3WS6A

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws6A01
3S37H 3QIBA 4P4KA 3X11A 4JFHD 5GPRA 4X5LA 3O9WB 3BZ4B 5JA9A 1NFDA 4HD9A 4FQPA 1FN4B 4KVNH 4PRHA 4DW2L 5E5MB 4NHUB 2PO6A 3QZWB 4QXTB 4Z18A 3QP3A 2XTJC 1S8DA 3HMXL 5LBSH 4OGYL 5KSAB 1HQ4A 3ULUL 2UVEA 4MJIB 4Q2ZA 4U05A 5I1HH 4NYLB 1C7SA 2Y23A 5GXBB 5J4MA 4R2GD 2P5ED 2A6IB 3QCVH 3RWGA 1BQHB 4PGZA 4YE4L 3WFHB 1VFUA 5DS8B 3ROLA 2MQ0A 2X4OA 1KPVA 2E6QA 3DX6A 5C0DA 2ICES 1GZQB 2VXUH 3OKEA 4IMLA 1JI1A 5C0ND 4C83B 3EYOA 1T7ZA 5I73C 4ZDHB 2BXYA 4NZJA 5JW4Q 3R1GL 1KTLA 4IHOA 2R8SH 4F7MB 5F1OB 2J8UB 2AJZA 2J5LC 1K4CB 4PD4K 1QG3A 1F90L 1YMHA 3UYRH 5IQ9A 4N0CC 1UACL 5IJKC 1KLUA 4O00A 1OGAB 4CADA 5FO8B 1HKLL 25C8H 2YMXL 2FATH 3W11C 4FP8H 2CH8A 4OGAD 3HPLA 4QHUA 2I5YL 2VZ1A 4XB8A 2QSCH 2MCPL 2KBGA 4JRYB 3A6BL 3TPUE 4WWKB 4HFWB 1ZVSB 4FXGB 5I6XC 1PZ5A 4YHZL 1T0NB 4C59B 3VI3F 2X7LA 3T77A 5F7KC 5ERWB 2NY0D 3VRLE 5FCUH 2D7MA 1CDIA 1LQSR 2EKSA 1B9ZA 1D5ZA 1XGTB 2O5XH 1IGML 5C08E 3KPLA 1OAZH 5SWZD 1W0VB 2MWCA 4ZFOL 5T3ZE 2X4SA 4AMKH 3TO2B 4Q6IA 1TPXC 1IGJB 3GSXA 4FQXB 2VZOA 5GGTL 4DUWA 4HIEA 1CE6A 4WFFD 1TZIA 2FJHA 2H1PL 3NGBC 1ORQA 5ICZB 3BVNB 1FG2A 1CTNA 5E95B 2YPLD 1L7TL 1NDGB 2FJFB 2MKWA 5LAXB 12E8L 5K59E 5ALBL 5KSUB 5HDQH 2GK2A 5EU4A 3RWHA 2F53A 2ICEB 4JZJC 4G6ML 3BUYB 1M6OA 2GHWB 5F6HI 5BV7C 4YH6A 4CN1A 1AGEA 4PJ5A 1A6TB 2DQDH 1NAMA 3N9GH 1XF3B 3LRHA 5FGCB 4AL8H 1INEH 2CUMA 1PKQE 4OCYL 5E1AA 5KTEH 1MREH 2NNAA 3D1MC 5E7FA 4U49A 5CBEB 3MREA 5CKGA 4KMTL 1R5IB 4YHNA 1NCTA 3BP6A 3QEQD 3RWEB 1DBBL 1K4DA 2B1AL 5F7UA 5K9QI 4NJAH 4S1RH 3C8HA 3ZKXC 4NO0A 4P99A 1YPZA 2EIDA 3ZL4H 1IKFL 4LVNB 4HEPG 1AIFB 2NZ9C 4LHUD 1BVLA 1CFTA 1UB6A 3CX2A 4G5ZL 2G60H 1N26A 1NGWB 3R8BB 5GRJH 4RX4A 2VZSA 5AAWA 4A2LA 1WZLA 4GRLC 4PJFA 3QXAA 4PJCE 5AYUH 5AZEL 1TCRB 3HLAB 4L3EB 3TO4D 1BPVA 2DAVA 2BSRA 3PWLA 3TA3D 3MRCA 3PWPE 4RAVA 3CCHA 3X3GH 4I13B 4CN4A 3BOVA 4OI9A 2JB5L 2JE8A 1IC7L 4RRPG 3CGTA 1D6EB 3SO5A 5ICYB 2H2PD 4PV9B 1FZKA 5DD6B 4E42A 2Q7NA 2BSED 1RFDL 5CBAA 3QUXD 3TWCH 2OSLA 3HRZA 1OD7A 5IVXB 2BVQA 4Y5XA 5IFJA 5CLWA 2AEPL 1EEYB 4CNIB 1NC4D 5DSCA 5ESQA 3N1MC 1T89C 3NCFB 2P8PA 4PJXE 5JPNA 1BZ9A 1WICA 1YNTA 4UINH 4JVUA 1F11B 1LO2L 4MQTB 4NUJA 4QRRA 2BDNH 1FNGA 1TZGL 1YEHH 4IRSB 4FTVE 3GKWH 5K59F 1IC5L 1I7ZB 3WIHL 2G5RA 4U1SB 4XP6H 3A6CH 4L9LC 2R56L 4EDWL 3PWVA 3CXDL 2P44B 2HVKA 1INDH 4KROC 1GVIA 1XGYH 4WNQA 3QG7H 3GIZH 1U2HA 1MUJA 5J1SC 2XXMB 2AV1B 2EO1A 2X4QA 4M5ZH 3FT3A 4DEPC 3ETBF 4GAYA 4WUUB 2AEQH 3QQ9D 5D7JD 3IU3A 2X1QA 5I2IA 5D96B 1VFMA 4C58B 4OLYH 1YYLL 2X1OA 1XAUA 1U8IA 3U6RB 1RMFL 2F54E 4JCLA 1P7QA 4LSTH 3LZFH 1JYXA 3G5ZA 1T21A 1AQKH 2EDLA 4XNUH 3VXRD 1P69B 1WZKA 1UJ3A 4DVRH 5JQ6H 3PIQB 3KJ4C 1P9MC 1I8KB 3G6AA 1I1FB 3DETD 4F9LA 3IYLW 5IBTH 4YR6A 3UEZA 4BFIB 1PY4A 4QO1A 3NH7H 3SQOL 1NCWH 1CG9B 4YFEA 2K9UA 2R23B 4N8CL 3DI2B 5FM4A 4JFFB 1BIIA 3SKNB 5J13C 4LVEA 5B39A 2EDDA 1GOHA 1FL6B 1TVDA 4JREB 3BKYH 2NY5H 3GBNL 3ZMRA 3F7QA 3GB7B 5FO7A 1LVEA 2WW8A 2HMID 1ONQA 4JFQA 4DUVA 4XBPA 1T7YA 2EC9T 1H15A 1UWXK 2AJSL 3K4AA 3QO0B 3KPOA 2HRPH 3C6SB 3MRJB 4X9GA 3TC9A 4DGVH 1BECA 1YMME 3EZJB 5F8RC 4ODXA 3X14A 1O5DT 1PSKH 4PJXF 4JFOA 4JO3L 1J5OL 1MCEA 4WFHD 3RPKA 3AMLA 4Y16A 1MJ7L 4WW2B 1OW0A 1FV1B 3MR9A 3RY5A 2DIBA 1DBKL 1DUYA 1NDMB 4ZAKD 5FAAA 3LKSB 5HYJD 5T33H 5HPOA 4LF3B 1IT9H 1MIML 3LQAC 4ZPTA 1NMBH 3ILQC 4UIKH 3KLAB 5CMAA 1HKFA 1XR9B 1MI5B 1XGUB 3MRFB 3EOTH 5DO2D 3X13B 3ZYOA 2GW5A 5D70H 3UTSE 5IKCB 3S5LA 1UC6A 3TF7A 2P24B 2Z8VC 2IBGA 3ARBA 4WO4D 3QUKB 2GJZA 1EERB 1PEZA 1OLZA 4Z7QE 4PTTA 3STBA 1K8IA 1RQ5A 4J8RA 4Z7VF 3BQUB 1U8KA 3DV6B 3MYJA 2B5IC 3QDGD 3WJJA 5IB2B 2VDRH 5DA4A 3MNWA 5IIEA 1YUHA 3QDJE 1BFSA 1BWMA 4HV8B 4R4FH 5F7DB 1YEDB 4OT1L 5F7HA 1U91A 2JJTA 4DKDC 3IDMA 3MQIA 2P49B 5CP7B 4J23A 5GGVY 4E5XA 1E6OH 1AHWB 2Z31C 3QHTC 3CUPA 5BW7C 5I19H 5GZNC 1EAPB 3OKMB 5ADPL 3TT3H 2NX5E 3X3FL 4U7SA 3GBML 3KYOA 1FC1A 3QDMB 1RZJL 5JZ7C 2UVFA 1AO7B 1WTLA 1NSNL 2WWKT 2DN7A 4JY4B 3IF1A 4HWEH 4XX1G 1LWRA 3HNTH 4OFDA 5E2VH 4OV6F 1JNLL 1NL0H 1KIRB 1L0XA 5DRWB 2P5WA 3HG1D 3BESR 4RGNB 4ZOCA 4WI3A 2QKIA 2L4OA 5INCB 5M95B 2HG5B 1MOEA 3C8KB 3T04D 4DKFH 2GKIA 4KC3B 1LGVA 1JV5A 4FFYH 1ZE3C 3R06A 2NY3C 4ZO6A 1M05A 4KKAC 3CLFH 4DVBA 3QCUH 3DLQR 2I07A 4ELMF 4Y2DA 2ZCHL 5IJVB 4YWGH 3VH8G 1S7XB 4A2MA 2B2XH 1KC5L 1BFOB 2BNQE 1K5NB 1G9ML 4Y4FB 4KUCF 3MLPA 4WEBL 5C0GA 2WM0A 5EBLB 1QSED 3O4LD 5H94B 3B9DA 1KCUL 2Z91A 1ZLUH 3SPVA 1Y6KR 1QO3A 5JHDA 2Y72A 3MV8B 5EO9A 1A4KA 2EIEA 1QBLL 3V4PL 3QHFL 4AEHH 3Q1SH 3BDBA 1RZJC 2YXMA 1WAAF 3MRMA 3UO1L 2BERA 5DD5H 3HZMA 2FYYA 1HNFA 4HIIA 4V2CB 1X7QA 3QUYB 4Q9QL 2IQ9L 3QJHB 5EO1B 2ZUVA 3F7VB 2PF6A 4X6BB 1H0DB 1D9KD 4CVWA 2BSSB 5DJAA 5E8NB 1FQ9C 4KGLA 2CR3A 4N0YH 1RV6X 1HH6A 4IOFD 5JXEC 1EEZA 2NXYD 4RBPK 2G2RB 5DYOB 5C9JA 3QXWA 1RIUL 4J1UA 1U36A 1A14H 2AERT 1C16A 4HCRA 5CJXC 2GYSA 4CVXA 4WJ5B 3D39A 4GW4B 3FQUB 4Y7MA 3RJDA 3HC0B 4M6AA 5I1DB 3QIWD 4QRQA 1CGUA 5GRWA 3VFNB 2WY3A 4P2YA 5GSRA 3KPNB 4M6OH 4Z7NE 4X6DA 1G9MC 4LARL 3CVHL 4K71B 