3NFNA

Recognition of peptide-mhc by a v-delta/v-beta tcr
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Plasticity of human CD8 alpha alpha binding to peptide-HLA-A*2402
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nfnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3nfnA01
1CK0H 4S0TD 3UO1H 3KR3H 4JY5H 4M7JL 5AYUL 9CGTA 4NC1C 4QHMA 4GKNA 4PLKD 4BM7A 1PZ5B 1IGIH 4XC1H 4DGYH 3GB7A 2AGJL 1U3HC 3HG1A 1UC6A 3OGOE 5FO8B 2ATPA 5FYKE 3BISA 4LHUA 3B8SA 2APXA 2PYED 5ESAB 4NQDE 3BIKA 3BKCH 1EGJH 3GBLA 5FYLD 3VWJB 1XR9B 4NYLB 1ZLUH 1QLFA 3LSOB 3KPPA 5IMOB 4HJJL 4MVBC 5EU6E 1IRAY 2PETA 3ETBF 4MA8L 2I9TB 3CH8A 5EIIB 3FO9A 3JV5A 5DUPH 3SQOH 5C07E 3RZWA 4CNIA 1GOFA 3DBXB 4XHJD 4M6NL 5T3ZD 4QTIH 1LNUA 5DRZA 3C2AL 1WVZA 2OL3H 3HRZA 1IGJB 1I1RA 1ZS8A 3OX8B 2BCKB 1WK0A 1FZMA 4Z0XB 2H1PL 1FDLH 2DN7A 2EDLA 4UU9B 2KUTA 1YMHB 4UQ3B 5IBTH 1AE6L 2YA1A 5BQ7B 3HLAA 3DURB 2G5RA 1UZ8B 2N1KA 3EOBB 4P2RB 5KVFL 2CO6B 1C16B 3BP6B 2OLDA 1WZ1L 5I9QC 2MJWA 3OAYK 4YDJA 4NJAH 1BBDL 1D5ZA 1T0MB 5KSAD 5BS0E 4EBQL 2IAND 2W38A 2WINA 1F4WH 3U48A 1JZ6A 1C5DA 4N90E 5IKCA 1B0GB 4OZIA 2YK1H 3UTSD 2ZUUA 2GTWB 2EXYD 5FGSA 3PP3K 3HZYB 1T0NA 5LG1A 4OFVA 3T4AB 4ERSH 3GSVB 4U1HB 4DKEL 4V3DB 4R4BB 3VFSA 3ZTJG 1MUJB 3CFCL 1NKRA 4U1MB 3TT1L 1S9VA 2ERJC 2VLRE 4JKPH 4O2FB 1F6AB 1FVCB 4Q58C 1K8IB 3KPLA 5KG9B 3AFLA 2KDGA 1CICB 2IJ0C 3HZKB 4M7LH 4I13B 5F9OH 1AGEA 2BMKA 5IJVA 4HIIA 4YBHA 4LDLB 3LHPL 1CE6B 4ONGL 1OARH 3WS3A 5IF0A 1JPFA 4ELKB 5CINH 4OT1H 4ZUTB 5FYKD 2A6KA 3NA9H 4XVSH 4PV9B 3ARYA 3D3VE 4NQDD 5INDB 2HH0H 1AQKH 3SDAA 5F3BB 4L9LC 1KNOA 1JHTB 2XA8L 3BE1H 4M1DL 3MACL 4X6DE 2FATH 2AKRA 1K6QH 5EU6D 5IOPB 4L3EA 4WCYH 5IW1A 4JJ5B 4NQTA 5BO1L 2WLYA 1IGML 3VXME 5TDNA 3VA2C 3BFOA 2WBJA 5H94A 1CLYL 4E5XB 1NC4B 4MA3A 1CFBA 4JPWH 4Y5VB 4LLVB 1BEYH 4ZUWB 1V7MH 3L3OA 1B88A 1EERB 1S7QB 2QEJA 4MD4B 3WLBB 4GG6F 1MRFH 4HPOH 5H2BA 3FMGL 3BH9A 2JJTA 2V7HB 4M1GH 3UJJH 4JE4B 4PGCB 2X7LB 4MMXC 1YEHL 4M3JA 5BRZD 1MFEH 1NCBH 2CLVB 1A1MB 3VRLF 5IMLB 3LEVH 3CVIL 4C56A 1NEZG 5KSBA 2JIXD 4DAGL 5BS0D 2P5EB 2HWZH 1EJ6A 2R1XB 2JCCB 3QWQB 4N90D 3QQNA 4LVNB 3U7WL 5IG7A 4ZD3H 5I17A 1ZWIA 2HMIC 1KULA 4KTYA 3EIFA 4O2EA 4DQOL 2H9GA 1KIPB 5IT2H 3MRDA 2DIAA 4R2GB 3K2UL 3LEXB 3BXNB 3ZHLA 4KRPB 2E6PA 2GIYA 3OF6A 5F97E 2C1PB 3KWWB 2F19H 4WWKD 1XF3A 1HDMA 2VLRD 1YQVL 2Q76B 4N1HB 4LPUA 4X7SL 3QIWD 1TZIA 3S35H 1G7PB 2EEBA 1LD9A 4Z7VE 3QIUB 5GRWA 3AXLA 3DYPA 4JM4H 1AGFA 4YX2L 5I76A 3BN3B 5EFIA 3AROA 3D3VD 4OB5H 3LPFA 2VQ1A 3NTCL 3GIZH 5F9WC 1OPGH 1J88A 1ZT1A 1Z9SA 5HGGS 4Z77B 2PW2A 2VXTH 2EO9A 4XP6L 1E6OH 3RGVD 5CIPB 3CSYB 2W59A 2I24N 1U92A 1GPOH 2RBLA 1JGEA 1JL8A 1RUPL 1T20A 1I3GL 1YN6A 2PTTB 4I2XE 4JRYB 3FAWA 4WUKH 3SO3C 4DVBA 2DAVA 5EBMB 3NZHL 4G6AD 3O11B 1HSBA 3C08H 5TGBA 5LVEA 5KSUB 2CRYA 5DD5H 5JW5A 3O3BB 3S88L 2V2TA 4WW2B 4RGNC 5IFAH 2AV7B 2MMXA 1HQ4B 3MV7A 2Z35A 3BEWA 3PWUA 4LVHC 1BIIB 1C5CH 1T83C 2FGWH 1O5DT 2XY2A 4LP4A 5DDHB 5EZOL 5FHAH 1FZJB 3QDMA 1RY7B 4P2OC 1X5FA 2EH8H 1IGYA 1UWGL 2V9QA 3G6JA 3MRQB 4G9DA 3A6CH 3FO1B 1DBBL 4BFIA 3MJ9H 3DI3B 2DBLL 1NEZB 1FNSH 3IDNA 5FK9B 3TBWB 4XBEH 4P46A 4JB9L 1VPOL 1AP2A 1BZQK 1ZGLA 3TPUA 1I9IH 1JHKL 4XVTL 1DEEB 4XXDA 4YWGL 3ARGD 1ZHKB 2V2WA 2FB4H 1UJTA 1S7UB 2XQYK 4NZRL 3LKNA 3QI9D 2EO1A 2XZZA 3MO1A 1J1XH 2YUWA 1PFCA 2NX5A 1EVUA 2B4CC 4NKQB 1K3ZA 4PJ8B 1BOYA 2DJUA 4M7KH 1NUDA 3QEHA 3BRFA 5DGRA 4PJGF 2XYCA 1GGTA 5FCSH 3HAEG 2FZ3A 4N9GB 1GL4B 4QHUB 4GJTB 4EUPH 5I19L 5ANME 4WEUD 5A1AA 4KUZL 1Y6KR 4S1DC 1KIRA 1C7TA 3EHBD 1I1AC 3GSNB 3WIIH 1S9YA 1LO4H 3S36H 1FNGB 1T6VN 3C60C 2ADIA 3RY6C 4ZFOA 5HY9A 4WV1A 1AC0A 4WHTA 1I9EA 2R2BA 1FGNL 4UIKH 2B4CH 3ZE0E 1CLZH 1A6VL 5L8JB 4KTEL 4ONFL 1Q0YL 5CZVL 1M05B 3QQ9C 2ZPKL 1LDPH 1IL1A 2AK1L 1MAJA 1T2JA 3BUYA 3W11C 4XPFH 2W9DH 2YD1A 1BQLH 3RIAK 4N0CD 1H15B 1V8HA 1TZHB 1XGYL 1LE5B 5FEBA 3SE9L 2NY7H 3U0PB 3DVGA 4JO3H 5D1QB 3WD5H 4NZUH 3B5HA 2VDPH 3HN3A 1MRCH 4F57L 1FNAA 1QFWL 1RPQA 4ODVL 1BJ8A 4NGHL 1CZ8L 1EFQA 3VFRB 1A4JB 2OS7A 5MERB 4MNQA 4A6YB 5IGXL 5E2UH 4HXAH 4LHQB 5CJXA 3BW9A 3ZDZE 5I73C 4AY0A 4IOFD 1RJLA 3RNKA 1RK1A 4I4WB 4WHYH 4JFEA 4M4RA 2AEPH 1MJ7L 1HQRB 1K4CB 5IFHL 1GZQB 3C6SA 3HMXA 3RX5A 1ES0A 3VWKB 5JA8B 1QTYT 3HI1B 2AXJA 5FA3A 1NFDF 1N8ZB 3GM8A 4KK6C 3WL9B 4NQXB 4AEFA 2X4NA 5GJSL 3GUTA 5E99L 3V4UH 1V3KA 5I1GH 1T0PB 1A2YA 2VZ3A 1KTRL 3HAEB 2GJJA 2CGRH 1LP9E 2NY1D 4ZXBC 3HB3C 3RWIB 1BGXL 2R69H 3KPQA 3VGDA 1KN4H 1MRDH 5DT1H 3FQNA 5EO0A 3QH3B 3OR6A 7FABH 1F6FB 2W07A 1I3RB 4JFDB 4G9FD 1DN0A 3FQUB 5C0FA 2NYYC 3HPJB 2I07A 3SY0A 3H9HA 1D6EA 5IM7A 3QEGH 3OKKB 1KCVH 1KYOK 3M07A 4BFEA 4K8RH 3WIHL 3JUYA 2GW5A 2YWZA 5I8OH 4X7FC 1E27A 4LLDA 2P7TA 3VFTB 1DLHB 1D9KD 1E28A 3EW3B 3CMOL 1F4HA 5C0BA 1NBYA 3NN8B 1OT1A 2VLKE 4G8FA 3BYTA 1FYTA 3DO7B 1FFRA 1U91A 3QA3B 1PY9A 5D8JL 2QHRL 4GG8A 3WFCH 4NN5C 4L8DA 3H6JA 3I6GA 5T1KB 1DSFL 3TZVD 1XH3A 4QRRD 1ADQA 3QHFH 2R1YB 2AVGA 3JXAA 4XWOD 4EIGB 1EJOH 1I1FA 1KJ2H 3UTPE 3H42L 3JVGA 4XNZB 4LARH 4ZMAT 4FZEL 4YDKL 2D2OA 4F9PC 5I71C 1K9TA 4JM2A 5E00B 4W4NA 