3NFNA

Recognition of peptide-mhc by a v-delta/v-beta tcr
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Plasticity of human CD8 alpha alpha binding to peptide-HLA-A*2402
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nfnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3nfnA01
3MJ9A 1T5WB 3MJ7A 4R96A 1AO7B 5JTWA 2FWOA 3BN9D 4LLDA 4XMLL 5IHUH 1NGPH 4XP4L 5BS0E 1Q0XH 5EU6E 1S7TB 1SBSL 4N8VG 5IFHH 4XNMA 1LEGB 4Q6IA 3R1GL 4LAQH 1AFVL 3LMJH 1H3WM 4W4OC 5DD0L 3QEHB 3JTCA 2D4DA 4OZ4B 4L9LC 2XQYG 2B2XH 4N5ED 5TQ0H 4ONFL 2X70A 3WUWB 2HLAB 3EOTL 2OI9A 1PVHA 1J1PH 1FZKA 2HVJA 2HMID 4UZGA 3BWAA 1J05A 2YR3A 1G7QA 5CJOH 1OAKL 3ZTNH 3QDJA 2CRMA 5KSAD 3MRHA 5L2KE 3SDXE 3RVXD 4M62H 4ODBD 4UV7L 5EUKB 4HH8A 4HUUA 1GGCL 5BS0B 5FA4B 2DJ4A 3RVWD 2DQFB 3DVFA 4L5FH 5C71A 5EU4A 3FB8B 3ARGA 1NGQL 1BP3B 2ZUQB 3TT1H 3HPLA 2YN5A 4BYHA 4I0CC 3EIFA 2ZJSH 5E5UB 1C5BH 3VXSD 1RMFH 4HG4J 5FUZH 3NIGE 3GO1H 3H3PL 1X5JA 4Z7VF 1PLGH 5C0CE 3GSOB 4NYLA 32C2A 3JTTB 1QSZA 3ARQA 3NH7L 3P9MA 2Z35B 3QO0A 1NMCC 3JV6A 5L2KB 4D2NA 3K80A 1G9MC 3OR7B 3QB7C 4U1GB 5DHYB 3QUZB 4DAGL 2WMPA 1WWBX 1JZ3A 2AV7A 5DZOA 4IMKC 3QWOA 4WCYH 4EQ3A 3VFPB 4K7PH 1N5YL 3FO9A 1B0GA 3TVMC 1H3PH 5BOPA 2Z8WC 4LCYA 5F7LB 1HXYB 3DO7B 4NQDD 5IW3A 3RZCC 3CC5B 4OCMC 3WBDA 3ULUL 2CGRL 3GJFK 5C09B 1P4BH 3PV6B 4I0PA 5CP3H 1PFCA 1FH5H 1H5BA 4QRRE 1O0VA 1RJLA 3PL6A 5C0CB 3L3IB 4M6OL 4XPAL 5B38G 3LIZL 3ARRA 3BZ4A 5CUSL 5B39A 3S36H 2X1PA 3FQRA 3N06B 4LSSL 3AM8C 5CJ8A 1DE4A 5T1DL 5BZDB 2PTVA 2RQ8A 4NJAH 1F4YH 1BFOA 2EZ0D 5E2WH 1TCMA 3TPKA 2Y07L 4TNVF 3GFUA 5CMAB 4LRNH 5JIHA 3I6KA 4PJ7E 4BFEA 3MBXH 3V52L 3ARWA 5IEKA 5EUOA 4PRHE 4GW5A 1NGWA 1DSFL 5EBLA 3ME0A 1UACH 1AHWC 4U7SA 2VR4A 3BMWA 5C8JA 1M4KA 3BE1L 2RJMA 1NCAH 4L8DB 2YA1A 1ZOXA 2WIIB 4EJ1C 1I8MB 2J8UE 1Y6NR 3LQAL 4RRPA 4PJEF 1T3FB 2MSPA 2EECA 4XC3L 3MCG1 1OQOA 3FT2A 4WFGD 3S34H 4L8CB 1KEML 1BZ7B 5I1LB 3WIHA 4P9ML 4KJPD 3CVHB 1IC5L 1KG0A 1BEYL 4KDWA 1NLBH 2Z31C 5DO2D 4OCRH 4PJXE 2VLRA 3QIUB 1N64H 3VFNB 2CMRL 1T4KB 4H1LB 5IVXA 3K46A 1RZJC 1BJMA 1OT2A 4HIHA 3RY6C 1CGUA 3T2NL 3LEXA 2R0WH 4NKMB 1BZ9B 4IRSB 1ZWIA 4NBYB 4PJ9C 4ZO8A 3KR3L 4PRHB 5IR1B 4JM2B 1QVOA 4MS8C 3OKDA 3OF6D 4I3SL 4JZNA 3MACH 1FFPA 1OB1B 1Y0LB 1MHEA 3D69A 3T3PF 4LEOB 4ELKA 5CJXA 3G5YB 1HE7A 2OTPA 2YD9A 1D6VL 1QLRB 2J8UB 4HKZB 1WEJH 5AD0B 3IKCB 2YWYA 1BFVL 1CGSL 1E4KA 4OV6F 5BRZE 8CGTA 4EEEA 5I16A 1G7LB 1E4XH 4NPYA 5EWIL 4NCC1 1ETZA 2YA2A 4MQXC 1FV1B 3HI5H 4U1JA 3QCVL 1S7WB 4I77L 3E3QE 4X6EB 1IGFH 2VDRH 3ILQD 4NWTH 1R6VA 3BO8B 1NBYB 4HG4K 4BFGA 3RTQA 4PJXB 3RDTD 5CZVL 1D6EB 1KJ2H 4JGMA 4GKOA 2PXYC 1XGPB 4LOUD 4M3KB 1G6RH 5IROA 2VLJE 4OCNC 3DVGA 2EC9U 5JW3H 3INUL 1B0RB 3FRPA 2DLIA 2ARWA 2FIKB 4RGMB 2IADB 2NNAA 4FQQA 2PUQT 5E08L 3BYYA 2QQQA 4OLXL 4XMLH 4EIGB 5B8CC 1QPXA 1HIML 2IBZY 3H6JA 3REWA 3UJIH 3VFMA 5BRZB 1KPRB 3A67L 5EZIL 4XP4H 1OWRM 4JZJC 1YPZA 4JG1L 3R1GH 3RHWK 3DSFL 2NY5L 5DD0H 5L6YL 1AR2A 3ZSTA 2YPLA 3VJ6B 2NY3D 3NCFB 1CLOL 5DD5H 5HJ3B 4NO2A 1GSMA 1JPTL 5IB4A 1S9KC 3OKEA 3VGBA 2GK2A 1TIUA 1XGYL 4ONFH 3UAJD 4WI3A 3EOTH 4QNPF 4JHBA 1QSFE 4Y4FA 3B2VL 5KSBA 1NUDA 1JI2A 1OAKH 4NZDA 2AJXL 5E8PB 2R2BA 4P2QD 2AABH 4PBXA 4M1CD 4UV7H 5J7CC 3MV7B 3TYGH 3QUYC 1GGCH 3V9FA 2Y4SA 4MA1B 2FBOJ 5J89A 1EO7A 2EKSB 5FDYA 1F11A 3VD5A 1H3UA 2IQAB 2Y6SD 5AYUL 2H1PL 5J1AB 1NGQH 4QHMA 1MQ8A 3PDOB 1IE5A 3QZWA 4L8SB 3H9SB 3DUSA 4MD4A 3WL9A 5ACZB 3LKQB 3QWRA 4M9OA 4OZ4A 1CFNB 3FO2B 2R1WA 1QSFB 5AEAA 1EERB 3NIFF 3WUWA 1KSRA 1MCEA 4FFWD 3MOAL 2UUDH 3NH7H 1IKFL 3O4LB 5DRWA 1FG2B 43C9B 2IPUG 1WQVT 4YXHL 4AIZA 1YEIH 1U58B 5JA8B 4HGMA 1P4LA 4P23A 4KKLC 4DAGH 5CZKA 5C6PB 1KFAL 3EDEA 5EUKA 1TMCB 5EO9A 5IB2A 2JB6B 3EYFB 1B6UA 3L7FB 3AY4A 5LVEA 5D2NC 5HI3C 4N8CL 1BJ1H 3ZKNC 2NX5A 2CDEB 2ITDB 4JRYE 4NIKB 2H2SC 3VXUE 1FBIH 2ESVD 3LN4B 5IMOB 2CGRH 5B39G 4PJCE 3LEVL 4PJIA 1AKJB 1Z9MA 4NT6B 2MQCA 3BD5A 4M6NH 1HWHB 4JDZB 1RULL 4FQJL 4NQSB 4BUHA 1SY6L 4KRPC 4AG4H 3GSOA 1XR9B 2NW2B 5CUSH 3JTTA 4ORGA 3MRGB 4CADB 3O3AA 2EXWC 1DUYA 5D7LE 5T1DH 3VI3E 1UA6L 4HC1H 4NQVB 3V4UL 5I8CB 2RGSA 1SBBA 5FDWB 3LPWA 4EZMA 5INDB 3OZ9L 4RWYL 1J10A 3ZTJH 3BP4A 3PP4L 4FQHB 4J7RA 4ZOEA 5FM8A 4MNQA 3V52H 3VFPA 3V5KB 3PWLB 1BVLA 1LDPL 4JRYB 4RRPG 2BY0A 3U4EB 3FJTA 4F7CB 4PJBA 3DO7A 3QUKA 2AEWA 1DSFH 3CC5A 4PJCB 1GIGL 1KTDB 1I1CA 4YHZL 5TDNB 4KHTL 5C09A 3BE1H 5K59E 3KPRD 4UILL 1JRHL 5D1QA 4XBEL 3LQAH 4NN7B 3X13A 1U3HC 1WZ1L 3PWPD 4L4JA 5DD1H 1N5AB 3PQYA 4NQXB 5I30L 2PO6C 2RBLA 4XC3H 3H7BA 5D7JD 4YEFA 3E2HC 3L3IA 5A16B 2A9ML 4QY8B 4HT1L 1J8HD 5HYSB 4QRPA 4PV9A 2HN7A 3RZWA 4V1DA 4XCYB 3GSRA 3CSGA 3DETC 3TIDA 1U9KA 1IC5H 2A73A 4OB5L 4Y4HA 5IEHA 1KJVB 4MZ3A 3RU8H 4QTHB 3RGVA 4HPOL 2UWEE 3S8WA 1DQJB 4ELME 1KCUH 3T2NH 1OTSC 4ZS7L 5HPOA 2Q76B 4UT9L 1CBVL 3PWJB 4U31A 3K0WA 3FO0L 4N0FB 1AR1C 1YJDH 3DARA 3DV6B 5CP3A 5JHDD 3MGAA 4PGCB 4I3SH 2CXGA 1NCDH 3P4NB 1S7XB 3CX2A 4R7NB 3U7WH 1JV5A 1D6VH 5CZXD 5C0DB 4L8DA 4OFVA 1CCZA 2WP3O 3K3QA 3MA9L 4PIRF 1CGSH 2VXSL 2VL5B 3RIFK 2AEPH 1A9BB 4NZJA 5EWIH 3PGCB 3HA0A 4WW2B 