOJ 4WI6A 5FGCE 4EVNA 4PLJC 1CFTB 2OTUA 3RPIB 4F58H 1NPUA 5AG8A 1WBZB 3P9LB 1ETZB 5CSZA 2OR8A 5JA8B 3UZEA 1OAKL 4NT6A 3VW3H 1G7PA 3L5XL 3OR7A 3BPNB 3MLYH 5J12B 3VFRB 4BZ1L 3TBSB 3NVQA 1G6RA 3UCRA 5HHVH 5HD8C 2R1WA 1H5BB 2HJLA 3A6BH 3FQTB 2YD7A 3RKPA 2DKSA 1LO0L 4ONFL 1U8PA 2BOCB 1DFBL 3JV6B 4LPTA 3ZKND 4JY4B 4MHHG 1T5WB 3S4SB 2FCBA 4OAWB 1HE7A 5F97E 1DQJB 2BZDA 1NC2B 4R6UA 4DOHE 4OLYL 1ZGLB 4JFEA 2Z91B 3HS0A 3MBXH 3ILPB 1MJUL 1EMTH 1MWAL 1QYGH 1SJHA 2DYPD 2P8MB 2BJMH 5GGSB 3MJ8A 1FLTX 2AJUH 3L3JA 4JANB 2HJFA 1T0NA 1EERB 3U2SB 3KHQA 2FBJH 1FH5H 3NH7H 1KT2B 3PUCA 5KS9E 1F3JB 2B2XH 5F7MC 3RBGA 5IFAH 3ARGB 4Y4FC 4FQXB 1KC5H 4Z7NF 2P8PB 1E4KC 3ARUA 5LG1A 4Y5YA 5IK3A 1SMOA 4LCCB 5MI0C 5GGTL 2RFXB 3F5WB 2VR9A 2FO4A 5IGXH 1MJ8H 3IU3A 12E8L 5F6HI 2AK4B 3WIIH 1BMGA 2DQJH 4L8DB 4W68A 2E9WA 4YAQB 1MQ8A 1FZMB 5F7DA 1ZWIB 5DLMH 3RVVD 1KIPB 2XN9E 1BLNA 1WCBA 3BGFB 5MEPA 3GMLA 4MD0B 4KI5F 3F12A 1Q9KB 4CMHB 4JFED 1I3RB 3OXSB 1DL7L 4YDKL 4X6FA 5DDHA 1S78C 3MRGA 5E4IA 5JR1L 3B6SA 1CFNB 1CLZH 2DWEB 5F1KC 1DQMH 5DVNA 1FV1B 4HWNA 4W4OC 4H1LA 2Q7YB 4L29B 3FJTA 1H15B 2ICWA 3CGTA 3DIFB 1VFOA 4WFEE 3V4UH 2IPUK 1F8TH 4Y89A 3FQNA 1HK6A 5D6CB 1BQHB 2C5DC 1X6LA 3QDGB 2P5EE 3HKFA 2JJSC 3AS2A 2K7QA 3V8CA 3O6MH 1Q9OB 1FNFA 1MQKH 4C56B 1HSBA 4S0SD 1JTPA 4X9IA 4TPRL 5JPMA 3QO1A 1TVBB 1R3IL 1BECA 5J6GB 1DVFD 3K4DA 3RWJA 5JNYA 4HS6B 4X8JA 4PJDA 1PX4A 4RGMB 3SO5A 3EBAA 2PCPB 4PJDE 5INDB 5EU5A 2AJ3B 2XWBA 1ITCA 3PF2A 25C8L 3OKMA 5DWUL 4X4XA 4GW5B 1C1EH 2D2OA 3TN0C 3V6BR 4EDWL 4JPVL 4HC1L 3S3JA 5KVEL 3L9RA 2P5ED 4RNRA 4LLVA 4IRJC 4UILL 1JHTB 4LARH 2FJGB 2CMRH 2GFBA 2WK2A 4PB0H 4R90L 3TT3H 1UWGH 1FGVL 3ET9F 4K3JH 3T1FA 5IOPA 3DGCR 2WMPA 1HXMB 1KLFA 2A0LC 2Z8VC 4U4BA 5LWYL 4D2NA 3KXFE 5DO2D 5EORH 3V5KB 4MA8H 1EFXD 1A3QA 4PJGF 4YO0B 4ACPA 1IGIH 1HH6A 1KCGC 4O5LH 1BWMA 4M7LL 4WY7H 3GMNA 2FX9H 3IKCA 4KWUA 1HH9A 2VZ3A 4YHOL 5B3JF 1T5XB 4NRXA 6FABH 3IDYB 3F6LA 2AEIT 5D7JD 1ZMYA 1IAOA 2VISA 3AM8C 5E6IA 1UYWH 3W11C 3X3GH 3U0TB 2H8PB 5BS0B 1C7TA 3LHPL 3QCTH 4JHAL 5BO1L 5IMOB 3MOBL 1MCJA 4PP1D 5K33A 4XNQA 5GJSL 1U58B 2E7CA 4WI9A 3U4EA 4NHUB 5HYSB 2BNRA 1NUNB 4RZCB 3OZ9L 5J11C 1JWSB 3U7YH 4PJ8C 2XXMB 4KAQH 3KXFD 2VLJA 3PDDA 2PYEA 2YD8A 4XP6H 3IDXH 1GRWA 4HZAA 3CK0L 1MI5E 3WO3B 1J05B 3NIDF 4QT5B 3T3MF 5EU7C 3SO3B 1LVEA 1T2JA 4NN7C 5HVHB 3VXQB 1JPFB 5F21B 5EO1B 4Z8FL 4JY5L 5DRZB 1IVLA 5DMGC 1NJ9B 3S88H 4BZ2L 2NY2C 4F2MB 1IZKA 1CR9H 4JDVB 3BEVB 3MV7E 1VFBB 5E6ID 4LCUB 2A6DB 3QEUA 2YC1B 1MFEH 3IDGB 3LKSA 3MJGX 3C08L 4YIQB 3WS6A 4O9HH 2OQJA 1I9EA 3WIHH 3H0TB 4PV8A 3T8XA 1FL5A 3MACL 1DQQA 4HWEH 4OGAD 4XCYB 2VLJD 4JO1L 3T0DA 4DTGH 2PYED 2MHAB 4PRNB 1MI5D 3I75A 4X80H 5HYQB 3GIVA 1DFBH 4KQ4H 2DM7A 4L9LA 2ZOKA 5AWNL 3SDYL 3HMWL 3TZVD 4D9QD 4D8PB 2C3VB 3WXWH 1CBVL 1KIRA 3MLRL 4G8FA 1E6JH 3PGDA 4YPGA 2J4WL 4G6KH 4N1HB 3I3EA 4EVNB 1CTOA 2OTUB 3KPRE 4EI5C 5D7IE 1T1XA 2DYPB 2P47B 5ACZA 3V6FA 1MJUH 3ARBC 4E41E 1MWAH 1VENA 5CSZB 2UY6A 1XGTA 4PS4H 1AGFA 4NT6B 5KVDL 1VSCA 1G7PB 3RPKA 3VMPA 3OR7B 3E3QA 3K2UH 3N9GL 4D0DA 1S9XA 4M3JA 3VXOA 1ZVYA 3RZCA 1G6RB 3WFCL 3UPRA 3LV3B 4HK3J 2R1WB 3L3OA 2HJLB 4OCSL 1WTLA 5FYLL 4EOWL 1YQVH 5J89A 1U8PB 4FXLA 4LNVA 2NY4B 5F7KC 2CLZA 4QRUA 1FLRL 3WIHA 4NNYB 5HYIA 2ZCHL 5D7LE 3RJDA 3K1DA 1NGZA 4H8WL 4CJ0A 4M43H 4TRPL 2B20A 4JFEB 3HS0B 1C8PA 1T7YA 5SWSA 5I1GH 5SX4H 1SJHB 4RWYL 3TA3C 4MX7A 1YQ2A 5AZEH 1WAAA 4KMTL 3MJ8B 5KS9B 2WUCH 4HX1A 3L3JB 2HJFB 1T0NB 1XCQA 3GKWL 4KKAD 4HJ0C 3SDCD 3DUSA 1MWAA 2EDWA 1MAML 5DJ2A 2VABA 4G7VL 1XGYL 3LB6D 4N0CA 4U3XA 1FZJA 4Y5YB 5IK3B 1MOEA 3REVA 1YPZA 4LK4A 2F5AH 2FO4B 3GMPA 5CEXA 1FYTE 2Q6WA 1D5MA 1FBIL 3BDYH 5GZOC 5F7DB 1BLNB 3U79A 1WCBB 5TDPA 5MEPB 3GMLB 5C0NC 3BN9D 3F12B 1RUPH 1DVFB 5GGTA 3CU1A 1KN2L 4IOFD 1TQBB 1RVFH 3PWVA 4HH8A 4X6FB 5DDHB 3PV7A 5FA4A 4UQ3A 5ESVA 3MRGB 5KTEL 5SWSD 3DVIA 3B6SB 1EHLL 2NY1D 3TVMD 3JWDL 3HTLX 1HI6A 4Q6IC 2VWEC 4KRPD 2VOTA 1XIWC 3C8HA 2C1OA 3P2TA 3BRFA 1BBJA 1YJDL 4CJ1A 3QJHA 1AR1D 2ICWB 4JG0L 1Q94A 1RZKC 3O81A 3EZ8A 2DI7A 2BVTA 3MGAA 3FQNB 1Z9OA 4OT1L 3V5DA 4WUUE 1OGAE 1FYTD 1NGPL 2H3NA 3O6KH 5ISZE 4UU9A 3DJ9A 5F7EH 2Q7NA 6CGTA 4KI5C 4HH9A 2EO1A 4R90H 1PEZA 2VDQL 3BJ91 1P69B 5JW4M 2A9NL 4QNPE 1HSBB 4BSJA 1EFXB 5JPMB 4GW4A 3QO1B 1F97A 1MIEL 1PD6A 1LO3L 3RWJB 4L3AA 4X8JB 5AUMA 4PJDB 5FDWA 2YD9A 2EE9A 1UT9A 3RVXC 3CFEA 4ODTL 1J1OH 1Z0MA 2WINA 4M7LH 4C58B 4MVBA 1NUFA 4K7FA 5EU5B 2XWBB 3VGHA 2VLKE 3LKOB 4X4XB 4U0QB 5A3ID 3P77A 4Y19A 1V8HA 5D70H 3L9RB 2R0LL 3SE4C 5IQ7H 4RNRB 1KIUA 4LLVB 1O7VA 1WWWX 4MNQA 1QNZL 5FFLA 2GFBB 3IDUA 2A73A 3BZEA 3RVUC 3T1FB 