3WS6A

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws6A01
2VE6A 4HJGA 1XH3B 2HJKB 1RHHB 3Q6GL 4Y1AA 5AAWA 5D5MF 2Z4QA 1KNOA 2C7UA 1KTLB 3ZTJG 2Y9RT 4WV1C 4O2FA 2NXZC 2H3NA 2FX8H 4QHKI 4YHLH 1YEJH 5BMFH 3ILQC 4Z7VA 4FZ8L 3HHRB 1NC4D 5TQ2H 4ZPTA 2RCSL 2BDNH 5CINL 3U30B 1NBZB 4NUGH 1KXQE 1Z5LA 4XXDA 3WSQL 3MRGB 3HC3L 3TNNB 2YKLL 4F9PC 5J6GA 1TCRB 4PJHA 5BZWB 3IS1X 2ZOKB 1KACB 1OAZH 4XP4L 5JW5B 2DJUA 3U83A 1F11A 1R3LB 4PRHA 1S7RB 2Q7YB 1PDKA 3MNWB 4L1HA 4I77L 2XQBL 1DEEA 2MPAL 4KXZI 4QGTA 5ADOL 1T2JA 1NMBH 3ZE0E 3DWTA 1XF2B 4YXHL 5E94B 4ZOBA 5D2LF 4Q9BA 4HWEL 3EOAB 3K80A 2HKFH 5CP7A 2PN5A 2HTKC 1X5LA 3SGKA 2X4UB 4NHUB 4EI5C 3U0PA 2HG5B 5DRZA 3QDJB 3CH8A 3BRDA 1MH5A 4P2QB 2PO6A 5D1ZB 5D7LA 5I16A 4LPVA 3BRGC 1BWMA 5F44A 3D18B 3G6JF 3NTCL 4KKNA 3O8XB 3KS0J 3VFUA 4WUUE 4L8CA 4D0CB 4IOIB 5A43C 3L7FA 1QSFE 2G5BB 3D5OF 1W0VB 3TVMB 1IFHH 1I8IA 4KFZC 4NM4H 5EOCJ 2O5YL 3TLRA 2DKSA 1UCBH 3HAEH 2VC2L 1CICC 3HMXA 3QT2A 5IMKA 3CZFB 1WICA 1SVCP 4OLWH 3VE0A 4LEOB 1A7NL 4HS8H 3VWJB 5J13C 2YRPA 3OAUL 1BWWA 5IEKA 4FZEL 2QQKL 5D2NB 5CJOL 4PG9B 3SKJL 3GMLB 1HILB 4L4VB 5L88L 1L7IH 1EMTH 1W8NA 4CDGC 4E5XA 2EDWA 1A7QH 1C16A 4X7SH 3VG9C 3VXUB 4X6CF 4U33A 3UBXA 4XBGB 4HH9A 1VACB 2VR9A 1BQUA 4P2YA 3VG0L 4XAWL 4WW2A 5JOPE 1D5XA 3MRRB 3QI9C 3EYUH 5DJ8B 3HNTL 4Y16D 5LGHH 1AXSA 4HUWA 5DJCB 5CJXA 2IBBA 1EEZB 3IDYC 5CWSA 2CDFA 2DWDA 3MLWH 3NZHH 2MOVA 4X6BB 2BY2A 3BUYB 3QCUL 1RIVH 4L29B 2BMKA 1Q9WA 4J23A 1S7TB 1B2WL 1G7PA 1YQVL 2YUXA 4WFFE 1HXYA 3L3GB 3RVVC 2ZCHL 1SJHA 4FQHA 2A6IA 3OKKA 2F54D 4RFEB 3D9AL 1FL3B 4WEUD 4YFDB 4NQCB 3T0EB 3KS0H 4PREA 4KMTH 3S3SA 4P5TB 1SYSB 2R69H 4ZUUA 2XTJE 4M1CD 1RZ7L 4U6VL 3QFJA 2LV4A 2H41A 4IMLB 4N90D 1CXEA 3PGFL 2C3GA 1FNAA 1ZS8A 1I85C 3PL6D 3BIBX 3G5XB 3CFIC 3TN0B 3BGMA 5FUCE 1HOCA 1F13A 3T0DA 5HHVH 2GK2A 1GHFL 2WSKA 3T3PF 4PJDE 5MERA 3WLBB 5T1KB 1FNHA 4W4OC 1LEIA 4OGXL 1CFNB 1QA9A 2P49B 43CAB 2EDQA 3KYAA 4G8EB 3FQXA 3GBMH 4UT7H 3FHAA 3P4MB 2FEEI 5MEND 4Y8AA 2HYMA 5CFHA 1AP2B 3LS4H 5CD3A 2W91A 3GDBA 2G75B 1SEQL 3C5SB 1BD2D 3UYRL 2VDMH 1P7QD 3P4LA 4JZJC 3I02A 4UNVA 1A7RL 2BP3A 3BPLC 3MQIA 2BX5A 1AFVL 4NNXB 4LLVB 3ARWA 2ATPB 4I0PA 3DRTB 1QEWA 1LE5B 3DX6A 5CZVH 4KK8D 5I75B 4UUJB 1N59B 4X5WA 1U8NA 5KVGL 3DO7B 2H9GA 3ZTJH 4L4TE 1Q9LA 5HHXH 3OB8A 3HUJB 2VQ1B 4JQVC 1UJ3A 3DX9A 5C0NC 3QSKB 5IMOB 4PRNB 2GITB 4M93B 2X70A 3EKCA 4GW5B 3SJVD 5F7EH 1TZGH 5EOCL 3LIZL 2FIKB 1BEYL 4YQXH 5E9DD 4HLJA 3RWIA 3V0WL 3FOLA 5TFSH 4U31A 1MY5A 4AEHH 3MROA 5C3TA 4MWFA 3IT8D 3PDOA 2UZXB 3T3PE 4X99B 1QBAA 4NZUL 5I1GL 4OCMC 1I7RA 5FKPA 3V79C 4YDLB 1EFXB 4LVEA 3J8F7 4ZFZA 4KTYA 3L1OL 3O2DL 5L2JA 5INCA 5LKNA 5F3BB 3CD4A 1JK8A 4JFDE 4QGYA 1NDGA 4U1JB 1I3RA 5DR5L 1AI1H 5I19H 1PD6A 3CH1B 5E8NB 5KSBB 3M17A 4JN2A 2X89D 3OR7B 2CRMA 5CLWA 2H2SC 4QHLA 3OZ9L 2ESVA 4RWYH 5ETUA 3RPKA 1KB9J 5IB4A 2ICWJ 3MUZ1 5DHVB 1J12A 5CIPA 3GO1H 1OGTA 5DT1L 2HFEB 3NCYP 2VXQL 1WEJL 4W4NA 5EO0A 1TJHL 1WZ1H 4NBYB 2CXGA 4LFHD 4UNUA 4LCYA 2IWGA 3ROLA 3GKWL 1CGWA 1A4JB 1ZHKA 3ET9F 3NIFE 5EIIA 4Y4FD 5IOPA 1Y18A 3BKJH 5GS1A 3P9WB 4Y1AE 3LPWA 3WNKA 1Q1JL 1ZHBA 5CJ5A 2GW5A 1MCRA 5HHNA 1CGVA 3C6LB 2F5BL 2V2WA 4MA7L 3GFUA 4YDIH 3IFNL 4QRUB 2L4OA 4O51B 5DHYB 3CMOL 1D5MB 4Z7VE 4AG4L 2B39A 1GZQA 3V8OA 3ERYA 1VERA 1EJOH 5A2FA 4JFOA 4KU1A 4PJHE 5E6IC 2YS4A 3B9KD 3D25A 3MBXH 2XZCL 2GKIA 2YUWA 4ODSH 3V2AR 2BNQA 3U4EA 4PRHE 3S35H 2OI9A 2CRZA 4IRJB 1KJMB 3L9RA 4WI2A 4HUKB 1AJ7L 1U0QA 3MODH 3OF6A 5EU5A 2I9LA 3THMH 3QZWB 4PRPD 3NABH 3IDMA 2KBGA 1LK3H 1U8QB 2JCCB 4AL8L 1Q0XL 5DEFA 4KTEH 2E3VA 1QR4A 2BSED 4PLJD 1YA5A 2DQUL 4H25A 4NSKB 2OTUB 2UV3A 4N5ED 3DBXA 1HCFX 1HXMB 3LS5H 3MCLH 2G60L 2RR3A 5D7LE 1JUFB 4QRRA 2J6EA 5KZCD 5HHPA 5I1EH 3RZWA 3ZHLA 1EXUA 3OG6B 5HHOE 2VDOH 3DRQB 1D7FA 1K6QH 2VXUH 5DRNA 1A6WL 1EGJH 1UH3A 3KYNB 2QKIB 3QAZC 3ALWA 3C2AH 2X4SB 3FMGH 5IBLD 3CAFA 3OAYK 4FA8A 1WCBB 1I3GH 3VXNB 3W0WA 5KVDL 2E7MA 5E8PB 4QHNA 1UFUA 1JZ4A 4XP5L 4PGDB 1H0DB 1S9WB 5IVZB 5A16A 2NX5A 2O5ZH 1UM5L 2DMCA 1QO3A 4MJ5B 4MQSB 4XWGH 4AQ1B 5FXCH 1D6EB 2I26N 4YDJB 1JBJA 1DVFB 4MD5B 1TETL 2DF3A 2YHGA 5H8DA 5L6YH 3G5VA 2BNUB 5EWIH 4P46A 3QEHB 4Z0XA 4UNTA 2OQJA 5I1IL 1MF2L 1Z0MA 3C09C 4JG0L 1VFAB 2YA2A 5B8CC 4TSAL 3RUGA 4NKOA 5FUZL 1HHHB 1FAIH 1GGBL 2DD8H 4GKZB 5DD1L 5JZ7D 1A1MA 2F58H 4S1RL 3I50H 1CT8B 2GJZA 4LSPL 5HPMA 4G7VL 4PGCA 4NN7C 4R96B 4OCNC 1E4KA 1PQZA 2AJVH 5EUOA 2YRLA 2H45A 3BP5A 1FN4B 3CPLA 1E4XL 4MYWB 3KXFB 2B4CC 3RZCC 1FFPA 4J3WA 4OD1L 3NCCB 2DL2A 4NRYB 4GAGH 3MLTB 2JK5A 3UTTE 3MLVL 3BT2H 4KDWA 1I7TB 3LEXA 5BRZA 3WFCL 3VMNA 4HJ0C 4P3CH 1NQBA 4WJ5B 5JW3H 1C5CL 3QFJE 1MCOL 4NWUL 1X5FA 5TGBA 3ULUL 4OQTH 5KS9B 3QULA 5C2BL 3F58L 5JA8B 4XNQA 2AW2A 1MCSA 5EOTB 4JRXA 5ITFB 4UQ3B 5I8CA 4OZGB 3DUUA 5EA0H 4WUKH 4RRPA 4XXCC 2X40A 4LSQH 4LF3A 3HMWH 1CGSH 1F3DJ 2X4NA 5T5FH 3DXAD 3IDIB 1J0ZA 2VLRA 1CFTA 1M7IB 4HZAA 4PJ9C 4MXQC 3Q2CA 3MLYH 1XGTA 1NGPL 2VR4A 1U9KA 2CUIA 3WLWC 2ITCB 3VXRA 4RGNE 5ADPL 1ZLWH 4APQA 3L3JA 5EZOH 1G9MC 3EO1B 4O9HL 4NO0D 5E1HB 