2FEEL 1NMBL 1RUQL 5F88B 4I77H 3ALPA 3MOBL 4P99A 3IDMB 2GJJA 5CZVH 5ILTH 2VUOA 1QR1B 1WAAA 1JFMA 4EQ2A 5FYJD 4DVRL 4H1LA 4O58L 2VLKA 4JPWH 4ZUTB 2V2TB 4PB0L 3VWJC 4LDOB 4IRSA 3CX5K 1MJ7L 3SDDB 3TO4D 3CXHK 1QSEA 4H0GA 4G9DB 1KIQB 4K3JL 4M43L 1Y0LA 1OB1A 5E08H 3ULVE 2IH1A 4OLXH 5JXAH 4G43A 5CLTA 2V7HB 1ZLVK 4OIBA 3A67H 5AD0A 3IKCA 4IHOA 5EZIH 4NKQB 3OAYH 2EO9A 4PY7B 1Q9WA 2EXWD 3KYNB 5MENE 4I0KA 4JG1H 5SX4H 2VSCA 1GGIL 3SKUD 3DSFH 1J0HA 3TA3C 3V8CA 2FR4B 1NC2A 1CLOH 2K1MA 3GI8L 2PCPA 4GRWF 4Y4KB 1T7VA 1BGXH 1XGYH 1UVQB 1U3JA 3B3IB 4FTVA 3B83A 5C0IB 2VDQL 4PS4L 5IW6A 4BQ9A 2VLME 1B0RA 1QFWL 3O6MH 1JPSL 1JVKA 1CG9B 2V2XB 4G9FE 5HBBA 4QRTB 1VESA 4JDTL 4S10A 4GKZB 5E7BA 3U46B 3VRJB 5JOPD 3QZWG 5CHNB 4AMKL 3MREB 1X44A 1QSVA 2HLFD 5GGTL 3T3ME 1YEHL 3DETD 2D31A 4MQSB 2H1PH 1IZKA 1HI6B 2GSIB 3S3SA 3CLFH 3WUWG 2AJ3A 1KJ2A 3O2DH 2C3WA 3MO1B 2JIXD 4U1MB 2X5PA 5I1DB 2DM7A 1WLHA 2E5EA 3VMNA 2LV4A 3NA4A 4CU8A 4IRJC 1DN0B 4PFEA 4M5YL 3U36B 1AR1D 1ZVHA 1ITCA 1MHCA 1MWAH 3OG4B 4YXHH 5B3NA 2X9WA 5K33A 1I8IB 1T1YB 4EOWL 1JNNH 1ZV5A 4XNZC 5HHPB 3ZDXF 1KFAH 3GEWB 4F7EB 3MV7A 1ORSA 4YBLC 4JZOA 2P5WD 4ZPVB 3EJYC 1J18A 1AGCB 1T7XA 4NC2B 3EDFA 4KWUA 2HJLA 4PPTA 5T3ZL 1FRGH 4QXGL 4XI5C 4ODXB 4LPWA 5M7QA 4PREB 5IT2H 4UIMA 1P84J 2I9LB 3PDOA 3LEVH 3D25B 3O9WC 4L8SA 3CNKA 5L8KB 3VXRA 3ZYZA 3BP7A 3K1KC 5JW4N 4GBXD 2N7BA 4FQJH 3M8OL 3UTTE 1FNFA 5IBUB 2VN7A 1SY6H 2R4SL 5CEZE 2DD8H 3EHBD 1L7TL 4NBXB 5EUOF 3ULUC 5T1LA 3TN0C 4JM4L 4LPYA 4XXDB 2YUWA 1CICA 3MNZB 1UA6H 3NFSL 4OF5A 1U58A 3TZVD 4OF3A 2UVFA 3NCCB 2CK0H 4YDVA 4XB7A 3OZ9H 4RWYH 1A6UH 1G84A 5E6ID 5GGUA 3S96A 1TMCA 4P4RB 1P2CA 1KNOB 3PP4H 3MRRB 2JB6A 4WU7B 3EYFA 4NC0B 5T5FL 3L7FA 4Q7DA 1AIFB 1QNZL 3G6AB 3VFUA 3FCTB 1WCQA 5HDBF 4U1IB 3SE4A 1XF2A 4I9WD 5GS1C 1K8DB 4PG9A 1GIGH 2E6PA 3EYQD 7FABL 4BH7B 1JRHH 3F7VB 4LBEA 1CDGA 3QEGL 5IVXF 1BBJA 3FT3A 4UV4L 3UTTB 4NT6A 1WZ1H 5I30H 5FB8B 1UZ8B 4OGYH 2D0HA 2I07A 3JTSB 3KPNB 4HT1H 3L6FB 3UTSD 3MYJA 2FJGA 1AQKL 4KXZH 4S1QH 4P57A 5FFLA 1UEYA 5MHSE 1N59B 3MXWL 3MRGA 2XY1A 1GPOH 4X6CE 1NC4D 4YHYB 4R97B 5FO8A 1SJHB 5DZLA 2D9CA 1A64A 2P47B 1VSCA 2XNAB 4WFHE 1ZA3A 5TF1L 1X4XA 4LKCA 3ARFC 2W38A 3E6HB 5BOZG 1CBVH 3FO0H 2JJSC 3V5KA 3U0WH 3FFCE 4LLWA 1X9QA 3DHJA 4F7CA 4OF6A 2QADC 3DJ9A 1V3LA 3X11B 4XPTL 1RHHB 2VQUA 5GGSY 3O0RH 1RU9L 5DC4B 3KJ4B 2OTUA 2HT3C 1M1SA 4S0SD 2BC4B 3MA9H 2VXSH 3QQ3B 1N5AA 5FO9B 4NQXA 4RSVA 1NKOA 2GFBB 4HC1A 4WHYG 4H1LG 4QY8A 4X6CB 1N6UA 2JJWA 3DECA 4J3XA 3LAFA 2WANA 3GK8H 1PD6A 2APTA 5E99L 4HZAA 4IJ3C 3UX9B 4PJ8B 3T77B 2E9BA 1PYWB 5K9JL 4JY4B 1NDGA 2H2PD 2KZ1B 1DQJA 3JUZA 4PB0H 4LQ1A 4P4KC 4K07A 4U3CA 3LQZB 2XTJC 4G6AC 2VITA 3FFCB 4IMLA 1G9EA 3EAKA 1MJ7H 1RSFA 1DLFH 4R4BA 5C0NC 1MI5E 4MJ6A 1F6AB 2VWEE 4WEBH 5J4MA 4M61A 2P48B 4RGNE 3P4NA 4RZCA 4ODHL 5EU5B 3F6IA 3PWNB 2OQJA 4MSWB 4EI6B 3HAEH 5CAYB 2AK4E 3TFKC 3RRQA 4L4TD 5KSBF 1EEYB 1QR4A 2VL5A 4KQ4L 5AWNL 2AGJL 3TC9A 3W9DA 1CFSB 2MCG1 1BREA 1P84K 1TZGL 2Y5EA 4P5MA 3MTRA 5EC2A 3VU2A 5IHLB 2X9YA 2AKRB 4KMTH 3S88L 1VFOA 2VDKL 3MC0A 5I66B 5I1HL 3DV4B 2Y36L 2ZKHL 2HFTA 4Z76A 3MV11 4FQ1H 5GZOC 3BRFA 2JLLA 4U7KA 3K4ZA 1RJYB 4PS4H 1Z9LA 1C5DB 2H26A 2NY5C 4HK0A 4HS3B 2AXGA 1QFHA 1EHLL 1KYOJ 1YEGL 1G7MA 1EEZA 4RGNB 5J11B 4JDTH 4G9DA 1KIQA 3K2UL 5EOCJ 1D5BB 1YC7A 2H6PB 3ZDZE 1EA9C 5JR1H 1D5IL 2AK4B 4AMKH 4HKXA 5GGQL 1WZLA 3NVQA 5GGTH 1CVRA 3IDJB 4NJ9H 4M00A 3GJEA 4PRIE 3KYNA 4HBCH 4XAKE 3VXQB 2WNGA 3DROB 2FR4A 4ZAKD 1S7QA 1BWWA 1LO2H 3O6FC 3KDMB 2X4NB 4M5YH 4NUJA 3DX9B 3LKRA 1TVDA 2WWMC 3AAZB 4JJ5B 3EGSA 1JGDB 2QV2A 3PV7A 4KK8D 4UTBL 5DC0A 5LXGL 1F3DH 1K85A 3L1OH 4EOWH 4MDJB 4PJIF 2COQA 1X5XA 4X7EC 5ESAB 2BNRB 2VIRA 4LHQB 3VRJA 5T3XE 1MCPH 3RL2A 1JHLL 1K6QH 3BIAX 1YDPB 1OTUD 2F54A 4PRIB 5T3ZH 1BQHB 4IIQA 1P7KA 4GOSA 3GSQB 4UOW1 2D7TL 1TQBB 2X10A 1BD2D 4G8IB 4JVWA 1BAFH 3P0VL 1A4JB 1HYSC 1P5VA 1LEIB 5LQBL 2R9HC 3GSUA 4XVUD 4LVEA 5KAQG 3WDJA 3MBEA 4M7KL 5D1ZD 4XC1H 4CVXB 3MRDB 2XTJD 2FL5B 5SX5K 1FNEA 3F7YA 3IDUA 1O7VA 3HE6B 4LLQB 3O6KL 3UTOA 2IQ9L 3VGHA 4Q0XL 2OL3L 4PJBF 5IK3B 1HEZB 4JM4H 3L5JA 5I17A 2UVEA 3CFDB 3ZE1E 5J12B 4JCMA 3NFSH 1E0OB 1KJ3L 4UDUA 4P9HC 3WIIL 5HGDB 1J0IA 1WT5C 4RMUA 4LK4A 3DURA 1EVTC 2DM4A 3QDMA 4F7MA 1ZHBA 1U8KB 1Z0MA 1NFDA 3O2DA 3WE6B 1QNZH 2K7QA 4V2BA 3MGTB 3VFVB 2EDEA 1VGEL 2PW1A 3T0EC 3TO2B 4LCCB 4DGIH 4G7YL 5IIEB 1T0NB 3QEGH 3C5ZA 1A6AB 1XGUB 4UV4H 1MWAA 4NRYA 4Z7QE 2I5YL 5IFJB 3SGKC 1HWGB 1ULVA 1AQKH 2R69L 3CVHL 1QQDA 2BVTA 2EIEA 3VW3L 1D5MB 1NBQA 5GGSB 4OFIA 3MFGB 5F72S 5LAXA 3HZKA 2XXMB 1DEDA 2KL6A 3FHAA 3BH9A 3NZHL 4YZFF 1J12A 5DYOA 3UYRL 1NAKL 3NFNB 5TF1H 4P4RA 2DYPB 3MRRA 2E8YA 4PR5B 1NFKA 2E7HA 2P8PA 3G6AA 1HILB 1KYOK 3FCTA 4HXBL 4U1IA 3ZE2E 4WUUB 4DGVL 3RWEB 4GQ9H 4U1HA 4PY8I 5HYSG 4XPTH 5C07D 1RU9H 1WAAF 2BP3A 3JVGC 5C0AA 3KLSA 3ZKMD 1MF2L 1IM9D 1FFNB 1G7PB 3RUGA 4YLQT 5FB8A 2MKWA 3AREB 5ISZD 5ECJE 1EPFA 4E0RA 3BX7C 3MRJA 3TBVB 5HTSA 1N59A 5DMIH 4JFHE 1I1AC 1YMME 5F7MC 1AQDA 1GYAA 2DLTA 5E99H 5K9JH 4V3EB 2X05A 5F9WC 3BP6B 1AP2A 2X44D 1M6OB 5J0BA 