3WS6A

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 72
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws6A01
2X1XR 1YMME 2PYED 1UJ3C 2WBJA 4HX1B 3SDCB 1AGEA 3DOSA 5E6ZA 1EFQA 1KCRH 3MACL 2VYRE 4KQ4H 4YQXL 4EI5D 3CK0H 3ME0A 5F9AC 2QBWA 1LVEA 4I5BA 3WD5L 4H0GA 4G42B 1CLYL 4MJIE 1ZLVK 5TF1L 2HFTA 5FHAL 4MCYA 2FSEB 1PW3A 3TIEB 1EEYA 3MX0A 1J05B 3JTTB 4LHUB 4JKMA 4GUPA 4WI9A 5E9DB 3TCLA 1INQB 3FT2B 3JV4B 5C0JA 1A14H 3GNMH 3AXLA 1KJ2B 4V3EB 3QB7C 3IJYB 4Z7VE 4G9DB 3TBYB 1PBYA 3G6JE 3NA4A 4LSQL 5C2BH 4U1JA 2DM3A 1FYHB 4PJ9A 1Y6MR 4NKQB 5LWYL 2Z9TA 1MREL 3IETB 1XR8A 4G5ZL 5GIRB 3LZFH 4X6BB 5BRZB 3MJGX 5GS2H 1T89A 1CFBA 2Y9RT 6CGTA 3QZWG 2DLTA 1T89C 2P45B 3G6JA 3NIFF 3P9MB 1N0XH 3LRSB 3EO1A 2LE9A 3QDMB 3WJJA 1VFUA 5FA3B 4I77H 4JPWL 4YDLB 4PJFF 5HYEA 2V5MA 5IV2B 1K2DA 4LPTA 1ETZA 4PTTA 3OAYH 1DBML 4QLRA 2D4DA 1JGVH 1OWRM 1U41A 2CRMA 1U2CA 1JBJA 3CAFA 3PGDB 3RVTC 1I4FB 2F58H 1UXSB 2X4OB 4K55A 5AUMA 2J8UA 1JGUL 3B5GA 3VGDA 4ZXBA 1A6VL 3UO1H 4XMPL 2YMXL 4NHCH 1F00I 3DUUA 4E5XA 4K3EL 3BPLC 3HR6A 3PF2A 4NQVA 4D0BB 4Y0GA 1JTTA 1I9JL 3R0NA 4LARL 3IF1A 4ZTOL 4TVPH 2DLIA 3IB4A 2IPUK 2WM0A 5E2WL 4UNVA 4PRAA 2IH3B 2OCFD 1VEMA 4U2YA 5J6GB 1S7TA 3PXJA 5E56A 4POYA 4P5TD 4K9EH 4UT7L 5TDPA 1NCNA 5JO5A 1NLDH 4M03A 3VRLF 3D69A 1ZGLM 5KTEL 3MGAA 1GOGA 1EFXD 4N0FA 3EYQC 5F9DC 4X6EA 2VAAB 4N1CA 1FGNL 2ZCLH 3HKFA 3MRBB 5DJAA 5EORL 3G9VA 4LLAA 2FH8A 1JNHA 2G60H 1GPOH 2UY6A 1K6QH 3WMSA 5D1ZC 4BFEA 3QEUB 3STBA 1AY1H 5HPOA 3ET9F 2BVPB 2I9LB 3SGKA 4UB0L 3GFUA 1AGFB 3P4MB 3PQYE 4KHXL 4D8PA 4L8DB 2F54D 3MLPA 4PPTA 1I3RA 1UACH 4P4KB 1UWXH 1HWHB 5LCVH 3ZKND 4CVZA 3BN9D 4H20H 3HUJF 3UP1A 4M7ZB 3KLAB 1LO2H 3SPVB 2EH7L 1FVDA 3UZQA 4H1LB 1HDMB 4GRMB 3GSXA 1V05A 3MMEA 2JB6B 1U8LA 4PJDA 6FABH 3LV3A 4KAQL 1F11B 3BPNC 4WO4B 2K1MA 4CADB 5BXFA 2YUVA 3DRTB 4N9GB 1FDLH 1QRKA 3WXWH 3QQ9C 4YFLI 4JFZH 4CN1A 1DR9A 1UCBL 4N8CH 3TPUB 1XF2A 5C0AB 2UWEA 5E8OA 2GCYA 2MKLC 3GMRA 1KPUA 5C0GA 3HZKB 5ADOH 2A73A 2X7LA 3EYVA 5D7LA 4HCRA 5DYOA 1RUMH 3O8XB 3NPZB 4RWYL 4QHNB 5IKCA 4OLUH 2X4NB 3OKLA 5GGVL 4ZG1A 4MD0A 2I9LA 4ZDHA 3VA2C 1YMHB 1OTUC 1OAYH 4HFUL 5H8DA 4ERSL 2IAND 3C6SB 2YUWA 2DQIL 3H3PL 3T0AA 1CGTA 2BSTA 4XAKE 3L5XH 5DC4B 5GRVL 3SDCA 3IGAB 1Q0YL 4XHQA 4MAYA 2OL3H 1EA9C 4QRTB 5DRWB 1RU9H 5HGAB 2NY4B 3FHQA 3F7YA 1OQXA 2MOVA 3IAGC 5AWNH 1BLNA 4NQDE 3QPXL 4NRXA 4KI5D 5IWLA 3W81A 2VXUH 3QUYB 5FKAB 4PJCA 4J3VA 5AYUH 3S34L 4YXHL 3VE0A 1YEJH 5SWZA 4XCCL 3TIDA 3BZ4B 4HUXA 1R3LB 5HHME 2NY4C 4OT1L 2EE6A 5D2NE 2FX8L 1UADC 1NAMH 3MLUL 4ZOAA 2VLKD 3LEVH 4OCRH 2EDDA 2W9EL 3N85H 2F54E 2FD6H 3RVVC 3WXVH 5HHQB 2OTUA 5KN5A 1MNUL 4BZ1H 3FB8B 5LBSL 4LPVA 2WV3A 3BO8A 2AJXH 3H9HB 2B4CC 1TCRB 3DHMA 4AH2A 4OLZL 4UOW0 1I1YB 4MD4A 3ZMRA 1ZANH 1RZFL 3T0VA 4MX7A 5F21B 4YH6A 4OQTL 1RFDH 5B8CB 2VR9A 3UDWC 3X14A 2WBWB 5E0QA 3VJ6B 4JE4B 2HMID 1SVZA 4GKZA 1A5FH 5HPMB 1YEKH 4JFED 2V2TB 4RMVA 4JKPH 2W0KA 2H8PB 