4YXHH 4LNVA 4L4VE 1U8OA 5HI4C 1ZVSA 4ODTH 3TJEL 4Z7UE 3VXRE 3D69B 5DA0B 1ZMYA 3QO0B 1NCNA 3VXSD 3QFJB 2AJYL 5DRNB 5DQ9B 1RUQL 3ILPB 4WTWA 1HKLH 3ZTNL 1CQYA 1T7ZA 1VADA 1YEJL 2EEAA 5T3XD 5BW7C 3X17A 2GK0B 5IR1B 1VGKA 1IT9L 1OY3B 4YHLH 3EO1A 1FN4A 3O8XD 5BXFA 2X1WL 5CEZL 4J7RA 1RZJH 4FQCH 3VGEA 5J57B 3O4LA 2R23A 1MJJA 1E4XH 4LSPH 4ZTPL 5E4EB 1WC7B 4KI1A 2HRPH 3E1F1 5CJ5A 1JI1A 1MFCH 3GRWA 3D48R 2X9XA 3VFNA 2YR3A 4LMQI 3S37L 1RJYA 4UB0L 4RZCB 3D0LA 4EI5C 4ZNEA 3EGSA 3TIDA 2NY3C 4YE4H 5IW3A 3G5ZB 5LCVL 3MBEB 3W2DL 5ISZE 5F1NB 5A2KH 4HH9A 3HE7D 1BFVL 1FBIL 1MCEA 5KSVA 4HFWB 5ACZA 1J8HB 3BT2L 5JOFB 3GSXA 3F58H 3UPCA 1S7TB 5KANI 1SBSH 2ICWB 5I18L 1J7VR 2MQ0A 4N8CL 4F3FA 1P7KB 4KMLB 3ARQA 1P5UA 4F7PB 3O2VH 3U30B 4EDXA 3GJFK 1FVDA 4TTGA 4GRLC 1X5GA 3LKRB 2V5SA 1KC5H 2VZOA 4XVJL 1ZLSH 4PDCE 2BY1A 5I74C 1QQDA 2Z92A 3V0WL 1R3LB 3W5NA 1EAJA 3JUZA 4IJ3B 1E4KA 4JPKL 3KPRB 3O4OB 4U31A 1NBVL 1RZKC 2DQEL 1RZFH 2NY5H 2JB6A 1AD9A 1VEMA 1ZHLB 2D0HA 2CDGA 2DI7A 2C3HA 4JHZA 2IH3B 5TPWH 3BH8B 1NJ9A 3EYFA 2QQNH 3UTPD 1VFBB 5E2TL 4FQ1H 3WFHA 3PWNA 1OAUL 4KXZH 2EDEA 1IGTB 3MUY1 3RBGA 4GO6B 3WNPA 4F80A 1E6JH 5B4MC 4L4VD 1E4JA 1CFQA 1IAII 2XKUA 1U3HA 4X6EA 4L5FH 4XCCH 3ARFD 2CK0H 4U0QB 3GJEA 1IQDB 3RL2B 1KTKE 2VRAA 4OLVH 1N0XL 5JQHC 2EDNA 1MJUH 2XTJC 3KPSB 3E3QE 3PL6A 4YDLB 5DR5L 4OCXL 2WK2A 2ZP0T 2XWJB 3SDDC 2IAMD 1P84J 4XH2A 2HT4C 4K7PH 3AGVA 4GW4B 3TT3H 1RZKH 3FRPG 4ZFGH 3CX2A 2Y6SD 1ZGLP 5J11B 2LAAA 4GAYA 1BREA 1GGIL 5TH2A 1QLEL 3G08B 2YXFA 4MJ4A 3GIVA 4JY6A 1G7QB 5MEPB 3RUGA 1EDQA 1X5XA 3DETD 3RNQB 4JZNB 2VIRB 3WFZA 1S5IL 3OKNA 1N5YH 3D85A 3PNWB 4CAGA 1AD0A 3PGFH 1J0ZA 1FG9C 2HG5B 2AXFA 3NPZB 4TYUA 5KVMC 5FM4A 5ISZD 5FM5O 4PFEA 2BHUA 1EO5A 4LCYB 4HC1L 3BZ4B 2BSRB 2HJKA 3C5ZA 4D0DB 1D7FA 1KXQE 3WCYA 4NBXB 2F58L 4FG6D 2WUCH 1LEGA 3RWGA 4J4PC 5HGDB 1NUNB 4JKWA 4LQFL 3VXUE 3P30H 2C26A 4ZTOL 5AWNL 4FTVB 3GHEH 4KI5E 1FVEA 3GK8L 5IVXB 2YZ8A 3BN9D 4CBPA 1H3GA 3WNLA 1AH1A 4KRLB 1MIML 3B83A 2HKFH 4J3WA 1ZA3B 4HFUL 1ACYL 1GSMA 2H3NB 2DQGH 1P4BL 1P4IH 5HVFB 4LSUL 4ZS7H 4MNHA 4L8BB 1QA9B 2R29L 2R2EA 1QRNB 3T65A 4NNPL 1CR9L 4WI6A 4GMSH 5ID1B 3G6AB 1X5JA 3QJHB 5CP7B 5K9JH 3W5MA 3GMQA 1J18A 1OF2B 4L9LA 4QCIB 3QHTC 4TOYH 5T1MB 5C70A 1YYLL 1AHWC 2DLIA 2JCCF 5EDXA 3ROOA 2VWEC 2CRIA 5L8LB 5DQDL 5EIVA 4UT6H 1KPRA 4ORGB 5D5ME 3HUJF 3TFKC 3U9PH 3P4OA 5E8EA 1IEAA 3VI3E 4BQCA 2EC9T 5L7XH 4KHXL 4D9QE 4GW5A 2V5YA 1D6VH 5DI8A 4PIRF 5D6CA 1PG7L 1PQZA 4E0RA 1FFOB 2Y4SA 1JF1A 3B2VH 4ZUVA 4XT1C 2ZNXA 1JGUL 1ZTXH 2AJVL 5J13B 3RWJA 3MNWA 4GQ9L 1IE5A 1MFDH 1FZKA 1KB9J 1X5YA 3V6ZB 1MFBH 3SJVA 4E9LA 3I6KA 2VXVL 4L9DA 4JEGB 5HBBA 5MEQB 3OWEA 1S7WA 5IHBA 2CKBL 5JUEL 2F53D 3NGBC 1KEGL 5FXCH 4X4YB 3I75A 2VXQL 1UA6L 2KBGA 4KI5D 3W0WB 4YIQA 4UT9H 3H9SA 1LK2A 1OHQA 1PKQA 4X7EC 3K2MC 1KJMA 5JOPE 1YEDA 1ZE3C 1RHFA 3FTGA 4I77H 5CGMA 1PSKH 2JJUA 3KLDA 2Y7QA 3F7YA 4F33A 4J3TA 5F96L 4HIHB 1C08A 3C09B 4PRIB 1BD2A 3Q2CA 5CGTA 5CKGA 4YXKH 3WLWD 3MRKB 5BOPA 2J8HA 3UROR 3EOTH 4PLOB 4MHHG 4KQ4H 3HTLX 5I1JL 2EH7H 1UXWB 1EEQA 4RFNB 1OM3H 4R3SB 4NC2B 1B4JH 4R4ND 1MPAH 4TVPL 5KW9L 4PJHE 4ZS6C 4U1IB 5DJ8A 5C2BL 5D7IB 3UTQB 4OLXH 5CKAA 4Y2DC 2EKSB 2NY0C 1XF4A 4DUVA 3TVMB 5E24E 1NCTA 3EYSH 1V05A 5FF6A 3IAQA 5IMMB 1FE8L 1UVQB 1AY1H 1INDL 2AJ3B 4ODWB 2X70B 2RB8A 4LFHG 4WI3A 4CMMB 5ENWB 1H0DA 1EO8H 1VENA 5HHNA 3AM8C 3SDXE 1U8PB 3CVHH 4LLQB 3NIGE 1TVBB 4D9QD 1CG9B 3REWA 4J3OC 4Z76B 1A7PL 1VFMA 1OSPH 4RISL 4R7DB 2W9LA 4PJDB 4U2ZA 5I1EH 5FO9B 1NCCL 3L3IA 4HUUA 1HHHA 4P2OA 4HIJA 2GY5A 4ZQKB 5I15H 1REIA 5BZWA 3ME0A 1JFQH 1IJ9A 4EUPA 4KTDH 4P57B 5I1KH 1T03H 1LO0L 3MLUL 2YN5A 2Q8AH 1UZ6F 5IW6B 4Y1AA 3ARVA 4XNUH 1OTUC 3MYJB 5HHXL 4Y5YB 3OBAA 5CLWA 4WW1A 3C2SA 5DD0L 2HVJB 1KLGA 1ZAGA 4DKAA 5TDOA 1HXMA 1MCOH 3MV11 4QF1B 4ZFFA 2VISA 4YEEA 1WGOA 2OR8A 5M94B 2A1WH 4HAFA 3QWRD 5FKPB 3B9EA 2YSSA 5EU5B 5CD5D 4LSQH 4NKIL 1A1OA 2DQUL 5D7LA 3JWNC 4XHJC 4Q2ZB 5C86A 2IWGA 4JN2B 5JIHA 2B1AL 2UWEB 5EN2A 5EA0L 2IFFL 3RTQD 3OJ2C 1I9RH 3GM0A 1RQ5A 3CPLB 5IROC 5K9OB 4P2RE 4P59H 5DLML 2DIBA 3EBAA 2ARWA 1WUNT 2IPTL 4PJIB 1I1AA 1MHCB 4Z18A 1QACA 4P3DB 1FL6A 2I60H 1MVUA 2HKHH 4Q6IA 2NXYB 3VGGA 5IFJB 2OYPA 1RUAH 1HHGB 3C60A 1YNKL 2DWEB 1FRGH 3RY6A 2JTDA 5CMAA 1CL7H 1PKOA 3L3DB 4OF3A 5C9KA 5KSAC 3BGMB 2Q3AA 2E6JA 5I1IH 1DANU 3BKML 3GSRA 3T3PE 5EOQH 4G8GD 3WO3B 4KVCL 2EXYC 4OQTL 3JWDL 5BZDB 4GRWB 1HH6A 1UB5A 2H8PA 4PJ5B 3WIHA 4UINH 5I1DA 4O51B 1YEKL 2ZG2A 5JMOC 4KDTC 5CEYA 5A16A 2EDFA 1YY9C 3FRUB 3H3KA 2NW3B 3CAFA 3TA3B 3DX6A 4U1LA 4YO0B 5HPMA 2W65B 3U79A 4PV8A 1KPVB 5F7NC 1JN6B 4TUKH 1I7RB 2YC1B 1ZHBA 3ZKND 2W0KA 4KJYB 4XI5C 4PJCA 2V17H 2QADB 1XGQA 3F7VA 2APWA 3MRLA 2MHAA 5T3ZL 1CDBA 4NHCH 1BQUA 3OKYA 3FT4B 4LEOB 3TO4A 4F58L 3BD4A 2UZIL 4Y16C 4QHKI 2XWBB 3B5TA 3OB8A 2ID5A 1KG0A 1TQBC 4OSUL 3QDJA 3E8UL 2H45A 1F45A 4ZXBA 4PJAA 4XCEB 4KVNL 1WT5A 5F9JB 2C3VB 4UTBH 4XPAH 4PUBL 5CJOH 1ZEAH 2J3SA 4R7NB 4JPIB 2VQTA 1H3WM 2E9IA 4P2RD 1U8KB 2FO1A 4OM1H 2BP3A 4JFOA 4Z7OE 3O3AA 1EZVX 3A6BH 5FYKH 2P5EE 5DRXB 3HI6L 1JUFA 4R97B 