3MRQA 3F58L 2NY1C 3E6HA 1I3VA 1TTGA 1CE1H 5FYKU 3AUVA 4Z5RA 3QEQE 5HVHC 3BIKB 4ODHH 5JPMB 3WJLA 1OSPL 1QTYT 2YMXL 1GOGA 2BC4A 4R7DA 3BD4A 4I8DA 3BUTA 4FQIL 5I1IL 5AWNH 2AGJH 4JCLA 4XCEB 5D7KE 2OMBA 1RURH 3FN0H 4X7TB 4M1DL 3AGVA 4ZXBB 4F7PA 1R3HB 1MEXL 1L0QA 4PJGA 2VDKH 3RWGA 2IH3A 5I1HH 2ADIA 2Y36H 4J3TA 3AXLB 1PYWA 4JY4A 1XCTB 1U8MB 3T0ED 4W81A 2P5EE 3FQWB 4P5KA 3LQZA 4HD9A 3UDWA 4G8GA 1EZVX 1LO5A 4J12A 3QEQB 2BXYA 3IVKB 5C0FB 5SWSB 1VFMA 2BMKB 1W0WA 1D5IH 5F7KC 4D9RD 3PWNA 5GGQH 4OF8A 2BY2A 4LAJH 3OKOA 4C56E 4CL7A 1UYWL 4ZFOA 5CD5C 3T04D 2P4AB 2EH8L 3FN9A 2NLJA 4XNYL 1CFSA 3KAAA 1EBPA 2GJ6B 3PNWB 4RFEA 4POZC 5HVGB 2XRAH 3T8XB 2FSEA 2F5AL 1CFQA 4HXAL 1OARL 1FL3A 3AMKA 4HGKC 4OFKA 3BW9B 1KGCD 3DV4A 2NY6C 1CD1A 3TBWB 3EDKA 3HZYA 2WINB 3D5OF 4DKDC 2VXUL 4I0PC 3CFBB 3I9GH 4Z7UE 4HS3A 3U1SL 4J1UA 3PL6C 4U2YA 1YMHA 4G59A 3GHEL 4LVHB 2R8SH 5F1NA 4JGJA 1TJHH 3RPKA 3DXAA 4C56B 1JHLH 3WKML 3UJJL 1BVKB 1KEGH 1G7IB 4EIZC 2WBJB 4ZQKB 4BA8A 2OR7A 2BSRB 3Q0HA 3HUJA 3VXQA 1XF4B 2ERJC 1XGRA 2AVGA 4XVSL 3BGMA 1RZKL 1S3KL 4N1EA 1VACA 5LQBH 2ARJQ 1L6ZA 2EDFA 3BD3A 3BPCA 3I3DA 3ZL4L 4EN3B 3MLTB 5GSVB 5D2LA 3KXFE 1MJUL 4M7KH 1VFUA 3L3JA 3MV8E 4UINL 1TQCB 3J7HA 3QUXA 2KPNA 4JFXA 3KDMA 4CVUA 3H42L 1E4WL 3O6KH 5C3LD 4GUPA 2IQ9H 1FNAA 3DX9A 4Q0XH 2OL3H 4Z7UB 1IEHA 4WW1A 4JJ5A 4P46C 3U9PH 1DP0A 2H41A 5C0JA 1N6VA 1KJ3H 3WIIH 2W1NA 4OKVB 2R1YB 5B22A 1IEAB 3SN6N 2BNRA 3IFPB 3GMNA 1J9CT 2XT1B 3C5JA 1RIUH 3MXVH 3QPXL 4LF3B 1FYTE 5DI8A 5HVWA 4C54A 4D9QD 1DANU 1VGEH 4QRSB 1BQHA 1MFAL 2RCSL 4ODTL 5IBUG 4NHCH 2AJUL 3ARGD 4G7YH 3HLAA 3LKOB 1IQWL 5CKAA 2IMNA 1I4FB 3SO3B 3MV8B 1I7TB 1I9IL 3MUZ1 1NBZB 3TNNA 3MRDA 1YY8B 5TGBA 1S9XB 5DR5L 5JMRA 1T04A 4YJZL 4M3JA 1J0JA 5C0BE 4P2OC 3WXVL 2R69H 3HE6A 3CVHH 3B8SA 3FQUA 2P8MB 1DUZB 2ADJA 3NZ8B 3VW3H 7CGTA 3MROA 3CFDA 3I02A 5HDLA 2DLHA 3MRPA 4JKPL 3ZE0F 1UKTA 1BLNB 5KS9A 2E27L 3NZHH 5TF0A 3UYRH 1NAKH 1U8KA 1HHHB 4HLZG 1S5HA 5IM7A 2O61A 4LSPH 3RTQC 4OFDA 2R4RH 3TJHD 3MGTA 1JUFA 3VFVA 2M2DA 4KH2A 1E28B 4PJFE 5I9QB 3W5NA 1AGBB 5IROC 1I8LC 5DRXB 5EH1A 1PZUB 3TO2A 4TN9A 3L3KA 1D9KA 2J88H 3LDBB 4WHTB 3B9KA 2F53E 5JQ6L 1LD9B 5CSBA 1MF2H 1KIPA 5D96B 4CU7A 5HD8C 3HE7B 1XGUA 4K71B 1R24A 1JTTA 1UCBH 1JHKL 4LHUD 2ZOLA 4I2XB 4MJ5A 3PL6D 1ONQA 4K8RH 4TUJB 3OBAA 1MJ8L 3CIQA 4OLZL 1X5LA 2DKMA 4U2ZA 3W81A 4L3EA 4A6YB 2PKDA 2NZ9C 4FOMA 4DTGH 1U8PB 3EDJA 1CS6A 2C1OA 4K7PX 4PJFB 3C6LA 2KDGA 3DRQB 5C08D 2V17L 3LKPB 3LKNA 4Y4FC 3VXSE 3IFOB 1FNGA 1FNLA 2BNQE 2XKSA 3T0BA 2YMXH 4WO4A 1M71B 4FQIH 1GAFH 2EYRB 3AREA 3X12B 2DI7A 1OQXA 2RAMA 1EXUA 4FFVC 4M1DH 1F4WL 5DS8B 4YHNB 5KSAB 5L9DL 2C4FT 3CK0L 3G5VA 1U36A 2B1AL 4TNWK 1IL1B 2X41A 4WU5B 4ZO7A 3UEZA 5JO5B 3BMVA 3G6JB 5JHLL 3CUPA 4UNVA 2DBLL 5EIIB 5F1KC 4UT6L 1F6FB 2GAZB 2XYCA 4XPGL 2E7CA 3REVB 4NQDE 4N0CC 5D93B 4CVWA 3ZT7A 3ULVL 1CZ8H 5DWUL 3KNBB 4XWOD 4KTDH 4RMVA 5DJCA 2MCPL 1CDYA 3VXSB 2ED8A 3FN3A 2YD6A 4MLIA 4DUWA 3MLVL 4DCQB 4XAWH 4TTDD 3P0GB 3QCTH 1UYWH 5DUPL 4XHJD 3GI9L 5GS0L 3PGFL 4IDLA 1CFTA 4X7TA 5D7IE 1R3HA 1QBLL 3CZFA 4APQB 1A6ZB 3V4PH 5CBEA 4K3DL 4G6FD 3RTQD 2ZUXA 1T2QH 5E2JA 2EE3A 2ZUQC 3BKJL 3KPPA 2RFXA 2DWEB 2VXUH 3U7YL 3CDCA 2R15A 4NQDB 1CTOA 1EEUA 3LRSA 5EU3A 1LILA 3GHEH 2CLRB 2BX5A 5SWSA 1MLBA 2FB4L 2PW2B 1DVFD 2XA3A 3MR9B 3C8KA 4NQEE 4F37K 3MA7B 5KANG 3UJJH 1JF6A 2RB8A 4WFGE 1UXSB 4AK1A 2CKBB 4U1GC 3QUZC 3WHE1 4QRQB 4KMQA 3QRFM 2UUDK 3CD4A 1EHXA 1GZPB 4HHAB 3V95A 4U05A 5D7IB 1S3KH 1AH1A 2IANA 5DD6B 1DBKL 2YXFA 2F9BT 1FSKB 1MJUH 2Q20A 4U1SB 4KK6D 1KLGA 4OTXL 3DTXA 2YPLD 4QLRA 1NFDF 3BW9A 5EZLB 5HYEA 3T0XA 1F58L 5A2IH 1FZMA 4NUGL 3TBWA 1B2WL 1LK2B 3EYSL 4XT1C 1NKRA 2JB5H 4KU1A 4U6YB 2GW5A 4EI5A 4LGPB 4ZS6D 1CE6A 4O9HL 4LMQI 5EU6A 1VKXA 4HH9B 5DVMA 1BQHG 1ZMYA 1SHMA 4RNRB 4J3VA 4BZYA 4MD5B 1B88A 5DEGA 4HGWA 3NAAH 4PTTB 3RNKB 4WDIB 5MEQB 4KKAC 4Y16A 2DL9A 5IMMB 3O3DB 3V6OE 1Z3GL 2G2RB 2V5MA 4JR9L 1WWCA 5EZOH 4ESKA 2ICWB 1CDIA 4ODTH 5AAWA 2XFXA 4OCLC 1AXSA 3EYOB 2GJZB 4LSQH 4NP4L 5C0EA 4JFYB 4E42A 1NAMB 1E4XI 1T0PB 4JO1L 3G9VA 1VPOH 3FQTA 4QHUB 2FJHA 3QWRD 5D71H 1MCDA 3I6GB 5DR5H 3RL1A 2WW8A 1IGJB 5I15H 4FZEL 3WXVH 3S4SA 3M45A 5JDJA 2EDOA 4F2MA 4XCNA 4WWID 1SYSA 1XF5A 4OKDA 4JKPH 2Z92B 4OKVA 1PQZB 1XZ0A 5FKPA 4JFPA 5FUOL 4P23D 3OB8A 3WFDH 4JQVC 3RUGF 3IFPA 3QH3A 1BPVA 4D0CB 5E9DE 5CP7B 5IGXL 2YC1B 3EJZD 4MNHB 1WFNA 1EO5A 5I1EL 2R0KL 4IRZH 2NX5D 1WBZB 1CT8A 2FH6A 3RDTB 2UZYB 2VLLA 4IRSC 5KVDH 1LO0H 1I4FA 1KTLA 3QYCA 4JM2C 1CXLA 2XPGA 4TULH 1JCKA 3TT3L 2FATH 1NBZA 4MD0A 4AM0A 4YDLB 2DKSA 1AXTH 4CU6A 3L3DB 1VADB 3P4OB 4G42B 2I60L 2M8XA 4ZTPH 1NCBL 1DUZA 3NZ8A 4OLZH 4C58B 3NACL 5J1SC 1I1FA 1BLNA 3ARDA 1S7RB 3BRDA 3PP3H 3PWUA 4NZRH 3PF2A 5HXMA 2FZ3B 5DHXB 2D0FA 4MNQD 4HUKB 1EFXA 4PJGF 3O3EB 4F9PA 3EYUL 2NY3B 3RVVC 4E9LA 1AGBA 5E8NB 3R4DA 3VXME 3ARXA 3PDGA 5FGCE 1PKQE 5D1QD 2X4TB 3HE7A 4RGMC 5FYLD 3SDAD 5ELIA 3PQYD 3BXNA 3VGGA 1F4WH 2Q7NA 2VZ1A 4R3SB 4P2QB 5L9DH 4X9HA 4QRPD 3L5HA 4PJ7A 1ZT1B 2Q3AA 2X4PB 4IOFD 4TUJA 4V1DD 4XHQA 3QNXA 4ZTOH 2VXTL 1NGXB 