1V7ML 2V7NA 1CGYA 3EHBC 1CDUA 4OI9A 2Y25A 3D39D 3MSPA 5D7JD 1VSCA 3D0LB 1PEWA 2D4FA 2AQ2A 2JB5L 3MRCB 4Y2DB 1T5WA 1AXIB 4UOW0 1EBAA 2OL3H 2YA0A 4QRTB 2HA1A 4JPVL 3NCFB 2VLJA 5TF1H 3K4ZA 1IGTA 5GRYA 3BN9D 3F5WB 3PGDB 2OJZL 5D6DA 4ZG1A 3QFDB 5GXBB 5JR1L 3RDTC 4HG4K 3AMLA 5I30H 1KTDB 3HE6B 4RQQA 1MHCB 4YE4H 3UTPD 4XWOD 3QPQC 4UV4L 4NQDD 2FO4A 1LO0L 3DTXB 4NO3B 4WHDA 4H26B 1QBMH 5ERWB 3SDXF 1S7QA 4M5ZH 4PB9L 4HGKC 3QUYB 3U6RA 3VU2A 4H5SB 1JPSH 3BIKB 3GMNA 2FX7H 5FO7B 4GLRI 2BY1A 2E6PA 3NFSL 4KROC 1GAFL 1BZ7B 3ETBF 4F37F 1IGJB 4XMPL 4QRPA 4H20L 4Z77B 1F4YH 4QYOB 3UTSB 2C3VB 4G80B 3VXSA 4PV8A 3IVKA 4JDZB 5F1IB 3VFPB 1BM3H 2ESVE 4AEFA 3HRZA 3SDAB 3I2CH 1FV1B 2KZWA 2J8UB 3NH7L 1Z2KA 4IIQC 1B0RA 3ARUA 3RL2A 3SPVB 1MCQA 5SWSE 2DQJH 4M62H 1WZMA 4R7NB 4U1NA 4DVRL 4FS0A 3LAFA 4GSDH 2NY1D 4MB3A 4WTZG 5MI0C 1WZLA 2QADB 4NWTL 1UB6B 4JQIH 2YN3A 5EG6C 3F7VB 1NEZB 1IGYA 1IGML 4DJMA 3U2SB 1M6OB 5ICYB 4P2RA 4JPKH 1I1FB 3VGAC 4JFYA 4PRBB 4XH2A 3PV6A 1BBJA 4DN4H 3N85H 1MFAL 3DECA 4XCCL 4G6KH 3ZE2F 3TIEB 2ZUWA 2ATKB 5D9SA 1MRCH 1NCWH 4MJID 4JPWH 1D3CA 4C55A 1J18A 2FD6H 3IDGA 3U0TA 1TJGL 3H7BB 3EDEA 5F8RC 2MCPL 3ZKXC 4KC3B 1JN6B 4N8VA 3BFOA 3FB6B 4U7KA 4YHZH 2P46B 4LHUB 3HRPA 2H6PB 1VADB 2GAZB 3IS0X 2BNQE 5IM7A 3C5JA 4Y88A 1EZVX 3RVTD 4WDIA 3S5LB 2GQHA 4UOW1 2JJSA 2IADA 1UVQA 4XAKE 1HZHH 1UWEL 2PXYA 3BSZL 4X8JB 5F7FA 4MAYC 2YMXH 3WIIL 4OIIH 1FGVH 4KVNL 1SQ2N 2XFXA 4WW1B 4ACPA 2H1PL 5CZKA 2VRAA 1X5HA 5DJDB 4GRLC 5IUSA 4UDTA 4O58L 1KCSL 2YC1A 1X5KA 4Y4KA 4GUPB 4QRRE 4OJFH 1XZ0B 2DQCL 1KCRH 1ZT1A 1NLDL 3RBSA 2Z8RA 1ZMYA 4CU8A 4HKJA 2QL1A 3FO1A 1MJ7H 4I2XA 1F97A 3SE9L 3HTLX 2D7TH 4WTXA 5BCAA 1IMHC 1I1YA 1GPOL 2JTDA 3LQAL 3QUXC 4LPWA 2A73A 5T5NF 4DOHB 2OR9L 1LGVA 2OZ4L 3MRHA 3SCMB 2IH3B 2EDFA 3W0WE 3LD8B 4O4YL 3MRJA 5JMOC 1T7ZA 3JUZA 1UWXH 4Z7UB 3QB7C 4LP5A 3TBWA 3UPAA 2H2PD 1FL5A 2BERA 1YEDB 1DQJA 1UH4A 2AEIT 2NX5E 2ZWLT 2XKNB 3KJ6L 2IBZY 4HBQA 5EU7E 1EPFA 5IK3A 3S36L 3CZJA 3FHQA 1KC5L 3D6GA 3GI9L 4P2OA 1G6VK 3WL9B 4JN1H 4YLQT 3IAGC 5DUML 1DQLL 1MHPL 4FHBD 4J8RB 2W0KA 3QDMA 3UTQA 3BKYL 1U3HC 3RUGE 2Z91B 2AK4A 8FABA 4Y7MA 1DQQB 1HQRA 3IDUA 5GRWA 2IAMC 2X9YA 4HIJB 4BH7A 2YR3A 5F1NA 3OKDA 2OR7A 3O2VH 3C8KA 5I15H 4Z7WB 2VWEC 1I3VA 3U4BL 5BW7A 4DQOH 1KEGL 3G6AA 1ZXQA 5EUOE 3QUKA 4FFZH 4EDXA 2HFGL 2AGJL 4NO5A 3HPLB 1VGEH 4RBPH 5D72L 1J05A 4PG2A 4CMHC 4HGMA 2CPCA 1CTOA 5ESQB 2VAAB 5I1KL 1NCCL 2B2XH 3T3ME 3VI4E 4PGZA 2YWZA 1V7NL 3HAEA 5DFVC 4P2CG 4BZ1L 5BRZE 3C6SB 4HSQA 1KCVH 3P4NA 4YGVB 1FO0L 1MPAH 3BEVB 3FQNA 3GSQB 1HH6B 1JNNH 1ACYH 1KLGA 2R0LL 2HN7A 2N56A 5A3IC 3MXWH 1KPVA 3T65B 1TIUA 1HE7A 2NLJA 4PJFB 5DRXA 3WO3B 4FFEX 3VDBA 2HTLC 4JRXE 3PIQA 4OCLC 5FM4A 3O6KH 4ZSOB 4EKXA 1G7LB 5DEGB 4JKPH 1AGFA 2YBRB 4KK9D 4AT6B 3PWNB 4TSBH 4TUJA 2VUOA 1OAQL 3HC4L 5BO1L 4E41B 4QNPF 2BSSA 2VLRE 4KPHH 2IFFL 3MGOB 2XNAB 4K8RD 4PBWD 3HZMB 3VXRE 2AEQL 4M7ZB 4X4XB 5I1JH 4PJ8C 4CAGA 2A6KA 4Q9QH 3TV3H 3GSWA 4J3OC 3WFHB 1OB1A 5IFAH 1FSKC 1X44A 4S1QL 4MDIA 3SKNB 4RIRA 5DI8B 2F9BT 5E1AA 5SX4H 1JPTH 1RULL 5IW3A 5FYKL 4WHCA 4H8WL 5DFWH 4P23B 2IEPA 2VLJE 4ZAKC 2D7OA 2X4TA 3OXRA 3BPNB 3GSNH 4UILH 1BREA 1D9KD 3DURB 5HI3C 1YEIH 4RGMC 4POYA 2WBJD 4PJBB 3AXLB 4HXBH 3P0VL 5GIRA 5I9QB 5ID1A 5DC9B 1U8LB 5JHDA 3LB6D 3TO4D 3O3DA 3S3PA 3MLUL 2EDKA 3GHEH 5KG9B 2VDPH 4OCSH 1ZHLB 2OSLB 1NJ9A 1NDMA 4YBQD 3QG6B 4F58L 5BZDB 1JCKA 2YWYA 4G6FB 2R23A 5FKAB 5DURD 5K33A 1JNLH 1DLFL 3MV7A 3ZYZA 2BNRB 2IC2A 1EAJA 5HYJD 1C08A 2NTFA 4WO4A 1WVZA 4M43L 1EEYA 2OTWA 4QRPE 1OLLA 1WFOA 1O5DT 5D5MB 5FECA 3P4OA 3VH8G 1X4ZA 1T1YA 1WBYA 1MIEL 4L3EA 3MJ9L 5HYEA 3PHSA 1G1CA 4AEEA 4P4KD 3CXDH 4Z9KB 1UYWL 3C9NB 4FFYL 3NCJH 4L4JA 3ARDB 5E5MB 1HEZB 3M1BA 5F7DB 2UYLB 3MLRH 4D8PB 3TPUA 4DKEH 4WCYL 3KLDA 4Q6IC 3S4SA 2AXFA 2GJ6D 3QUZB 4RMTA 3V7MA 3MV8B 4QRSA 1S9VA 2R29L 5DS8B 3GMOA 3O4LA 3IXAB 1IC1A 1LO5B 3MRQB 1OOAA 4P59L 4XVJL 5ACLA 2D03L 1K4CB 4MXWL 1CS6A 4JM2A 2IQ9L 4MNQD 3HG1D 3DV6A 5ENWB 4P2RE 3FFDB 3IDNB 4X98B 5D2LB 4HFUL 5H94A 1A4KA 3UP1A 4AM0A 1A8JH 5HDOA 2ZUYA 4FQ1H 2KDGA 2GYSA 4ZXBA 3E2HC 2VISB 4AJ0A 5HBBA 1BQLL 1D5IL 3VFNA 4DEPC 4ORGA 1UWGL 3QQ3B 4OZIA 4LLUB 3VFMB 3D3VA 4D9LH 3QH3B 5GRZA 3G6JB 3RHWF 4P48A 3TZVB 3CC5A 3R1GL 4XPGL 2WY3A 1IEHA 3PQYA 4PGEA 2HJLA 1X3DA 1S7VB 4DAGL 3OKMB 2GTWA 2VR5A 4JZNA 1AR1D 3QHFH 3UX9B 3OPZH 1E27A 5EBMA 2D7QA 5JOFA 4R4BB 5D1QB 5TE6L 2VMFA 3DETC 5H37G 3LQZA 1YPZF 3KPPB 1JYWA 3SDCB 5ESVA 5ACZA 1ORSA 5JNYB 4K7PX 1R3JB 3LQAC 4X6FB 2AEWA 2J12B 3GJEB 1AHWA 4YHKH 5IROA 4OFKA 1CFQA 4WU7B 5HGGS 4GMSL 4HS3B 4G43A 5HYSA 1WFUA 1R5IA 3SQOL 3EYOB 4I2XE 5TPWL 3Q48A 2DWEB 1VFBB 3DPBA 1NUDA 4GW4A 4X6CB 5F9OH 1BGXH 1JFMA 4QOKD 3SDDC 4CN6A 4G6JL 1U58B 1A6ZB 3KYKH 2OK0L 3A6BL 4GAJL 5FCUH 1U93A 4PRAB 3NFPA 2FWOB 1XIWA 1UACH 1OPGH 5KN5A 1RIHH 3GMMA 5EZIH 1KN2L 4XGZB 4EVNA 4DGYL 1DDHB 3PWPD 1WT5C 2RB8A 2ZCLL 2AV1B 5CMAB 5K59F 2K3TA 4L4TB 1F2QA 1Z6JT 2ITDB 2R15A 3V5KA 5C07A 3QIWB 2Y5TA 4C56D 3VRLF 1V3JA 4NQSA 4TUKL 2G2RB 1H3XA 3TC9A 4ODVH 3HPJA 1DUZB 