3KYNB 5C09B 4YHML 4GKSB 2PYFA 3NBNA 4D2NA 2CDFB 1A9BB 1JCKA 2J7LA 5JDSA 5IEKA 1BQSA 4UIMB 1I7UA 4O4YH 3QIBC 5GGRB 3ZZ1A 4OFKA 1J0HA 4PRBB 3S37X 3RDTA 1F4XH 3LKPA 1CXKA 4MQXC 4PGEA 4GT7A 2BVQB 4K7PY 4W6WB 5E5MB 2PR4H 2EE3A 2Z4QB 5EUOB 4Q9CA 2NY2C 3X11A 5FKAB 3QQ4A 3KPMB 1NMBL 4UAOB 2H32B 2X4SB 4WWKC 3A67L 2IALA 4Y4FD 3GMNB 1IC7L 4PJBE 2ZJSH 2OP4H 1L7TH 4F9PA 3P2TA 4PGBA 3DXAA 1G7LB 2RJMA 4HV8A 3WYRA 4AL8H 4XMPH 3VD4A 2BNRE 3B9DA 4AEIL 3WO4B 5CD3A 5MEOA 3BZDA 1BOGA 3GBNL 3ARDB 4YNYB 5DQJA 1SYSA 4MAUH 4UDUB 1EEUA 3H3PH 4EJ1C 1FNEB 2VLLA 1PYWB 5K9QI 5FGCB 3DHMA 3L5WB 3UTTE 4BUGA 2GUOB 4V3EB 4FFYH 1CQKA 1SYVB 3D39A 1QFWI 3QJFB 4IRSB 1F11B 2P1YA 3N9GH 4PRDB 5DTFA 1NC4D 2I9LA 3RGVC 3NH7H 1SEBB 4PGZA 3U2SA 2IBBA 2DQHL 1K8DA 4ZPVA 3F7QA 5E70A 1HXYB 4J3SA 5DURD 4G6AC 4L4TB 1G6RB 1FGVH 5HHMB 3HPLB 1NFIB 3VMOA 4N0FA 3I84A 3HG1E 4LKCA 1QSEB 4MXWL 5GRXG 3FQWB 5D96B 2BNQB 4RWYH 5E94A 1NGQH 4F7EA 4DEPC 5F89A 5FYKU 4NSKA 2P5ED 3EFDL 1YN7B 3FONA 4QTIL 3KXFA 3MJ7B 3TWCL 5DZLA 4H88H 1CFTB 3LS4L 3PWPB 12E8L 1Z0NA 3PGCA 4KHTL 4LPWA 3WHXB 4YDIH 1X5KA 1MCHA 3AMLA 3RVWC 5KS9B 4GRLA 4HF5H 2HFTA 3DOSA 3ARGC 4JR9L 1IKNC 2HLAA 5EC1A 4X99A 3S97C 3O3EA 3BO8B 3C6LA 2Y36H 3ET9F 3BZEB 4OGXH 4HC1A 5IVZB 1F4YL 4HWNA 4NJAL 3MRPA 2F5AL 1ZLVH 1H3PL 3CUPB 5K59E 1XF1A 1M1SA 4APQA 3DUUB 3QIUD 5AZEL 1FO0B 2VSCA 2YBRA 4JFQA 4M93C 2ARJQ 3E2HC 3ARTA 3OKOB 5IBLD 1J86A 2D9CA 4ODXB 4BJLA 1G1CA 2JK5B 4OV5A 3W9EA 2J6EA 1CGSH 1DQQB 2AV1B 5GGTL 3LKQA 2BNRD 4WEBH 2X4QB 3ZE2E 2JELH 4OZIE 2LU7A 4JKPL 3ZE1F 4XP4L 2V5MA 3G9AB 1ED3B 3DUSB 3WSQH 3SDCB 3UTTD 3RWCA 1FFNB 4JFYA 2FO4B 4JRYD 3IDUA 2XG5A 5GIRA 4AENA 2VDNH 3LQZA 2EYRA 5C0AA 3SDDA 4D8PA 4LRNL 5AAWA 2IG2H 1Y0LA 3SKOA 4DKFH 5IVXF 2AXGA 2JKXA 1MCPL 1R3JA 1M6OA 3F6IA 5DHVH 3KPNA 3BE1L 2BJML 3OKMB 3P73A 1MF2L 3HC4H 1KJVB 3P3YA 4WCYL 3HG1D 2ZOLB 4JGMA 2FSEB 5EPMB 3HR6A 1CD8A 4N0CC 5HJ3B 1BAFL 1Z6JT 4HWBH 4BFBD 3HC3L 1FPTH 3MCLH 3X12B 3L3KB 3SPVA 1DQLH 1JVKA 3L7EA 4RMRA 1Q38A 3BMVA 1UYWH 3QO1B 5TF1L 5E6ZA 3N06B 4PJ7A 4L3EE 4ZDHB 5GZOD 1I85C 4Q9RL 4KKAD 1EHNA 2F74B 5GS0D 1GZPB 1Z0MA 2P8PB 4PRNB 2R0WH 2L7JA 2XICA 3HC0A 4XPGL 4IOFC 4LLMB 3QUXA 3BHBB 5D2NB 4PJ8D 1OAXH 1XIWB 1Q9KB 4B50A 3MRBA 5HHPB 5HYEA 3O9WA 3TCLB 4WHDA 3T0VA 2OTUA 1LO2L 1FV1A 1JWMA 1M4KA 4NM8H 2VJXA 2NTFA 3DMMA 3ZDYF 4BK5A 4DVRL 2FBOJ 2HWZL 5F1IA 3K8MA 3LKOB 1B6DA 5EORL 4YHZH 5TQ0H 4OCYH 5F7LB 3VE0B 3D9AL 5JPMA 1RIUL 2AS5M 3B9KA 1CVRA 4RFEB 1FORH 2VL5B 2Z8RA 2IMMA 1A6WL 1CFNB 1CE1L 2VAAA 2EYTB 4H1LG 2ZKHH 3T1FA 1P84K 3FOLB 4PJ9D 5EBWA 3WFDH 5JHDB 1U8LA 4M6ML 3BPNB 3MMEB 3SE8L 4BK4A 1FSKC 1Q9LA 4XZUB 3O0RH 2C1OB 3WDIA 5ITBL 5ESVB 4HQQH 4TN9A 1CXIA 1F00I 5L0QC 4KRNA 1JGVH 3FB8B 1AXSA 2G60L 2XACC 1F3RB 2DB8A 1OCWH 4JM4L 5JORA 5JXAH 3OGCB 1VSCA 4PP8C 4RRPG 1KCGC 1D9KC 3TFKA 4ALAL 1YZZA 4QHMB 3K80A 3DX9A 5SWSA 2VH5L 5LWYH 2BVUA 5IB5A 2B20A 4JY4B 2ATPB 4GSDH 4JANA 5D1QD 1A6PA 3QUZC 2EDJA 4I1NB 1JF6A 3BIKB 4QLRA 1ZT4B 1A7QL 4TULH 1I8MB 2OX5A 3X3GH 4C58B 4UT7H 1UM6H 1UJ3C 3TZVC 5A3ID 3S3JA 1LE9A 4HWEL 3KPPB 2IF7A 4XWOC 3EJYC 3STLB 2C4XA 3MA7A 3PDDA 5DD5L 5D7IF 4DN4H 4NCC1 1HSAB 4OI9A 4PTUA 5CCKL 2X4OB 1IGFH 1KCLA 1C5CL 4Z8FL 4MX7B 4AG4L 3TBVA 2X4TA 5D1XD 5DHYB 3S96B 4FQIH 3BWAA 3HRZB 2ESVB 2AJZA 5DFTA 3A0OA 3MV7E 1W0WB 3MJ9L 1U8HB 2K7QA 35C8H 4Z7WA 5C3LD 4CVXA 4KC3B 1DQDL 3P0GB 1MCBA 3AVEA 3QDME 3OZ9L 3QWOA 4JHWL 1N6VA 3NFNA 3IDXL 3OTTA 4OZFA 3AU1B 1SEQH 3G6JE 4YDJB 4PJDF 4UBDC 1G0YR 2WINB 4XX1G 2Q6WA 5SWZB 3IU4H 4QHLA 1C5BH 1C5DB 3V5HA 4H1LB 4WDIA 2P8MB 3LRSB 2FHCA 3NCJH 3L1OL 3FN0H 1E4WL 1TNNA 4Y2DA 2N7AA 4ETQA 4HK0B 1ITCA 4NQCB 4HIEA 3AS0A 2V6HA 4XGZB 1DBAH 5JZ7C 4HCRH 1NCDH 4HUVA 2WP3T 4R4FL 2VERN 4Z0BL 1S9VB 5C0CB 4Z78B 4LCWA 1VERA 1V7NH 2X4UA 1L9MA 3D87B 3U0TB 5FUZL 3KPLB 4OKDA 3NIFE 3VG0L 4FQJH 5F88A 4X5WA 4YHNA 3QDGA 4P2QE 1LDSA 5T1KD 2AABH 4XAWH 4RMQA 4X7TA 4M61A 3WS3B 4LMQE 1P4LA 2DM7A 4G6JL 2N56A 4K3EH 1G7HA 3MXWH 1U3YA 4KKLC 1FP5A 1IEBA 2IADA 1QSFA 1DQJB 3KLSA 1NC2A 3IFLH 1NCAL 2KQMA 3NACL 4JVPA 4G8EA 1HCVA 1GGCH 2JB5H 5T3XL 4WTZG 4OQTA 2V2XA 1JPSL 4PJIF 1A3RL 3SGEH 5DD6A 5C0DB 1CD0A 1BLNB 1G9NC 2NY7L 3REVB 3V5KA 4UNVA 4OKVA 4PY7B 3WD5L 5ALBL 3ARFC 4HJ0D 4HS8L 2FHFA 2PYEA 3CSBA 4G3YH 4RIRA 1N64L 1EX0A 1F2QA 1HCFX 3MV7D 3L3OB 5GRYA 4OLUL 6FABL 4D9LL 1MJ8H 2GSGB 5E2UL 1WBXB 1MFAH 3MOQA 3BH9B 3WE6A 3RIFK 2IAMC 3GKWH 1INEH 3QZWA 2B0SL 3VW3L 4FOMA 4GRWF 2W9EH 5I1AA 2ZZUT 2D3VA 1AJ7H 3IGAB 4NFBA 1TPXB 2Y6SC 3OXSB 4C56B 1M71A 5KSBB 4Y2OA 1XGUA 3I9GL 4HHAB 3WKNA 5C7XH 3RX8A 1J8HD 3M1BA 1VGEH 4P46D 1MWAL 1UM4H 5I17B 1G9NH 1ZOXA 4LLAA 4JG1H 2ZUXA 3PV6A 4JFEE 2YXMA 2GITA 3MRDB 2X44D 1HEZA 1J10A 1CF8L 2WV3A 4LVOC 3UPRB 3TH3T 3GJFA 1OW0A 2WLZA 4FXLA 2QJDA 5J4MA 1Q0XH 1RVFL 1OP5K 2GSIB 4DZ8A 3D25A 1TFHA 5T1LB 1X3DA 2J8UA 4NPYA 2C9AA 3QUML 1UWXH 3MUZ1 5KSAA 2B5IB 2IANA 2VABA 5DD1H 5F44A 1FFQA 3U46A 3OQ3B 2V5TA 4P2QD 1FFPA 5IHLB 2Q1EA 1OL0A 3UTSA 2D4FA 5J0BA 3O41B 5GSVA 3PIQB 2HJLB 4R0LC 5ICYA 3BN9C 3KPOA 4JRWA 4Y4KB 4HZLB 1GGBH 4DTGH 2IPUG 