3WS6A

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
273
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws6A01
3KPRD 1L9MA 2C3HA 2NW3B 3BH8B 4HWBH 3ARXA 1G7LB 2EDEA 4Q9RH 4L4VE 3VE0A 1UWXH 2PR4L 3WSQL 3S34H 1IM9B 3D85A 3MRPA 2Y72A 4OB5L 3RGVA 1ZVSB 5E1AB 4JM4L 3C08L 1Y18A 1V3KA 3C60B 4ZFZA 5HVHC 5E9DD 3X14A 3MODH 1BJ8A 2HLAA 3WO4C 2BMKB 5E2VL 3CFEB 2BXYA 4OFPA 5ANMA 5HDQH 2CK0L 4BSVB 2DI9A 2F8OA 4ZXBA 1JIBA 4EI5D 3PWNA 4ZNEA 1Q9LA 4WRLA 4NQXA 5J6GA 4HGMA 4JN2A 3KPSB 4WU5A 2VZ1A 3MROA 3HLAA 4N90D 3MSPA 5ADPL 1IAIH 3HZMA 2P1YA 4NOBA 2XZQH 2NR6D 2DJUA 1NEZA 5C09E 2F54E 3IJHB 3SCMD 4EN3C 3GMLA 2HJFB 1CLZL 4LLDB 1HHJA 4PJ8D 2ZP0T 4XP6H 3N1GC 1IFHH 1N0XL 1B2WH 5CUSL 1N3NB 5MI0C 2VN4A 1OY3B 1XF4A 4HC1A 1TJIL 4XBEL 1IQDB 4UINH 1QFHA 3UTPD 4LARL 3QNXA 3EDEA 1A3RL 2D03H 4QRPD 5IR1B 4WEUD 4JO3H 3RBSA 2BVPA 4K8RD 1Z0MA 3RZWA 3MREA 2QEJA 3MLTB 2WWMD 4U1IB 2OP4H 3O0RH 2GJ6A 3TP4A 3VWKD 1S9WA 4HWBL 1AY1H 1W8OA 1FN4A 3LV3A 4Q9RL 4YBQC 1EEQA 4KTEH 1VFMA 3BEWB 5DLML 3MA9H 5JHDB 1CFTB 2Z31A 3U6RA 4F7CA 5IT2L 1BWMA 1EUUA 4ZTOL 5B21A 1T5WB 2YS4A 5DEFA 1M05A 4LIQH 4C4KO 3RPKA 4DZ8A 1VCAA 3EDKA 1Q94B 1IKFH 1FAIL 1MLBB 3F8UB 2FGZA 3ETBF 4X6EA 3V8CA 3WS6C 1KBGH 1FFQA 4ZO9A 3MODL 3C9NB 2O5YL 2HFEA 3TBYA 5J12B 4N8VA 5DFWH 4QWWC 4JFXA 2QSQA 1JNNH 4M6AA 1C12B 2IH1A 5ICXA 1T2XA 5EU3B 5HDQL 1KPVB 2VLRB 4ZPVA 3PG2A 1MVUA 1E4JA 4G8FA 2DQDL 3ZHKA 4QHKI 1HHKA 3RWJB 1FZKB 1QYGL 3FRUA 4ODUA 4U6HA 1IAIL 3RWHA 4X7TA 1LO5A 1A8JH 2EIZB 2HVKB 3R06B 2VDNL 1I1AC 3SBWA 3ZKMD 1HHHB 1ZT1A 4Y4KA 4PGCA 3D39A 2ZCLH 2P5ED 3KPSE 1LO4H 4Y4HC 4LOUC 1G9MC 1IZJA 1FVDA 5IK3B 3C6LA 4NO2B 1HH6A 2F54D 4JFOA 5C09D 4MJID 3UEZA 2OM5A 4UINL 2P7TB 1JN6A 4QT5A 5DRNA 2PO6B 3STBA 3CX5K 4ZDHA 3MUZ1 3VH8A 4NGHH 5IKCB 5D6DC 2GK0A 5DXWA 4X7FC 1K8IA 1FNSH 3GRWH 4JO3L 4Z7OE 5IM7B 4RFNC 4Y5VB 3L3DA 1MCDA 5IESL 5H35A 4HIIB 3SQBA 2OP4L 2HT2C 3O0RL 5DD1L 3QNZA 4K55A 4HFWA 4HMCA 1T21B 4QOKE 1AY1L 1MHHB 4NP4L 3ZKXC 4F8TA 4LSVL 4P48A 4MAYA 3MA9L 4BSJA 1S7UA 3NAAL 2BVUA 4LIQL 1JFQH 2RR3A 2N7BA 1PG7W 2VZTA 2ICCA 4N0UA 1IKFL 5KOVC 2OK0H 4NBYB 2UUDH 4FQJH 1PEWA 5FM8A 1JUFB 4QCIB 3S4SA 5JHDE 1S5IL 5DURB 2J8HA 1P84K 3FHAA 5IMMB 2C9AA 2X4RA 4JPKL 3RVXC 1JGVH 5CEXA 4OT1H 4JFEB 1IM9D 5HGAA 3T0EE 3QUYB 2PYFA 5EWIL 1HXMB 4FP8H 5C0FB 3EYOA 4LHJB 1IZKA 4LAQH 4MVBA 4JEGB 2Q6WA 3TPKA 3QPXL 3RKDD 3C60D 4U1NB 1KLUB 1XR9B 1ZANL 5DHVH 3HUJE 2Q8AH 4ZUSA 1LO4L 4NN6B 3S5LG 2HJKA 4LMQI 1XT5A 4MDJA 2ZPKH 1ZK9A 2NY1B 1CDHA 2VOTA 4YFLF 2CRZA 4XMLL 1BFSA 3KPSD 4NKDA 5GRYA 3B6SA 4HIJB 1WTGT 2P8PA 1J18A 3GRWL 2EDYA 5FCUH 1A4JB 3P0VH 1F58H 1UVQA 1PYWB 5E2TL 2ICEA 3V5HA 1WFNA 4K8RH 2HN7A 3HE7C 3B2VH 4HIEA 1S7WB 4RISL 1AE6H 4JM2A 5FO9A 1AFVL 2R0WL 4JFDE 2BSRA 4L8DA 2LVCA 3VFPB 1DP0A 4X98B 4BFBD 4P2RA 3HC4H 2WUBL 1JFQL 2GJZA 2WY3A 3VJ6A 1NGZB 1RIVH 2VJXA 4FQ2H 4NHCL 4M00A 3ARDB 4TRPL 4HGKC 3RHWF 4KXZH 5H2BA 2XOTA 3MGOB 2VLJB 2Z4QB 2VZUA 3PIQB 4R0LA 3MRRB 5JPNB 1GOFA 4IEFB 2MSPA 4M1CD 4Z76B 4EI6B 1JGVL 3VMOA 5JMOC 3B5HA 3SDYL 5JHDD 1MCBA 4OT1L 2YRLA 4BSWA 4YDJB 5BS0B 2NCMA 4IIQA 3LEXB 4FP8L 5DFVD 1YNKL 1X5JA 2I25N 3A6CH 4GKSA 1RHHB 4IOIA 1PGRB 4MNQB 1MCSA 2FYYA 3I2CH 4IOFD 3UTSB 2A6KA 1WFUA 3SGDI 3STLA 4JFEE 3EZJB 4M7ZB 5E95B 3H9ZA 2XFXB 3J7HA 4WNQA 2VLRD 4J23A 4KKLD 2ZCKL 3O2DA 1MCOH 3IDMA 3FT2A 3TVMA 1AGFA 4UIKH 3BP4B 4PLKC 3UZVB 2B8OT 3HPLB 5FCUL 5CZXC 1VADA 3QXWA 2A77L 2JCCB 3BZ4A 4JPWH 2DTML 3FL7A 5GGUA 4WHTA 4JPVL 4IJ3B 3RUGA 3V5DA 5ID0B 5DMGC 5FGSA 2X89A 3MCLH 1XCQA 3AY4C 2XQYK 5E4EC 3QDGB 4U6XA 4KDWA 2DD8H 3NCBB 2IQ9H 1B6UA 2BY0A 4OIIH 4X5LA 3PDOB 3O6LH 2F58L 3HC4L 1ES0A 5LG1A 2IPUG 2PO6D 1EEYA 2ED9A 4QRRE 5KS9B 1F02I 3QAZC 1BZ7B 4XCCH 2KPNA 3TO2A 1GGBL 3ULUH 4FQ2L 4HUWA 3QJFB 4NC0B 2G75A 3QIUC 4YUEH 1WCBA 5JO5B 3L95A 4HLZG 3WEXA 3VD9A 4JRXB 4NOFA 1XZ0A 1DUZB 1S7QB 3NIDF 3R0NA 5F7FA 2GSGB 4CKVX 1LO2L 3NIFE 2OBGA 4NM4H 1ETZA 5ALCH 4Y4FB 5A16A 4YPJA 3CAFA 5B3NA 1YEEH 4JB9L 2VLJE 2Y7QA 3PWVB 5D1QB 1RZJH 2NY7L 4I18A 1DVFB 2BNRB 1U91A 3MRHB 3H9SE 3WL9A 4XNXL 5DURD 3L5JA 4HX1B 1AHWB 5MEPA 3IVKB 1NCWH 1MCOL 4I9WE 3TZVA 2YUVA 5JPMB 4MNQE 2IFFL 1KCVH 3G6DH 1XMWA 4OM1H 5ID1B 4UIKL 4HKJB 1QEWA 5L88H 4JFED 1MFAL 1EXUA 1MCKA 1RZGB 2ICWB 3UTSE 4P4RB 5CZKA 3RZCA 5F1IA 4U1GC 4KPHL 3T2QA 1WZKA 3MXVL 4JR9L 3E6HA 2Z0BA 2HH0L 4ODWA 4J4PD 3BPOC 4Y2DA 5J13C 4OBRA 3UZQA 1JI2A 4OIIL 3STZA 4OFKA 2NY1D 4NM8L 1NFIA 3DX8B 5T3XH 3EYUH 3IETA 4ZTPH 1YMMA 5JXAL 5E2WH 3QDGE 3L7EA 4QHNA 1A2YB 4S2SB 1IILE 3QQ3A 4FFYH 4NUJB 1YEIL 5IOPA 1R3KB 3PGCA 2EE2A 4PJGB 2O26U 3S88H 1IC5H 5EA0H 1INQA 4LVNC 4X9HA 1TCRA 3RJDA 2VC2H 4M9PA 2QHLA 1WBXB 2WNGA 1YEEL 4R7NB 5DFTA 4K7PH 3MRIB 3BGAA 4E41A 3QUMA 4JRXE 4R26H 1RK1A 1J10A 2R23B 2LU3A 3SDCC 2DYPA 3ARDD 1GPOH 3O11A 3CSGA 2D7OA 4RGMB 1D6EA 2QR0A 1CFSA 3QEUB 3MNVA 5BQ7B 1CE1L 2AK1H 1NCWL 3TYFB 4PJFE 1FZOA 3O41A 5D7SL 4DEPC 1R3JA 1KJMB 4GRLA 5FV2A 1KCVL 1ZWIB 3DX7A 3NMEA 4A6YH 2DQUL 4YFEA 5BS0D 3MACH 2ED8A 2NY2B 3O2VL 3DYPA 4U1JB 4YDIH 1G6RH 1V7MH 2M26A 4Z7OF 