1KCVL 4OCSL 4IDJL 1TMCB 5TH2A 2ZJSL 3ABZA 4V1DB 2VXVH 2Z4QA 3T65A 3VD5A 3LHPH 4FG6D 1CDJA 3THML 1RZFH 4HUWA 5MEPA 4P5KA 2ZG2A 4YDKH 1ZT1B 1ZA6B 2GK0B 1ZLVK 5D7LA 1P5UA 3VWJA 5C8JA 1RZ7H 7FABH 4WHCA 2QQKH 1JPGA 3LRSB 5IB5B 2DYPD 4NKDA 3V6ZB 3UTPD 3OZ9L 5HHXH 3D2UD 2J6EA 2A73A 3QA3A 2BX5A 3QUZD 3TZVC 1MRCH 3SCMC 4NRYA 1I8LC 2CLRB 3QPXH 3TH4T 1FO0A 5C07D 3R8QA 3EDJA 4FQ2L 1VGKB 4HK3N 5IBUB 5D1QD 1TQCC 1UCTA 3GGWB 3FOMA 4OM0H 5I8KH 4MSWA 1U92B 4OUUB 2E8YA 1CDHA 1OB1B 2J2ZA 5HXMA 3T0XA 4LGPB 1UM5H 3MLXL 1QVOB 3ULVH 3QNXA 3D18B 4HS6A 4FHBD 4J3VA 2AGJH 3DARA 3GHEH 1U93A 2QHRH 3BO8B 3FFDA 3MFFB 3QQ4A 4C56D 5HDBE 5C6TL 1T3FB 2RHEA 1Q9OB 5DMIL 1IAOA 5EIIB 5JHLL 2DQCH 1YDPB 3HS0A 4V2BA 1QP1A 4LKXB 2F74A 3TPKA 4JB9H 3FFCD 1RJLB 2CR6A 5IHBA 4OIIL 3HE7B 4Q6YA 4MLSA 3FOLA 2BVOA 3DURB 1UJTA 1DQJA 4QNPE 3WSQH 3QH3B 1XIWA 1J1OH 3ULSB 4TSAH 4FQLL 2YEZB 5FYJD 6FABH 4IS6A 5A2FA 4L29B 1G7QA 3F12A 1QSFD 4G42A 3ARSA 4O51B 3SDXE 4MXWL 5E4EB 3L3OA 3T09A 5CILL 2MOVA 3F6LA 1ZLWH 2EC9U 2HVJB 4LCWE 2CDGA 1CVSC 1DEEA 3LEXA 3JWNC 1V05A 3FB6A 2X41A 3VGAC 1T7XA 4EI5C 2BCKB 1LD9B 3ARFD 2Q76B 1NFDB 4HJ0C 4TULH 4PRHB 3I6GA 3TBSB 2R2BA 3P30L 4JGJA 1CFSA 5HI3C 3C5ZD 4N5UA 3G5VB 4I48B 3WFBH 4NRXA 3DRTB 1HQ4B 3VA2C 4Q2ZB 5I1EL 2NZIA 2MPAL 3JUZA 3GMNA 1I7TA 3RWCA 1FAIH 4WFED 5D1ZC 4X4ZA 4ZTOL 1CICD 4P9ML 5CGYC 2YD6A 4K3DH 1GGIL 4OBRA 4FRWA 3V52L 4FQCL 4F58H 5KN5A 5D6DC 2X4OB 1YEGH 4YAQA 5I30L 2APBA 3SJVA 3BIAX 3DX6B 5C0DB 3DVGB 3B5TA 4JPWL 2Q7YA 2ZG1A 2YD7A 1CLZL 4P23D 3S34L 2EYRA 2EEAA 1U8HA 5HDBF 1G0YR 4HWZA 3H9SB 1SEQH 3IJHA 3LB6D 1IQDA 4ZUVA 5K9QG 5KOVC 1F4YH 4M6NH 2VH5H 3ZYZA 1JN6A 2VLJA 1DN2A 3N1QC 4OD3H 2AJZB 3RZCA 1F8TL 5LJYH 1YMHB 4Y0GA 4TN9A 4XNMB 4ZTPH 1QR4A 43CAA 5KSBB 1FBIH 3V7MA 1ZK9A 4CVZA 3DXAE 5GISH 1Q9LB 3VDCA 3HA0A 4DUXA 3NFNA 4QHUB 1OVZA 2L0DA 4M7ZC 4S0SD 3IVKA 3VGGA 4L8BA 3MUJA 1OF2A 2GJ6A 4QWWC 2AK4A 3UBXA 1G1YA 5KZCD 5TQ2L 5DGRA 1PZ5B 3P11L 1NBZA 3WJLA 4W6WB 4Q58C 2D31B 4QXGH 4I9WE 2CDFA 1I85C 3VW3H 4HSQA 5HVHC 4ZUTA 4PY7B 2X4SB 3LKNB 5DMJB 3O2VH 5LGKA 1S7QB 3PF2A 4OLVL 1CE6B 4K7FB 4W68A 5EO0B 2VISB 5I17A 3W2DH 1ORQB 4KJPD 4U0RC 2XOTA 2H3NB 2AQ2A 5FA4A 2BNRA 5EU4B 4R7NA 3OPZH 1HK6A 1ZSDA 3JTTB 4YPJA 1M6OB 1JWSA 4HUUA 4BH8A 2ED9A 1AGEB 3PV6A 4PJ5B 3RY4A 4N8VG 1QFWM 1NAMB 2E27H 4NN6C 4BJLA 3VA6A 2NNAB 1NAMH 5IHZB 1S3KH 1T5XA 4PJDE 1CR9L 4XP1H 3O9WD 1C5CH 4ONFL 5D2LE 1BM3L 4RFNC 1CTOA 3AM8C 4Y5YB 5JORB 5DZNA 4L8SB 4NO0B 3H7BA 2GEEA 3FB5A 4O5LH 1P6AB 3BUTA 4HPOL 2PTTA 5KSAD 2RAMA 3REWA 3KPQA 3LPWA 1CFTB 4MJID 3HI1A 4K94L 2OZ4A 3GKZA 4TOYH 4YFLF 2VL4A 1TVBA 2NY6B 4N0UA 4HXAL 1NGPH 2OBGA 5FFLA 3ET9F 5F9WC 2NR6D 4PJFB 3QXAB 2Q6WA 3U36A 1QLEH 2VABA 5DFVD 2PXYB 3GSNA 1FRGL 1EMTH 3PWLB 5F7NC 5HPMA 5FHBH 2VLRA 4LCUB 4RAVB 3OG4B 5KVDL 4LVHB 3EYUL 4YXKL 4Q9RL 1N5AA 5DHYA 1Q72L 4PRNA 1BAFL 1SJEB 4PJGA 4KRPC 3O41B 4JQIL 3RGVC 4E42B 5CBAB 4JGMA 1QD0A 2OSLB 3HRZB 5C09E 4M1CD 2BVQB 4Y5XB 4DAGH 1BQLH 1NEZA 5DSCB 5EU7E 5ESQB 4PG9A 4MS8C 5EU5A 4XTRC 2JTDA 3CK0H 1OGAD 3LPGA 2P8PB 4E41A 5JPNB 2ORBH 1RULH 4WUKH 1SYVB 3VXQA 3Q2CA 4PRBA 4QRRB 4K55A 4XNXL 1C08A 4LQ1A 5INDA 1BOYA 4JRYD 4JO4H 4WWKD 1N2RB 5JIIA 3VRIB 3RAJL 2D03H 1O7SA 3MOAL 4G9FA 4K94C 4F7PB 2OI9B 3VFOA 3F6IA 4RA0C 4MA7L 4XAWL 2GSGA 3KS0J 3PXJA 4WNQB 4MD0B 4GO6B 1MUJB 2XY2A 4LDLB 3GSRB 3DVIA 4N0CA 1T83A 2IPUK 4FQJL 1HHIA 4HAFA 3MLSH 1DBJL 1A4JA 1TETL 4G8EA 4FQXD 4QCIB 2E7LE 2DRUA 1CZ8L 2EDHA 3OGCA 1FZOA 4KV5F 5KSVB 1GCFA 3S4SA 1UEMA 1P7QB 5F9OL 2G9HA 3DMMB 4K7PL 5E6IC 5J9PA 3G5ZB 2BOCB 4ERSL 4HGMA 1T21B 4GG8A 4X7CC 4OKVA 5J1TC 1KG0B 1U3HC 5BVPH 1UJ3B 5EU7C 2QQNH 3CVIH 3CNKA 3UZEA 4HKZA 5A3IC 2V6HA 3GI8H 3G6AB 4FFWD 1MJ8L 3BH8A 2XWTA 5FO9A 3DYPA 1FE8H 2HT3C 2VQUA 4GXUM 4OLEA 5M94B 1RUML 1P4LA 4XCNA 1LK2A 1KPUA 3L3GA 3MRRB 3F7PC 1NLBH 2XQBH 2SEBB 1D5IL 2Y06H 3OXRA 3BHBB 2C3XA 2K1MA 4LRIA 4ONGH 2LTQB 4XVJH 1VFBA 5BCAA 3EHBC 4HLZG 5IUSA 5HGDA 4FZ8H 4NC1E 3HZVB 3D5OF 5FO7B 5BO1L 2OL3L 2DLEA 3BE1H 1H3PL 1OT1A 3QSKB 1BD2A 4G6JH 1EGJH 1JBJA 5J3HC 3IXAA 3SBWC 5HYFA 2AJ3B 1ZKAA 4JFEE 3S36L 2IPTL 4PR5A 2E7LC 3LRGA 4KMLB 3EIFA 4X83A 4Z7WE 3QUML 4ODXB 1N8ZA 1J8KA 2GY7B 5DTFB 4L3ED 4Y4HC 4YHLH 2NMSA 1OSZA 2V7HA 5DJXA 2CGRL 4Y16B 2V17L 2VL5B 3U7WL 4XBGA 1AXTH 4HAGA 1FVDA 3TYGH 1SBBA 2A2QT 2HA1A 1S7TA 2I24N 4TNVF 2R0KL 2GITA 5EDXA 1DUYB 3AAZB 2HFEB 5JW3L 4LLVA 5GIRA 3FO0H 4ZPTB 2I27N 1YQVL 3PGCA 4QHNA 1KF9B 3FB8A 1YEIL 3F58L 4RGMC 5T5FH 2ENSA 4U6VH 1ORSA 5HYSB 4J4PD 3BX7C 4HT1H 2H45A 3ZE0E 4S1SL 2HFGH 4GRLA 2RBLA 1Q9WA 3NOIA 4NZUH 4QT5A 5FYJL 4NC1C 3L5XL 4J8RB 1B4JL 1T1XA 1N64H 4IRSD 3ES6A 1GAFL 3LCYA 3WIIH 3BZEA 2AJYL 1ZHNA 3U82B 1IZJA 1OLLA 2FJGB 4LDEB 3NTCH 3EFDH 1GGCL 2DB8A 4ODHL 1F3DH 2CIIA 1F45A 4R97B 3SHSA 4Y19E 2DQJH 3LKRA 3PDGA 4PLKC 5GRYA 1T89A 5T5NG 1SHMA 32C2A 2OQJB 1SVZA 1QQDB 3RVWD 4ZUSA 4JM2A 3JWDL 1DQLL 1S7WA 2DL9A 4JANB 1JRHL 4LLDB 4YDVA 4ZFFB 3FRPG 3INUH 1CXFA 1SM3H 2YPVL 1U8LA 4YC2B 5FYKD 3EO1B 3SDDC 1YY8B 4L9LA 5BS0A 3BD4A 4NO3A 4PJCA 4ODSL 