2VQ1B 4M48H 4NOFA 3PXJA 3QUKA 4KDTA 3LY6A 4M6AA 1A14H 1HI6A 2VO5A 1OTTC 4XB8A 1U92B 4O02H 43C9A 5HXMA 1DTUA 1T20B 1YN6B 2EECA 4FQLL 4NZTH 5I30L 4W6YB 3C8KA 2EKJA 5L8KB 3KNBB 3CSGA 4M62L 5C0BE 5JW5B 1D5IL 4PRPB 1YY8B 2Z35B 5AZ2H 1G0XA 1T66D 4FNLL 4X98A 3EYUH 1FYTE 1JWSB 5TE7L 5LJYH 2X5PA 3D0VB 3PWUB 3ULUE 4JRXE 1NMAL 5C9JA 3O3DA 4OCLC 3E3QC 4M5YL 3ORJA 4WRLA 4YGVA 4R26H 1IC5H 4LIQL 5AUMB 1IM3B 5C08B 3H8NA 2QBWA 4GW1A 1TZGH 5EUOF 2RAMA 3WUWA 1NQBA 3FFDB 3QNZB 5TE6L 1IAOB 3I2CH 2FL5B 3IDGB 4CMHC 3TPUB 5L6YH 3T0DA 1RZJL 3G5XB 4HG4J 5HYQB 1KTLB 3MBXL 4OZGB 1E4XL 2CMRH 2YUZA 4CVZB 2V2WB 3BPOC 3LKNB 1MFCL 4JFED 3EOAA 4BA8A 4MB4A 2J5LB 3WXWL 2HVKB 3BZFB 4MWFA 3ZSTA 1SBBA 2NX5B 2X9YA 8CGTA 2PO6A 5DC4B 4P3CL 1U93A 4XMKL 1BWWA 2DQIH 1DVFD 5BRZA 3VI4F 3QG7L 3F8UB 3O4LE 4O5LH 5BJTA 1QFUH 4OLEA 3Q6FA 4TRPL 2XA3A 2FZ3B 2JIXA 3P4MA 2YRLA 4RGOL 3TN0A 5BS0A 2JE8A 5IK3A 3TF7A 5LGHL 3CC5A 3STBA 3TYFA 4I3RL 2RIKA 2P4AB 4LOUD 1RUML 4PRIE 3EDFA 4FMFA 4KI5C 3ABZA 4NQUA 3QUYB 1OGTA 4KZDH 3VH8A 1A7NL 5GRUH 4HSQA 3WHE1 4IM8A 3ULVE 3B6SA 1QRND 4RGMB 3MREB 4DOHB 4WWKA 1A5FH 3EFFA 3NIDE 4P5TB 3V52L 3VFOB 4WV1B 5HY9B 4P5MA 3WLWC 1KEMH 2VLRA 4HGWA 3Q1SL 4P5KA 4MDIB 3QIWA 5GGUA 4AYFA 5T1DH 1BBJA 4R4NC 1M7IA 5DD3H 1I7TB 4YLQT 4P4KD 5I75C 1CGWA 4OIAA 4W4OC 2DTMH 3TO2B 4XPHH 5C0GB 3D6GA 1ZHNB 1FYTD 25C8H 3D3VA 3DARA 4WNQA 1A9EA 1QPXA 4JRXD 3RPIB 2EDDA 5FHBH 3ULUD 1PLGL 2H6PB 1QPPA 4NNYB 4N0UB 4ZO8A 5KS9F 1MEXL 3MRRB 1B2WH 3P9MA 5GGTA 4U7KA 3DNKA 4GS7B 5ID0A 4X6DA 1N6QL 4POZD 4U1GC 3CIQA 3KYAA 2FJFB 2D31A 4MNQB 2D03L 2F54B 4ZSOA 4Y5XB 1U8QB 1FLTX 4PB0L 2D7TH 1NDMA 5DFVD 2PTVA 4L8SA 3IFOA 5F1KC 3IETB 3TESA 2OR9L 3C6SB 4EZMA 4GXVL 1CDCA 2WIIA 2VL4A 3NCCB 3P0YL 2OJEA 4UUJB 3Q5YA 1G9EA 1ES0B 4Y88A 5D70H 2EE6A 1RIHL 3QFDA 3QXDB 3GI9L 1EEYB 4O9HH 3GUTB 4NWUL 3JV4B 3FOMA 3O4LD 4Z7NE 5K9KB 1A2YB 4KQ3L 3MODL 3PGFL 5ADPL 4IHOA 1X5LA 3FFCB 4PJEF 5DUBA 4KY1H 3KPQB 4JO2L 2E5EA 1YMMA 3FT2B 4G59A 3DGGA 4U1JB 1IKNA 4PRID 4PYHA 4CU7A 2LU4A 5JNYA 1X7QB 2XN9A 1GAFH 3QI9A 3OAZK 5IQ9A 2OI9A 1P2CA 5KTEH 2UWEE 4YQXH 4QRPB 4IOSD 4OCSH 2BOBB 5EIQA 2VZUA 1Q9WB 1KIQA 5IM7B 3SDYL 3ULVD 2J4WL 3E2HA 1D5BA 4NC0B 2C7UA 4EEEA 4FZ8H 2X05A 4LLDB 4ODHL 5TDPA 2FR4A 3TVMD 3OKDB 4W70A 4N8VA 1UH3A 1VCAA 3UZQA 1J1OH 4Z7VA 3PDGA 3THMH 3RTQC 5BOZG 4LBEA 5EO1B 2GFBB 1KB5B 4H25A 3MV01 2G2RB 4LPTA 2YPLE 1U91B 3O6FB 2E7MA 1QOKA 4GG8B 3VD3A 4YUEL 1KLUB 3MXVL 5FDWB 4U7SA 4L8DB 4J8RB 3IFNH 1H9VA 1T5WB 4JN1L 2ZUSA 1MCJA 4QHNB 2HFFB 4O2CB 5EZIL 3LDBB 5F1SA 3LV3B 4PJFB 4WU5A 1I1FB 1RV6X 4ODSH 1HIMH 4UTAL 1W72H 4JM2B 1ZVSB 5ICZA 1KN2L 3CFKA 4MLIA 3S5LA 2IBZY 1ZSDB 3R1GH 3ZL4L 5I8EB 2IQ9H 1ZLWK 5GS1C 4X6FA 1OSZB 4S11A 1S7XA 4YBLB 4N0CA 1WQVT 3EAKA 3S35X 3U4BL 1CGVA 5BXFB 2R2CA 4D0CA 3QXVA 1OTSD 1CS6A 4M03A 5D2LA 2IGFL 4I48B 1F3DJ 3PL6D 4MXVF 2IPKA 3RWDA 1JYVA 4OLWH 32C2A 4QHKJ 4ZO7A 1I85A 4G6ML 3U7AA 3ZKNC 3SKMB 1HK6A 3MJ6A 3D0LB 3QNXB 1CIUA 3B5GA 4JFPA 3FAXA 4TNWF 3TIDB 1QSVA 5BV7L 4RSVA 4WGWB 4OF5A 3J8F7 2DLEA 4IIQB 3I85A 3T77A 4DW2H 1F90L 3MV8B 4HH9B 3CFBA 3NFPA 3FN9A 4ODUB 4WFEE 4KV5E 1IBGL 5IB2A 2X6MA 2P47B 4RAUB 3P77B 5F7DB 1A47A 1NGXA 3MFFA 2ITDA 4P23D 3C5ZD 4Y8AA 4H26A 4EDXB 4I77L 1FVDB 5TE4H 1KCSL 3H7BB 3Q6GL 4K71C 4U0RB 2BHYA 2GEEA 1AIFB 4D3CH 5ANMA 3WBDA 3OR7A 1BF2A 4UV7H 3GBML 1YECL 4GRMA 1Z9MA 5LAXA 1KBGH 2YPLD 3C8DA 4G9FA 5LQBH 3QXTA 2Z0BA 3O45A 1BZ7A 4QNPE 1Z2KA 4PGDA 4JQIH 1OM3L 1PZUB 2JB6B 4XPTL 3VXQB 3OKLB 2CDGB 4IS6A 4OTXL 1NJ9B 5EO9A 3IAPA 1BD2E 4QTHA 5B8CC 1XFPA 2NLJA 5DRWB 1D9KA 5IJKC 4PJ5D 3EYSL 1UWEL 1YEEL 2OL3B 4QO1A 2AQ2A 5DYOA 3L3HB 1TJGL 5FO7A 1NAMH 2GJZB 1SM3L 2DYPB 3GJEB 1PDKA 2XZQH 2HTKD 5E2VL 3TA3D 3WIFA 3NVQA 1JGDA 1EO8L 1NGZA 3A6OA 2OZ4H 1JGLH 1VDGA 5FGBC 2A9NL 2X9WA 4L29B 5DK2B 1MHPH 5C0IA 1UJ3A 1DQML 3SOBH 4QRRA 4Y4FC 1MY5A 3INUH 1QKZH 3EYQD 1FYHB 1U6AH 1C12A 4Q6YA 1LK3H 4BELD 1T5XB 3VMNA 1DBKH 1AGDA 4KMTH 3S36X 4G43A 3KYMA 2DQDL 4YPJA 1RUKL 3VXSA 2D7OA 3KJ6L 1MH5B 4BZ1L 3GIVB 5DXWA 3RUGB 2VDMH 4LF3B 4JZOA 3ZHKA 4KZEH 4TTDD 1FIGL 1K3IA 1S3KL 4XRCB 3T2NH 1XMWA 3O8XA 5ERWA 4XPBH 3BJLA 4XCNA 2HJKB 4WFED 1EEZA 5T5NG 2R4RH 4NIKB 1GC1L 1MNUH 1U2CA 4KJPD 3UC0H 3V0VA 4HKZB 1LEGB 2D7MA 5I9QB 2I27N 5F93C 2BNUA 1RU9H 3F62A 4U6YB 6CGTA 4Y19A 5HYSA 4Y1AE 4R8WL 5C09D 2DDQH 1CVSC 3CLEH 3PXHA 4O00A 1FVEB 5ESQB 1KFAL 4K3GA 3C5SA 4X5XB 3MRCB 1IFHL 2A6IA 4JDTH 1KTDA 5EU4A 3FB7A 4MCZB 3T3ME 3HE7A 2ZWLT 1ND0B 1YDPB 3NFSH 5F6IC 5I16A 1J5OL 4HIXH 2FIRT 5BVJA 5SWQB 2ZCHH 1MWAA 3RI5F 4BQBA 1BD2D 2AK4B 4YBQD 4M7LT 3DTXA 2CIKA 4EI6B 5C0RH 5F7HA 5I1HL 3QCVH 3IF1B 2OJZH 3RVXD 3IFPA 4H8WC 5IB1A 3U9UB 2M1KA 2ZSWA 2DQJH 3PQYE 1XF5A 5KSBF 3SN6N 3SEPA 1BZ9A 3V6FA 4M8VA 3GMQB 3WFEH 4L9LB 3OKEB 2R56H 3QUMA 3QIUC 2F8OA 3Q3GA 1Q1JH 5FFLA 5E8OA 3ROOB 1R6VA 3ARDD 2G9HA 2Y06H 1LO5A 5IBLC 5I8CA 3JTSA 1Z5LA 3P4OB 1YPZE 3HMWH 5E8EB 4JFXA 2R9HD 4WFGD 4L4VA 2XZCH 1PD6A 2WUBH 3LZFH 4MXQD 1L8JA 3ARFA 2CQVA 4ZUVB 3CH1B 1S78D 4I5BA 3NABH 3EJJX 3GMOB 3SGKA 5DJXB 4OFDA 3G6DL 5I0DA 4X6CE 4LSRH 