3OKNB 3GBNL 3FRUB 2NNAB 5DRNB 5GGTH 5J11C 3MGTA 4RRPG 5D8JL 3B2VH 5DD5H 4N9GA 4ZUTA 5IGXL 1A6WH 4RGMC 4B5EA 4M43L 5DMYA 4IRZH 5D7LD 3ZTJH 4KTYA 5DDHA 3SJVA 3MZGB 3RWJA 4GBXA 4NBYB 1H3XA 5E99L 5JOPE 1MOEA 3OTTA 1KPRA 4DW2H 1JZ8A 3SY0A 2NY3B 3JVGA 3JWNC 1FYTE 4YHOH 2GUOA 1HHGB 2G5RA 5CFHA 8FABA 3EKCA 2Z35B 4BH8B 1BJ1J 5ERWA 1MI5B 5DJYA 4MDIB 2DBJA 4RCAA 5ECJE 3K0WA 3ETBF 4HDIB 3HE7A 2YPLA 1JPFA 1LEKA 2YEZB 1T83A 3AREB 4UZGA 2ICWA 4KUZH 2RCSH 5I74C 1CVSC 4FFWD 2BSTB 4BKLA 1UKQA 5GRUL 4QRPB 4ZFOA 5I71B 1F02I 3MXWH 5GGTA 2DQUH 4QRPD 5J13B 1XEDA 3DVGA 3OKMA 3FO2A 3LKQB 5ALCL 2HN7A 2VTFA 1LMKA 3ARDA 2R4RL 5FGSA 4ONOA 1VADB 4KZDL 1BVZA 1WZ1H 4KTDH 4JHZA 4P2RE 5E2UL 1RSFA 4JZJA 1MRDH 5FDYA 3U82B 3P77A 5CS7A 2DQFA 3OQ3B 2W65A 2HP4A 4YEFA 3QI9C 1XF2B 1P4BH 5IHUH 3O0RL 4F57H 3OXRB 1UB5A 2VXVL 5BQ7A 1T03H 2HKFL 3S97C 3C5SB 3GEWB 1IBGH 4JREC 5JR1H 4KJYA 2E9IA 3Q5OA 4XHJC 3RDTA 3IDNB 1B0WA 3K8LA 2GEEA 1EEUA 1Z9MA 3S88L 3GI8L 3O9WA 4IJ3C 3VXSE 4YGVB 4NQTA 3KPMB 5J1SC 2DQDL 3QUXB 3TF7C 1LO5A 1FSKC 3U48A 4AH2B 3GDBA 2VUYA 3QWOA 3BEWB 3HB3D 1SYVB 3QCUH 4PJEA 1NGQH 4UMGA 4HT1L 4QGTA 3MROB 1VPOH 4KKLC 1KCGC 2FO4B 3BW9A 2BVPA 2VXTL 4HUUB 1JPTL 5GGQL 1YN7B 4KI5C 3Q0HA 3VFPB 5CBEB 3DJ9A 4H5SA 4V1DA 4MD5A 3CFIC 5IEKB 5L2KE 4G80B 1CE6A 1Z3GH 3C09B 1IGYA 5GS0C 2IADB 2CH8A 5SV4A 4HWBH 3ARGC 3CFDA 2EH8H 1YECH 4HS8H 1NCDH 4WVRA 5GRJH 3KDMA 4QOKA 3W9EA 3ULUL 4LVOC 3VFVB 1QHPA 3KR3L 1EGJA 4P99A 3FFDB 1TCMA 4P3DA 2P24A 4IRSC 1BAFH 1VFAA 4Y5XA 3O9WB 4Q7DA 4WFGD 3EOAB 4R9HA 4PJBB 1TJGL 3LQAL 4U1NA 3QWOB 1IAMA 4OBSA 1ZHLA 3AREC 1FLRL 1P5UA 5EU7C 3L5WB 4U1GC 2X44D 1TJIL 1D6VL 4OLVL 1CE1H 4Y2DC 2NZ9C 2AJYL 4AG4L 3HE7B 1CG9B 5B38B 1A6UH 5GJSH 3MLWH 2GJZA 4RDQF 1S9YB 5MERB 3K81A 3Q5YA 3MJ8B 2A2QT 4P9HH 4ODBD 1SY6H 5EZOL 3QSKB 2CKNA 4NKOB 5JLZA 4IIQC 4UUJA 3MRPA 1OLLA 2EDNA 5I1CL 1MUJA 1PVHA 1IC4L 2XKUA 4LQFH 3VXPA 2APBA 5D7JB 4PLNC 1BJ1H 3BGMB 1TZIB 2VRAA 5CGYC 5GSRA 2GTWB 2X4UB 1WWWX 4YNYA 3BYYA 2C26A 1IEAB 1RHHA 5JW4N 1DDHB 1L7TL 1K9TA 1U36A 4PY7B 2CIIB 4LEOB 1M05B 3UYRL 5DHXB 4XTRD 4GKSB 1HCFX 3JWOH 5D7SH 3BP7A 1DQLL 5DHVH 5ENWB 3MLTA 5IB4B 4PLKC 4I3RL 3MRKA 4XMKH 2V9TA 2AEPL 1AGBA 4WUUE 2MPAH 3SE3C 2AEWA 4K07A 2AK1L 4QRRE 1XF5A 3HE7D 5HYQB 1EHLH 4ISVB 2LV4A 4L8BA 2APVA 3U7WH 4R4FL 1WWCA 1NC2A 1LE5B 4HDIA 5IEHA 1F6AB 3VRIB 5ABDE 3MUY1 4TYUA 1AJ7L 2HWZL 4HKJA 5HSFA 4TSAH 5ID0A 1JNJA 5CIPH 4Y4KC 3NA9H 4Q58C 1J88A 4PRIE 4TTDC 1AKJB 3V4VL 1ODAA 3DTXA 3TN0B 3VXUB 1O5DT 1HQRA 1ZMYA 1CLZL 1XT5A 3R8QA 4TULL 1DDHA 4M5YH 2OJZL 4IOSD 4O02H 3PIQA 1FNSH 4GBXD 3ARYA 4FNLL 3GIZL 3OJMB 2WNGA 5FKPB 2NY5H 3QUYC 2CIKB 3HC4H 4XB7A 2LTQC 4QRQB 1P4IH 4XNYL 5T5FH 1Q0XL 1UM4H 5HHNB 4G9DA 1NSNL 2IALB 3BD4A 2ATPB 3DSFL 3MFGB 4YHYB 1JRHL 2VC2H 2VABA 4FXKB 2D03L 3CUPA 4QY8B 3U30C 2XQYG 4M8QB 2Y6SC 4J23A 3ULSA 1S9XB 4PRNA 2R2HB 1YN6A 2VLRB 3BD3A 2ZUXA 3BWAB 3WFHA 3OX8A 1V3MA 3KPMA 4KKLD 4FZ8H 4UTBH 