2ICWA 4W6WB 3QDME 3KPLB 5GZNC 1LE9A 1QQDB 2AK4E 5BVJA 3GIZL 3OXSA 5C0BB 1OQOA 1NBYB 5CHNB 2P8LA 2VTFA 2ORBL 1FE8H 1WSST 3IJHB 4Y5VB 5DK0B 5BXFB 5HTSA 5JUEH 3D85A 3RTQD 1B4JH 1T21A 2CXKA 1BFVH 1RUKL 1P7HL 1N0LA 1FYTA 1WJ3A 1EGJA 4LKXB 4KI5E 3QNZA 4P5MA 3G04B 3MUJA 4N8PA 4GOSA 1HYSD 4JFXB 2AEPH 4WFHD 4U0RB 5KSUB 1OGAB 2ED8A 1K8DB 4GQ9L 5L8KB 3H42L 4Y19A 5F3HB 1CFVL 3TT1L 4R0LC 1ODAA 4N9GA 2PW1B 1FDLL 1UH2A 5FV1L 3U9PH 1TQCB 4JY4B 4X0KB 1BP3B 2ZCKH 4KJPD 1JZ5A 2CR3A 2QHLA 4P4RB 3PP4H 2B5IC 2HLFC 4KRNA 4HPOH 1G7QB 2VZ1A 3I9GL 4JDVA 4JY6B 3TJHA 1I7UA 1F6LL 1T0MA 1DN0A 1IGIL 5DUBA 3U46B 3D0VA 5CBEB 5KSAD 1M7DB 3S8WA 5BJTB 3WFEL 1XF5A 3LPGA 4ZDHA 3BWAB 4G8IA 4MA1C 3FN0H 2XWTA 5K59E 2C7UB 5IVXA 1GC1L 1SJEB 4F37K 4MZ3A 2D31B 1WFTA 2EYTA 4O2FB 4RBPK 5LWYH 1VB9A 2CGRH 2AQ1A 1I4FB 2CKBH 3H3KA 3MBEC 2X9WA 3VGGA 4JE4B 1YNKL 1X5AA 2JIXB 5L88H 2EXYC 2Q86A 1J11A 1G6RH 4GS7C 3CLEL 2NW3A 3O6FB 4LVOC 4JQXC 3VFSB 4XXDB 3L3HA 4NYLB 4ZYKA 1KFAH 4LIQL 2XWBA 3FONB 1T83C 4Z95L 3QG7H 1A0QL 4PBVC 3K7UA 2QJDA 1J1OL 3BQUB 3T0WA 1UM4H 1P9MC 1IQDB 3C5ZD 3UJIL 1XAUA 3TYFA 4LMQE 3OKOA 5JQ6L 3KAAA 1GXEA 5JHDE 5GRXG 2VLKA 3U0PB 3L6FA 2A6JA 4K2UL 2DIBA 5HI4C 1QRND 1MH5B 2JB6B 2CD0A 2IH1B 5HHMD 3BAEL 2DKUA 5K9KB 1A6AB 5FF6A 4WEMB 2B4CH 4Y4FC 1ZEAL 4YK4C 3MV7E 1T3FB 3ARFB 4NKMB 1J1PH 3JWOL 5DJAB 3ES6B 5HHOB 1RK1A 3HE7B 5JPMA 4ZO8A 3AM8C 4X9FA 5CCKL 4L3EE 2R1XA 4OKVA 1CK0L 3EZJB 5H37H 1BPVA 2AKRB 1BFSA 4KVCH 1F4WH 2W60A 2VDQL 1YY8B 5J11C 5KSVB 4P57B 1DANT 4OCXH 3WIHH 1P7KB 1HHIA 2EDNA 1NAKH 1BQHA 1NC4A 2A9NH 4JFED 4JCLA 5I17B 1SEQH 1WBZB 3TPUE 3TNMA 2V2XB 4NQTA 3HC0A 3MGAA 3BN3B 3WMSA 1ONQB 3BPOC 5EO9B 2HVJA 1PKQA 2GSIA 2D2OA 2OL3B 5CD5D 3NA9H 3GBNH 5I74B 4DTGL 1FNGB 1P84K 3O4LE 5DJXB 2F5AL 3U1SL 1U95B 4HAGA 4NQEE 4QHKJ 3R8BB 1NGZA 3TBVA 2V5SA 4BSWB 1FZMA 2NNAA 3ZKMD 4RZCA 4YFLF 3T2QA 3D69B 1RSFA 3LHPH 2BFVH 2ZUUA 5C0IB 35C8L 3QQ9D 2WUCL 3SOBL 1G9MH 3GMRA 1QVOA 3EOTH 5BS0D 3RPIB 3FFCB 4R97B 1RZGA 2BMKB 4JKKA 4I4WA 2ZKHL 2WMPA 1G7PB 2YPKA 1KN4L 4O2EA 4CMMB 3OJDA 1T04A 3OKKB 4PTTB 3UTTB 4PJGF 4OZIE 3D3VE 2ZUXA 5HY9A 5IMLA 5IWLC 4TYUA 3PWLA 5GZOD 4ISVA 4IRZL 5L9DL 3PQYE 3KPRD 1GIGL 2FIRT 4EI6A 4LNRA 2PYEB 2R2CA 3T8XB 4YHYC 1EUUA 1HOCB 5SWZD 4JJ5B 5H2BB 2VDNH 4JDTL 3Q5YA 4JKMA 3OKYA 1Q94B 1QBLH 2UWEA 4HEME 2AP2A 4GKSA 4Y4HB 5FM5O 1J7VR 2FATL 1LEIB 1A02N 5ALBH 2W9EL 4FXGB 2R2BA 4HMCA 5IFJA 1LO3H 2CR6A 2QV2A 2WUBH 1A6UH 1N7MH 2VL5B 1VEMA 4OUUA 2NY0C 3CVHB 4J3VA 2B0SL 1OAYL 2IPUG 4PV9A 1QYGH 3QHZL 4ZUTA 3PGCA 4NT6A 1T80A 4PB0H 4R7DA 4KHXL 1CU4H 1YJDH 2EIZB 3TH4T 1N3NB 4XHJD 1K85A 3GB7B 2CK2A 2J88H 1WITA 5EFIA 5ESAB 2H8PB 5F70A 3DX6B 4QTIH 3GJFH 1ZK9A 3PABB 3FQTA 4Y16A 5ABDE 1MHHA 3T77A 4XI5C 4EN3C 1NCBL 2QQNL 3MOAH 4KXZH 2C3XA 1I7ZA 1OW0A 5T1LD 1RVFL 1HWHB 3DIFB 5C07E 1J8KA 1QFPA 2F54A 5E6YA 3V52H 3MXVL 1YEEH 3E6FA 4OF8A 2FEDD 3Q1SL 4LPUA 1CDHA 2W0LA 4QF1B 3ZTNL 1PG7L 3IF1B 1NBVL 3PHQB 5F9JB 4DZ8A 4FFVD 1UJTA 3MRBA 2ZUSA 3GNML 5J9PA 3CDCA 1K5NB 3ELAT 3KR3H 3TJEH 5F6IB 1DQMH 1P69B 1FVEA 3N1PC 1WIUA 4KKBD 1BJMA 1WQVT 5EC1B 3RQ3A 15C8H 3TH3T 4PRIA 1I7RB 2XPGB 4XC1L 3MLPA 3FQUB 2P7TA 1H3PH 5E2WH 1FYTE 4IDJH 3Q3GB 4IEFB 3C08H 1KB5L 5EO1A 2EEBA 3EO0B 4L1DA 3K8LA 1H3UA 1RK0A 5DJYA 5EH1A 1FO0A 1HWGB 3IJSA 4U1LA 1T1XB 5MENA 1NCDL 3ULUE 2NY3B 1LEGA 1BD2A 3FB5A 4CW1A 1ZAGA 1NSNL 2EIDA 4XNYL 1DBJL 2EDHA 3BISA 3CGTA 4K8RL 4OZHA 3MRKB 1QLEH 3TA3C 5GS0L 4LLQA 5SWSB 2DL9A 4U6XA 1LDSA 3ARGD 1DBKL 1KUMA 2H26B 4LCYB 2W07A 1QNZL 4XVTL 2AK1H 1MEXL 3BDYL 3FB8A 3ZSTA 4D0BB 4E0RB 3AVEA 8CGTA 1Y18B 3QA3A 1X5JA 4AEIH 2AJ3A 3BDXA 3O9WB 4DUXA 3VMOA 1EA9C 3LKQA 4LCWB 3CDGB 3KPNA 1DL7H 5IVXE 1I1AC 5HHNB 3V4VH 2YSSB 2BVYA 4OF7A 4CVXB 3QNXB 1JYXA 1HSBA 1BVZA 2GSGB 3OKNA 3UJJH 4D9QE 3TVMC 3BE1H 2A6DB 1MCPH 3MV01 1T0NA 4WV1B 3TO2B 4HWBH 1A7PL 2NXZB 5C0DA 3INUH 5CUSL 4MQXC 4F7TB 4GG6F 2BJMH 3PF2A 4ONGH 4U49A 1CF8H 1QPPA 5IBTH 4N0UE 3SDXB 3VWJC 5IHUH 4TN9A 2W0FB 4OM0L 3MOBL 3STLB 1W72L 1VDGA 1KJ2H 1NFKA 3BD4A 1OTUD 1SM3L 1T89C 4DWHA 3TCLA 1FJ1B 3H6JA 5IKCA 4AIZB 1KENL 1OAXH 1RJZB 4MXVE 4LDOB 1MIML 1F6FB 2KL6A 1KG0A 2X89A 4AH2B 1TPXC 3JWOC 4JPIA 4R8WL 5FDWA 2V9QA 2VLKE 5E00B 4NZRH 3JTCA 1PAMA 5DVMA 1A21A 4FQXD 3O6MH 1LQVA 1PZ5A 4KKCD 1RJLB 1NEUA 1NFDF 2P24A 1TZIA 1ES0B 4TSCH 3V9FA 4OF3A 4MB5A 3TT3L 4EI5B 4KRPD 4YDVA 4MA8H 3CFCL 1QLRA 2CDEA 4OCRH 3TWCL 1P53A 2CDGA 5HHPB 4OLXL 1G7HB 5FYJU 1WBXA 5JDSA 1OARL 2A74A 1JPFA 1SHMA 3N1QC 3V4UH 2V7HA 5MEQA 5HGBB 4KDVA 3T0EC 5EBLB 5ICZA 5SWQA 4HT1L 1DJSA 1L7TH 4NIKB 2NY6D 4HQQL 4P5TC 4ZQKB 3P9MB 1G0XA 3X3FH 3RHWK 3HZKA 5LQBL 4M48L 1KTKE 1MLCA 5GGTH 1D5ZB 5HGHA 5DQJA 3GHBH 3W0WB 3B83A 1L0YA 4G9FB 4WTZA 2HH0L 1CD1A 5I8EA 3IXTA 5B3NA 3L5IA 3W11D 4HJJH 5BQ7A 4NNPH 2P5EB 2DQIL 1CICB 3MUY1 4LARL 2BRQA 4IMKA 4I3SL 3N9GH 3WDHA 3ULVD 3BZFA 2FHCA 3TF7C 3FN3A 1PKQE 5J13B 2C1OA 4I8DA 3R0NA 4FQPA 2NY2D 3B9KA 1MVFA 3BPCB 3O11A 2IAND 3WHXB 3W5NA 2V9RA 2XT1B 5F7NC 4OFPA 2E6QA 1S3KH 2E9WA 3B2VL 3QNYA 3GSNB 3F62A 3KPOA 