4QYOB 5L88H 2IAMA 4LKXA 4MJIA 4U2YA 2H26A 4EUPG 2V17L 5A2JH 1NBZB 4LLWA 3P11L 1BQHA 1JIBA 2W0FA 3V8CA 5LGKA 2X4RA 4PRHA 4TNVF 1T04A 4Y1AD 2MSPA 2KZWA 3HE6B 3H9SB 5IHUH 1PKQB 1QHOA 2P5WB 1KJMB 3LS5H 4PJCE 4RAVB 1YEDB 5ISZA 4XC3H 1T3FA 5GJTL 3OXRB 4DN3H 3KDMA 2WQ8A 1G7JB 3MLYL 4H8WL 2OTWA 1KENL 4LAQL 1KOAA 1I9JH 4OM1L 1T4KA 5GS0C 2XRAL 1T22A 3QDJE 1HHKA 5M95B 4LLUA 3VXTB 4NDMA 4YR6A 4BSWA 3BP4B 3MRJB 4GAFB 2ED7A 4R0LA 5CEZE 2CK2A 2FX7L 1J05B 3PQYD 5LBSL 5B39A 4QY8A 3VFPA 3MRMA 3CLFL 2QQLL 2JJWA 4TPRH 5FYJL 2PR4L 4HUNB 4QOKA 1VACA 5B38A 3BDYL 4ZOEA 3P4NB 5DWUH 1A6AA 3RAJH 3SDCD 1DL7L 3CGTA 4WHYG 4YH6A 3Q5TA 2OXHA 1FL3A 4CL7A 1DE4A 1URLA 2DLTA 4PJ9C 1A6UL 4FQ2L 4FFWD 5GS0H 4HWZA 1TJHH 1F3JA 5DF0A 1JZ8A 4RFOL 4HT1L 2B7DT 4LVHB 2Z8VC 1HHHB 2P8LB 3ESUF 4S1QH 2IQAB 4F7MA 4ZYKA 2ED9A 4HXBH 5F3HB 2FX8L 3FCTA 5KVGH 4PJGA 5EU3B 4EKXA 4EUPB 1XZ0A 3PDOA 3MOAH 3LQAC 4P2CG 2R0KH 3UCRA 2Q7YA 3O2DL 5CP3A 5DJZA 3S4SG 3WJJA 5IHZA 3GNMH 5D1QC 4BZ2L 5HGHA 4NP4L 5C0ND 2GAZA 2A83B 4W6XB 4WW1B 5M7QA 2QKIA 1KLGB 1BF8A 1TMCA 4LK4A 1HXMB 1S5HB 3GKZA 5HDQL 2VISB 4OCWH 5EZJA 2CLRA 5T33H 3ARZA 5DK3A 3SDAC 4OGYL 4YHKH 3LEYH 1P9MC 1QBMH 3M8OL 4HS3A 3D18A 1OAKH 3L3GA 3TO4D 3K81A 4QRUB 4JDZA 4YXLH 1HNFA 3MR9A 4FFZH 4LEXL 3OMZA 4LASH 5D7LB 1GHFH 1I4FA 4OZHE 1IKFL 1F58H 2F53A 1RFDH 1KUMA 5D1XC 1MAKA 1K5NA 3ILQD 5EN2B 2W60A 4MNGB 5F71A 1D5XA 5ELIA 3WMSA 3LQAH 2BOCA 3BGFC 1R3KB 1QEWA 5DJ2A 3GSNL 5CSZA 1OOAA 3GDBA 2FX9L 1I1AB 4KAQL 1FL6B 5CEZD 1MVUB 3T8XB 4IMLA 5SV3A 5DJYA 1U8IA 4GBXD 3QNYA 1AXIB 2JJTC 4KJQD 5EZLA 3IJHA 2NZ9D 4HX1A 4TVSa 5JHDD 1OB1B 1RJCA 4F2MB 5E08L 3ES6A 4MCYB 3BSZL 5DEGB 3I3BA 2C5DC 4FQXD 3R8QA 1UACH 2E8ZA 4M8QB 1QHPA 5C0EA 1MCKA 4U6XA 3RDTD 4YC2C 2H8PB 5H37H 1NDGB 4FQQA 1N3NB 3RU8L 3O6ML 5I1DB 3CU7A 3N85H 1JNJA 2AJUH 5T5FL 2OTPA 4YAQB 4TSAL 4HG4K 1CBVL 1A6ZA 2JELL 4X6BA 4JDVA 5C6PB 1RSFA 1Y18B 2UUDH 3RWEA 1FHGA 5IEHA 5D5MA 4ELMB 1MCIA 2KKQA 3HCVA 4A6YL 2V9RA 4KK5D 5HVHB 4JFZH 5CZXD 1ZHBB 2VDNL 2O5YH 3S4SB 2HTLC 3HZVA 1V3LA 1C1EH 3MV9E 5I73B 4HBCH 1U58B 3CZFA 1SJEA 3T0EB 1DUYB 3PJSA 4BQ9A 1LEKB 2DQTH 1UM5H 4LPCA 2NCMA 3F7VB 1NGPL 4Z7QE 2R8SH 3MRLB 2MHAB 2R4SL 2HFGL 4K3DL 4PTTA 5GRJH 4WI9A 5C6TH 2LAGB 2BY3A 3SE3A 4NWTL 5D7KD 1WCQA 4OI8A 1WWAX 5C0AE 1E4XI 2ESVD 4CN6A 2DLHA 4WY7L 3VFVA 3X3FH 4ZXBB 4PJAB 1BVZA 5BMFH 4P3WA 1U9KA 4G7VL 4HJ0C 4PJFF 1H3TA 1S9WA 4U6HA 3VFUA 4EXPX 2B1HL 4ENED 3R06A 1S9KC 1C8PA 2CJUH 4S2SA 1XGPA 4JM2F 4JFOB 4MGXA 3O3AB 3VRJB 4UQ2B 1KJ2B 5EOCL 4Q0XH 1AGCA 2FIKB 5E6ID 3LIZL 5SWZD 4DGVH 1JUFB 1TQCB 2XTLA 4C83B 1KGCE 2ZG3A 3H9ZA 5GISL 3BKJL 3QHZH 3K46A 3DRTB 5IEKB 3T08A 4GXUN 5J6HB 3G5YB 4K9EC 4CU8A 2Y9RT 3MSPA 5TQ0L 1N4XH 3RTQA 3LD8C 4P46C 4XCYA 3GO1H 1A3LL 4PGEB 5DMKA 5DMIH 2AJSH 4YFLI 2EDOA 4YDVA 3MLVL 3C6LD 5ECJE 4NN5B 2XQBL 3RQ3A 1J12A 4OIIL 5L9DL 2R0LL 4NO3A 4WI4A 2IALB 4PRAA 2ADFH 2MKLC 1HYRC 1F8TL 3CX5K 3CFJA 5L2JB 4Q9QH 4DCQA 3E6FB 3O0RL 4EVNB 2VDLL 3DXAB 4HV8B 4NQSA 4XP1L 3DX8A 3SDXA 4JFFB 5CD3B 5D7SL 2NPLX 2ZCKL 2N7BA 1BOGB 4G8GA 1LEIA 4IMKA 1MCWM 4LCUA 3MV9D 3WUZA 3ULSB 4ZPTB 3S34H 5LXGH 4K9EH 5GS1A 2WAHA 3BAEL 4DZBA 4NKMB 1D3CA 3D39B 4AIZA 1QO3A 1PZ5A 1YJDH 1P6FA 4JREC 3BVNB 4MA7H 1G7IB 5FO8A 3BPCA 3PWJA 2I5YH 5ESAA 4MQSB 3TC9A 4TVPE 4WHCA 5D1ZB 2OMNA 1J8KA 1KT2B 1XR9A 4YZFF 5E2WH 1WF5A 3UJIL 2NR6C 5CILH 3L6FB 2DKMA 4EI5B 5IMOA 2BRQA 4LKCB 5MP6H 4XMLL 5J1TC 3GI8L 2I9TA 5CUSH 3RVUC 4LGSB 1KYOJ 3JWOC 4OAWB 4OLZH 5E94B 5EIIA 5F89B 1R5WB 1L0XA 2F5BH 3DBXA 4IDLA 1WISA 2YD5A 1AXTL 3FONB 3KXFB 4OZGE 1EIBA 1KGCD 4ONOA 5F72S 1IGJA 3OX8A 2BCKA 3PGCB 3QCTH 35C8L 4R6UA 3UX9B 4ZG1A 5DJAB 2BVPB 1YMHA 4WTXA 4UQ3A 5FA4B 5EC1B 5DVLA 5HD8D 5IBUG 3DURA 5I74B 3EOBA 4P2RA 5DMYA 3STZB 4PG9B 1XAUA 3BP6A 5T1LD 5J9PA 4NHUE 1T1WB 1A6TB 1R5IB 1WJ3A 2GT9B 1CLOL 5I1CL 2XKSA 4Z7WE 1CI5A 1R24B 3DMMD 3WV0A 1MCLA 1B0GA 1DVFC 3RUGF 1EXUB 3JWOH 2GTWA 4BH8B 2H2SD 1R3IH 3HZYA 3T4AA 5B8CA 4EDWL 3CK0H 4XNMA 5IJKA 3GSVA 3W9EB 4U1HA 1ONQA 3LKQB 4FP8H 2B2XH 3B3IB 4HCRL 5DS8A 4N0RA 4JLRB 3U7YL 4LOUC 3MOBH 2C3GA 1CFVH 4EOWH 4BKLB 1JPTH 2A38A 1JV5B 1HINH 5EB9A 4O2FA 2QSTA 3RWCB 2XTJB 1K8IA 5FGBA 5KG9A 1R0AH 3HZKA 1CXFA 5F21B 5B22A 5GIRB 1YEFL 4XAWL 1BHGA 3V2AR 1O7SA 4Y4FA 3AS2A 2EYRB 3SDDB 4D8PB 1CE6A 1JK8A 1J11A 5HPOA 3V7AE 3DSNA 4I18C 4PRPD 4ELKA 4ZUTA 2A6DB 4LCWE 5L2KB 4PV9A 3HMXH 1R3JB 5INDA 1VFUA 4TVPD 4OCMC 2WZPD 3KPNB 3SKJH 5HYFA 3QDGE 1JHTA 5EOTA 4P4KC 3SBWA 1A7OH 3LPGA 1Z3GH 5C08D 3QEQB 4N0YL 2XNAB 3SKNB 4RDQF 3ULUC 4P9HC 4HK3J 4PJXB 5TFSL 3CDFA 3U4EB 4G7YH 2FECL 1QSFE 3M17B 5KVDH 3L7FB 2F54E 4E5XA 1WFUA 1NC4A 1IAIL 1XGTB 4G3YL 4POZC 3OPZH 4J6RH 1BM3H 4LLVA 5J13C 4HPYL 4ZUWA 3FO0H 4CKVX 1MIEL 4KK8D 4MD4A 5FIEA 3MLSH 3WLBA 3HC0B 1JZ7A 1NL0L 2V7HA 4X9HA 1PW3A 3MRBB 4PGCA 2X7LA 2BDNL 5IBUB 1GIGH 3T09A 1CU4L 5DFVC 4KKBD 1A1MA 4L8CA 5IMLA 1R3HB 1I75A 1NANI 3WHE0 3FFCE 2YPKB 3RHWF 1U8MA 3O6KL 2P5EA 1EMTH 5C7XL 5HYJB 4MQTB 4CRPA 2R1XA 2JCCA 3L5HA 4P9HH 3QAZC 4PS4H 4Z5RB 5J6GB 2AEQL 4OZFG 3CFDB 2P49B 4S1RL 2WWKT 2A0LD 3D2UB 