3D39E 2XFXA 5FO9B 2PR4H 4KY1L 4ZFZA 3V0VB 4G3YH 5HD8D 1CIUA 4FFZH 4IOFD 4P2YA 3FRPA 3TGXA 4K71C 2P8PB 1FJ1B 1PZ5A 5E6YA 4Z7UB 3X3GH 4PJIF 1MEXL 3QG7L 4WEBL 1Z0NA 3G6JF 4MJ6B 4OZ4A 1B88A 1DEDA 3IDMB 3Q1SH 5IVZB 1RZ8A 1W8NA 2EDOA 4QRQA 4I0CC 3MNWA 2BX5A 3DMMC 2R4SL 1C7TA 3QQ4B 1X5AA 3LH2L 2YN5A 3CX2A 4BELD 2APWA 1Q1JH 3HNVL 1ITCA 2QQLL 3UJTH 1V5JA 3DX6B 3U2SB 2Z31D 2OK0L 3MLXL 2X05A 2Q76B 4WUKL 4N0YL 4WI4A 4XWGH 2QL1A 5C0BD 2VITA 4CU7A 4JHWL 4XCYA 5ID1A 3CSYA 5T1MB 3OKKB 1J12A 5D71H 4U1KB 3IDXL 5I18L 1KLUA 1MCNA 4UQ3A 4XNMA 1UWGL 2XYCA 3HMXH 3QNXA 4DZBB 1MLCA 4QTIL 4TNWF 5FK9A 5HHPA 4WGWB 3IS0X 3LS4H 2NYYD 5ALBH 2HFEB 4BUHA 4GQ9H 4DKAA 4NJ9L 2DL9A 4POZC 4X4MA 2HTKD 1CXEA 2BDNH 3VFUB 5I1AA 2IWGA 3SN6N 4X7SL 1DQML 1HXMA 2I26N 3O6KL 3HPLA 5FA3A 4U1SB 4LLQB 1FL6A 2EYRB 5FYKH 2ITCB 1QSEB 4NUJA 1I3VA 2D9QB 5GZOD 4JO2H 3VFPA 4TRPH 1BQLH 3EUUA 4OCYL 5EOCH 2JK5B 3OJ2C 4YHYC 3LHPH 4GO6B 3V7MA 1NCTA 5BW7C 1CDBA 2RJMA 2X89D 3PQYB 3QAZC 4JO1L 4XCNA 4XPAL 1A7NL 1HIMH 3OKOB 3TPUA 4EDWH 3O2VH 4YE4L 4UTAH 1AI1H 4ODUA 2B0SH 1KCKA 1ZEAL 3C8KA 4UIKL 3IFPA 3WIHH 4U0QB 4UIMB 3IT8D 2ZOKA 1NMBL 1Z0MA 3BWUC 3E0GA 4PJGA 2CDEB 1G6RH 3VXOA 4NO5B 3MA7B 5I8EB 1A6ZA 3GK8H 5CWSB 2RB8A 4BH7A 4D0CA 1ZHLB 1J0KA 3I85A 5C92A 2GK2A 3TJHA 1A1NB 1HSAA 4YO0A 1NANH 4WFFE 2JB5L 1AP2A 4HMCA 4NP4H 3CU7A 3O3DB 1EEZB 1ZVSB 1E4KC 1XGPB 3RWHB 1LILA 3MLZH 3RIAK 4U1JB 4M7LH 1WAAA 5HHMA 4M5ZL 1S8DA 4O51A 1SVCP 1LO3L 2J5LC 4HKXA 2F74B 1PKQB 2R1YB 1I1AC 3I3DA 4S10A 2YPVL 4ALAL 4QRRB 1F4XH 1L6ZA 3VFSA 2BNUB 2C1PA 2CK0H 4MQ7A 3T2PA 3T4AA 4GQPH 2VIRA 1MLBB 3TVMA 2R15A 2ZCKH 2ATPA 3NCCB 3CVIH 4JZOA 1M1SA 3D6GA 5J56B 2FJGB 3GSNB 1RZ7L 3MV01 4KQ3H 4M48H 1FO0A 3HS0A 5HHQA 1SBSH 1TZHA 2NQCA 2QSQA 4ELME 4PJCF 2XV6B 3MYJA 3CDYA 2OL3B 3LRGA 5D2LB 2R69L 3STZA 1IQWL 2O5XL 3AROA 5B38G 1OP5K 4PLJC 3HC3H 2GJ6B 4XVSL 5AG9A 1QQDA 2EDRA 1R3HB 4YLQT 1PSKH 2JCCA 2CR6A 1IAOA 3TZVD 5EBLB 1NFIB 4G6FD 2E7LE 5EA0H 4GUPB 4PYGA 2ADJB 3MUGB 5E8NA 3BMWA 2EYRA 2YSSA 3VD9A 4P49A 3MRGB 2VXSL 4WFGE 5C0RH 2ZCKL 1OAKH 4HUVA 2XWJB 1A4JB 4HBCH 4MQXD 3FRUA 5C8JB 4OZHE 3VGHA 4Q74A 4XPHH 4IRSB 2YPVH 3BZFA 2CRZA 1WBYB 4MA8L 3UTQA 4YBLB 2XOTA 1I3GH 3HR5A 3PP4H 4M1GH 5J89A 4JPIA 1WWBX 3LIZH 4OUUB 2PYFA 1F3DH 4U7SA 4NKMB 4HF5H 5I1EH 2RAMA 3ARGA 2HTKC 1UM6L 2VDQH 4OSUL 1KB9J 1WCBA 4B7IA 1UCTA 1T1ZB 3KYNA 3ZKSD 5F7DB 5SWQA 5DVKA 7FABH 3R06A 4BQBA 4XX1G 3RQ3A 5KN5B 5EBLA 3LY6A 1KTLB 3U9UA 1BZ9B 1EJOH 2BOBA 4MJ2A 3GK8L 2J8OA 4OM0H 4XXDA 1WFUA 3VMNA 4GRWB 4U1LA 3MXVH 1P6FA 2VLJA 5CZKA 2O61A 3I50L 2VDRL 3VI3F 4NQVB 5L6YL 1CT8B 4H1LH 3LKQA 2UWEB 1NC2D 2F19L 3BN3B 5F3HA 5J3HD 2P8PA 4NKDB 1FZOA 4KKAC 3QHZL 5GS2D 4UIKH 5B8CA 4IMKC 2XXMB 4H8WL 4JZJB 1ZXQA 3ULVC 2X4QB 4ZOEA 2ED8A 2Y4SA 1OGTB 5F9JB 1SEBA 2V2TA 4HSQA 2H8PA 4WTZG 3RWDA 3WCYA 1INDL 2B4CH 1DUZB 1S7SB 2C1PB 3QHFH 5C07B 3G08B 5CCKL 4NRZB 1QFWH 4NO0A 3FB7A 3WFDH 2ADIB 1BF2A 4N0UA 2EIZB 