4CRPA 3RY4A 5DMKA 1ND0B 1U92A 1H3WM 4OIAA 4K3JL 3VFVB 3VG9B 4MNGB 4PRPA 3VXTA 1AY1L 4LASL 5KJRL 3NIGE 5FK9A 1RFDL 4I9WD 3LKRA 4KJQC 5GSRB 3CFJA 4TQEL 4MJ2A 3LV3A 3QI9B 2L7UA 4N0FA 4WI3A 3CFBB 4N5EA 3BP4B 2J8HA 2UVEA 2YN5A 2Z8WC 5GGRB 1NFDE 3IDYB 3KHOA 1WC7B 1AD0A 3OV6A 4U1IA 1CWVA 1JHLL 4QXUH 4LPCA 4ONFL 1EAPA 1NCAL 1RV6X 5AG9A 3S37L 3LEXB 1E4WL 1KIRB 3PWJB 5AD0B 4TVSa 2HMIC 1IKNA 2AV7A 5C09B 2BC4B 2QR0A 5IIEB 2QSCL 1G7JA 3MNVA 1QZ1A 3GM0A 3WXVL 5ALCL 3REVA 2FX9L 3EYSH 4NFDA 5I66A 4RNRB 5E2VH 1OP5K 3QQ4A 3MREB 1NGYB 2P8PA 1B90A 3IJYA 2UWEE 4F3FA 5IB5B 5FUOL 3RWEB 2WWMD 4Z0BL 5SX5H 1UXWA 1TVHB 4NC1E 4ZUVA 2I07B 3T2NL 4S1DC 5TE4L 1I9JL 4G6AD 3G6DL 3MOQA 1FORL 4K23L 1A6VL 3P0GB 3BZ4B 4OV5B 3VXRB 1RUPH 1I8KB 3HLAA 3P9LB 2AXJA 1JF1A 1ZT7A 1T7YA 3HB3D 1GZPB 2QTEA 1JF5A 4P2QD 1HQ4B 5D1ZD 3BW9A 3EYQD 3VFOA 5IB2A 2A0LC 3QIUA 4FQIL 4JZJB 5HJ3B 1RZJC 1N2RA 3BPLB 3O8XD 5FYKU 4NHCL 3KDMA 1N8ZB 4JQVA 1UZ6E 1H8SA 4F57H 1G0YR 2IALB 1YYML 1CE6A 1W0YT 4I1NB 4POZC 4Z7QF 1FC1A 5D7LD 4E42A 4XRCA 1AO7B 2IG2H 1B6UA 3B6SA 5JW4Q 3ARXA 5HGAB 3P11H 4YXKH 4N0CC 3QUMH 2F54E 4CL7A 4HUVA 4JFZL 2VDKL 5L0QC 4MD4A 4V1DB 3NVQA 2RAMA 4YR6B 3CFKA 4XPTH 4DW2H 3EAKA 3TIDB 4ZNCD 2OMNA 4L4VD 4N90E 2ZOLB 3HI6L 2VOTA 2AJZA 3NZ8A 4Y2OA 3QIBB 3UJTL 5GPRA 3WD5L 1S7SB 4U2YA 3VFWB 4F8QA 1VGKA 3KPQA 2BY3A 1P6FA 3OB0H 3GJFK 4JG1L 5GGSA 3FCTB 4G8FB 1A47A 1HNGA 3QCVH 3UEZA 5GS0C 5EZJA 2CIKA 3D2UB 3QHTC 5MENE 3GRWL 4ZS7H 1MAJA 4XMLH 3MRDA 4C83A 4CGTA 1BD2E 2UZIH 5K9JL 1BVLA 4ODXA 5EU3A 5FYJH 3LRHA 4F7MB 3RL1B 1KYOJ 5K9OA 4WY7H 4OZHE 4OZ4B 5C0GA 4NO0A 2DQFA 4NQCD 4BKLB 4JHWH 5J1SC 3D39A 3V8CA 5D7JA 1BAFL 5IR1A 3SE9H 2I60H 1CFSA 1MFCH 3SGJC 4Y5YC 4U6HB 4KZEL 3BGFC 5EIVA 3JXAA 1CI5A 4M6MH 1NL0H 3O0RL 5DD3L 5DRWB 3TN0D 4KKLD 1FIGH 1EH9A 2FJFB 3FRPA 3MMEA 1KELH 4DKFL 4M6AA 4D3CL 4DGIH 5GHWH 3REWA 1FZKA 3MJ7A 3CIQA 5T1KD 4WWKC 4QHMB 4XP1H 3VXMB 4MB4A 2Z92A 1JPST 4Q74A 4JFQA 1UGNA 3W39B 4NQUA 4CADB 3MZGB 5E9DE 2FJHA 1S7WB 4ERSL 3B3IB 2IMMA 4M7JH 1GJIA 4OLUL 2E9IA 2CKNA 1J8HB 4J4PA 1AC6A 2FLRT 3O2WH 1PY9A 4JHAL 4XNMB 2WANA 3C5JB 5E6IB 4EDWL 3U4BH 1TTFA 2KZ1B 2IADB 3T1FB 1UVQB 4OCYL 4ELMA 2E5EA 1IEAB 4LCCC 3RVXC 3ZE1E 2HFGH 3OGCA 1MCNA 3K46A 5ILTL 2AVGA 5MP6L 1F4XL 1INQA 4MCZB 4XBEL 5JXAH 5CP3H 4NN5C 2Z0BA 4GG8A 5D93C 5L8JB 3JV4B 1WWCA 2VL4A 2SEBA 3GZKA 4LCIL 5FYLH 2FZ3A 1VESA 5DMGC 1MHEA 4Y4KB 2PUQT 3WS3A 1Q72L 1KJVA 1P2CB 3RWFA 3DGGA 2CKBA 5M94B 3GGWA 1ZLVH 2W1NA 3G9AB 3TEUA 3GSUB 2E6JA 5BVPL 4B50A 4XVUC 1NGWA 3VH8B 3WUWG 1I1YB 4K94C 1AGCA 3BXNB 2Z35B 2DS4A 4TUOB 3RY6A 3QAZB 1EFXD 3ORJA 3I3BA 5C0FB 5CBAA 3DUHA 5E2UH 4P9MH 1G6RB 3S96B 3U4AA 2JKXA 3FZUD 4PJ7F 3H9ZA 5DA4A 1UZ8B 4QLRA 1J87A 4MJIA 4WEBL 3T1WA 4FQQA 4JJHA 2I9TA 4WIQA 4YDKL 3BMWA 3VMPA 1OY3B 2YEZA 4YHOH 1SEBA 2Z31C 4OB5H 1EO5A 3EIFA 3BUTA 2GCYA 3L3OA 4FFWD 2P5WB 3O6LL 4N0YL 3C09B 3PJSB 5B8CB 4PRPE 2FSEA 2ZSVB 1NAML 4KY1H 2E7BA 1DZBA 4GLRH 5T3ZD 1QR1A 2EE6A 3MRNA 1QFWI 3LRSB 2DDQH 1K2DB 5FHAL 5IF0B 1YPZB 5C86A 3OAZH 1DBAH 5B39G 3M8OH 3C6LD 5BV7L 2XZAL 1HINH 1F00I 5DO2D 4PJ5B 4EOWL 4GKOA 1NKRA 1XR9A 3FQRA 2DLFL 3FAWA 1MWAL 2X05A 2BOBB 5HI5C 3TP4A 3BDBA 4Z5RB 2V17H 4HUUB 2EZ0C 3HE6C 1MCIA 3RIFF 3UC0L 5IGXL 4HH8A 1A2YB 2A77H 3QPXH 4NUJA 2EH8L 5EOQL 3ARBC 5CEYA 4XXCA 5DSCA 1L6ZA 3AGVA 3QXDA 1KXTB 4IRJD 4UU9B 1SYVB 4WHTB 3P73B 3VCLA 2PYFA 5F96L 1QFOA 4X5XB 3A0OA 3L5HA 3RAJL 4K3HA 2LU3A 2BRRL 1VFUA 2D7NA 3IDXH 2EKSA 2KPNA 4M1DL 2H32H 4J7RA 3T0XA 4PJ9B 4HPYL 5M95B 5E99L 4XAKD 3JV6A 3KLHC 2VYRE 1JWUA 2AJXH 3ECBB 4XPHH 4MDIB 3I75A 3QJHB 4IRSC 3KYMA 5HYIA 1IGCH 5JO5A 5IT2H 1BIHA 4BH8B 2ZPKL 3O3EA 5GJSH 1GGCL 4LLYA 1ZANH 3WJJA 1QG3A 1AGEB 1AQKH 4L9LC 3DX8A 4RFOH 4XBPA 3SHSA 5KTEH 5A1AA 1OL0A 1FFOA 3RDTA 4Z76B 2VXTL 3UO1L 3O3BA 3HI5H 2QHRH 4PGJA 4A6YL 5SX5K 1IAOA 4M03A 2N7AA 4R90H 3OKLA 1IQWH 1T4KA 1VFMA 1T20B 3N1GC 5DVNA 3V95A 1DVFD 2CRIA 4KAQL 3CLFH 3P0YL 3EFDH 1CL7H 4HXAL 1U8PA 1ZT4B 5C2UB 3PNWA 3DV4A 5KSAC 4LRNH 3VGHA 4FABL 7FABL 3EJZD 4ODTL 3CSYA 5INDB 1I8MB 1TMCB 1ZWIB 2BHZA 3TBYA 4MAUL 3R06B 4RX4D 4I5BB 3UPRB 4K9EL 5CILL 4KROB 4P46D 3DXAE 1S7UB 1IC5L 5DDHB 2BVPB 2HFTA 4LSRH 5FO9B 5I1DB 1YEGL 3DVIA 3RGVA 3KXFD 3T0AA 1E6JL 4I0KA 1ZTXL 1NC2B 2ADGA 2R0KL 4NDMA 3HFMH 5DJ2A 2FHFA 5C92A 3LEVL 4U05A 2VKXA 4ODHH 3S4SB 3ZDZE 3D39E 1R0AH 4QRSB 1T2QH 3GJFB 2JJVA 4NN6C 3TYGH 4IIQB 4PD4K 4NQEB 2VJXA 5AUMA 5CJQL 4Q9RL 1U8HB 2AJYH 3MRIB 2W9DH 4PJAF 4P9HH 1D9KA 4XX1E 5MI0B 3L5XH 2MQ3A 3KPSB 1ZHNB 5D70L 2WBJA 1NGXA 1R5WA 3SCMC 3B8YA 1U8JA 4AM0B 4MSWB 3VGAB 3TO4A 4V2BA 5D7IF 5FGRA 5I2IA 3UTPE 4NRXB 4RGOH 3DOSA 1W72A 2ADFH 5DJ0B 2DTSA 4LRIA 1LDPL 1YY9D 1UKQA 3QEGH 4ORGB 4ENEC 4AENA 4BZ2H 4XPFL 2BSTB 4DFIA 4J1UA 3BMVA 1FNSH 4W6YB 1XGRB 3ZKXB 1XF3B 3SQBA 3PQYB 4PGEB 3LN9A 5IQ7H 4FQLH 3MACL 3UDWA 4M7LT 5C7XH 4JKWA 3WV0A 5FGBA 4ELME 5KAQG 2F74B 5HGDA 4JZNB 1YDPB 3IETA 5MEOA 3O3AB 2NCMA 4JCMA 2WINB 3IFLH 4U1GB 3GMQA 3C60C 4P4KA 4Z7OE 5GRUH 1TNMA 5JIPA 4MAYB 3DVNB 4ONHA 3S9DB 5E5UB 1HH9B 5IHZA 