1YC8A 4UV7L 2QQLH 4MNQD 4ACPA 4JY5H 4XPGL 5CD5D 2L4OA 3UTSD 3VMPA 1D5BA 4D9RD 3TA3B 5DD5H 5I74B 2HTLD 3EYFB 2YR3A 4FQHA 4MZ3A 1AGDA 4K7PY 2CO7B 2IPTL 1I7UB 1F6LL 4U2ZA 1CXIA 4XVTH 2DWDA 1JWUB 1N64H 3EHBC 4F9LC 3CH1B 3UPAA 5LWYH 3SJVA 3LD8C 4JHWH 3I50H 3HC3H 2Z35B 4UQ2B 2LFGA 5FHAH 3FONA 5AZEL 32C2B 1LVEA 3ZE0E 1WBZA 3IFLH 1A6WH 4TUJA 4QTHB 4H26A 4FFYL 2MJWA 2OR7A 4NWTL 3QDGD 1JGDB 5IFHH 4Z8FH 2CIIB 3A67H 1MRCL 3GSNL 3AS3A 3MNWA 3OGCA 5D70L 2IFGA 4LVOC 2EYRB 1FQ9C 1AO7B 3CDGA 5T1MA 2F8VA 3TCLA 4NRYA 3BO8B 1NDGB 2NY6C 4PRAB 4HS6B 5D7IA 1D5ZA 2P8MA 5KVDL 2J2ZA 4OCSH 5E6IB 5GHWL 2YOCA 2YXFA 3ILPA 2AK1L 1RU9L 4P57B 4JRXD 1G9ML 2DM7A 3IDGB 4O4YH 1J0HA 3UTOA 4NRXB 3QG6A 4C59B 4I48A 4A6YL 3FRPA 2ITCB 3KJ4C 4YDIL 4JZNB 1G6RL 5C0EB 2XG4A 5TF0A 4ZUUA 5HXMA 4Y5XC 4BQ6A 5BZWA 4GOSA 5D1QD 4OD3H 3EYSL 3HI1B 3IRZA 3VMNA 3KYAA 4HULB 1DVFD 2BNRD 2X1OA 3MLXH 3NACH 3PJSA 3VFVB 4PJCA 5DD5L 3DHJA 5FYKE 1WZ1H 3NZHL 1QBLL 4M5ZH 5IW1B 3UDWC 3WJJC 1ITCA 5HHPA 3OWEA 1DZBA 5C6TH 4AT6B 3CDYA 4XVTL 2BFVH 4WI4A 1EMTH 1ED3B 5C9KA 3IAQA 4P23A 4LEXH 1JYXA 5LWYL 5DUML 5C08A 3KNBA 1KSRA 1CGYA 3I50L 1HIML 5J9PA 1TZIB 2OTPA 1S3KL 1P4IH 3HI6H 4QXWA 2P47B 3U2SA 4NNPL 4KJWC 2DQEH 4JANB 4ODBD 3WKNA 4J3WA 3QRGL 5D2LB 2ZOLA 3MZTA 4HZLA 3O9WB 1EAJA 5E7FA 5I66B 3MCKA 2UYLB 2VERN 3A67L 1TZHB 5I1EH 3DBXB 5J3HC 4CW1A 3QFJA 3JV4A 3PP3H 5D1ZD 3DO7B 2PCPA 5BCAA 4Y5YB 1KJVA 5C0GB 1P1ZB 3KG5A 4NJAL 1P9MC 1H0DB 2AS5M 4LMQE 4JFFA 3BP6B 3D0VB 3CVIL 5J11C 1BBJB 4RFOH 4EVNB 1CT8A 4Z0BH 3VFSB 4W4OC 4Q7DA 3ESUF 4O4YL 4JQVC 5CEZD 3QO1B 2YPVH 3B3IA 5AWNL 3OKEB 4PUBH 1LNUA 2ZUSA 1RUML 4JQXA 1JNHA 1BGXH 2IG2L 5CLWA 2F53A 5EC2A 4MAUL 2EH8L 3BP5B 1DCLA 1P7KB 1A6AB 4X9GA 4GG6A 4UU9A 4NUGH 1U3HD 3QH3B 4ZFFA 1UXWB 4KRNA 4L9LC 2EECA 2QKIA 3HG1B 1J0IA 3VG9B 3MYJA 1WZ1L 4L3EE 3KPOB 1D6VL 2WBJC 2OQJB 5C0IA 1E4KC 1J0KA 1EMTL 1UZ6F 2OTUA 4XCNA 1Z0NA 2CLZA 1YNTA 4LCUB 4LEXL 3MV7E 3RVTD 4PRHB 2NY5L 3DYOA 2NY2D 4POYA 3SKMB 1XGYH 3BT2H 1OWRM 2FL5A 1U8JA 4HWBA 4PV8B 5KVGH 4IDJL 2H6PA 4KMLB 1HK6A 2CKBH 2H26B 3TA3D 3IDJB 4PTUB 5I1EL 1DEDA 4KMQA 4YHNB 4N0CC 4RZCA 3MYZA 1E4XL 1INEH 1CR9H 1GL4B 5EOCJ 4K7PX 3N1MC 2JK5A 4RMQA 3RDTC 2FX7H 5EU6E 1JI1A 3I3EA 4IMLA 3HRPA 1UWGL 1YEKL 5I75C 3LQAH 5KBNC 4NSKA 4AEHH 5F9WB 4YZFF 3WIFB 4PJXE 1HQRA 2X4NB 1W72H 3HZYA 4PUBL 3BW9B 3L3GA 3DX6A 1H3WM 5C0ND 1JCKA 3KR3L 2FCBA 1NGPH 4QHMA 4D9LH 1L6XA 4P9HC 3D2UB 1AO7D 1XGTB 2LABA 1QLFA 1SJEA 4TUOA 2BSSA 1U9KA 1TTFA 4HZAA 4YGVA 5D7LA 4KKCC 5JW4M 4RGOH 5E6ID 5I1IH 1FO0H 2ZSVB 2Z8VC 4X8XA 4Y2OA 5JDSB 4K2UL 1NCAL 1KF9B 3CUPB 1PZUB 4L8CB 1TMCA 1Y6NR 4G80A 4TSCL 3NCYP 1TNMA 3C09C 2JCCF 5D5MB 5SWQA 3V4VH 2XACC 1UXSA 3DX9B 3DARA 5IEHB 4NT6B 3HG1E 1IBGH 1J1PH 3BT2L 3WKMH 3DTXA 4MSWA 5D6CA 5KVGL 1A14L 4MQSB 4X83A 3LRGA 4CMHC 4H1LB 5F70A 4GW4B 3UMTA 3DXAA 1KFAL 3D5OF 2J6EL 4XBPB 1F8TH 5SWZB 5KJRH 4B41A 5C6WH 1CICA 4PRHE 3AB0B 5D4QA 5C71A 3OBAA 5E6YA 2CR3A 5KS9F 3BEVA 3GI9H 2WIMA 4X6DA 5D9SA 2Y07H 1KB9K 3CK0H 4WHCA 3OAUL 5F97E 1UM6L 3GKWL 4G8IB 4PG2A 1CVRA 2QADB 5IW3A 1J0YA 1LWRA 1SBSH 3IKCA 3LQAL 2QQQA 4BFIA 1NGYA 4G9DA 4PP1C 3T2OA 2NXYB 1LK3H 1W72L 4OUUA 5JNYA 3O9WD 4XMPH 1LEIA 3EOAB 5AG9A 1QBBA 5I76B 1KN2L 4Z0XA 1RIHH 5CEZH 1DTUA 2CQVA 2FJGA 1QVOB 4U1SB 3LKSB 3UBXA 3KXFA 4HDIB 5M7QA 3EKCA 2DQGH 3X11A 1JYNA 3FO1B 1IGTA 1SBBA 4K23H 4R3SA 5FECB 1CWVA 2YBRA 2I24N 2CLRA 2E3VA 1CDIA 1OAXH 1U92A 5C0JA 1FL3B 1G1CA 1RZ7H 3P9MB 2D31B 3IJYB 3OX8A 1CD8A 5ICZB 1VKXA 1FVCA 4OCNC 3GRWA 4GS7B 2PW1B 4ZUTA 1KIPB 1AP2A 3O3UN 4HQQL 4M48L 1NMBL 1J1PL 3WKML 3OMZA 4F7MA 4H20H 1LE5B 1FRGL 1O7VA 5DTFB 4KJYA 2XXCB 1X4YA 1NBQA 5KZCB 1O0VA 5JORB 4KJPD 3HG1D 3Q0HA 5D5ME 3DI2B 2WBKA 1BLNB 3U4EA 3O6KL 2FZ3A 3RWEA 3GI9L 1G7MA 3OJDB 1MJUH 3F5WA 4KDTC 3TFKC 4TPRH 2Y07L 1DUYB 3MBEB 4HPOH 4XAKE 4PRIB 1FNEA 3LN5B 4FABL 4LVHC 4PRHD 15C8L 4ZAKD 4Z18A 2YEZB 2C4FT 5SWZE 5E7BA 3RPIB 2XNAB 3PQYA 3PNWA 4YDKH 4ZUVB 4Z7QE 4LLUA 1J05B 4U49A 3NCEB 3BXNA 4JVUA 2B2XH 3MRKA 4PJGF 1QKZH 4F9PC 3EOBA 1CXFA 1B88A 1VEOA 5CZVH 4OF6A 4CJ0A 1ZXQA 2VDRH 4U1HA 3VGHA 4KY1H 5F9OL 1MHPL 3GSXA 5F89A 5AD0A 1DEEB 4J3SA 5FA3A 3SPVA 4EI5C 4AYFA 1PAMA 2VITB 3DGGB 3QUZA 2GCYB 4K23L 1G7JA 1TTGA 2YD1A 4HXBH 2AAVA 1EDQA 4BQCA 2AK4A 3KHQA 1RZ7L 4WWKA 1Q9KB 2AXFB 1RIUH 2NR6C 3IFOB 5KSVB 3HHRB 5LCVH 1BIIB 2XPGA 1VESA 4E5XB 3CJJA 5EBMB 1DQML 3SCMC 3UTTA 4QXTB 4PJ8C 5F9JA 4F3FA 4JVWA 1I1YA 5M95B 4C83B 3V2AR 4DKDC 2ATKA 4DKEH 1DANT 1BFTA 4UQ3B 3CC5A 5IIEB 4H20L 4QRSA 2EDWA 4HWNA 4C57C 3D2UD 1YJDH 4WFFE 2W60B 4ENED 4ESKA 2NMSA 4NQEB 4ZODA 4YX2L 3V0VB 1T1WB 3FQRB 4OAWB 1FG2A 5E08H 1RZKL 5CWSA 3HNTL 4O51B 5DWUL 4CU6A 2APXA 4K8RC 2YA0A 1B3JA 1A5FH 2E7LA 2Z91A 4ELME 4JZJC 2WWMC 4WFHE 1I8MA 4XRCB 4DZBA 4NRZA 3JV6A 4WW1A 1LP9E 3VWKC 5C86A 2V7HA 4JFYB 5D7JB 3CSYB 1J8KA 1LILA 1CLYH 4LRNH 2JB5L 4M6ML 1BQHB 2O5XH 2MQ3A 4L4TB 1YECH 3JV5A 2B2XL 2AERT 1AR2A 1D5IH 4PRIE 1ZOXA 4QYOB 5SWZD 5KTEL 1BVZA 2VDRL 5CJXC 4WGWB 1AQKH 2YSSB 4NNYB 4P5TB 1CD1B 3U4AA 1NC4A 2YXMA 4G9FB 1F4WH 