1A7RH 2VDKH 3PP4L 3IU3B 2VC2H 2XFXB 1KIPA 1ADQH 4LPYA 4LDEB 3VD7A 3LEXA 3T1FB 1U36A 4X9IA 5T5NF 3KWWA 3T4YA 3C09C 5GPRA 1T7WA 4P5TD 1JPGB 4FABL 2ICES 2E7LE 3FKUS 3MCKA 2Q76A 5JMRA 1B9ZA 3WKMH 3GSOB 1SY6L 4RFNC 1G7PA 4PLNC 2DI8A 1QNZH 4FQHB 4UOW1 3ULVC 1AXSB 2OM5A 3QIUA 3IKCB 1AHWB 4U6VH 1N2RB 3TJHD 5IB3B 3CMGA 5JORB 3LQMA 2D0GA 2XWTB 1P7QD 1XGRB 4NJ9H 4XP5L 2PXYD 4K55A 1JNLL 4M7JH 5AYUH 5SWSB 3TM6A 2J8UE 5J1AA 2BNRA 2IANE 5IB5B 3RZCD 4JANB 2AGJH 2YRZA 1IM9D 4QXUL 1SJXA 4G5ZL 5CIPA 3ZDXE 3CSYA 3P0VL 3BPLC 4NZTL 2Y5TA 4JRYA 3OB0K 5JLZB 5EBMA 2BRRL 2J88L 2ZOKA 3O11A 1QSFD 1HYSD 2EZ0D 2F54D 4HJJH 1QFPA 2VN4A 2DBJA 3O3BA 4JO1L 4PTUB 4WW2A 2AV7A 1PEWA 3EYUL 2AEIT 4MA8H 2R1WB 1AKJB 3BUTA 1QBBA 1YYML 1JNNL 4I8DA 3UTZB 5D6DC 1BIIA 1A4KB 3V4VL 5A2IH 3NA4A 1JTTA 2X4TB 2YPVL 4NQEB 5CGYD 4M6NH 4LHJB 4UILL 5LKNA 3BWAB 4JO4L 2C3XA 3AY4A 3C2AH 5KAQF 3MRQA 5DMJB 3FO1A 1TZGL 3TIEB 4XP9L 3SCMB 5GRVL 2H1PH 1NEZA 5FK9A 4H20L 3FFCD 5IB4B 3FT3B 4PP2B 4U3HA 3PL6C 1AE6H 3O2DA 1YNLL 4OZFB 3CVHB 2AW2A 5HDBF 4RNRB 1NSNL 4NO2B 5KVFH 1S7UA 1WZ1H 3MROB 5CBEB 4LL9A 1OP3K 4OD1L 1BBDH 3ULVL 4EBQH 2WBKA 2YKLL 3ECBA 5DUML 5MHSE 5KOVC 4PJ8A 4NKOA 4QRPD 4QWWD 2OK0L 1AGBB 3AB0C 5EH1A 4Y2DB 2NY0B 3VRIA 4TQEL 3EO9L 3LMJL 1UG9A 1JZ5A 4IOIA 4DKEH 4N9GA 3CFCH 2X09A 4LU5L 3KLHD 4K23L 1A1NB 1RZ8A 5JR1L 4IRJB 1WWBX 4YFDB 3TT1H 3BP7B 2X4UB 4P23C 4ESKA 3C5ZC 5BRZE 1HILA 2P42B 3GSNA 2ZG1A 4NM4L 3ISWA 1DANT 2A77L 4X7TB 1FNGA 4PJ9A 5I1LB 3LHPH 1NCWH 3ELAT 4ONGH 1KEML 5I8KH 1CDUA 1AO7B 3ZKXC 4HUWB 4QRSB 1Q9OB 1F5WA 2IADB 2WNGA 2G5BA 4LQ1A 3UYRL 5E8PB 1M05A 3MRGA 4Y8DC 1TJIL 3MNVB 2Z8SA 2XA8H 4M1DH 3MACH 3LRHA 5CSGA 1CT8B 2VE6B 1J0IA 2NY4C 3SGDH 3CCHB 5JW3L 5BO1H 5I66B 5FHBL 1IGMH 3QG6A 1LE5A 4X5LA 2WWMD 3U0PA 1CLYH 5D1QA 1VHPA 5E2JA 4K94L 2PYEB 2HTKC 4RIRB 5D7JD 1IMHC 4N5ED 5KVEL 1J0JA 2NXZC 4Q97A 1JP5A 1A4JA 4XBGA 5MERA 4A6YA 1G9ML 3FMGH 1WTLA 1P9MA 3UZEA 5FB8A 1YEHH 4L3CA 2VAJA 4WUUE 4AT6A 2LABA 2X4PB 1VKXB 1WIOA 1HQRA 1K4CA 4M02A 3WUWG 3CVIH 3IJSB 3QPQD 4DAGH 3MV8D 5D1XA 5HDLA 1OD7A 2AQ1A 5MHSD 1MAML 4ZSOE 1HZHH 3U7WH 4Y4HD 4R90L 5HSFA 4TTDC 4PLJD 3WL9A 4ELMF 4EQ2A 1U8NB 4DQOH 1HEZB 1FL5B 1RHHB 5AD0B 3RWIA 1CGXA 4YPGB 4NUGL 3SGJC 4OLYH 1BFOB 3D25B 4DZ8B 2PO6D 2E27L 4LAJH 4PJCF 3QH3A 4NPYB 1YQVH 5KSAB 1RMFL 1I3RA 1OGAB 4JFDA 4X7SH 2D9QB 3FQUA 4AEHL 2FEDC 3HPJA 2P48B 1DBJL 4R97C 3TN0D 4HKXA 1DLFL 1HOCB 5GSVB 1YMME 3OKKA 1Q94B 3IJYB 4EIZC 4KKCD 4NN6C 4YX2H 2EXWD 4TUJA 4NO5B 3VFTA 4AQ1B 1DLHA 3HUJB 2XN9E 4KDWA 4PJAF 3NTCH 3PHSA 3MRNA 1TCMA 1IQWL 2FH6A 3DO7A 2DYPD 4XP6H 2MPAL 2E8YA 3QA3A 5JIPA 15C8L 5IWLC 1RUPH 2XV6B 1I3GH 4E41B 5KJRL 1EHLL 3C8KB 5T1KA 2VDOL 3NZHH 5F7YC 2R1YA 3L3JA 3RVXC 3S88H 2IH1A 2A9ML 4BQ8A 1HIML 3BP5A 5D72L 4NQDB 5E03A 1QR1B 5E00A 1DFBL 2ENYA 4N68A 5EZOH 4FHBD 4K3JL 3WO4C 4YGVB 1ZVYA 1NGWB 4NRYB 3T2OA 3QO0A 1RZ7L 4ZFZB 3ARDC 3QB7C 1UWGH 5DRNA 4L1HA 3ILPA 4Y16B 5EU6B 4NFDA 5E1AA 4WUUD 2GJ6E 1TQBB 1DBBH 1U3ZA 3WUWB 3ZYJA 2DBLH 2GK0A 5C07B 4MXQC 5DA4A 3HZMA 4JB9H 1VPOH 3ARBB 3WFBL 4QEGA 4WI2A 1JHKH 4XVTH 4YWGH 4OD3H 3U82B 4GUPA 1WC7A 3UJTL 2DQFB 4NZRH 4CADB 1QZ1A 5GSRB 1WIPA 4RZCA 1IGCL 2UY6A 4GAGL 4MD0B 4NQVB 5D2LE 2FWOB 1UB6B 2HFEA 5JW4N 3NAAL 4MD5B 5D96C 2P5WE 4DW2L 3QIBB 5BS0B 1CGTA 4TSBL 1L0QA 2P44B 5E8DL 4HFWA 5I19H 1J8HA 5FM5M 5JOFA 4C54A 4KUZH 5ABDE 3MGTB 1S7TA 1O0VA 1YMMD 2ICWA 2BVYA 1DN2A 3VU2A 1GJIA 2NY2B 2AK4D 2XN9D 3B6SB 1KCKA 5E6YA 3EFFB 2WSKA 1CGYA 2ZUQC 4LCIL 4Y0GA 3MJGX 4F37K 2I25N 1FGNH 1NCUA 5LQBL 5GGUB 1A6VH 4KTEH 4ONFH 3ZKMD 4IDJL 2IBZX 5MENB 3U0WH 1Q0YH 5CZVH 4P2QA 4X4MA 4LP5A 2ZPKH 2AK1H 4I3SL 1N59A 2IH3A 3CSPA 2BK8A 1TVHB 1EFXB 5LGJA 3BQUD 1NLDL 4C57C 3PWLB 4G9FE 3OAUL 2Q8BL 1XGYH 1NLBL 3SE9H 2FJGB 4Q6IC 5CJBA 1T80A 5HHOB 3IDYB 4X6DB 3RGVB 2FRGP 2VZSA 5DVKA 2YD7A 1IQDA 2GJ6D 4F57H 1R5VB 3QRGL 1QFWH 1WBZB 1G6RL 2D31B 4NGHH 1CZ8H 4ODVH 3VXMB 2ATKB 4YHOL 4FFWC 5IV2B 1KF9B 2H2PC 3IXAB 3X14B 3CDYA 2XWJA 4PR5A 1YEGL 2CIIB 1DBML 1U6AL 1OWWA 1IAMA 3U6RB 3DRQB 4G6KL 4OFIA 3IFOB 1MJ7H 1WBYA 4KMTL 5IFHH 1WZMA 2WIIB 4DEPB 5I2IB 4QRRE 4J23A 4PYGA 4M5ZL 3G08A 4RQQB 1G7QA 3T2PA 4PB9L 4KZEL 5EWIL 3RNQA 3HE6D 4HK3N 2ARJB 2VIRA 4P99A 5GJSH 2HMID 5E99H 3PNWA 4HLZH 2P5WD 2EE2A 2HG5A 4MSWA 4XPBL 2AERT 2CH8A 2VLJE 4LCYA 3VXSE 3UPAA 3ARGB 3TNMA 5C0NC 3BZ4A 2BSRA 4D0DA 1FH5L 5EC2A 3OB0H 4QRQB 3EO0A 5HGDA 5T3XE 1RU9L 5TQ2L 1GH7A 3DVIA 5IQ9B 3HNTL 4OZ4B 1FO0L 1MLBB 2XI9A 2APTA 4MNGE 4TUOB 1WAAA 2QL1A 4S0SD 3RX7A 4M93B 1DVFA 3TO4C 5DHVB 3E2HB 1BJ1J 1T1ZB 3WIHH 4KUCF 3N0PB 5IVXA 4JVWA 3T0XA 2XZAL 3U1SL 4PJXF 1X5AA 3CMOH 1MI5E 4KU1A 4OQ1A 3ILQC 4Z7VB 3MLZL 4G42B 4UDTB 2AI0L 1WT5C 2H3NA 1XEDA 4H0HB 4Y19E 4NBYB 1HHIB 2DI9A 4PJ7F 5D8JH 2QHRH 5BCAA 1SVZA 3FB5B 1QA9A 3DUHA 3TGXA 4HEME 1QRNA 4GBXC 4OCRL 3NZ8A 5B3NA 4KJQC 1XCTA 2RFXA 1WZLA 3EDEA 2VDQL 2V9TA 4TSCL 3H42H 5ID1A 4I18A 4FZEH 4YDKH 5HHVL 2CUHA 3QJHA 4I2XB 5CP7A 5A2LH 5JQ6L 1WFNA 3VXOA 5F7KC 3IDMB 4FQXC 3TJEH 4QCIA 2YD9A 5T1MA 1SY6A 1QBLL 4P4KA 2Z31B 2AJYH 3RDTC 4P9ML 2VDRL 