5IOPB 3R4DA 2UUDH 3OBAA 4ODHL 4X98A 4LPVA 2O5YL 3ZL4H 2AEPL 4UUJA 1HH6B 4RDQG 1TENA 2R23A 4XXDA 1M71A 1CVSC 5IW3A 4YBQC 2EIEA 4Z7VE 3CK0H 1HIMH 3IKCB 1HH9B 5GGUA 2VLKD 4P57A 3VFMA 4MVBD 5I17A 1TJIL 3MJ7B 3I9GH 4LQ1A 4ELKA 3LMJL 1UH2A 1VGEL 1JHLL 2DQDL 4HZLA 1IAOB 3QEGH 2VISB 5E6IB 4KMQA 1PZ5A 3PIQA 5JDJA 4Y19D 2VN4A 3O3BA 4XNQB 1ZHLB 3U4EB 4NJ9L 4HJGA 2BNRB 1YMHA 3MGTA 3BIBX 3PL6C 5DMKB 1WIPA 3C08H 3C5ZD 3OKOA 4APQA 3U9UA 2VLJB 2PYEB 5J3HC 3HC3L 5HSFA 1M05A 4JO1H 4ZO9A 4JEGB 3HNSL 1RJZA 3DTXA 3TLRA 5AZ2L 4RRPG 1WEJL 4YR6A 3MUHL 1VDGA 2Z93A 3ARDA 4GQPH 3LQAL 3H9HA 2J88H 1BVLA 4M1DL 4DKDC 4Q97A 3QAZC 3NFSL 3J7HA 3HPLB 3IF1A 5J06A 4TYUA 3Q3GA 2QHLA 4L3EA 3QEUB 4IRSC 5E2VH 1HILA 3LKSB 4PRHA 2XKSA 3ROOA 1D5BA 1J1PH 2ZPKL 4MAYC 2V9QA 3N9GH 2OQJB 1EEYA 4MA7L 3G5VA 1D7FA 4N0FA 1GGCL 4O00A 4PV8B 3T8XB 1FL5B 3WFCH 1DQQB 4G3YL 3DGGA 3DO3A 4APQD 4RWHA 1TVHB 4M7LT 5T5NG 2CQVA 1QBAA 4AZ8A 3I75B 4OZGF 2DLFL 4NQDA 2YZ1A 1G1YA 3GIVB 2X9YA 4NKDA 2QR0A 3DUUA 4WFGE 5ALBH 2CR3A 4L9LB 4JHBA 2ZOKB 2C4FU 4LFHG 2VZ1A 3HG1A 4QGTA 2OXHA 5D7IF 4H8WH 4HT1H 1UXSA 1KIRB 5IEKA 3AMLA 4G8FB 3PGDB 2QQNL 5CLTA 4YPGB 1P4BH 5F6HJ 2QHRH 3VWKD 3SKJH 1MH5A 3VD4A 5DJZA 1T1XB 5ACZB 3V6FB 1BF2A 2APTA 4NN6C 3KDMA 4GG6F 1XGTB 1AGFB 4L3ED 2J8HA 4D0DB 1S9XB 4PRHD 3VXOB 5KANI 3RZCB 3MBEA 3GKWH 3VG9B 3IB4A 4UIKL 3UPRB 3RDTA 3L3OB 2DIBA 3ZE1F 1XGYH 4V3EB 4G5ZH 3N1MC 4QXGL 4XCCH 2APWA 4WFGD 2CLZB 4QRUB 4I2XE 2XWJB 3ARTA 1JHKH 4NQDD 4PJIF 3MLXL 2EEBA 5ABDE 1NGZB 4PGDB 5IHUL 3W2DH 3GSQA 1N8ZA 3HA0A 4ETQA 3RWEA 2IH3A 4NQCE 3I84A 3RFZC 5SWSB 2NY1B 4HULB 4WNQA 3MCG1 1NCWL 1MNUH 5KTEH 1KJVA 4MX7B 3DMMC 4OKDA 1NFIA 1DP0A 2HT2C 3R1GL 1QRNE 1XCQB 4O51A 1P1ZA 2ADJA 5IKCA 1CI5A 4M7KH 1VCAA 1CGUA 3DUSB 1MWAB 4UBDC 1RPQA 4M03A 5DJ2B 2VABB 3RTQA 4Z7OF 3T2OA 1BHGA 3RDTD 1FZJB 3EO0A 4QXWA 4NKOA 3REVB 1YPZB 2EECA 4U1GC 5HHXL 1W8OA 3GMPB 3U6RA 1RJLA 1X5ZA 1OAUL 1D5MB 2Q6WB 1P7HL 1HHJA 4XP4L 3T77A 3FFCE 2D0HA 1NL0L 1OLLA 5TDPB 3TBVA 2YMXL 4NQCD 5KSUA 1N5YL 4F33A 3PWVB 2UZYB 4CUCA 5D93C 2UUDK 5FA4B 4UQ3B 5ESVB 5H2BA 1HI6B 2C1OB 4OZHA 1BBJB 5CD5D 3QJHB 4NNXA 3GSRA 4O58L 2MCPL 1L7IL 5DQJA 3WUWG 4RA3A 1CE1H 4GUPA 5C07E 4UNTA 3IS1X 3BT2H 2VL4A 3V5DB 2PTVA 3PP4L 4QRPE 4IM8A 5DHXB 4QNPF 5I8EA 2H3NB 3MJ9L 3WFBH 1T89C 4N90D 4UU9B 4BK4A 3GIZL 5F88B 4QOKA 2K9UA 2XQYG 3HE7A 2NLJB 4HH9B 4PJ7F 2VDKH 4HKBA 5FYKU 4KKLC 4PR5A 1HYSC 1SVCP 4GW4B 5FYJL 4JM4L 4CN1A 4TUOA 5LCVH 3C9NA 3SY0A 5K9JL 3HUJA 5AUMB 5FDWB 4OD3L 1TXKA 4Z7UA 1F6FB 5B8CA 4F3FA 1W72H 4WCYL 5CAYB 3CFEB 2VLKB 2WINB 3HUJE 2VQTA 1IC5L 5ACLA 4K7FB 3SDXF 5I8KH 1BD2E 2GCYA 2J8UE 1OAQL 2PO6C 1JPSL 3H9YA 1TJIH 1GIGL 3G6DL 3P77B 1F4AA 3D9AL 4LFHD 4Y19B 4P23C 4PJXA 3GSVA 3QWQB 3SJVE 2JJUA 1LP9A 3MUZ1 4MNQB 4JQIH 2XIDA 2A73B 2DIAA 4Z7QF 1GHFH 1DLHA 4CN6A 3WNPA 4NP4H 4QOKD 3E6HA 1K8IA 3HE7D 3NCJH 3ULUF 4PY8I 4X98B 2ZCKL 2VH5L 4OD2A 2AI0L 4LQFH 4Z7VF 4PJ9C 4KK6D 2ZUQC 1UWXH 4CU6A 2QJDA 1I1AD 4EDXA 1E6OH 3VD7A 2XA8L 3RY4A 4UUJB 5C0BA 2X40A 2R23B 4XXDB 1M71B 4EN3D 3HNSH 2R8SL 4LEOA 1X5XA 2AJYL 2BCKA 3QFDA 4YXKL 1QBLH 5GGUB 4YH6A 4P57B 3VFMB 2HMID 5I17B 5DD1L 3SN6N 2KUTA 1BJMA 3LQAH 4HZLB 5DA4A 5IWLC 1UJ3A 1PZ5B 3PIQB 2DDQL 4RGNE 4LOUD 1U8HA 4U31A 3B4NA 4LSDA 5K93A 2FX7H 1I7RA 2C4FT 1CCZA 2CPCA 4HJGB 1YMHB 3MGTB 3ZKQD 1NCNA 1U3HA 4OLWL 2QQLL 2NY0D 4KXZI 1YEKL 1NANI 2AEWA 3OKOB 4XPGH 4KRNA 5DUPL 4APQB 3U9UB 5FYKH 5L7XL 5IF0A 1M05B 3UTSA 5I71B 4IDLA 4ZNCD 1RJZB 1X6NA 5D2NE 4URTB 4Q2ZA 3NCBB 1EGJL 2FEEL 3RIFK 4YR6B 3N50A 2Z93B 2N7AA 3ARDB 3OGCA 3B43A 4RMWA 5DRWA 3H9HB 4ZUTA 5C09A 4KHXH 1RFDH 3IF1B 5I6XC 4OSUL 4RMTA 3A67L 2WWKO 4L3EB 4P2RE 4UB0H 1HILB 4PRHB 4DK6A 2IBBA 3NPSB 4BYHA 2FD6H 1D5BB 5F9OH 2M1KA 1EEYB 3G5VB 4N0FB 2WLZA 4HK3N 1H3PL 4HFUH 4N9GA 2D0FA 4IS6A 3JV4A 3DGGB 4XB8A 4GKZA 1FZKA 1S9VA 4HKZA 2FJHA 4I3RL 4FQQA 1D6VL 4DKFL 4OZ4A 5JIKA 2J5LC 2OL3L 5TQ2L 2EDBA 4NQDB 1V7ML 3I6LE 4Z0XA 4NKDB 2QR0B 2W92A 3AAZA 2BDNL 2VDOL 3HG1B 1TTUA 1NGXA 1EH9A 5DK2A 3EYSL 1OSPL 5T1LA 3WNOA 5IEKB 3FFDB 5FYJU 3LEYL 3U7WH 1YNTA 3OGOE 1MH5B 5DJZB 2XA3A 5F6IB 4R8WH 3S9DB 1N5AA 1JFQL 1IQWL 5C09D 5JLZA 3KDMB 2CD0A 3VRLE 4P4KA 5TPWL 2AXJA 3BYTA 5L6YL 5C08E 3SKNA 2VR4A 3MBEB 4OI9A 5L8KB 2RIKA 5MENE 3RDTB 3BO8A 5EO0A 4LU5L 4MXQD 1IC1A 2P8LA 1PY4A 2W59A 3RGVD 4GJTB 1E4WL 3I6LD 1EHNA 1L0QA 4JO3H 1KPVB 3OAUL 4UINL 3QUML 1JNNL 1OAUH 3A6CH 2EXWC 4H0HB 5FYKD 3GSQB 4NQCB 1N8ZB 4Z7WE 1J0ZA 3P30H 4ETQB 5T1LD 1B4JH 3RWEB 2IH3B 4IOSD 4J3WA 3DROA 2PXYA 4WNQB 3OMZA 1UEYA 1LMKA 2YA2A 4R0LC 3LPFA 1KJVB 4EI6A 1NFIB 1FFNA 2X4NA 5J1AA 4O51B 4M6NL 1P1ZB 