2WWMD 2QR0A 2HYMA 2FZ3A 1KCSH 3JV6A 3QEUA 3OXSA 1YEFH 1FNGA 1NAMA 3VI3E 3LRHA 5DK0B 4MS8C 5I71C 2E9WA 4WI7A 1IEBA 1QSVA 3LQAC 1DN0B 3KPRB 3EJYD 4P4KC 4W68A 5ISZD 2VB5A 3RIFF 1ZA6A 3BXNB 3HLAB 4I3GA 1HH6A 4C58B 4YO0B 4PJ7E 4QHKI 5ALBL 5GGSY 4QRPE 5FO7A 1GGIL 1W8OA 1TDQA 4JFHD 1RUQH 4NWUL 3N1PC 3O6LH 3UAJC 2E7CA 2PTVA 4ZPVB 5TFSH 4XRCA 1UWGH 3HE7C 3CIQA 3VDAA 4OI8A 1JHKL 4KJQC 2DTSA 3UCRA 4JFYA 2R9HC 2XXCB 3WJLC 3VFWB 1VKXA 3VMPA 1I7ZA 1NFDF 4DOHE 1L9NA 4NO0B 3V6BR 1Q1JL 3HNVH 4E41D 3SDXA 3VXTB 4OFPA 1BIHA 3MODL 3MOBH 2R4SH 5T3XL 5FGCE 1KLGB 2DMKA 5IKCB 3Q1SL 5D1XA 5E70A 3VWJB 2K3TA 2X4NA 5SWSD 1QO3B 5HYIA 1NUNB 5LAXA 4JPIB 3DETD 3QG7H 1KBGH 1D9KD 3KS0H 4D2NA 1QEWA 2DBLL 2XT1B 3NACL 2FIKA 4GLRI 1RI8A 5GSVA 1Y0LB 4JFDB 1RZIA 1HWGB 2AXGB 4OAWB 2PR4L 1N64H 3O3AA 3RU8L 4X6CB 4DFHA 3TZVC 1U3ZA 2FHFA 3CZFA 5EO1B 1ZLUK 2DL2A 5K9OA 4WY7L 4JFDE 1NBZA 3H9SA 3BKCH 3FQTB 4WI8A 4MVBA 3NVQA 4D0CB 4KJWD 3E6HA 1JE6A 3I6KB 3N1MC 2ZSVB 5C0BE 3FB6B 1M4KA 1CXKA 1NMCC 2I5YL 3ARFA 4XCEB 3GHEH 4UUJB 3QUML 4YHZH 2AEQL 2VC2L 4HULB 2HJKA 3AS2A 4NHUA 4Q6IB 2X1QA 1UM4L 4IEFB 2PW1B 3TNNA 4JFFB 2AGJL 3H2WA 5E2VL 2AJUH 4XC3H 3PDOA 2R0WH 1A4KB 2J4WL 4FP8L 2IQAA 4Y19E 4TULH 3OWEA 1CDUA 1AGBB 3FHAA 2ESVE 2MMXA 5JXAH 4DEPC 3MNVB 3O3AB 2XRAH 2BK8A 2CDFA 2C1OB 2P4AB 3D5OF 3GHEL 4WWID 1IRAY 2GJJA 1DBBH 3IDJB 4HPYL 2FX7H 3QEGH 2LVCA 3FQXA 3V6ZB 3CPLA 3W0WA 2PF6A 4R4FH 5DC9B 4ZSOE 3SDYH 3V4UH 3BKCL 3OKNA 3I9GH 1EHLL 1T2QH 4YFDB 3B2UD 5DZLA 5J06A 1AE6L 4TVPD 3FONB 3R1GL 4Z6AT 3CJJA 2D0FA 4FQXB 2IJ0C 4XMKL 1CCZA 1GGBL 1DQLH 2AV7A 3SE9H 3UYRH 1HINH 4DGVL 1L6XA 5AYQA 1L7TH 2IQAB 2E3VA 3TO2A 5KSVB 2PKDA 3CVHB 5IROA 4YGVA 4RGOL 3VH8G 3RWDB 2GUOB 5EDXA 5I6XB 1AGFA 1FZMB 1JN6A 1S3KL 3HAEG 3OF6D 2CIIA 4LEOA 3HAEH 3PL6A 4ODVL 2DYPA 1II4E 2ZJSH 3QXAA 4W6WB 1Q9WA 4X5WA 5EZJB 1S7WA 1ED3B 1SHMA 1HINL 1HYRC 5DRZB 4N0RA 3P4OA 2WBKA 3PWUB 3ZTNL 2IMNA 4TTDD 3BP6A 3W82A 5DO2C 5B3JE 4HFWB 3HZMA 4IDLA 5I1IL 3R1GH 1CE1L 1W72B 3QH3B 5TDNB 1MRFH 3MV11 4OZIF 5FYKU 1J0YA 5JPMB 2QJDA 1RZKH 3VRIA 3ARBA 2IEPA 5FHBH 4PRHD 5DK2B 1CICB 2W60B 3JWOC 1VENA 3QG6A 4Y19B 3QFJA 3B8YA 2YD6A 3IU3A 5D1ZA 2DIAA 1YEFL 4JM2A 3DO7B 1FBIH 1BAFL 4HJ0D 1DBJL 2NY6B 4KKCC 5JXEA 4G7VH 2E7LC 5TQ0L 3CX5K 4EVNB 4PJBA 3RIAF 1LK3L 5L9DL 4F80A 1H3TA 5DA4A 4BFIA 3WE6A 5KSAD 3MRNB 4U7KA 1NCDL 5F1OB 4M1CD 1EAJA 3MLYL 1CWVA 4D9RD 3MA9H 2J4WH 2HLAB 4DK6A 1NGZA 2ICWJ 5KS9A 3QZWB 3D39D 1P7QD 4L29B 1KN4H 4XC3L 4H8WH 3VXRA 5I0DA 5MEND 5ESVB 3BPCA 2P48B 1ND0B 5A1AA 3WNPA 5CJXA 5BMFH 3RZCD 1FPTL 4L8SC 4O4YL 2Q8AL 1XCTB 4X7CC 2AEQH 1FFPB 3SDCD 4MQTB 3CZFB 5EO1A 1H8NA 5EPMA 1NBZB 3QCTL 4M3KB 4YHML 3GI8H 3S88H 5BZWB 1MCEA 3RI5F 3DMMD 3ZL4L 5LJYH 5GGSB 4HEPG 3ROOB 3RTQD 1YQ2A 4ZNCD 1JPSH 4UT9H 3JSSA 5FV2A 1G9ML 1JHLH 5IB2B 5MHSE 1RUKL 3IFLH 3Q3GB 1UM6H 4FG6C 3KPTA 3O0RH 2OI9C 4X7TA 5HVWA 4F2MA 4XP9L 5EUOB 3TWCL 4HIEA 1YY9D 3JUZA 4WU5A 1I3GL 3AAZA 