3GMQA

Structure of mouse cd1d expressed in sf9 cells, no ligand added
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
267
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
publication title Structural evaluation of potent NKT cell agonists: implications for design of novel stimulatory ligands.
pubmed doi rcsb
source organism Mus musculus
total genus 80
structure length 267
sequence length 275
ec nomenclature
pdb deposition date 2009-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gmqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gmqA01
1ZK9A 3VFPB 3O3BB 3GBMH 2OZ4L 2OP4H 1W0VB 4Y8AA 2ESVB 3MV9E 1EJ6A 2JE8A 3O6FC 3H3KA 4NOFA 4FXKA 1SBBA 2C3WA 5E5MA 1X44A 2Q1EA 4UB0H 3U7YH 3FCTB 2BNRE 2HA1A 5MEND 5JQ6H 4FQJH 1OAQH 1MCBA 3D25B 3KPMA 1HN1A 2B2XL 5IB1B 4XVJH 5DA0B 2FEEI 1I3RB 4O4YL 5F9OH 4O2CA 5HVGB 1B0GA 4J8RA 3HN3A 1CDYA 4LAQH 3EDFA 4R97B 1RJZA 2X1XR 3CDCA 3HTLX 3BHBB 4X6CA 4ZFFA 1S3KL 1I1YB 5J1AB 2HLAB 1H8OA 5EBWB 4BFBD 3RWDA 3F8UB 2I9TB 4PRPD 4P46A 1PSKH 3QHFL 3HCVB 3DECA 5IWLA 2FYYB 4IJ3C 3ALPA 4PJ5B 5F89B 3O8XA 3EZJB 4AH2B 1X5HA 3QCTL 4QXUL 3DMMB 3HUJA 4JZOB 3KS0J 1FYTE 1GGTA 3U0WL 1U8MA 2EC9U 2XKSA 2IPKB 2OI9A 1MJJA 3LIZH 4KI1A 3HZMA 2A83A 1UM4L 2EYTA 2HH0L 5FOJA 5F3BA 3BO8A 3CX2A 1XMWA 1C08A 3CFDB 3CFJB 3VW3H 3QEHA 1OGAE 4HBCH 1XGYL 3FQRA 3VJ6B 4PG9B 4U33A 1FL6B 3NCFB 5T3ZE 1ZLVH 1K85A 1RZGB 4R4FL 5F96L 4D0BB 1ZT1A 2IAMD 4GW1A 1G6RH 4M6MH 1OAKL 3DRTB 4NQTA 4UU9B 4OZFA 1HHIA 4KMQA 5JIKA 3VXSB 4YX2H 2R1WA 3HE7B 4M1GL 2IADA 1MIEH 4NJ9L 3BQUB 5CBAB 3O0RL 4HGMA 1TDQA 5SWZB 3MRBB 4LSDA 4N9GB 4O2EA 4RFEB 2EDOA 1MCOH 4WUKH 3CMOH 3LQAL 5IWLC 5FA4B 2CMRH 3EO0A 5EZOH 4Y2DB 1YEKL 2YEZA 2UWEE 3S5LB 2Z35B 1ES0A 2FGWL 1N8ZA 2OI9C 1G7LA 2YRLA 3DLQR 3MZTA 1BEYH 4JFZL 3G5YB 4GBXB 4RDQG 4U7MA 2B1AH 5MP6L 3BT2H 2KZ1B 5IIEB 1B3JA 3RWIB 3RY4A 2NX5E 4BELD 3PQYE 4XPFL 4HIJA 5FM5M 2A9NL 3QULA 2BY2A 3RDTD 1X5KA 4JJ5B 3O6LH 1DLHA 5D1XA 2EE2A 1LK2A 4OM0H 5CEZH 1ZHKB 4PBVC 2NXZC 4NO3B 4QHKJ 4XCEA 5DLMH 2BJML 4K3GA 4XBEH 3BRDA 3Q2CA 3FO9A 3VD5A 3WFZA 1U3ZA 3DVNA 4M6NL 4PY8I 4FTVE 4AK1A 5CZKA 3B9KA 4ZXBA 5IBTH 2P5WB 2D31A 2YD2A 2GCYB 3IKCA 4N0FB 4TRPH 4I5BB 4U1GC 3I75A 4KXZI 1T6VN 1G6VK 2WIIB 3QG7H 4M1CC 4ORGA 4JZJB 4C83A 4F2MA 4YPGB 3KLHD 1MEXL 1RUQL 1LO2H 4CDGC 1FORH 4NQED 3SE4C 3GRWL 4WW2F 1NDGB 1DANU 4KI5E 4XP4L 4G9DA 2EE9A 1F6FB 4DAGL 2AERT 3UTSE 4DCQB 3GJEB 3IDMA 3QJHA 2N56A 4BFGA 4ODVH 1MFAL 3VFNA 2YD7A 3MRMA 4ZTPH 4ZTOL 5H35A 4K9EC 3MRFB 2I60H 3AXLA 1GIGL 4GUPB 3MRPB 1AO7A 3IFNL 3MRJB 5H2BB 3QDGB 2W07A 3VFRA 4LCIH 1NMCB 1YEGL 1S5IH 4CDHA 4V1DA 2NLJA 1GHFH 3M17B 4BKLB 4ZYKB 1Q1JH 4JY5L 4ZXBC 3WL9B 3NCBB 2V17H 2P7TA 5D8JH 2OMBA 2XWTA 1NGZB 5C2BH 4XNUL 1TLKA 4JFEB 2BSRA 4JQIL 5C0ND 2BDNL 4JO3L 2PTTA 5E0QA 4IMLA 5J6GA 4EUPG 3MRNA 3QEQE 2UVFA 5EC2A 5I1LA 1YJDL 1J88A 1A9EB 4LVHC 2CUMA 4WI7A 3BD5A 1EHLH 1S7VA 3KYNB 4S0UC 2EYSB 5TJWK 1BJ8A 3P9MA 3RUGF 2J5LB 2XZZA 1X5GA 4UIMA 1KN2L 3TJHA 2G5BA 1XGQB 4WFFE 4LHUD 1F6AB 3OJ2C 4C4KT 4NKDA 2R0WL 2HKFH 3IDGB 3LRSA 2NY2B 4UV7L 1NCBL 2WIMA 3CLEL 1D9KD 3RKPA 1JZ5A 1TPXB 1CFQA 4FQLH 2AV1B 1NGWB 5A40E 1BQSA 2J8UF 2HVKA 3RWHA 5DD6B 2C3XA 1JIBA 4P4KA 4LLDA 1BD2B 4E0RB 3SQBA 3V8OA 3LKRB 4G8EA 4Y0GA 3TCLA 3QUYB 2PN5A 3ULVE 5FYKD 4RA0C 3EKCA 2M1KA 4ZMAT 5J9PA 4MX7B 1BFOB 5AD0B 2EZ0C 2EXWD 1NKOA 3L3IA 5IW6B 4MNGE 3FO1A 1RK0A 4QHMA 3L3HB 2AXFA 5ITBH 2FWOA 1VFOA 4JN2A 3X11A 1Z0NA 2JJTA 4DW2L 3GMLB 1QVOB 2D7MA 5J13B 4OD1L 4YE4L 3LQZB 5T1KA 1MCRA 3SJVB 4NZUL 3PP4H 4HC1H 5DFTA 3BPLB 4V2CB 3B8YA 3TJHC 3PJSA 1OAXL 3BPCB 4XP5L 2WWKO 4HV8A 1F3RB 3SKOB 1BWWA 2YD5A 4OUOA 3O41A 4PJ9B 3QIWB 5C0BE 3KYMB 4NCC2 2Y72A 4K71C 1FO0H 7CGTA 4JO2H 4Z7OE 1U8KA 1HDMA 1PD6A 1X5ZA 2XXMB 3IJYA 5E1AB 4PJAB 4YDIH 4CKVX 3N9GL 4S1RH 4O02L 3MODL 5BCAA 4M5ZL 4L4TA 1FL5B 4LSSH 4J3VA 5EO0A 4JANA 3SDAB 1HINH 1UKSA 5I1HH 3UJTH 1U2HA 3AS3A 3O4OB 4Y4HD 3DV4A 3VXRA 1AIFA 4P4RB 5DRNA 2DQTH 1HXMB 2BSED 4ZUUB 3S3PA 1D6EA 4R2GD 2VWEC 4U6TA 1RV6X 5LAXA 4MSWB 4EN3A 4WI5A 4XP9L 2QHLA 4PJFF 1PY4A 3V6FA 3T0EA 2DBJA 3L95A 4PJEE 2YD1A 3MLTA 3T4AA 5TGBB 1GGUA 4YIQB 1S9KC 3TESA 2EH8H 5I1DA 2AEWA 3B2VH 4TSAL 2NY7H 5HHXL 3SDXF 4I77H 5J57B 1XF2A 4N0CC 3TZVD 3TBYA 3T1FB 4OZFG 4YUEL 1E4XH 3QEGL 3X12B 4JM2F 3WNNA 3NZ8B 1MCQA 4EUPB 5LKNA 2Q86A 2DIBA 5KAQF 2A6KB 3SN6N 2V2TA 1JNHB 3O6FB 3OKMB 4EBQH 3C5SA 4BZ2L 3MX0A 1AQKH 1TMCA 5I74B 1S78C 1S9WB 5BRZA 3TA3A 1QACA 5EOQH 4YAQA 4J3OC 4WW1B 3RKDC 1FFNA 2CLZA 5C0AA 4BFIB 5T1LB 3VFUB 3NIGE 1CXFA 4OLVH 4XNQB 5IVOA 2FD6H 4Z0XA 5A2FA 5F3HA 3UTQA 4QRPD 2R4RL 4XVUC 3REWA 5DC4B 3EGSB 4HEME 5F88A 2VXSL 3F58L 4Z78B 4ZS7H 2GK2A 1RZ7L 2Q76A 3LV3A 4KH2A 2D4FA 1RZIA 5JDSA 3JWDL 3N85L 3VFMA 4YJZL 4IOSD 1EVTC 3MRCA 4KUZL 3H6JA 4UT6L 3N1GC 4GS7C 4IJ3B 2VN7A 3WNLA 4NHUB 2F8VA 4FXLA 2EE6A 4OF8A 1IFHL 1REIA 2J3SA 4OF5A 4QTHA 1OARL 3DV6A 1JWUB 5CWSB 4FQHA 3WIIH 3NIDF 1XCTB 4OV5B 1RIHH 3KPSE 2DM7A 2Y7QA 3FQWA 3Q5YA 3V6OE 3GSNH 5CUSH 1XIWD 4FXKB 4XXCC 1OP9A 4X83A 5E5MB 5GPRA 1RMFL 3ZDXE 1UEYA 3ZHLA 1A14H 5DVNA 1YQ2A 1IGIH 1U8HA 2MTPA 