1IGMH 3T65B 5I6XC 4YIQB 3BPOB 4Y4HD 4F9LA 4KJYB 3IXAA 2HVKA 2VZTA 5JORB 5JDSB 2DJSA 3LOWA 3E3QC 2DBLH 3V79C 3RGVD 5IHZA 4UT6H 4ZSOE 2EDHA 3OAYK 3SGDI 1A1OA 1YYML 3UXFA 3OX8B 2FYYA 3ULVH 3DRQA 3LKPA 2W0FA 4N0RA 5DT1L 4RMSA 2CUIA 2DQEL 3MLVH 4CAGA 3HI1A 1ZANL 3X17A 5K9KB 4N5EA 4OCYL 1OW0A 1WFOA 2DS4A 1M71A 3SCMA 2VOTA 5TDPB 3BDYL 5CSZB 3GI9H 5GS0H 2EYRA 4DN3L 4DUXA 3X12A 3MV9E 1RZ8B 2WM0A 3PGFH 3ERYA 9CGTA 2H8PA 2ADFH 2Y25A 1QBLH 1RK0B 3ARTA 2FCBA 2LABA 3MLZH 3I75B 2D2OA 2A83A 4MXVE 3WEXB 3LQMA 3K74B 3BKJH 5DFVD 1WZMA 1A1NA 3G6JA 5DJ0A 2F19L 1REIA 2QR0A 4MA7L 4L8SC 3U7YH 1TZHB 1JYXA 5GSRB 5ID0B 1XF3B 3HUJF 1FG9C 4JFDD 2VLKD 3TBSA 2ESVB 3IRPX 2W9EL 4EXKA 1A7PL 2LQRA 4OSUL 3QG7L 4FQCL 5F6HI 5D2LF 3KPRE 4QHNA 4DKAA 1UM4H 1FZOA 1QSED 2FB4H 2ZUYA 4KI1A 1OD9A 4MAUL 1LDSA 5IB5A 3K2MC 1A7NL 1B0WA 1MCWM 5J3HC 3MRFA 5K9OB 1FJ1B 5DLML 5E03A 1HSAB 5HHOA 3OHXB 3SE4C 1LE5A 3EJJX 4X9FA 4OTXH 2J5LB 1NC2D 5L2JA 3VCLA 4CW1B 2R2EB 5HY9A 4NUGH 1B2WH 1YECL 3EYSH 1QA9B 5ID1B 1JZ6A 1TVBA 4NKOB 4LSVL 1UJ3B 4QOKE 2HFFB 4L4VA 4ENEC 4FTVD 1RZKC 4X5WA 1C5CH 4O9HH 5C0RL 1KIRB 3KPRB 3GGWB 3RY5A 4PRDA 4X7FC 5T3XL 5CEYB 2CLRA 1BWMA 1OPGL 2J2ZA 3PWPB 4MQ7B 2YKLL 3MR9A 5D7JB 1PY9A 5BO1L 4I4WA 1J8HB 3MYZA 4LNRA 4BKLA 1KJMA 5HI4D 2X4QB 4JR9H 1KF9B 5DK0B 4OZGE 4RFOL 3W39B 3G04B 4XCFH 4JFOA 1TTFA 1GZPA 3LH2H 5KS9F 3S4SG 2P7TB 4U6TA 4O00A 2A77H 4Y5VB 3DBXA 5DD6A 1IKNC 4YHIB 3CSPA 5D2NE 5CEZH 4XNUH 5JXED 5EZLA 4ZNEE 2ZUTA 1C7TA 1BOGB 4NZTL 4ZFGL 5A2JH 3GMQB 3QIBA 2PETA 5JHDB 4FNLL 3OR6B 4WY7H 4P3DA 2HWZL 4NN7C 3FB5B 4I18A 5JIPA 1S7SA 4MCZA 3HC3H 2CLZA 4HH9A 5DJDB 2Q8AL 4QYOB 1TTUA 2EC8A 2H32H 2NR6C 4RNRA 5ENWA 3S7GA 4HUNB 2FHFA 3U4BL 5DJXA 2CR6A 3W11D 4PYHA 3HC4L 5MEQA 4OZIB 2EXYC 4PYGA 3SBWA 1AE6L 1S7UB 3L5WB 1M7DA 5I1EH 1U2CA 2ZSVA 4R0LB 5D2NB 2HRPL 3O2WH 4JFYA 2VH5H 1NAMA 4RDQG 3VI4E 2APBA 1MH5B 5DJ8B 3VXRD 1RZ7L 4GKSB 1C12A 4PJDE 3Q6FA 1CD8A 2L0DA 1KPVB 3G9AB 5FHAL 3TO4B 2I60H 1CLYL 1J8KA 3DUUB 1NCBH 3HG1E 5T1LD 1NSNL 4YBQD 3L3HA 1U95B 2C5DC 5DGQA 2AS5M 4N0UB 4OD2A 1XGTB 2QKIA 1CICD 4PRAA 4Z7WE 4WW2C 1AD9B 3LV3B 3EO1B 2YBRB 4Y1AD 2FRGP 4EUPB 1EAJA 2I25N 4RAUB 2LFGA 3W9EA 3N50A 5CCKH 3H9ZA 3AVEA 3B5TA 4LPTA 3T4AB 1JPST 3OXRB 2YWZA 3EYUH 2D7PA 1FVCA 4BSVB 4CNIA 1LVEA 2A38A 1WBZA 2P42B 2DB8A 1FNSL 3RDTA 2YPKB 2X89A 4KDVA 1H8OA 5D7LA 1X5GA 3WFCL 1VCAA 4Z7NE 2A1WH 1VFBA 2DIJA 4PV8B 3SDDC 3VG9C 4PJDB 3IFLL 3DRTB 5AAMA 3QUMB 5GRZA 5LWYH 3VDBA 5FA3B 3HN3A 2YRLA 4HJJH 3THMH 4G42A 5F7DB 1ZVSA 2VXTH 5LGHL 3VWKA 2PO6B 3MRMA 5EU7C 3D39E 4XWGH 5D9SA 1S7RA 5C6TL 2NQCA 4GSDH 3L9RA 1ZK9A 1LP9E 5TDOA 3T0WA 3V5HA 2CDGB 2FZ3A 3QHTC 1T1ZB 3OGOE 5L7XH 5A3IC 2JIXB 1GGTA 1RK1B 4Y4KC 2MNUA 4PP2A 2GTZA 3O3EA 4NHUB 1A3LL 3QXAB 1HZHH 1OOAA 5DT1H 4D0BA 5E8NA 4PTUB 4LPCA 2DQEH 3OJ2C 1F2XK 1CLCA 1T03L 1ZANH 2EC9T 3QFDA 1Q1JH 4OCYH 3VFRA 3ROLB 3RWCA 1W0VA 4G80B 3STLA 3CVIL 5ICZB 4MX7B 5E24E 1W72B 2P24B 2BSED 5J8OA 2I24N 1UM5L 1ZT1A 5FM5O 3SJVE 2P5WB 2YS4A 1UWGL 3WD5L 5JORA 4Y19D 1ZHLA 3MBEC 2J4WH 2W9EH 1A7PH 5CWSB 3QG7H 1LO4L 3M17A 4JN1L 4F15B 4QWWC 4GBXB 3VWJB 5F7YC 2J8OA 3RWDB 1F4AA 3UTZB 1A7NH 2BSSB 2EKJA 3ARSA 2X4UB 1UEMA 5TDPA 4Z78A 3HR5B 2XWBB 2VAAA 4YHPA 4D9LL 2OX5A 2ED9A 1RZ8A 4R4ND 5DLMH 3TZVB 3FQXB 2O5XH 3SJVB 4YUEH 5E2UL 4K7FB 5E6IB 2O5YL 5GRYA 4JDVB 4KXZI 1WIUA 1YECH 4KK9D 3T4YA 4LSVH 5TFSH 1L7IL 5EBWA 1KXQE 4Z7VE 5GSRA 1DQTA 2OTWB 5IW1A 4HKBB 1IBGL 1ADQH 1M7IB 1X5HA 3KYAA 1EH9A 4GRLA 2BHZA 4NZUL 4RAHA 2CJUL 5IWLA 1OPGH 1GOFA 4X99B 5C86A 3QNZA 3U6RA 5BO1H 3UTSB 1F42A 4B5EA 1WCBB 3AU1B 3TV3L 1KCSL 1DQML 3ZYJA 1NC4B 5IUSA 3N1MC 1SJVA 1INEH 4GQPH 5F1OB 4LGSB 5F97E 1FJ1A 5JMOC 2ZSWA 3I85A 2J7LA 2WBKA 4G9FA 3HRZB 5T5NG 4X4YB 4NO5B 2Q86B 1MCBA 4IDJH 1GC1L 3G5XB 5A3ID 3RVTC 2R2EA 1W0YT 1KIUA 4Z7VB 3QQ9C 4S1DC 2AJVL 4HJGB 1AGDA 5EBMB 3IAQA 2DI9A 1FVEB 1NDMB 4JRXD 5H2BA 2B8OT 3GSNL 3CSYA 4HWBL 2FD6L 2OSLB 5DHVB 3MRBB 3S97C 4JG0L 4L3CB 2OZ4L 4MQ7A 1U8HA 4KMLB 3HC4H 5I2IA 4L4TE 4MAYD 2YD3A 4R97C 1KCRL 5ESQB 4X4MA 2F54D 5DK0A 4LFHD 43CAB 2A6KA 2GCYA 1QEWB 4RDQF 4OQ1A 3PHOA 5SWQA 3DIFB 2IFFL 1C08A 4U4BA 3T1FB 5BW7A 3ELAT 4KZDL 1I7ZA 3GKWL 1BMGA 2V5TA 4GAYB 4OT1H 1NCTA 3MBED 1RZ7H 3NCJL 4HS6B 4DGYL 3GSXB 4E41D 4KAQH 2P8LB 3TIEB 3WJLC 5FHAH 3WFHB 4LKXA 3KJ4C 4PJEE 3TH4T 1CLYH 1KB5L 4XBPB 5JHDA 3HCVB 2EDTA 3OR6A 1MUJA 3D3VE 2F8OA 4GW1B 3UPAA 5I1AB 2SEBB 3MUHL 4A6YL 2ZG2A 5KANI 1EHNA 1IC4L 2BJML 3BEVA 3QJHB 4M8QA 5DJDA 3DX7B 4UQ2B 2JJVA 1RJCA 1OGAD 3QDMD 4L4TB 1CGXA 4WFFE 3SKOB 4P3CL 1XCQA 1ZAGA 4QO1A 3ARBA 2EICA 4OUUA 3KPMA 1HHKB 3BVNB 4OIAA 1SM3H 3LHPL 4OGAD 1FNSH 4K23L 4MJIA 5ALBL 3S5LB 3WN5A 3WFCH 4Q9CA 3T3PE 1DEEA 5GS2H 1PBYA 5FKAA 1BIIB 3C5ZD 4BSWA 2ZOKB 4MWFB 3X14B 4LCUB 3MUGA 4JFFE 1IEBA 3GRWH 4FFYL 5DUBB 3BZEB 2H32A 4NC1C 1T21B 3ZLQC 1Q9KB 3DUUA 3P4MB 5LGHH 5C6WH 2OYPA 1Q8MA 4N0UA 1IGIL 5KG9B 1YC8A 3CFEB 1FC1A 4KDTA 5C6TH 1T0MB 4PLKC 4WWKD 4F3FB 4P5TA 4HEME 3GJFA 4KI5D 4DVBA 4GAJL 2B39A 4RAUA 3BZDA 3A6OA 4E5XA 1DQQB 5J9PA 3OXRA 2PNDA 4ZAKB 3SE9L 5E2VL 