2ADJB 5IKCB 3F8UB 2DBLH 3F62A 1PYWA 4JVPA 5EIQA 5GJTH 5HVGB 2I9LA 4TSCL 3RTQB 5HHPA 1KBGH 4K94C 3EO0B 4OIIL 5L0QC 1H9VA 4NKOB 3FB7A 4XCFL 1K85A 4KPHL 4F8QA 5HPOA 1OSZA 2NY7L 5BVPH 3U6RB 3AY4C 5GGRA 1RJLB 1I1RA 4NM8L 4KHTH 4Y0GA 4J12A 1HHJB 3T77B 4DKEH 2XY1A 5E6YA 3OG6B 4PG2A 8FABA 5J9PA 5EDXA 4M1CC 3TBVB 4LMQI 5CZKA 4LSUL 4KDWA 5EFIA 5KSUB 5EU4A 2DD8H 4F33B 1G9NH 2YBRA 5K9JH 5H2BB 2PXYD 1VFMA 3X13A 4AY0A 1KTDA 1UWXK 2XTJC 4OZHB 5IFHL 2BY0A 5DURB 2BSTA 4NNXB 1F2QA 3GSRB 4GS7B 1DDHA 1DJSA 3SQBA 4KY1H 5DQJB 1RMFH 5C2UB 1GIGH 4GUPB 4KROB 5DT1H 4GSDL 2Q8AL 4ELME 3L3HB 1A2YA 1GGTA 4LF3B 4B53A 4KKBD 4OF3A 4NJAH 4OF6A 4QOKB 4Y4KA 3HE7B 4JVUA 2CRMA 5L9DH 4HKBB 4M7ZB 1PG7H 4JKKA 1I1AB 1EUUA 1GGBH 4LLMA 3T0WA 5D1QC 3MODL 4KTEH 4TUOB 3C9NB 4EN3B 4PREA 3HUJB 1U8QA 4Z6AT 3MRLA 3I02A 2EYTA 4Z7UB 5B8CB 4F3FB 3GZKA 4WFFD 1CFBA 2X2YA 4X7TA 4YXKH 1MVUA 1B0WA 2GCYB 4UAOC 3ZTNL 5CCKH 5GRWA 1J0KA 3HR5A 4PJXB 3MRMA 1JF6A 1RZKL 2RB8A 3SCMC 3HFML 1ACYL 1RY7B 3GSVB 5C6PB 1LP9B 2NY0B 4IJ3C 1L8JA 3RWGA 4W4OA 4EQ3A 3EDKA 4Q74A 1MIML 1AE6H 1DLHB 2EKJA 4OLWH 4U0RC 3TYGL 5C70A 5EA0L 1FC2D 3E6HB 1A7PL 4Y4KD 3UTOA 2P49B 5LGKA 4OD2B 1U95A 1NSNL 4V3DB 4EZMA 1FPTL 4LSTH 3S98A 4LVOC 4EDXB 5L7XH 1MCLA 4HUUA 5DSCA 5C0BB 4Z9KB 4S1DC 1J0JA 3QA3A 4M62L 1B2WL 3SDDD 3T3PF 2GI7A 4LEOB 5BW7C 3QFDB 4ZSOA 2BCKB 1EGJH 1P4LA 5IVXE 4WW2A 1HWHB 3S36L 3F7RA 3E6FA 2X7LA 4XWOD 1A1MA 1FIGL 3MX0A 2IGFL 4KVCH 3UJIL 1UJ3B 1T1WA 5K9QG 3MV11 3NIFE 1U8HB 4KK5D 2DQCH 1RHHA 1I7RB 1KCSL 4OSUH 4I0CC 3ERYA 1AXIB 2DMBA 4XNUH 4JDZA 1U3HB 4YWGH 4WI4A 1DEDA 3JV5A 1JF5A 4WO4C 4LLDB 1N64L 3SKOA 3P11L 4LSSL 4ZS6D 1F11A 1LILA 5IF0B 3WJLA 1F6LL 5D2NB 1OW0A 1M4KA 5KVFH 3E0GA 1V7MH 4L4TE 4Q2ZB 7CGTA 3CVIH 1RK0A 2FB4L 2VE6A 1Y6NR 1VA9A 2ZKHH 4RMRA 3OGCB 5H8DA 5DRWB 5E7FA 5EUOA 4PLKD 4ZUTB 5JQ6L 5C09B 4X83A 3EJZD 4ZDHA 5L2JA 1EGJA 1U8LA 2VC2H 1DQDL 4OJFH 4XBGA 2CRYA 4S1QL 2X4QA 1QEWA 2DQHL 3M07A 2D4DA 4QLRA 5TPWH 5FA3A 3MRKA 4I48A 3KAAA 2PR4H 1ZAGA 4N9GB 5DFTA 4IS6B 5DMJB 3JV4B 4V1DE 2W1NA 3MA9L 4GKZB 1FZKB 1S9VB 4HKZB 4JHZA 3G6JA 2FJHB 2W07A 4B41A 4FQQB 2YWZA 4OZ4B 3Q6GH 4ZD3L 3GHEH 3ZE2E 4XNMA 4L4TD 1QBMH 2CK2A 3EO9L 4Z0XB 3KPTA 3KJ4B 3AAZB 1EO8H 4PJ8A 3TIEA 4MJ4A 4D3CH 5JW4R 4KZDH 5DK2B 5T1LB 1QFPA 3KPMA 3OHXA 1MFNA 4EKXA 3CD4A 1FAKT 3VRLF 1YNTB 4JRXE 2GY7B 1N5AB 4M93C 1IILE 5JLZB 4NZTH 4HMEA 4OZIE 2AJSL 4P4KB 2VXVH 4HUNB 4U1JA 4LIQH 2NY3B 3MV9A 2EDOA 3SKNB 2X41A 4M6NH 2PUQT 3SQOH 4MS8A 3BO8B 4NZRL 5EO0B 3MRQA 1A7RH 5C0CA 1GGIL 2P8LB 1D9KC 2DLTA 5D96C 1QKZL 5F9DC 1FGNL 1P6AB 1A0QL 5C0IA 5I18H 1DN0A 1R5IA 1N4XL 4Z7WB 4NM8H 4CNIA 1RIUH 3FMGH 1ZVHA 2JELH 5FAAA 4JHWH 1XT5A 1LEKA 4NN5B 2NW3A 4UQ2A 1FNAA 4J3SA 4UTBL 1HINH 4FQHB 4OI8A 1EEUA 2W0LA 2CKBL 3DROB 2PXYB 1OARL 4XNYL 5ELIA 3SGKC 4EI6B 4NO3A 1FFNB 1WV7T 2X4NB 5J1AB 3QH3A 2JKXA 2YK1H 4X6DE 4YBHA 1PYWB 1RZ8B 3LEXA 3MV9D 3M1BA 2L0DA 1DUZA 4G6JL 4ODVL 2I9LB 1CICD 1T0MA 3WJJA 3K74B 5HHPB 1RAMA 4OIBA 4QHNA 3L7FA 4LVHB 3HHRB 3B2VL 3FB7B 4N8PA 2JCCA 4S2SA 4PJ5E 3ELAT 2ZNWA 1KEGL 1OSZB 1J88A 1XF4A 1INEL 3Q1SH 5GGRB 1W0YT 4LIQE 4M1GL 5T5FL 4HWBH 3ZT6A 8FABB 5J9PB 1KGCE 3ZTJG 2EDLA 2VYRE 1TVDA 2Z31C 3EYOA 2R1XA 1AKJA 2FDBP 2P24A 5EFIB 5EU4B 4R97C 2YBRB 3IFLH 5AYUL 4XB7A 4PY8J 4RISH 3MXWH 1KTDB 2BNQA 1NAMH 5IB4A 4ELMF 4XMPL 1CXHA 5HI5C 2CRZA 2Z92A 4YGAB 4JB9L 4AQOA 2BSTB 1I9IH 1DDHB 2DI8A 1W2KT 4U33A 4JAMA 5DD3L 3FTGA 4PJ5D 3WFEL 1A2YB 4N0YL 2W0PA 4NHCL 1JVKA 3ESVF 4R4ND 2YZ8A 3VA6A 4FG6D 4HD9A 5I75C 2GITA 4Y4KB 4JPKL 1VB9A 1KGCD 2G5BA 5MEOA 3UDWA 2IADA 1F4WH 2NR6D 2XPGA 3JBG7 1WIUA 4PREB 1U8QB 3MRLB 3I02B 1MHHA 4RMSA 2EYTB 4U6HA 3EDDA 3VFUA 4KUZH 2DMCA 4M5YL 4FQLL 4NKMA 2EC8A 4MXWL 4PBVC 1IQDA 4WRLA 4X7TB 2A38A 1MVUB 2BNQD 1VFAB 3MZTA 1RIHL 1TZGH 5FEBA 1AGDA 5K9KA 3HR5B 1FIGH 3MRMB 4P9HC 1I1YA 1NGWA 5HXMA 4LLQB 4AG4H 4N8VG 1FO0L 4MDIA 5JXEC 5DK3A 2HAZA 1QSEA 2C1PA 3GBLA 1KCSH 4WFHE 5E2UL 2OP4L 5IBUG 3UTTA 3RWGB 2OJZL 2V5RA 1H3UA 3AROA 2HLFD 1QSFA 4XAKE 3P40A 3OPZH 1B0RA 1HKFA 3EJJX 2VXTL 1U95B 1MCPL 1YYLL 1AC0A 1J18A 1KSRA 2DQUH 1AJ7H 3P11H 3STBA 3DHMA 4HMCA 4OCRL 4QHLA 3BPNC 3DNKA 5J12C 4HUUB 5DSCB 2QV2A 3QBTB 3QA3B 4XMKL 3VH8A 4CVZA 1H5BC 4ZSOB 4TULL 4K9EC 1P4LB 3GI9L 5IVNA 4WW2B 3I6GA 3E6FB 2X7LB 1H8SA 4KDTC 1K8DA 1EDQA 5KJRL 5HYEA 1T1WB 4JR9H 4PJAE 1OAXL 5DZOA 2UWEE 5F93C 1T1ZA 1UFUA 1T2XA 1LDPH 1QFWI 2ZUVA 1J0YA 3GSNH 4OLVL 3FONA 2MNUA 4HPYH 4JDZB 2AAVA 2J12B 4I18A 4GKNA 5E2TL 2DQHH 1T1YA 2Y72A 5DD5L 3QR2A 4GRLC 3SKOB 4TUJA 5I1HH 4K23H 2HT4D 2NXYD 1F11B 3TNMA 3JWOL 3MA9H 4Q0XH 5MP6H 4ZNEA 3TJEL 3QCVL 3CVHL 