3KPMB 2HWZH 2F54D 4WFHE 5AYQA 4C56E 3ARVA 5MENA 2E7HA 4O2CB 5HYJE 1B0GB 4J8RB 3ARBD 1MCHA 4GKZA 3O4LE 1RJZB 3GMOA 5KJRH 4HXBH 4X6CB 3EOBA 4ZFFB 5DSCA 2HLFD 1MRFL 4DQOH 5BZWA 5C3LD 3U7AA 5DJ0A 3QQ3A 5TF1L 5FOBA 3OZ9L 4GMSL 4LARH 3RWDB 2ATKA 1ROWA 1NBZA 5TE6H 3ZL4H 4XXDA 4P46B 2ZG1A 2VL4A 4NWUH 1EMTH 3X17A 1YQVH 3O8XB 3MR9A 4F3FA 2JKXA 1JN6A 3HUJB 4JFFE 2A2QT 3WUWG 3MV01 2YD6A 3RX7A 1U8MB 1N4XL 2OI9B 1LILA 1MJJB 3NCCB 3HZMB 3R1GL 4PJXE 4YLQT 2A83B 4JFQA 1MH5A 4NSKA 1NCUA 2EYTB 5F3BB 3BO8B 2DN7A 1C08B 1AGBB 5DD3H 3QEHB 3T0XA 5KSBA 2RB8A 3FQRB 4Y4KC 1QLFA 3GJFH 4LP5A 5DK0A 4YFLF 1GGYA 3TV3H 4GW1B 2P4AB 3BKJH 4OD3H 2D3VA 3VFWA 3HI6H 3NFSH 4PJGF 2BFVL 4MJ2A 4RCAA 4OZFB 5E2VL 1WV7T 1HHIB 3QHTC 2IAMA 3IGAA 2R1WB 2GYSA 1PVHA 2IADB 3CIQA 1K3ZA 4HMEA 4U6XA 1EHAA 2FEDC 4O2EB 4MXQA 3WFCL 4A2MA 4U1GB 3O6ML 1EEUA 3EO0B 3S35L 3MA9L 2YEZB 2X9YA 2J88L 4LNRA 3BE1H 3HNSH 2CGRH 2J6EA 2H6PA 5FCUH 1I1RA 1ES0B 1N8ZB 4FQXB 1PBYA 1BM3H 1G7LB 1MFCL 3X13A 3PXHA 3ZHKA 5I8KH 4YHZL 3T1WA 4NQDD 4J6RH 4LLWB 1QOKA 4FFYH 5C0GA 1INEH 3UTPD 3RAJH 4HIJB 2W60A 1N6QL 1MNUH 5D1QD 3QULB 1GC1C 1Y6NR 4D0DA 1UH2A 1OPGH 5D1XB 1DLHB 1LK2B 4XCEB 3AY4A 5CZXD 4DGIL 1BPVA 1X9QA 3FRPG 3RDTA 1S9YA 1F3JA 4CJ1A 2ZCKL 1SMAA 2VLMD 3FO9B 2XOTA 2OQJA 3BZEA 3DVNB 5F93C 2AJUH 3B9KB 4ZXBB 5JHDD 2D31B 3VXUE 4MXQC 3IKCB 2E27H 4RAVA 4X4YA 5DQDL 1IQWL 4ZDHA 2YXFA 4ORGB 5HHOE 4C83B 4F2MB 3AUVA 1UJTA 1YN7A 4YC2B 5KVGH 4PRHD 2EEBA 3WIFA 5TFSL 1ZLWK 3ARZA 2EIDA 2JB5H 1HIMH 4NQEA 4K9EL 5ICXA 3TNNA 2RAMA 4NNPH 1RU9H 5K59E 3IDMB 1ITCA 3QJHB 1G7MA 1GCFA 3VFNB 3MRMB 5H35B 2C4XA 5I9QC 2L7JA 3QFJD 4URTB 2HT3D 5JR1L 4S1DC 2R56L 3AXLB 4GKOA 2DJUA 4PBXA 4TSBL 4IDLA 2CQVA 1A9BA 5BQ7A 1AO7B 3MV8D 5J11C 4HS8L 3VFRB 4C59B 5DJXB 4OBRA 4PB9L 4KTDH 4V1DB 4OIIL 2IQ9H 2NLJB 2APXA 3N1QC 2X70A 4KI5F 1T83A 4N8VA 1A6VL 5BVPL 4M1DH 5ADPH 2OSLA 2WK2A 2GTZA 3Q1SL 5DT1L 1JMZA 2P7TB 3O6KH 3VXNA 2XWTB 4HFUH 5ALBH 2K3TA 3TO2A 4OCYH 1X6NA 1AGEA 2BSRB 1E6OL 1HWGB 1KIUA 4NUGH 4IMLB 5J6GB 1AJ7L 1CLOH 3MRNB 4JFPA 5EC2B 3WD5H 4KKCC 5I1LB 1KTDA 5T1DH 3BGAA 2GTWA 5HYSA 1BVLA 4XNMA 4N8CL 5LBSL 2R2BA 5M95B 4JFDE 3MACL 5IFJA 2DMBA 1KCRH 3MJ7A 1WBYA 1S7VB 2QADD 4ZO9A 5I8CA 1MCPH 1OSPL 3P9MB 1PLGL 1F4XL 5ECJE 4UIMB 2YPKA 2G5BB 4IIQA 4FQPA 1JF5A 3IRPX 4APQD 4CN1A 2P8MA 3RGVD 5AZEL 4NKDB 4FZ8L 3GI9L 3UEZA 1F8TH 5LXGH 2CJUL 1I7TA 4FG6C 3W0WE 4LHUA 4KRPB 3GBNH 4U49A 4PGEA 2I25N 1GPOH 1CFQB 2OR9H 5GZNC 4DKFL 2CKBH 1D9KA 3BN3B 1H8SA 5DF0A 3VFOA 4H1LH 1T83C 2NY4C 3NFPA 4GRWB 2E7CA 4G8IA 3BJ91 1K6QH 4WCYL 2HVKB 3C8HA 1OTTD 5GRWA 3RWHB 1G9NC 1A0QL 3RTQD 2AV7A 2VIRA 4LEXH 2WQ8A 1A3LL 4ZOBA 4P4KB 3CDGA 4LLDB 3ULUL 4G8EB 3TCLB 4UOJA 4L8SA 1FZJA 4TQEH 1JF1A 5AG9A 3VGHA 5J9PB 1C7TA 5E2TL 4NC1C 3L3IB 4MWFA 3FO1B 1RK0B 3VA6A 4QHMB 2AXFB 2FWOB 1UZ6E 4JN2B 3IFOA 3X11B 3D39A 4PR5A 1OP5H 2VXVH 4G7YH 3V9FA 1JHLH 1GZQA 4HULB 1T66C 5T1KB 5IHUH 2P5ED 2EDLA 2V5SA 3LKOA 2FSEA 1M7DA 4HV8B 5F7YC 3O41B 2ERJC 1B2WH 4FQCL 3KR3L 4KK5D 2FATH 1U8KB 1HDMB 2GSIA 2Z0BA 1Q72L 2VOTA 3IJYB 4UI2A 5FYLE 5TE7L 4AG4H 3WV0A 2VLRD 3T8XA 2QQLL 2JLLA 4L4TB 3GIZL 5E8DH 1AFVH 4JRXE 4ONGH 5EO0B 1VDGA 4JANB 4OLZL 1MWAA 3DV4B 1HQ4A 1RUPH 3VXRB 7FABH 1AIFB 4M93C 4MD0A 4NKQB 5DRNB 5E03A 3UZVB 2NPLX 2JK5B 1P2CA 1D6EB 4RMUA 4M4RA 4Y4HA 5LAXB 3CFCL 4FFVC 2YUWA 1J1OH 4EN3B 5I1KL 3H2WA 3T0EB 3V6FB 3FN0H 1SEBA 3BGFC 2EXWC 3NAAL 4UILH 3MLTB 4O2FA 3T4AB 1BQHA 1E6JL 1MI5E 5I75C 4LGSB 3M1BA 4L4VE 4GS7B 1B4JH 1FC1A 2IG2L 1NMBL 1XF2B 3NMEA 3TBYB 4PLKD 3FB5A 5FAAA 2UZIL 1U95A 5IBLD 3BAEL 4P2RE 2G75A 2ORBH 2R9HD 4P5TD 3TZVA 5CS7A 1LO4H 1HQRA 5F7EL 4EI5C 2Q86B 4TYUA 3F7VA 4JVWA 1NBYA 4L5FL 5CEZD 2OJEA 2V2TB 3C08L 3IFLL 3P11L 1TMCB 3C60A 4F57H 3TA3B 5BRZB 4EEEA 1GGIH 4HHAA 3D48R 4YAQB 4X4ME 5CGTA 1J0IA 1FFNB 2CLZB 4LCCA 5C0AB 2MFNA 4BFEA 3F62A 5H94A 3SPVB 1IT9L 3OKLA 4Z0XB 1JNNH 5F3HB 5C0DA 3UTQB 4Y4HC 4Y8DC 3T3PE 1LWRA 4U31A 5FDWA 2BXZA 4I3GA 5F88B 3PWVA 4D3CH 4R2GC 5F7KC 4QRPA 2KPNA 1IM3A 3LV3B 2Q76B 4G8FA 1RZIB 5JDSB 1RZJH 4LSRL 3VD9A 3VFMB 1A6WL 1X4YA 3CVIL 3MRCB 4HS6A 5GZOD 1ZANH 5DMYA 5HTSA 4KRNA 4Y16D 4Y5YC 5EN2A 4YHLL 2DQUH 5HYQA 4N0UE 5C0RH 4QTHB 4Z7WE 4Y1AD 2XRAL 3DV6B 3UJJH 1IAII 4FQHB 1SM3H 3V5KA 1LE5A 1JFQL 5D7JC 3BFOA 3KS0H 1RK1A 3FQWB 1DBAH 3VGEA 1TQCB 4N0RA 3SDCD 3AVEA 4QCIA 1CLYL 2NY6D 1MHEB 4LHQB 5LGHL 3C60C 2XTJD 2O26U 4ZNEE 5I0DA 1U8HB 1OY3B 5KVEL 2YA1A 1XIWA 1IAKA 4YDJA 4TSCH 5C2UB 4X7CC 1BBJA 3ZYJA 4JKPH 5MENB 2BY0A 3VXME 4M8QA 5J3HD 2F58H 3R0NA 5JA8B 3GMOB 3UX9B 5B39G 5DSCB 2FB4L 2XWBA 2VZVA 5BZWB 3RY5A 4K7PY 3ARBA 1H3VA 1JZ7A 3QQ3B 4QGTA 3V6ZA 5FOBB 3RVXD 3DBXA 4Q7DA 43CAA 4XWGL 5DJDA 2K7QA 3I6LD 3PF2A 2ATKB 1NBZB 2A73B 3ZKMD 1T2QL 3BN9D 5GGVY 1AR1C 3MLZH 4XXDB 4Q0XL 1QHOA 3K1DA 2EEAA 1UB6A 3ZDXF 1DL7L 1BGXL 1ZVHA 2O5ZL 3FHQA 5BV7C 4F3FB 3QXUA 1LO0L 2ESVE 1JN6B 4PRPB 4WI6A 2JJUA 5BXFA 1R3IL 1BJ1J 5ILTL 4JVUA 3LZFL 4WW2C 1B88A 4YHKH 4JFQB 4NSKB 2X4TA 1CTOA 5JHLH 3WE6A 1H15A 4FMKA 3EYVA 5KSBB 3BWAA 4JPWH 4ONFH 5HYSG 3RUGA 1MF2L 3JV6B 2V9TA 2GK0A 1QLFB 3V0WL 5GS0H 3K7UA 5DK0B 4O5LL 