1UH3A 3EFFA 4HUXA 3EO0A 3D6GA 1UJTA 2YPKA 3CFCH 3KJ6H 1T03H 2XTJE 5C0AD 1F97A 3G6JF 4PV8A 2VWEC 1V7ML 5I1CL 4PJ5A 1FN4B 2DQDL 1U92A 3IJYB 4JFFB 2HJFA 5J11C 1I1YA 1T5XA 3CVIH 4F57L 4ERSH 2DAVA 1N7ML 2UYLB 2XTLA 2VSDA 4H5SB 5IJVA 2AEQL 2AQ3A 1I85C 5F7DA 5IG7B 5J6GB 3L95B 4ODSH 3QPQD 5CINL 1YEEL 2JJUA 1OP5K 3IU4L 1KELL 1HXMA 1IGYB 2VYRE 1D7FA 1BD2B 1RUAH 3OKLA 3FAXA 2E9IA 2V7NA 1PEWA 1T22B 4QNPE 2EE6A 5JPNA 1EGJL 5DJAA 2JIXA 3SGJA 1RK1A 1JWUA 2ZPKL 1MPAL 1R5WB 1YNKL 4P3WA 3MCKB 1JHTA 5D1ZB 3QXAA 3T0VA 3SO5A 5FYJU 4PTUA 2XTJB 3Q1SL 4QXWA 1ZLVH 1YUHB 4LCWE 2IAMA 1MHPL 4HEPG 5DFTA 2CKBL 2Z8VC 2ZZUT 3ULSA 5CLWA 1DZBA 4XPHH 4G80A 4JPKL 3GBNH 3L3OB 1OP9A 3KPOB 4D9LH 2HKFL 1S5IH 5F7NC 3CAFA 3GNMH 4G3YL 4L8BB 1PAMA 4NFDA 2XZQL 5E2UH 4N68A 2O5YH 1C16B 4FQXA 1TQBC 1U8QB 2P5WA 3C9NB 4M4PA 5SWZD 3CMOL 3KLAB 4NNXA 1BX2B 4OD1L 4ZFFB 4HZLB 4JY5L 3VDAA 1IBGH 1JP5A 3OJVC 5GXBB 3NIFE 4QHKJ 1QHPA 4U6XA 3GMMB 5CWSA 1I3RB 5IESL 4G8GD 1YYLL 3T2OA 4LSUH 4UBDC 1CK0L 3ZT6A 3HE6C 4GBXA 1ZHKB 2Y7QA 3RWDA 4YE4H 5J12C 5ISZE 4ZPTA 3UBXB 2GHWB 3TV3H 4MCYA 1F5WA 3DPBA 1DQMH 3LB6C 5T5NF 3A6BL 4RCAA 3FQXA 5BQ7B 1OHQA 3K8MA 4JB9H 2VQ1B 3P73B 3VFGL 1A4KA 1NFIB 1GC1H 4CRPA 1D9KC 4JANA 4HV8B 3CFJA 4WTZA 3BAEL 5E94B 4GH7B 3FB6A 2EH7L 2LTQB 5B21A 4PGZA 5C07B 3GSNH 4HWBH 2FD6H 5D1XD 4W6YB 1PKOA 3P11L 1IM9B 4JFEE 1IM3A 4JG0H 3G6DL 1CGTA 4X99A 4OLUL 1G9ML 4OIIL 5ISZB 4ONHB 1S8DB 2UV3A 1KCRH 3DXAD 3IDNA 5ADOH 1H0DA 1FO0H 3IGAB 5EZJB 1OF2B 3AU1A 4N1CA 1T89A 2R2HB 1NC4A 2CLVA 5IF0B 3STBA 3MUY1 4ZUVA 1R3LB 2IFFH 1ZT7B 4KZDH 2V5YA 1CLZL 3CPLA 1CDJA 3GKWH 3N1PC 3WXWL 4PRBB 5F89A 3MLUL 3F8UB 5B38B 1A7RH 2BVQA 1MCIA 3T0EE 3U2SA 4DGYH 1ADQA 2YZ1A 3HRZA 2VDNH 3FZUC 4MZ2A 2BFVL 4RA0C 5F8RC 3QUXD 5TQ2L 4H20L 4HJGA 3GM8A 4O2CB 1KB5H 4KKBD 5EBMA 3MFFA 3NTCL 4X5XA 4NDMB 1NDMA 5FV2A 3K81A 1IC4H 3AREC 1TFHA 3UC0L 1MCKA 2AK1L 2OSLA 4WUKL 2VISA 4NRZA 1OLLA 1SEBB 1BM3H 4C4KT 4H8WL 2BK8A 5MEOA 4GKNA 4P3CH 2QBWA 2DWDA 1T1WB 3IS1X 3RX7A 1FAKT 4ZODA 3UJTL 1QEWA 4GW4B 3LHPH 1L9MA 1IVLA 1HK6A 3DIFA 4LLUA 3VD4A 4K23H 3T1FA 1KGCE 2IPTL 5ALBH 3D87B 3KYOA 1I8KB 4GAYA 3T0EB 3E0GA 1OTTC 3BHBB 1ZT4A 3HI6L 4HS6A 2E6JA 4WFEE 2XWTB 3DO3A 2FJFB 4FFYH 5IKCB 4N9GB 4HIIB 4U1NB 4UBDD 3S35H 3KWWB 4G8FA 1DQDH 1EUUA 4AH2A 3D48R 4MLSA 1IGTA 3TCXA 5I1AA 2SEBA 1NUFA 5ICYB 1ES0B 1IGIH 3QJHA 3HNSL 1XEDA 5I0ZA 3KLHD 3WIFB 4UQ2A 2XZAL 5DZNA 4HS8L 2W65B 3BGFB 4ZXBC 5T3ZD 3H0TA 3SKNA 4GAJH 3IU3B 5KTEL 1UXWA 1AGFB 1RZJL 3LVEA 4O2EB 4MNGA 2MOVA 2YSSB 4NRXB 1MJJB 3SE9H 3DGGB 1YY9C 2ICEB 2DTML 4JVUA 1EK3A 3MLYH 2D7MA 1WF5A 1MLCA 4J4PD 3C87A 4KKCC 1LMKA 3S5LA 3B9KD 3KYKL 1X7QB 1V7MH 1S78C 3RGHA 1KCGC 1NL0L 3C09B 3LZFH 5C0GA 3U0PA 4FQPA 4UUJA 1N7MH 4LU5H 2E7LA 2VUYA 2AEQH 1Q9KA 1I9RH 3QDJE 1HDMB 4YX2L 3MJ7B 4R96B 1NMAL 2FWOB 5CINH 5I1KL 2W9DL 1YEEH 2A0LC 3TYFA 2MPAL 3IU4H 4HW6A 3CFEA 1LK3L 1KELH 4L3ED 3AFLA 4GRWE 2VDPH 4F3FA 3MPCA 4G6KH 3VD9A 4ODUA 2CH8A 4XNMB 2XKUA 4Q6IB 3DGCR 1EGJH 5EDXA 3TH2T 1MHHA 2ZPKH 2E6QA 3C6LD 3QJFA 1DQQA 1L6XA 4ZAKA 4OBRA 2WWKT 2VERN 3ARPA 1Y18A 3N1FC 1YMMA 3GRWA 1MHPH 1NANH 3DI3B 1A7QL 2X70B 5CGYD 5CIPH 5F9AC 4WO4D 2OI9B 2DQJL 4LVHC 4S2SA 4NBZB 4XP1H 4JPKH 2HVJB 3BWAB 4WEMB 4G8EA 1T66C 1J05B 2HKFH 2XG5A 1NCWL 1G7QB 4Y2OA 4YHMH 2UYLA 4PB9L 1OD7A 2XZQH 1VEPA 3N0PB 1QRNA 4ISVA 1IT9L 3TGXA 2N7AA 4PJAA 2HFGL 4YWGH 3AB0B 2WBJC 1OAYH 3HNTL 4HKJB 3CMOH 3JWOC 3KGRA 4GRWB 1A5FL 4EN3C 2KQNA 3M07A 4H0IA 1JNLL 2DQTL 1IGYA 3BUYA 1BD2A 5EU4B 3ARGB 5J6HB 1TQCC 3P30L 3RIAF 5KZCD 1YYLH 1AY1L 1U6AL 1OTTD 3CLEL 2R23A 3A6CH 5LGJA 4XPFH 3QNYA 3ZDXE 4CN6A 3LS5L 5I1JL 4OJFL 1IFHL 1T7YA 4KVCL 1IAIM 3P9MB 4ZOCA 3QO0B 4MVBA 1MVUA 4KVNH 1NGYA 2F5BL 1M05B 3KPOA 3JV6B 4WTZG 5HSFA 3A6BH 2UZIH 4AT6B 3U9UA 1IAOB 4NO0A 3OL2A 1OP3H 3TBYA 3N85L 3MSPA 1C16A 4MYWB 3VFGH 1JK8B 1HNGA 4AEHL 1R0AL 5DFWH 4LRIA 4IS6B 1VA9A 3P77B 3HFML 1R5VB 35C8L 1BX2A 1B0GB 3K7UA 4ZUSA 2ZCLL 3QXTA 4LCYB 3OXSB 3SO3C 1AO7D 3D9AL 5EUOE 3GMMA 4BQBA 5DQJA 1MIEL 4IOSD 3JBG7 4I0PB 1GC1C 3V0VA 3G6DH 1H5BB 5GIRB 3O8XA 5I75B 4OLUH 4LHUB 1G9MH 3HPJA 4OIIH 1RJLB 2PTUA 2MHAA 3PL6B 3GMPB 4OQTL 4P48A 1OAZH 2D4FA 1OY3B 3UBXA 3BZ4B 3ARDC 5B39B 5I73C 4LARH 1JYWA 5HDBE 8FABA 2GYSA 1J1XL 2FLRT 3WXWH 2R39A 1BFOB 2IAND 4RMRA 5GJSL 2F8VA 3IF1A 4TYUA 3H9HA 4NOFA 2VLRE 4ETQB 2ERJB 5HYFA 5I9QC 5IVXE 2BFVH 4YQXH 1UADC 4OZIF 2E8ZA 5KW9L 3I6KB 5C08B 2VTFA 4H20H 3UPRA 5IEKB 12E8H 5EUOB 1RQ5A 3NTCH 4GW5B 4RFNB 4TSBL 5D96C 3HE7C 4K71C 4EI5D 5C07A 3VE0A 5EBLB 4NQCA 5EU6D 1PX3A 4LASL 4XNXL 2DJUA 3UC0H 5C8JB 4CVZA 4WUKH 5IB3A 3QFJE 1R3JA 1HSBA 3TF7A 2DN7A 5EN2A 5F7UA 3BN9C 4Y16D 5L8JB 4F9LC 3FT2B 5EPMA 3WJJA 3IGAA 5AZ2H 2HTKD 3UJTH 5BV7B 2VRAA 2YRPA 1R3LA 1KG0B 5AG8A 4UDTA 2IPTH 3FAWA 4PRBA 2CIIA 3I3BA 3O41A 5JUEL 5IVXB 3QUML 2WV3A 3HI6H 3PHSA 4HIHB 5L2KD 3LEXB 3PP3K 1ZWIB 2EDDA 4N5EC 3ISWA 1GGUA 1V7NL 1OW0C 2EIZA 4JZNB 5E7FA 1FFPB 3D69B 1INQA 1MHEB 2HMIC 4ELKB 4D0DB 2YUVA 3Q2CA 3F62A 1FO0A 5IBTL 5HGBB 1DJSA 3GIVB 3V6ZB 3IYLW 5KSAC 4HS8H 4DEPB 3RWHA 3Q5OA 4FZ8L 