1S5IL 3BPOB 1A1OB 1YNLH 2FEDD 4GUPB 2ZP0T 2Z93A 4P2QE 3RPIB 1WZMA 2DQGL 3U1SH 4H20H 2VDQL 1LO4L 4FFEX 4G8FA 3VWKC 2VQTA 3B9EA 5E8PA 2N56A 3ZE1F 4CU7A 4JFFD 4UILL 3ECBA 1M05B 3E1F1 4FFVC 2I07B 4Y2DB 1VESA 4WI6A 3ZSSA 2HFFB 4TNWF 1X5ZA 1TQBB 4YXHH 5F21B 2YZ1A 4YX2L 1JGLL 5T3XH 5L9DL 4KRLB 3FQTA 3P4NA 3CSGA 2BRQA 4XX1E 1TJIH 4X6CE 2Z8WC 3ZE0F 3SPVB 4XT1C 1A1NA 1KOAA 2HJKB 4UOW0 2JK5B 4GG6A 4TSBL 2VAAA 1A4KB 4P46C 1DLHB 4M7JH 1PBYA 2EDXA 1AD9A 4FTVA 1N4XH 5EWIH 35C8H 5DC9B 5B4MC 2FYYB 3B5GA 1H3WM 4HBQA 4I3RL 5I16A 3VXTA 3FL7A 2OP4L 3WKML 5MENE 1FDLL 2FLRT 3WNLA 1BJ8A 1NGYA 5BZWB 3KPMA 1MI5D 4HULB 4PJ7E 3H2WA 5D8JL 3DROB 2XRAL 4ETQA 5ILTH 4YZFE 4J1UB 3O6LL 4JM4H 3UPRA 5KS9F 3QEUA 4MXQD 5J6GA 4MHHI 1E0OB 2JJUA 3UC0L 1NCAL 2NXZB 1IGFL 3D39B 4NQVA 3TFKA 3BQUD 3KG5A 1KB5L 3H7LA 4DZBA 3ZZ1A 4HCRH 1RVFH 5D93B 3U0TB 5IQ7L 3GNML 1AI1L 2FR4A 1KJ2B 4WENB 4OCXH 3O2DA 2R0ZL 5TH2B 3S37L 3O3EB 4Z77B 4ZPVB 3T65B 4LASH 3OKNA 4Z78B 1JPTL 4KVNL 3VMPA 4CN6A 1UWEH 3QRGH 4K3JH 5MERA 3O8XC 3KPSB 1E6JH 3KYMA 5D7LB 5LBSL 3CMOH 3QXVA 4ODWA 1CGWA 3HMWH 1JPGB 3QDMD 5I1HL 4LSSH 1AO7D 4HBCH 2MKLC 1GJIA 4X5XA 4H1LG 3T2QA 1EEQA 3OB0K 4X4YA 3QA3B 4ENED 2HLFD 3QCVL 4NRYB 1YMMA 1A7QL 5CZKA 3O45B 5CINH 4X6CF 1VPOH 4HW6A 4LAJH 3ZTNH 4JY6A 4ACPA 2VXUL 4RGND 3ZDXF 4LLUB 4GMTH 3P4OA 1CFNB 4MSWB 4MD5A 2R2HA 3DO3A 1FFPB 2R8SL 3RIAK 2NY4C 3SE8H 3QNXB 2C1OB 2JELH 5ITFA 2EIBA 2WBJA 3UYRL 3FO2A 3QQ4B 3N1PC 1RK0B 3LVEA 1TTUA 4ZNCD 1HHKA 2PW2B 25C8L 3UTSA 1IAOB 5ICXA 2FATL 4FP8L 4PJ7F 4Y4FD 4Y5VC 4JKWA 4U1LA 4X0KA 3DX8B 1AGCB 3RHWK 3H3BC 1EXUA 5JMRA 2QSCL 3TVMA 3MV8D 4APQA 1AXIB 3DX7B 3VGFA 4M4PA 3RI5F 2DD8H 1KGCE 4XCCL 3VFVA 2OTUA 2XKNA 4N5EC 1AGFB 3BPNC 5DK2B 3D3VA 2DDQH 3QEHB 2O5XL 1OAZL 3I9GH 4PJAF 3QUYD 5E6YA 1PX3A 2Q86A 3TIEA 1U8JA 4G42B 5EORH 3QIUC 1FORH 2ZOKB 1R3HB 1LO5B 2IFGA 3L3OB 1GXEA 5A16A 3UTZA 5F7LB 2CDGB 3JTSA 4U1MA 4KI5E 1XZ0A 1UVQB 3B9VA 4PFEA 2NX5A 2DL2A 4OZFG 3R0MA 5AYQA 5J57B 3PG2A 5HDQL 1F6AA 1PDKA 3UJIH 2CO6B 3X12B 2VIRA 4ONOA 4QXUL 4LPCA 2V5MA 2I9LA 4NJ9H 1N6VA 5I66B 3SKOB 3H9HA 2DQDL 2GCYB 2ZSVA 3VGHA 3N9GL 1A5FH 1CCZA 1R3JA 4WY7H 5J12B 5DUBA 4AL8L 1INEL 3D85A 1OY3B 2W60A 4M5YH 5KTEL 1MREL 3ZTJG 3HZKA 3EFFA 4OTXH 3DPBA 1QRKA 4V1DD 3UBXI 1KJVA 2VXTH 3EYFB 1I7TB 2YHGA 3RWCB 5JXEA 1G6RB 1I1AC 4S1RL 5IEKA 4HKXB 4LCYA 3U4EB 4A6YA 5TJWK 3ZL4L 3G6JE 3CX5J 3N0PB 5FDWA 4Y89A 5K9OB 5KN5B 4YAQB 3M8OH 5C2BH 4XP5H 1VSCA 1HWGB 5GS0H 3CAFA 1JYNA 2G60L 5GRJL 5IROC 4I18A 4PV8A 1PD6A 2H8PA 5D2NC 2BNQA 3FQXA 1EV2E 1U8HB 1ZT4A 5AYUL 4KI5C 4MNHA 4MXVE 2W0LA 2YK1H 4X4ME 1L9MA 4O58H 4LLAA 5KVMC 3RKDD 1JN6B 2VLJB 3CFBA 1VADA 3RZCB 3RWIA 1YY9D 3IETA 3X3GL 3P4MA 5DVKA 43CAB 5AG8A 1HQRB 4G8GB 1DVFA 5FV1L 5LG1A 5T1KA 4Y4KC 4XWOC 4KZEH 3VFGH 4PJ9A 1FZJA 1GGUA 3EJJX 3C60B 4L8BB 3TWCL 4PRIA 1OF2B 1V3LA 2AK4B 4L4VE 1NFIA 2DQTH 5TE7H 1UENA 1CWVA 5IMMB 1HCFX 3ARZA 1KELH 3WS6A 1FNEA 4R3SB 4WHYG 5DA0B 2UV3A 4NGHH 2L7UA 4UINL 4ZFGH 4ZOAA 2HFTA 2XG5A 1MCHA 4GSDH 5FA3B 3MV7B 2BDNL 2V2WA 3LPFA 4Z7UB 3W5MA 1GC1H 1YEHL 3E0GA 1OP3K 2YN5A 4ZUTB 5I1IH 3GKWL 3HE7D 1ZANH 4RFOH 3MLRH 4IRJC 3NAAH 3JWOH 4XP6L 3A6CL 3TBTA 5DT1H 4QHKJ 4PRPB 4KKBD 5I17B 1INDL 1W72A 2VB5A 5JW4R 1XGYL 1H5BB 3QG7L 3GIZL 3LIZH 4OQTA 4M5ZL 1OCWH 2AEQL 3B5HA 5FA4B 2FEEI 4WI7A 4OLYL 3RVTC 4EN3C 2WAHA 4HUUB 4D9QE 3L3KA 3WNKA 1GPOH 4LSTL 3LZFL 5HY9A 1WLHA 3PV6B 3G04A 1QRNE 4KZDH 3MC0A 2GAZA 5D5ME 1AQKL 1ZHBB 4XNUL 1DZBA 4LLQB 1JPST 3G6JF 5JPMA 1BF8A 2WWKO 4NQEE 1YQ2A 4DVRL 4I77H 5JQ6L 4F7TB 1KIQA 3GSUA 2DLFH 1U8NA 4PGBA 4Z0XB 1W2KT 4MQXD 5GRVK 3U4BH 2P45B 4PRHD 5IBTL 4L3AA 1A8JH 1L8JA 4S11A 1KIPA 3NH7L 4JJ5A 1NCWL 1IM9B 4XPGH 3REWB 3OAZH 3QNYB 1UWGL 3HI1B 3L5WA 1DE4B 4NCC1 3AUVA 5EUOE 1VHPA 3TN0C 1LHZA 3BKYL 3WYRA 2NY5L 2Q6WB 3U36B 2OZ4H 3SKUD 2VABB 1F58H 5BXFB 4D9RE 2DBLH 3GSNB 1S5HA 4MDIA 4PYGA 4L8CA 4EI5A 1CYGA 4JY5H 5IWLC 2VLRB 1JK8B 1DP0A 3GSNH 2HRPL 3HAEA 4DGVL 1E27A 1HHGB 2WQRA 4WDIA 4X6EA 1ZEAH 5FM5M 2NW3B 3S5LG 2IALA 3RRQA 4PRNB 1PSKL 5D72H 1BJMA 3H9SD 1G84A 3U30C 2XTJB 1ZA3A 3HNVH 5IVXF 4TUKH 1BX2B 4L4TA 3VXOA 2VUYA 1NEZB 5I71C 3FTGB 5EU5B 5D1ZA 3SDCC 3T4AB 3LEYH 4ORGA 1VACA 1Y0LB 4E41B 5T33L 2B7DT 1MSPA 1A6AA 3SDYH 1IT9L 1I75A 4UNUA 1A3RH 4UIKL 2A9MH 2N7BA 2APFA 3IFOB 3KXFE 5CUSH 3EOTL 4QRTA 2H32B 1C08B 2CUHA 3W0WB 5INDB 5IB4A 2DLTA 4QF1A 4S1DD 2IH3A 5D70L 3SDXA 3VXUB 3FZUD 3Q6FA 2AV7B 3CXHJ 1N3NA 5I73B 4G9FB 2J12B 1EJOH 3GJEA 2HRLA 2HKHH 4I0PA 3MBEC 2GSGB 5FB8B 2NY5C 2J5LB 4GJTB 3FO1B 3I2CH 5D5MF 1EIBA 3DTXA 4I4WA 2OTPA 2VDRL 4OGZA 2DQIH 4NDMB 2CLZB 3EYQC 1A4JB 4R4FL 4G8EB 2LABA 5D9SA 3BWAA 1J05A 3DBXB 4Y1AA 2C4FT 1BJ1H 1S78C 4ODUA 3I6KB 1VA9A 3AY4C 5C0JA 4OKVB 1NGZB 5J7CC 3FN9A 4H5SA 1X5GA 4G7YL 4K07A 4XP4H 5I19L 3ZDYF 4HKZB 5I6XB 5SWZE 3IDXH 2KQNA 3TT3L 3NA9H 1WT5C 1XF4A 1WCBA 1G0XA 3TJHD 1P4LB 4NQCA 4OZHA 4PJ5D 5B8CA 1I85A 2GI7A 1KPUB 3L3GB 4K7PX 3E3QA 1BZ7A 1J0ZA 4HWEL 1IAII 1ZMYA 3HNTL 3OXRB 2X89D 5E2VL 4IEFB 3NZ8A 3L9RB 1VFBB 3D25B 1M7XA 1NL0L 