4GMTL 4I3RH 3ZKSD 1FJ1A 2FX7H 1GJIA 1ZVYA 2CRMA 3VFWB 1LGVA 3NCJH 4FFWD 4HJJH 2AI0H 3HAEA 1CZ8L 3INUH 3QUXD 4AT6A 5F1NB 2IAMB 5IQ7H 4PJ5E 3IGAB 4LK4A 2HAZA 1OTSC 1KJVA 1ZLUH 3BIAX 1JGLL 4ERSL 2HLFC 2IAND 3IXAA 1A5FL 4U6XB 3U0TA 4NKIH 3UYRH 2IBBA 1TJHH 4LHUG 4LIQE 4XNYL 2X09A 2X89D 4KVCL 5TPWH 4LNRB 2H6PB 5CP3H 4JCLA 1KF9B 3BGMA 5DR5L 3A6BL 3ZYOA 1OAUL 2EECA 3X13B 1NCAL 1KJMA 4FABH 1JPTH 3DRQA 2UZYB 4TN9A 1M71A 4PIRF 1GC1L 4KKBC 1MELA 4G8GA 1YMMD 4PTUA 1YECL 2GEEA 5HDBE 1WZMA 5C0GB 4XBPA 1P6FA 2W60B 4LSTH 1DBKL 3VXSE 1CFVH 3L3OA 4D9LL 3HG1D 2E9BA 4D0DB 5J11B 3W9EA 2AJSL 4WFGD 3CSGA 4BM7A 4W6XB 4OUUA 5SWZE 2DOCA 5D1QA 1DQML 3RDTB 1S9YB 1L0YA 1F3JB 4XH2A 2HT4D 2IPUK 2OQJB 1XAUA 5GRYA 3BZEB 3BKCL 3OGOE 3K4ZA 3ALWA 2DLTA 3K8KA 4PRNA 1A1NA 1A64A 5DHVH 1IM9D 1PYWA 4RAVB 4X4YB 3NGBB 3ZE2F 1RURL 2J6EL 4Y5XC 5DO2D 3QRGH 5JHDA 4ZDHB 3E2HC 4CRPA 3B3IB 4M62H 4DGYH 3P0VL 5CJ8A 2LFGA 4NWTH 1YN7B 2EDFA 1MCNA 2SEBA 1VPOL 1YPZF 3K2UH 2XQBH 5I73B 3WIFB 3DSFH 1FL3A 1NBVH 4X5WA 3NPZB 1E4JA 4FMFA 4NQEB 2EEDA 5ICXB 3QZWA 4PJFA 4PRHA 2WLYA 1G7MB 5C86A 3O3EA 3UROR 1DBJL 3TN0C 5F7UA 3DROA 1E4KA 3OAUH 3PHOB 4L8DA 5BQ7B 4JY6A 1MRDH 3SDXA 5DMGD 2QSQA 3QFJA 4UZGA 2P5WE 4LPUA 1DLFH 2AEPH 1OAZH 2DM4A 2VDKL 4KDTC 4YQXL 1CDBA 1BQHG 2VRAA 3MV8A 4K23H 3WKNA 5A2IH 2X70B 1P4BH 2WNGA 4N8VB 2NY4B 4Y5VC 1NUNB 3VE0A 2OSLB 2GQHA 2GTZB 3GMRA 2CO6B 4BZYA 3DYMA 3VXNB 3TO2B 1AGEB 4GRLA 2NCMA 5GGRB 5J0BA 1GYAA 3BRFA 3WXWH 1J0ZA 1ZLSH 4JFPB 3EW3B 1MCIA 1KTDB 2COQA 2GTWB 5HYSB 1BVLB 3AREC 4JN1L 4XNMB 1TJGH 4QNPE 4NZRH 2R2BB 5IFJB 1BFSA 3MJ7B 1WBYB 2P45B 1A22B 2HN7A 5I8CB 2J2ZA 5I76A 5AAMA 4RWHA 4HWZA 9CGTA 3L5XL 3IAGC 3NFNA 3QDGE 5D2LF 3VDBA 3U1SL 4X98B 4AEIH 2AXHA 4KY1H 2YPKB 2C4FT 4IIQB 2HRLA 1CFTA 4OB5L 2UUDH 1A7BA 1E4KC 1CQKA 2P8MB 2DBLL 5IVXF 5I18L 4UDUA 4WO4A 1FFQA 3K8MA 4QO1A 1I7TB 4G6KL 4I8DA 1A4KA 2AK1L 4LHUB 3SKUD 4APQA 4PGEB 3RGVA 3UP1A 4OFYD 4JM2C 4JFEE 1EJOH 5LWYL 3MJ8A 1D9KB 3VFOB 2G60L 3CAFA 1R5VA 4LRIA 1OD7A 3NFPB 3Q5OA 4S1QH 4LEOA 4LVOC 3D85A 2G5RA 4NZTH 1TNMA 2AV7B 1WEJL 2VIRB 1BVKA 3CDGB 4YWGH 5DZNA 4NO2A 4GRLC 4WHDA 1MHHA 4L8SB 5ICYA 4M93B 1EDQA 1J5OL 5BMFH 2I07A 4XPGL 1FZJB 1JF1B 4GAFB 4XNXL 4G3YL 2HG5A 4IS6A 4MWFB 2GIYA 1YUHB 1EEQA 1W0YT 3IFOB 1IMHC 2E8YA 1KYOK 1KIRA 4LPWA 4PR5B 5TQ0L 2WM0A 3KWWA 3QPQC 4KPHL 2DM3A 1GZQB 3V7AE 1WAAE 3VWJA 4LASL 5EIQA 4YHOL 1JGVL 4FQIH 1OOAA 3S8WA 3B9EA 3RIAF 1MFNA 3LKOB 3W81A 1EO8L 2FSEB 2VDPH 1RUAH 1CDGA 1URLA 2DQCH 2P5EA 5F44A 4WO4C 3S34L 2DL9A 3VD7A 1ZA3A 1SMOA 2VLJD 3RGVC 2GSIB 2LABA 1BD2E 4UT7H 4WNQA 1CQYA 4K2UH 3HI1B 5GJSL 5F7HA 2YA2A 3H3PL 3HMWH 5ESAA 3GSOA 3T8XB 5EU3A 1SEQH 3WFDL 2DAVA 2D0FA 4KV5E 1UA6L 1AXTH 1JTPA 5IM7A 1G6RA 3D0VB 1MWAB 2VLRA 1OB1A 3T2OA 1HQ4B 4YDVA 5FYKL 4MD0B 1H3WM 1D5IL 1P2CB 4Z7VE 1N0XH 4Y4HB 5J1SC 1GGBL 1YY9C 5K93A 3SJVE 1FFPA 5IJKA 3UJIL 2VDLH 4GXUN 2C3GA 4HXAL 4KGLA 5LCVH 5B22A 4PJGA 1VENA 4R2GB 5C9KA 4P2OD 1SEBB 2Z31C 1VESA 3SBWA 1NAMH 5HHVL 1BQHB 4G6MH 3VWJC 3WFBL 1SBSH 4RAHA 4NQCD 1QPXA 3T0VA 1NSNH 4PJAE 4G9FD 3HAEG 1IC7L 2GY7B 3FB5B 3DTXA 1L6XA 1PX4A 5F8RC 1PEZA 2CH8A 1CLZH 3P4MA 3RI5K 3RPKA 5B38G 1YEDA 3O45A 4G5ZH 1X6LA 1U95B 5HDOA 2G75B 3UPRA 3TZVB 1FE8L 1HQRB 2W9EL 5GRUH 3EYSL 1F02I 3F7VB 1GGCL 1NBYB 1MWAL 3NCMA 4P5TA 2OJEB 3QI9D 2W65A 5JW4Q 3G5VA 4HHAB 4ZODA 2KH2B 1CN4A 4BSWA 2YRZA 2EIZA 5MEOA 1KYOJ 2EDWA 4LCCB 5H94B 5J56B 4DEPB 1FGNH 3OKLB 2D7TL 3BKYL 3SO3B 5C0DB 3TWCL 3JZ7A 5FDWB 4R26L 1OW0A 4YBHA 2ADFH 4M7KL 1CL7H 1T04A 2HTKD 3PWVB 5CSBA 2IBZX 4IRZH 3RVWC 4YHML 3T3ME 4I0PD 4QRPB 2Q7YA 3SBWC 1IM3B 4ZD3H 4G8FB 1F4WL 2VDOL 1YMHA 1QNZL 4FNLH 2WBJD 4HS6B 2BK8A 2VZTA 1YDPA 2OL3H 2CRZA 4U1IA 5EN2B 1I3GH 3P4OA 4UT9H 4LCWD 5HYQB 1RZKC 5F6HI 2OJZH 3BEWA 3GEWB 2F15A 1LE5B 3V5KB 3OV6A 1EZVX 1WBXA 4FS0A 5E70A 1NFDF 3DI3B 2ZG2A 1XF5A 4MAYD 5HDQH 2HJLA 3LD8C 3QFDA 4UQ2A 3T3PF 3GUTA 1RK1B 1J1PL 1RIVH 3MRIA 3VGAC 3L1OL 3LAFA 4DOHB 5D71L 2IEPA 1HKLH 2VXQL 1F42A 3ULVH 3Q0HA 2X1WL 2PCPA 5TQ2H 5EOCJ 1QPPA 1IAKB 1RIUH 1XIWB 4YDJB 3U36A 1BBJB 2X10A 5DI8A 1AE6L 3SKNA 5J1TC 1B0RA 3OJVC 3QZWG 4M8QB 4P3CH 1V7NH 3S37X 2F54B 3U4BH 4Z7WF 1U91A 2R69L 1FFRA 2FR4A 2X4OA 2XWBB 3GNML 3CFBA 3ARBB 5DHYA 3PWLA 3LKPA 3DSNA 3FT2B 3V6ZB 2Y5TA 3C6LD 4ZFZB 3DBXB 2HRPH 4XZUA 5DJDB 43CAB 1UG9A 3RU8H 1SY6A 2I5YH 3LHPL 3O3DA 5CGYC 3VFGH 4PLJC 5IGXL 4NJAL 3FB6A 1QFWL 2D0HA 5FDYA 2X4PA 5GZOC 1IGFL 1TTGA 5BXFB 4K07A 1OAYL 5KAQG 3C9NA 3DGCR 2HMIC 3VCLA 1P4IL 3HI5H 3S37H 5FK9A 2XA8L 3TYGH 1TQBC 2JB6A 1RZ8A 1YEFL 2X4TB 3WE6B 1H15B 1WZLA 2N1KA 1FSKC 3PNWA 1A1MA 4MAUL 4ODWA 2ZUQB 5B8CB 3EYVB 4X6DA 3BWAB 2WZPD 3WSQL 3KJ6H 3RUGB 4X6CE 5DTFA 3HC4L 3SGEH 2GK0B 4RX4D 1VHPA 3QHZH 2VAAA 4JHBA 4CNIA 1FJ1B 5KVFL 1A02N 2A0LC 3HAEB 4OI7A 4AT6B 2XZAH 5E99H 1KJVB 5I1CH 4KI5C 2OK0H 4OQTH 4LKCA 1YC8A 3SCMD 3HUJE 3QUXA 3IXAB 3CFIC 1A6PA 1UWXK 3U0TB 3JWOH 4HWEH 4PGDA 2YPLD 5H37G 1ZVSA 1ZHLA 1RJLA 4HWBH 2IANA 2RCSH 1TZGL 4HUUA 1WBZA 4OZ4A 3MLYH 5EZIL 4XT1C 3BGMB 1ZHNA 2X89A 4HC1A 2W9DH 3S35X 3RNQA 1NL0L 4TNVK 1G7JA 5DEFA 4XBGA 2XACC 3S4SA 3DRQB 3FQTA 