1DBJL 1MQKH 2YK1L 3RVXC 3B5GA 3S5LG 5I16B 1RZJH 1YEKL 4NQUA 5ABDE 5TJWK 4U1JB 4Q97A 4O2FB 2ZCKL 4U49A 5EOCH 3RVWC 5C0CD 2DTMH 1JPGB 1MCOL 4AQOA 1G9NC 2CRZA 4G6FB 3RTQB 5D93C 3KYKH 3QRGH 1I8KA 1YEJL 4TUOA 1I9JH 4ODWA 3DVGB 4M8VA 1W72L 1BIHA 4I3RL 3QWQB 2G60L 2FJFA 1ZHNA 5KSBE 2YN3A 2XZCL 3LRGA 2NNAB 1DVFB 1DLHA 5I8OL 4FQQB 1NMAH 4OM0L 4YHOL 5I1KH 5E8OA 4OV5A 1ES0A 5E2TH 4YXKL 2MPAH 5ALCL 3WIFA 1LK3H 3ARDD 3WKNA 5DK2B 3UPCA 2A74B 3UTQA 4ZO6A 2QQKL 4WJ5A 1YPZB 5D4QA 3SHSA 1QBMH 1AGFA 4QRRD 4UB0L 4O2EA 4XP9H 2ICES 3TBTA 2YSSA 4NRXA 1EFXD 2ICEA 2YPLB 3P40A 5DF0A 2FECL 4QF1A 3JWNC 4NO2B 3FMGH 3OKEB 1AJ7H 1A7QH 1X7QA 4ZYKA 1Z0NA 2DQJH 5JW4Q 3LS4L 3VG0H 1JGLH 2C3VA 5KSBB 5FCSH 3B6SA 3P2TA 3VGFA 4PB9H 4XTRD 2R0LL 2C1PA 2R2BB 4YBHA 3VA6A 2IBZX 1MOEA 2HFGH 1HDMA 2FDBP 2HT2D 2KBGA 3QCUH 2VDML 5I1GH 4F7TB 1KB9J 5I8KH 2EZ0C 4YHKL 3TEUA 2DQTH 1JZ7A 1F11B 1FSKC 1HCFX 1X5KA 3KVQA 4QHMB 3NCBB 1ND0A 2BOBB 3P30H 3QZWB 1NBVH 1AY1H 4LCIH 4XXCA 1V5JA 1IC7L 3DUSB 4MD4B 1EJOL 3WL9B 4OI9A 1IC1A 3BFOA 2GUOA 4OZFH 2VC2H 4I18C 2R1WB 2Z8SA 2EIDA 2NY4D 1EO8L 4K8RD 4OD3L 4M4RA 3SCMD 5DRWB 1Z2KA 4P2RA 3O11A 2F5BH 3SE8H 3HB3D 5FCUH 4AIZB 5AZEL 4HULB 1SMOA 4XP6H 1P4LB 3SDCA 2DRUA 4P23B 2X4SA 1A6VL 5E8DH 3SBWC 5I19L 4Z8FH 2NY7L 2AW2A 2V2WA 4KJPC 5I8EA 5IB2B 5EO9B 3RHWF 2ENSA 1R0AH 3W82A 3LEYL 4HKJA 5C2BH 4ONGL 35C8H 1I1RA 5EO1B 5DO2C 4MNQE 4A2MA 2ZCLH 1AXIB 4YDKL 2NX5B 3D9AH 2B5IC 5ITBH 1UWEL 5J6HA 3UBXG 5H37G 3WLBB 1MIEH 2EO1A 5CIPA 4XP5H 5C09E 4PJIB 3FB7B 4AZ8A 4J3WA 2CUHA 5FYLE 3MZTA 4DZ8A 3IDXL 5J13C 4M6AA 4ORGB 4QXUH 3O3AB 4W4OA 1DUYB 3JZ7A 1J1XH 2VLJD 3V6OC 2M26A 1M05A 4P0DA 3BP5B 3FRUB 5JOFB 5GRUL 4AT6A 3B43A 5GJSH 1IAOA 3MRKA 3O6LL 2EDKA 1Z5LA 2AI0L 4L9LA 5HHOD 1U8NA 4HWEL 4C4KO 1JK8A 4XX1G 3BP4B 3ILQC 1DANT 2C4XA 1HINL 1ACZA 4IS6A 3RDTC 4MNQB 3TJHA 3P77A 1R5VA 3ZHLA 1BVLB 3H3BC 4LOUC 4L4VD 3OXSA 4PJBB 4TSBH 3QUKB 4Z6AT 1F3RB 4YDLC 5LG1A 1P6AB 3NCMA 4HMCA 3WNNA 5D1QB 4F33A 2BDNL 5GIRA 1X6NA 3MCLH 3X13B 3CJJA 3SDAB 3PQYB 4LHUA 4YZFE 4GXVL 1YN6A 3GMPA 3H7BB 2EDWA 4RMWA 4Y89A 4QRPB 4PV9B 1SQ2N 2HN7B 3QXDA 2XQBL 4V1DB 4MB4A 3GSRB 1IMHC 1ZSDA 2ATKB 4UT7H 3TIDB 4FXGB 2A73B 4Y4HB 4OZHB 5IEHB 4QHLB 3CCHA 4TOYH 4KTEL 2Q7YB 4H8WC 4DN4L 1KC5H 4BH8B 3RGVB 1WAAE 5D72L 4ETQA 2EDQA 1CL7H 2NY3C 4PP1D 5KVEH 4BM7A 2VLKE 2OJEA 3NMEA 5C08A 1ZVYA 4U33A 3QIBD 1V7NH 3UAJC 3FOMA 2DTSA 5D6DC 1OWWA 4NKIH 1QSEE 1W2KT 2CKNA 4FQLL 3IDYB 1JV5B 1F8TL 1FQ9C 2AXFB 4IMKA 1KB9K 4HF5H 5IBLD 1MRDH 4FZ8H 4Q9RL 2VMFA 4M1CC 5F7HA 3DOSA 4DW2L 3ES6A 3TVMA 3WFZA 2VE6A 3BPOC 1YEKH 3RZCA 4R90L 2MFNA 3OJDA 2ZCKH 1PGRB 4QCIA 1MCOH 2Y6SC 4MMZC 3UMTA 4PLJD 4JPVL 1J1OL 1A0QL 4N8PA 3ZDYF 1YEJH 1HQ4B 1XGQA 4JFDB 2VLKB 4I3RH 5I74B 5D70H 1NPUA 3FFDA 1TITA 1HKFA 3D18A 5EC1B 1YN7A 4YPJA 4YGVA 3GSWA 2XZCH 1QSEB 4FFWC 5I8OH 1PX4A 2WWKO 4K3HA 2IH1B 4OM0H 4YHOH 4D0DA 4G43B 3D2UD 3VXUD 1DL7L 5HGBA 4N90D 2P46B 4PJHA 3GIVA 1NLDL 4IHOB 4P59L 5EB9A 4X7CC 3V6ZA 4LQFL 5C9JB 4ZDHB 1Q9WB 1T7ZA 4XNQB 2QQKH 2Y5TB 2K3TA 1H9VA 1MCQA 4UB0H 4DK3A 3VA2C 4O2FA 3TESA 4PJAF 2GI7A 5DRZA 1NC2B 5GRJH 1JPGA 2JE8A 3HMXL 2PCPB 2X89D 4Y8DC 5DGRA 5D7LD 2A6DA 4FTVB 1QLEH 3RNQB 4GT7A 3LS4H 5HI5D 5IW6B 3TCLB 1MFCH 5F96L 1RAMA 4X8XA 2R0LH 3RIFF 1PG7H 3MNVA 5E4IA 3M1BA 1DVFA 3VFTA 4HUMB 3VWKD 1FCCA 5I71B 3C60A 1ZA6A 3AMLA 1UT9A 3MV7E 3VXMA 4YHKH 5CILL 5DK2A 4PJ9A 3SDYL 2D31B 4HJ0D 5I6XB 1SBSH 2A74A 2J5LC 2AJ3B 1KJ2B 1AFVH 3TWCL 1JN6B 3IFNL 1UJ3C 1G6RB 2EYTB 4NM4L 3H9SE 5ACMA 3NGBB 3C8DA 4PUBL 4HUVA 5H35A 1LQVA 4OD3H 1EO8H 4DK6A 3GM0A 3L3GA 1MHCB 3O4LE 5BCAA 5D7JC 3C8HA 5CD3A 4DZBA 5I19H 3IJHA 2WQRA 4WNQA 2PXYA 3QDGA 1ORSB 4JZOB 3LEYH 4F7TA 3SPVA 4HCRL 5TPWL 4O5LL 2HJLB 2LU4A 4Y5VC 4YDKH 4JGUA 1SMAA 4OUOA 2DMKA 1EBAA 5DHVH 4UIMB 2BOBA 2FX7L 4H88L 3MV9A 4R2GD 1TCRA 5A2FA 3VXRB 3IB4A 3S9DB 3BP7B 4YFDB 3KPLA 1JZ5A 1E6JL 2NYYD 3I2CL 3H3PH 5CJBA 3RAJL 1MFNA 5IB1A 1UM6L 5CZXC 1KXTB 3IDXH 1G0XA 1K3ZA 5T1LB 3GMRA 1QRKA 3RKDD 2GTWA 1CICB 1C8PA 5GRUH 4ZD3L 4BZ2L 2IJ0C 1IILE 1OGTA 3O6LH 4YDVB 5DD3L 4Y1AB 5E8EA 5GGUB 3S96B 2NXZD 4HWEH 2N4IA 2FO1A 1P2CB 1HINH 5C70A 4R0LC 3MGOA 5EO1A 4QGTA 3VFUB 3ULVD 4LHUG 3WN5C 1XF2B 1N5YH 2IGFL 1VDGA 1CU4L 3LSOA 4PG9B 3ULUH 4OZFA 4X80L 4GO6B 4GRLD 1RIVL 3WLBA 4JO3L 3LRHA 3IETB 3V8OA 4LBEB 5MEND 4O51B 3EW3B 3QUYA 1BBJB 1N8ZB 3FT3B 3TO4C 3FB7A 2JTDA 2R56L 4P9HL 3ZE0E 1WZKA 1B3JA 5T1MA 4XRCA 5GS0D 4BZ1L 4M6OH 4CJ0A 2I07B 4XPAH 3LIZH 5K93A 4K94L 3MYJB 2FJGB 4P57B 4L9DA 1QYGL 4KDTC 4HK3J 1N4XL 4LSSH 1JTOA 4P5TC 5FO8B 1CXKA 3BP5A 2VLMD 3FRUA 5JOFA 5F3BA 5E6ZA 1J0YA 3MNWA 2H9GA 5D72H 1ZA3B 2Y07H 1B90A 5KBNC 4G9FD 4LKCB 2Z93A 3RI5K 4Z0XA 5L8LB 4ZMAT 5KSUA 1FPTL 4LLWB 4NKDB 5C9KA 3QEUA 3V7AG 5DEZA 4MA8L 4R26L 3I84A 5F3HA 2OR9L 3HZVB 4JHWL 1TETL 4FQLH 4XH2B 1MCLA 1F8TH 2OTUB 1FDLL 2FIRT 3AC0A 3SDAA 2O26U 2PTTA 1F3JB 3KG5A 1KEMH 4R90H 4XVJL 5IMLA 1NCCL 2HLFC 4P9MH 2XIDA 1ZTXL 3T2PA 2ATKA 1RVFL 5D8JL 4FXGA 4IOIA 1BEYH 4OZHA 4QHLA 4JPVH 2Q7YA 2PYEA 1CXEA 4H25B 4Y19B 3TPUA 4BH8A 1NDGB 2CMRH 3HR6A 