3UZQA 1RK0B 4JZNA 3ARGC 3HLAA 1WVZA 2VE6B 3IDJA 3W0WA 4OGYL 1L6ZA 3QCUH 1AQKH 2V2XA 2YRPA 3LKNA 4LCCC 1J0HA 2ZCLL 4JJ5A 1OAZL 5ESQA 1MF2L 3MA7A 3P73A 1EZVX 5EUOB 3KYNA 1ZEAH 4ZDHB 2RGSA 5L2JB 1KYOK 1PG7W 4G7YL 1U8LB 1RIVL 3S36X 5LVEA 4XBGB 3BGFC 4YHLL 4ZFGL 5ACMA 2X4QB 1QEWB 2GK0A 3F58L 1Y0LA 1N59A 2N4IA 3OKKA 5FA3B 4CMHC 1L0XA 4A6YH 5D2LA 4XX1E 3GBNL 4IEFB 3MRKB 4Z77A 1F4YL 5FO8A 1WFUA 5HI4D 5HYJA 3UP1A 4NZRH 3G6JB 1MCWM 4OLXL 5HTSA 5GSRA 4FQJH 3X3FL 1QKZH 3DVFA 4XNMB 2O93L 3IJSA 5HYJE 3BP6A 3HB3D 2FX8L 3TIEB 2AEQL 4ZXBC 4UZGA 1KB9J 4PTUA 3B9DA 1QLRA 1Z6JT 3KPMB 3OHXB 1OTSD 3CDCA 3S3PA 3RL1A 4OZIF 4PRDA 5FUOH 4FHBD 1GZQA 1FCCA 4LKXA 2QSQA 5E2WH 4GLRI 1T7WA 4AL8L 4F7PA 4Q9RL 1X4YA 5DHYA 4HXBL 1NUGA 3U4AA 2FATL 4K71C 4U1JB 1FSKB 3MV9B 3FQRA 3W5NA 3VXSA 4NFBA 3NTCH 4QRQA 3E8UL 1CG9A 3TIDA 2IPKA 1IJ9A 3BZ4A 3QUYD 4G6JH 1VKXA 3MRQB 4RGMC 5C0CB 4PGCB 3VWJD 5HYJD 4ZUVA 1A6ZA 5C0IB 1KEGH 4R7NA 5JW5B 5CUSL 1R5IB 4CNIB 2XTLA 3CMOH 4HXAL 3SPVA 4M6ML 1BF8A 2VZOA 2Y25A 5HHOA 1LEKB 2NW3B 4UQ2B 2NMSA 4X99A 3O2VH 2GHWB 2MPAH 3U1SH 5LGHL 3KYKH 3IFNL 5HHOE 4JJHA 4X6DF 4FQIL 2Y6SD 2CKNA 1CDYA 3EDFA 1CQYA 5TH2A 1T21B 4NO3B 1BOYA 4ONGL 3QH3B 4MA1B 2CKBA 3V4PL 3LEXB 3IXTA 3M1BB 1DUZB 1RK1A 3QXAA 1T0MB 3GNMH 4JG1L 3MUGB 4QHNB 3L7FB 1CWVA 1GJIA 5E2JA 3WFEH 2CLRA 2JCCB 4LEXL 3DHJA 4S2SB 3V6OE 4YFLI 5F3HA 1XF4B 5KAQF 3ZE0E 3V52H 5JHDE 3TPKA 1G7LA 3KYOA 4GRWH 3BRDA 2L7UA 3UJJL 3SGEH 2FEDC 3EOAA 1UA6H 2ICWI 2H1PH 1IKFL 4PJEA 2J3SA 4YHKH 2FL5A 3EYOB 5TGBA 2R1XB 1AKJB 2P24B 5HHOD 3DVGA 4G8GE 3T2QA 4PJEE 2V17H 2BK8A 4XPFH 3HZVA 3C60D 1BBDH 5T3ZH 3WFZA 1V3LA 5JPNA 1AQDA 2BNQB 4M5YH 5IB4B 5C0FA 3ZSSA 3MRFA 2Z92B 1W0WB 3KJ6H 3QDME 1A7BA 1BQLL 4LVNB 1T66D 2AQ2A 1UB6A 4JAMB 1LE9A 3FTGB 4PJFE 3UAJC 3IU4L 3SO3C 3WBDA 1OB1A 2EDTA 3H42L 4PJCE 5HVHC 4GMTH 4K94L 1T22A 5TE7H 4UIMA 2GITB 3LEVL 2OJZH 5DI8A 5IROC 1HQRA 2G5BB 4JPIA 5MEOB 1RSFA 3KPLA 3F6IA 3VFOA 1FDLL 2IADB 4G8GD 2B4CH 2XPGB 3MC0A 1A7QH 3ZDXF 2R1YB 4XZUA 2DTML 1S5IL 1MHHB 2CO6B 4MXVF 3KPSE 5F9JA 2VDML 3VFUB 1ZLVK 4LPCA 5FCSH 4QRRA 4OF7A 4GRWE 4NKMB 1IQDB 5D72L 4MZ3A 3O3UN 1FNHA 1ADQH 2F5BH 3ZKNC 2NX5A 1AGDB 5K9KB 2X4SA 4I77H 4ZTOH 1RURL 2L4OA 1VESA 5T3ZE 1QA9A 4JREB 4MDIB 1M7XA 1I7TA 3UTTB 1QSEB 2C1PB 4GKSA 2C7UA 2HYMA 5IB1B 1R5WA 4KTYA 1FZOA 1JTOA 1WZLA 2ARJA 3SDAA 1B0RB 2NXYB 4NO5A 4DK3A 4YDJA 4NC0B 5KSBE 3MR9A 3HZYA 2WP3O 1FO0A 3K46A 2R4SH 4N1EA 5EZIH 5FYLE 5L2KE 2YUXA 4QHLB 3JWOH 2O5ZL 3O41A 4POYA 5CGTA 4DN3L 4HGWA 1RZJH 1SEQH 1WAAF 4CVZB 3CVHH 5IBTL 4QRRD 4ESKA 4PJAF 4K3EH 1OY3B 3I6GB 1K8DB 1G6VK 3H3PL 1H3GA 3EYFA 3RVVC 5ILTL 1YMMA 2NX5D 3ARFD 5T3ZD 1YPZF 5DUML 4MA3A 1T1ZB 5C8JB 5HHME 5IMLA 4GXUN 1T3FA 4ALAH 1UZ8A 2J7LA 3FONB 4KV5E 4I18B 4GKNB 3O4OB 5CEYA 1T1YB 1BFVH 4XPTH 3CDYA 4TUJB 3UBXG 5L2KD 4IRZL 5KVGL 4P23A 3SDAD 3TNMB 1SY6H 1V3MA 1U0QA 5JOEA 2DJ4A 2DRUA 2JJTA 5EZJA 3VA2C 2YWYA 1IE5A 4LLWA 1TZIA 2WUBL 1S9WA 2M2DA 3KLDA 4JZNB 4X7SL 2R29L 3HLAB 1BEYL 3FRUA 3IDJB 3W0WB 5E08H 4QY8A 3PDGA 4Y5YC 3L6FA 2V2XB 1T04A 3LKNB 2Q8BH 4JJ5B 4PJ9A 4XNZB 5ESQB 3MA7B 3P73B 3I6KA 1EFQA 2HRPH 3CVHA 3QZWA 3KYNB 5HHMD 4U1NA 1RUQL 3CMGA 3BKCL 3QPXH 1S7TA 4HF5L 1OT1A 4Q9RH 1C5DA 1TNNA 2GK0B 1Y0LB 1DVFC 1N59B 2F8XC 3OKKB 4PB9L 3SGDH 4HG4K 5D2LB 1ZTXL 2O26U 3QUYB 4R26L 1TQBC 1U8IA 4Z77B 5FO8B 2XICA 3UO1L 3NABH 4GXUM 4M00A 3NZ8B 5T3XH 4P9ML 3VWJB 2YS4A 5HYJB 4H88L 4Z18A 1NFDE 4IMKA 4XMLH 1WUNT 4ZS7L 5GSRB 4NZJA 3MFGB 4LSVH 3IJSB 3BP6B 5DHVH 1KULA 2E7LE 3OJDA 4J1UA 3GJEA 43C9A 4LDEB 4PTUB 1MRDH 1QLRB 1RZFL 1W8NA 5I1DA 3CSPA 3HI6L 4HJJL 3ULVH 4PRDB 4U1HB 1JNLL 1GZQB 2R69L 3HCVA 4LKXB 4FNLL 3LAFA 3T2PA 3BMVA 4F7PB 5DHYB 5DO2C 2D9CA 4GKOA 1REIA 3TPUE 4KK9D 3QIBA 4POZD 4NOBA 3FQRB 3VXSB 4UT7L 3WIFA 1QRKA 1CG9B 3TIDB 4JFDA 2IPKB 2CGRH 3BZ4B 3V4PH 1YEIL 2HTKD 3PXHA 1LK3H 4ZUVB 1SJEA 4EBQL 1A6ZB 4HHAA 4R7NB 4NIKB 4OQTL 1AHWB 2F54E 2DJSA 4WI8A 4QXUL 4Y1AE 3SPVB 5KBNC 2P4AB 4PP1C 3QEHA 1UXWA 1IGCL 4HPOL 5T3XE 5HHOB 1BJ8A 5DHVA 5EC2A 3UBXA 4X99B 3QO0A 3NZHL 3QUZA 5DMYA 3C60B 3L5HA 1OCWL 4I9WE 2Y06H 3BJLA 2A6IA 3M8OL 2A9MH 3P0YH 5EBWA 3CZFA 3CNKA 3ZHKA 5IG7A 2WANA 3D18A 5H94A 3ARZA 3TO2A 2CKBB 5T1MB 1OAYL 4OV6F 3IXTB 3ULVE 3D39A 1RK1B 3QXAB 5CHNA 3ZE0F 1G84A 2E9IA 1A4KA 4Z76A 3BSZL 1AO7E 4JFDD 4L4VA 1S7UA 2ARJQ 4NN6B 3D39E 5CBEA 2CLRB 1ZLSH 3MGOA 5F3HB 5I30H 2PNDA 4Y1AD 2VQUA 4QTIL 4QHUA 3RAJL 4UV7L 1G7LB 4QHMA 4YX2H 3I3DA 3KYOB 3EOAB 5E6IC 5T3XD 3VFSA 4MQSB 3NGBB 5SX4I 5I0DA 1A7OH 1NLDH 4PJEB 4KZEL 3T2NH 4KJQD 2FL5B 4NM4H 3C8DA 4BSWA 3DVGB 1CLYL 4JDTL 5KVMC 3TBWB 1V3KA 4EUPG 3QFJE 