2CIKA 4Z0BH 3O9WC 1BOGA 1V7MH 1M71B 1A8JH 3VMPA 1DQLH 4ZS6D 2EDYA 4PTUB 3PWPD 4K8RC 3CXDH 4UBDD 2DI8A 4XBPB 4XVTH 3U82B 5SWSD 3L3OB 4G6AC 4YFLI 5ADOL 5I1GL 1KEML 3W9EB 2DQHL 1A1OB 4B53A 4G6JL 5I19H 2B7DT 4OUUB 5D1QB 3D1MC 1OT2A 3HG1A 4XH2B 3O2VL 4JRYD 4NBYB 4Z18A 3RBSA 4KK8C 1OHQA 5IFHL 1A1NB 4M7LL 1PYWB 4LRNL 4RAUB 5EU7C 5JHDB 4NFBA 3TEUA 1IM9A 4I0KA 2SEBB 1RVFH 4EXKA 1UACH 4RGND 3HC3L 1L9NA 4LOUC 3WXVH 3HFML 5DJ6A 1FL3B 1JHKH 4X5WB 3BSZL 3QZWB 4PJFB 4PRHB 1VKXA 5T3XH 3O3EB 1G7IA 3G6DL 5EBGA 1FNGA 4XC1H 2R8SH 4PY8J 3F5WA 2PYED 3QB7C 1WSST 1WT5A 4U1HA 1JP5A 3DROB 1F13A 4EKXA 4L8DB 3PL6D 5L2JA 4JY6B 1CS6A 3SDXB 1CDHA 1EV2E 3RZCB 3QFJB 3DYPA 1NCCL 4ALAL 3MLVH 4PRIA 2BMKA 3A67H 5ESVA 4WWKD 3QQ9C 1WCBA 4QWWD 4P5KA 3MV8B 1T7ZA 4QHUA 1M6OA 5SX4H 3VE0B 5EUOA 1JYXA 1FC2D 4KC3B 2GKIA 2HFEA 4DK3A 4HT1H 5KANI 2AK4D 1BFVH 2FO1A 2OM5A 1QD0A 1S9XA 2ZPKH 3DURA 4GRLB 1N64H 4JDTL 1U93A 3PV6A 1WZ1L 1RULH 4U1JA 1ZLWH 1WWAX 3UTTD 3VMOA 3VI3F 3IU3A 4RGOL 5DO2C 1U9KA 2VLKD 1HZHL 4PJ7F 1EUTA 5JDJA 3MXVL 4H0GA 4YEEA 3P4NA 5EWIH 2HN7B 3ZMRA 5I76B 1AO7E 4HWZB 4HF5L 5T33L 1QYGH 3ZSSA 3NFNB 4D9RE 2VH5H 2CK2A 3NOIA 2F8XC 5C08D 2GSGB 2BVYA 4K94H 4EDWH 4V1DE 3KYKL 1CFTB 1IKNA 4IRJC 1I8IB 1YYML 5JLZA 2R29H 4UDUB 4U6VL 4UV4H 4CUCA 1A4KB 3VG0H 4L3AA 4APQB 3RGVB 1HSAB 1U58A 5DMGC 1CLCA 5L6YL 2BSTA 1OCWL 4WV1C 1WFNA 1WFUA 2ICEA 3MJ8B 4W4NA 5KANG 4HPYH 1R5VB 3FQNA 4LEOB 2F5AL 4OFYA 1FNSH 1H3XA 3GIVA 3ULUE 4HKBA 1RQ5A 1BVKB 3STLA 5GS1A 4NO2B 3U30B 1MHHB 4JB9H 3SE8H 1A47A 1NJ9A 5DMIL 4X5XB 5ICYB 4MNQD 4JHAL 3WN5A 2I07B 1T3FA 4N5EC 1QRND 3S3SA 4OLYL 2HG5B 2VUYA 2VO5A 5L88L 3KPNA 4IS6B 4I3SL 5E2UL 4NUJA 2EE3A 3RL2A 3X14A 3QJFA 1NC2A 2X1OA 1KIRB 2YUXA 5D70H 1NUFA 3KWWB 2NXYC 3CVHH 1HHKA 3GDBA 4GKNA 3VWJB 4WUUA 3FJTA 2EDQA 3MOAH 2ED9A 1HYSD 2GJ6D 2X41A 3NA9H 1J0YA 5FYKU 3RVVC 1EFQA 4UB0L 5B3JE 2P5EB 4FQJL 4GRWE 4YDLB 1EEZA 1OAQL 1R5IA 3TBVB 4HX1A 3QO1A 1ZA3B 5EG6C 4XVJL 4M6OH 5GS0D 1JTOA 4WNQB 1XGPA 1OQXA 5F9OL 5TDOB 1QTYT 4DN3H 4KJWD 4LAQL 4U3XA 5ESAB 4EIZC 2VLJA 3GSOB 5EU3B 3NBNA 1F4YH 1BQLL 1MAMH 5GS1C 5IM7B 1G84A 3UTZA 1K3IA 1G6RB 1WAAF 2VLRB 2XZCH 3GMNB 2Q8BL 1FNEA 1AC6A 4CU8A 4YDVB 3WN5C 1I9EA 4DUXA 4M9PA 3HHRB 1PSKL 4QEGA 1NCDH 2QLVB 2ZJSL 2DQJL 3GMPA 1YEEH 4PJGB 1TNNA 5HGHB 5ETUA 4OIBA 4AEHH 3FN3A 3LIZL 3QNZA 5FIEA 5EZLA 1A6AA 4P2OA 3AS0A 4XVSH 4NM4H 4LLQA 3VW3L 1X5IA 4HBCL 1KENH 4X0KA 3DTXB 4NQCA 1YEDB 3O45B 4TUOA 4L4TE 4ZAKD 3V0VA 2CD0A 1DVFD 1GL4B 3GM0A 5GSVA 3VXRE 1G6RL 4P5TB 5IT2H 1SJEA 2V7HA 3VGAB 4HIXH 2W65B 3DYOA 3F7PC 3G5VB 3QBTB 3EAKA 4OTXH 1IVLA 1MIEL 3PUCA 4PLOB 3EHBC 4BSWB 2EIZB 2V5TA 3QI9A 5MEOB 4D0CA 3T0EE 4NO5B 5A3IC 4NFCA 3MROA 3T0DA 6FABL 3FQXA 5E4EC 4PJAF 1MCOL 4WUKL 2E7LA 1MJ8L 3HRZA 5GGQH 2CMRL 5J8OA 4C57C 5EZOL 3FT4A 1AHWA 1RUKH 1T04B 3BDXA 2Q7YB 3S3JA 1YMHB 4EXPX 3OB0K 4N68A 1RZKL 3PP3K 1KJ3L 5IK3A 3ESUF 1YDPB 4WTXA 4JHWH 1AGDA 2H32A 3BT2L 3S36X 4U1IB 3RWFA 3P4OB 2O61A 2WBJA 3BEWB 4WHYG 5DWUH 1T03H 3W2DH 3HB3C 4M7JH 1WBXB 4RA3A 5BRZE 1YPZA 4OCWL 3WFHA 1XF5B 5AWNH 3RVUC 2HJLB 4UQ2B 2Y06H 3GUTB 3O6LL 1BJ1H 4OM0L 5CEZL 5C0AE 1FYHB 3UO1H 2AGJH 4TUKH 3MRIB 3QIBD 3IT8D 1S5HB 4XBEL 4JM4L 3DETD 4HJGA 3JTSA 2PCPB 5IBTL 3U36B 3V7MA 3WNOA 2NY6B 3H7LA 4U0RC 5DI8B 2XTJB 2WW8A 3SKNB 1B0RB 1VACA 5DMKA 2WWKT 1LQSR 2QEJA 1U91B 2FR4B 2X4OB 1LO2L 1FORL 3CFBB 1KJ2H 1TTFA 5DHYB 3PWLB 3LKPB 5IF0B 2Y5TB 3MREA 5CD5C 2R0KH 4XZUB 5FYJH 3W11D 4WFED 1CE1H 3O3DB 1N6UA 4JQXA 4HH9A 3C6LA 2R0LH 4Z95L 5EFIA 3KLDA 1P5UA 4ODVL 2FNBA 5I1IH 1DUZA 4ZTPL 1QSVA 5F97E 2X4PB 1AP2A 1UWEH 2WBJC 1WTGT 3B83A 3C9NB 1IGTA 2CUHA 3VCLB 3OAYK 3SOBH 5J7CC 3MJ9H 4Z7QE 2VDQH 5FK9B 3D3VD 2F19H 4LCIL 2JB6B 1RZ8B 1S5IL 5MENE 1GHFL 3PNWB 3RX8A 1A1MB 1CGUA 1I9JH 4X6DB 3V95A 5D2LA 12E8H 1Q1JL 3GFUA 4XPTH 2J4WH 1EA9C 5DTFB 5CLTA 2V17L 4LSVH 3BW9A 5EOTA 5D8JL 1U8LA 3U0PA 5C2BL 4O00A 5IVXA 4LFHD 3C5ZD 4CNIB 2W9LA 3MQIA 5CILH 2DI9A 5J89A 1F58H 4RX4A 2MSPA 1SY6L 1L7IH 4R3SA 3WO3B 4MJIA 3CFEA 1G9MC 4LKCB 1KCVH 3QUXB 2NY1D 1EHLL 3P30H 4U2ZA 3B9VA 2DTMH 4JJHA 3TFKA 4PGDB 3ZKND 3K74B 4I0CC 4IMKA 2X4RA 1ZVSB 3SCMA 1ZHLB 1RJLB 5EUKA 1S7QA 2IANB 4X6CF 4HUUB 1WBZB 5F9DC 4OZ4B 1JYNA 5KSBE 2YPLA 2JIXD 3CLFH 2HKFL 4YHNA 3FAXA 1ZHNB 5AG8A 1FHGA 3RNQB 5DEFB 3BIKA 1G7JB 1SYSA 4R6UA 3SGDI 4XBGB 4F7PA 3S4SB 3FQTB 2CIKB 3QUMH 4IBLT 4FQLL 1BOGB 1ZT7A 2LAAA 3CUPA 5E94A 4MQXC 1FO0B 4R90H 1OTUD 4AQOA 3RHWK 3HUJF 2ZSVA 3M45A 4QXWA 3DO3A 3NTCH 4ZQKA 1TCRA 2UY6A 4PG2A 2P49B 3MNWA 1Q0YH 1JZ4A 3PWPA 3AMLA 5C0FA 2OXHA 1R0AH 1UM6H 2YZ8A 2NW2A 5SWSA 4E42A 3HG1B 4NN7B 5ITFA 3LSOA 1TTUA 4F15C 4K3DH 1UH3A 5ITBL 1P7QA 1W72H 2VDRL 3T77A 3UTSD 5FV1L 4JRYA 4JFHD 1LK3L 3TFKC 1GOFA 1MJUH 3SCMC 1HSBA 3PP4L 4HC1L 1IM9B 3DARA 4FA8A 1LDPH 1C16A 2XFXA 5C8JA 4G80A 2OZ4H 4WHTA 5IW3A 4HLZH 5JPNA 5DJ6B 5CAYB 3HZYA 1FO0L 1UWGH 3SDDD 1YNKL 4MA3A 1VKXB 1EPFA 2B2XH 4UNVA 4YDIL 1G7IB 4S1RL 4PJCA 1FNGB 4O4YH 4JRWA 5F9JB 3PWNA 3H9HA 4U1HB 5INDA 5L2JB 1JNLH 1OVZA 1QQDA 2A6IB 1HINL 2PYEA 3UJTL 2ICCA 4PRIB 5GGTH 2BMKB 4KQ4L 5ESVB 1WCBB 2DQTL 2DDQH 4P5KB 