5F7EH 1TPXB 3IRZA 2XWBA 1KB9J 4S2SA 1JGEB 3QG6B 1MVUA 2N7AA 5HGDB 4LSUH 4X80H 2JCCF 1XH3B 2BHYA 4JKPH 2R2CA 4NO0D 4BSWB 2UWEE 1HE7A 2OR8A 4HUXB 4DKFL 3IXAB 2ZCLH 2ITCA 3MRHA 4JZJB 4FFYL 3CLFL 4X99A 2X10A 5BV7B 3QCUL 2NY6D 5D7KE 1E28A 5ID0A 1LO3H 2B2XL 5BV7H 4WW2F 4PJ8C 1MCWM 2PXYD 3AS0A 3CX5K 3TPUB 5ALCH 1FVDB 3DYOA 4RAHA 1S7TB 2GSIA 3OX8A 5IW1A 5I9QC 3AM8A 3Q6GH 3A6OA 2DM2A 3MROB 3RUGE 1S7UA 5GIRB 3ZKXB 1HEZB 4YDJA 4AEHL 3EDEA 3WS3B 3QFDA 5C08B 3Q1SL 1BQSA 3NIGE 3S8WA 4X9FA 2C7UA 1IAIH 2O93L 5DD5L 3BP7A 5C0AE 3VFUA 1XCTA 5T3ZH 2GTZA 3ARDA 5I74C 5E00A 3MSPA 4P5TA 4GRLB 1Q9WB 3HCVB 3ROOA 1WZ1L 5CD5C 4RNRA 5E5UB 1IL1A 3RKPA 2IPKA 1IQWH 3EUUA 4QRRD 4N0YL 4KJQD 3OJVC 3JVGC 5DR5H 4XPHH 1R6VA 3MUY1 3BXNA 2XZAH 1MIEH 1AKJB 4D2NA 1I8MA 1CD9B 3WKNA 4X9IA 5C86A 2AAVA 4YGAB 5M7QA 2CIIB 2XXCB 4JFDE 1PKQB 3BMVA 4GBXC 4AT6A 4G6FB 4NUGH 4PJDA 4MS8A 4C57C 2AXFA 2EH7H 5D2LA 3GUTA 3MRPA 32C2B 4NT6A 4QRPA 1QHOA 3RVXD 1P7QD 2VXVL 4MHHG 3DMMD 3QWRD 1S7WB 4ODBD 3LHPL 5F1IA 4YDVB 3J8F7 4U3CA 1RZFL 3CSYB 5EN2B 4YDKL 2BVPA 4U6YA 3AFLA 2BC4B 1RZIA 1QLFA 5DVOA 2IANE 3C6LC 4YDLC 5SX5K 2OX5A 2CDEB 1S7RA 3JV5A 3GJFA 4L9LB 1RZ7L 4NO3B 1T04A 1TJGH 4PJCB 3S96B 7FABL 2YS4A 2QQKL 3HUJE 4KK8D 3UTQA 4KROB 3E8UH 5HHXL 3MCLH 1L0YA 1YEJH 1VEOA 3PWPB 3EJZD 3L3IA 1MRCL 1DN0A 3NCEB 4DEPB 2D7NA 4ZS6C 5E8PB 5HI5C 3QPXL 5DHVB 3O4OC 5AZEH 3VXRE 1F4XH 6CGTA 4G3YH 5D7IA 1MH5A 4KRNA 1IFHH 4XXDB 1F4WH 5DHVH 4U1KB 2LQRA 4OM0L 3BISA 5I8KL 3RUGF 4F7CB 2F19H 4N1CA 4TQEH 5GJTH 3DWTA 4H8WC 3FQTB 3P4NB 2Q8AH 1X3DA 2DLHA 4R90H 4NIKB 2OJZH 3H0TA 3KJ4B 1II4E 5F89B 7CGTA 3MCKA 1UM5L 3GRWA 4PJXB 3ULVL 1OPGH 3RY6A 1LDPH 4MAYA 3T0DA 4BQBA 1KENH 2AGJL 4OZIA 3GHEL 2QHRL 2AEPH 1EHLH 2FCBA 4QEGA 3L3DB 1JZ5A 2FL5A 4HMCA 4W81A 1WQVT 4Y16D 5EZLA 4NKQB 1X4XA 2DQCL 3MNZB 4KFZC 5J13B 1S9VA 1UG9A 5EOCJ 3C5SB 1F3JB 4JB9L 4AENB 1CVRA 3W5NA 5DFTA 1AR1C 4RRPA 4PGDA 5CD3A 3WIHH 3WSQL 2FDBP 3G5YA 1G1CA 1JI2A 1J1OL 3SBWA 3FB7B 5I8OH 1QR1A 1WSST 1SEBA 2R56H 3BN3B 4TSAL 3V6OE 4PDCE 4JHZA 1QZ1A 1U8MA 1BVKA 3O3AA 4ETQB 4F37F 6FABL 1B0RB 2F54B 1AQDA 2IBZY 5J6GB 1MVFA 3T2OA 3L5HA 5KW9H 1NGXA 3V5KA 3IU4H 4QRSA 4RAUA 2Y36H 1QYGH 4JG1H 1INQB 2X9XA 4PJBE 1MFDH 4MJ6B 2DQHH 3PWUA 1Z9SA 1QHPA 4JQXA 3EDFA 3NCYP 5DQ9A 3RL1A 4YUEH 1BJ1J 2ESVA 3D0VA 5CKAA 4KK6D 1NMCC 3O2DH 4LLWB 4TULL 3LQAH 1RK1A 3RBGA 3PV7A 5J11C 2X4RA 2A83B 3KYMB 3MV01 1CXKA 2DTSA 5D1XA 4ODWB 5ENWA 1QSVA 1A64A 1S9YA 4EKXA 2YD1A 3S37X 4L3CA 3AROA 5T5NF 2KH2B 3BH9A 1FAIL 1MWAA 3M07A 4X5XB 3QBTB 1BBJA 2B5IB 5CJ8A 5LCVH 3V6OC 5CSZB 1HXMA 4K3DL 4UMGA 4L5FH 3OKLA 4Z7WA 4F58L 1YEGL 1YNKH 5ABDE 3VG0H 5IESH 1KEMH 2AJSH 3P4OB 2VLKE 4DTGH 1WWBX 3S35H 3ULVF 2Z31B 4JFZH 1SEQL 5EC2B 1NAKH 3KYAA 4LMQI 1S9WB 1F4YL 4M6NL 3ESVF 4NQSA 1ZWIB 2VH5L 5ISZB 1KB9K 4OD3L 1MFBH 4KQ4H 3B83A 4KKLD 3NZHH 4Y2DD 3TIDB 5T3XD 4ZTPL 3V6FB 4PGEA 5DRNA 1LE5A 5TGBB 1FBIL 2C4FU 1KN2H 3MACH 5GISL 5ANME 2OCFD 3UTSB 3NBNA 4AQ1B 2IPUG 4U1LB 1YN7A 2YC1B 3WNNA 4N9GA 3WLBB 3QIBC 4P4KC 4KAQH 3PHQA 3SEPA 4P59H 1G0DA 3NPZB 4JZOA 2PO6C 4UTBH 3UX9B 5EBMA 4XMLH 5KVFH 1P84J 4XZUA 3GMQA 2NY3B 3QDJB 3VW3L 2UUDH 3RZWA 5JDSB 3CFJA 2EXWD 4ZXBC 3IJYB 3IKKA 3VXME 3KHQA 4U3XA 2F9BT 2Q86B 3REVA 1HSAB 3C9NA 3O2VL 1BQUA 3UTZB 4FNLH 2F15A 3FONA 4U1MB 4NRZA 1U95A 3W2DL 4CUCA 5F8QC 2FX9H 2NX5B 1H8NA 3FO9A 3PWJA 3TYFA 3V5DA 2D7QA 3FN0H 1IKNA 1F6AB 4YHIA 3WE6A 3OPZL 1NFDF 2NXZD 4M3KB 3D39D 3U83A 3GBMH 4LDOB 2NY7H 2E27L 1BBDH 2ZSVB 2DWDA 1IGCH 1C12A 3T8XA 5E2UH 4PP1D 1NSNH 2F53E 1T5WB 3EJYC 1NAML 4ZO8A 5FKPA 3HZKB 4XI5C 3OKDB 4P2QA 4OV5A 1S3KL 3DV4A 4LGRB 4W4OA 1KJVB 4XP1L 4DFHA 1T1ZA 5BOZG 3STZA 3F62A 1P2CA 3GIVB 4MWFA 3NIDF 3L7FB 2VLLA 3V0AC 1D5BB 2W1NA 4NQXA 3KPSD 4O5LL 4TUOA 5D7LD 2EDBA 2MTPA 2ILLA 2O5YH 3DNKA 2WIIA 5B3JE 4TOYL 4C4KO 3HMXA 1OP5K 2H8PB 1NGPL 2ATKA 2BNQB 1Y6MR 1YPZE 3MRGA 4MNHB 4PLJD 1QLEL 4M62H 3HKFA 5IV2A 4UIMB 4Q6IC 3LN4B 1L0QA 3AB0C 3IB4A 5C0IA 1EMTL 1HNGA 4QHLA 3RWIB 5FHBL 1XF5B 4BA8A 4LBEA 1OOAA 1KJ3H 2E7MA 4WEBH 1CIDA 2XNAA 2HT4D 3V8CA 2BJMH 1JMZA 1D9KC 2ZUYA 2VN7A 2Z92A 4R8WH 1M71A 4EI6B 4IOFC 4KPHH 5DMKA 3ZDZE 5DHXB 1NFIB 1YECH 4L8DB 4DAGL 3B6SB 1BQLL 5IW6B 4PRDA 2MQ3A 5C07E 1KACB 5AWNH 1MRFH 2CXGA 3CK0L 2B8OT 3OR6A 3RWDA 2WWMC 3TZVB 2ORBL 1RULL 1FPTH 2GIYA 4WUKL 3SCMB 3VH8A 2ZUXA 2QLVB 2Z0BA 1A6ZA 3QIWC 5ACZB 3TBYB 5H37H 5L2KA 5E24E 1IARB 1TQCB 1KTDB 2FWOA 3GSVA 4JO4L 4X5WB 3F7YA 2D03L 3MGOA 5I8EA 1WWCA 4N0FA 3WHE0 1J88A 1LEIA 3MJ8B 3RJQB 3ALWA 1W72B 1TIUA 1OTUC 1XGRA 1F13A 1UCBH 4JRXA 1W8OA 4MNQA 1W72H 5EU3B 4GXVH 4HIJA 5JNYB 5EUKA 5SWSA 3MLSL 1TXKA 3MRIB 4IBLT 4ZO9A 4OQTH 1SJHA 4WFGD 4BH7B 3HB3C 1CDGA 4ZFOA 2NTFA 3E6FB 1I4FB 4OD2A 2GAZB 5JIKA 4NSKA 4CJ1A 2V7NA 4HGWB 4OI7A 5E1HB 5BVPL 2QQNL 3CVIL 4X7TA 1MHPL 5GHWH 2F5BL 3CFCH 1GOFA 2UZYB 1AD0A 3GI8L 4ZQKB 4O2FA 1FE8L 5IEHA 4OAWB 4XPFH 2KDGA 1YPZF 4N5EA 1R24A 2ICWB 4OFPA 1Q1JL 4LEOA 1NLBL 5HHOE 3WO4C 2XQBL 2Y06L 4ONGL 3M1BB 4XVJL 3VJ6B 1IGIH 1F2XK 5IMOA 3L5WB 2W38A 3CFDB 4M8QA 3T1WA 