2NZIA 3SKOB 5LCVH 2YPLB 3SY0A 4HFWA 1QFHA 2GJ6A 2IPTL 1AHWB 4GRLB 1JGVH 1CFQB 1OAUL 1E4JA 3X13A 1N0XH 3X14B 2XKSA 4LLDB 3ULVL 3L5WB 5CS7A 3T4AB 3RU8H 1CGXA 1A5FL 1WGOA 1ZSDB 3BWUC 4GAYA 1MRFL 1H3GA 1UXSB 2Y06L 3MRPB 5A2LH 1F3JA 4PJIF 3FT2B 3QUYD 4LBEB 4WU5A 4S0SD 4CNIA 5D1XC 4MNQA 4R2GB 1INDH 2ADIA 3HG1A 1BHGA 2G9HB 3ARQA 4C57C 3F7RA 3QUXB 3OQ3B 4IS6A 4L8SB 2E7LE 3GMMB 3BD5A 2X4PA 5DK2B 3VW3H 1RZFH 4Z7NF 2F53B 3PP3H 1HDMB 1KLFA 2I24N 1OP3K 1RY7B 4MJIE 2NW2A 4MHHI 3S98A 4FQCH 2ZG2A 1YNKH 5IB1A 1KLUB 4RISL 4I18A 2CLVA 4PJGB 4JAMB 3SDAD 1YN6B 2EXWD 6FABH 3H0TB 5IMMB 1KJ2B 1CXIA 4YHPB 3W9DB 2B1HH 3A67L 5AWNL 2E8YA 1U6AL 5J3HD 3RY5A 2BY0A 3VXSD 2DQGL 5BV7C 4OLVH 2XZQL 4PGBA 4Y5XA 4R3SA 2UZYB 1U3HB 4ETQB 3TBSA 4YHML 1C5BL 5JTWA 4YXLH 2APFA 2IAMB 2QADD 4LDEB 2Y5EA 1NMAH 3H3BC 4QY8A 6CGTA 1T21B 4RDQG 4PJCF 1QFUL 1T1WB 4R4FH 1DLHB 3DNKA 3BPNC 4LKCB 3NPZB 5GGTA 4DVBA 3QEQB 1J10A 5CZXD 4F2MB 3WNNA 3MV9B 4CJ1A 3KYOA 3PWVA 4CMHB 5B38G 3CFEA 2B1AL 1D5BA 4UTAH 3NCYS 3O45B 2QQLH 5E0QA 3FRUB 1EEQA 3NACL 4R4NC 2VLLA 3F6IA 4QOKA 3NIDF 3QZWG 1CCZA 1Q0YL 1A1NB 5EORH 4LHUD 3VGFA 3CVIL 3HS0A 5GGQH 1NKOA 2Q6WA 4OM1L 1EHXA 3SE4A 4RAVA 1YEKH 5EUKA 5A40E 2VLME 4PFEA 3PWPA 2QLVB 4L3AA 1EHLH 1OD7A 2AJSL 4XNUL 4JO4H 5HVWA 4TNVF 3AUVA 5TH2A 5C6TH 4C56A 4F7PA 1QSZA 1Q9KB 4CBPA 4FFVC 5E8DH 5DMIL 3WIFA 4JY5H 4CJ0A 1X7QA 3EJJX 2LVEA 1MCHA 1TITA 3IFOA 2PXYD 5F88B 2R0ZL 1AGBA 1IAIH 4JRWA 4YO0A 3RA7L 4KKBC 4IJ3C 5I0ZA 5GQBA 1UB5A 4PJ8B 4N0UB 4BA8A 3MJ8B 1BFTA 1JGLL 5ANMA 1FSKB 4PR5B 2Q8AL 1C1EH 1JWSA 2DAVA 1XGYH 2FYYA 3KGRA 1DUYA 2DQDH 3ILPA 4TPRH 1OTSD 3RTQA 3OR6A 1G9NL 3SOBH 1MI5B 4NZTH 3OWEA 1H5BA 1YNLL 4TOYH 2AABL 3S34H 1J0HA 5LBSL 1KPRA 1F90H 3H9HA 1XCQB 4E9LA 2HT2D 4K3DH 1YEFL 1U91B 5JORA 3T04D 3MO1B 1WTLA 2VLKB 4NNYB 2BCKA 5IJVB 4RGMB 3RWJB 3ARGC 1A3RL 1CXLA 1OHQA 1ED3A 4K9EC 1MUJB 5IQ9B 4JANA 1P4LA 5FO8B 4NJAH 1P1ZB 2WLZA 3QISA 5EU6A 1OF2A 1A3LL 32C2A 5EN2A 1WF5A 4HF5H 4DN3H 4LSSL 5TDPA 5LGJB 1JRHH 1CLYL 2BVQA 2P42B 1RK1B 2E27L 5SX4I 4GRMB 2HT3D 4OV6F 1AH1A 1XGUA 4X8XA 2XTJC 3MLZH 4HIEA 3VXOA 2QQQA 5F89A 3S88L 1XGQA 1V5JA 2FLBT 5HHQB 3HN3A 3QDGB 4CVZB 5J1TC 3QO1B 5KW9L 2Q3ZA 5EBWB 3VWKA 1IEBA 3QCTL 5FUCC 3LH2H 3LMJL 1CZ8H 3ARED 4X9BA 3RKPA 5I8KL 1UT9A 1P4IL 2DYPB 4PTUA 5CJBA 4GG6B 1HK6A 1RUQL 1RZKL 1INEH 4GJTB 4C4KO 1K8IB 5DLML 3QUMA 1OTUC 5FGCB 5CGYD 3UZQA 4Q6IB 25C8H 3AC0A 1ZGLM 2NNAB 4L8BA 1CN4A 3GSVA 3RIAF 4LU5L 1U8OA 1Q38A 3C5ZA 3LN4A 4OF5A 1IL1B 1QVOB 4HS6B 4OT1H 5DJ6A 2Q8BH 2GK0A 4S1SL 1XMWA 5DHVH 2YD1A 1EDQA 1OSZA 1RZJH 2YD7A 4E41D 3GUTA 4NP4H 3RVUD 4I4WB 4ZTOH 3WXWL 3BVNB 1NFDB 2BOCA 2R4SH 2DQTL 2GTZA 3OJ2C 4U1HA 1AR2A 4L3CB 4MS8C 3SGDI 5HHMA 4XP6H 3E2HB 1LEKA 1SMAA 2Y07L 1OSPL 1W0WB 3D1MC 3B2UC 1RUAH 2NY6C 4DEPB 2I5YH 4ZUSB 3H3PH 3L95B 5HYJE 1EO8H 4JB9H 3GSOA 5D8JL 4PJXF 5GRVK 3V6ZA 4F33B 1N4XL 4G7YL 4MVBD 3BKML 5IFHL 1R5VA 1TQBC 5T3XH 2YK1L 4P23D 1YYLH 3IU3B 3RWHA 1P6AB 3HNVH 1WZKA 3DSNA 4PP2A 2XQYK 3FB7B 4HKXA 3VRJA 3WKMH 4JO2L 4KK5C 4YPGB 2JJTA 5EC2B 1DBBH 1N6VA 3RBGA 4M61A 2Y7QB 2GT9B 2J5LC 5DQ9B 1BBDH 3WN5A 4JFEA 2NY2C 3RRQA 4UINH 1UENA 5DJZA 5DQDL 2GJ6E 1CE1H 4YUEH 2D0GA 1MRDH 4R6UA 3VXPB 1DFBH 1WAAF 2CJUL 5CAYB 1ETZA 4KJYB 1KCUL 2ZG3A 4G6FD 3N0PB 4UI2A 2VDLH 5F72S 1S5HB 1IT9H 2CMRL 4MNQE 5SV4A 4GW1A 1F02I 2BNRD 3HG1E 4JZOA 5EFIB 3VJ6B 1WT5A 3BZDA 3GIVB 2GUOA 1MFBL 2IBGA 3SDDB 3IFPB 3LDBC 3A6CH 4Y16B 3RIFK 2DMBA 4UDUB 1M4KA 5ID0A 5IV2B 2F8OA 1F58H 1LMKA 1R3KB 5T3ZL 4OFYA 4N68A 5FHBH 4HCRH 4I3RL 4QHUB 3ARDD 4YIQB 4ZPVB 5IB3A 4H1LB 2VABA 5CP3A 5C71A 4QWWD 4JFFD 2EH7L 3QUZD 2ZJSH 4WGVB 3KPRA 4L3ED 1NEZG 1FNEB 3MV8D 3SE3A 2DBLH 4M9PA 3VI3F 3PL6B 3Q0HA 5IEHB 1IKFL 5T1MA 4OGAC 5SWZA 2EYRB 1HSAB 1VEOA 4Z8FL 3K2UH 1AD9B 4MD0B 1VFOA 5DFTA 3S36X 3JTSA 4JVUA 4Q7DA 5E8OB 2HFFA 1J5OL 3PP3K 2R9HC 1AIFB 1X5GA 3IKCA 4LHUG 1TVDA 4XPBH 3ZHKA 4QTHA 1FL6B 1P7QB 5KVFH 3S5LG 2IF7A 4QOKE 1GYAA 2HKHH 3FO2A 4XNZC 4R0LB 3CUPB 3TZVD 2PO6C 2VDRH 4Y8DC 1ADQH 2B5IB 2R8SH 4H0HB 5C0EB 5AYUL 2BVOA 3PWPE 1U41A 4UTBL 4URTB 3V4PH 4MJ6A 5T1LA 5D71H 2HP4A 2XWJA 2XZZA 1Z9SA 3DX7B 2F19H 4JFHD 4MA1B 5FA4A 4C56E 1F6AB 3SDCD 1JHKH 4K94H 3SJVB 4U1KB 4QXGL 3K8KA 2RJMA 4WI8A 4J3SA 1G9NC 4OSUL 1RHFA 5E9DB 3MBEB 2W65A 1KT2B 4FTVA 3VI3E 3AAZA 3MZTA 5ANME 4GS7B 1YNTB 1IZKA 4M8VA 1CDBA 4HLZG 4LCUA 2BXZA 5TE7L 4LVOB 1M05A 3W2DL 4N8CH 4DGVL 4HBCH 3GSXA 2X4QB 2P48B 1T22B 4DZBB 1LNUB 5CEXB 2ADJA 1XR8A 2WP3T 1I9RL 1HHGB 1HIMH 1MELA 3RWDB 3RVWD 2PNDA 4YBLC 5E56A 4WW2C 4WFHE 2A83A 5KVEH 1OQXA 2MHAA 4X7TB 2WQRA 3RKDD 4K7FA 4S2SA 3OHXB 5CJXC 2FJGA 3DROB 3QIWD 1DSFH 1DANU 4J3TA 3K74B 3EOBB 4YDVB 2X4OB 3PDDA 1QLRB 2CDEB 2CDGB 5DD0L 2DTMH 3F7YA 2H32A 4HIXH 1A1OB 4HKBA 4KKLC 2V7HB 3SO3B 1JGUL 4Y4FB 4NKDA 4LEXH 1J88A 4YK4B 2XRAL 3TFKD 1N5AB 1OTTD 1FP5A 3NFNB 1JE6A 1RZKC 3FN9A 5GISL 3H9SD 3OKEA 2RHEA 1FBIL 4LLMA 1UQSB 3TPKA 3MRMA 1AE6L 2ZNXA 4XVSL 5T1DH 3X11A 3E6HA 1B0WA 1I3UA 1LD9A 1RPQA 2FBJL 4WI6A 4TULL 3BEWA 4HK0A 4X80H 2J7LA 4U6YB 