4JFYB 1I1CA 3NACH 1GC1C 3IXTB 1KBGL 4MA8H 1U8QB 2AI0H 3QNYB 3PV6B 4JDVA 4U1NB 4YHLH 3G6JB 2NY6C 1X5XA 5F3BB 1VESA 3I3EA 1KTDB 5ESQA 1QZ1A 4XP5L 1PKOA 2VITB 2DQUL 4JG1L 3B9KA 1QLEH 5GRUH 1TMCB 2V5YA 2H32B 4NNXB 3F65A 2VDPH 3SDDC 1KOAA 5I1GH 1I7RB 1H5BB 1N4XH 2IAMC 1WVZA 2XTLA 1I4FA 1OOAA 4MJ5B 3NFPA 2YUZA 5L2KB 4HQQH 2B5IC 2F8OA 1KJMB 4K3DL 1IQWH 1UZ8B 3D9AL 3G6DH 1S7XB 4C56E 4WFED 1IKNC 1JGEA 3FB5A 5E6IB 2A6JA 5C6PB 5E99H 1YPZF 1UB6B 3AS3A 3IFNL 4N1EA 4BJLA 4IRZL 5DD3L 1ZLWH 3C6LA 3BGAA 4NQDD 4LAQH 3Q6FB 5IMKB 1GOFA 1N7MH 4G8EB 5DD6B 3VFSB 3CCHB 5E2JA 2YBRA 3FOMB 4ISVA 3L1OH 3GRWH 3WFDL 4ALAH 4P5TC 5DF0A 4A6YH 5IHZA 2A0LD 1K85A 4KTEL 1Q9KB 2OM5A 1T20A 1YEKL 3HZVB 4I3SH 3QHFL 1JFQH 3RL2B 3LDBB 2BXZA 2QSCH 1U3JA 1LO3H 4YZFF 2OZ4A 3K2MC 1M71A 2BJMH 3ARTA 3QI9A 1Q94A 1CR9L 1J8HA 1DUYB 2DB8A 4HH8A 4ONHA 4OQTH 5DRXB 2R0ZL 1VERA 4ZFOL 1FFRA 3ECBB 1FORL 1JYWA 1X44A 2GQHA 3KPLB 4ZPTB 2JB5H 1MFBL 1S5IL 1AXSA 1F8TH 4U6HA 4U6YB 2Z8RA 2VDRH 1KELH 4E41E 4ZFGH 5C70A 3TBTB 1NH6A 3H9ZA 4UQ2A 5T1KB 1UM5L 4X6DE 4XCYB 1IZJA 4YAQA 1EJOL 2NY0B 1A1OB 1PG7L 3GJEB 4NQDA 1NUDA 1VGKA 1EO5A 1F8TL 5C8JA 2QQNH 1KPUB 4U6XB 2DDQH 3WE6B 2XWTA 4GXUN 3DECA 1P1ZA 2ZWLT 4PRPB 2R0ZH 1A7NH 4R0LA 3VG0L 3OV6A 4YXLH 3MGOA 3KPSE 3SKUD 3UAJD 1RU9L 2OL3L 3DPBA 4XNQA 5ESQB 4X6EB 4ZO7A 5EU4A 1FZJB 3L1OL 1J11A 4UV7L 4XPHL 4MNGA 5C08E 1IGCH 1BPVA 3LSOB 3VWKB 1MIML 2DQIH 2X42A 1G1YA 1CIDA 1T1XA 4HLJA 4JFFE 1DQMH 1CS6A 2WZPD 5HYJD 4M61A 2OL3A 4OD3L 3M17A 4LLDB 4EDXB 2BDNL 4QF1A 2RFXA 2Z92B 2GIYA 5F89B 4DVRL 5F7LB 4P4KA 3ZDZF 3L7FA 3BGFB 1XAUA 4WFHD 1VGKB 1I8LC 3ZDXF 4FXGB 4K9EC 3S35L 2Z93A 1IL1A 5DJ0A 1RJYB 2F8VA 3HMXL 4DK3A 4KH2A 3NCBB 4DVRH 4N8CL 1D6EB 5I18H 3TA3D 1KIQB 1A3LH 4OV5A 4XBPB 5I1GL 1O7SA 1XZ0B 3HE6C 3LVEA 4HGKC 1X3DA 1D5MB 2KZWA 5E8PA 1LE9B 4KKBD 3WIIL 4CVXA 1M7IA 1UACL 2VQ1B 5L7XH 1V3KA 2D3VA 2G2RB 3VFTB 3LQMA 1F13A 4GRWE 4PJCE 2OR8A 2V2XB 2PO6C 4N5EA 2ZCHH 1FNGB 1UXSA 4RWHA 3U9PL 1MEXH 4WEBH 1KJVB 5E4IA 1B3JA 4J12A 4XI5C 3ABZA 4ZD3H 1NFDA 3W0WD 1S7QA 3ARGB 2VQUA 4MNHA 5J1AB 3VXSD 3BHBA 5CJOL 4X4ME 2VLRD 2FL5A 1OTTC 3NCJL 1AD0A 3EYOA 4MAUH 4Z18A 3G5XA 5EN2A 2QQNL 4YDVB 4Z7OF 4QT5A 3TBTA 4JRXE 1CGWA 2R2BA 1WBZB 3VWKC 1FAIL 1XF5B 2NR6C 3ZL4H 2FJGA 1WEJL 5HYQA 1XIWC 1JGEB 2DKSA 4YHMH 3S5LA 5MI0B 1TVBB 4PJEF 4KK8C 2VAAA 3IFPB 1U3HC 3G6AB 3L5JA 5IG7A 4NKDA 4OZIE 5D1QA 4J3UA 1T7VA 4O4YH 5HGDA 4GRWF 1WFNA 2JJTC 4LMQE 1CQKA 3C60C 3KYOA 4PJAB 1ZLSL 2RGSA 3WIHL 2R8SH 3DI2B 2O5YH 2H1PH 3T8XB 4AEEA 3B2UC 1JGUH 3TFKD 4YE4H 3GIZH 1OL0A 4EDWL 4OCNC 4XPAH 3VGBA 2KUTA 3C60B 1UVQA 4QHUB 2D31A 3LHPL 5E8NB 1DBMH 4ONHB 5EOCL 3ZHKA 4RFNC 4HW6A 3H6JA 4KTEH 4PGZA 5FIEA 3P0VH 4ZFOB 4A6YL 3WIFA 1MH5B 1X5LA 2GHWB 1LK3H 3WKML 3D39A 1DEEA 2DD8H 3LV3B 4PJEE 3ARDB 3PHSA 1NJ9A 3QIBD 3RIFK 3U36B 4ELMB 1FBIL 3GMPA 1OGAD 2Y25A 3IFNH 4M9OA 5JW3H 3SGJA 1KEGL 1I8LA 5FHBL 4MCZB 5HJ3A 3WJJC 1X7QB 4V1DE 