3IDGB 4J3TA 4PJFF 3ME0A 3MRLA 3RWFB 3ELAT 4FZ8L 3RWJB 3WUWB 4ZSOA 3BE1L 3H9ZA 5GS0D 1S5HB 1SQ2N 2B4CC 3NA4A 4G6JL 1EGJL 4ZNEE 3MBXH 1PQZB 3VGAB 4L8CB 4EI5B 2DM7A 3EAKA 1RJCA 2CPCA 5DI8A 4PY8J 4LL9A 4UNVA 3ARQA 3RA7H 2IALB 4HS3B 4G59A 1ITCA 1JF1B 3W39A 1Q94A 4G6AD 1ZLSH 3NN8A 4X98A 2LU3A 4XMKH 5E2TH 1ZA3B 4YHLL 4RIRB 5MEQA 3C8DA 2VLJD 1Y18B 3MXWH 4KVCH 1AXTL 3RZCD 3P2TA 1C5DA 1MCCA 5A2JH 3TYGL 4DZ8A 3HNSH 4NCDA 3SO3C 1WC7A 5D1ZB 4G8GD 1I1AA 3N06B 1JTTA 5EOQH 3B43A 3FO0L 1O0VA 5AUMB 5JUEH 3QDHA 5T5FL 2XTLA 4QRTB 1FCCA 3C60D 4IOSD 4LK4A 4F33B 4UBDD 4U6VL 4NM8H 2AK4D 3BJ91 4QF1B 2IH3B 3C87A 3SDXB 4F9LC 1RJYA 5CZVH 2LAGB 1VDGA 4HT1L 5IROA 3Q6FB 1N3NB 4NZUL 4LCWB 4POZC 2A6KB 3MV7D 4R4ND 2JJSC 1N64L 1PW3A 3UP1A 3WIIL 3BEWA 1CF8H 5D7SH 1WBZA 2X70A 2MQCA 1J05B 2PTVA 3NTCL 3EFDL 4XH2A 1P84K 4PRPD 5F3HA 4M7ZB 4GW1B 3GMPB 3IDJB 1CDYA 3MXVH 4UQ3B 3MRNB 2NCMA 2DQJL 3MV9E 4R4BB 2DMCA 4QRUB 1IAKB 4XC1H 4QHMB 4KK5C 1DBMH 4HZAA 1I3RB 4OQ1A 1XF4B 3QWQB 1WCBB 3T2PA 1OW0C 3CDGA 2G75B 4YK4C 5I1EH 3EOAB 1BZ7B 1FL5B 3KAAA 5JW4M 2MPAH 2VZUA 5HVHB 3INUL 1ZHKB 4WTWA 1A7RH 1SM3L 4KDTA 3KLDA 1JF6A 5TDOB 1K8DA 3VCLA 1V3KA 2YWYA 1MVUB 3V52H 5FGSA 2A74A 2E9JA 5I1LA 1YNLL 2YD2A 3PNWB 3IAGC 4BQ8A 5HVWA 3U1SL 4U0RB 4H20L 3TF7C 1IM9D 4NZDA 3HC4L 1S7VB 2F5AL 3MLZL 3ARBC 5T1MA 4PJHE 1J0IA 2P5WE 5ETUA 3CFKA 1VCAA 3DXAB 3WN5A 1OTSC 5TE6H 2X4TA 1TCMA 2OR7A 3ALPA 1E28B 3PJSB 3QQNA 5KAQG 4P9HL 4NN6B 4YXHL 1QFUL 4U1JA 2VLME 2Y1VA 4YHOH 5T3XL 1A0QH 4ZO7A 5I1GH 2Q1EA 2FX8H 4HXBH 2VLRD 2JJTC 1TJIL 3OX8B 4XCFH 1V7NH 4RFNB 4J3SA 1JYVA 4NC0B 1J7VR 1QACA 1S7UB 1FIEA 3UTTA 4M7JL 1RZGA 2XTJD 4YDJB 5DEFB 1U8QA 3QFDB 4JKMA 4JFPA 5EWIL 1N4XL 1XT5A 1YEEH 35C8L 1FJ1A 1MCDA 4MD4B 1IEHA 2C7UB 4QYOB 1VEPA 3BP7B 2IMMA 2Z35A 3VFUB 3TN0A 4K8RC 5E00B 1HOCA 5F9WB 4IIQC 4E41D 1GYAA 1TFHA 3ILPB 3IFPA 4X7SH 1Z9OA 4AEIH 3W0WD 5DRXA 4P5MB 4X6FB 3FMGH 5ILTL 3VXUD 1VKXA 5A2IH 2WBWB 3DGGA 4JM4L 1N59B 2XKUA 2NY1C 4OUOA 1I8MB 4TPRL 1YYMH 4G9FD 5HGGS 1QRNA 4KRPB 3RGVB 2VRAA 3HR6A 1FSKC 1OGAE 3VFMA 3IDIA 4JVPA 4HCRL 4P9HC 1RVFL 1WAAA 4AT6B 4N0CD 3LN5B 1QA9B 4KK9C 1KYOJ 2K7QA 5D2LB 5C0FA 4OCXL 4NQDE 1I9IH 1B0GB 4JRYE 5BVJA 3VFPA 1P7KB 3W11D 5E70A 5JA8B 4LNVA 1OL0A 3BI9X 4LASL 2VZ3A 5F1IB 1G6VK 2P43B 2XV6B 3CLEH 4HHAA 1UWEL 2W65A 3QRGL 3FQWA 4K3JL 1KCLA 4HIXH 4X6DE 4OFIA 1V7MH 2PR4H 1E6JL 3LH2H 1HI6A 5EUOA 1S7RB 4U1NA 2EDNA 2XFXA 1R5WA 4WU5A 3CMOL 1X5AA 3FQRA 2IQAA 4LSSL 4Q7DA 5J0BA 4ZS7H 4WU7A 4HBCL 4RWYH 2XPGA 3G9VA 3WLWC 5K9JH 4N8VA 4TTDD 2ICWJ 1DN0B 3AS2A 5E9DE 1HYRC 5E8OB 2AXJA 2RCSH 3QT2A 2BMKA 1DANT 5CGTA 1A9BB 5CINL 1MH5B 3QYCA 1VPOL 1JTOA 2XQYG 3ZTNL 5KVEH 4G43A 2MHAB 4NWUH 4UQ2A 3QWOA 5E6IB 8FABA 4GMTL 5C09B 2I26N 3RNQB 1U3HB 4FFZH 1J12A 3U9UA 3BYYA 4FS0A 3MCKB 1EX0A 1QBMH 3SE8L 2JELL 3KHOA 4B41A 1WT5A 2DKMA 2YUWA 3S98A 1WGOA 3KXFA 4NBXB 1PAMA 5HJ3B 3RVVC 3SE4C 3E2HA 4F15C 2BVEA 2FL5B 1ND0B 3PXHA 5CEXA 5EZLB 1FGNH 2DBJA 1S9VB 4R26H 4R96A 4GRMA 3MRKA 3ESUF 3UPAA 3VU2A 3PP3H 3BPLC 4QXWA 5HGAB 1BLNA 3DUHA 4OF3A 4PGDB 2EYTA 1RUQH 5C08D 2DD8L 3MGTA 3U46A 5T3ZD 2NZ9D 3VWJC 1QR1B 2ZCKH 1XCQB 1U8MB 5JQHC 1BVKB 4P3DA 5HD8C 3O3AB 2DDQL 3SQBA 1I1YA 4UB0L 2VXSH 2GTWA 3T0AA 1MJJA 3I9GL 2W0KA 1AQDB 4GRLD 1SJVA 4CW1A 4UT6H 2IFFH 2HH0H 1NGXB 5EORL 3PL6D 4Y4HB 3K1KC 1FORL 5ECJE 4ISVB 2AJVH 1JZ6A 1B0WA 2E7BA 4LLYB 2EICA 4X6DF 2YUXA 5SWZA 2IH1A 1AKJD 4NC2B 2F8VA 3AS1A 5J6HA 5HYIA 5DQ9B 3BIBX 1T80A 3BKMH 4IJ3C 1J11A 4NNPH 3RL1B 1RUPH 3LKQA 4UAOC 3UJIL 5FGBA 4N90E 4RGMB 2ZUSA 3TJEH 2UUDK 4NNYA 4HLJA 4NJ9L 2YPLA 4G6FD 1R3KB 1K9TA 1GL4B 1A5FL 3GHBH 2AJUH 1MQ8A 3QFJE 1XF2B 4M5YL 3BJLA 4OTXL 1S9YB 5F3BA 2C1PA 4L3CB 2VXTL 5IF0B 2UWEA 3CVHA 5LQBH 3TH3T 1BBJB 4JFEB 2XWJA 4QY8B 1HXMB 1ZT7A 2BRRH 1NCDH 3FCTA 5F9DC 3OKLB 1MLBA 5F9JA 3WCYA 5BO1H 3VD9A 3X17A 4R6UA 1ZOXA 1YN6B 3M8OL 2ZSWA 5C2BL 4XP5L 3TNNB 1XIWC 3KJ6H 4KROD 3QEQA 5IT2H 2X09A 3VFWB 2XY1A 3S36H 3MMEB 5IVOA 3EO0B 2EDJA 5CIPA 3PWPD 4BK5A 2YK1L 4NQSB 4O58L 3SJVE 1TNNA 4LHUA 3BAEH 1JGVH 5FYKE 2DWEA 1JVKA 4PGEB 2FB4H 1LE5B 3QULA 1JGUH 5HHQA 3PGFH 4MNGE 4XHQA 3DUUB 3OR7A 4QTHA 3TO4A 4NKOA 3DIFA 3JUYA 3SDDB 3VFGL 4KZEL 4FXKA 1IM3A 4N9GB 3VI4E 4GW5B 3TA3A 3NFSH 1U3JA 2DQTL 1ZTXH 4M6MH 5TE7L 4XGZA 1PYWB 1HILA 2Y5EA 1KELL 3WNMA 5L8JB 4NGHL 5MP6L 4ZFGL 5HYSG 3VWKB 3QUXA 2GJ6E 2DI9A 2DTMH 4GSDL 2CUIA 2DQEH 4I5BA 4YHYC 2O61A 3SGJA 4QGYA 3CFJB 1N5YH 1GC1L 4YBHA 1GZPA 1ZANL 2EDWA 4RFOL 3MLRL 3NAAL 3C9NB 4PJIE 3JWOL 1RUKH 3MA9H 3OHXA 2V2TA 3K3QA 1A7OL 2W91A 3T4YA 4Y19B 5MEOB 5EFIB 3FJTA 5DT1L 1KTKE 3FONB 2LFGA 1U95B 2XA3A 2LVCA 2RFXA 3FO9B 3PWJB 3TYFB 3LIZL 2F54D 1OCWL 2HT2C 4HK3J 2E6PA 4YHIB 4P46B 4X7EC 4UT9H 1BFVH 3KLHC 1GPOL 1A7PH 2HLAA 3MRQB 4KZDL 2FIKA 3O3UN 2BNRE 5D7JA 2ZUWA 2VC2H 3HUJA 1V3JA 3K1DA 4O2EA 2VR5A 4I77L 4P2QB 4V3EB 5GGUA 3ILQD 2MSPA 1HDMA 2DLFL 2IADB 4YIQA 3U4BL 1X5KA 3HAEG 4F7EB 2XICA 1C1EH 1OAQH 4MWFB 1S5IH 3CFIC 2VLLB 5F6IC 3VXRA 2VOTA 3MLTA 3CH8A 1KLFA 1IE5A 3D0LB 1KYOK 4XPGL 2DQGH 2YD5A 