4H88L 5J11B 1OGAD 2ZSWB 4YC2B 4PYHA 1HKLL 2NY5L 3E1F1 1KIPA 4PJEF 4ZFOA 1P4BH 5JHLH 4HW6A 3BPOB 4I3GA 1U8MB 4RGNC 4EXPX 1TVBA 4FQJH 3LZFL 3GMPA 3EYFA 2ICEA 2DQEL 4HMEA 4U3CA 1BOGA 3DMMA 3WYRA 1JGEA 4I0PC 4Y19D 4Q0XH 1YEHH 2V5YA 2VXVH 1J0JA 4M7KH 4PRDA 4QXTB 2R56L 1KPUB 5HYQA 3L3KB 4NOFA 4FQXA 4FNLL 5DTFB 3EO9L 3WFBL 5B21A 3G08A 3MNZB 2R1YA 2L7JA 1RMFH 4LLWA 2XN9B 4K3EL 4XP9H 4KZDL 5HHME 2YXMA 4JO3H 2JIXD 3U7YH 1UJ3C 1MREH 2IPKB 2OBGA 2ICCA 1BFOB 1A9BB 3R4DA 3MGTA 3O6FD 1SMOA 1S9KC 3GSRA 1JTTA 4F7CA 2QR0B 3TBTB 2VITB 4UB0L 2APXA 1MJ8H 3DVFA 4AZ8A 4OD2A 4CKVX 3ALXA 4YHYB 3KJ4B 3BQUD 2E7HA 4F3FB 1S9XB 4P5KB 5C9KA 4HIIA 1J9CT 1GSMA 5J1AA 1PYWA 3X3GL 1K3ZA 5CSZB 3B9VA 4PJ7B 4YPJA 3EFFA 4JFEE 1BIIB 4NKIH 4O2CB 3GK8L 2M2DA 4MX7A 2VZVA 3DHJA 1SY6H 4YNYA 1PSKL 1KIQB 2EECA 2WM0A 4ZFFA 3W9EB 5FB8A 2VH5H 2BSRA 1MJJA 3LKPB 5GGUA 3WUWB 5C6PB 2NY0B 3ZE0F 2Q3AA 1ZGLA 4FP8H 5IB2B 3ZDYE 1QLFB 1Z3GH 1JVKA 1IC4L 5FEBA 4PLKD 4U7MA 3U9UB 3KDMB 4Z78B 4M3KB 1XH3A 2HJKA 4FQ2L 4JGUA 4M5YL 3HE7D 3FO9B 3ESUF 2J4WL 1K4DB 3LCYA 4XT1C 4KHTH 1KTLA 3E8UL 4PLOB 5DWUL 3HZVB 5GS1C 4KTDL 3U7WL 1OM3H 1U3JA 5H35B 1ZVSB 1GOFA 5BOPA 4KJWC 4MDJB 5F9DC 1FFNA 1NBZA 4JEGB 4TNVK 2V2TB 2FL5B 3KPRE 3MRGA 5FYLE 3TNNA 1TCRA 2AJZB 2FR4B 5BZWA 1CIUA 5I1CL 2YPVH 4ONOA 4HLZH 5CEZH 3UTOA 1CLOL 4BSJA 1PLGH 5JW5A 5SWZE 2VN4A 2APTA 1S7RA 2Q7YA 3MNWA 5B39B 3HNSL 4RMQA 3QEUB 3QJFA 3FTGB 2FBOJ 4X6EB 4XB8A 3EYVB 1XF2A 5E94A 2OI9C 4XBEH 4XC3H 3DXAB 2Y36L 3F7QA 3JWDC 4KUZL 1QSEB 2PW2B 4OUOA 2R4RH 2R2HB 2X4UA 2A38A 1S8DB 3FFCD 4NHUA 3MLSL 1G7MB 4ZD3H 5MEPB 3OAYH 2HG5A 1UM6H 5D7SL 1T66D 4ODXB 4LPXA 4LK4A 3QDJA 4KQ3L 1FNFA 4ALAH 4P2QA 5D1ZA 5AZ2L 3BKCL 5C0GB 4NM8H 4EBQL 2NMSA 3D18A 3AU1B 4FG6C 3K0WA 1X5IA 4ZS6D 3CX5J 5HDBE 2XIDA 4ZFGH 3O8XA 3QRGH 3TA3B 2EDDA 4RMVA 4KH2A 2PYED 4J6RL 4D0CA 4X4ME 4FXKB 2ARJB 5LXGL 4GBXD 4K07A 2G5BA 1ZVYA 5TDOB 1W0VA 3V0AC 2PCPA 3TVMA 3VFRB 4M3JA 3NN8B 5T33H 4YHIB 3H9YA 1NFIB 4JM4H 5E5RB 2X7LB 3VFGH 4JR9H 3CZFA 4Y4HD 4W70A 2XKUA 4S0UC 1I1AB 3GI8H 2MQCA 4LEOA 4BSVB 3FQWB 2FX8L 1FHGA 1YEJL 5DVLA 5BMFL 5D2NA 2HWZH 4HC1H 4PG9A 2A9MH 3KPMB 3GMLA 4V2CB 1HILA 4L4VA 4WRLA 4NQDB 5HYFA 1UCTA 5TQ2L 4PJDF 1MFEH 2BDNL 5EU7C 4NUGL 3WJLA 3MTRA 5GS2H 4OLZH 2Y1VA 1JFQH 4XBGA 4N0YH 3T0VA 1OAZL 1VACA 5C0RH 4BELD 3H2WA 3MRRA 5DJ8A 2OM5A 1NMBL 5DJCA 3RWCB 1SJVA 1U8IB 1EEZA 1L4IA 3RIAK 4X6BA 3BUYA 4MQTB 1E4KC 4L29A 2YOCA 2HKFL 5I1AB 4YFLI 1S7TA 4GKNB 3L3GA 3IGAB 2Y4SA 3SE8H 2FZ3B 4RFEA 1TPXB 1FL3A 1MFDH 4NQCA 3JTTB 3T0EA 4LSUH 1SYSA 3RNQB 4Q97A 1WV7T 1GRWA 3BH9B 4Q9CA 4IMLA 4KKAC 1F3RB 4TVPD 5LAXB 5ECJE 3G5XA 3CX2A 3RNKB 3TN0A 4PJAB 3TM6A 4DK6A 3TH2T 2APVA 4D9RE 2RBLA 3RP1A 1UC6A 3QWOB 3WLBA 1IFHL 3KVQA 5CLTA 5T1KA 1CXFA 2NY5C 4NM4L 5F96H 4PDCE 5JLZB 3BHBB 5HDQH 1UCBL 1CFNA 5D7IB 43CAA 1YY9C 4G8EA 4ORZC 1VPOH 4LAQH 4KMQA 4OLWL 5DVOA 1E4XI 2CQVA 3P4MA 4HS8L 1AP2A 5I73C 3QYCA 2G75A 4PRID 4ZUWB 3C5SA 4OZFH 1QACA 2B7DT 1L7IL 3FT4B 1EMTL 4NNXA 4LLVA 1EVUA 5JW4M 5L2KB 1JPGB 1S78D 2ATPA 3ZDXE 4OI7A 1LO2H 3DRTA 4X7SL 1A7QL 2PF6A 5FIEA 2A1WH 4APQC 1LE5A 2GIYA 4M4PA 4UUJA 1N59A 1YMHB 3EYUL 4LGRB 4RA3A 3O9WD 5JXED 5LGHL 3DO7A 4LCWD 1FRGH 2OJEB 3MLWL 1VEPA 3HUJA 3NZHL 2VQ1A 1ZA3B 1CD9B 5TF0A 1RIVL 5IMOA 1YMMB 4PRNA 2GITA 1N6UA 4GW5A 3NIFF 3ARPA 3P0YH 1OWRM 5D6DC 2FIKA 2NXZD 1G1YA 4HV8B 4UIMB 3ILQD 3C8HA 3QXAB 5J56B 4KMTL 2R69L 2Y6SC 4M6OH 4PJIB 1EO7A 3FL7A 1D6VH 4WFGD 4Z7VF 4K7PH 4X99A 3BYYA 5IW6A 4KI1A 5MHSD 2QSVA 3QIBC 1EFXA 1RZ8B 5HHVL 3U0WH 5E08H 1NGQH 1AC0A 3KLSA 5F3BA 1CLZH 5GGSY 2CLZB 1IAKB 4PJHF 4U1JA 4OBRA 2EXWC 5E8NA 3CH1A 5KSBA 2P43B 2LE9A 1NH6A 5DUPH 3ULVE 3OR7A 5IW1B 1IILE 2XTLA 3GBML 4UT7L 2X09A 3LKNB 4UZGA 5DHVA 2GY5A 3LS4L 5DYOB 2IANE 1T1ZB 3JV6B 2HTKD 3MLXL 3PWUB 2HFEA 4EI5D 2VDML 2DIJA 4DFHA 2AJUH 4XNXH 4EZMA 1DQDH 3MYJB 1A7OH 3DVGB 3L7EB 1A4JA 5C8JB 5J12C 4I9WE 9CGTA 1PX3A 5CZVL 1ITBB 3SDYH 4JVWA 1PY4A 3NMEA 1HI6B 5D6CB 1JP5A 5DZLA 4JRYB 4PJCB 1X4XA 5CZXC 3C6LA 4OAWB 1I8LA 3EUUA 4G9FD 1F5WA 4QRUA 5HHXL 4O51A 5DHYA 1ZLSH 4C59B 1D5MA 1REIA 2P5ED 5IESH 1CICD 4LOUD 1MJUH 1X5XA 5F7EL 2VZTA 4XPFH 1TZGL 5L0QB 4YQXL 2GJJA 2LFGA 4NQVB 1BX2B 5IJKA 5TFSL 4UBDC 1KB5B 4AEHL 2NR6D 3FT3A 4IRJA 1KJMA 1XT5A 3MCKB 3MPCA 4JLRB 5I71C 3QZWA 2NY4C 1U8QA 1KGCE 2JCCA 3VDCA 5D96C 3LN5B 2JJSC 5B38B 1U36A 1BZ9B 4U1MA 1VKXB 3QI9D 5C0AB 4B7IA 4NSKA 4NHUE 1AI1L 2OTUA 5I19L 4A2MA 3PE9A 1PG7X 3BO8B 1NMCB 1JZ7A 4UIKH 4WW2F 1FC2D 5GS3A 1HXMA 4LNVA 4RWYL 2O61B 1FLRH 4P2QE 3SGJA 1JUFA 2VSCA 1CR9H 2WAHA 3GO1L 3CCHB 2WQ8A 3RVVD 3CDYA 2HT4C 1N5YH 1DCLA 4ELKB 3BOVA 4Y4KC 1XCTB 1WZ1L 4QT5B 5FA3B 3BZEB 5C09D 4O02H 2Z9TA 1JTOA 3DRQA 2PTUA 3IYLW 3MRLB 3KYNA 2DQHH 2QKIA 2Y72A 4OLYH 3A6OA 4Y5YB 1U42A 2X4SA 3BKJL 3BGFB 4F7EB 2YUVA 1RU9H 1WCBA 3VXNA 2BHUA 3NOIA 5E8PA 4PGDA 1H0DA 1QFWH 1S9WA 5IVZA 1G7IB 2DICA 4MJ5A 4YDIL 4LHJB 1D6EA 4YDJA 5D2NE 4WWKB 1DVFA 4MD5A 2XA8H 1NANH 4KUCF 4L4VE 5LVEA 2BNUA 5BOZG 1RIUH 2V5MA 3QEHA 1U6AH 3KHQA 1O7VA 5DURB 1EJOL 4P2OC 2PTTB 