5LWYH 4IIQB 4OD2B 3O6MH 2R2HA 3MOQA 5C0CA 4EKXA 4LSQH 2D2OA 4PREA 4ZUWA 2PUQT 2X7LB 4JFOA 5ANMA 3VDBA 2LU4A 3LN4B 1GCFA 3H9YA 1ONQB 1IGFL 2HJFA 3QUKB 1S78C 5TGBA 3P4NA 4HUNB 3D2UA 1NKRA 3NIGF 3RBGA 4BSWA 5J1TC 3ZE2F 4BUGA 1WWAX 1ZS8B 1CLYH 4XWGL 3L6FA 4P2RA 2ZJSL 2VDPL 5EU5B 5D2LA 1OVZA 4YK4C 4HBQA 3CK0L 4Z7VF 3E3QE 2QQLH 3UJTL 2Q86A 3IDMA 3MACH 3BEWA 1R3HA 1A7QL 4LDOB 3RNKB 4N0CD 3U36A 3MV7D 3N06B 5EZOH 4ELMA 4P2QD 3GSXB 1UH4A 2X4QA 4K3GA 5E1AB 3X3GL 3SE8H 4G6KH 1GGBH 5D7KD 3HB3C 1CD1A 1JHTA 5DQDL 3IDIB 4UAOC 1S7SA 4G3YL 3IKCB 3FQNB 4PJFE 1D6VH 3MRLA 1AHWA 3WO3B 2ZP0T 4PP8C 2QLVB 1TJGH 1WLHA 3CH1A 2VDNH 3ZE0E 1RUKH 4M7LT 2A73B 3EYVB 3P77B 4D94A 2P24B 5D96B 5IJKA 3ERYA 5KS9F 4C83B 3MRCA 4PJBE 2DTMH 4KXZH 4ZS6C 4PJFB 4P2RB 5IIEB 3D18B 2MQ3A 1WGOA 3T8XA 4TUOB 3R8BB 5F93C 5BMFL 4NCDA 4CJ1A 1QFUL 4XNYH 5T5FL 2VH5L 1OLZA 3FT4B 3CMGA 1Q9OA 1UWXK 5IB3B 1S7WB 3FAWA 5K93A 1LO0L 1HOCA 4DUVA 4FNLH 4NQXA 3JWDL 4AYFA 1KN4L 3S3SA 1JPTH 1OTTD 2AJUL 3WUWG 5HYJB 2VXTH 1M7DA 1CFTA 3REWA 2OMNA 5FYJE 3ZE0F 4PJEB 2V5RA 3QCUL 1XGQA 1A9EA 3T0EC 2H2SD 3QXUA 2KKQA 1KYOK 1QSFE 1UXWA 2NY6D 4PRIA 1BQHG 2DQDH 4KKNA 4QT5B 5DK2A 5TQ0H 2V17L 5DEZA 2DTML 1KNOA 1AHWC 1DBJH 1K8DB 4Y16C 3TN0D 3VXUD 3IDNA 4PY7A 1A7OH 2W38A 3THMH 5FGBC 1KPRB 3GGWB 3MJ7B 3HN3A 1EZVX 3DGGB 1C08B 2IAMD 2X4TB 5ENWA 5AG8A 3MRKB 5JOEA 1E27A 3LPWA 5INDA 5DMGC 2P1YA 4LIQH 1MRFL 2HJFB 4Y5VC 2XWBB 4BM7A 2MPAL 4U31A 2Y36L 2X1OA 5GHWH 4PJAA 3H9SB 3RVUC 3RWIA 2FEEI 5DO2D 5MEOB 4MX7B 1LEIB 5E2UH 1R5VB 2F54A 2A6IB 5ESVA 3GHBL 3J8F7 2GT9B 3FO2B 3MOBL 4DVBB 7CGTA 4RGND 5BZDA 2ERJB 1TQCC 1G7PA 4PJAE 2ZNWA 2Y7QA 5D2LE 4F7CA 4F7PB 4LGSB 3PDDA 2GJZB 5I1CH 2VZSA 1GZQB 5T3ZD 3NZ8B 4MXQA 5GS3A 5DA0B 3GHBH 4KRMB 4M7ZC 1INEH 4Z7OE 1CD1B 1EPFA 1JHTB 3O8XD 5DEGA 2I07A 3KJ6H 1E6JL 3R0MA 4UAOB 3MBEA 3MLWL 1R24A 3EOAA 1A6UL 5EO0B 3PGFH 2A6DB 3RI5K 4OZIB 1IGIH 1FV1A 4N8PA 3KXFE 1TJIH 1CGYA 3H7BA 4AZ8A 3BQUA 2HA1A 3TV3L 1MCBA 2LU7A 3EFFA 3KPQA 1X4XA 1MCCA 4K23H 4WW2A 3FFCA 4JB9H 4QHLB 1A7OL 3THML 1K5NB 1NPUA 4M43H 5DD5L 4EUPH 2GSIA 1DBBL 4HPYH 1MVUB 1KCLA 1JK8A 4D9QE 3PWNB 1U93A 3AB0B 3MO1A 4NDMA 4PG2C 5I30L 1KSRA 3GMLB 4JKPL 3DO3A 4HUUA 1QFWL 2MQCA 1W0WA 3ZYZA 4BQ8A 4HWBL 4I4WB 3NZ8A 1J8HE 4I48A 3O6FD 3O3EB 2BY2A 5CIPA 1M7DB 2CDGA 1X5ZA 5FB8A 3BPLB 2FX9L 3MLRL 3JWDH 1JGDB 3DUSA 4P46A 1LO0H 2O5YL 2AGJH 2R8SL 2VH5H 4HT1H 4Z9KB 2F5AL 4ZFFA 3WO4C 4PRDA 3I50H 5LBSH 4WO4D 3SCMC 2EXYC 2FD6L 3WXVL 4HK3J 2I5YH 3B3IA 1JVKA 4ZS6D 5JORB 5JHDA 4LCCA 4FMKA 3SE3A 3LQZB 5E9DE 2ARWA 4HIJB 2JJUA 4PJ5B 2BSSA 2H6PB 1MHHA 3ZE2E 4JO3L 2VDNL 1X5JA 1XH3B 5AYUL 4MAUL 3RU8H 3S34H 2VXUL 3P4NB 1QR1A 3NCJH 5HGBA 3BQUD 3KJ4B 5CAYB 8CGTA 3QPXH 5DQDH 4YUEL 3IJHA 4P57B 1CDJA 2JJSA 5D93B 1C8PA 1VGEH 5CEZH 3U9PH 2IANB 1B4JH 3FQRB 3MR9B 4KTDL 3T0ED 1CFNB 1MI5E 5HHXL 1CFTB 5L7XL 1NUFA 3KYMB 4NUGL 1MSPA 1CD9B 3H3PH 2DJSA 3MRNA 3BKML 3C5JB 3KAAA 2FRGP 4OV6F 