3BRFA 1O7VA 4NZTH 4YO0A 5FV2A 1SY6A 3LY6A 2G5BA 5DDHA 3BZFB 4UILH 1J18A 1LEKB 4HQQH 2OZ4L 1F58L 3IDYC 2EE6A 4NCC2 4X6CB 5IV2B 1EJ6A 2DBLL 4GLRI 3EOYG 3VI4F 4EIGB 5L8KB 3CU1A 4JY5L 1JGLH 1OD9A 4N0UE 3GSNL 4NO5B 2OTWA 4LBEB 5A2LH 4AH2A 4XVUC 1ES0A 2FEEL 1ZEAL 5T1LA 2IAMC 1SMAA 2Z31D 5D72L 5F88B 3O8XB 1OTTC 3BP4A 1PX4A 3BT2H 3HNVL 5GZND 5DMKB 2FRGP 4MB5A 4TUKL 1UB5B 5ISZD 5JXAH 3VXSE 4HX1A 5MENB 1MLCA 4AEEA 3L3JB 4PRDB 5JZ7D 4YFDB 2W0FA 3WHE1 4UTAH 4BZ2H 4PJGE 3LEYL 4PJ7B 2LAAA 3OR6B 4KUCD 3V6OA 4RFEB 2ATPB 3UTSD 2JIXA 4G8IA 3SDYL 1A3RL 2A9ML 2BSTA 3HC3H 5CUSL 1A6ZB 1T2QH 2YRPA 2FWOB 3O3BA 4HS8H 1NBYB 4EDXA 5HYJA 3BN9C 1CLOH 4HIHB 3KYNB 3TLRA 5E6ZA 5I8EB 2WP3T 1TZHA 3O11B 4PJBA 5FHAH 1EJOL 5JO5A 2HKHL 2NY3D 3QDJD 1H3GA 3WFZA 4KKAD 2NY4B 4Q74A 2VKXA 5IB3B 4NO2A 3I2CL 4RMSA 4GLRH 1KJMB 2LVEA 3JV0A 4HIJB 4WO4A 1DANU 2DQIL 3DX9A 3GNMH 4JJHA 1NC2B 5L2JB 1NLDH 3O81A 1I8IB 1KT2A 4Y5VB 3S6CA 3QDGA 4NSKB 2EO9A 2NX5D 3AREB 5ADOH 2FH6A 2QSTA 1JPTH 3AU1A 3BKJH 1KCKA 4XP4L 4X7TB 3IKCA 1RUAH 3ZKMC 3IDXL 1W0WA 1D5XA 3NA9L 1KNOA 4JPVH 4JO2H 1R24B 3BPNB 2YD4A 4JFYA 4LEOB 3VFTA 4ZXBA 1OHQA 5KJRH 2FHBA 1T6VN 2FHFA 3T3PF 4DGYH 4GKSB 1HXYA 15C8H 2VLKA 5F7EL 5IMOB 3QIUB 5AG9A 3GI9H 4IMKA 4E9LA 1NBVH 4JN2A 4M8QB 1A7QH 1AGBB 5JXED 4LSUL 4X80L 2VITB 4C54A 4JKPL 5CEYA 2PW1A 4KKCC 5GS1C 3BGMA 3FAXA 1ACYH 3LSOA 2ARWA 2ZCLL 5DMGC 4IRZH 1CDUA 3LOWA 2QR0A 1T1YB 4PG2A 5DI8B 4K3GA 1XFPA 5ANMA 5I0ZA 4PJGF 2BNQD 3Q5TA 1BD2E 1Q94B 4FQQB 1LO3L 3C09C 5BV7L 2FGWH 4H1LA 3WEXA 1T83C 4TYUA 1HHHA 3GMOA 1OWWA 5I1AB 1JPFA 1CXLA 4M7KL 5ALCL 1C5DB 3SE3C 4DZ8B 2Z8RA 5TE4H 4CBPA 1I1AB 3Q6GL 1AGDB 1BVZA 1X5FA 5SWQA 4NNXA 4AM0B 1QSEA 3VXMA 3O4LA 4O02H 1IAIL 2X42A 4N0RA 3ZKQD 3P0YH 1RJYB 4XCCH 4ZG1A 2X4UA 3T1FA 1AP2A 5T3ZL 2XYCA 3B3IA 5D2NB 1UM4H 1QNZH 3TZVD 3SCMD 4NQTA 1L7IH 2YZ8A 4LRIC 4JPIB 4ESKA 3FKUS 3G5XA 1IQWL 5F1NB 1R3IL 2HTLC 2VDOH 5KG9A 1UQSA 5L0QC 5DR5L 4XPHL 4D8PB 3MRDA 3T3ME 2XZAL 1MIEL 3BEWB 4YBQC 3R4DA 5L8LB 5ESAA 2JLLA 5GS2H 5TDPA 3P73B 4GKOA 1D9KA 5J1AA 3BSZH 4Y4KB 5FKAA 1DSFH 5F3HB 1Z2KA 5HHVH 2JKXA 4ONHA 1RIVH 5FOBB 4RZCA 4QXUH 3H8NA 4NUGL 3JV4B 1QFHA 2QADC 3ZT7A 2EH7L 4FA8A 1UXSB 1QLRA 3L95B 1CN4A 3GSOA 3ARXA 3G6JB 3ZO0A 3RNKA 3CDGB 3IDNB 1FZMB 3QIWA 5AZ2H 3NCYS 1ULVA 3SDAC 4NKMA 4IRJB 4OZFA 1HINH 2N1KA 4P4RA 1K8DB 5E8EB 1LMKA 3VCLB 2ITDA 1TJGL 4D9LH 5D4QA 3CC5B 3Q3GA 3E8UL 3GMLA 1JYWA 4NFDA 3MCLL 1ADQH 1T0MB 1YEJL 4TUJA 4KTYA 3HFMH 1WJ3A 4R0LA 4PTUA 5BS0E 5HHME 1IVLA 4P57A 1F4XL 4Z5RA 4EN3B 3K81A 4G3YL 2X4TB 1IGTB 1IFHL 2R15A 3GMRA 1F4WL 3D2UA 3MV11 5E03A 1UFUA 5DJ0A 4O9HH 1T4KB 3QUZA 1U3ZA 5CZXC 4U1JB 2R29H 2F19L 4LLMB 4L4VB 3BW9A 4TQEL 5GJTL 5DUMH 4KY1H 2Q8AL 1RHFA 5C07A 1OAUH 2QV2A 4R90L 4EI5D 2OL3A 2OJZL 5IMLB 1QTYT 3V7AG 3KWWB 5D1QA 5IR1A 1H3UA 1OPGL 1LDPL 4HJ0D 3VRLF 2A6DB 1KENL 4HH9A 1EHLL 4M3JA 5HI3D 2CKBA 4MCYA 4UUJB 5C0CB 3QUMA 2FBOJ 1WBYA 1FJ1B 3JTCA 1IBGH 1FVCA 3FT4A 3P9LA 3O0RH 4JM2C 3QXDB 4GG6E 1FL3B 3TN0B 5D1ZD 4C56A 5GRUH 5CGYD 1TJHH 3WMSA 4HK0B 1SMOA 4ZOBA 5E4IA 2DQUH 1NKOA 4OZGE 4IOIA 5GGSA 2J8OA 3V4VL 5I8OL 4U1HA 2PYFA 5IM7B 3WDJA 5FF6B 3FFCA 4Z9KB 2CRZA 2X6MA 4V3DB 4U2ZA 2FSEA 4MJ5B 3B9KC 4Y8AA 1FLRH 1PZUB 4LCWD 3QJFA 1S9XA 4BZYA 3HZYA 2R1WB 3U30B 5KW9L 3OV6A 5D5MB 2PKDA 2NTSP 3IU4L 1EO7A 1R3LB 2Y36L 3EOBA 1QYGL 4JG1L 3VFMB 4XNQA 4ZFZA 2ARJA 4NQEB 2DLGA 3VE0B 4TNVK 3NFPB 1MFDL 5DJZA 3PP3K 5I71B 1N0XH 2P42B 3HR5A 2DQHL 1QSFA 1EH9A 2XACC 4YHPA 3SDCB 1A47A 4YUEL 1RURH 4JM2F 1AFVH 1N6QH 5ESVB 4WV1A 4XCYB 1Z6JT 4PP2B 5DC4B 5HHOA 2PCPA 3WXVL 3O2DL 3LQAL 1B2WH 4G9DB 2AXHA 3IS1X 1HI6B 4PJCF 5EUOB 1F5WA 1UZ8A 4X4XA 1IEBA 2R0LH 1FVEA 1OAXH 3PHOA 2IQAB 2DIAA 2NPLX 3MBEB 2CLVB 3LKOA 1UWGH 2R9HD 2JJSA 5H35B 2XPGB 4ZNEA 1A9EA 2Q3ZA 3SE9H 3C5ZA 4X8JB 5LCVL 1CT8A 4MAUH 3QI9C 4FZEL 4L5FL 4M9OA 1A1MA 2JCCB 2BMKB 4PJEE 1CGVA 3L3HB 1YNKL 1A2YA 3VG0L 1LEGA 3K4DA 4G43B 5IESL 4UQ2B 3QWOB 8FABB 1KEML 4DTGL 3S35L 1UZ6E 5LGJB 1I1CA 3V5HA 4JFZL 5IVZA 1NAKL 2X5PA 2BNUB 2P8MB 3BYTA 4GAGH 4JAMB 1EZVY 1J9CT 1JMXA 3DXAD 2YUZA 1MFBL 4KQ4L 3TCLB 4ZUWA 4GG6F 3BKCH 3TFKC 3NZHL 4P23A 2ZNXA 1ZS8B 3KXFB 4PRAB 3MFGB 3MJ6A 3UAJC 4KMQA 1KN2L 3MACL 4HKJA 4WTXA 5CEXB 4AIXA 4WI4A 4XRCB 1BOGA 4XB7A 4KAQL 5TF1H 1W0YT 3U7YH 4P59L 5MHSE 4AIZA 1XGPA 4UTBL 1H8SA 1DUZB 1UXWA 1LP9A 3L6FA 4XMLL 3SGKC 5KVFL 3MGTB 5C0BE 3U46B 5F7WC 2XZZA 2YXFA 1GGTA 4KHTH 4OZ4B 1GGBH 3O2WH 3TBWA 1NFKA 2GTWB 4TNWK 4CW1B 1MJJB 3OKKA 3QEGH 4J12A 1E4WH 4PJ8B 1A3LH 3MV9A 4FNLL 3D3VE 3CD4A 4OLWH 2VJXA 2IH1B 3AMKA 5EPMA 2FX9L 1RJZA 5I9QB 4WI2A 4MA3B 4JRWA 5LGHH 3FN0L 5L88H 1G7PA 3QPQC 4P48A 2WINB 4LMQE 1TTFA 4KRPD 3RL2B 3RGVD 4G7YH 1J1PH 4OLXH 4NNYB 4EVNA 3PABB 2WV3A 2NY7L 3JBG7 1BBDL 3CPLA 1IGCL 2DJSA 2WBJC 5I74B 5E2UL 4OF0A 1KB5A 4IIQA 4H25A 4MQ7A 1ZVHA 1QUNA 5EU6E 5F3BB 2Q8BH 3B8YA 1Z9MA 2UWEB 1J8HE 1Z5LA 2D3VA 4PJHA 4W70A 2BFVH 2XWJB 5DF0A 1UZ6F 2PXYC 3TVMC 5DJ2A 1ZT7B 2DOCA 1MLBB 5DURB 4APQC 5ID1B 4LIQH 2O5YL 2P7TB 3O9WA 1Q0XL 5HBBA 1KCRH 2K7PA 2V2XA 