4AMKL 3N85L 1U93A 4R4FL 1CGWA 3HZVB 3QUZD 5DD0L 3HC4L 1UACH 3DYMA 4F37K 4C59B 4OGAC 5JPNB 4HS3A 1AQDB 3PWPE 1MLCA 2BVYA 5C0FB 2J1KA 3MRFB 5D5ME 3ULVD 3RX7A 2RJMA 4G9FE 4PJFB 1KJMB 4FZEL 3D25A 1AO7D 2VXUL 2W38A 3WXVL 3TZVC 3D39D 1LE9B 4F7TB 4YK4B 3BOVA 1ZS8A 4XP1H 1OB1B 4WTZG 4R0LA 4L4VD 4P49A 4U49A 2B39A 1T22B 1GYAA 4UIMB 1CE6A 5TFSH 3T0EE 4OFIA 4JM2F 1QLFA 5T1DL 5DI8B 2V6HA 4PY7A 4M5ZH 1HQRB 4JPIB 1S5HA 3KPLB 3VFOB 1BAFH 5C0EA 4XZUB 1GAFL 3WS6C 3BD4A 4LP4A 4ZUWA 1NMBH 5F9JB 1A8JH 2EO9A 4DN3H 4QRRB 1GC1H 3PWPD 1K5NA 4S1SL 5JHLH 1CGXA 3ES6A 2CXGA 4EUPH 5D8JL 2NX5B 4GAGH 4HGKC 1WC7A 2X4SB 4L9LC 5HI3D 4J23A 4FXKA 5C2BH 1QA9B 3T0ED 1DBAH 4GKSB 4ODSH 2C7UB 5GRUL 2ESVE 1BOGA 4OFPA 1R5WB 2IMMA 3TP4A 1FZOB 4ZOBA 3K8LA 5HBBA 4YQXH 3TJHD 3DLQR 3REWA 4HBQA 1G7HA 3SDAB 1UCTA 4NO5B 4YDJB 3MR9B 1R3JA 3HZYB 3OTTA 1RHFA 5FGBA 1FO0B 1A6UL 3VXUA 4I13B 3BE1L 2YA0A 4JCMA 4LASH 4Q6YA 2VXQL 5CSGA 3BVNA 3AC0A 3O41B 3E3QC 4KKAC 1PW3A 3OSKA 5KW9L 3BGAA 3VXUE 3VG9C 3LB6C 3QQ9D 4AH2B 3NCMA 2X10A 4JZJA 5IVOA 4CDHA 3O6LL 3GMOB 3DURA 3AS3A 4Y8AA 2GJ6A 5HHMB 4KV5F 2H32A 2ARWA 1CLOL 4FQ1L 3EYFB 2EIZA 5CIPH 2E8YA 1MSPA 2DQIH 1LWRA 4MA3B 3FT3A 1RUQH 2JB6A 5IMLB 3BN9C 2ESVD 3BKCH 4EUPA 4XRCA 4KRMB 1T3FB 1UZ8B 4IOFC 1Q0XL 5CEYB 4GRMA 3O4LE 1B6DA 1CS6A 1TLKA 1ZTXH 3SOBL 2NY1C 3TVMC 4CRPA 4ZUSA 1KELH 3UO1H 4KRPC 4P23B 1QD0A 2Z0BA 2WNGA 5ANMA 2LE9A 4KFZC 3BKYL 5EZJB 3WFDL 3FN3A 4ISVA 5IB2A 1AR1C 3VXUD 1CXFA 1NQBA 5T5NF 2A77H 1TZIB 4LLWB 4MQTB 2EEDA 4WTZA 1S9WB 1T03L 3FRUB 3DVNA 3ALPA 4QY8B 4N0CC 3L6FB 5CJ5A 1T04B 4P3CL 1TTGA 4KDVA 4PJ9B 4OTXL 3I6KB 2GJ6D 1WBYA 3VXMA 3CVHB 4OI7A 3QZWB 3QXDA 1AY1L 2BRQA 2BVQA 2JB5L 4U1NB 4PLJD 3HMXL 1S7TB 2DJUA 4LLYA 3X14B 4TSBL 1C5DB 3SHSA 2F8OA 5CJOH 1XF3A 1AR2A 2AABL 2FGWL 3BIAX 4UOJA 5GS0L 1U8IB 1BVZA 4UT7H 1CL7H 5J56B 5ESAA 4EIZC 2R56H 3THML 4Z7UF 1ZV5A 1MRCH 4WHYG 3GRWL 3QEQE 3QHTC 1IC7L 4CN4A 3QSKB 3OJDB 4Z0BH 4J1UB 1NDGA 2CDFA 3GJEB 43C9B 3L1OL 2QTEA 2NTSP 4MQXD 2HTLD 2UVFA 4NRYB 5I1DB 3CX2A 2GJZA 5FHBL 3MV8A 4HCRH 3WLWD 3RY5A 4DCQB 3HCVB 5C3TA 4G80A 2RHEA 3VXMD 2XZAL 1PBYA 2ICWJ 3MV8E 3W5MA 3GM0A 3QB7C 3M8OH 4PJHA 3MLSL 2YOCA 3QIBB 4HW6A 1JGUH 2HKFL 2HKHL 3WIFB 4JFDB 4XVTH 2A1WL 4YPJA 1BFSA 2GSIA 3BI9X 3BSZH 2GQHA 4MVBC 4Y4FD 5E70A 3LH2L 1ZA6A 1MFAH 4X6CA 3WNLA 1YA5A 2X1PA 4Y1AB 1SJEB 4HHAB 3N1FC 5J57B 3DOSA 3ZDYF 3KPNA 2OXGA 1B4RA 1A14L 4HWUA 1FP5A 2JLLA 3MJ6A 3QEHB 1UXWB 2BMKA 2JE8A 4OLZH 1U3YA 2ED7A 4DVRH 3H9SA 5DHVB 5EC2B 2DQEH 5MHSD 3N0PB 4WHYH 1KN4L 5DRXA 3UBXB 3QO0B 2MQCA 3QUZB 3C5ZC 4OQTA 3MV8D 5JZ7D 3GHBL 4Y16A 4ZOEA 4AMKH 2A6IB 4F8TA 1TMCA 5I1AA 3CCHA 4NZDA 2CJUL 3QUXD 3CZFB 5EBWB 1OP3H 2F58H 5IG7B 1A3LL 3D18B 5H94B 2DWDA 4OF5A 4NPYA 2Y07L 4JPWH 3TO2B 3D39B 2XQBH 2AJVH 4M9OA 5CHNB 1A4KB 4Z76B 3IS0X 1UM6L 3HC0A 4MCYA 1ED3A 4U05A 4BQ6A 2F8VA 4L4VB 1S7UB 5CBEB 1DBJL 4XC1L 4ODXA 5GGVY 2P43B 4YHZL 2WLYA 2BVEA 4QHUB 4ZODA 5IR1A 1KTLA 4O2FA 4BFEA 4QHMB 1MHCA 2NTFB 3RUGA 4BJLA 3VFSB 4HBCH 1NMCB 4JKPH 4FTVE 5ALCH 4JRYA 4BSWB 1IFHH 3RL2A 3H9SD 1CGSH 3WHXA 1U93B 4APQC 3PWLA 4UV4H 3LRGA 4PP2A 3O6FA 5TE6H 4HS3B 4Y16D 1CU4L 3EZJB 3ULSA 1MLCB 1GL4B 5EU6E 5CEZL 5I66A 1INDH 3F7YA 3QRGL 5E9DE 5A2JH 2DLGA 4RBPK 5I1JL 4R3SA 3T65A 1ZS8B 3SGKA 3BPOB 4R0LB 2ZJSH 3LRSA 4D9LL 4Q7DA 3D0LA 3VWKC 4JGUA 3VGGA 1CE6B 5ENWA 4V2BA 3PHOA 1QLFB 3U9PL 2VN7A 4LAQH 4PY7B 5ICYA 4FTVD 3UC0L 5DQ9A 5B38G 3S8WA 5K9OA 1T2QH 1N6QL 3J8F7 3DSFH 2A0LD 4KVNL 4WEMB 5C0EB 4TSAL 1A6UH 3MLWH 1FAIL 3NPSC 1A6AA 4ZUWB 5E24E 1R0AH 1DBKH 4K7PY 3UTQA 4K3DL 3FN0L 4CBPA 7FABL 2ITCA 9CGTA 1KCRL 1K5NB 3ES6B 3O6FD 1K6QH 1Q8MA 3HI5L 1BPVA 35C8L 3MZGB 3LPGA 2B0SL 3WD5L 2Z31A 5E8DH 1CK0L 5KN5A 1A7NL 5EU7E 3RY6A 2LV4A 3OF6A 4J4PA 1C12A 2R0KH 4JFZH 3MXVH 1WC7B 4N5UA 3MRNA 3WNKA 2AP2A 1NCDH 4FXKB 1QFWL 2C3GA 1WK0A 3QXTA 2LU7A 4TUKH 5T1KA 4LSRH 1GZPA 1BOGB 1ZANH 3OAZH 3C6LA 2R4RL 1J8HA 3U0PA 1AXTL 4FQPA 5FM8A 3REWB 5F6IC 1G7HB 4GAYB 2K7PA 4X5XA 3W9EA 4H26A 3VXUB 4J3OC 1N3NA 3BVNB 3A6OA 5BV7H 1GGYA 1X9QA 3BD5A 4LVEA 3MBEC 3X17A 3G04A 3VFGH 3R06A 3RDTC 2YXFA 3F65A 4JZJB 3B9EA 4NUGH 3BISA 3DURB 5EUKA 5A16B 4LHUA 2GJ6B 2R2HA 1NCCL 5F1IA 4E9LA 3H3BC 4OTXH 2EIZB 4ZO6A 1KFAH 1I9RL 1G7MA 3OF6D 4J4PD 3TNNA 5C0RH 5E8PA 1AY1H 2JB6B 3HI1A 4EUPB 4XRCB 4K2UL 5LXGH 4GRMB 2FNBA 3MUY1 2NPLX 4YDVA 3GJFA 5GS0H 1B3JA 4H8WC 4ZUSB 2DQFA 1DLFL 5DEGA 5IESL 1RUAH 5ANMB 4QWWD 5CD5C 5IB2B 4ISVB 2HH0L 3QQ4B 5EBMA 4YXLL 1BGXL 3BQUA 4OGZA 3V7MA 1GVIA 3T0VA 5I8OH 1CQKA 2ZWLT 3DVNB 3JXAA 4P3WA 1BX2A 3MSPA 1ETZA 4XC3L 5J7CC 3MLZH 3IKKA 1ND0A 3FHQA 1WBYB 3VXMB 2OTWB 