4PJDA 1T03H 2FB4H 1J12A 4HXBL 2QADD 3GJFB 2SEBB 1M71B 5K9JL 5BW7A 25C8H 3P77A 4R6UA 5DF0A 4JDZA 4OF3A 7CGTA 2OL3B 5LCVL 2C1OB 3KWWB 4L8BB 3LQZA 3VD4A 2NXYD 4W6XB 3ZKMC 2A1WH 1LQVA 4HK3N 4L8SA 1T89A 5BJTA 1BD2E 2DLHA 4MNHA 3BIBX 1KACB 1UG9A 5FK9A 5EBLB 4DKEL 3MRNB 5HHMB 4RX4D 3PP3K 4BH8B 4LSSL 1D5XA 2F5BL 4JREB 3HNVH 2ESVB 2VL4A 4MDIB 4X6FA 3W39A 3BZEB 4FQCH 4I5BB 3K1KC 1EFXB 3SKJL 1BM3L 4N8CH 4XPTH 3UJTH 4QRTB 3P9LB 1FSKB 5JLZA 2J88H 4LASH 1HZHH 4G8GE 1QLRB 4I1NB 1IGCH 1WV7T 4N9GB 2IEPA 1LEKB 1FHGA 5EOCL 1A7PH 2C1PB 6FABL 2P5WE 1XF2A 4CAGA 4GBXA 3UTZA 2ZUQB 4MCYA 4XNQA 1H8OA 2AV1B 5I6XB 5DC4B 4DVRH 4YHPB 1QNZH 1U3ZA 1JHLH 1L7IH 1G0YR 1TJHL 4LRIC 1CLYL 3HE6B 5GS2D 3GI8L 1RJYA 5D2LF 4WFHD 3WV0A 1Z9LA 1EGJH 4P46A 4G3YH 1UB5B 3BIAX 3PGFH 1XIWB 4GXVH 5KZCD 4U3XA 1D5IL 4R4BA 1GOHA 1SVCP 3CSBA 5E6ZA 2ZG3A 1I9RH 2FWOA 1WIPA 1HEZB 2FBJL 1AQKL 4FXGB 3KYMA 3SE3C 2VLKE 3MBED 4GLRH 2W9DL 4EXKA 3K80A 1BHGA 4PB0H 4PRID 3KGRA 3MJ7B 2YD2A 4R7DA 3X3GL 3I9GH 5F7YC 4LDEB 1ZT4A 1QQDA 3E8UH 3JTTB 3E0GA 4PGBA 2R1WA 4CVXA 4JKWA 3OF6D 1NJ9A 4LDOB 1ZLVH 2RCSH 3SE9L 4S1RH 1F3DJ 1YEGH 1KT2B 2EYTB 3U0TB 1L9NA 3DMMA 3S97C 1BIHA 3RKDC 4YJZL 3C60C 4PJBB 4H1LG 5GRVL 5CILH 4XPFL 3HNVL 2CDFA 4OZHA 2B0SL 4F15B 3BFOA 1J5OH 4LLWB 5LAXA 5DS8B 3QUXB 1HE7A 4XPTL 3S35X 3UJTL 1I85A 2O61B 3OR7A 1S7XA 4WFGE 5AUMA 1E0OB 5DMKB 3NCMA 4OCRL 4KC3B 4ZSOB 4J1UB 4F80A 4JGUA 1GZPB 2FIKA 2F19H 2IADA 2ESVE 4XCFH 3E6FA 3VXSB 3Q5TA 2NLJA 5L2KB 4BK5A 3IGAB 4X4YB 1I8LC 1M7XA 1DLHA 1L7IL 3JVGC 4P9ML 1BFVH 1OGTA 4Z9KB 1QBMH 3MFFA 1S9VA 3HRZB 2IPKB 1A9BA 2X4UB 4NQED 3TPUB 5ABDE 1J88A 3GSNA 2HT3D 4YHLL 1IAKA 4RCAA 3RIFF 4DGVL 1ZGLB 5DI8B 1AJ7H 3SKUD 2GY7B 1WVZA 1PKOA 3L3OB 4QRQA 2AP2A 3UYOD 1TDQA 1M6OA 4M1CC 1U8MA 4JFQB 2EZ0D 3BJLA 5HTSA 4P9HL 2YMXH 1BVKB 1CVSC 3V6BR 1QO3A 4L4TD 4ZPTA 5J7CC 1MH5B 4S1RL 5DFVC 1KJ2H 1KIQA 3DUUA 2CSPA 3A0OA 4A6YA 3BIKB 3WFHA 1X6NA 4F7EA 1K5NB 5IVXE 3DURB 5KVMC 1ORSA 1ZT7B 4UZGA 1G6RA 4I0CC 1KCRL 4IOFC 4MB4A 4OZGB 5J12C 1FVEB 5A2FA 1T4KB 4QGTA 2AJYL 2LE9A 1JHKL 4YNYB 4JFPB 4G9FD 3WMSA 4FOMA 3WBDA 5F7HA 4KKLC 4HH9B 2V2TB 4LKCB 2V17H 1JGEA 1IEBB 3K0WA 4RWYH 3ZDYF 2VSDA 3VD7A 3FN9A 3ARGB 5D5MF 1BFOB 2V5SA 3SKOB 2F19L 4BQBA 5F3BB 5SX5H 5EIIB 1I9JL 1NAML 3O6FB 2KBGA 1F11B 2H1PH 1H9VA 1ZHLB 1MFDH 5HHMD 2AKRA 4X6CB 1QBML 4ZSOE 2ESVD 4OGYH 4Y16A 5IG7B 2D3VA 4R97B 2V7NB 1EFXD 5DMIH 3WFCH 3ES6B 5GS2H 2PO6C 3ARBA 3QWRD 2XICA 4IRSA 3CDFA 1BJ1H 4A2MA 1T6WA 1OARL 4C56B 2VDLL 3ARED 4Y5VC 2Q76B 3MO1A 1AJ7L 1S9KC 1YDPA 1Y6MR 2I60H 1OAUL 2ADFL 4M8QA 5EZLB 1T1XB 3TLRA 1KCUL 4NHUB 1ZA3B 3E3QA 2K1MA 3TPUE 2W9EH 3MCG1 3HE6D 1RV6X 1J11A 4JFZL 4OLZH 1FDLL 4PR5B 4XI5D 3O3DB 3NGBB 1YY9D 2XT1B 1XGUB 3NZ8A 3DIFA 3D25B 3RU8H 3MJ9H 3L5XH 5JQ6H 1G6VK 2P24A 1YEFH 4GAYB 3V0AC 4WJ5A 1IEAB 3CU7A 2AXJA 3C8HA 1F4XH 1WT5A 3QEHB 3MV8B 4RA3A 1AKJA 4RWYL 2IAMA 1KNOA 3QDMB 1HI6B 2VDOH 4MXQA 2AI0L 1BQHG 3ZO0A 1NLBH 3U7AA 3T1WA 1MFDL 4A2LA 4ODVH 1WTLA 3QIWA 4J4PC 4XVSH 5HYJB 2ADJA 2EXYD 3RA7L 4NN6C 2VXVH 5D96B 3KLAA 1ZA6B 1JGLL 2VUYA 2QQNL 1UA6H 5F71A 5GS0L 2XIDA 2NY1C 3RWFB 4JRYE 4M62H 4MLIA 5DRWA 5FAAA 4RGNB 1CFVL 3NCCB 3WIIH 5CGTA 4X6CE 5GRXG 1W0VB 1K8DA 4PJ9A 4QXGL 2B5IB 4PREA 3ZYIA 3WS3B 3VXSD 3OL2A 5L2KD 3FFCA 3CFJB 2Y5EA 1WITA 1XGQB 3BZFB 2YD5A 1MF2H 3EDFA 4DAGH 1P6FA 2BCKB 3DRQB 2PTTB 4OLZL 5CP3H 1L0QA 4KI5E 4MA3A 3BUTA 2DWEA 3L3JB 2RFXB 3KPLB 4BM7A 35C8H 1JYVA 3ARDC 5JQ6L 4XBGB 2X40A 5HGBA 3RBGA 2IMMA 4Z7WA 4D0DA 3O8XB 2X4OA 1GGYA 4BK4A 3FT3B 5ECJE 4DW2L 1WGOA 4U7KA 3VFWB 3CFCL 3VFMA 1GZQB 4K3JH 2VXUL 43CAA 2J8UB 3QA3B 3QBTB 4FTVA 2VDOL 4JCLA 4CNIA 3TIDA 2OR9H 5IMKA 5F1NA 3L5WB 3DECA 5FHBH 1P6AB 1VEPA 1D9KB 3KDMA 5CD5C 5KSBF 1KLGA 3QCVH 4L5FH 1TJGH 2HTLC 4HUUB 4M7ZC 5F6HI 2Z93A 5EZJB 1UWEL 2I5YL 2Q8BL 1WICA 2CKBA 2J6EA 5K9OA 4F33B 4G6JL 5FYJH 4BH7A 4PJEA 5EO1B 1FNGA 1JF1B 3ARGD 4FZ8L 4XNMA 5BXFA 5F88A 3EBAA 5HYSB 1PY4A 5HI5D 3MOQA 4PJ7E 1QSEB 3O6FD 1G9NL 4IJ3C 4M43H 4YO0A 4L29B 5GRVK 3ZDZE 3BI9X 5J06A 3BRFA 3R0MA 1CD0A 1T1YA 2ADGA 5FO8A 1BOGA 3OR6B 8FABA 5E5RB 1W72A 1GGTA 2RB8A 3UP1A 1TITA 1C5BH 5K9QI 5JA9A 4ISVA 1FE8H 1UJ3B 4Z7UB 4YPGB 5D7KE 3VFTA 3EYQD 4OCXH 4C56D 4IDLA 3KYNB 1KG0B 3MRJA 2CGRL 4AH2B 1LO3H 1Y0LA 4E0RA 4X5XA 1CIDA 4KI5D 5JXEA 4GT7A 4MJ5A 3DROB 4WUUA 4XTRD 1AI1H 3F7VB 4XVUD 3SHSA 3JTSB 3U30B 4FXKA 4UT7L 4X0KB 4CJ1A 1FYTE 3GM8A 1IL1B 4CDGC 5ERWB 3JXAA 3IAPA 3ARFB 4GQ9L 4M1GL 2X09A 1NMAH 3F12B 5D1QC 5K59F 2BZDA 1Z5LB 3OHXA 4V1DB 4PLOB 5FGCE 2ZKHH 1DVFC 3QCVL 4JAMA 3TBVB 5DO2D 4KRPB 2J8UE 3P2TA 3VU2A 1VFAA 1AHWC 3SE4C 3MRBA 5JW3L 2DQFB 3MV8D 2B4CH 4ONFH 3GSVA 5MEOB 4NN7B 1YQVH 4NJ9L 2BNQA 1NCCL 2E9WA 2DKSA 3QDMD 4PTTA 3U36A 1HSAA 4N0FB 1UZ8A 4OLVL 4UAOB 5E2UL 4CN6A 3VW3H 1CFQB 4JO2H 1G7QB 1ONQA 5HYJD 4GW1B 3U46B 4ZQKA 4BUHA 3QIBD 4S1QH 1WC7B 2W65A 2YN5A 4G8EB 4FMFA 3L3IA 2GTWB 5D1ZC 4QRUB 1QSEE 3PWLB 1N59B 2K3TA 3QO0B 1FZMA 4RGND 2VABA 1JPST 4I0PB 5I18H 4OCXL 4XP9L 1OF2B 2WINA 1LO3L 2FEEL 4QF1B 2XV6B 4KZEL 1NUFA 4NDMB 