3VFRB 3QZWA 4Z76B 2BOBB 4GBXB 4QXTA 5CIPB 4Z95H 4M62L 2PYEB 1X4ZA 2X9WA 5KSAA 2DI8A 1BGXH 1JUFB 5CIPH 3RUGB 4NYLA 3HTLX 3L5JA 3O6MH 5E6ID 1KJ3L 3ZHLA 3U9PH 3QULB 4KDVA 4LU5H 5DJ8A 2A6IA 3LQZB 5C09D 3OR7B 1A22B 2BJML 4HLZH 4X9HA 1TTGA 3ZKSD 4R8WL 2HJFB 1U3HD 3DIFB 5C0AB 5DS8A 3BD3A 3C6LB 5F6HJ 4YDLB 4FXKB 4KPHL 5A3ID 4Z7QF 5K33A 4AEFA 1F6LL 5D71H 5H2BA 1GZQA 1YECL 1CFQA 1RHHB 3ZE2E 4C83A 4MCZB 2ZUQC 5AWNL 1G9EA 1IEAB 2VXQH 1MRFL 3SY0B 4CMMA 4LOUC 2CSPA 5KANG 1T22A 2CKNA 3KDMB 2R0WH 5EZJB 1FPTL 4PRIE 4F7MA 2A0LC 1WZ1H 2J8UA 3O4OB 1K4CA 1Z3GH 3EHBD 2W92A 5D6CB 3U2SB 4ETYA 1ROWA 5TQ0H 1OGAA 2D7PA 1T1WB 1EFXB 1UH3A 4JFDB 1G7HA 3T4YB 3E6HB 2IF7A 4OKDA 1MRDH 4LSVH 5J3HD 4XHJC 3IXTB 2KPNA 2ADIA 4GRWE 3QO1B 3W9EA 3F7RA 3OF6D 4NQDA 4UU9A 4H8WH 4F8QA 4JRYA 4HUVB 1UCBL 4WWKA 1KBGH 4K23H 3WL9A 1ZVSA 4I18C 1W72L 2EEDA 2PETA 3J7HA 4FXGA 4GXVL 4MYWB 3BMWA 3SE4A 1DL7H 4Y4HD 1T0NA 3TBVA 4OQTL 1MY7A 1JFQH 5ERWA 3NMEA 4JG0H 4B0MM 2IANB 1E4KC 1XGTA 2FIKB 1W0VA 1JPSH 5GZOD 1CGYA 3TO2A 3HUJB 5FUOH 1KLGB 3LQMA 3G9AB 4F3FB 4O2EB 1DVFC 1M1SA 4GKNB 1IGJA 3RI5K 5KVGH 1CDCA 4OFVA 5GHWL 3CFCL 5DJCB 3NCMA 4PJ9C 3BVNA 4XPFL 5E9DA 1U58A 5GGRA 1NDGA 5LAXA 3MLTB 5KSUA 4H26B 3WS6C 2ICEA 4OSUH 1IGIL 1WUNT 1QBAA 2CRYA 3ZKNC 4WCYH 1LE9A 1SY6H 3OG6B 2XG4A 4JFED 1XF3A 1X5LA 3O6FC 4QTIH 3OXSB 3MBXL 4R9HA 5EZIH 1R5IA 4YBLC 3KPPA 1A6WH 1NMCB 5FK9B 4AH2B 3C08H 5T1LB 3RA7L 3I75A 2EXYC 2COQA 1ZLSL 4PLKD 3PGDB 5J11B 3BP4B 4XMKL 1LILA 5E2TL 1AIFA 4P0DA 4LCCC 3MXWL 1K6QH 4KVCL 3UCRA 4X9BA 4ZYKA 5AD0B 1NGWA 3LV3B 3HNSL 4BQ9A 4D3CH 1A7NH 2W0FB 1HH9A 2RJMA 3HLAA 3V0WH 5EOQL 4JDTH 3GEWB 2JIXB 4G8IB 4L4TE 4YPGB 4M03A 1VB9A 5JUEL 2BSTB 3SDDD 2CIKB 4GRWF 4NM8L 5DVMA 3JZ7A 5CZVL 3TNMB 5HDLA 5C92A 2RIKA 5ICYA 2H26A 4PV9A 1CL7I 3ARVA 5DD6A 4Z7NF 3VWKD 4NBZB 3CDCA 1ERNA 4NPYB 4J4PA 4XVTH 4CNIA 4I0KA 4FFVD 3U0PB 2ADJB 3WIFB 5F9AC 1DDHA 1CF8L 5D7SL 3OGOE 4X8XA 5CHNA 4Y19D 1MCLA 4XXCC 4XCEA 2FH8A 4JHWH 5GGSY 1AC6A 1BHGA 2V5YA 5JLZA 4I3SH 3MJGX 3MXVL 3QIBB 4P4KB 3SN6N 3QFJA 1FFRA 3X11B 2P47B 1MFEH 1I7ZA 5IBLC 3AU1B 2RQ8A 4U1SA 4Y1AE 4XC1L 2PO6B 3EKCA 1KSRA 4P46D 3BWUC 2AP2A 1SJXA 1DBML 1S8DB 4Z0BH 4Q97A 4LQFH 1MCSA 5B4MD 2AV1A 4JFYB 3VFTB 4ZXBB 1HCVA 2HWZL 1A7RL 5CWSA 1DTUA 3P4LA 4W4NA 3RVUC 1HXYB 2EDTA 1U0QA 3CU7A 2VLKB 3O6KH 4P2QD 4LPWA 3RWGB 5L7XH 4NQCE 4OZHE 3E3QE 4W6YB 2QJDA 5CJQH 3ROLB 1CL7H 3LDBC 5CEYB 1KPVB 3BGMB 4RDQF 3OKEB 3LSOB 4IMLB 3K2UH 3EYOB 4ORZC 1I8KA 4E0RA 3WD5H 3NACH 4MNGA 1KTLB 4IHOB 5TE6L 5ANMB 4I0PC 3T0EE 3LN9A 4BFIA 3FN3A 5JIPA 3GFUA 4LAQH 1CG9A 4XNZC 1KV3A 5IQ9B 1XEDA 3SOBH 1HHHB 1KLUB 4YHOL 1ETZA 2F8OA 3GMOB 2NY2C 5CLTA 1CD0A 5JOPE 3SKNA 4QNPF 1A0QL 4CADB 5I1GL 4H1LH 2FX8L 4HXBL 3KPSE 2CK2A 2EXWC 3HPLB 1ZGLA 4YQXH 4XCFL 1V7NL 3GB7A 4OJFL 4NM4H 1CD1A 3O8XD 4YDIH 3OBAA 5SWQB 1YEEL 2HYMA 3SDXF 3VXMB 3C6SA 3MRJA 2PUQT 4K9EC 4PJIA 5MEND 4J3OC 2X7LB 3T77B 5B8CC 3E3QC 2EKSB 1C5BH 2ICCA 1UKSA 1D5ZB 1RAMA 4ALAH 4D0DA 3KPLB 1WFOA 4X7SL 1G7LA 4MZ3A 3MPCA 4Q6IB 3JXAA 3AB0B 1FV1A 5LKNA 3GSXB 1UQSB 4AEIL 3MRDB 4HIEB 1NDMA 1TZIB 2FJHB 3FMGL 3LKSA 1TITA 4P2RE 1FG2B 3M17A 3T0EC 2IAMA 5TDPB 4LF3A 2PTUA 1YYML 3KLAA 5J1AB 1XR9A 4GQ9H 1XGUA 3MRFA 1C7TA 3X13A 2DF3A 3RWHB 2F53B 4ONHB 2NY4D 5IKCA 4RZCB 4S1QH 1FGVH 2P24A 4EBQH 4MXQA 1NC2D 4O2CA 1I9IL 1QLRB 4OZHF 4FQ1H 4DFIA 3BQUA 5E1AB 1IGYA 4ODTH 3DV6A 4EOWH 3MREB 3CLEL 5IB2A 3K74B 4YHNB 3ARED 1MCWW 1J0YA 3BP6B 4HIXL 1UKTA 2VDKL 1V7ML 2PR4L 4HV8A 2KZWA 4OZFB 3PWNA 3LH2L 4QRPE 1K4DB 1Y6NR 3DGCR 1YPZB 2ITDB 1NGQH 2HP4A 5CP7A 5BZDA 4OZFH 3EBAA 2ERJC 5FOJA 3Q3GB 4ZS7L 4N5ED 1BVLB 4WFGE 4AG4H 1UB6B 4BFGA 2DMBA 4RWYL 1AHWA 4BQCA 5DWUH 3U79A 5FYLE 5K9JL 3ARDC 2APVA 4P5TC 4B5EA 3OKMA 2RCSL 1UWXH 3QIUD 3P0VH 3QDMA 3F5WA 2BVTA 1PEWA 1AO7A 5KVEL 3D2UB 2BSRB 4NWUL 5DJ0B 3MRCB 3ZTJH 3CCHB 2YA2A 3VXSA 4H0GA 4FFZL 5C07B 4Y88A 5D7IE 5DRWA 1FZKB 3SKMA 4ZMAT 5IR1B 1QBML 4OB5L 3MCG1 1UT9A 1VERA 1T66C 3QHZH 2V9RA 1FIGH 5GGQH 5IFJB 4RSVA 5INCA 3OMZA 2HG5A 3WO4B 4MCYB 3CH1A 4TSCH 3K4ZA 4XC3H 5E99H 5F7YC 1FGNL 1BZ9B 1YNTB 4R26L 3FT4B 3P9LB 4YEFA 5DZOA 4OZIE 4NUJB 1FNGB 1KGCD 3S88H 1S7XA 5H37G 5GS1A 4LRNH 1T2XA 5JR1H 4IOIB 5CSGA 5GGSB 3S3SA 1RUQL 4XVSH 1EO5A 1MELA 5EBLA 2ZCKL 5H94A 3PWVB 2B4CH 2HVKB 5F96H 2HN7A 4HH8A 4HWBA 2VXSL 3IT8D 2FSEB 3MV8A 4UT6L 2IFFL 1S9XB 2HH0L 4KI5D 2X4QB 3IDUA 3FT3B 3V7AE 4MX7A 4GAYB 4G8GE 3IU3B 5I2IB 4UNTA 4XNQB 4ZFZB 2AJVL 2ARJB 4PJDF 1U8IB 5GS2D 3SE3A 4WHYH 4CU8A 5D2LF 2X1PA 5DJZB 3SO3B 3D48R 3WFEH 3QJHA 5EO1A 4GXUN 3BKML 4U1GC 1H0DA 1RU9L 4NNPL 3V8OA 1RUPL 2BSSA 1GHFL 4NKIH 4Y4KD 4XWOD 4OFYD 5HHOB 1MHPH 3TJEL 3VG9C 2F5BH 2AEWA 3MLVH 4PYHA 2G2RA 5DYOA 2W9EH 2R1YA 5LWYH 3MLUH 3RY6C 1Z0MA 4MAYC 4F9PA 3MV7E 5HDOA 1DQQA 4YR6B 4Z7UE 1LDSA 4BSJA 3GHBL 2ESVE 2AJUL 1UZ8B 1Q1JH 4X4XB 4CGTA 4GW4A 4LHUG 2VDMH 1KCSH 2XN9E 3FQUA 4TVSa 3LKOB 5EC1A 1BIIB 5I1DA 3C2SA 4N1EA 1LNUA 1A9EB 1NANI 1NCNA 5B39B 5LQBL 1LK3H 2UYLA 3BEVA 3KPNA 5CEZE 4IRJD 2OM5A 2BRRL 1MWAL 1NCDL 5D7IF 2EZ0C 