3TGXA 5I8EA 4OZGB 4QHUB 1M6OB 4IOIA 4W6YB 2BOCA 5EUOB 4XCCL 3PGFH 2PF6A 2HFEB 1MCWW 4ETQA 3V4UH 1S9XB 3DURB 2EH8L 4RMVA 1HK6A 3C87A 5FUZH 1U93B 3PV6B 4NQEE 1ZGLM 4U1JB 2NY7L 4F7TA 2AK4A 1IC4H 1WISA 1GXEA 3IU3B 4OZHF 4PRBA 4I77L 5J12C 3SHSA 1KELH 1BIIA 1UM4H 4YZFF 4KKLD 5DRXA 3IAPA 3V4PL 4M03A 2H1PL 1MUJA 1E4XL 3OBAA 4JR9H 5IQ9A 1DDHA 1X7QA 2DM2A 4RGNC 2NXYB 3PDOB 2VLKA 3TVMD 3ZTJG 2BY1A 4TTDD 5FKAA 3AAZA 2VXTH 1NQBA 4R4FH 5F96H 2R4SH 4HGKC 15C8L 1FNLA 3LKSA 5JLZB 1OAKH 5EOQL 5C08A 3QCUH 1G1CA 3DOSA 2YPVH 2YXMA 4M1GH 4L8CA 1U58B 1IC1A 4OLVL 2BSTB 4PJ8C 2AQ2A 4O9HH 2FD6L 1NFDA 1ZTXL 1PGRB 3FQNB 5CEXA 3LQAH 1ONQA 1MVFA 3ET9F 4QWWC 1CK0H 3GIVB 2CO7B 4HKBB 1YEKH 4LIQH 3STLB 5GS1B 1CICD 5FO7A 1LMKA 2DQEL 4C55A 2NY3C 1NJ9B 3T65A 3RJQB 4N1CA 3WN5B 3KDMA 1T3FB 2ARJA 5CSZA 2L4OA 4KUCD 4OGYL 4AEFA 1PG7H 3L5HA 3GI8L 4PP2A 3WKMH 3KPNB 5C0BD 4NUJB 2I26N 3NZHH 4MNQA 4KZDH 5MP6H 1ZE3C 3RL2B 3X14B 2R15A 3QJFB 1J8HD 1QRNA 4LPTA 2VZOA 3QUKA 5JIPA 1ADQH 1Q9WA 3WIIL 3QYCA 4ONHA 8CGTA 5JO5A 1M4KA 3LKQA 1RIHL 1HHKB 5ACLA 2X9XA 4GKNB 1KFAH 1W0WA 4XCFL 5DZLA 3DX8A 5CUSL 3ULUF 1QSFD 4BYHA 1A14L 3KPPA 1UKTA 1EEZB 2IQAA 1VGEH 1I9IH 4HX1B 3QO1B 4KJPD 5DQJA 2MHAB 5IVZA 1TITA 4LSPH 3DUHA 1XGPB 1I3UA 2X44D 1C5DA 1QLEL 3ARTA 3DIFA 3QAZC 3OAZK 3MJGX 2VLJB 4J7RA 5KJRL 4DQOL 2I9LA 3E0GA 3JVGC 4YXLH 1JUFA 4Y7MA 1RUQH 5DMJB 5FYKE 2Y6SD 1DTUA 5I30H 2ZUWA 3K8LA 1FNEB 4LARL 5TE6L 5CJXA 3QXVA 1QFHA 5EC1A 2VQ1A 1CGSL 5ESQA 4DAGH 1EMTL 3ARWA 3EOAA 1CXKA 3O3BA 3AFLA 2Z8VC 3BPOC 1MFAH 3GMPB 2VLLA 3C09C 1LDSA 5ETUB 4JREC 1FLTX 4ZTOH 1JGUH 2B4CH 4Z7UF 3CNKA 5ENWA 1UXSA 1QZ1A 3QNZB 2XI9A 1A6AB 1UZ8A 3NIFF 1KTRL 4MLSA 4P2OB 1QFPA 1RJYA 4LLQB 2EKSA 1DBBL 1YEGH 4F37K 1DQTA 3D0LA 4X0KB 4NQCB 5JW5A 1HYSC 3ILPA 4TUOB 5T5FH 4JY5H 3VDCA 3V0VB 1D7FA 2VDNH 4DZBA 3TV3L 3BKJL 5GSVB 1J0KA 2GUOA 4HUKB 4ZAKA 4OD3L 3MFFA 3JUZA 3NFSL 1SJEB 2V7HB 3KNBA 4JQIH 3EOTH 4GG6A 1CG9A 5I8OH 4ZOCA 4KJWC 2DLFL 3RY6C 3EO9H 4QXGH 5E6ID 5CIPA 1YJDH 1A6ZA 5DJ8A 3QI9B 4D0CB 2CR6A 3MROB 4U0RB 2QSCH 4YR6A 3FQXB 2W59A 5C09A 3RZCC 2VQUA 3HRZB 5EOCH 4AY0A 1H3PH 4U6HA 1NEUA 3FT4B 1AHWB 5DHVA 3WS3A 4AEEA 1XFPA 2HTLC 3BE1L 3E8UH 2CGRL 5FCUL 3KPSD 1KN2H 1R3HA 4POUB 3G5ZA 3MLPA 3EOYG 5I8KL 2R1XA 4UV7H 5IK3B 5T3XD 4J6RL 5CJQL 1AGDB 2H32B 2MQCA 5JXAL 3RWFB 5CEYA 2FH8A 4FFYL 1QFUH 1T20A 3U6RA 4C56D 2WBJB 2O61B 1INEL 1DE4A 4JKWA 3RAJL 1HH6A 3B2UD 3FAWA 1EGJA 1MNUL 1DEEA 1YPZB 3WFHB 4CMHB 2HT2C 3CGTA 5JOPD 1OPGL 4ZAKC 5JTWA 5GS2H 3SKMA 2BP3A 1QBLH 1FRGH 2FGZA 1KBGL 1NDMB 2KL6A 4BJLA 5FA4A 4M7ZB 5HI3D 4LBEB 2AJUL 4HJGB 3JTSB 3U79A 2HKHH 3QIBA 3MBXH 4JGJA 1FG9C 2OLDA 3RZWA 5IESL 1U0QA 4QRPE 1LEGA 2E27L 3P40A 2BY3A 1VACB 5DMKB 1XGTA 1JL8A 1E28A 4JFFD 4GW5A 4HUWA 2WQRA 1V5JA 3T2PA 1PDKA 2X05A 4NZUH 5KVGL 3MREB 2DYPD 3WNMA 1QUNA 1MCLA 5F7FA 2EO1A 4JKMA 2JB5L 1HIML 1INDH 4ODHH 4HG4K 1UFUA 3U7WL 5E08L 1RU9L 4HH9B 1MRCH 3C6LB 5EFIB 1JHTA 5FGBC 2VTFA 4LVNB 2GI7A 5DHXB 1AP2B 4J3WA 2QL1A 3C8DA 3HMXH 4AMKH 4DOHE 2O5YL 3MODH 5ID1A 4BK5A 2NMSA 1TZHA 2Q7NA 4PJ7A 3CU1A 3ILQC 4PTTA 2GCYA 4KTDL 2VC2H 3IETA 1LD9B 3BZDA 1A7OH 2NTSP 4ZUWA 4OAWB 3D3VA 2Q8AL 5D2LB 5KN5A 2F54E 2RGSA 4Y2DC 4M1DL 5ADPL 5EU5A 4W6WB 1KXTB 1KCSH 3BW9B 5EOTB 3O6KL 1U8LB 2CKBB 3U0PB 4OCYL 4XP9H 4H1LB 5IVXB 3MCKA 4LCYA 4NUGL 1U8OA 5I2IA 1G9ML 1N0LA 1CLOL 1FIEA 5T1DL 3C5ZA 3CC5A 4I9WD 4TSAH 4MJIB 4F15B 5L8JB 4PP1D 4Z7QF 3SQOL 3CFEB 3PXJA 3TO4D 4OGAD 2LTQB 4KHXL 3BP7A 4ZUSA 2R0ZH 4YUEH 2VDMH 1MAKA 3B43A 4XP6L 2X4RB 4LQFH 3W11C 3SCMB 5EUKB 1S7QB 2E6JA 2E9WA 4UTBL 1B6UA 4YK4B 4JAMA 3TH2T 2YPLB 4HLJA 2O5XH 4YHNB 4HUMB 3RUGE 1UXWA 3V4VH 3EUUA 3V2AR 3WL9A 4PB0H 4P48A 3BIKB 1SYSB 3MLWL 3UYOD 4K3JH 3FZUD 4OFVA 4F7PB 1FH5H 2ZUXA 2JIXA 1GPOL 2V2WA 2Q6WA 2OR9L 3KJ4B 5EBMA 5HHMD 1ZT7B 2CKBL 1ACZA 3CUPB 5E94B 1K6QL 4HBQA 2ZSVB 5AEAA 5DUBA 2KBGA 4W81A 4ZQKB 1TCRB 2BVPA 2ENYA 3MNWB 5MEPA 2M2DA 4H25A 5EDXA 3IDJA 1OLLA 3F6LA 3PWPB 3GHBH 5FKPA 5C0FB 4PJHF 4WI2A 4HG4J 1ZWIA 3QISA 3VFVA 5JQHC 5SWSB 1ZXQA 2IH3A 4TQEL 4E42B 5ITFB 3LSOB 4KXZH 2CK0H 4FN0A 1VADA 5GSRA 1UT9A 3T77B 3T2NH 4GLRI 1F6AA 3A6OA 1QLRA 4JRYB 1VB9A 5D96C 3WJJA 1B4RA 4X9IA 1IEBA 3QQNA 3QIUD 1KB9K 4KRMB 2Y07L 1HSBB 3BKML 1NMCC 3VG9B 1N6VA 5J12B 1C16B 2XFXB 4G80B 3BWUC 3MUHL 4WHTB 4G8GE 5JPNB 3HZYB 2FATL 4MA3B 4QY8A 4RGNB 4P0DA 4E0RA 3EYUL 3UTPE 4PJCB 5H8DA 1XGUA 3PWNB 1MREH 3H9HB 1NCWH 3SDDA 2JCCF 1EK3A 1LO5A 3P0YH 5INDB 4Y4FA 1A7PH 2QV2A 2XA3A 4KK9C 1QQDB 4ONGL 4JG1L 1I7UA 1MRFH 3TF7A 2PYEB 1MJ7L 3X3GH 3QDAA 4KK6C 2W38A 1RUPL 1JPSL 7FABL 2VLME 3PL6B 3MBEA 3J8F7 4PGBA 3GMLA 4GMSH 4UNUA 5GRVL 2IGFL 2IWGA 5DVOA 1BFTA 5JHDE 4JFDD 5I8EB 4ISVA 3QWOA 4TOYH 2WANA 4IOIB 3G6JF 2J5LC 2BOCB 1J1OL 4AZ8A 2KKQA 2DTSA 3M07A 2V6HA 3BPCA 3WJJC 3MYZA 1QBAA 1G0YR 3FN0L 4ETQB 4UILL 4PRDA 5AZ2H 4X80H 3BYYA 1TPXC 4PJFE 4PRHE 3VD3A 4F7TB 2AK4B 3NH7H 1F11A 3R1GH 1B4JL 4PRBB 1BIIB 2X2YA 5ALCH 5DRXB 3W0WD 4LSQH 1MUJB 3UTTB 2LU7A 5IQ9B 1DDHB 2Y5EA 1FL5A 2F5BL 3SDXE 3THML 1LO4L 2VLKB 3QFJE 5FO8A 3QUYC 4XAKD 5FKAB 3H0TB 3AAZB 3KPRD 2MKWA 3PE9A 3SDDC 