4ODWA 3PV6A 4WDIA 4I0KA 2BVQB 4JFXA 1S3KL 1HZHL 2DS4A 3K81A 2XZAH 4LLYB 2VLRE 5E95B 1H5BA 4DGYL 2DLIA 1XF3B 1QFUH 1ZHBA 1PLGL 5CJXA 3ARSA 1JYXA 2OBGA 1NUDA 3E2HB 1EAJA 3O3EA 3HMXA 5E99H 3KS0H 5DJDA 5ESAB 2BOBA 4QRTA 1DQJA 4NQEE 3S97C 1MVFA 1H8OA 4GS7C 3VD5A 3ARWA 3BQUD 4F58L 3T08A 2EH7H 4KROC 1NDGB 2CDFB 3L7EA 5ITFB 4NNPH 4GRLA 4BFGA 3JWDC 4C4KO 3VW3L 1E0OB 1YJDC 2GJZB 3MLYL 2FO1A 4PUBH 3MV8B 2UY7A 3HE7C 4OZFG 4G80B 2AW2A 3LS5H 2EDNA 5EOCH 5HHVL 3RVTD 3OKYA 4M7ZC 2BNUA 3PXJA 4KK6C 2VERN 4PJHB 3S35H 1I1AC 2YRZA 4X9BA 1HHKA 4Q9BA 4UMGA 3S5LG 3CH1A 2ADFL 1LNUA 4EN3C 2QQKH 2Q86A 2VWEE 1MY7A 3ARRA 5B8CC 2GSIB 4Z7NE 2KQNA 5DC4B 2Q3ZA 2HMIC 4NQED 1DCLA 1ZA6B 4OBRA 1IAKA 4X6CB 4ZFFB 3K7UA 3N1GC 2PN5A 1S7VA 2ERJB 3MBXL 3KPNB 1EMTL 3QWRA 5GS0D 1I3RA 1QYGL 4P0DA 4NWUH 2BMKB 4KJWD 4YC2B 2BJML 4KI5E 3H9SB 3WN5A 1FL6A 2AJUL 4AIOA 5DRXB 2NY0C 1X5AA 2FBJL 1FH5L 2DM2A 3NH7L 4M61A 5E03A 1UCBH 1G9MH 4Y16B 4WGWB 1TMCB 5IFAL 5I1AB 4AEEA 1KC5L 1YC7A 5IHBA 4ZXBA 3PHSA 4OQ1A 2DWDB 4KJYA 1CD0A 4NPYB 4JKLA 5IGXL 1MJ8L 4OZFH 1JNHA 2DQJL 2R0WH 3HC0B 3QRGH 4MCYB 1E4XH 1ED3B 1V5JA 4MLSA 5DLML 4X4YA 4N5EA 1VADA 5JOPD 4ODXB 1DQTA 5C7XH 1JGLH 4X4ME 4J8RB 1WWCA 1J12A 2IPUG 3DPBA 4FFVD 1MHPH 3U83A 3A0OA 1SM3L 1KTLB 2WBJA 4O2FB 4BKLA 1MHCB 2R2EA 4FTVB 4XCEA 4Y5VA 5CP3H 3RUGB 1JNJA 1QACA 5BJTB 1CLZL 5CLWA 1DQML 4JRYB 5F7LB 3RL2B 1QFOA 5GGVH 1U3HC 1DEEA 5BCAA 4Q9QH 3WHXB 4JFYA 4B0MM 3MYJA 3V4UL 1CDHA 3PWLB 1F8TL 4PP2B 1JPTH 3O6FB 1CN4A 2LTQB 3ULSB 3RVXD 4LCIH 3RJQB 4X9GA 3DX6A 5D2NC 2V5TA 5I66B 2HFTA 1Y18A 3ECBA 3F7YB 4DW2H 35C8H 5B39A 4RQQA 1FC1A 2YPVH 3VD9A 4PRIA 4ZOAA 3O6ML 3F7VA 4R3SB 3T65B 1MQKL 4RX4A 4LNRA 1I75A 3QNYA 3LRSB 4N5ED 4OZFA 5CJBA 3D0LB 5FB8A 3BUTA 2WQRA 5ENWB 3PHOB 2W0FA 3B2UD 5CBAA 3D2UA 3KYMA 4PLNC 4NWTL 4L4JA 2IAMA 5ICYB 2WBJD 4JO4L 5EWIL 4PJGA 3MLTA 3RVUD 3S5LA 5DQ9B 2KZWA 5K9OB 3R8BB 5ITBH 3GBML 4IIQA 2QSCL 3LQAC 5CP3A 5J4MA 3GUTB 1C1EL 3OL2A 3V79C 4MXQC 2MKLC 1HHIA 2R39A 3UTQB 3GO1H 3VMOA 5FXCH 2ITCB 4YBQD 4LSPH 3RGVC 5B3JE 5K59F 1KV3A 1URLA 2DKUA 3QYCA 3VGBA 4LARL 3QDJE 2CMRL 1OPGH 3Q2CA 4PD4J 4FFEX 2Z31B 2DLEA 5KN5B 3OKLB 2IQ9H 5LQBH 5TF1H 1C12B 3ZZ1A 4PB0L 4JKWA 1F2XK 4K3JL 1JWSA 3MRNB 3KJ4C 4FZ8H 4K7PH 1FFOA 4PRID 2V9TA 4P3DA 1MELA 1KB5H 5DJYA 1GZPB 4MA8L 2NNAA 1QVOA 4I4WA 3C6LB 1IGIL 1J8HB 1KCKA 3U0PB 1I85A 1LO2H 5J13B 2JJWA 3D2UD 4L5FH 5SWZA 5AG9A 5SX5H 2IAMD 4X5XB 3I3BA 3W9EB 2FX9L 4H26B 2V2WB 2DBJA 4LCWA 5C1MB 1DLFH 4P4KC 1N3NB 4HEME 6FABL 3CSGA 5J3HD 1JPFA 1YEFH 2VAAA 3ZLQC 3G04B 3EOTH 3R06B 1PKQE 3NIDE 4PLOB 4OFVA 3T3ME 2OLDA 1WWAX 1UYWL 3TH2T 3X3GL 3QCTL 3NMEA 1FRGH 5EUKB 4LHUB 2R2HB 5F1IB 4YE4H 1KCUH 3OJVC 2IPTH 2JCCF 1G7MB 1NBZB 3TNNB 4KAQL 1U2CA 2ZSVA 5E8PB 1QG3A 1EHXA 3HI1B 4NO0A 1S3KH 5FIEA 4WW1A 4X6EA 3IFPA 4MJ2A 4XP6L 3IDXL 4NN5C 2PXYC 4YDVB 3GJFB 2X4TA 3INUH 2QKIA 5CZXD 5DEGB 5SWZD 1HCFX 2VR5A 4XVUD 1OTTD 2EE6A 3DV6B 5INCA 3V4VH 3BQUB 3S88L 1CR9L 2DYPA 4LVHC 1JI2A 4KKBC 1BX2B 1I1CA 4ZPVA 5BV7B 1MFEL 5C0AE 5SV3A 5HDBF 1ND0B 3NCYP 4O9HL 4ODWB 3PV6B 4DUWA 4WDIB 3MRDA 5JUEH 4JFXB 3WIHL 3GEWB 4PG2C 5F9WC 3LV3A 4HWEL 1MCFA 1II4E 1OD7A 3FT4A 3G5YB 3C2SA 4NO0D 4DTGL 4XNXH 3MLVL 1ZHBB 4X80L 4KGJA 4X0KA 2ADFH 4XP5H 3O3EB 3OB0K 4KQ4L 5L88H 4NNYA 4NQEB 1SJVA 4PJBF 5I1CH 5DJDB 2ENYA 2BOBB 1C5CH 3WXWL 4QRTB 5HVFB 1YC8A 4GAJH 1E6JL 4G6KL 5E1HB 3BUYA 1KJ2H 5CJQH 3L7EB 1F58H 4GRLB 3SE9H 3AREA 1A6WL 2MWCA 1MUJA 4PS4L 1PDKA 1D5XA 5KS9A 3K2UL 2MCG1 2BY2A 4AYFA 4Y4KC 3NPZB 3FKUS 4NDMA 5K9QI 4HMDA 2BNUB 3MOAH 4RCAA 1CFVH 2ZUUA 1P7KA 1YQVL 3L3DA 2H6PA 1HHKB 3CH1B 2OZ4H 4Y5XA 1Q9LA 1LNUB 3KLHD 3ZYZA 4EIGB 2PYFA 2Q86B 5HGBA 2XN9A 2EC9U 4MNHA 1QR4A 4M43L 1RU9H 2X6MA 3QI9A 2DL2A 4XWOC 1IAKB 4NYLA 2YSSA 1V7NH 1J1XH 1S7VB 4NZUL 1DVFA 2H41A 3CXDH 5I1GL 1SM3H 4KK5C 1UH3A 1TJGH 5AZEL 2DQTH 2ZZUT 2WUCL 3ARED 1FL6B 3WN5B 4IDJH 4F7MA 2D03H 4Y4HA 1KJ2A 4M61B 4G6AD 1SQ2N 3FAXA 1AP2A 3CFCH 3QRFM 3RU8L 5F7HA 4XAWH 4X9HA 1QHOA 1YYMH 3QT2A 1M7IA 5FM5O 2P5EA 4ZXBB 3IDMA 4KJYB 2F5AL 5BRZA 3IAPA 3MRJA 4RMVA 1JNHB 2EYSA 3BDYL 3HNTH 5IW1A 4X4YB 1YEEH 5BRZE 2XN9D 1N0LA 1VADB 2FJFB 3QI9D 1RUPL 4R2GD 4WW2C 1EFXA 4PLKC 4ZOCA 2IBZX 4K71B 1AI1H 2W9DH 5F72S 1RVFL 2WBJB 3EJZC 4BKLB 2R2EB 4JFPA 4Y5VB 4XCEB 4BSVA 5GIRA 4ZYKB 2F19H 4NWTH 1JZ8A 4AEIL 4JO4H 5EWIH 3UMTA 2HP4A 3L5IA 3LZFL 1HYSD 2Z35A 1DEEB 3GBMH 1NCBL 4JFYB 2QSCH 1KXTB 4P59H 3VDCA 3LKOA 5D7JA 4Y4HD 3MYJB 4WFED 3NAAH 5SX5K 1BZ9A 1WTGT 5FUZH 3FT2A 4G6MH 3LRHA 4P2QE 4U1IA 4BELD 2Y9RT 5D2LF 3WJLC 3DX6B 5E4EB 1OW0C 5BXFA 3S37H 3O6KL 1GOGA 1MCQA 1Y18B 3ECBB 5B39B 3GFUA 