4NNXA 5GGSB 2BNUA 3P0GB 4NO3B 3FMGH 4ONOA 3N0PB 4LHQB 1AGBA 4FNLH 1TNNA 2AJUH 2NNAA 4Z7UE 2V5RA 2X1WL 3WFZA 4PJBF 4TSBH 2BRQA 1CBVL 1AGCB 1JNLH 4Y19A 1U3HC 1OL0A 2AV7A 3RY6C 3ZHLA 3QXTA 1E28A 5F9DC 1RJZA 4IBLT 4MJ4A 4ZS7H 4RGMC 3CFBA 1DBKH 4LK4A 3V4UL 4FN0A 3EO0A 3IKKA 1JWSB 3EFFB 3O8XD 3LQMA 3FO2A 3RWDB 1U36A 1C08B 4QNPE 2P43B 3IFNH 5CINL 4ETYA 4Y1AA 3MV11 1NL0H 2AEWA 5FUOH 5GXBB 3RVTC 1CXHA 1ORQB 2NY2C 2PXYA 3SOBL 2CR6A 5JW4N 1FNFA 3P4OB 4NQCE 3L3HB 2X1XR 1JMXA 2Y4SA 3VW3L 2CDGB 3VI4F 1D9KD 3O3EB 1RULH 3KJ6L 3REWB 3TA3C 4M7KL 5I74C 3LKQA 1CGTA 1DE4B 1U95A 4UV4H 1F3JB 1H5BB 5D8JH 5E8OB 2H8PB 3S98A 3HMWL 3WXVL 4LCWA 5HJ3B 4XHJD 1JK8A 3MR9A 4FQXB 2CRIA 2HKFH 3SGKA 2R1XA 1Q72H 2L7UA 3HS0B 5CJOL 5IP4A 4LHUA 1BZ9B 3VE0B 3WJLC 4YK4C 3RJQB 1QSED 2IWGA 4F57H 3VG0H 5C3LD 3D85B 3MRPB 4NC1E 3FMGL 5I1LA 3RGVB 4Q0XL 3D3VA 4DTGL 1QSFA 1Y18B 1F6FB 4ZFZB 3X14B 5C0NC 1J8HA 1DQDL 1DQQA 2HLAB 3N06B 4TVPH 4OZGF 4FFZH 3AGVA 5ANMB 4P2OA 1CL7H 3TYGL 1NC2A 3GSUA 4ZXBB 4F2MA 3PWNB 1Q9LB 4KUZH 4NQXB 5J6GB 4JN2B 5F8RC 2QSCH 5E6IC 4DVBA 3MROB 1T20A 4HKXA 3HZMB 4JG0L 2H3NA 1NEZB 1CFBA 3IFNL 1NL0L 2W92A 5AEAA 1WLHA 4OGXH 3GMLB 4OZ4A 1HSBB 5FUOL 1FCCA 1RVFL 1VERA 1M1SA 1YJDC 3T8XA 5FDWA 4F58H 3M8OH 4O5LL 1C7TA 4WCYH 4HV8A 3QXUA 4DK3A 3DV6A 5GISH 3ARFD 2ZUXA 4HUXA 4ODHL 4TNVK 3BAEL 4O00A 4PPTA 4ZFOA 3ORJA 1RSFA 5I1DA 4V1DD 1RULL 3VXUE 3QNXB 4YQXL 4KRPD 2G5BA 4W68A 4M1DH 3H7BA 4CBPA 2BVPB 2WUCL 3GMRA 3MREB 4YC2B 3VWJA 5HI3D 2GJ6B 1Q72L 1CU4H 1S9WB 5CEYA 5E2JA 4XPBH 4GKOA 4KI5F 4WEMB 4XVJH 1FN4B 3W11D 1Z3GH 2ZUUA 5BRZB 2R56L 4PLNC 2Z31B 3U6RB 1ODAA 4HWZA 4OTXL 2F9BT 2ITDA 4X99A 3QQ4B 5DEFB 1M05B 1IJ9A 4DZ8B 5CJQH 3PXJA 4HIHB 1NLDH 3O9WC 4K3GA 4XMKH 4JFHE 4X6EB 4O9HL 2VQTA 2BX5A 3N50A 3WIHH 4JFXB 1IC7L 1NCDL 2IH1B 5ICXB 5JOPD 3S8WA 4ZPVB 4IMKA 1RZFL 4I0PD 3FN3A 2EC8A 1TETH 1MVUB 3LEYH 4G8FB 4AJ0A 1HHKB 4PLJD 3MRGA 3FRUB 4ODUB 1SYVA 4RFEA 3OKYA 4U6HB 4X7TB 5K9KA 1LO5B 4Z7VE 5C9JA 5HYSG 4P4KA 3VI3E 1N2RA 3U7YH 5ANME 3FB5A 1ZT1B 4Y4KB 5CSGA 3U4BL 3OB0K 5DRZA 12E8H 4PGCB 4ZNEE 3D39B 3RNQA 2F74A 4NZRH 4LPTA 1A7RH 1U8QA 3DHMA 3C6LB 1HH6B 3SE8L 3QWOA 5CBEA 5CGYD 2UWEB 3QEQE 1JN6B 4QT5B 4KJPC 5DRNB 3CLFL 4OD2A 4ZDHB 3VG9C 2ERJB 3VH8B 5LXGH 5I15H 2GK0B 3WLWD 4OFIA 1K8IB 1YY8B 4LEOA 3W2DH 5EIVA 3L3DB 4DUVA 5H35B 3MV01 2MHAA 1CU4L 4KAQH 3QNZB 4HFWB 3T4AA 3GMNA 1U8KA 4ZAKC 3GHBH 3ZTNL 3CFIC 4MAYB 3M45A 2N56A 4L3AA 5FFLA 1S7UB 1DJSA 4HIXL 4O2FA 2RQ8A 5F21B 3QRFM 1MCFA 1NLDL 3GK8L 3PV6A 4N0UB 4XC1L 5T1KA 2DJ4A 3RVVD 4DQOL 1FLRH 5BRZE 3S4SB 3WIHL 4MXWL 2JJSC 5T3ZD 4FQXD 1A6UL 5FA4A 3N9GH 1L8JA 3Q5OA 5ITFB 3DVFA 3LKRA 4KQ3L 1TETL 2X4RB 1YMHA 1IQWL 3H3BC 5CEXB 3SO5A 5CJ5A 3NN8A 2VZVA 3NABH 2DB8A 3D85D 3K2UH 5DQJA 5HGAB 1OLLA 2PYFB 4KZDH 3RGVD 5F9WC 3EYOB 3U7YL 2CLVA 2J8UF 2Q6WB 3NFNA 4APQA 5L6YL 3AU1A 5IB2A 1MY7A 4UILL 1BAFL 4PJIA 5MERA 4H88L 4NZRL 5C0BA 5I8OH 5CCKH 1A7RL 1NAMA 3U0WL 5F1SA 5TQ0H 2HJKB 4MDJB 3PABA 3QCTH 3CGTA 4ZXBD 2GYSA 2MWCA 4ENEC 4YLQT 5FCSH 5CAYB 4YWGH 4NKDB 5TE4H 3B6SB 5MP6L 1HILA 4JY6A 2P8PB 1I3RA 1R6VA 4JHZA 1UVQB 4YHKH 5IF0A 2X44D 1JZ8A 4B0MM 4P2CG 1F42A 4L9DA 4RMSA 2UWEE 2ICEB 2HN7B 4MNGB 4HIEB 1LDSA 4JM2B 1SJHB 5FO9B 1J9CT 3CMOH 2BSRB 4L8DB 1GJIA 4UOW0 5I1KL 1K3IA 4P2RB 2FLBT 2GJZB 2XY1A 3VJ6B 4CMMA 4AMKH 2GI7A 4XPAH 1L7TL 2EDNA 2Z8SA 3AB0C 3B8YA 1DBJL 1KJ2A 2CXGA 4HFUH 5DRXA 1Z2KA 5ITBH 3FQTA 5H2BB 2DM2A 3FZUD 5IFJA 2EYSA 3N9GL 4WWID 4M5YH 4I3RH 3V6OC 2GJ6D 1X44A 3BH9A 3DYMA 2R2CA 4R0LB 5FB8A 5IFAH 1P4LA 2R69H 3QI9A 2QADC 3QEGH 2Z31D 4BSWB 5C2BL 1YPZA 5KVEH 4X4ZA 5DJ6A 4KRLB 5JOFA 4HGWB 2NXYC 3MXWH 4GKSB 1KIRA 4IOIB 5C07E 3FAXA 1RAMA 5FOBA 2FYYB 4HG4K 1GHFL 3DPBA 5DK2A 2A6KB 2EDXA 3LS4L 5TQ0L 1OGAA 5FYKH 1AIFA 2MKWA 2UY7A 2Q7NA 4WNQB 5HGHA 2ZUTA 5KVFH 5TDNB 3IDMB 3RX7A 5F7KC 5TE4L 2YD8A 3TVMB 1AGFB 4DGIH 2W9LA 1OAZH 5ADOH 5DT1L 1VADB 4OLWL 2VXSH 4JJ5A 5IBUB 4DWHA 1FV1A 4YHOL 3BZ4B 1KOAA 3LSOA 4YHKL 4LAJH 5GGUB 4WHTB 3ZDXF 4QXUH 1IRAY 1NEUA 5HHQA 4Y4KD 4W70A 3RUGB 3V5DB 4GS7C 1MCPL 4LLYA 4UT9H 3D39D 5E03A 5F6IB 4YDVA 4G43B 3W81A 5A3ID 3UYRL 4RIRA 3C6LD 2VDML 4KTDH 4NKOA 5GGSY 1ES0B 3T77A 1JRHH 2UZXB 1EEYB 4AMKL 1G0XA 5LQBH 3S96B 4HHAA 4MNGE 3TO2B 4OZIE 4HUWB 4UDUA 2G75B 4OD1L 2C4XA 1MQKH 1WCBB 3MBEC 1N8ZA 1HINH 3L95B 4M5YL 4YR6B 1XGPA 3WEXB 4P2RE 3MJ9A 3UAJD 3NFPA 1NEZG 5DA0B 4WU7A 2F5AH 4Y89A 3V6FB 3QEGL 4MAYD 1ZVHA 2AQ3A 4P3CL 5CP7A 4Q9QH 1TZGL 5KVEL 2X7LA 1FPTH 1W0YT 5D2NC 2DLTA 2AQ1A 1FH5H 3EO9H 4KI1A 4KK6D 1ETZB 1NUDA 1RJLA 5A16B 2IC2A 4H8WH 4X5WA 3U7WL 2R2EA 2R0LH 2Y7QB 1A9EA 2VTFA 2ZUWA 4LPWA 2UZIH 4I18B 3B9EA 1RUQL 5C6PB 1GCFA 1WIOA 2AEQL 1U91B 4Z7NF 1NBZA 1YEJL 3WL9B 5FGBA 2BJMH 4LNRA 1U2CA 2KZWA 5MEPB 4DOHB 2DJSA 3BQUA 3RAJH 2IANA 3TZVB 4RAHA 5GS1A 3CD4A 1QEWB 4Q74A 5J13B 3IF1A 3C8DA 1EXUB 5DJAA 2VXSL 1OD7A 1M4KA 4RNRA 3RZCB 5F1IB 5HHVH 4MVBD 1RURH 4OM0H 2JELH 3E6HB 1K85A 5C3TA 4ODWB 4WEBL 1M7IA 3GIVA 4L4VA 4Y2DB 5F44A 3VRJA 4N1CA 3ZTJG 1A0QH 1A1MA 5I2IB 4G6FD 4KTDL 4JDTH 1U8LA 4UB0L 