5L7XH 4P4RA 3TVMA 4LP4A 3LKSB 3MV8E 5HD8C 4Y4FC 5BO1H 4BSJA 5ID0A 4F57L 1GGIL 2BFVH 4QRTA 4AJ0A 4HJ0D 3TF7C 5C08B 3C5JA 5D93C 4L8CB 3MBEC 1C12A 1I1AD 2C1PA 4NT6A 4WENB 1KB9J 1NFDB 1JNNL 3BESR 2VERN 4JZNB 3FB7A 5CEXB 1ONQB 4LVEA 3ZZ1A 3GMQA 2BX5A 2XPGA 3BPLC 2VITA 4D3CL 4LLUA 1IZKA 1CXHA 1M7XA 3ZDYF 5FYJD 4L29A 5FO7B 1RZJL 2P1YA 3T65B 1A21A 3R4DA 3PABA 4H5SA 3KDMB 2ARJB 1ZANL 1MFCH 1CICA 1CVSC 5C7XH 1TJIL 4PP2B 1BBDL 2DQUL 2VUOA 4MNQB 1N59A 2A77H 3NPSC 1WQVT 3BPOB 3T04D 3WEXA 5C0RL 1QRNB 3QUKB 3C09B 1FNAA 3UJJL 4JREB 4M3KB 1Q9WB 3BPNB 3UC0H 4ONHB 4JQVA 5DUPH 4KKLC 5JO5B 3LKQB 1UJ3A 5HYEA 3HR6A 1J8HA 3O4OC 3RWCA 1W0WB 1DBAL 4OZFH 5F9WB 1UM5H 3DX8B 3VDAA 3NIDE 1QBMH 4JRXD 3RQ3A 5D7IF 3E3QA 3KPPB 2IQAB 1RD6A 5DQJB 3I3BA 4TSCL 1EAPA 5IVZB 1QSFA 1KB5H 4JKPL 3RVTD 5JNYA 5IW1A 3BH8A 3DIFB 4I2XA 2FJHA 2NR6C 2F58L 3HZKA 1IQWH 2I9LB 3IKKA 5LGKA 1UC6A 1DN2A 3JWDC 4NHUA 4Q97A 1DCLA 1X4XA 4XMLH 4L4JA 3D87B 2AJ3A 4FZEH 3H42L 5TFSH 1FGVL 3MLZL 4XP1H 5EC1B 2VQ1B 1CICC 5ESQB 4K9EH 2BNQD 2PTUA 3EOAB 3J7HA 3VI4E 3X3FH 4P2RD 3WS6A 5DGRA 4CL7A 2VLLB 5E2WH 5JR1H 4OLXH 5I74C 4JQVC 3SY0A 5ENWB 2P5EE 1UXSB 4HWBA 1JGEA 1UJ3C 1DJSA 3I85A 5E5UB 1U8QA 5TE4H 3F7QA 3SGKA 2WUBH 1UZ8B 3QUZD 4DVRH 3A6CL 5IMOA 5JHLL 1RJYB 2EKSB 5D1ZD 3D0LB 4JPWL 3E3QC 4QKXB 5JW5B 3MLXH 3ILPB 4QRQA 3OB8A 1A6VH 3EFDH 5GS0L 5JIIA 3QA3A 3EJYC 3Q1SH 4UOW1 3V79C 2VLRE 5D5MA 4DZBB 2FX7L 2GUOB 2PXYD 4ZAKB 4QRUA 3MFFB 4HJJL 2AI0L 3KNBB 4L3CA 3INUL 4GG6B 1CG9B 4ESKA 5IQ7L 3LEVH 5CIPB 1A6ZB 4KHTH 5DJ8B 5LBSH 4PJGE 5BOZG 3MACH 4YR6B 5C09B 3UYRL 5E6IA 1TJHL 3MRQA 4V2BA 1GVIA 4L3EA 1CBVH 3ZSTA 3WJLA 4U6HB 4CVXA 5DHVB 5TPWL 2Q3ZA 3TH4T 3WS3B 5K9JH 1PLGH 1QG3A 5MEQA 1AGBA 3TM6A 1UADC 1R3HB 4Z7NF 3FO2A 1GZPA 4AIXA 1IGMH 3G5ZB 4FHBD 3SGKC 1H5BA 2R1XB 4OM1L 2CJUH 2HJKB 5E8PA 1AC0A 5CEYB 3WLWD 1T20B 2P47B 3U6RB 2KQMA 1DE4B 1HH6B 1ZOXA 5E24E 4LSTL 1F90H 4NKOA 1DEEB 4XGZA 1CFVL 1H3UA 2UY7A 1A0QH 5A16A 4XHJC 5JW4N 5C9JA 1A3LH 2MWCA 3IVKA 3U9PL 3SKMB 3GO1H 3V7AG 1QA9A 4P46C 1UYWH 1Q94A 3O8XC 5FM4A 2IBZY 3DX6A 5DZOA 3QIBB 5E2TH 2NZ9C 4DUVA 4OV5A 1LEGB 1FQ9C 5E6IC 5JUEH 3ZHDA 4FQXA 2BRQA 3QRGL 4XCYA 1XGTB 1E28B 3KPLA 4GW5B 2MKLC 4H20H 4HUWB 5F6HJ 4LLWA 3I50H 1JZ6A 1YYLL 3K2UL 1CGXA 2XQBL 3DSFL 2IH1A 5BW7A 1EZVY 1HOCA 1NBVL 1AGFA 3HNTH 4TVPH 4HUVA 2DYPA 1JHTB 4FQCH 1EGJL 3HRPA 3OWEA 4GRWH 1L4IA 2FX8H 1NEZA 1BF2A 1U6AH 1DP0A 3VA2C 1AXSB 5KSAD 4OZHA 1MRDL 4B50A 5ID1B 2AJYH 5EIVA 4HD9A 4U1MA 2WBKA 1TZHB 4PJ7B 1DLFL 2AEPL 1OAZL 4PTTB 2XTJE 3IETB 2BERA 1D5ZA 2OXGA 3IDXH 4ZUWB 1P4BL 3D3VB 5DXWA 5KN5B 2OBGA 3EDDA 5DGQA 5DC0A 5EU5B 1GRWA 1D5BA 3K1KC 3PWUA 2FIKB 4A2LA 2ADJA 1U3HD 4FQXC 4E5XA 3MCKB 4LCYB 1FIGL 2OX5A 4AL8L 1RPQA 1U8OB 1ZLSL 3WXWL 5I2IB 4Z9KB 2X42A 3C5ZB 3CC5B 4OCMC 3GM8A 1TJGL 2GT9A 3I6LE 4NZRL 2P46B 5BW7C 1NMBH 2XICA 3BP7B 4ZUSB 5D96B 3LMJH 3NCYS 4KKAD 4UINH 2B8OT 3MCG1 1WC7A 5DJAA 3TO4A 3KLSA 5DJXA 2CDFA 5D1XC 1U3JA 2NY1B 1K4DA 3OAYH 1UB5A 4AEIL 3LRHA 4JAMB 1CFSA 3CVHA 1J1XH 1F2QA 4X6DE 2IMNA 1CD8A 3RA7H 4HPOH 3RIFF 3B9KC 1UXWB 2W1NA 1KPVA 1D6VH 3BP4A 5E7BA 2JIXB 2Q6WB 2V2WB 4EVNA 5IB3A 5EBMB 4PD4K 4OFDA 3H9SD 1IT9H 2E9JA 5DUBB 1Q38A 2AP2A 4KRLB 4NZTL 1CDCA 4YC2C 2BVPB 5IHZA 5HHMA 3L3KA 5MEPB 4H25B 1QHPA 4YWGL 3IDJB 1Y6MR 2EDEA 3GHEH 5FKPB 2EDJA 5IROA 1ZWIB 3VFVB 1G7PA 5DRZA 5BMFL 2ZUSA 2IH3B 1NLDH 3KXFD 5EU7E 3QG6A 5JOFA 4F7MA 2IANE 1VADB 2F74B 5GSRB 2WSKA 1QLRB 4RISH 2ZCHH 1IEBB 3ABZA 1E4WH 1Z0MA 3TO4C 3UTSB 2A9ML 4OGAC 4AIZA 5FGRA 1NFIA 3WNKA 1PEWA 3WUZA 3I3EA 1I1CA 1DN0A 3QIUA 1GOHA 2VDPL 1RUAL 2DQCL 1KOAA 2GJZB 4LSUH 3HE6D 4QY8B 1F4HA 1UQSA 1EVUA 5B4MC 4UT7L 5KVEH 5JXED 1LQVA 4Z7UA 2DQIH 4PFEA 4K2UL 1CDUA 1A6UH 1XGUB 3K2MC 3VGGA 1MPAH 3HMWL 3SDDB 1SEQL 3V52H 1LO5B 3HG1E 3ARQA 4Y4FB 3ULUC 4WFGE 3OKDB 1AXTL 1I7UB 4GRMA 5IROC 5D93B 4G59A 3MBEB 5HI5D 4PGBB 5JZ7C 4XWGH 4S1SH 4ISVB 3QWOB 1N0XL 2YK1H 4U1KA 2H2PD 4AENB 1Y0LA 1LNUA 2O5ZH 4X99A 4PRDB 1O7SA 5L2KD 4MNHA 1Z9SA 1SBSL 3LZFH 2EIEA 1HNFA 4KRPC 1F11B 2B1HL 4NCC1 2B39A 3L7FB 1NSNL 2AQ3A 4J3XA 4XPHH 4H26A 4RGMB 4LNVA 1A7NH 3NPSB 1CLZL 1WWBX 4GKSA 4G5ZL 2DQGL 3F7YA 4P4KC 5GRUL 2XZQH 4OBSA 1DSFH 5FO8B 4JPIA 1CCZA 3LH2H 4PRIE 4F80A 2NYYD 2CKNA 5GS2D 4LGRB 1A2YA 3TVMB 2JK5A 2J12B 3T08A 4WY7L 5ID0B 5SX4I 4QRTB 3KPRA 5CJOH 4G6FD 5EUOE 2KQNA 1RUMH 5ISZD 3C5JB 2JJTC 2JELH 1C12B 1C1EH 2DMKA 2C1PB 1FGNL 5DFVD 5CBEA 4NT6B 2YC1A 1MCFA 3FB7B 3OF6A 3NN8A 4JG0H 1FBIL 4GOSA 1CGTA 3HS0A 3GMQB 2XPGB 2ADFL 1JI2A 2VITB 5BS0D 2NY2D 4LLUB 4KVCH 1NCNA 1HKFA 4ZD3L 2ZKHL 3ARDD 4L29B 3PABB 4FNLL 1KJ2A 4H5SB 4PV9A 2PW2B 4K7FA 4J3SA 1CICB 2OL3L 4WTWA 2K9UA 3SE3A 1I3GL 1N59B 3S97C 3WEXB 1FDLH 2OJZL 5JIHA 3DHJA 2M8XA 3T0BA 1GC1H 2FX9L 3BRGC 4Q9RH 4F9LA 4NN5C 4POYA 1UJ3B 4P59L 1T0PB 5GXBB 1MFEH 5HDQL 4Y2OA 4ODSH 3VGFA 1J8HB 3RWCB 4D9LH 1RIVL 2VSCA 3SPVA 2CSPA 5HSFA 3MJ9A 5SV4A 2H2SD 2AS5M 1N7ML 1HKLL 2VABA 5C0CD 3FB8A 3LB6C 4EN3C 5TQ2L 4FFZH 1RIUL 1J87A 1EAPB 1QSFB 3T0EC 5IUSA 1S7WA 5JNYB 5IW1B 1HWHB 5GRXG 1EFXD 1T1ZA 3BH8B 4I2XB 2FJHB 4P3CL 3U2SA 1V7NL 1WFTA 3HZKB 5I1JH 