3VI3F 4RQQB 5F7EL 5BRZD 3PJSA 1CDBA 1RQ5A 4PRIB 2X5PA 5CJ8A 5GQBA 3KXFA 1FNGA 5I1EH 3F7VB 2VLLB 4OCXH 4LNRB 3QNYB 5TJWK 4OZFB 5FB8B 2W0FB 5CBAB 3D2UB 3DXAE 3KYMB 2J2ZA 3PQYE 1ES0A 1OVZA 2IAMB 1QQDA 3BZDA 4PJGB 3MLTB 4U6VL 3S5LB 2M26A 1J1OL 4WGVB 2ITDB 2WSKA 4WJ5A 4HQQH 4IIQB 2XNAA 3SE8H 2X4RA 1R3HA 3UPAA 1J5OL 3DI2B 2IFFH 3MJ7A 1HHIB 2P1YA 5D70L 1L7TH 3PP3K 3L5WA 4AEHH 2AK1H 4XP9H 5IQ7L 5ICZA 1I7ZA 2F74A 4KC3B 3WHE1 2MMXA 3HRPA 5IHZA 1ZHLA 5DMKA 1S7SB 1FFOB 4P3DB 5ID1A 5DJYB 2Q87A 4RFNC 3ZL4L 4GO6B 2NNAB 3PQYD 1QVOB 1AIFA 1MI5A 2BVOA 4I4WB 3LD8B 2UZIH 5SWZB 4NC2B 1HIML 4ZMAT 5KZCD 3AS0A 3TZVA 5CGMA 4LCWB 5EN2B 1X7QA 3BIKA 4G8IB 1UB5B 1F02I 1I8MB 2PKDA 1U92A 2ZUTA 1FSKC 5E5MA 1YEHH 1CICC 3I9GL 2VAAB 1RJCA 2WWMD 4HS8L 4HLZG 4MZ2A 5CD3A 1MCHA 3MV7A 3QEGL 4MS8C 2D7OA 3QDAA 5C92A 4E42A 2Q20A 5DF0A 3HPLA 1U91A 2QADD 3TBTA 5CKGA 4PRPE 4JO2H 1RJYA 5DR5H 3EYVA 5I19H 2G9HB 5JW3L 1R24A 2C3XA 2ZSVB 3OXRB 4NO0B 4WW1B 4X6EB 1MPAH 3IFPB 4KJPD 3DRTA 1TVHA 4OV5A 1MCWW 1JMXA 3MLVH 4PDCE 1YNKH 3KHOA 2X4TB 4JQXA 1I4FA 2QKIB 5LAXA 5F1NA 5FGCB 3ZDZF 3KPRA 3ZYIA 5INCB 5D7IA 4OZGE 4EJ1C 1TNMA 2J88L 3EKCA 4MA1C 3LN4A 3QHFH 4L1DA 4E41A 4S0UC 3CLEH 3WJJC 2CO7B 3MV7D 3MCKA 2EC9T 4FG6C 4ZPVB 5E2VL 1A6WH 1JP5A 1X5HA 3MO1A 1VERA 4HLZH 1Q72H 1J1PL 1NLBH 4NQXA 2AXFA 3SDCA 3MRDB 1UQSA 5GHWH 3JVGA 1EO7A 4GG6E 2DB8A 5ADOH 3FQXA 3FT4B 1WFTA 4XI5D 5D7LA 5DZNA 3CU7A 4X0KB 5DVOA 1KEML 1UADC 5ALBL 4XXCA 5DC9B 3BGMA 2XWJA 4DOHB 4TVPH 1WT5A 4IMLA 4PGDA 3ZE1E 4HT1L 1JRHH 1XR9A 1P4BL 3O0RH 2QHRL 3KPRD 3SKJL 4P46D 3BUYB 4NZUH 3D87B 4PJIE 5F96L 1KJ3H 4LVNC 5IT2H 4E41D 1DBBH 3AREB 3BPLB 3TVMA 1MUJB 3WKMH 5F7WC 1RZ7H 1CD8A 1D5XB 2HLFC 2AJXH 1F00I 3CPLA 1KIQA 4L8SA 3AS1A 4NDMB 4OCWH 5D9SA 5F7NC 1JMZA 4P2OA 1Q1JH 3RU8H 4A2MA 3UDWC 1P7KB 3L3DB 4XGZA 2H6PB 4G5ZL 1FYTA 4XCCL 3B5GA 4Y5XB 1Q9LB 5C6TH 2PYFB 5HGBB 2XTJE 1JHKL 2XN9B 5D7LD 4MNHB 1I8LA 4Z7OE 5E5UB 3W2DL 3QI9B 4R2GB 5TDNA 1EPFA 4NYLB 2LAAA 2YSSB 1IEAA 1TTFA 1X5IA 2B5IB 1WGOA 4H0GA 1IARB 3NA9L 3P4OA 1LO4H 4Y2DD 2YKLH 1TJHH 3IXAA 1MNUL 2N56A 3BDXA 4HIIA 4AEIH 4JREC 5EZOL 2XZQH 4TVPE 4F7MB 4GH7B 3VU2A 4Y4HB 1KJ2B 3LZFH 4JGJA 1NKOA 4M7KL 1AP2B 4GBXD 4HIHA 1NCBH 1G0DA 3GK8H 3DBXA 5FKAA 4WUUA 1M7IB 1OGAA 2HT4C 2NXYC 4P2OD 5EBLA 2P5EB 2E7BA 3IDMB 4XBEH 5ISZA 3QG7H 3NFPA 3OX8A 4HGMA 3EYUH 4P5TA 1WICA 1FG9C 1IGFL 2R2CA 3IJYA 5GGSY 3WYRA 3S34H 5BRZB 5HHQB 4LPWA 2AS5M 3MRJB 1A1OA 2JK5B 1X44A 1BZQK 3ULUH 2EYSB 5IW1B 5LGJA 5F88A 2NLJA 4LDLB 4NRZA 1IGJA 2EKSB 3P4LA 1L6XA 4KKCD 4JFPB 4PJ7E 4BSVB 5GIRB 1D5IH 1SYSA 3Q48A 3S6CA 2QL1A 4TVPD 2EEAA 2Z8RA 4U6VH 3WSQH 3T0BA 2VLKA 5D71H 1G7QA 3N06B 1FYHB 1ORSA 1Q0YH 2Z35B 4I18C 3SGJC 3O4OC 3VDAA 2YHGA 5D7JB 5HI4C 2X09A 3Q5OA 1J5OH 1BZ9B 1CE1L 3FT2B 1B6UA 3BT2L 4WUUD 4U1IB 1OGAD 1FNEA 2EIBA 3VFWA 1AC6A 5E8EA 3SDXE 3CX5J 3WFBL 5BXFB 5ISZD 2JF1A 3HB3C 5ERWA 4P5TD 3G5ZA 4HLJA 3PJSB 1KPRA 1LK2A 4HUWA 3C5ZA 1DQLL 2VDKL 4KUCD 1S7WA 1FNGB 3KXFB 1XF1A 5JA9A 3RQ3A 4MSWA 3SGEI 4QRSA 3P3YA 1OTSC 4BM7A 5TQ0H 1ZT4A 1HDMA 3CDFA 4LRIC 4XNZC 5LCVL 4DKAA 4Z7VA 2VAJA 4Z7QE 1ES0B 2IANE 1Z2KA 1QQDB 1V3JA 3ULUE 1W72L 5HGAA 4WIQA 3O2WH 2GKIA 5IIEA 1P4IH 3WUZA 2HLAA 3WMSA 4WJ5B 2XNAB 1F4HA 5I8KL 2X4RB 1J7VR 1R3HB 2Q76A 4DN4H 2HWZH 3QUYC 1OTUD 4MNGE 2BHUA 4FFYH 2QADB 1OHQA 4HS8H 3L5WB 3VWJC 2NY6D 5ICZB 4RGOH 2Z9TA 1I7ZB 2F74B 4UT6H 2P5WE 1T83C 1IGMH 1F3DH 4JQIL 5IHZB 5FV2A 1GHFL 5A40E 2IMNA 2EDJA 4NP4L 3NCJL 5HY9A 5ID1B 5JW3H 5FCUH 4LQFL 3P4MB 5CZVH 4DZBA 1KF9B 1PKOA 4O4YH 2CK0H 1E6OL 2IAND 1AIFB 1MI5B 2BVOB 1YNLH 5D1ZA 2IG2L 4WEBL 1GPOH 1VGKA 3ULUD 1XCTB 1ZHKA 3CIQA 4WO4D 1DE4A 2DLHA 3TZVB 1IM9D 1QBLL 5D7KE 1X7QB 3BIKB 3N1QC 1RUMH 1U92B 3FB5A 4MMXC 5E5MB 2RCSH 1BFTA 4HFWA 3LKPA 3FO2A 1MCEA 3VWKA 4N0UE 5CD3B 3MV7B 4E42B 2P5WD 1U91B 3TBTB 2FX7L 3IDIA 4KK8D 1RJYB 3EYVB 5GS1A 1AHWC 4XPGL 1R24B 3KLSA 5FYKL 1AFVL 5CFHA 4CU7A 2JJVA 5LBSH 4O2EB 3DRTB 4M6OH 4OV5B 4ERSH 3SE3A 3C60C 1S7QA 5D1ZD 3PWNA 5D7KD 1I4FB 1KEMH 5LAXB 4X7FC 5F1NB 3T1WA 1OQXA 4LSQH 4CVUA 1JN6A 1T4KA 4YJZL 3KPRB 1QP1A 5D7IB 3TBYA 3FFDA 4LKCA 3LN4B 1T66C 3RKDD 4E41B 3K80A 4I3SL 1CF8H 3B9KD 4KHXL 1RFDL 5F96H 3MCKB 3TYFA 3UTPE 4H5SA 4UB0L 4K8RH 4RMUA 2FD6L 4H20H 3MO1B 4NQXB 5F9OL 2AXFB 1DANU 3DX8A 3SDCB 1UQSB 2E27L 4HFUL 1XMWA 3NGBC 3FO9A 3FQXB 4U1LB 5EB9A 3B3IA 4BQBA 4U3HA 4I2XA 3W9DA 3KPOA 5D7LB 1JWMA 2QLVB 3C6SA 1KPVA 3RWFA 3BGMB 5E6ZA 4J6RH 5CILH 2LU3A 4IMLB 4L1HA 4NQCA 1XR9B 5IHLB 2VTFA 3D3VE 3U7WL 3BH8A 3TO4A 4S1RL 4R8WL 3UTPD 2A83B 3FAWA 3NA9H 4RAVA 3TVMB 4YK4C 5C71A 1QRNA 1KYOJ 4KRPB 4AIZA 3KR3L 3ARPA 