2BXZA 1CWVA 4KK5D 4HWUA 1A3QA 1BHGA 2VITB 4IMLB 3KR3H 3PWVB 3AS1A 4R4BB 2IAMC 3MJ9L 4MJ6B 2YUZA 4M61B 4YHLL 5TH2A 3BPLB 4RZCB 2AXHA 2OQJB 2CXKA 1GHFL 1I7UA 1K4DB 2AXFA 2DQCL 3Q5YA 1HQRA 1NLDH 5I18L 4OM1L 1BFVH 3EYVA 5E00A 1MAJA 3BWUC 3W9DB 1DBBL 2W0LA 5DQDL 1KENL 5EU7E 2MKLC 1LNUA 3ARBD 4P5MB 4U1LA 5J57B 3QCVH 5EC2B 5CEZD 1MRFL 1YQVL 2X1OA 3FRPG 3HMXH 2JELL 2DLFL 4MJID 4RX4D 1U3HA 4Z76B 3GMOA 4XZUB 1CVSC 5MP6L 1HQ4A 3UROR 1X5AA 4JFDA 4F15C 2H26B 2NCMA 3INUH 1DQLL 4UI2A 4HK0B 3QP3A 4GBXC 4EBQL 1QZ1A 5CBAA 5M95B 5F96H 1EVUA 2AXGB 5EC1A 3VG9B 3EHBC 1G7MB 1EEZB 1SVCP 5F44A 1Q9OA 2ZUUA 4HKXB 1UZ6F 1HIMH 1JF1B 3ILPA 5DJZB 1V3JA 5CILH 3TZVC 4Q2ZA 1R5IB 4GS7B 4JY6B 4Y8AA 5C9JA 3GJEB 2F54E 1KPUA 2NXYD 2ORBL 5E6IC 4ZDHA 4P5TD 4XNQA 5D5MB 2Y5TA 2YOCA 2NY5H 2NY2D 3TWCH 4HIEA 4JO4L 5L6YH 1ED3A 3IFNH 5DTFA 5BVJA 5T33L 1S7QB 3GIZL 1HHGA 3B9AA 5DURD 3WLWD 1ODAA 5MHSD 1JPTH 1BQSA 5GRVK 3EYQC 4NOBA 4M5ZL 4NUJB 5F7WC 4PUBH 3LKRB 3HZMB 4PJ5D 3RNQA 3B2VH 3EGSB 3TCLA 2FHBA 2FBJL 3MUJA 1P9MA 4PRNB 4WFHD 5IVNA 2WUBL 2AJXH 5FIEA 4YDIL 2DQUL 4NSKA 5IP4A 3VMPA 1FFQA 2VIRB 4BSJA 3QDME 4MAYB 1CDCA 2YD4A 1CFVL 3RL2B 1IGCL 4O5LH 4FRWA 1VHPA 2F54B 3QI9A 4LLMA 1RZGA 3OB0H 4IIQB 1P7KB 2AP2A 4U1KA 5AYUH 1J7VR 4X0KA 2BVOB 5MEPA 3D1MC 4U6HA 2FX7H 5FYKE 3BN3B 2G9HA 3GSUB 3GZKA 1JN6A 4GMSL 1WTLA 3MBEB 3SGEI 1G6RA 2EYTA 4HPYL 5JXEA 2PN5A 4Y2DD 3MX0A 4E41B 3Q48A 4ALAL 5L0QB 1FNEB 3LKSB 3F7YB 3RAJH 2RIKA 1UM6H 4GAFB 2IAMD 3D85A 3DX8A 4S1SL 3UO1L 3C2AL 3MOAH 3BSZL 1IKFH 2HH0L 1FGNL 5I17B 5BVPL 3UTPE 4XBGA 4UDUB 2OCFD 4CDHA 2MTPA 3DURB 4ZD3H 1OGAB 3QDMB 4F7MB 5DD3H 1WBYA 4D3CL 1ZHBB 5EO0B 4FQXD 1MI5D 1XIWA 3PIQB 4OFYA 4BQ8A 1NFDB 1RFDL 3E6FA 4ZFZA 2H3NA 1KLUA 1E6OL 4N8CH 2PW1B 2IGFH 5E56A 2CRIA 2G5BB 2H2PC 5FO7A 3QO1A 2FGWL 4HWNA 5FXCH 4POYA 4JO3H 2LU3A 1TVHA 3C5ZB 2CRYA 4P9HH 2Z0BA 2Q8BL 1MWAB 4NRYB 1B4JL 1RULH 2XWJA 4BZ1H 1BECA 4X6DA 3RUGE 2VDOL 3WIHL 1CF8L 3OAZK 5TE4L 5BV7L 2R1XB 5DVKA 1Q9LB 1ZEAL 1QQDB 1CXFA 3QXVA 1N4XH 3RX5A 4JLRB 4HX1A 4NN6B 5LAXB 5FAAA 3HZKB 3V4UH 2GK0A 3BH9B 1V3MA 4WWKB 5DYOB 4OLWL 4Q9BA 3CH8A 4Y1AA 2AXJA 3CXDL 3JWDL 1I7RB 2DI8A 4IM8A 5JOEA 1FPTH 2P8PB 2ICWJ 3LN5A 1LDPH 4HIJA 1F00I 2NTFB 4WEUD 3RBGA 4MA8H 4U1HB 2AJSL 4R26H 4JHWH 1TETH 4RMQA 4YHZH 5C0AB 1UH4A 4KHTH 3IETA 4UILH 4EDXB 4GMTL 4O51A 5JZ7D 1FDLH 1FC2D 1N8ZA 2E7LC 4XBEH 5B4MD 2WLYA 3RUGB 4KQ3L 4ZUUA 4E0RB 5DRNB 3MRJB 2A9MH 2QL1A 3PJSA 4HAGA 1N3NB 3GUTB 6FABL 5F1IB 5D8JH 3ESUF 3O9WA 1AQDB 4OB5H 4PJGE 2ZP0T 5A1AA 4V2CB 5DDHA 2IMMA 4UQ3A 4PJHF 5FM4A 4HPOH 1AP2B 5DMKB 4ZAKC 3MRIB 3MRQB 3UBXI 1A6TA 4WVRA 4GG8B 4MA3A 2L4OA 5DMGD 4ZS7H 2HFEB 4HDIA 4UT9H 3RA7L 4UU9A 2AJZA 1VFAB 1CDHA 4NKDA 4Z5RB 2AV1B 5BZWB 4YHLH 1MFBL 3OTTA 2F58L 1ERNA 3HZVA 1CDBA 3OV6A 4XH2A 2DQCH 4KK8C 4LSTL 4KUCD 1GXEA 4Y0GA 5I18H 4GLRH 4NC1E 4R7DB 3Q3GB 3F12B 5C7XL 4BUGA 5GS1A 1DBBH 5DQDH 1F3JA 1NMBH 1OTUC 4F7PB 1RUQH 1MRFH 4PJGB 3UP1A 3MOBH 3RWGB 2IH3B 5DA0B 5F9JB 2ADIB 2FEDD 2JELH 3O45A 4X8JA 4H25A 4J3UA 5MERA 4XVUC 4Y19A 1JZ4A 1F45A 1RJZB 4DVRH 4O58H 3MLWL 1YNTB 5C1MB 5ETUB 1DDHA 5D1ZC 1AC0A 2X40A 4EBQH 4P5KB 1YPZF 3EO9L 4G8GB 1LO5B 5D6CA 3C2SA 3PWVA 5AUMA 1J5OL 5TE6L 3NCYP 4JVPA 1JI1A 2D7QA 5HGHB 1BZQK 4K3JH 4M43H 1LEKB 1WBXA 1W0WB 4WI7A 5T1KA 2EEBA 2O5ZL 1FAIL 1K4DA 3OKOB 4M7JL 3ARFA 4ZFOB 4HK3N 5DSCA 2ORBH 2G75B 1P4IL 2Z4QA 2NLJB 3TJEL 4RMTA 4RFEB 1D3CA 3CH1A 3HUJE 1FL5A 1GGIH 4L1HA 2AQ1A 4JO4H 2HG5A 4TVPE 1SJXA 2FSEB 5FGSA 1CFQB 3U48A 3GIZH 1FL3B 3GI8H 1CD1B 4Y7MA 3W0WA 3HZYB 4M7LL 3OQ3B 4XZUA 1IAKB 4MXWL 4H0HB 3RVUD 1WTGT 2VDQH 3O8XC 2FBJH 3X3FL 1QFWH 4J1UB 2JCCA 3S35X 3UZQA 2X1XR 1JPSH 1OAXL 1YMHB 2DQHL 4GG6B 1Q0XL 3BQUD 4YDIH 4C83A 2DQUH 5IFHL 5F1NB 1O5DT 25C8L 3ALXA 3WNMA 3LMJL 3DXAB 1CFVH 2BNRE 3NN8A 3BYTA 4YFLF 3VFOA 1IGCH 1JF1A 3C5SB 4MXVF 5DJZA 4P4KA 2A2QT 2LAAA 1R5IA 1OVZA 4JY6A 1YEHH 1EDQA 1N0LA 2GKIA 3OJMB 3HUJB 2B2XL 3HMXA 1XGRB 5D5MA 2I9TA 3BGMB 1VACB 1OM3L 3BPCB 3MLXL 5K9QG 1J1PL 5D2LB 1XMWA 5GS2D 3O3BB 1DBML 2OXHA 3L3JB 1OP3K 3TFKA 3ZTNL 3QUXB 4JFXB 4JFHD 3SOBL 2LTQC 1YMMD 3ZKQD 4M62L 4GUPB 4S1SH 3HZMA 3ZKMC 3UO1H 4WW1B 4UOW0 3BSZH 1NH6A 2HH0H 1FGNH 4JRXA 3DVNA 1CFBA 5BVPH 2Z91B 1OLZA 1PEZA 5C0JB 1QFOA 3ARUA 4PRNA 4L5FL 1IAII 2APFA 5KS9E 1QRND 1JWMA 3TT1L 2P1YA 3GMNB 4MAYA 1RFDH 1QBAA 2XI9A 3C5JB 3O3UN 2ATPA 5DI8B 2ZJSL 2WAHA 1X3DA 1PZ5A 5FUZL 3D0LA 3GO1L 4QXGH 5F93C 4DOHE 2FGWH 1PLGL 2BVOA 3HLAB 3VXPA 5FYLL 1S9WA 1HH9B 2ZNXA 5D7KD 1ZGLA 1J0KA 5E95B 2ADGA 4E41A 4EXPX 2Q8BH 3TNNB 1FZJB 3L7EB 1B4JH 3DMMD 3M8OH 5TGBB 3LKSA 1T04B 2R4SH 5DQ9B 3WIHH 2KH2B 1L7TH 5E70A 5ICXA 1DTUA 1ZEAH 1QACA 3WO4B 3MZGB 3FQUB 2ADJB 1TPXB 3MROB 4MVBD 3I02B 1GL4B 3MRPB 2P5ED 5KS9B 5EOQL 4F58L 3O6FA 4UNUA 1OGAA 4FMFA 4NO0D 5E1AA 4OLWH 5EO0A 3CXDH 4K94C 2BRQA 3PIQA 3P4LA 1S5HB 1KT2A 5IM7B 1FVDA 5T5FH 2O61B 2Y1VA 3ZYOA 1JUFB 3EOBA 4DOHB 1R3KA 2G5BA 3QIWD 4OZHF 2AJSH 1U0QA 2IEPA 4WUUE 3L3KB 1D9KB 3B9KB 1CIDA 3S36L 7FABH 1KIPB 1R24B 3O8XD 4WV1B 4NJAL 2ZOLB 1F4YL 4KQ3H 4MJ5B 1ONQB 2B20A 3P9WB 