1NFIB 4YXLL 4HK3J 3IETB 4DN4H 3RUGE 4JKPH 1YMMB 3S37L 2HT3C 2YWYA 3BD5A 4HC1H 2X2YA 1A1OA 1OSPH 3L7EB 4QHNB 5IMOA 7FABL 4PRDA 3VGEA 5GRWA 3QQ3B 3B9KA 4RAVA 3L5HA 5I19L 1FBIL 1E4WL 5AG8A 2EZ0C 1KELH 5IOPB 4JM2D 4EQ2A 3PGCB 1INQB 1FH5L 4PYHA 1MJJA 4P2RD 3C8KA 3QDAA 5K9QG 1DQLH 1SHMA 4ZS6D 5C09A 2VSCA 3JWOH 4XPHL 1PG7L 4JCMA 4E41B 3QUMB 4PS4H 3VI3F 2ZG1A 1RK1B 1KN4H 1LO0H 3HMXH 2AXGA 2R2BA 4XP5L 2DYPB 4S1SH 5DD3H 2IBGA 3O11B 3VH8G 1FNHA 5TDOA 2QR0B 1CFSB 3MNVB 5I9QB 1MCJA 4OLEA 5H37G 1QPPA 5D1XA 1DQTA 1FZOB 3O41B 3DSFL 1R3JB 4GRLB 2MCPH 2X70A 3DX7B 5EPMA 4EJ1C 1EVTC 3O4LE 2XWTA 4OM0L 3TF7A 4ZFGL 2LAAA 3L9RA 4GAGL 4X7EC 5DJZA 3ALPA 1AGEA 2E8YA 4L1DA 3P11H 5IMLA 3BGMA 2W91A 1D5BB 4AEEA 4JREC 1OLZA 1I7RB 4FQHB 4JDTL 5DVMA 1AGDB 3S4SG 3OAYK 1CDUA 3CCHA 1C5CH 1FSKC 1JZ2A 2DWDB 3TVMD 4P49A 1SY6L 2A6IA 3O2WH 3RTQA 5DJCA 1UFUA 3SJVB 2ZJSH 3IYLW 3DVGB 2O5ZL 5GS3A 1EO8L 3LEVL 3MLYL 5FYLD 3FONB 1A3LH 1ZVSA 1HXYA 2ZUQC 3IDXL 1WBZB 5LGHH 3KPPA 3ARRA 4TUJB 5I6XC 2CKNA 2X89D 4H26B 3MBXL 1YMME 3HE6C 3KAAA 1VGEL 2AJXL 2CRMA 4OLXL 2E9JA 3TWCL 2GUOB 5IWLA 2E6QA 2GHWB 4O02H 3MNWB 4XI5C 2Y06L 3K4AA 4GFTB 4HBQA 1YY9C 3OGCB 4AEIL 4AEFA 4ODXA 5GJTH 4YFLI 3CDGB 1HDMA 5T1MB 1I8IA 4X4MA 5DD3L 5D7IB 3OAZH 1D5ZB 5BVJA 4M4PA 3BKJH 3ILPB 4XCEA 1MREH 3WNOA 1OD9A 5C0RL 3T3PE 3QG6B 2PW2A 3QWQB 3NFSH 1MAKA 2WK2A 5EU5A 1KTLA 2UV3A 4U33A 2FEDD 5DSCA 1AXSA 2FD6L 4ZUUB 4D9QE 1IQDA 2RBLA 5BZWB 4QOKA 1TFHA 3MLZL 5DEGA 3T2PA 1WAAA 3SDXB 2EXYC 3PJSB 1WSST 5E8EA 1NFDA 2ENYA 2B4CC 2W0PA 4F15C 1A7QL 3RGHA 2H32A 2XA8L 3FQUA 5FIEA 2LV4A 2D0GA 1C5CL 1Q9WA 3QG7L 1T7YA 3FQXA 3TZVD 4P23B 2WP3T 1MUJB 2WM0A 4FQ1L 2FATH 5C08B 3KNBB 4YIQA 1OW0A 3MNZA 3RZCD 4P59L 1U3JA 4M6OH 5J9PB 3MZGB 1TENA 1DSFH 3VGAB 3RI5F 3U2SB 3VFNA 4HWEH 1T3FA 5IJKA 4HD9A 4Y2DD 2ZOLB 3LAFA 4HZLB 3RL2A 2ID5A 3I84A 3MCKB 2LQRA 3T0EA 4O02L 2XI9A 2PYEA 4KU1A 4OKVA 4CW1B 3QFJB 3JV4B 2Z8RA 5EU3A 2PCPB 1YMMD 1IAMA 2AEPH 3HUJA 1JPGB 5BMFL 4JFFB 4L4JA 3T1FA 3CXHJ 5DD6A 2KUTA 1BEYH 3LZFH 3BKJL 1CT8B 4M6NH 3W5NA 2X4SA 3OZ9H 4R90H 5IBUG 1QR1A 5D72L 4F7TA 4AM0B 3V9FA 2E8ZA 5FGRA 1LNUB 4GRMA 1JNHB 5D7IE 2F53B 5EC2B 4XAWL 4KXZI 3VFGH 4UU9B 4E41D 5C0AB 1YA5A 2X4QB 2JF1A 1KEML 4D3CH 2DYPD 2QKIB 3M07A 5B39A 2JJUA 5T5FL 4F8QA 4JFDA 1W0WA 3MYJB 3AM8A 5IM7A 2OJZL 1S7RB 4LCIH 5TQ2H 1OAYH 4D9QD 1G84A 2ZZUT 1MFCL 2A74A 2DI7A 2OSLA 3RX8A 1PSKL 1ZTXL 4G6MH 4GRLD 2OTUB 2NX5E 4XCNB 5JA8B 5ILTH 1YNTB 1KGCE 3ARGC 1AXTH 3SDXE 1Y6KR 5F72S 5HI5C 3CVHL 1X5YA 3KLSA 3O6FC 5GGRA 1U93A 2FL5B 4JM2F 1N5YL 1DLFH 2E27H 1CGXA 3QHZH 5ETUA 5FYLH 5B8CA 4PB9L 4ONGL 2IGFH 5EORL 6CGTA 3ULVD 4QCIA 4K94H 4R97C 4D0BA 1IGJA 2HFFB 1X5FA 4RZCB 3V0WH 4XB7A 4FRWA 1A7NH 3EYQC 4HS8H 3TH3T 3TT3L 4U3HA 3SJVD 3SN6N 3QP3A 4JFEA 4IMLB 4ZUWA 2ORBH 1UQSA 3QUYA 1HXMA 4KI5C 4C4KT 3BKCL 3QFJE 4R90L 4EBQH 1KV3A 1FC2D 5IW6A 4XTRC 3Q5YA 2Y36H 4XVUC 1HQRB 1KLUA 2BY1A 4OBSA 5MHSD 3HZYB 1E6JL 3L3GB 3VDBA 1B0GB 1QFPA 3DX6B 5TE7H 5HDOA 2A0LD 4LGSB 4I3SH 1R5WA 2VRAA 1PW3A 3NGBC 3ULSA 2Z92A 4QHMB 5C70A 1VPOH 1QLFB 1KCKA 1UYWL 2BSSB 3K8MA 5A2KH 3CNKA 2B1HH 4G6KL 2VDKL 5BO1L 2VWEC 1F3RB 5DO2C 1PDKA 5D7LB 4R4FH 3WO3B 3DNKA 1A4JA 4NZDA 1HOCA 5EO9A 5E99L 1TMCB 4G80B 4PY7A 4QRRA 4HAFA 3H0TA 3TT1H 5GGVL 3A6OA 1X5IA 3IU4H 2EEDA 5C0AE 2RIKA 3GMOA 2PETA 5SWQB 1AXTL 3ARVA 5E8DL 5FF6A 1A47A 4KVNH 4TULH 3RUGF 4YGAB 3DTXB 4MSWB 5DR5L 5D6CB 2XQBH 3QHZL 1MAMH 4GMSH 3DXAB 3RWCB 1FP5A 1Q0XL 3QIBC 2IGFL 4UOJA 3AUVA 5D96C 1CDGA 1CICB 4BZ2H 5TDPA 3BEVB 3LKNA 4X6DB 5D9SB 2VLJA 4J3XA 4RGNC 3GMMA 1OOAA 2EIEA 3V0WL 5MEQA 4P23D 4DN3L 1X5AA 2JJVA 3D9AH 3UTQA 1F90H 3C5ZA 5I1AA 3WIHA 1Z9MA 1MHEB 5C08D 3H9SA 2B5IC 3UJIH 2ORBL 3LEXA 3PXHA 4CDHA 5IGXH 1NCBH 4L1HA 3U9PL 3IKCB 2VE6B 4GUPA 4BFIB 1NGYB 4IRZL 1JWMA 4G9DB 3QUKB 2NTFA 5JNYB 2X9WA 3F7YB 1LEIB 2EDJA 4J3TA 4Z0XB 1CQKA 1I1FA 1CG9A 3QFJD 3EFDH 1H3PH 2FHCA 2FJGB 5LBSL 3UBXB 3KXFB 2WV3A 4WDIA 5HGGS 1MCHA 3X11B 1LDPL 3TESA 1IGTB 4JFFD 2B1HL 4G5ZH 2UZYB 4R3SB 2R15A 2DL2A 1QHOA 2CLRB 1U92B 5C0JB 5EO0A 3REVB 3GHEL 1YYMH 3O8XC 3OXRA 3FCTB 4WI6A 3OX8B 4MMXC 4R8WL 2A83A 3TT1L 1VKXB 2J8OA 5ID0A 3IU4L 4HH8A 1FVCB 4PJ5E 1CIUA 1MCWW 1A6TA 5T33H 4ZUTB 1AP2B 2R1YA 3MTRA 2F53D 1N6VA 4F7MB 1N6QH 2BHUA 3QDJE 4V2CB 4MJ6A 4KJYB 1R0AH 1D9KC 4K3EH 5EOTB 4PBWD 4YXHH 4AL8L 2YPLE 3ZZ1A 5IB5A 2OZ4H 3HI5H 2FZ3B 3RWEB 5JO5A 1G7MB 2QJDA 4XHJC 1U6AL 3F5WB 2XKNA 1OM3H 3ULVH 2HKHH 1FNEB 1DUZA 3DXAE 4M7LT 1P53A 3WFEL 3UJJH 4G7YH 3OG6B 3PQYB 3PNWB 3TBSA 3FRPG 5IGXL 4OI8A 1RZ8A 5I1JL 3GBNH 4LLUB 4XWGH 4Y4FA 3BXNB 1S9XA 5DZOA 2D7PA 4PJFA 1B4JL 3EOBB 5SWSE 1MVFA 3SDAA 1FGVL 3AS2A 4LCCA 1OTUD 2EDBA 4Y0GA 3T3PF 4U1HB 4G6AD 3GSXB 1QLEH 5F89B 5AD0B 3CXDH 4HCRL 2YUXA 4ERSL 2VIRB 2IH3B 2AJSH 3TIEA 1KTKE 5FA3B 1NCNA 2OL3L 1UJ3C 3SPVB 3QUZB 1MFEL 2DQJH 1G7JB 3HZVA 4PJ8B 5FUZH 3A6BH 5IV2A 2AK4B 3T3MF 4WWKB 1MI5A 3MLRH 2MPAH 2XPGB 1KXTB 5TFSL 3KXFE 3UTTB 3U30C 5F9JB 2X4PA 1MCCA 4F3FB 1I1YB 4XNYH 2B39A 2ATKB 2NY4B 5CS7A 3CC5B 3LMJH 2CDEB 3ARFC 5ALBH 4QRSB 