3NAAH 3I6LD 1VFAA 4DKDC 1HHHA 5HYJB 3MBXL 4GKZA 3WE6B 3SBWA 4TRPH 4ODSL 1A6TB 1CT8A 4XZUB 3S35L 4RX4A 1S9YB 4R96A 3WO4C 2XV6B 1MCFA 3ROOB 1T5XB 1Z9OA 3MODL 3K4AA 3THML 1FN4A 3NBNA 1KSRA 4LCCB 4NJ9H 1YC7A 4KTEL 1ADQA 3KXFA 3GKZA 4YWGH 5BW7C 1AO7D 3QIUD 4WI9A 1LK2B 4NRYA 2FB4L 2ZNWA 4NN5B 5L8LB 5D93B 3MLTA 3E3QA 2R0WH 2R2EB 2UY7A 3STZB 4MHHG 4PG2C 4NQCE 2BVUA 1I7TA 4KI5C 2EDXA 3LS5L 3MCLL 5C0ND 4XCEB 4WJ5A 3SGEI 3UZVB 2B20A 5I1EL 4Q2ZB 2DN7A 5KS9A 4I13B 1F3JB 4WFED 2QEJA 2VDOL 3WHE0 3AS3A 1K6QL 2VXUL 4OF0A 4MNQB 4CNIB 1AKJD 1EGJL 5EOTA 4XPAH 5ITFA 4UQ3A 3HZYB 4N9OB 3C2AL 3P77B 4OZGA 3FMGL 3ZL4H 1I3GL 3CMGA 2GI7A 3IDIA 2VERN 1M7IA 1JNJA 1FZJB 3D2UD 2NW2B 4JFPB 4Y89A 2O5ZL 4XWGL 4KGLA 5IB1B 1QKZH 4D94A 3SEPA 2ITCA 1GGTA 1PVHA 1MNUH 5L6YL 2DBJA 3ARRA 2AI0H 5EWIL 3C8DA 2QBWA 4HZLA 4LVHB 3FO0H 2CIIB 4PJXB 2HLAA 3D0LA 4RSVA 3MRCA 4Y2DA 1FAIL 1AXTH 4R3SB 2Z31B 2DD8L 3I6KB 4YH6A 2F58L 3HMXH 4QRTA 4OTXH 3I50L 5AAMA 1JI1A 4G6MH 2VB5A 1XF4B 3IDJB 2VXSH 3QWRD 1SBSH 2KQMA 3IB4A 2AJVL 3F5WA 3PGDA 4D0DB 5C0JB 3W5MA 4LQFH 3DYMA 3MR9B 1CG9B 3VXMD 4M6NH 3TCXA 1GGUA 1KTDA 4Q6YA 3HE6A 4YAQB 4GAGL 1MHCA 5LG1A 3BT2L 12E8H 1JHTB 1M71B 3B9EA 4CVWA 3DTXA 4NO3A 4H26A 5ERWA 4P3CL 4QCIA 5JW3L 1WLHA 1J8HD 3QUYA 4H5SA 2IBZX 3BIKA 5FO7A 1Y0LB 4NQXB 1ZVHA 4OQTL 4QEGA 4G5ZH 1IGJA 43C9A 4Z77A 4KQ4H 3ARBB 3ZYIA 4QYOA 3PWPB 2CK0H 3VD3A 4QRQB 3B5HA 4WO4C 5EA0L 2C3VA 4J4PD 4WUKL 4G80A 4LSQL 5KSBE 3HMWL 3I3EA 1CGSL 4JDZA 1JV5B 3CFDB 5T5FL 1CVSC 5GGVH 4EUPB 1HNFA 3S37X 3VFPA 4F7PB 3WFDH 3SDAA 5JMRA 3MLYL 1N64H 5HVHC 1CBVH 4HX1B 1FV1A 2A2QT 2J8UA 1XGPB 3MV11 5JA9A 2C5DC 3SPVA 3IU4H 1GVIA 4JREC 5TDNB 5EZOL 4PP1C 4R7NA 1NBQA 1X6NA 3HCVB 4ZTPH 1P5VA 4IRSB 2Q76A 2EE9A 4GRWF 1IM9B 3ILPB 3BI9X 1CQYA 4R26H 3VXQB 1UB6A 3WHE1 5T3ZE 2C4XA 2D7PA 2OL3L 3F7VA 4G9DB 1NEZA 1H15A 1UEYA 5TF1L 3U2SA 1M6OA 5ICYA 3V0VB 4G8GB 1I1FA 3CVHH 4PRBA 4L9LB 4NPYB 1MCCA 5I76B 4JM2C 2VO5A 2C1PB 5IHBA 5IP4A 3TIEA 2IGFH 2MMXA 2ATKA 2CSPA 1MLBB 1Q8MA 5I30L 5ICXB 3KWWB 2NZ9C 2IMNA 4YE4L 3H7BA 4XTRC 1JN6A 4HIHB 4IHOB 4ZXBC 3FB6A 1FPTH 2EEDA 4HWZA 3EDKA 2C3WA 4LHUA 1QBML 5D8JH 4M5ZL 1J1XL 1VADA 2GAZA 1SY6A 1JPSL 5TDPB 1GH7A 2O5XH 3S5LA 2FX7L 4GMTH 4HKZB 2X4RB 2LU7A 5F7YC 1R3HB 2P5WD 5KSAB 1F8TH 2JCCE 4X8JA 3VXOB 1EEUA 4AMKH 1F4YL 4XCYB 3ZLQC 2LAAA 4WW1A 5I6XC 3RUGF 5DJDA 1FVDB 1CXKA 2IQAB 4U1GC 1BM3L 4RMSA 4TVPH 4PJ5D 3I2CL 5DF0A 3RZCD 1DBMH 4GUPA 5TJWK 1XZ0A 5T5NG 1JF6A 4KK6D 3LKOB 2JELH 5I18H 3EOYG 4XMKH 5EUOF 3F12B 2DQJL 1UA6H 4BFIB 4M62L 3N1FC 4GRWE 1AHWC 1ERNA 5FM5M 5IROC 4FOMA 3L3DB 2OP4H 4HJ0D 1FG2B 4NN6B 4GSDL 1CL7I 3T3MF 4IOFD 3VI4F 1KBGH 5DMJB 3ESVF 3UTZB 4JQIL 1YN7B 4TTDC 3SCMA 2IH3A 3MUHL 2K1MA 4L8DB 1S7XB 4Z7UA 1BLNB 3LSOB 3L5JA 2DB8A 4R2GC 4JPKL 2HJFB 5ITBH 4PS4H 1U8KA 1JZ8A 5GRJH 1XIWC 4DN4L 2XKNA 2B8OT 3N85L 1FCCA 1A14H 4L8SC 5ISZB 2FGWH 4LSVH 5DD5H 3WL9A 4G6KL 5I8OH 1MRCL 1NCWL 2V6HA 1QRNB 4U1HB 4JPWL 1F45A 4PJ9D 2GFBB 2NYYC 2FD6L 1C7SA 4MXQD 3EGSB 2W92A 4J8RA 1E6OH 2VLMD 3CK0H 2LTQB 1EUTA 3WLWD 4I48B 2Z91A 4YHZL 4F80A 1DQQA 3V5HB 4HIJA 2WNGA 3LEYH 4AIOA 1F4AA 4Z7WA 3EHBD 1UKSA 5HVFB 1HZHL 3KNBB 3HPLA 4KV5E 2ENYA 2YMXL 4MCYB 1C12B 1MY7A 3KXFE 4OIIL 1FGVL 1E28B 1RJYB 3AREA 1TZHB 3C60B 1R3IH 4JFEB 2VAAA 5ESQA 1U3YA 5E8EB 3E3QE 4BJLA 4LSTH 1NUNB 4YHNB 1Y6NR 3P30H 2DJ4A 3ZO0A 3C6SA 4M1GH 2E9JA 4EIGB 4YGVA 1DE4B 4OJFL 3RDTD 1KCRL 2RFXB 3BEVA 3GSQA 4PJEB 5CKGA 1HH6A 1IGFH 1MCWW 3JWDH 4XCFH 4BUHA 3ULUC 3BH8B 5KS9E 1MJ7L 3T65A 4HWNA 4PJFA 1LO4H 2D7TL 2WWKO 3HR5B 3ULSB 3VA6A 1CDGA 2V9TA 5E2TH 4OZGE 4ZSOA 1G7LA 1S5IH 5DEGA 1ORQB 5D1XB 2YBRA 4AT6A 5BS0B 3PWNA 4WNQB 4KROD 3TJHC 1MQKH 4E41A 4OGYH 1P84J 4PUBH 5TQ0H 3MGOA 2J6EH 2XNAA 3EDFA 2EDLA 4WHYH 5AZEH 3HZMA 3AY4A 1NC2D 2X2YA 2R1WB 4X4XA 4JN1L 3WNLA 1FH5H 3WFHA 4HGWB 5I1LB 4G42B 4OD3H 4UV7H 1TJIH 4M8QB 1ULVA 4PYGA 3SKNA 5DI8A 1NAMB 4O5LH 4N5UA 3DSFH 4X4ZA 4MVBA 4U1SB 3T08A 3ZKNC 3RGVD 4MQ7B 5D7KD 4P23A 1EERB 4EQ2A 5BV7B 4ZO9A 3O2VL 5I15L 2HRPH 4DQOL 5DD6B 1OCWH 3DURA 5EDXA 4FFZL 4XCNB 1MWAB 2XACC 3KPSD 1I9IH 1VGEL 2ILLA 4OFVA 4PJBA 3AXLA 3ZHDA 5JPNB 3BP6B 3SKMB 1U8LA 2YA1A 5C6WH 1KCKA 4N1CA 1RURH 4OKDA 2B2XL 5KG9A 2Y23A 2OSLA 1KCVL 1NLBH 2EIEA 3QG6A 1HKFA 4M9OA 5BZDA 1MPAL 5FKAA 3RJQB 1JNNL 3WFZA 1ACYL 3UXFA 3UPCA 2BNRA 4HDIB 3MXWL 1JNHB 3F7PC 5DC0A 3O6KL 5D5MA 3UZEA 4OCWH 4JKPL 2CLRB 4TSBL 4MNHB 5HDLA 4HMDA 3VRIB 4OZFB 5GJTH 3C9NA 3O41B 4KPHL 4MAYD 4WUUB 5B4MD 3ARDA 1AQDB 5E5MA 2J8UE 1QSFB 3JVGA 1HEZA 5F7DA 2EDRA 2UYLA 4UT9H 5B3JE 1JI2A 2YPLD 4P3WA 1ZLUK 3WEXB 4D8PA 4JFFA 3V6FB 5I1JL 4Q9QL 3QUZA 1BVKB 4GRLD 3TV3L 3VXSE 5IFAL 3MV8A 1V05A 5DS8A 3SGDH 1JPTL 3IXAA 1LO5A 3MRQA 1LHZA 1WK0A 4IJ3B 1T7XA 4M7LH 4IDLA 5F7UA 1K4CA 4ODBD 2W59A 1MAMH 2EDOA 3UROR 2FECL 2X1QA 4A6YB 5EZLB 5ENWA 2AXHA 3FFDA 3IDNA 4DCQA 4X98A 5D2LA 3GSNL 4UILL 5EB9A 3MA7B 2WIIB 2AXGB 1YUHB 4ESKA 1YEIL 4P3DB 1KEMH 4HXBL 4OBSA 3I6GB 2VISA 3CXHJ 1JZ6A 1TTUA 2DLGA 5L7XH 2X1PA 3QQ3A 3GHEL 3VFMA 2VDPL 4OCSL 3ARGB 1FNLA 