1ONQB 4JFQB 1A1MB 4XBPB 1TMCA 2W9LA 4V1DA 1H15B 3WUWG 2EIZA 3KJ6L 5IT2L 4TVPL 3KPOB 5GGRY 1ZT1A 1ZA6A 2ZPKH 3X14B 4TVPE 1H3XA 4DN4L 4JFOB 4JVWA 3BAEL 5HHNA 3RVTD 4EN3D 3LRSA 4OZIF 5IB5A 1JGVL 1IAIM 4MGXA 2FB4L 4YK4B 1MF2H 1JGUL 3MR9B 3PGFL 3SDAA 3S35X 4L4VD 4MMXC 4JQXC 2CLRA 3K2MC 2Q87A 1BOGB 1VGKA 1KN4H 5CMAB 1BZQK 5C70A 3NFSL 2P8LA 1ZTXL 4M6ML 1EK3A 2VERN 1XGPB 1MCRA 2HKFH 4UZGA 3S5LB 4F57H 4OUUA 1FH5H 2AK1H 5C0CD 4S10A 3ARBB 1NANH 2GJZB 2DTML 5D1XC 2DQEL 2WP3O 1QVOA 4PTTB 3Q0HA 1K8IB 3D18A 4NZRL 4RBPH 3TBWB 1N5YL 3TN0D 3V0VA 3MFFA 4KTDH 1U8KB 3MYJB 1ZLUK 1RUKL 3MA9L 3MNWB 5IIEB 3U0WH 1YUHB 3MV9B 5E5RB 4G7VH 1YDPA 4UV4H 1U91B 4LKXA 2X4NA 3IDMB 2WIMA 3BFOA 3L1OH 1OQXA 4D9QD 3DURA 4E5XB 4Q9BA 1A7BA 4OI8A 3KGRA 4UT9L 4WUUD 3CUPB 3QH3A 1J0HA 1BFVL 2R4RH 4NQED 1A7PL 3KYOB 5HTSA 4L29A 3CPLB 4DOHE 3W0WE 4NOFA 2EDRA 4IIQB 3SDCD 2VC2L 3IF1B 4M8VA 4H25B 4O51A 1ZLVH 5I1JH 3U7AA 4LVOC 4K8RH 1X5XA 3ARGC 2IGFH 2HVJA 1MCNA 1URLA 4F37K 4PJHB 5HHMA 1C1EL 1OAQL 2P5WB 4Z7WF 3KVQA 2Y6SC 2NQCA 2QKIB 3B9KA 2NY1B 5IGXH 2BCKA 5JW5A 4NZTL 1LD9A 3KPRE 3HC4H 2Q76A 4M93C 1R5VA 2F5AH 3MLZH 1FSKB 3MBED 4D9RD 3TBSA 2V2XB 1JV5B 2VZVA 4LSQH 3R06B 1WIUA 2H9GA 3T0BA 5IK3A 4DVBB 4HQQL 3G5VA 4I48A 2Q20A 4LSPH 2VDNH 4P9HH 3UDWA 3EYQD 1QFUH 3DRTA 5SX4I 4OF5A 1S78D 5HI4C 3NCBB 1I3VA 3GO1H 3ULUE 5DJ8B 5C0GB 1MQKH 4K2UH 1T7WA 4LFHD 2Z91B 4P2OC 3BT2L 1IKNC 1QO3B 5JHDB 5EO9B 3EYVA 2NYYC 5H2BB 2OLDA 5JXAL 3DVGA 2EEBA 3MTRA 1CFQB 3MUHL 5EBGA 4ZD3H 1T2JA 3MRMB 4JKLA 4OZGA 1WV7T 3KXFD 2W9DH 4UTAL 3HZMB 4BZ2L 3H9SA 4CMMB 1KIUA 4KJWC 5ITBH 1T22B 4HIIB 1HYSC 2MMXA 3QI9A 1X7QB 2AABH 3QQ3A 3HE6C 3HC3L 1ZV5A 1T2QL 4W4OC 5DJAB 4XNMA 1V3MA 1F2QA 5T1DH 1HH6B 5KSBA 1EEZB 4HS8L 4DWHA 1Q9LA 3RDTC 4ODVH 1CLOL 1G7HB 5TDNA 5C9JB 2EDYA 5FHAL 4HC1A 2ADIB 4TPRH 1C16B 2IBZX 3TT1H 5L2KE 3W9EB 4NQDB 4CVXB 4UU9B 3JV6A 3WL9B 2JF1A 5SX4H 1WK0A 4M43H 5HSFA 2FIRT 4QRQB 4F15B 3ULUC 4PJ8D 3TBVB 5B38G 5GSRB 2D31A 1NLDL 4XPAH 4X6DB 1F02I 2WZPD 1H9VA 5CGMA 3N85H 4JRXE 4MNQE 4PY7A 4TTDC 2Z4QB 5SWSE 3LKNA 2VMFA 5ADOL 3BKJL 3BPLB 1KEGH 4HUWB 5MEPB 1S7QA 4P5KB 1RUAL 3DSNA 4K7FA 4NWTH 5EO0A 2VISA 3SGKA 3VWJB 5C8JB 4JPVL 5E9DB 5BRZE 1U58B 1NH6A 4JO2L 8CGTA 5DUPH 5E8DH 1ITBB 5GGRB 1QKZH 1JZ8A 2VDPH 4PJEA 2H3NA 1ZLWK 1JF5A 4NKDB 2A73B 5KJRL 4GQPH 2C26A 4DGYL 4EUPG 5CD5D 3JTTA 15C8L 4OLZH 5EOTA 5C7XH 3GI9L 2Y07H 1NBVL 4MVBC 2J6EH 1BREA 1FO0B 3TJHA 3ULUF 1LE9B 3Q48A 5I75C 3WFCH 2M8XA 1FO0H 1ACYL 3FOMB 2CRIA 4YEEA 4OIBA 2X89A 3C2AH 5IHZA 5FM8A 5DURD 4IJ3B 5D7KD 5EA0H 4IRZL 3MJ9A 4O4YH 4UAOB 3KPPB 3ZYIA 4ZSOE 4HDIA 4Y5YA 5JORA 3I75B 4GBXD 4L8SA 4HS6B 4BFBD 2FGWL 2PYED 1OAYH 1U93B 3FFDB 3UTOA 4ZYKB 1EO8H 1CLYH 5F7FA 1HH9B 3UPCA 5TE4L 3HS0B 4WRLA 5C0BA 2F74B 4YZFF 3PL6C 2PXYA 3I6LE 3BRGC 5C0AD 4H88L 3C6LD 3PQYE 3FOLB 2BVOB 1DQJB 2MCG1 4U4BA 5HYEA 4LCUA 4O02L 4UT7H 1XIWB 3P0YL 3G08A 2H26B 1DQMH 1SJEA 1UM4L 1QNZL 4UB0H 3O41A 4IS6B 1G7QB 1L7IL 4ZS6D 3MA7A 3F12B 1ED3A 5HI5D 4HJGA 5ACMA 2EE2A 2VDOL 1MCFA 4JQVA 2AQ3A 3UZVB 2MFNA 1DDHB 3LEVH 1EFXD 1TNMA 4JFDD 1DEEB 4M1DH 5CHNB 1SYVA 3LEXB 3FB6B 4XCEB 3BSZL 1DSFL 5JLZB 5HHVL 1F3DJ 1RIVL 3QFJB 1N2RA 5EU6A 3VRIA 3I6GB 2R2BB 2J88H 1CFSB 1J8HA 4F7PA 2CK0H 2OI9A 1MFAH 2AJXH 1KTRL 2BHUA 3SGEI 3NVQA 1MHEA 3S9DB 4NRXB 4MA1C 3A0OA 4MD0A 4YHYB 2IAND 5AZ2L 3GSRA 5C3LD 1KXQE 4CVUA 3GMNB 3ISWA 3I50H 1V5JA 5CWSB 4AJ0A 1HINL 1AR1D 4QCIA 4M4RA 3B2UC 1P4BH 2J1KA 5KSVA 4D9LL 3DMMA 3QWRA 4Z7VE 1FG9C 1K3ZA 2BOCA 1X6LA 2YN3A 4BQ6A 3SJVB 3V4UH 4MJ2A 3IRPX 1ADQL 2Q7YB 1FNFA 1KG0A 3HFML 1U8PA 2EYRB 5I76A 4E0RB 1LO0H 4HWZB 2X9YA 3IJHB 4H0HB 1IQDB 4MNGB 4ZUVB 2H2SC 5FYKH 1IZKA 4DGIL 1A6PA 1JHKH 3EYSH 3B4NA 1P4IH 4WEMB 4XNYH 3MRRA 3S3JA 3QNZA 1E4KA 2BK8A 4O9HL 2SEBA 4GS7C 3BHBA 2R29L 3VFSA 4OCNC 3L7EA 1ETZB 2VKWA 4KY1L 5DUML 3RTQC 4CVZB 4GFTB 4EQ3A 3CFEA 1OAUL 5I8CA 3ULVD 3NFNB 4K3EH 1ZGLB 3IVKB 5T1LD 1EGJA 3HZVA 5CJOH 2XA8H 2GJ6B 4YHMH 2C5DC 3UBXB 3SGEH 1J1XH 3RBSA 1P1ZA 5F6IB 3VRJA 1OSPH 1CD1B 4D0BA 1XMWA 2ZNWA 4C55A 2AJ3A 5C6WH 1D6VH 1IBGL 2APTA 1BMGA 1NBZB 4QOKE 4PJIB 5MP6H 4WGWB 3O0RL 2CDFB 4NN7C 4KI5F 3UTTE 4Z8FH 5GRUL 5DTFA 1TJHL 2QSVA 4D0DB 3O6FA 2L7JA 2JIXD 3IDYB 4KDTC 5HVFB 1G7LB 2DQUL 2VL5A 1PVHA 1CBVH 1A7OH 2NW2A 2CQVA 4ELME 1SBSH 3MOQA 1OQOA 5ISZE 3AAZA 2HFEA 4RMRA 3M17B 5DRZA 2IAMB 4HJJH 2R39A 1FLRL 2FBJH 1FYTE 1FHGA 3AGVA 1GIGL 4LCCA 2BNRB 1A6UH 4R7NB 1ZSDB 5HYSA 1TVHA 5HVGB 2FECI 3WN5C 1JWSB 4BH8B 1N0XL 2AKRA 4O2CB 1RURL 1V8HA 5DEZA 2BY3A 1AFVL 1N6QL 3TV3H 1WAAE 4JDVA 4DKEH 1IGYB 1T5XB 3QIBD 4P4KD 5F44A 3NPSC 1B2WL 2YPKA 2YA1A 4GMSH 1GOGA 2FJGA 2PO6D 3PWNB 4MXVF 3UYPA 3RGHA 3H7BB 5BZDB 3FB5B 2R0LL 5HGHA 2PTTB 1OAXL 1KPRA 3IAQA 3KPQB 3SE9L 3LS4H 4ZXBD 1TVBB 4N0UB 4MAUL 1HHJA 1F4HA 4P2CG 4JFHE 2OQJA 1JE6A 4DK6A 2VLKD 1AJ7H 1QQDA 3I3BA 4XXCA 3LMJH 5IFHH 3F5WB 4JANA 4RISH 4LLDA 4OM1H 5HPMB 4ZFFA 3BZDA 4JE4B 2CJUH 2E7HA 4XMPH 2EDFA 3VXSB 5DQJA 1KXVC 1N5AB 3EO1A 5DHYB 3RIFK 1YY8A 1B6UA 4GAGL 1Q0YH 4PJGB 3SKMB 4GUPA 1A1OA 2P5EE