4YE4H 3RIAK 3TBWA 5IBTH 4NC2B 2BVOA 1KYOJ 3ULVF 3OG4B 2R8SH 1J1OL 4GH7B 4U0RB 4KRPC 1FG2B 5D7LD 2OZ4L 5CWSB 5J8OA 2XQYG 4U6VH 1I9IL 1EBPA 4KJQD 5F7NC 3FOMA 2Z91B 1NMCB 4LGRB 1VDGA 4DJMA 4NN7C 5HI3C 1I8MB 1MWAL 4DZBB 4NRZB 4WW1B 2V7HB 3O3BA 3KPRE 3U0PA 1WZLA 4GSDL 2EEAA 3W11C 2JTDA 4HEME 1RMFL 4JO1H 5DJXA 2XKSA 4UTAL 1Q1JH 4EEEA 5BV7H 1BQLH 3GFUA 3GBNL 4UAOC 1PVHA 3DXAD 2R23A 4MQTB 1CICD 2P49B 5E24E 2PR4H 1ZKAA 3WSQH 1NSNL 4FMKA 5E8PA 1XF3A 5IJVA 4OB5H 2AJSL 5D7IF 1NC4B 4G42A 4LSQL 1MIEL 4I0PC 4JM4H 4PJDB 3C08H 1T66D 1NH6A 4PLJC 3VGBA 3E2HA 1K6QH 3P77B 4JDZB 4J12A 5E2VH 5E4IA 1IC1A 4WI5A 1SMAA 3LQZB 2CK0H 3RL1A 3BMWA 4I77L 4HPYL 1BJMA 4JLRB 4L8SB 5BJTB 3ZKND 4MNHB 1B0WA 3EYFA 1RHFA 3OKNA 5ADPH 3QXVA 5TGBB 4EDWL 1D5XB 2DLFL 1J0JA 3KXFD 1GSMA 1DN0B 2XTJB 4X6FB 5IBTL 1I7UA 4PJCF 3W39B 1KULA 1YN7A 5CGYC 2R8SL 4EIGB 4TYUA 2VH5L 1AD9A 1CLZH 4MYWB 5JLZB 5JTWA 3UTPE 2DRUA 1N0XH 3WLWC 2ATPB 1ZLUH 4UQ2A 4QRPE 2PKDA 3IB4A 1XF2B 4JGJA 4GBXB 3UTZB 1EZVY 4XBEH 1I7TA 2EH7L 4MCYB 4XNQB 3RWIA 3UC0L 3LIZL 2JLLA 4J8RB 1FFNA 1A3RH 1RJYB 2KQMA 1T83A 4P46B 4PY8I 4CU7A 3TN0A 1UC6A 2CO6B 1H5BC 3RVVC 2FWOB 4PRAA 2OI9A 2JJTC 4O2EA 5DLMH 3KYMB 4OFYA 3TJEL 1EH9A 1HKLL 4FQXC 5IT2H 4ZTOH 2EKJA 4R7DB 4U31A 1HHIA 4QY8A 4CADA 1FAIH 1YEHL 1ZT4B 1QQDB 4CVXB 2HWZL 2R1WB 4PGBB 1JPSH 1K6QL 3PQYD 1NJ9B 2CRYA 4L3EA 2YPKA 2O5YH 2R29L 3RGVC 5IROA 2AXHA 5SX4I 1UJTA 2A6DA 3NIDE 3HI1A 3DMMB 1YEDA 1F4YH 3MV7A 2VB5A 4PJDE 1INDL 1FG9C 1ZV5A 1N4XL 2DQDH 4K9EH 4GG6F 1QYGH 1WBYA 3FO9A 1D5MA 4WI2A 2P5EE 4DGYL 2CDFB 4OZHB 1PX4A 2R4RL 1CGVA 3VXOA 4E9LA 2VDNH 4ZXBC 5LAXB 2UVEA 1JF6A 3QUZD 4MJIE 3TGXA 2DQHL 3OR7B 1S7XB 3FKUS 1MJ8H 2AK4D 4JHBA 4WWKD 1VB9A 4EUPH 4XX1E 5CFHA 2FIKB 2IADB 3AAZB 2XTJE 3E6FB 1SY6A 3LOWA 4PRPB 3UTTD 1U8PA 3CSPA 3CU1A 2NY4D 1DLHB 5EU6A 3VRIA 5I66A 2UYLA 1OGTB 4OV5A 2XZAL 3MMEA 3F6IA 5J6HA 3MFFB 1S9VB 4AQOA 5IESH 4PJXA 4Y5YA 5DD1H 2B1AL 3UBXG 3ULUE 2D9QB 3EDJA 1I8KA 4NP4H 1X5XA 1N5AA 4DKAA 4LSVH 2WQRA 4Q9BA 3RVWD 2PNDA 3FTGA 3BN3B 3FZUC 4YC2C 1NCTA 3NAAH 4QRQB 1MY5A 1VSCA 3HMXA 3QO1A 4MD0A 2ICWI 1KTRL 3I6KA 5IUSA 3H8NA 1U8MB 4NO5A 1JPSL 2Z31C 1KCGC 1QO3B 4ZPTB 5I71B 5DVNA 1P7KA 2X9XA 1Z9OA 1KIQB 1S5IH 3DUUB 2DKUA 1GC1L 4JG1L 4H5SA 1F4YL 4P99A 4A6YB 5ICYA 3WFHB 4WV1A 1T7XA 1ORSB 4K9EL 4JPKH 1NGQL 4PD4J 1G6RB 3ZSSA 2MQ0A 2AVGA 5EWIH 1NC4D 3OKKA 1Z6JT 4DKFL 4MQXD 4YHIA 4ZO8A 3QPXH 2YRPA 1JGEB 1MJ8L 4PRHA 1ZANH 4WUKL 4DK6A 2HFTA 1JMZA 1HWGB 5HD8D 3SBWC 1I1CA 4Y4KC 2VXQL 1NCUA 1OT2A 5J56B 4XMLH 5CD3B 3L7FA 3GJFK 4ZOEA 3F65A 5A3IC 4V3DB 1R3HA 4Y16B 2XTJD 2DMCA 3C6LC 1YQ2A 5E2TH 4HJ0D 4PRPE 5HPMA 3ARBB 2DLIA 2ERJC 1I3GL 2AGJL 4IRSB 4X6DF 5SV3A 3V79C 4RISH 4KHXL 3KYOA 1AFVH 4GKZA 2R0WH 3MO1B 4AK1A 1YDPB 3S3SA 4GBXD 3ULUD 1QSVA 2D7NA 2WUBH 1H8NA 4M8QB 3UAJC 5CIPH 3JUYA 5C0DA 4MAYC 4TUKL 3T4YA 1EZVX 3ZT6A 4NHCH 4TRPH 4NYLA 2BOCA 2G9HA 4KK6C 4P46D 5L2JA 2NY0B 2EDRA 3T0XA 3DIFB 2JB6A 3V52L 3SDYH 1QFWM 2P24B 4KRMB 2A9NL 4OQTL 5ACZA 5JDSA 4WJ5B 1IM3A 2NYYD 2P45B 5F6HJ 1YNKH 5HDBF 1AXIB 1YC7A 1P69B 3PHOA 1KB5L 1TQCB 1AKJB 2VLRE 4LSDA 5B38A 1IGFH 3DX9A 4LPUA 4LQ1A 2IAMB 5AYUH 4TTDD 1KNOB 1IGIL 2VAAA 3TJHA 3FO0L 4MVBC 5DHXB 3DMMD 2FRGP 4H1LA 2ZCKH 4WW2A 3TV3L 3D18A 1MRFH 5EZIL 3QIWB 3G9VA 2VL5A 4NZJA 4XXDA 2ADJB 2DIBA 3VA2C 1JPFA 3CVHA 3I02A 3WFDL 3KLAB 2WLZA 1S9YA 2A77H 4M3JA 2DTMH 4KDVA 4NN5B 1IKNA 4JPVH 1ZHKA 5DRWB 3KHOA 2Q20A 1DL7L 4LGPB 5EU7C 1EAPA 3LPFA 3T65A 4LLQA 5T3XD 5DJYA 3J8F7 1K8DB 3BPNB 4PJ9B 4PREB 2X1PA 1UENA 2F58H 4PRPD 3FFCB 2F15A 3WCYA 2UVFA 5DUPL 1CE6A 4JM2C 5I76A 1GGBH 2C5DC 4NO0A 3EJZD 3BKYL 5IQ7L 4XX1G 4U1SA 3RNKB 4YEEA 1K4CA 4ZS6C 3BPCA 1X9QA 1U41A 3IDUA 4MA3B 2DWEB 5I17A 1FL6A 5L0QB 3E3QE 3BZDA 1CDYA 3O81A 1FL3A 1U8HA 3ZE1E 4OSUH 2Y5TA 1LO2H 4Z7WB 2APFA 4D0DB 3GB7A 1IAOA 2X4OB 5ICZA 4R0LC 5IHBA 4JB9H 4N0YL 3D87B 5H8DA 1IGFL 1JPTL 3VFMB 1CDJA 2NY7H 5AYUL 2WIIA 43CAB 3KS0J 1EK3A 4IIQC 4TQEL 2ARJA 4ELMA 2K7QA 1UT9A 4FTVB 4CNIB 4XNXH 3TIDB 5FM5M 4URTB 3BPLB 1DBMH 5IMKB 1CTOA 2E9IA 1LP9A 3SGJA 5F1NB 4PYGA 3OKDA 2EO9A 1CGWA 1MRFL 5IB1A 2YZ8A 2D4FA 1FZJA 2DDQL 3MGTA 3KDMB 4HK0A 2IFFH 1KLGB 3DJ9A 3KYKL 5IVZA 1MFAH 5J1AB 2VYRE 3Q6GL 3D0LA 4OI9A 5DMJB 3C5JA 4KPHH 4LFHD 2CKBB 5K9OB 3IU3A 3MXVH 4JR9H 2HH0H 4BH7B 4PJEB 1ND0A 3HN3A 3TVMC 2NTSP 1FNGB 4XNMB 5BXFB 5CBAB 4KVCL 5F88B 3ZE2F 4M7JL 1XCTA 4ZUVA 1UZ6E 2ICES 4XXCA 4UT6L 3GBMH 4YO0B 4NM8H 4JHAL 4Q58C 5F6IC 4KHTH 5FOJA 3DRTA 2I27N 1P7QA 3WE6A 1FYHB 4Y16D 5JXAH 1T1YB 5FO8B 1BOGB 5C8JA 8FABB 3OPZH 1W72B 2GQHA 3ARBD 1HH9B 3PL6A 4IRSD 1I7ZA 1DBAH 2DLGA 1BD2A 3ABZA 1ZLUK 1YEIH 3VFTB 1MPAL 5JZ7D 2Y25A 3MRJB 1Q9KA 4PJDF 4Z5RA 1Y0LB 4OSUL 4E0RB 4JO4L 1NUNB 4X5XB 5H94B 4JE4B 2XZCL 4LP5A 4WUUB 5GGTL 1QG3A 4M61A 1FO0B 3F6LA 3QJHB 4G8GA 2FEDC 4YZFE 2P5WA 2NY0D 5BS0E 1NAKL 3VRLF 2G60L 2HRPL 1DBML 3ZKQD 1UACL 1CE1H 4GLRI 2DQTL 4PGEA 4MQ7B 3ROOA 5HHNA 3OHXB 2OLDA 1T1WA 3FQRA 5D7SH 4MS8A 4I18C 5F93C 1T1ZA 4JAMB 4F7PA 4OF7A 5AZ2L 2DQUH 3Q3GA 3O2VH 3P30L 4D9RE 1VFAB 