3QH3A 1ZE3C 4JO1H 3G6JA 5FOBA 1IBGH 3TZVA 1A9EB 1H3TA 1IAII 1JNLL 2X9XA 2DM4A 3OKMA 4LPYA 5F6HJ 1U3HD 1HHJB 1OAKH 4R4BA 5D1QA 1FGNH 2XTJB 3KPPA 4YX2H 2P44B 3SDCA 1IC7H 4OFDA 1N6QH 1FVCB 3V5DB 3CXDL 5JNYA 1R3JA 3NCJL 3QP3A 1YECH 4X6FA 3ZYOA 3QEQD 1B88A 3GJEA 1MCKA 1LVEA 3MV9D 4BQ6A 4X4YA 4PJDB 3MLRL 2PR4H 4WU7A 4LPTA 4DKEL 4KDTA 4HS3A 4NC1C 3L3IB 4UT6H 5J6HA 3EYOA 1JGDB 3MJ6A 2DWEA 1VFBA 5DFVD 4F15C 4X6CA 4KI5F 4G3YH 1U58A 1A6ZA 2EKJA 1IARB 4NRZB 4DOHE 5I1HH 1T03H 1KJ3H 4HHAB 3QXTA 3VA2C 4PRAA 2FWOA 5A3ID 4Z7UE 4FMFA 1JRHI 1FZOB 4XGZA 4EXKA 1DDHA 2HTLD 4B5EA 4PY8I 2AV1A 5CMAA 3U7WH 2P8MB 4Y16C 1JL8A 5IG7B 3QO0B 4HUXB 2ITDA 4FQXB 4OFIA 4ODUB 4FQ1L 4W6XB 3QIWA 3Q6GH 2G2RA 1Q9OB 1OW0C 1SBBA 1A3QA 1B4RA 1DUZA 1RZIB 1ACZA 4X9HA 3KPLA 1QQDA 1MFNA 4D9LL 3MGTB 1GGIL 5C0BA 1NBYA 5CHNA 4FZ8H 2V5RA 3IJHA 4Y5VA 5DK0A 5BXFA 2NY6B 3TFKA 3U36B 1KOAA 4Z7WE 4M1CC 2RCSH 5CINH 5HD8D 2DOCA 3H9SA 1TTGA 4PY7B 5IBUB 2DI7A 1MI5D 2WWKT 3HC3H 3OPZL 2YKLH 1TQBB 3PL6C 3QHFL 3WSQH 3X12B 3B5GA 4NCC2 4LKXA 1EV2E 4XP4H 4ZAKD 4MA3A 4I77H 2XQBH 4JFXA 2MPAH 5HI3D 5ADOH 5KSUA 1OGAA 2J5LB 4YXHH 1K8DA 4B7LA 2NY2B 4ODWB 4HWEH 2WK2A 3MUGB 4YHKL 4QO1A 2IANB 5B22A 3OX8B 4S10A 2PW1A 3N1MC 4JFDB 4JY4A 4X0KA 4UQ2B 4P4RA 4PJFE 1G7QA 5F9OL 1BGXL 3G5ZB 2F8XC 1RD6A 3WS6A 3KYKL 1JMZA 4ZSOE 5FCUL 3B8SA 3G5YB 3U46A 1E0OB 5CBEA 1M7DA 5BJTA 4F9LA 1EHNA 1UACL 3DUSB 3BWAA 1OPGL 5GSVB 3NTCH 4KK8C 1RIHL 5EZIL 2YUZA 4E41E 3LDBB 4D9RD 3QDGD 1SJEA 2D31A 3S4SG 3KLAB 2Z93B 5EU6D 1I4FA 1R24B 2VE6B 4HJGB 1FAKT 2JIXA 4BFGA 2O5YH 4Y1AB 2VC2H 2DYPD 2ARJQ 1FFNB 2Z4QB 1KNOB 3O6FA 3VFSA 4ODVL 4NYLA 4X9IA 1A7NH 3VWKD 2H3NB 4H8WC 3OAUH 3FONA 1DN2A 4FZEH 2QQKH 5CJOH 4Z7VB 1FE8L 3SKJH 4AYFA 2MSPA 5JUEL 4ZPTB 3QJFB 3BQUA 1Z5LB 1IQDA 1B4JL 5J6GB 4PJHB 1BFVL 4NO2A 1Z9MA 4PJBE 5JIKA 4RMRA 1F11B 3VG0H 4XAWH 4PRHB 2JE8A 2Z8SA 2EDJA 1DEEB 4ZODA 2AEPL 3HNTH 1X4YA 4JM2F 3U82B 3P2TA 4OQTA 2JB6A 3OMZA 2IH1A 3QCUH 5K9KA 1A6AA 5FV2A 2ZUVA 1K3IA 5CP7B 1LILA 1BQSA 3U9PL 1YQVH 1B2WH 3V7AG 1T3FA 3ARFA 2BNRE 4NKMA 2ZCKL 4BQCA 2ZCHH 5DJAA 5FGSA 3PP4L 3D9AH 3ES6A 4HPOL 4BZYA 5HHOA 2WW8A 3HE7A 4XNZB 5DRZB 3UYOD 5D5ME 2PO6B 2ZG1A 5D7LB 2PCPB 5I16B 3SO3C 4OZIF 3C2SA 3STBA 1RZ7H 4U6VH 4RAUA 4LHQB 3FN0L 3PGFH 3QXVA 2AKRA 4LOUC 5FYJD 3VFUB 1YY8A 5HYSG 5KSVA 5LWYL 4L8CB 4P57A 2CGRL 3L7FB 1P7KA 1GHFH 1KF9B 2CKBL 4P99A 3DETD 5I17A 4K3GA 1WBZA 1H3VA 4JFFE 4L5FL 1I8IB 2V2XA 4PLNC 1ONQA 4HK3J 5EO9A 3MV8E 1G6RL 2NR6C 4LVNC 2OL3A 4OGXH 1FNGA 4IMKC 5DJXA 5IMKB 1U95A 1PG7W 5CSGA 3VE0B 1KFAL 4YC2C 1NCTA 4BSWA 2LVCA 2P1YA 5IEKB 3B9KC 3D69A 3UYRH 3QG7L 5C0IA 2WZPD 3MFGB 1A7RH 2I25N 5D2LE 3SDDD 1AFVH 1UM4L 4E5XB 1C16B 1CD0A 2W9LA 3RPIA 3UBXB 4AY0A 3FFCA 2GEEA 3W82A 4YJZL 4HH9B 4YBLB 4WW2B 1OP5H 4PLJC 1D5XB 1ZGLP 4CMMA 4PTTA 3UTTA 5KVGH 4N5EC 1AXSB 4HUWB 3U48A 2YD2A 5CWSB 2CDFB 2DWDB 3G6JE 3QXUA 3ME0A 1MOEA 2B4CL 5C08D 1Q9WB 2C26A 3CJJA 2PYEA 1HXYB 1J1PL 4OFYD 3T8XA 1SJHB 4FQHB 4GBXA 2A6IB 3ZMRA 5EOCH 1JWMA 3LIZH 5GZND 1BEYH 1CVRA 1C5DA 1IKNC 4JJ5A 5H2BA 1FLTX 3V0WH 3WNOA 4PREB 1Z0NA 1Q94A 4ZUUB 4JFHE 4Y4HA 3QFJB 4FXGA 5FYLD 5IBLC 4ZMAT 1FCGA 1ZS8B 4KVCL 4NZUH 3KJ4C 1F4WL 5I1GH 4NZJA 1F2XK 2VL5A 3BGMB 4TTGA 1BMGA 3CVHA 4OCXL 3WIHL 3V6OA 1NAKL 3L1OH 2A9NL 3O2DH 5MERB 2XICA 3MLXH 5DR5H 2VIRA 1H9VA 5J89A 4X6CE 1QA9B 3GBNL 3NA9L 3OZ9H 2EIZA 3FQXB 1N3NA 3GB7A 5ESAA 2H8PA 5CD3B 3PABA 3ULUF 5DT1H 5KANI 3LHPL 4RGNB 2PTVA 2BFVL 5JZ7C 5C0CD 3MJGX 2HLFD 2VXQH 3QIUC 1WEJH 3NCMA 3I02B 5E24E 1TJHH 1G9ML 3NPSB 3GKWH 1CDIA 3EOTL 1UADC 4I0PB 1T0PB 1QEWB 3DIFA 2MTPA 1QHOA 2X10A 1Q1JH 2X1OA 4QF1A 4X5WB 5FYKD 5LGKA 3IF1A 1U8NB 2F5BH 3PHQA 4MA7H 3OTTA 5F9JA 2H9GB 3MBED 1MAKA 5KOMC 3IFNH 1Q9LB 5IVXF 5C0BE 1K5NA 1X6LA 4PBXA 3CMOH 1UJ3B 2EXYD 3DX9B 4AG4H 2X70B 4LSDA 5EC1A 1T6VN 1JMXA 3H9SE 3WKNA 1ZV5A 5IW6B 2XPGA 5F7KC 3ZT5A 2W38A 3FQUA 4OQ1A 2VDNL 2DLIA 3RWIB 3Q3GA 3FOLB 2XZCH 4AQOA 4FTVD 1WUNT 2D3VA 1QBLL 3EO0A 2AQ3A 5JW4R 3MROB 1JZ2A 4MWFB 5ALBL 1T1XA 3PDOB 1AJ7H 1LO3L 2WUBL 1OGAE 1A6UL 1N7ML 2EICA 5FKPB 1GL4B 3D87B 4AL8H 4ZFZB 1Q0XH 5L2JB 2JJUA 5INCB 3DHMA 1JK8B 3MRKA 4MXVF 1NDGB 1QYGL 2DQUH 1I3RB 5SWSA 4U3HA 3M17B 4JN2B 4PB0L 2H26A 1CU4L 4QHLB 1YJDL 5HI4D 2CUMA 2ESVB 5ETUB 2J88L 4D0BA 5IB4B 2G60H 4E0RA 4Y19E 2OLDA 5D7JC 5CIPB 4QTIL 1TXKA 1OGTB 2YRZA 3O9WA 5JXEA 4LCWA 1BQHG 2JLLA 3CDGA 1GC1C 5EO0B 2YSSA 4CVXA 3NCEB 3QNXA 1BF2A 3MOAL 2GSGA 1A6WH 3ROLB 1ZA6A 3BN9C 1ZHKB 2A6DA 5EIIB 5IOPB 1GCFA 4WV1A 3TO2A 5EBGA 5GS1B 3V52L 1YEEL 3PUCA 1ZHBB 5KVDH 5IHLB 4F7TA 1DTUA 1U2HA 3O4OC 4XP5H 3SDXA 2V2WB 1I75A 2W0FA 1UM5H 4WWID 3STLA 4XWOC 3TJEL 3KR3L 1TETH 3SO5A 1GZQB 4F9PA 1DQML 3FT3B 4J4PC 1FJ1A 1V8HA 4AIZA 15C8L 5I1IH 1RJZA 1MF2H 4JG0H 4JFOB 1H3PL 2EDTA 4TSAH 5E2WL 1WIOA 5FUZH 3D25B 4IDJL 4X83A 4JHBA 1GGBH 1H8NA 5DD1H 3C08L 1UG9A 4AH2A 4S1RH 4U1MB 2GHWB 2BNQB 3U4EB 2NXYD 2OI9B 4LSPH 3NGBC 2FB4H 4G7VH 5E00A 3JBG7 3L9RB 4MLIA 5CGTA 1RJLA 4K71C 1ES0A 3F65A 5EU5B 2I9LB 3VD7A 3IDMB 4EI5A 3WCYA 3BYTA 3DMMD 2XN9D