1RURH 2J6EH 1C5CH 4J12A 1V8HA 4IRSD 1NEZG 5E7FA 4PJ9D 4ZUVA 1SJVA 2VE6A 2HRPL 4MS8D 1VPOH 3RU8L 4PJEB 5EIIB 2AJ3B 4XMKH 4W4OA 2I5YL 1G7QA 4OKVA 5DA4A 4ENED 3DVIA 1T1XB 3SE3C 4WUUE 4PLNC 2E7BA 4AQ1B 1WFOA 4IEFB 5CMAA 3CSYA 1MHEA 2YD8A 2BNQA 1DR9A 3SY0B 3TA3C 4P9MH 3MO1A 4LGPB 3HI5L 3S37L 1JGEB 2Z93A 1U8QB 4NBZB 1RHFA 3TYGL 1U41A 4A6YH 5IMOB 3MUY1 4ELKA 3V0AC 5D7SH 1P1ZA 3TJEH 3ZYZA 3CSBA 3KJ6L 2VLJE 4FP8L 2OTUA 1F5WA 2MCPH 4OD2A 3JTCA 3QUMA 4QRQB 3QA3B 5KG9A 5D1ZA 1KGCD 1G0DA 3QHZL 5I0ZA 3EJJX 1NLBL 3R06A 4X7EC 5D5MB 3QXWA 4RZCA 1QKZH 1KCLA 2A73A 1T6WA 4QRUB 3VI4F 2MQ3A 3BDBA 4L3CB 3FRUA 2R2CA 4XI5D 2XZAL 5E99L 2Q3AA 5IOPA 1CDIA 3KG5A 1BZ9A 1UH4A 2QSTA 4OQTL 2OK0L 4H8WC 4N8PA 3K81A 4PRPA 5E00A 2FZ3A 4KROD 4W4OC 3PWJA 3JWOL 5E6IB 4HWEL 3MRQB 4L3EB 2HP4A 3O6FD 4HWBL 1HH9A 1TQCC 2RCSL 3L5XH 3DXAD 4PJHA 4X7SL 4CVXB 2IF7A 5MEQB 3W5MA 3U1SH 1XF1A 2YBRA 3T4YA 4YDKH 3FO2B 4OB5H 4NQCE 1GZPB 3MCLH 1IAIM 3JV6A 4ETYA 1H5BB 2DBLH 1WGOA 1IAIH 5I18H 3TP4A 1IGCL 4Z0BL 1Z9LA 5D72H 1FZOA 4W68A 5E8PB 3TIEA 1DQLL 4MLIA 2H8PA 1G9NH 1DBMH 5LWYH 1G1YA 1OSZA 3Q3GA 4KTEL 4YFDB 4J2XA 2JJSA 4NKOB 5F1NA 4QRRD 4XGZB 3MLRH 4WEBL 1MLBA 5A16B 5C9JB 4GG8A 2EDRA 1BVZA 5I19L 3IVKB 3EBAA 3EO1A 5BVJA 1AQDA 1QA9B 1VERA 3QCVH 2ED8A 2E7LE 1Q94B 5GGTA 4KVNH 2C3VA 4YO0A 1CR9L 3DX6B 3M8OH 2JCCA 1MQKL 4CVZA 4YFEA 1II4E 3CZFA 3U4EA 5HY9A 3RWJA 1RI8A 4XCYB 3STZA 5DUMH 2H26A 3KPLB 2ITCA 4LASH 3OXSA 1FLRH 4DKAA 1JGVH 3ZE2E 5C0EA 1IZJA 3WXVL 1XGRA 2IH1B 1JHKL 1HOCB 3U4AA 1ZGLA 1EO8H 3G6JA 4JEGB 3MLUH 1AGFB 4JCMA 4NM8H 1YNLH 4RQQA 5A2KH 3S34H 4HUVB 1YPZE 4XC3H 2DYPB 1HILA 5T3XL 3O3AA 4I18A 1WK0A 1NEZB 4NZJA 3IDYB 1U8PA 2R8SL 4RFOL 5IEHA 4JO4H 2WUCH 4K7PH 2ED7A 3H3PH 1YN6A 2JJSC 2IAMC 4OZHB 3ZE0F 3P9LA 1P7KA 3WFDH 3WLWC 4U1MB 1UA6H 1G0XA 5GGVH 3A67L 5KSAA 3MOBL 1WLHA 2ICWA 4YXHH 1D5ZB 2P48B 4ZO8A 4N90E 4Q2ZA 1MVUA 3B3IA 1K8DA 4B0MM 5D7LD 1D5BB 2GAZA 3PWUB 1L0QA 4HT1L 1NFKA 2ADJB 2ZPKL 4E5XB 1N64L 1RULL 2ZZUT 1Q9LA 3OKOB 5CLWA 1F00I 2UVEA 3OKKA 2GT9B 5ANMA 2X4SA 3P2TA 3OJMB 4GW4A 1A7RH 4K3HA 3IS0X 3LCYA 1KN4L 5EWIL 1IC7H 2DJSA 3PHOA 5EH1A 3IXTA 3U48A 4XMPH 1QYGL 3TCXA 5CHNB 1AI1L 1WC7B 5DJAB 2NXZD 4I18C 3TO4B 3WLBA 2CDFB 4ELMF 1K4DB 1FE8H 2B5IB 1UB5B 4R4BA 5KBNC 1ADQA 1XZ0A 3AY4C 4EDWL 1CFSB 3CVHB 3RDTC 4WDIA 3ALXA 4QHLA 4Y19D 4MD4A 4OCXH 5D2LE 5A1AA 3KYOA 4DFIA 2KZWA 4CVUA 4UV4L 1KPVB 4QRSA 3BP4B 4NKMA 5MERA 4M1CD 4PGZA 5IVXE 4EVNB 5IB3B 3NGBC 3VXQA 1XEDA 5GGRA 2EXYD 1WCQA 1H0DA 5HPMA 3BKYH 4GXUM 1P5VA 1FNSL 5HGBA 5HHMB 2YN3A 5IHZB 4MJIE 2DLIA 3FFCD 3L3KB 3H9SA 1J8KA 5I73C 3IU4L 1X5XA 4M02A 5D7IA 3KLHC 5I1AA 4JB9L 3SE8L 4JE4B 1G7PB 5DRZB 3QSKB 3MJ6A 1F3DJ 3WIHA 1EBAA 2QBWA 2VDOH 3QP3A 3TT1H 4X6DF 3QG6B 3F12A 1KEGL 5JOFB 4F7MB 5DJYA 4J1UA 4X98A 5IFAH 4YEFA 3KXFA 1FAIH 4Z76A 2YPLE 2BZDA 4ZOEA 3CVHL 1KLFA 4JDVA 4X9HA 3MOAL 4AIZB 4XAWH 2CDGA 1NFIB 4NBXB 1DN0B 3QIUB 4ZXBD 3JV4A 4X5LA 4JPKL 4MYWB 1I4FB 2BVTA 1UQSB 2ZOKA 4PPTA 4U2YA 1SYVA 2AJZA 3PWPE 4Z7UB 3ECBA 3LY6A 1A6TB 4IOFD 4J4PD 4DN3L 4OSUH 2AEQH 1IRAY 4OZIF 5SWSE 2QSVA 3MV7D 1C5BH 2KDGA 4LDLB 5HYFA 5JXEA 1F4YL 5C0NC 2R69H 1Q0XL 1YUHA 1NMAH 3A0OA 4GRMB 1DFBH 2VKXA 4JRYE 1CDJA 2YHGA 4MA8H 5BV7H 3B9AA 3W5NA 4L9LA 1NCDL 2IC2A 4OCRH 4U1KB 4WGVB 1Y0LB 1LNUB 4IIQC 4X99B 2AW2A 3CPLB 1BP3B 2BHYA 3MRDA 2RR3A 5E8EB 3KPOA 1P53A 1OAYH 1Z9OA 4MNHB 4BH8A 2YR3A 4V1DD 4RGNE 1OQOA 3LPFA 4XVSL 4NM4L 2X5PA 4H26B 4EJ1C 1YEFH 3HI1A 4PJCE 2UYLA 1D9KC 5L2KA 5SX5K 5L9DH 3G08A 1HCFX 4MAUH 4GKSB 1ED3A 1ODAA 2IFFH 3RJDA 3MA7A 3F7YB 3WSQH 5KW9H 4F9PA 4NN5B 1JZ3A 2YWZA 2PYEE 3D0VA 5T1MA 5HVHC 4JPIB 4U4BA 4L8SC 1GH7A 1NGPL 1A2YB 2H45A 4R8WH 2EZ0D 4LMQI 4OTXL 3KPRB 1HNGA 4LHJB 3RNKA 1IARB 5M7QA 5CBEB 4OCSH 4CMMA 5GGQL 2YC1B 3LEYH 5ISZA 1C7SA 3TJHD 3NN8B 1OP3H 2FL5A 3HS0B 2AK4E 5HI5C 3RL1B 1RUKL 4OLWH 2H41A 2ARWA 3UTTE 5GJTL 5BS0A 1KJ2B 4PV9B 1YEHH 4EZMA 4K7FB 4TVPD 2VLKE 2BVQB 4JHWL 4OZGF 3D2UD 3ARDA 3UBXA 1AD9A 4LU5H 3SGJA 5EUOF 1PKQA 1I75A 3BXNA 1W8OA 1JCKA 3GZKA 1J0HA 4U3CA 3W2DL 1T03L 4M7JL 4DTGH 4KMLB 3TIDA 5AWNL 3RIAK 5C08E 2Y06L 3HAEH 5EO9A 3QNXA 3HMXA 5I1GH 3UO1L 4TUKL 3TPUA 3D5OF 4CW1A 2F8OA 4G6JH 3VH8A 1NFDE 2P8LA 5CINH 4CU6A 2VABB 3FB8B 1KIPA 4P49A 2DQFA 3IJHA 1R3LA 1KACB 1S7WB 2ZSWA 5CGMA 1S8DA 3S36L 5GGRY 1T1ZB 5GRVK 5C0CA 5IFHH 1IKFH 3U2SB 3GGWA 4LRNH 1SHMA 1ND0A 2IPTH 5FUOH 3ZKXB 3T0AA 4UOW0 4N0CD 5DFVC 4R0LA 1EFXA 1KJ2L 4ZUVB 1LHZA 2VE6B 4MNQE 1U2CA 5FYJL 1QRNE 4XCNA 1CE1L 2MPAH 3HFMH 1G7QB 3TZVC 1T0MA 4OKVB 4UAOB 5IJVB 3ARDC 5JW4R 4MS8A 5I1IL 1KLGA 1BZQK 4PJBA 1UWEL 4Q6YA 1CIDA 1S78D 5C6TH 1L9MA 5CMAB 3CSYB 2BNQB 3MO1B 4J3UA 3CK0H 3CSPA 3MJ9L 5D6CA 2Z93B 3SDYH 2VDQL 3RKDD 2E9IA 3VXRD 2F19L 2Y9RT 5EA0L 3FMGL 4LCCC 3WFEL 3LEXA 3S7GA 3C2SA 3CD4A 4DEPC 4ELKB 4ZFGL 1ERNA 1CE6A 4XVUD 1P1ZB 3SO3C 2F54A 2RJMA 4ZNCD 1PY9A 2OTUB 5E6ZA 4OD2B 1BREA 4LSVL 1U8IA 4DVBA 3QUMB 2A6DB 5KG9B 5D1ZB 3BH9A 2APFA 3FT2A 2EC9T 1JF6A 4ZFZA 3R06B 3QXDA 4RZCB 3UCRA 1F58L 1NANI 4TPRH 4H8WL 3U83A 2APBA 4R0LC 3FRUB 3OHXA 1L7IL 5MI0C 2PXYB 5IOPB 1T2JA 4MXVE 1BZ9B 1CFBA 4RGOH 