5E5MA 1JFMA 3MRBB 1AKJD 3GSVB 4UV7H 3JWDC 2PUQT 3TZVC 3B83A 5D7JA 1UB6A 1EO5A 2BNQB 2IAMD 1IC4L 4FG6D 4TSAH 4XPGH 4HJGA 1NDMA 3JWNC 3ULUF 2VLKA 3NPZB 4PTTB 3RZCC 3U36B 1HSAB 4MXQD 1AD0A 1LEGA 1UZ8B 3GBML 2JCCE 4TN9A 4MA8H 2IPTH 3OB8A 5D1ZB 1CFNA 3QIWD 1ONQB 5T3ZL 4KHTL 4Y2DC 2CMRL 4PJEE 4ZQKB 1ZVYA 1A6VL 1VFOA 2W65B 2L7JA 5JMRA 4HUMB 3L3IB 4XCYA 4NNYA 4P5TA 1X5ZA 3OPZL 5AZEH 3FB7A 4EOWL 1VACA 4GKNA 1FZMB 4LPCA 3BGFC 4EXPX 1DBAL 2VABB 3ARSA 4LFHG 5KS9E 4NWTH 2NZ9D 4KWUA 2WINB 4PJ9D 1MRCH 2COQA 3GSNH 4EQ3A 5JIPA 3FFCD 4NNXB 5D70H 2BNUB 5I8EA 1JYWA 3BMVA 5T1DL 2P44B 1U3HB 4HWUA 1AGBB 2VLMD 5TH2B 2NNAB 4LF3A 3I6LE 2OJEA 5KVDH 5GHWH 1VHPA 4I5BA 4NZUL 1EFXA 1RU9H 2AV7B 3DVNA 1G9MH 4UBDD 1NANH 3D48R 4OZHF 1E28B 1RJZB 4D8PA 1II4E 2HAZA 3CFBB 2BNRE 3BE1L 5FKPB 3WUWA 5E56A 3EO0B 2R4SL 1KPRA 4RMTA 3FO2B 1KTDB 5I9QC 3S36H 2FO4A 3VD3A 4UDTA 4GRLC 2OZ4A 4Y1AB 3EYSH 3ZYJA 1CQYA 4TSAL 1ZHNA 1ZGLM 2PXYB 4D0CA 3H3KA 4FTVD 3NZHH 1QBLH 1F13A 2BSTB 1MWAA 1TPXB 5DMYA 1XIWA 4MA8L 3EUUA 1AQDA 1T22A 1UM5L 2VQUA 2VXTL 2QQKL 1DDHA 1KYOK 5I1CL 5F7UA 3ULVC 3LKQB 1U95B 5DUMH 3WYRA 1HIMH 3C5SA 4LCWB 4YK4B 3SY0A 1S3KH 3NTCL 1JK8B 3MR9B 4MD4A 4NNPH 5IVXA 4IRJA 2R1XB 1OP3K 3QRGH 5DVKA 4N5UA 1H3GA 3QNYA 4LHUB 4OUOA 1RQ5A 1P7HL 3QHFL 4Q6IA 5KW9L 1EPFA 2V6HA 5L7XL 3PHQB 3LN4A 4MB3A 3D3VB 2C3VA 4B50A 2W0LA 3CMGA 1BF8A 4NJAH 1QFWI 1H3UA 1QSFB 3L1OL 1QPXA 4WVRA 5CEZE 4WO4A 1MJ7H 3FOLA 1J8HB 2A0LC 1F97A 4PJGE 1DQQB 2C7UB 3CVIH 4POZD 4GJTB 2MMXA 3N85H 4U0QB 2WQ8A 1FL5A 3V4PH 4P2OB 3QUXA 1F6AA 4Z77A 1NC2B 3GSUB 4F2MB 2BVTA 3I6LD 5AWNH 3KLDA 4CN4A 3M17A 4ZSOA 1DQJA 4DVBB 1RUMH 5F9AC 4HEPG 1T20B 2IG2H 4HKXB 4RAUA 4BZ1L 5JXED 3VXMA 4MAUH 2EH8H 3MRFA 3S36L 4WUUD 1EHLL 4O2CA 4J7RA 3IT8D 1R3IL 1BWWA 5J4MA 2ENSA 3SDDB 3T8XB 5FDWB 3NA9L 4HV8B 3DV6B 1LQSR 2IPKA 3X13A 1D6VH 4KK9D 4ZFOB 4YXKL 5I1DB 2O93L 3ZYZA 3TPUA 3HR5B 5HDLA 2NY5H 3CZJA 2G5BB 3VXPA 4GRWB 1QRNA 3H7BB 3VXNA 1GAFL 3GMRB 5GSRA 2NY3B 3VWJB 2QV2A 4IDJH 4P23C 2BNQD 5CEYB 3VXQB 2ZWLT 4CGTA 2Y9RT 2D7MA 4MWFA 3VGAC 4HWZB 4AZ8A 4FQLL 3WN5A 2EDOA 4X99B 3M1BA 3ZE1F 5CHNA 5FO7A 4DCQA 1E4XH 3K4ZA 3MUGA 4OIBA 4X7DC 1QFOA 1MJ7L 3D6GA 1WISA 3HAEH 5ACMA 1UWGH 1YEKH 3N85L 4M3KB 4ZOCA 3AFLA 5KSAA 3V4PL 2APTA 4WENB 4LKCA 1P5VA 1AO7E 5ESQA 1SM3L 3ARGA 5DJ8B 3O3AB 3MRGB 3C6SA 3BKMH 4RFEB 1SYVB 3KR3H 4W81A 4JZOA 5K9KB 5HYFA 4JRYA 5F3BA 2V2WA 4P4KB 1N2RB 3BJ91 1EEUA 1U8IA 3FB5B 3MLVL 4C54A 5DRZB 2OXHA 4OQ1A 4X6CA 4JQXC 4O58H 1G1YA 3RNQB 3U1SL 2F74B 1EFQA 4K2UH 1NCAH 1U8QB 1NUGA 5DC0A 4Y19D 1FFPA 4TSCH 5CBEB 2XTLA 1OP9A 2MFNA 3I3DA 1LK2A 1Q0YL 4OD2B 4XGZA 4ZAKB 2E7BA 5ESAB 1OTSD 2EO1A 4X7SL 3NPSB 5DC9B 4LEOB 5DJ2A 3VCLA 1T1XA 1A14H 4W4NA 4Y1AD 2MHAB 4OJFL 3SGEH 1KFAH 3G04A 2J6EH 3GMNB 4FQQA 1U8KB 3T4AB 4HMDA 2PXYD 3T0AA 3JZ7A 1EERB 1P5UA 2WMPA 4JKKA 3P4NB 1X5HA 2BC4A 3ECBA 2RAMA 2VNCA 4O2FB 1R5IA 3OAUH 1UM6H 3PV6B 1ZLSL 5D2LE 3GKWH 1OTUC 1CDBA 2R2HA 5DYOA 4G6AC 4LCWD 3LDBB 5FA4B 4K7FA 4LU5L 2XXMB 5JW5A 4KV5E 3VFOA 3LKRB 4Z7WF 5DJ0A 4HW6A 2OS7A 4LHUD 1YMHB 2HA1A 1KN2H 3BKML 3LB6D 3MPCA 3NN8B 1HI6A 5DQJB 5I1GL 3D3VD 2CLVB 3MV9A 4GG8A 4K71B 3NFNB 4APQB 3AU1B 1NBVL 1M7DA 1QSFD 4NKMA 5IB2B 2YK1L 4CVUA 4EUPA 3O2DL 1J8HD 4PJIB 4O58L 1KLFA 5MERB 4OZFH 5FM4A 1ZA6A 5C0BB 4PJ7A 5F7EL 1NAMB 1OSZA 2IBBA 4P2OD 1YN6A 2VO5A 3PABB 5KANI 1NC2D 3QULA 5GRJL 4HUVA 2DBJA 1T2QL 4NPYA 4JY6B 4HQQH 1YUHA 2Z8WC 4KJQC 4M48H 1NMBH 4PJEF 5DVLA 1I3RB 3EDDA 1FRGH 1H15A 4YEFA 2RHEA 4N5EA 3GIZH 1QBAA 3BZFA 2XRAL 5DDHA 2BCKA 1MIMH 2Y23A 3SDDD 5DK0A 3O6KH 3P0YH 5A43C 3KPQA 5B3JF 3L3JA 3WHXB 4X6BA 1X3DA 2Q3ZA 3ZT7A 3ZYOA 4CMMB 4FABH 5JDJA 2CXKA 2ZSWA 4WI9A 15C8H 1CICC 1FYTA 1KJ2B 5KN5A 2DI8A 2W07A 3EOYG 1OP5K 5DRXB 1ZEAH 3ROLA 2AJVL 3FQTB 3HC0B 2NY3D 5IFJB 2EYSB 5INDA 3VWJD 3P3YA 3BH9B 2MCG1 1UADC 4PG2C 3VFWA 1T66C 5FB8B 3FQNA 3I6GA 1WFOA 3QI9B 3T04D 1GH7A 3QA3A 5F9OH 4POUB 1KB5A 1MHPH 5DJ6B 5JOFB 1SJVA 3AS1A 5JIIA 2FHBA 2P48B 1FGNL 1HNGA 1KIRB 2VISB 4UNUA 3D69A 1F2QA 3ZKNC 5FOBB 3OGOE 5TF1L 3AC0A 1NGWA 5DK2B 4OCWL 3EOTL 1T0NA 1OGAB 1AIFB 4P3DB 3KVQA 4KK8D 5HGHB 1DQMH 4AIZA 2R9HD 2ARJQ 2AABL 4B7LA 3MUJA 4OLUL 1VFBA 4AIXA 3AVEA 4LHUG 4P4KD 2AW2A 4QHLA 5C0BE 3WFBL 1QA9A 1QSEA 2NXZD 4JJ5B 3WXWL 1FV1B 1SEQL 3AS0A 3LSOB 4FQIL 3GIZL 3ZDYE 4UIMB 2E6PA 2GT9A 3H3PL 5FUCC 5HHQB 3WHE0 1MIML 4YX2H 1J1XL 4LLYB 1RZKH 1KPUB 3PWPA 3HNTH 1A6PA 3GSOA 3P0YL 3OR6A 5CIPA 5DWUH 3TH4T 3W0WA 4PJHA 3LRSA 4RIRB 4NKOB 3JBG7 3T77B 1WZMA 1RK0A 1S7TB 4HHAB 3ILQD 5E94A 4UDUB 1ZSDA 2JB5H 4M6MH 4P5KA 1ZEAL 4CVWA 1N8ZB 5D2NB 1XGPB 1ITBB 5BZDA 2D7TL 3NFPB 3V6OE 5KTEH 3LS5H 4HT1L 3QUML 2ADIA 5CP7B 2X7LB 3CH8A 3VXRA 5CLTA 1N26A 2Q7YA 4OLYL 4WTWA 5EDXA 5JUEL 1RUAL 3MJGX 1AC6A 1RJLB 3L3KA 2GIYA 2IMNA 2P8LA 4X5WB 5T1KD 4NZTL 1A9EB 3QZWA 4MX7A 3PGDB 1AR1D 1U42A 5I8CA 5K9JH 2OYPA 2BY3A 4H0HB 3ARWA 4NQCA 4NQVA 1NBZB 1PX3A 3EYVA 4LNRB 4XNUL 3NIGF 2MTPA 5MEOA 3QUZC 1EIBA 3BQUB 5IHLB 2IANB 1MCLA 4WWKC 4K3DL 4LSPL 3IF1B 4LSSH 2F5BH 3ALXA 5DJAB 4N0FA 4RNRB 5KSBB 