5EZOH 3S4SG 4GBXB 2BSSA 3CPLB 4L8SB 1KIQB 5D9SB 3SGDI 2XKUA 4P2OB 4RRPA 2NCMA 3FZUD 2G2RA 4HIXL 2EXYD 4P9HH 4XGZB 1FYTB 5F1SA 3CXHJ 4JO3L 1IGFH 3WNMA 3FFCA 4WUKL 3MNZA 3ZSTA 3UBXI 4J3XA 3A6CL 1LDSA 1A47A 2BRRH 4MDJA 5TDNB 4ZTPH 4BH7A 2CDGA 2ZUXA 1OGTA 4RFOH 3P30L 1IEAB 2XT1B 1B4JL 3P0VH 1XGUA 3ARFC 3P4OB 3X12A 2X1WL 3WNNA 1KB9K 3TO4D 4O02H 3IXAB 4L9DA 1IBGH 1TZHA 3BDBA 4HIIB 4ODUA 2H2PD 1QRND 1MFDH 4M48H 2DBLL 4FQ2H 4FQCH 5DJXA 1W0VB 4HIHB 5GJTL 3PGFH 1N7MH 5C07A 1U36A 3DBXB 4WUUB 5FKAB 1OGAB 3SDAC 4QRPA 1KBGL 1P9MA 4KQ3H 5EBLB 2D7TH 1UM5H 5ISZB 3NFPB 2BHZA 3L3HA 3OX8B 4K8RD 4P5TB 3IJYB 5FECB 4LF3A 2MJWA 2OTPA 4L8BA 3NFNA 1A1OB 4FP8H 5BVPL 3OKDA 4F9LA 2OR9L 4KHTL 5SV4A 3NN8A 4J3TA 5LGJB 4DKEL 3FFCD 1DQLH 1KLUA 2B4CC 4NRZB 2XZZA 1IGJB 1NC4D 5H35A 1I1AA 4MJIE 5T33H 2DD8L 1G9NL 3VCLA 1SYSB 3O8XA 4EN3A 5HDLA 3BEWB 4ZFZA 3OAYH 3ZT5A 1ZOXA 1BD2A 2J8UA 1AXSA 1G7QB 5JMOC 5SWQB 1ORSB 4TTDD 2ICES 1QOKA 4YXHL 4KY1L 2HFEA 1RMFL 2NY6B 5DEZA 5DT1L 5C07D 3SJVA 2KZ1B 2ORBH 2D7PA 4QRPD 1FNEB 1MCOH 2D7NA 3VFWB 4CVXA 5E8EB 2JJTC 5ERWB 4NJAL 1YY9D 3G5ZB 1KPRB 1LK2B 4HUWB 3C5ZB 2J6EH 5L9DL 4POUB 1S7WB 1MRFH 4P48A 1PG7L 4MSWB 4QRSB 3QIWA 3D1MC 1HHGA 5E0QA 3JWOC 1GGBL 3TWCH 1ZT4B 1HDMB 1RZJC 4KTEL 4Z7VB 3MRBA 4ZFOB 2IG2H 4WEBH 1NAKH 3V0WL 1IM9B 1F42A 5HGAB 5LKNA 3O8XD 5IIEB 1A6VH 4KK9C 4JCLA 4POZC 4JLRA 2HLAB 4M4RA 1YEJH 1BD2D 5F44A 1D5ZA 2Q76B 4M7JL 4LBEA 1FNSH 5DMIH 5CCKL 4PJHF 2HTKC 4J3VA 2MSPA 3T3PE 5DEFA 1W72A 3FOMA 4JN2A 5IFJA 4OM0L 4F9PC 4PIRF 3SJVD 4IMKC 4YHPB 1QPXA 5FDYA 1AE6L 5HY9B 1DSFH 4LLDA 4OFDA 2AK4E 4DZBB 3QIWD 2FZ3A 1T80A 4LSTL 1AFVH 5D1ZB 2J6EA 4FFZH 5D2NA 1VGKB 3WUWA 2X1OA 1IKNC 2VDRH 1ZHKB 4UT9H 2LAGB 5JIPA 1DE4B 5IW6A 1CFSA 2E6JA 1DANT 2HFGH 3QIBC 3FB5B 4YHYC 4HFWB 3O11A 3LKPB 3FO2B 2I5YL 3VWKB 1XGPB 1S8DA 3CAFA 1EBPA 4KVCL 4P2RA 4RGND 2E9JA 4I3SH 1OQOA 1OLZA 2DQCL 1P5UA 3IDIB 4FQXD 1A64A 1M6OA 1ZSDA 4OBSA 4XNUL 4J7RA 5GZND 5GS1B 4LPYA 4YWGL 3AUVA 3JTSA 4N0RA 5HGHA 4C83A 3QDGE 4MXQA 4KJQC 2E27H 2ZUWA 5JOFB 1C08A 4DGIH 2F15A 5GISH 3RGVA 1WFOA 3RUGF 1GH7A 4TVSa 2HN7A 5B4MD 1U6AH 5KSVA 3JTTA 3QUZC 5KVFL 1NBYA 1S7QB 5AEAA 4C56E 3PWNB 5BMFH 5H37G 1YY8A 3CVIL 2NQCA 3ROLA 3K3QA 4DWHA 4XPBH 3ULVC 2ZKHL 1JN6B 1T4KB 3T09A 3TBYB 4LKCB 5D7SH 1ZLUK 1KPUA 4S1RH 2X1QA 3WO4B 2VC2L 5KOVC 3TYFB 4H5SB 4P2RD 3QXWA 4OJFL 5C08A 4DGVH 3OKEA 3KR3H 3V0VA 1C16A 5MENA 1KXQE 5I0ZA 3DX8B 3HZMB 1X5GA 5EIIA 2PR4L 1M1SA 2AVGA 1DR9A 1NMCC 1XGQA 3FO9B 1N0XL 3B3IB 4I2XB 3Q6GL 2FECI 3GHEL 4HIXH 4C56D 3W9DB 1XZ0A 1A21A 3KPOB 5FO7A 3UTZA 1QBML 2PF6A 1JWMB 3C6SB 2X4OA 3BAEH 2P7TA 3RWIA 3QULA 3T0AA 3RWFB 1EO8L 4WUKH 1EJOH 4Z7WA 3HNVH 4D3CL 2YPLA 4KZDL 1LD9A 4P5MA 4GG8A 1QUNA 3VXPA 2E6PA 3QJFA 15C8H 1CIUA 2YPLE 4FXGA 3BH8B 3TO4B 5H37H 4LPXA 5HI3C 4FQHA 4BK5A 4RAVB 4NZTL 3T0EC 1QRNB 3QWOA 1ZT1A 3BPOC 2VXVL 4AIZB 4LIQL 3MPCA 4CU8A 5C08D 3TJHC 2BSSB 3JSSA 4K3HA 5BS0E 3RX5A 5MEND 3SQOL 4HG4J 3OAYK 1RZ8A 4NHUE 1A7RL 1CL7I 2G2RB 4WI2A 4N8CH 1JGVH 1FJ1A 1ULVA 2VUYA 3GI8H 4I8DA 3FFCB 1JBJA 3QQ9C 5I18L 3MNZB 4ZPTA 2OR9H 1RIUL 3FMGL 3VI4F 2JELL 4KI1A 4JHWL 4MDJB 4BH7B 3U0WH 2CDGB 5GGQH 1OGTB 2YPLD 1WWBX 3AVEA 1P7QD 2BFVH 4WU7A 1NGQL 1UKTA 1HINL 1XGUB 3X12B 3BPCA 2DL9A 2A6KA 2ZG3A 1TZHB 1G6RH 1TQCB 1YEGH 4ODUB 1P6FA 5BS0D 4XWGH 3BP5A 5GRYA 1CYGA 2YK1L 1P84J 5DJXB 5C07B 4ELMA 3ARXA 1UM4L 1NCAH 1LQSR 4YXHH 4KKNA 4QRPB 5E94B 1PSKH 1U2HA 5FGBC 2ATPA 2NY5L 3UYRH 1Z9SA 4L8BB 3NFNB 5DJ8A 3TT1H 2BSRA 3OKDB 3Q1SL 5FUCC 2FLBT 3L3IA 3NN8B 4HWBL 3CH8A 1CFQA 4H1LG 1KLUB 2WY3A 4G43A 2HA1A 3DSNA 4JZJC 1SBBA 4XVJH 5H35B 2E7HA 4F57H 3VCLB 1BQSA 1GC1C 3IFLL 3O8XB 3SDDA 5D1XA 4ZFZB 3VGAC 5IV2A 3V0WH 4RISL 3MXWL 1BD2B 1NAML 1IC4H 2J8UB 1QR1A 1AXSB 3CC5B 3PABA 1ERNA 4F7EB 2HG5A 1I9IL 1VFAA 3RHWF 4M7JH 4NFCA 2HFEB 3V6ZA 2D0GA 2EH8H 3SJVB 3MRRA 2R9HD 4LHQB 3F7QA 2KBGA 4OM0H 4CVXB 4LLQA 3VFTA 1IGYA 5EO9A 3QIWB 4MQXC 2HTLC 3W81A 1A5FH 2EDKA 2IQAB 2XZCH 1HHGB 3HE6A 4B7IA 1F4WL 4I5BA 3O3AA 5EOQH 3WLWC 4AIXA 3MRBB 4U6XA 2R15A 2GAZA 4H1LH 2X4PA 4FFWD 1BM3H 4JFEE 4KUZL 4OD1H 5IVXA 5D1XD 4JLRB 1DBML 1D5ZB 1RULL 1TZGL 4LBEB 2EYRA 4RGNB 2IJ0C 4WHDA 2I5YH 5DEFB 1W72B 3E2HC 3FOMB 4JN2B 2FWOA 5JXAH 5GRZA 5IFJB 3EW3B 4AG4L 3MMEA 1J9CT 2W9EH 3WKNA 3BKJL 4ZG1A 3Q5TA 3VRJA 2NY4D 2O5XH 3U82B 3CJJA 3OPZL 1HNGA 4YHMH 1LGVA 3BWUC 2CLVA 2DQUL 1AJ7L 2FZ3B 2G5RA 3HE6D 1FFPA 4MAUH 4CW1B 1IGTA 4F7CA 4L4TA 5JZ7C 3WUWB 1MREH 4OCYL 1PG7X 3CZJA 3D85A 3AB0B 3WV0A 1A3RH 3QUXC 5IW6B 5AD0A 1CFSB 1JPGA 5DVKA 3B83A 4JRWA 2CIIA 3O11B 4WV1A 2VDLH 4OF8A 5I1LA 1S8DB 5I2IA 2HFFA 4HDIA 4JR9L