1S9VA 3F6IA 1KCVL 5E00B 2FZ3B 4N8VG 3PWJB 3P30L 1HZHH 4X4XB 1T1YA 2DTML 3MXVH 1JYWA 3QWQB 3BMWA 4MS8C 4X7TA 3ARXA 1WIOA 4P9HC 5T33H 1T7YA 4M00A 1HH9B 4PJHB 5KZCD 2Z4QA 3F65A 4M48H 4KQ3L 1JRHI 5B8CA 2YBRB 1Q9KA 3T4YB 3KYKH 1VFUA 3K4DA 3DXAA 1YYMH 3F7RA 1XIWC 5FF6A 4U6VH 3QUML 1SVCP 1FZOB 1L7TL 3TIEB 2H8PB 4PJDB 1P4LA 4HW6A 4R90L 1OSZB 3Q3GB 3NTCL 4GG6E 2NY5C 3ARBC 4AYFA 4GXVH 1Q0YL 5F72S 3GK8H 2CLVA 2UZXB 4YH6A 1MLBB 4GO6B 4FRWA 4GG8B 1R0AL 1UM6L 3P0GB 1CU4H 2AABH 5IB5B 3EO1B 5D2NA 5BVJB 1AQDB 5C09E 4QRRA 1OWRM 4KZEL 2C3VB 4YO0B 3MNVA 2WP3O 2JCCB 5EU4A 1GSMA 1ZS8A 1QSED 4CVZB 4I3SH 3CZFB 3U4EB 5HY9B 4DGVH 4WU5A 3RWJB 6CGTA 3STZB 1MJUL 2H26B 3MGAA 1IC5H 2ITCB 4YHYB 1LDPL 3IS1X 3OXSB 2FBOJ 4Y4KD 2ZUQC 5B8CC 4MB3A 4E41D 5C0EB 1XGRB 3MRGA 4JDZB 4HIHA 1ZGLB 3G6JB 1QFOA 5H37H 4NQDA 1UWGL 2DIAA 3FOLB 4RQQB 1HILB 1SJXA 2R23A 4GSDH 3O3AB 1A1OA 2C7UA 1NGQL 4I18B 1U8PB 1Y6KR 4FQ2H 4GAJL 5IEHB 3K80A 1YN6B 1DANT 4NP4H 2VMFA 1JNLL 4DKEL 4OJFH 3P9LB 1P7KB 1BQLH 2FEDD 5GGTL 1HHGA 3C2AH 5KSAB 2DJ4A 5D2NC 5HHPA 2ICWB 2Q8BH 4RAUA 2DDQL 3LN9A 3U9UA 1UKQA 4Q2ZB 1MVUB 3DO7A 3B5GA 1ZLUK 1K8DB 3Q6FA 1OF2A 1FCCA 2GAZB 3PGFL 1JV5A 2ZJSH 4WI9A 2GJJA 3S96A 3V4UL 2DQJH 3LKNA 3UBXI 1V3MA 5D7LA 5FUZL 5E9DD 4KGJA 1IC4L 1Q9LB 1I3VA 1U3HB 3QPXL 1A3RH 5HBBA 4BQBA 5JOEA 1KELL 3OKKB 4P2CG 5ANMB 2X4SB 4WFEE 4GW4B 2H3NA 1BECA 4JR9L 2YUZA 4G7VH 3OMZA 3VI3E 3IXTB 3LS4L 4MDJA 2FECL 3WLBB 4PJ7E 4MJ6A 2FJFA 4R4BB 4JHZA 2VXTL 1XZ0B 5F71A 5C07D 5D1QC 1WICA 2R4SL 4WDIB 4QHLB 4OCNC 3D3VE 4MD4B 5CD3A 1MFDH 1VCAA 3EDEA 5E56A 3KYOB 3BP6A 5CZXC 1MCJA 3QCUL 2QQKH 4HK0A 3C8KA 4MXQD 2YPVL 4QRSB 3GSRA 4XRCA 4Y19A 1WZKA 4NKMB 3GBLA 5MERB 4Z6AT 2QHRH 4O9HL 3VXQB 6FABH 4QHNA 1U3YA 3BDYH 2B0SH 3V8CA 1KB5A 1MJ8H 1H0DB 5HPMB 1QFWI 4Y88A 3UBXG 3ARUA 3TYFA 2ARJQ 1CK0L 3BX7C 3I84A 5HGBB 4CADA 4LIQL 4LLAA 3H9SB 5D7IB 3SE4A 5I1AB 1JWSB 2Z92A 3ARYA 3FFCA 3AS1A 5JW3H 1JPST 1PG7L 3F12B 1RZKH 3WKML 5DJYB 4GQPH 1KJ3H 4J1UB 4S1DD 4TNWF 4KZDL 3NZHL 3VH8G 1KV3A 5T3ZH 2GSGA 4QT5A 3KXFB 3B6SA 1ADQL 4Z76B 1I8IA 1ORSA 4J23A 5DJZA 2HT3C 4RWYH 4JDVB 3VU2A 1KFAL 4OCWH 2CDGB 1HSAA 4BK4A 3EZ8A 4Q6IB 4OLUL 3UZQA 3JV4B 4MZ3A 4ODXB 1S7TA 1K2DA 1NC4D 1UENA 1VGEL 4G42A 1I9IL 2DIJA 4JM4H 2DF3A 2JJWA 4LSPL 4JFOB 1BIHA 2ZOKB 3ZDZE 5FHBL 1SYVB 3CH1B 2RIKA 2AJZB 3ECBB 5DD1L 5HVHB 4KAQH 2JF1A 4X5XA 4KKCD 3HE6B 3RTQA 1PJ9A 4WVRA 4YXLL 4ODUA 4R7NA 4HWUA 4J4PA 3O2WH 3WIHL 1OGTA 2EXYC 1H9VA 5I30L 4RBPK 3MV7A 5E95B 3GKWH 2ZCLL 4L9LB 5HVWA 5I6XC 1PAMA 1NKRA 3TNMA 5A2JH 3ETBF 2QADC 4NNXA 4Z95H 4JFHE 2XYCA 4JO1L 2EDBA 4XPAH 2P8PA 3MRDB 1JGUL 4CBPA 2B4CL 3EDKA 3KPOB 4FG6D 3GSVA 3TBVA 4BH8B 2WAHA 3ISWA 5GZND 4APQC 5I71B 3QO0A 3SE9H 1EERB 3ARFD 5TDOA 1PKOA 1RJCA 2NY4D 2UUDK 5L2KB 2UYLB 1JRHL 4Q9QH 3G08B 3I02A 1CFNA 4LRIC 1N5YH 3WDHA 1ED3B 4F33A 2E6PA 3MA7B 4ZSOA 5T5FL 3WUWA 4AM0A 2VDNL 4NHCH 5T1MB 3U30C 3GMNA 1OTTC 5EPMA 4PYHA 1MHPH 3RTQC 5C6PB 3TH3T 2NTFA 4P23D 3EOTL 5F7WC 5I8OL 4DJMA 4LDEB 4J4PC 4IOFC 3EO9L 4QXGL 1SY6H 3LS5L 1UCBH 1JZ2A 3RNKB 3H9ZA 4M43H 5HGHA 2QSCL 3MGOA 1T66D 25C8H 4MQ7A 4OI8A 4CMMB 5EOCL 4PJCF 4G6FB 5ISZB 1H3PL 2Y23A 5TH2A 2FL5B 3E8UL 1H3GA 3WHE0 5FB8A 1KCKA 4YHIA 1J11A 4BZ1L 4YDLC 4MD5A 4X8XA 1ZEAL 1TXKA 5BS0B 2PTVA 4UUJA 4TULH 3GSWA 4IDJH 1PZ5A 2GY5A 5F7LB 3ARDB 2J8HA 4K8RH 3UBXB 1AD9B 4KK5C 4X6EA 4F8QA 1QFUL 4XNZB 1PKQB 1UEMA 1EEYA 4KMTH 4B41A 3BXNB 3D2UA 3ZYIA 2C4FU 1EHNA 3TIDB 2IBGA 2AKRA 4R7DA 3NCEB 2VXUL 4NO5A 3QNXB 1MY5A 4JY4B 2FEEL 5EO9B 3BYTA 4NQVA 5FYJU 5C0IB 1QBLL 3QQ4A 3TPUB 2BOBA 1FRGL 4CW1B 1L8JA 5HI4D 3VH8B 4NOBA 4D9QD 3N50A 3S88H 4FFVD 2P8LB 4LCUA 3BUTA 4L1HA 4FQQA 3HPJA 1KIPB 3D39D 5IJKC 2HKHL 3W82A 5FUCE 3MBXL 2K7PA 1ORQA 2DQFB 3IJHB 1A4JA 1G7HA 1R3LB 2ZSWB 1S8DB 1FZKA 4MQTB 4NQSA 2VDRH 4UQ3A 5C0CB 2VYRE 4MDIA 3GGWB 5LG1A 2QTEA 1LK3H 4I48A 1ND0B 2OR7A 4Z7VB 2XY2A 2V9RA 3HC0A 4R0LB 1EFXB 3FRPA 5MI0B 1FVCA 3CDFA 3PHSA 3KYAA 4IRSB 4XCNB 4N0CA 4HUXA 1INDL 4ODHL 4EI5D 1T0MB 4Y16A 3G6AA 1MRCL 2FLBT 4PLKC 4LDOB 1KLGB 1J8HE 1YNKH 4Y1AA 4PJBB 5IBLC 4X4ZA 1I9RH 2R9HC 4P5TC 3QDMD 2DS4A 1S5HA 3HMXL 4AMKL 3E3QE 4NC0B 5D6CB 3SDCA 5AYUH 4U7SA 2YKLH 5CP7A 4DUWA 1QSFE 4RRPA 2RFXA 3LEXB 4FQ1L 4P99A 2VC2L 3AC0A 3W9DA 2X7LA 4WHYH 1A7OL 4I2XE 1CE6B 4KQ4H 4ELMA 2VR9A 1OW0C 1JVKA 3OGCA 1U8IB 1KCSL 4DVBB 4I4WA 5C0JA 3BH9B 4OFIA 4NHUE 1H8NA 4XCCH 5IF0A 5I15H 2XXCB 2V7NA 1MHCA 3QXDB 1RAMA 2ADIA 3G5XA 2FCBA 2NY0D 3OHXB 4IHOA 5KS9F 1FVEA 1S9VB 5I16A 4P9HL 1FFOA 3V4PH 2R0ZL 2H1PH 1T1YB 4Y16C 3LOWA 5D7JD 3MPCA 3MRKA 2VDML 4NGHH 4LQFL 4X7TB 5F6IC 4KROB 2BRRH 3MZGB 2Z4QB 1HEZA 4OV6F 1MIML 4I13B 3C60D 1CWVA 1Q9KB 2O5XL 15C8H 4XXCA 1JPGA 3DXAB 3V4VL 3SDCC 3OX8A 2ILLA 4PB0L 2GFBA 1JMXA 3ZLQC 2XIDA 4U1NA 4K3EL 4K3JL 2NY6C 1A7QH 1NAKH 1FH5L 4WU7A 2N7AA 2XTJC 5IKCA 4E9LA 5FF6B 5DC9B 4O51A 2NY5L 5D5ME 4DN4H 4MXVF 1QO3A 1RZFH 1IL1A 1P4LB 4R9HA 1ZTXH 2E6QA 1XCQA 4F58H 5J3HC 3QEUA 2CLVB 4WI8A 4QOKD 3GHBL 3BP5A 1AR1D 1QEWA 4H88H 5D2NB 4CN4A 4QRRB 1YEIH 2YUVA 2DQEH 4NRXA 3RVXC 5EO1A 4L3EE 2CK0L 5IMLB 2DQDH 4OGYH 3ZKMC 4HKXA 3BN9C