4U05A 3WD5H 3QSKB 1L4IA 5JW4R 1JV5A 1K2DA 4APQD 5I16A 3SKJH 1BM3H 1FFOB 4J6RL 2DM4A 1CL7I 2NY4C 3ARYA 5DEZA 5GRUL 1M7IB 3GIVB 4L4VB 2CUMA 5C0BD 4HBCL 3VRJB 4TNWK 4HXAL 1A1MB 4HKBA 5EOCH 6FABH 2FO1A 1N59A 3CPLA 1U8LB 5I8KL 4U0RC 1JJUA 5DHYA 3C2AL 1MLCA 1WF5A 2VDPH 3FFDB 3HCVB 3MUHL 1TJHH 2HT4D 3RVWC 3X3FL 4AG4L 3ZSTA 1A1OB 3GI8H 3MJ8A 2E7LC 1NMCC 4LSTL 3CZFB 3K46A 4NDMA 5IMOB 3H42L 4GRWH 3B9KB 4RAVB 3GSQA 4YAQA 3LS5L 3QCUH 4M7LH 2FBJH 1PLGL 1C7SA 3F7PC 1MJJB 5C1MB 2W9DH 3C8KB 3K3QA 3ZL4H 5D2NE 4LNVA 4M93B 1FORH 3X3GH 4BA8A 2LVEA 4HSQA 1FAKT 2AXGB 2R2BB 3G5VB 5MENA 1KC5L 4RRPA 3SE9H 5JQHC 4IHOB 3CLEL 1ADQH 1T5XA 3RWDA 3HPJA 5T5NG 5TDOB 3R1GH 4RQQA 5T1LA 5ESVA 4MCZA 3TO4A 4MQXC 3VXUA 5D1XB 4WI3A 4YH6A 1C1EL 1DFBL 2FGWL 3QI9D 2WP3O 2X70B 2B20A 3BHBA 5BW7C 5EPMB 3BWAA 4XPFH 4YDLB 5AAWA 5E8NA 2B0SH 5HD8C 3WD5L 2XWTB 3O4OC 5CMAA 4QKXB 4L8SC 3TM6A 1A4KA 1T89C 5F3HA 5DJZB 2IANE 1AGEB 1T0PB 5IMLB 3BGMB 4OCRH 3P4MA 1EEZA 4LSRL 1OGAD 2XTJC 3AREB 3OSKA 1CZ8L 4R4ND 1PZ5A 5KSBE 2J4WL 1S5HA 3MJ6A 1T7VA 4HJ0C 2BY2A 4GRWF 1YYLH 3HS0A 3CCHB 5IHZA 4NQEE 3PWUB 5GS0D 3ELAT 2VDPL 3TBTA 2A6IB 3ET9F 4P9MH 3RTQB 5DJCB 5KG9A 1BZ9A 3FB8A 2BERA 5HYQA 3OXSB 4GBXC 3ULUC 2P4AB 1HXYB 4X4XA 1PKQA 5ISZA 2FECI 3KPPB 4F37F 1X5GA 3QCUL 4YHLH 4I3GA 4KV5F 4M7LL 4DGVH 4Z7VA 2FX9H 3EIFA 4P46C 2K9UA 4L4TE 2AEIT 5IEKA 3ZL4L 4ODXB 1FORL 4RWHA 2ZCHL 4EN3A 1A7BA 1HDMB 1K3ZA 1I8IB 4P9HH 2HTKD 2VDQL 4J2XA 1ADQL 5BVJB 2NYYC 1MQ8A 1RZJC 2V9QA 3R1GL 3IXAB 3QEQA 5CSZA 4XCEB 4HUKB 4XP4L 4G9FE 3MRQA 4MHHI 1HSBA 1J86A 1KJ3L 3V5KA 2PW2B 4GQPH 3S3JA 4TTDC 1KCRH 5EU5B 1KTLB 3IDIB 1BZQK 4LSUL 2AJYH 5DSCB 1JHKH 5BVPL 1AXSB 1X4XA 1SYSA 1V7NL 2D9CA 3DMMC 3P73A 2JIXA 4QOKB 5JIKA 1HHGA 3NA4A 5DEGB 5E8EB 1NFDB 3MRMA 1JF5A 1JGUL 5HHME 2H32B 5K59E 5FYJE 3LH2L 2V2XA 4S1DD 3FQUB 4W6WB 1ACYL 1I85C 3BQUD 5T5NF 1I9JH 1NAMH 1OAKH 1YYLL 1BBDH 1ZMYA 2IAND 1Q9WB 3FQXB 4J3UA 5BRZA 3WS6A 5GQBA 4YIQB 3S34L 2BVEA 3MNZB 5DQ9A 2YD6A 4NQTA 3QQ4A 3VFNB 4HIHA 1T3FB 2XWJA 4L4VD 1BX2A 3RL2B 1OARH 2FX9L 3EJZC 3T0EB 2VDLH 2VR4A 2PYEB 4OKVB 3W9DA 2DIJA 1OAUH 2ADFH 5E0QA 2DMKA 3GMQA 1KCUH 1I1AA 3HUJB 3NOIA 1HYSD 3EZ8A 3F58H 4N0RA 3T1FB 1UEMA 1V8HA 4JFZH 5DD6B 3DSNA 3X12A 1FDLH 1RUPH 4Y4HA 2VQ1B 2XZQL 3G08A 3MLSH 4UOW1 3ZMRA 3B9KD 3BVNA 1F45A 2X4SB 1QR1B 3MGAA 4F7TB 1EVUA 4XP6L 3BYTA 1G0DA 3OQ3B 1IFHL 2M1KA 5D6DA 1B2WL 4GRMB 4X4ME 4WHDA 5I71C 1HCVA 4NQSA 4PJIF 2UWEA 1EA9C 4WTZA 4ONHA 4PJBE 2I9TA 5B39B 4YHMH 2D03L 3K81A 4JFDB 3MA7A 1W0WB 1YY8A 3MLWH 1KB9J 1Q8MA 3MRCA 2AI0H 2A74B 4ZYKA 2OSLB 3I75A 1G7PB 1OAKL 5D1XD 1BBDL 1A1NA 1JTPA 2FH6A 4PJAA 1XGRA 4KTEL 3RA7H 1WAAE 5FYJD 1NFDE 5GZOD 4Q97A 5A2JH 2WZPD 4OF0A 3UPRA 1JGLH 4OCLC 2QQNH 5GIRA 3RY5A 3ISWA 4LVEA 5GS0H 5GGRB 1U93B 3B4NA 3QPQD 3VXSE 5L2KE 1EUTA 2ED7A 3G6JA 1A22B 2AJZB 1CFVH 5ETUB 2YRZA 5B8CB 4XB8A 5I73B 1KBGL 4Y16C 5DJDA 1S7VA 4X9IA 4YBHA 4D0BB 4QXGH 3VI4E 1IGJB 2QSVA 1JNNL 5ITFA 5C07A 1C8PA 3ARBC 3W9EA 1R24A 4IRSC 3CFKA 3DI3B 3RTQD 3F58L 5JZ7C 2XN9A 3QHTC 4ZUWB 1RUPL 4PRBA 1UQSB 3MLSL 2PYEE 3V7AG 3E3QC 5DGQA 5IW6B 1YPZF 1JRHI 1FJ1A 2X1QA 3T08A 4AENB 2GFBA 2ZCLL 3VFUA 3DWTA 4PG9B 1QUNA 1R5WB 1MFBH 2NY0C 3V8OA 1ZLWK 2WANA 3ULSB 1LE9B 2Z92B 4BZYA 3GBLA 2FJHA 4DW2H 4BKLA 1JHTA 4LKXA 1HYRC 2W0FA 3CFCH 4NGHL 3HE7A 2YHGA 4YHML 2J1KA 2VXUH 1FNSL 4OZGE 1VGKA 3MLWL 4FFWD 4LLMA 2G2RA 1WT5C 1MOEA 1HOCB 5B4MD 1TQCC 5EO9B 4PY7B 4QRRB 3H0TB 1X6LA 5HVFB 1W8NA 4MNGA 3DGCR 3UO1H 2IAMC 1A21A 3GMOB 4FG6C 3GUTA 2XG5A 4OZIA 3TH2T 5FF6B 4ZD3H 1SJHA 3G5YA 1QACA 3QIBB 4MXQC 4ODSH 1HQ4A 2EICA 1UWEH 2I5YH 2Q8BH 4WHYG 1BP3B 1OCWH 2NY5C 4MA1C 4QOKD 4G6JH 3WNKA 5EU4A 3QIWC 1OAQH 5IB4B 2OK0L 3QFDA 4FQJL 3JV0A 4FZ8H 4HKZA 5EULV 1OQXA 2I07A 5TDPB 4NN5C 3LKNB 4M4RA 1MHCA 1P2CA 1G9NH 3GMMB 4H0GA 2JJWA 5MEQB 2JKXA 3T0BA 1G7HA 1X4ZA 2NZ9C 3V6ZA 4TNVF 3HAEA 3C5ZB 1F3DH 3UTQB 5I1AB 1MCNA 4R2GB 3H9SB 3BPNC 3OB0H 4PJ9C 1MELA 4C56E 4HGWA 2KQNA 4LAQL 4LQFH 5EC1B 2H2SD 4GUPB 5KAQG 3IDNA 1JWMB 4NHUE 4NBZB 2NTFB 2Q8AL 3T0ED 4I2XB 4TVPE 1B0RB 2CGRH 2PYED 1MFBL 4NQDA 1I1FB 1CG9B 2ZPKL 1RUKH 4WDIB 1KEGH 4UUJA 4WHYH 2WWKT 5L0QC 5TDNA 4UBDC 4NKIH 4ZNCD 3AY4A 4UT7H 1XR8A 3GSRA 5EO0B 1E27B 2VWEE 3P0VL 1F58L 3OXRB 2A83B 4GQ9H 4M1GH 3IFPA 3OKOA 4RSVA 3MV8E 4K8RL 3UO1L 3B2VL 2FX8H 3DLQR 4PFEA 1AE6L 1A6TB 4ZD3L 4G43A 1I3UA 1U2HA 2R1YB 4ODSL 5KANG 3QIUA 5L8KB 2C3XA 3QDME 3BPLC 1OCWL 3HB3D 5JW3H 3HTLX 4MJ6B 4QHUA 3MOAH 1RIVL 1OAQL 4AQ1B 5JW4Q 4NJ9H 3S96A 5HYJE 4JFDD 3EGSA 1NCCH 5IB5B 3O45B 2Q86A 2W1NA 4YR6A 2XKNB 4OLVH 2BOBA 1QHPA 4OFDA 5E2UH 4CVZB 4RGNE 1FCGA 3LRHA 3P9WB 2EKSA 3V6FA 4U6YA 5K93A 5GPRA 5I0DA 2NW2A 3TBSB 1RZ8B 3A6CL 4LQFL 4FFEX 1S9XB 4P5MA 4PJFB 4U4BA 3G6AA 4U7MA 3SDAB 4LCCB 4IS6A 3FB6B 3I2CL 3LQAC 4XP9H 5EFIB 3O4LA 5EB9A 4POZC 1RZIA 4KZEH 1RUKL 3L6FB 2G5RA 1KEGL 3TIEB 4NKIL 4OZFA 4OIAA 1UWXK 4TVPD 1UEYA 3HZVB 5IV2B 3JTCA 3QUYD 4I2XE 5JXEC 1MI5B 4JPWL 1JVKA 3IDYB 5HVWA 1CBVH 4XH2A 5EN2A 4HLZH 3WDJA 4HUNB 4YHZH 3MCLL 4QTIH 1TCMA 2FX8L 5KAQF 2X4PB