4ACPA 3ULVL 1M05A 2CUIA 4ODWB 4CL7A 4K94C 4WFEE 5J12B 3V0AC 3BUYB 1A3LL 3C87A 4RWYH 2OTUB 4J4PD 5IB1B 4HIJA 2FJHA 3O6LL 4G6FB 3CFBA 5ADOL 1JN6B 1N59B 2DJ4A 2X09A 5HHOA 2PO6B 2MFNA 3S35H 4RMWA 4RQQA 3D0LA 3EO0B 4X6DB 1IKNA 5DVOA 1A8JH 3CFJB 2X10A 5CHNB 1KEGH 4QEGA 5JW3L 5B38A 1C12B 4KAQH 3UPRB 4OGYL 1TQCB 3TT3H 3VWKD 5FECA 1FL5A 4GW4A 1XIWD 4HPOL 3BRFA 1MIMH 4AENA 5GRVK 1NCUA 5GGTL 1XGUB 3GBNH 1XCQA 1F4XL 4NSKA 3O3EA 5CIPB 3SGEI 4MMXC 5DZOA 1F3DJ 4HLZG 4HK0B 1JZ2A 4UB0H 5EBGA 4MHHG 1INDH 1NFDE 4FFWC 2ZG1A 4RBPH 1J7VR 4HAGA 4YXLL 1NDGA 1K6QL 3VG0H 3TFKC 3MLZL 5EORH 2H1PL 3FN0H 1ZLSH 5F3BA 4FXKA 1J0IA 2E8YA 2OP4L 1FGNH 3SDAC 1KGCD 1IGTA 4RQQB 1P4LB 3V6OE 2HRPL 5LGKA 1BMGA 1PG7H 3SDXF 4QOKD 1YDPA 1I1AD 3LQZA 3MXVL 2NCMA 1UM5H 2CO6B 3VRLE 1F3JB 2IG2H 3LEVL 3QDJA 5CGTA 3TH3T 4HKBB 1NAML 3RZCA 1G6RL 4UIMA 4EI5B 2FLBT 5E9DA 4XCCH 2ZUQB 3PE9A 4G9FD 4BFBD 1MFBH 4QRSA 2OP4H 5DHVB 4L4VA 3QR2A 4OSUH 4XHJD 4JZJC 3BKJH 1DVFA 4XMPH 1ZEAH 3VXOB 5HYJE 2ZG2A 1A6VH 3UTTE 3UO1L 1S7XA 1H8SA 2P7TB 4PR5A 1FORH 3LKPB 1HIML 5IBUG 1U8JB 2ED9A 2HT4D 4ZD3L 4NPYB 3UTZA 5EIIA 4DVBA 5F7FA 2Q8BL 3QO1B 3O4OC 2ZCHL 3GM0A 4TRPL 4R7DB 1JYVA 3T3MF 5LGJB 4JPWH 3GRWL 2FJFA 4YDVA 3I6GA 5FYKL 1P4LA 3WO4B 4MSWA 2P5EB 4HPOH 1S8DB 4YDJB 1GGUA 1CGXA 3W5MA 2DLGA 5EIQA 4OGYH 3TT3L 2YXFA 2N7BA 5F88A 1KIRB 3CFBB 1RK0B 2YK1H 1HEZB 3GSQA 3T77A 2DICA 4YBLC 1KV3A 5F1IB 4XVSH 4GQ9L 1IM3B 2AK4A 3VRJA 4OFYD 3AMLA 5DUML 5F7UA 2R69H 3F8UB 1A14L 4X9IA 4PP1D 5HHOE 1JMZA 4U1HA 2LQRA 4MJID 3RGVC 4FQXA 3WXWL 5D71L 4OD3H 5DHYB 5C0CD 3G5YB 1ZHNB 4TTGA 5DUBB 1U93B 3RHWK 3MLXH 1KJMA 2XPGA 3FQRA 2ZNXA 2R1XB 4KQ4L 1XF1A 2EDKA 2Q3ZA 3BKMH 5HGHB 1B0RA 3UDWA 3KDMB 4QOKB 3W9EB 3KPRD 5GRYA 1IGCL 4NUGH 2VIRB 2E9JA 3RGVB 3B6SA 5HHXH 2BVQB 2F53B 1JYNA 2IPKA 3MRBA 5DJAB 1PG7W 4FTVB 3U79A 4UILL 4WW2C 4KMLB 2DQCL 1B4JL 1HKLH 2AI0L 2M26A 1RPQA 4XVUD 4AIZB 5CEZL 4KJPD 5IW3A 4OUOA 3BEVB 1X4ZA 3UZEA 1J5OH 1IM9A 4PJCB 4YUEH 2NLJB 4WTWA 1TNMA 1KF9B 2YA0A 3C60D 4M00A 3TWCH 4KY1H 4L4TB 3V9FA 2ADIA 1MCDA 3S4SA 1E28B 4XP6H 2N4IA 1SJHB 2YA1A 4NO5A 4EN3D 1LP9A 3L3DA 1G9MH 1HXYA 4X0KA 1EMTH 3MRMB 1MELA 4OF6A 4ZNEA 1T6WA 3DIFA 1T04A 3ARVA 5EC2B 3MMEB 4KDTA 1WFOA 4RFOH 1EAPA 1T3FB 1PD6A 4QXGL 2GYSA 3EGSB 1I1AB 1MF2H 5F7KC 2C5DC 1DVFB 4TVPL 3DSFH 2F5AH 4NM8H 4QGYA 4PJ8C 4L9LC 2YMXH 3ARPA 3IFOB 3HC4L 3CFEB 2B0SL 4O51B 2NY5L 1GVIA 4XRCB 1MHEA 2OJZH 4I18A 4JO1H 1CR9H 3MA9L 4PV8A 4P23A 2R2CA 3HHRB 1T22A 3ULVE 2QSCL 3RVUD 4NN7B 1JFQL 1QRND 1BQLL 2VZOA 4OCYH 1AGCB 4MSWB 1HNGA 1U42A 1ACZA 4V2CB 1N0XL 4PRPA 4PJBF 1AJ7H 5C0CE 2VMFA 3R06B 4G7VL 4MZ3A 3MRHA 2J12B 1VFBA 1JWUB 3RVXC 4MVBD 3ILQC 2VR5A 3RX5A 2KH2B 3DV4B 1J8HD 4PREB 4X7SH 3U7WL 3G9AB 1HHHB 3UTPE 4KV5F 1K4CB 3BD5A 4D8PB 2Y5TB 5ID0B 3TV3H 5J6HA 3BZDA 5D6DA 2NX5A 4QHMA 4HIIB 3B9EA 3G6DL 1JUFA 1IGIL 1FVDB 2C4FU 3FJTA 3QUZA 4K3DH 5ITFB 4HWUA 4PJGE 5FM5O 3PGFL 4WNQA 3QO0B 3UROR 2ADJA 