3ZTNH 3J7HA 2BFVL 2RHEA 3FQTA 4B5EA 4KPHL 4ORGA 2BC4B 3MZGB 1YEJH 1YNTB 4JRXA 1KCRL 3FRPA 2X89D 1IT9H 5FGRA 5D9SA 5EUKB 5FCUL 3O6LL 4GG6E 1N0LA 2PKDA 5CEZH 3T0EE 2IPKB 2LVCA 4ZTPH 1HN1A 1FFOA 3TBYA 32C2B 1A22B 3OAYH 4KK5C 1RIVL 3QXAB 2R2HB 4GKZB 3S37H 1OT2A 2OSLB 4UB0H 3V6ZA 3JTTB 4LNRA 2VMFA 2VLJD 5KOMC 2ICWI 3PP3H 3L5XL 4C4KT 3MTRA 4MJ6B 5LCVH 2HT3C 3W2DH 2VQUA 3CFBB 5MEQA 3RIAF 1RULL 3KYKL 4EN3D 4WO4B 1BFVH 1FBIH 3BT2H 4X4YA 1P1ZA 3ROLB 4DUWA 1OAQH 5HHVH 4F9LA 2ITDB 4S1DD 5DVOA 3O2WL 5C0JA 5I18H 5IHUL 4MJIE 4N8CH 3T04D 1NMCB 1RURL 1MI5D 4JGJA 5ANMB 4PRHE 3RKPA 1LMKA 4HIHA 4ENEC 5AG8A 4XVJH 4PRIA 3U36A 1FSKB 1TVDA 4Y19D 5GGQL 1AQDA 4JKMA 4XNYL 3MRKA 2XKNA 5F7EL 4LIQE 3O45B 4JPKH 5E6IC 2DD8L 4M3KB 1I8KA 1NBVH 2VXSL 1UXWA 2DQEH 3EUUA 5L0QB 1JWUB 2EDXA 2OQJB 1KCUL 4U1IA 4XVUD 5D7IA 3UTQA 5D71L 2EKSA 1UGNA 4PREA 5E2TH 1D9KB 3TVMA 1OAUH 5KZCB 3ZT5A 2HN7B 5DYOB 3IAGC 2CXGA 1OLZA 5IMMA 4OFYD 4F7CB 5FO7B 2GYSA 2ADGB 2Y07L 1UVQA 2AJ3A 3QUZB 4ODWA 2X70A 4CMMA 3H2WA 1CYGA 1JGDB 3C6LC 5ENWA 4DGIL 1N0XH 4H0IA 1A64A 3TZVB 4JFFE 1UADC 4OUUA 1U8PA 4CW1A 1I8LC 4LSTL 1TVBA 5DR5H 1QYGL 3OJDB 4APQC 5J12C 3C8HA 4Z76A 4O58H 3T0ED 1U42A 3QQ3B 4QOKE 4R7DA 4HLJA 1AGDB 3LKSB 3SGEI 4G43B 3VXPA 5FO9A 5D6DA 4K8RD 5MI0C 3ALXA 4JCLA 2FECI 1GGIH 1QLEH 4ZQKA 4NCC2 1ITBB 4YK4C 2BERA 1S5IH 4P57A 2ZNWA 1AI1L 5IW6A 3CXHK 3HB3D 5GGVL 1EEZB 4HC1H 2WMPA 1MCFA 2F58H 3F7PC 4PJGE 4MJID 5B3JF 2O5ZL 4LRIC 3IVKB 2BNUB 2HVJA 3BDBA 1WWCA 1LP9B 1A0QL 1T89A 4LQFH 4QF1A 2NYYD 1QVOA 4JG0L 4S1SL 1X5ZA 4AH2A 4ZTOH 5AWNH 2R39A 1MHHB 5FKPA 4PRHD 2D7QA 4HBQA 3BIAX 1SMOA 3GK8H 2J6EH 3BJ91 2QSCL 1TPXC 1T1XB 1KTDB 3DHJA 3FB7B 1P6AB 1MIMH 4Q2ZA 1L7IL 3DX7A 4X80L 4JN2A 4HFUH 2UWEA 1MQKL 1P4BH 3GHBL 2P46B 3CPLA 3PGDA 4LSUH 4P23A 5K9OA 2D7PA 4YGAB 4PJIA 4IRZH 3MLTA 4P3DA 4JPVL 1O7VA 1S7RB 5ADOL 2M26A 2R29H 1X5HA 4NNPH 2VLKB 3IXTA 3HI5L 2F53E 1HE7A 1HHGA 5HD8C 4NRZA 1CR9H 3QUXC 1ZLUK 4WIQA 1RJZB 3IFPB 4HGKC 5IB1B 3L3DA 2YPLA 3O9WC 1TNMA 1JNHA 3MUGB 3V6FB 4XBPB 2B5IC 5I0ZA 5HI4D 3DMMC 4JFFD 2GI7A 4W81A 3Q3GB 4RMUA 1NUFA 1UACL 3HNSL 3V4PL 5E8OB 1YYLH 3MUJA 5BZDA 4WI5A 5E9DB 5DQDH 4JFXB 4PJ5A 3B9KC 3PABB 4JQXC 4L4VB 4QOKD 1I7ZA 2AJUL 4O51A 4Z9KB 4KHXH 4Z7UB 3VXRB 1PG7H 1BFTA 1JTOA 2DLFL 3FRUA 4RA3A 4HAGA 5D93C 4BSJA 2NW3A 3TA3A 5E5UB 4I5BB 1W8OA 3V8OA 4YO0A 1JGUH 1KPVA 3QPXL 2AJVH 5D1ZD 1JN6A 3QEUB 4GQ9H 1ORSB 1I7RA 43CAB 1X4XA 2O5YL 2YC1A 1BX2B 5HI5D 5INCB 2IAMB 4HBCL 4LKXB 3DGCR 4WI7A 1MOEA 4EI5D 4YHIB 2H26B 2VXVH 3HR5B 3WJLA 1KELL 1T2QL 4DK3A 2E9BA 1NFDE 1WCBB 1K4DA 1MHEA 3AC0A 2CKBH 3DROB 5JUEH 1T04B 4MJ2A 1ZANL 1OAZL 3VMPA 1KEGH 3IS1X 4ZAKB 5EBGA 2VXQH 2XWBA 1UA6H 2CO7B 4AK1A 4OJFL 3MRFA 3ARSA 5ISZB 1T3FB 1FAIL 4LVOB 4XCEA 1QLRA 4M9OA 3KDMB 5F9JA 4AEEA 5F96H 3SGJA 1EAPB 3OV6A 1Q72L 1NAKL 4R7NA 4JQVC 4F7TA 4KK8C 3TBSB 5I1JH 4YR6B 3FQXB 5HYJE 3KYNA 5C09A 4TVPH 5KW9H 4GKSA 2EIZB 5C2BH 1DZBA 3WN5B 3QHZL 4KKBC 2ORBL 4R0LB 2CDFA 1BECA 3NCFB 5JO5B 3EYVB 5GGRA 3GFUA 3MA9L 3VGBA 3MRMB 4PBXA 4PRBA 2EEDA 2VXUL 1FE8H 3VGAC 1RK0A 2O5XH 1INDH 2A0LC 5CJQH 5E5MA 3PHOB 4MZ3A 2Z91A 2Z4QA 1B90A 5EUOA 1YUHB 5IWLA 1TCRB 4MAYB 3C9NA 1IAKB 1DE4B 3KPMA 4RGMC 2H32A 2X4SA 1A8JH 4P5TC 3DWTA 4HWZB 2HLFC 1A7PH 2MCPL 5J8OA 3VG9C 3Q48A 2HJFB 4XNXL 4G8IB 4RISH 2CDEB 1G7LA 2YRPA 3RY4A 1NH6A 1NCCH 5AG9A 4JKLA 5IQ7L 3HFML 4J3UA 4QGTA 3WXVL 4F7MB 3DLQR 3ARDA 4YNYA 3RJDA 3OHXB 4UDUA 2OMBA 4QXTB 4XCFL 4AZ8A 1FNEA 1PYWA 3BKYL 2K7PA 3QEQD 2PXYC 3IDIB 3L5WA 1U95B 1LO0H 1S8DA 3MLUH 4OD2A 5DJZB 4MXQA 2UYLA 5C71A 1J0YA 2A6JB 1WSST 2V7NB 3RZCC 4CMHB 4PRDA 4OZFH 3GEWB 2LFGA 4G8GE 4RBPK 5HHXH 4JAMB 4NCDA 2BXYA 1SEBA 2FYYA 5JW4Q 3BPOB 5DD0H 1IILE 4MHHI 3WNOA 5FUCE 1HXYA 4L4TA 1W0YT 1HYSC 1G6RA 2EZ0C 3CZJA 4MDJB 5BVPL 3CJJA 3S7GA 4ISVA 3HPLA 1NFIA 3D18B 5GHWL 1IC4L 4HUKB 4JDZB 3MCG1 3E6HA 5JHLL 1I4FB 1K2DB 3OJVC 4NKIH 2DQUH 1J1PL 1WTGT 3JWDC 3K1KC 3VXUB 3DPBA 2W60B 1D5XB 4PLKC 2B1AH 2NY6D 5EA0H 2BOCB 2IFFH 1YN7A 5HYJD 1N26A 4X6DF 3DECA 4JZJB 5DJ2B 5CSZB 5DLMH 1CFTA 1LO3L 3D2UD 1JYNA 2IPTH 4IMLB 5FOBB 2W91A 1BPVA 3DIFA 1WFTA 3B4NA 5KS9A 3AS1A 3GSUB 4M1CD 3T0BA 3UBXG 2O61B 3HNVH 1YNKH 1HHJB 4DK6A 3L5JA 3BO8A 5FV1L 4GAJL 3BZEA 1UKQA 5IVZA 3MLXL 2PCPB 2FD6L 5ACMA 3CXDL 3IDJB 4B7LA 1TTGA 3BKMH 4QWWC 1KSRA 3VJ6A 1FO0A 5I75B 4OQTH 3JWDH 3KLAB 3OKOA 5SX4I 4WJ5B 2E7LC 1TETH 4ODXA 3PQYA 4GQPH 1JRHL 4FFVD 1XCQB 4I0KA 2JK5A 5A2FA 5CEXA 1DQQA 2AV1A 1YEKH 3KLHC 2QQKH 2RCSL 2X4QA 5E5RB 1X6NA 1OW0C 2PW1B 5E0QA 5GXBB 1AO7E 1S7VA 5IEHB 5DJDA 1ED3A 4U1GB 5FYLH 1YPZA 3HCVB 3SDCA 3UBXI 1R0AL 1IZKA 1CLCA 1FFNA 2ZUYA 4XNQB 1TLKA 1MLCB 3HZVB 3TV3L 2DM4A 3RFZC 1ERNA 3FHQA 4QXGL 2ZSVA 1AKJD 1WV7T 1TXKA 4PTTB 5T3ZH 4Z7VF 4X6CA 2R0ZL 5HHQB 4NQED 4F58H 5CWSB 1CCZA 2UZIH 3OKMA 1KJVA 1WLHA 1X4YA 2ZOLA 4OSUH 2FSEA 5EPMA 3E8UH 3DSFL 4FN0A 3SCMD 3GJFH 2MTPA 1WEJL 5I6XB 2WWMC 5IP4A 5D4QA 4KVNH 2M2DA 2PF6A 3X12A 3L3KA 3FZUD 3RWFA 4XWGL 3LN4B 3VFUB 4U33A 3VWJD 2YMXH 3ULUH 1ETZB 5D7JC 1H5BB 3T1WA 1XGPB 4N5EC 1F97A 4HH8A 1OAYL 4ZDHA 