2R1XA 1H15A 2QHRL 1Q9LA 6FABH 3MXWH 1WSST 1M7XA 3BGFC 4JLRA 2VXQL 3GMLA 4L3EB 2R29L 4WWKA 3V0WL 3HS0A 3T1WA 1UACL 2XOTA 1FFOA 2MJWA 3ZZ1A 1I7RA 1S9VA 2C1OB 1NCAL 5GRXG 3RA7H 1ZGLP 3C6LB 2HT4D 3V6FA 2NTFA 4M7ZB 1UB5A 2LE9A 1WT5A 3WS3B 3LKNB 3DNKA 4IBLT 1FNGB 4X98A 3C09C 4NQCD 1SY6A 4X4XA 1U8LA 4LSTH 4WO4B 2EDYA 3ZTJG 4EDXA 5JLZA 1FGVL 3WO3B 4KRNA 3KXFD 2XY2A 2HJKB 4Y5XB 1EXUB 3P0YL 1N64L 5DRNA 3ET9F 3MV8D 4Y5YB 1N3NA 3G5VB 3GUTA 2R0WL 5F1IA 5GGRB 4JHZA 3B9VA 1KXVC 4Q6IC 3CUPB 3MACL 1VGKA 5DMKA 2GSGB 3VH8B 3MRIA 3SGKA 4NNYA 4GG8A 3EO9H 2QTEA 2HFEA 5KZCB 1J5OH 3QG6A 1N6QL 3LY6A 5F6IB 5TE6H 1VFAA 4I48A 4PRPA 5DJCB 2AV1A 1FYTD 4MB3A 5BZWA 3T2QA 1E4XL 4QRUA 2OI9C 5JNYA 1I3UA 4FG6D 5SWSE 2O5ZH 4DQOL 1FAIH 5ANMA 3PXJA 5DJYA 4M7JH 5LKNA 1MRCL 4FFZL 4NWTL 3ZSSA 1ACYL 3Q3GA 4NQTA 3F12A 3K4AA 1P4IH 4KQ4H 1SYVB 3TJEH 3AB0C 4HFWB 3N1QC 5FK9B 1CFTB 1ROWA 1TZGH 4Q6YA 5SV3A 5JW3L 2GJ6E 5FOBB 4HWZB 3QSKB 2IANE 4LSRL 3WCYA 3CZFB 3FONA 5C0BD 2GT9A 5I0DA 3S88H 3KLDA 5F9JA 2ZKHH 5SWZA 5CBEB 3ARGC 5E5MA 4K2UL 2A9NL 4M7LH 3KPPB 2RFXB 1UFUA 4MXWH 1RJZA 1YNTA 5ETUA 5KJRL 3LRSB 5EU3B 3UJIL 3X3FH 1FIGL 4X6BA 1A22B 1I1AA 1OAXH 2DQHH 3VFWB 1EHLH 1YEGH 3RWFB 5HGHA 25C8H 1MLBB 2VR9A 4PGDA 3K2UH 3MJ8A 1LEKA 2B4CC 4Z7OF 3C8KB 4JE4B 4B7LA 1OP5H 1WICA 4TNWF 5GZND 4CDGC 4FXKB 2PR4L 5DD5L 3ECBA 2F53D 1QO3A 3NA9L 2CDFA 2CUMA 2G75A 2Z8RA 4L29A 3MLXH 3QAZB 1OM3H 3VD3A 2IANB 1XF1A 3X3GL 4OAWA 3TJHC 1DBMH 4XPBL 3OKYA 3HC0A 1KLGB 3DTXB 2Y72A 3SOBH 1FZMB 2AABL 5HYJA 4JKMA 1IAKA 1HH6B 3TYGL 3BZFA 1OCWL 4EI5B 1H5BC 2BHYA 5I75C 1CE6B 4D8PB 3KHOA 5EU6B 1VKXB 2L7JA 4LFHG 4UTBH 5LXGH 5D1XA 4GG6A 2OP4L 3HAEA 3HTLX 4Z18A 1K5NA 5GISL 1U93A 5DEGB 3MLPA 4HGWB 4Y16B 4X6DF 3MV01 3O4OB 1AGEA 3C5SA 2GITA 2BNQD 2D7TH 2BRRL 4OGZA 2XFXB 3P0VH 1AXSB 1BQUA 4R9HA 4LEXL 5C0EB 4S1RL 5FYLH 4E42B 4GJTB 3O3BA 1WFUA 4OLVL 3FQTB 1DR9A 3SDXB 1YEIL 1DBAL 4RFNC 4JKKA 2FJHB 5DA4A 3RL1B 3QULB 1E4JA 3PABA 4APQD 3S4SB 2IPKA 4F2MB 4XCNB 4F37F 1SYSB 1XF5B 4P2RD 2Z91A 3EFDL 5EOQH 4F58H 1XZ0B 2KUTA 3V5DA 5FKPB 2PYFA 4JFPB 5GGTA 1FBIL 3SDCD 2CO7B 4JQIL 3QH3B 5BV7C 3RX8A 3C08L 1CD9B 1CD0A 4X5LA 4M6NL 3MJ6A 2ZWLT 2XN9A 1CT8B 1MCNA 4AG4L 2VLLB 1HH9A 1KTLB 3JWDC 5FF6A 4XWOC 2OL3B 2XPGB 4HC1L 4MD0B 3ULUF 1FZJA 3L7EA 3PE9A 2I5YH 1HOCB 2ZG3A 4AM0B 5EA0L 5DQ9A 4TTDC 4I2XE 5CJXC 4RISL 2QHRH 3C6SB 1WC7A 4YDJA 1RUML 4XGZA 3TLRA 4DEPC 1UCTA 4XHJC 1E4KC 1CXHA 1RUPL 4BQ6A 2VXQH 1T20B 4WHYH 1I1FB 4H1LH 3MMEA 3QQNA 3ARDB 3G08B 1NGZB 3B8YA 2R29H 5I73B 1YA5A 4M02A 5EBGA 3V0WH 4CKVX 3UYOD 1H8SA 4YFLI 2CIKA 3PWUB 4QRRB 3WHXA 4P46A 4NQED 5DD1L 1EFXB 4HXBH 4DGVH 4Z9KB 4KROC 4J4PA 2MWCA 5FV1L 1P7QD 1FL6B 5JW5B 2V9RA 1FGVH 1DVFC 4MDIB 4WV1A 1WVZA 3BXNB 3RU8L 3NPSC 3P0YH 3C60C 4WTWA 4MQTB 1KCUL 4PJ7B 2W07A 3QNXB 3KPSA 1U8IA 3IXAB 1K4CB 1YJDL 2HVKB 1NCDL 1F90L 4KRMB 4CMHB 5KSVA 5IHZB 3G6JE 4YNYB 1MREL 2LU7A 4P2OA 3U7WL 4KK6C 3F58H 3QFJA 2DMBA 1A1OB 5HYQA 3LPFA 1L9NA 2FYYB 1N6QH 1ZS8A 4K9EC 2W0FB 3R0MA 2AEPL 4JAMA 3DYMA 4K55A 3OMZA 4BFBD 5HHMA 1HHJB 3WS3A 4M93C 4ZS6C 4G6ML 1OSPH 3HI1B 1K2DA 4DQOH 3IDIA 5ESVB 2NY4B 3S6CA 1MRCH 4FFZH 3QA3A 3SCMB 1ACYH 5ILTL 1XR8B 1A2YA 1EX0A 1JZ2A 4JJHA 5I1IH 2JCCF 4GRMA 2HJKA 4Y5XA 3TVMD 4A2LA 5TE7L 1I8LA 4JPWL 4Y5YA 2H8PB 2OXGA 3RZCD 2YEZA 3PHQA 1MEXH 2FLBT 4LSRH 4YC2B 4NO3A 5HHOE 1JWSB 5GGRA 2FO4A 2Y06L 3EOAA 2A83B 2A9NH 3PXHA 4K2UH 4QKXB 1XAUA 1A1NB 5DJ0B 2QR0B 2BY3A 2GSGA 3JV0A 3VH8A 5JXAL 3U7AA 4L4VE 5HGAB 3TBSB 5D5MF 5KJRH 4HIXL 1FIGH 5EORL 1U8JA 1YZZA 1MY7A 1HKLL 4QHNB 5E9DD 3RBSA 1FZOB 3UZVB 4CJ1A 2P45B 5IB5B 1YQ2A 4YR6A 3GHBL 2PR4H 2E9JA 3OKNB 1UB6A 4P23C 3NA9H 4RIRB 1BGXL 2VLJB 1SYVA 2EH8H 2FH8A 4LLVA 4HFWA 4XNYH 3MRFB 4KJQC 2W60A 5FK9A 2YD7A 3X3GH 3AY4C 5MI0B 5FOBA 5HHOB 3VRIA 4HWZA 3EJZC 1TJIL 2F5AH 4XPBH 1LE5B 3O6ML 4HXAH 4EVNA 1OARH 5L2JB 3WNPA 2AJYL 2C3XA 3HAEG 2Q6WA 3VCLB 5HY9B 1TVBB 3P9LA 4G6JL 4BELD 4L4VB 2EDLA 1T5WA 1AO7A 3T09A 3BKYL 4X5WB 1OCWH 3UZEA 4KROD 1RD6A 3WHE0 2DIBA 2YD5A 1G1YA 3U1SH 1CL7I 4PRDB 3VFWA 2OP4H 2V6HA 4LHJB 1S7TA 4H26B 3RWFA 1RZIB 2VKWA 5GISH 3CLFL 1IQDB 1QFUL 1LEGA 2NPLX 3O2DL 1NEUA 2Z31D 4FA8A 5AG9A 3I6LD 1XFPA 3QEHA 4I4WB 3C60D 2E7MA 4LNRB 3WKMH 1KJMB 4BKLB 4JREB 2X1QA 4FXKA 5AYQA 3VXMD 4N0CA 5FYKL 2MQ3A 5J56B 3VRLF 2BRRH 4PJ9D 4JFOB 4OLYL 4MS8D 4LEXH 4XVSH 4U3XA 1RZKH 2HLAA 4S1RH 5IVOA 1WIPA 3ZL4H 3DBXB 1EIBA 1MWAL 4BFIB 3CX5J 3OAUL 4OLVH 1DBAH 4UINH 3MJGX 3CXHJ 3SGDH 1JNNL 2ID5A 5DMYA 3H42H 1E4WH 3QIBB 1Y6MR 2KKQA 1RZFL 1HH6A 5D1QC 3VGAC 1LE9B 4P3DB 1EMTL 3SDAC 4F8TA 4D8PA 4I18B 4JEGB 3EFDH 4MQXD 1S7SB 4MCZB 5FA4A 5BS0A 2CLZB 2DBJA 3IKKA 1IARB 2EIBA 1PG7X 2DQFA 5ENWB 1FRGL 4HAFA 3FB8A 3QT2A 4N90E 4AEEA 4IOFC 5DJXB 4JQIH 5IT2L 4TNVK 2PXYD 3C08H 3QPXH 3QDGD 4Y4HC 4ZOBA 1PY4A 1FIEA 2APWA 2NZIA 5KN5B 1M7DB 1MFAH 2RCSH 5INCB 2ZSVB 1H3VA 3RGVC 3H3KA 2DD8L 2AJUH 4PG2A 2EEAA 3VXOB 1CYGA 3QDAA 1IQWH 3UCRA 2Z35A 3MV9D 4F8QA 2B5IB 1I9IH 2GEEA 4KI5F 5L2KA 3SDXA 1C12B 3Q6FB 3OR7A 4AYFA 1QOKA 5EA0H 2CK0L 4URTB 5DHYA 4B7IA 4FQ2L 3QULA 2OJZL