2F74A 2KH2B 2X10A 2P8PA 4PRNA 4IEFB 1W72B 3UBXB 1Q8MA 1EPFA 4LLMA 2BVTA 4YHMH 1ORQB 1Q9KA 4CU6A 1INQA 5HHPA 3TCLA 3ZO0A 1U8JB 4P4RB 4Z95L 2AJXL 5JDJA 4M6OL 1EVTC 4OUOA 5C8JA 1KB5L 4B0MM 5IESL 4Q9BA 4XCYB 3LKOA 4OF0A 3F5WB 2YOCA 3MLWL 4HKJA 4PJHB 4Y4HC 3UEZA 3VFMB 4IRJD 1I1YB 3VE0A 2XXCB 4HUMB 3BEVB 3GSQB 4RFEA 2VL5A 4M7ZC 3IRZA 1OGAE 5ICXB 3KPTA 4NO3B 4RX4D 2EYTA 3T0AA 2VNCA 4GBXA 1HNGA 2GTZA 3A67H 1DJSA 3FOLA 1IC7H 5JHDA 3MMEA 2PO6C 1KJ3H 2JCCE 3HS0B 4B53A 3U83A 1AO7D 4XZUA 4NQSB 2XPGA 4Y89A 2C1OA 1SJHA 3DX8B 3HUJE 5ESVA 3G5VB 1QNZL 4AEIH 4FQXA 3TN0C 1L9NA 1ROWA 3TF7C 3FB8A 3GBNH 4LCUB 2WQRA 4KKCC 1E0OB 2APBA 4LSSH 4X8JA 2E9WA 3L95B 2EXWC 4DZBB 3OGCA 2LE9A 5DVMA 3DI2B 4AIZB 4E41E 1QO3B 2IMNA 4ODBD 3GGWB 1CICD 4UNUA 4JY4A 5DJCB 3BPCB 3PWJB 3RL1B 4CDHA 4AMKL 1OTUD 4KGJA 2ADJB 3T2QA 4FXGA 3GRWL 2Y72A 1BFSA 1ZT4A 5HGAB 2DQHH 1I8MA 1T6WA 3TBTB 1FIEA 1FG2A 4MZ2A 2Y5EA 3QIWC 3STLA 4J2XA 3VGHA 2EDYA 4HMDA 1HSAA 3GMPB 4MXWH 2CLZB 2GHWB 2EYSB 1XR8B 2X4OA 3UTOA 3ZE0F 5CHNA 3FQRB 1CK0L 3DV6A 4NT6B 5FYJE 3UO1L 3KR3L 4JY5L 4MX7A 4JRYE 1S7SB 1RZIB 3EFDH 5DHYA 1IGIL 4XC1L 3S96A 3I3EA 5GQBA 4DGYL 4J1UB 3TWCH 2ESVA 3S3PA 1HH9B 3LS4H 1NAMB 1W0WA 1U8HA 4OZHA 12E8H 1EUUA 3I02B 3U4AA 5F7WC 4KHTH 3F7RA 3BKCL 2E7BA 1EGJL 5F70A 4K71B 1FJ1B 3L9RA 2Q20A 4JR9H 2DLGA 1TDQA 3AU1A 5J7CC 1F4YH 4NRXB 5J9PB 4MLSA 5E6IA 1OGAD 4L8SC 5SWZA 2F5AH 3SQOL 5DUPL 1H3PH 4H1LA 3SQBA 5KN5B 3ZDZF 5AZEH 1BVKB 4X0KA 4HS6B 2P8MA 3LRSA 1OP9A 3ERYA 2EC8A 2I26N 4DKDC 5B8CB 1B0RB 2OL3L 4HK0A 4XNMB 2B39A 3CDGB 3MRHB 4NQCA 1ONQB 3MGOA 1FDLL 3JV6B 5DS8B 5GGTH 4XGZA 5GGSA 1FC1A 4KROB 5AEAA 3SKUD 4R2GD 3MNZA 1YY9D 4KRPD 5IBTL 5C0CA 4XP4H 4Z78A 3U0TA 4RRPA 3AREB 4LSVH 1LP9F 3P40A 5MENE 5ILTH 1NGYA 3QI9C 4E41D 5FUOH 1I8LA 3LN5B 4NN7B 4Y4FB 3TNNB 1F4WL 2OI9C 1NCWL 1JK8B 5I8KL 2YK1L 4LRNH 4XI5D 4Z6AT 2DF3A 1CDGA 3RKDD 4YEFA 1MELA 3ZKMC 4ERSL 1MCPH 3RBSA 3UMTA 3QCUH 1DQJA 4BSVB 1UZ6E 5EOTB 5HHOE 3MV9A 2BJMH 4Y16D 3OG6B 1WITA 1MF2H 4FXKA 3BQUC 2XXMB 4ZUSB 3EHBC 5DEFA 5C0DA 4WU7A 4OBSA 1BAFH 1BLNA 5FYJD 5C07D 3HC3H 3KS0J 3EYOA 3REVA 3EKCA 4M7LL 3H0TA 3DJ9A 5F9OL 4B7IA 4PJEB 4PY7A 4H5SB 3ARBD 2LTQB 5H35B 1UQSA 1G7MB 3ZYIA 1OARL 1LILA 1W0VA 3UDWC 5TF1H 4V1DB 3S98A 5CINL 4OT1L 2APFA 3VCLB 3NA9L 4XVSL 4HW6A 4LRIA 5DURB 3PHQB 4Q9RH 2VR4A 5IIEB 2HH0L 3PV7A 2GSGA 1WBXA 4LCCB 1AQKL 4XPGH 4UNTA 1KPUA 5EOCJ 3PWVB 4HUXB 5JW4M 4LHUG 2FATL 1LO2H 4L8CB 3ZYZA 1K6QL 3IGAA 4HULB 3OXSA 4ACPA 2EDRA 1U8MB 2Q86B 3MRIB 3QIBD 4Z7UF 4HHAA 4DVRH 4BFGA 1VFAB 2BY2A 3NPSB 5F6IB 5EORH 1UXSA 1HZHL 3FB6B 5F8QC 4PGJA 3HE6C 5EULV 2FJHB 3D9AH 4MQXD 1RIUH 4D0BB 1HWHB 3K4DA 4MS8A 3AAZA 2H41A 4KMQA 2QR0A 4U3CA 1A6WH 4JPWL 2QHLA 4QT5A 1CE1H 2NY2D 4X4XA 5GZND 1BEYL 5E8NB 1V7ML 4RBPH 3UPRA 1MRFL 4HPOL 4OLYL 5FAAA 3T4YB 3KHOA 1GGYA 2O26U 2GSIA 4M1GL 4M6MH 3UJJL 3SE8H 4C59B 1TTUA 2YWYA 4ZO6A 3MFGB 1W8NA 3WEXB 1J9CT 3MCKB 5T1LA 1MFEL 1NCBL 3G04B 2BSTB 5ITBH 1ZK9A 3P9WB 1EK3A 3LEVL 5MEND 1D5MB 2J12B 1TENA 4XTRD 2G60H 3EZJB 4PJBB 1T1YA 3O41A 3PIQA 3SE4C 2CKBA 1J0KA 2HJLA 4Y4KA 4MYWB 5ETUB 4ZD3L 4HZLA 1EFXD 2DRUA 5HGBB 4ALAH 4I0PB 5J1AB 4JQXA 4KK9D 5IT2L 2BNRB 2NY1C 4JFDE 5ITFB 2VH5H 3CNKA 4NO0B 2SEBB 2WP3O 5HHOD 1M7DB 1DDHB 2F19L 2P24A 3PE9A 4WTZA 2JJSA 3UTTB 1A7QH 2Y5TB 2NW2B 2QSQA 5E4IA 3VXMD 3VXNA 3GSWB 2ZOKB 4HWEH 3S35L 3KNBA 4K7FB 3AS3A 2DQCH 4PRPA 1YY8A 4M4PA 5CCKH 1JWSA 3D0VA 1BWMA 4Z8FH 5F7MC 4QXWA 3TYGH 4AIXA 4AG4H 4OB5L 4BYHA 1LGVA 3GIZL 4GKNB 1ZV5A 3GB7B 1OPGL 5AUMA 1IM3A 5HVGB 5C08A 3HG1B 2VXTL 4LHUB 1E6OL 3GMRA 2ICWJ 2LV4A 1GPOL 3FFDA 3QNZA 4WUKL 1DQDH 3RVWD 1IAOA 2FL5A 3IDGA 3OZ9H 3V6OA 3UXFA 4JHWH 1QLFB 3G5XA 5HYQA 1KTLA 3C08L 3QFJE 4OZGA 3IDXH 4OD3L 3MPCA 4CVZA 5IFAL 4YFLF 2MFNA 4GLRI 4XAKE 5F8RC 4JQVA 2HVKA 3BZFA 3FO9B 4NKDA 3ECBB 2FGWL 5FHAL 5H37G 4YHYB 4CNIB 2F9BT 4NKOB 2EH8L 3L1OH 3VRIB 1LNUB 1E4WH 2VZTA 5DRZB 3VWKD 3A6CL 1ZS8B 1DP0A 4IOIB 4EN3C 1FZMB 4NHUA 1FNSL 3WNMA 1RZ8B 3O8XC 4XBEL 4R4FH 4Z0BH 1DR9A 1I9IL 1MCNA 1HILB 3HLAB 2E9JA 3QUYA 5FUZH 3VG0H 2FB4L 1I8IA 2D7NA 2C3WA 1MREH 5KBNC 1D5ZB 3RGHA 1CXEA 4JFDD 4PJ9B 1J1XL 2CR6A 3MREA 1I3VA 2CRZA 5IKCB 4P5TA 4OZIB 3VFOA 1J8HE 4M7KL 4G6JH 3RVVD 2AEWA 1T0NB 1MQ8A 2G5BB 3CFEA 4MDIA 3U0WL 3MRGB 1NCAH 3VFSB 4AIOA 1DQTA 3HE7C 3NACH 4XVUC 3TJHA 1I7TA 2F8XC 2Z31D 4KI5F 5T3XH 1P7QA 3MX0A 5C0GA 3TO2A 1JPSH 2PXYA 1ZHNA 1A3RH 3GMLA 3RPIA 3QG6B 3WIIL 2H6PA 4NNYA 3KPRE 4N0UA 1LO4L 3RZCA 3S36L 3MRRA 1AGEB 2BMKB 1IM9A 4X4ME 5ALBH 5IJVB 4HIIB 2A74A 4HS8H 2G75A 5IF0B 1JPFB 1N64H 2A6KB 4UIKL 5HVHC 2B4CL 1CLZL 2FJFA 4XBGB 4OLUH 6FABH 4D9LH 3SDAB 1KNOB 2F54A 5FB8B 1LDPL 1U8QA 4Y5XA 4L3CB 2B0SH 3VW3H 5DVNA 3T0EC 4NOBA 3QFJD 3RA7H 4AT6B 3AMKA 4HKBA 2YS4A 1GOGA 2AKRB 5CJ8A 4L3EB 1QRKA 5IW1B 4XPFL 4K8RC 3IETA 4XAKD 2W9DL 3ZHDA 1BQLL 3DVNA 3I9GH 4UUJA 5D1XB 5TDNB 4LLYA 2WBJB 3KPSE 4WO4D 5H94B 3QXDA 3BGFB 1UH4A 1JZ2A 4JO3L 1MWAH 1EEYA 4MA3B 4NZUL 4FQPA 5D5MF 4B41A 2CUIA 2VDPL 2GY7B 3JV4A 5K9KA 3VI3F 1CGUA 2DMBA 1KXTB 1MRCL 2OBGA 1NFKA 1CF8H 3SGKC 3FFCA 2X1PA