4HQQL 4X7TB 1SMOA 3JWOL 5D7SL 3T65B 4R2GC 1J9CT 1E6JH 5C0BB 4Y2DB 5E5RB 1INEL 3O45B 4ZODA 5E5MA 3MRGA 5TF1H 1N4XL 1A1MA 2FH6A 1ULVA 4WUKH 2ESVB 2OK0H 2EDXA 1A0QH 5E9DD 3X12A 1QLEL 3PL6D 3TYGH 2IPKB 4QXUH 1SJEA 4HWEH 1XR9B 3VFVA 2NPLX 4JFEE 3UJIL 2BHZA 3PHQB 2PETA 5TJWK 4GRWH 1NGYB 1C5CH 1IM9B 2E7MA 4DGVH 4PP2A 4WHTB 2VL5A 4CVUA 4LF3B 4XPFL 4LVOB 2BCKA 3IKCA 3CXHJ 3RL1A 4NZJA 1URLA 3HUJE 3RVWD 5KZCB 2Y36H 5GHWL 4HK3N 3EOBB 3L5WA 1AQDB 3G5ZB 4F8QA 4LIQL 5DZNA 4ZUVB 4IM8A 4BSJA 1T2QL 2DQHL 3LQAH 1LK2A 4FZ8L 4UTBL 5GRZA 2UUDH 3BDYL 3E2HB 1JHLL 3DHJA 3OKDA 5A2FA 3V4UL 2QADD 4PJXB 4XXCA 5IM7B 4UT9L 1JPSL 3E6FA 2CPCA 3L9RB 2LABA 2HLFC 4OZHA 4ZUSA 3QCTH 3UX9B 1UB6A 2H2SC 3KR3H 2MSPA 4LSTH 1P9MA 3QQ4A 1F3RB 3QUXC 4X6BA 2G9HA 2APFA 3ULUH 1LQVA 4WGVB 2Q8AH 3U1SL 5GRJL 1HOCB 1FPTH 5JXAL 4OKDA 1Q0XH 4ODSL 2DKUA 1B0GB 4KJPC 3IYLW 1Z3GL 1QD0A 1T22B 4WIQA 3EDDA 3PJSB 4JZNB 5I17B 2ZPKH 3LKRA 3UTSA 5BS0B 5LGJA 1A02N 5DQ9B 4M5YL 3BEVA 3AM8C 4R90L 3UZVB 4HGWA 4F7MB 2FEEL 3MLYH 4EN3C 4Z7WB 4NFDA 2NY1C 1NGQL 4ZTPH 2E7HA 4ZNEE 3GSWA 2W0FA 4HCRL 5JQ6H 1F4HA 5A16B 2M8XA 1CTOA 1JIBA 4X4XA 2HN7B 3QUMH 2HWZH 2EYSB 2J8UE 2AXJA 4QHKJ 5CILH 2W92A 4PRPE 3VXRD 1YA5A 1LD9A 4U7MA 3ZSTA 5F1IA 4X9GA 4LHUA 1IM3A 1BFSA 1RIUH 5D7IB 1RZKL 4WY7H 1QBMH 5CMAA 3QUZB 2IF7A 2ITCA 4J4PC 4NQCD 4F57L 4KROC 4RRPA 5F9WB 3SKMB 1MAJA 5I1IH 5L2JB 3M1BA 5JHDD 5IMLB 2PYEA 1DJSA 1NEZA 4G6KL 5SX4H 1OD9A 3ZTNH 4JDZA 3F12B 1P1ZB 1U3HB 1RD6A 4Z95H 5A2JH 5ICZB 2AP2A 1AR1D 4OI9A 5F8RC 1WZ1L 1MCPH 1NC4A 3AY4C 2O26U 1TFHA 1CLCA 3ILPB 3GM8A 4MB3A 4I0KA 1A7QH 3B6SB 3HI1B 4XNUH 1HSBA 4PRDB 4F9LC 2NZIA 4LQFL 4O9HL 4RGMB 5E6IC 1MCOL 4RGOH 1U95B 3KNBB 4HJ0C 4JVUA 4LBEB 4X83A 3U46A 3BW9B 3TO2B 4PLOB 2HT3D 2NX5E 2HVKA 5HGGS 4L29A 4KWUA 5TDOA 5KSAC 1IGFH 4QRPA 3F7VB 3VD3A 4NWUH 1BHGA 3GSVA 1E4WH 3K8MA 4YHOL 1AIFA 1HXYB 2FYYA 1AE6H 1FLRH 4DW2L 2YPLD 4JM4H 3O6ML 3NOIA 5BS0E 2NXZB 3I9GL 5ICYA 5IFAL 5C0IA 4GS7C 4I9WE 4AM0A 4R96A 2HFGL 3SJVE 1HQ4A 3V0WL 2ZG3A 1KB9K 4WV1A 1KCSL 3MRFA 4ODHH 1C5DB 4N1HB 5F6IB 1JJUA 2DD8L 4U3HA 2BNRA 4XBGA 3WKMH 4R7NA 1B0GA 5I1LA 2XRAL 3KPPA 4PRPD 3CMOH 5D93C 3VXRE 3P0VL 1YMMD 2C3WA 4IMKA 4WRLA 4P4RA 5E8PB 4B0MM 4ZUTB 3SBWA 5L8KB 1KT2B 3B9DA 1Z9LA 3E3QC 3C6LD 4I0PA 4MXQD 4OM1L 4FP8H 2F8XC 1ROWA 3BGFC 3BPOB 3W39A 5I1DB 4YHNA 5KVDL 4LLUA 2VLME 1ZANL 4CN6A 2M2DA 3F7YB 3QHZH 1BQSA 1RJCA 3P4MA 4U1MA 2F19H 4NOBA 3QAZB 4Y16B 1FIGL 5L6YH 2Y7QB 1WF5A 3G5ZA 5CKGA 4F7PA 4WUUD 4BZ1L 4HGMA 4YHZL 2HLFD 3F7QA 1MI5D 5F7EL 3O11A 4OM0L 4LSRL 2BSSB 3QT2A 2IFGA 3KS0J 1WEJH 5FECB 1FAIH 1GZPB 4NN7C 3WBDA 5JZ7D 2AJVL 5B3NA 3I6KA 4X80L 3MRIB 5DJCA 2EKSA 2P8LA 3QIUB 4Y1AA 3WN5B 5IHUL 4J3TA 1T0NB 5CJOH 1PY4A 2GTZA 3H7BB 3PP4L 2DRUA 4LCWA 1D5BB 2DBLH 1MQ8A 2EC8A 4ETQB 2ESVA 3WS3B 3MJ7A 2AW2A 5GIRA 1MJJB 4PTUA 5DEFB 3HE6A 3OG6B 1KTKE 4OUUA 4LLVB 5J3HC 1SJEB 2R4RH 2VE6A 4OIAA 3TVMD 3WIIH 3ARRA 3OKEA 3CSYB 3MXWL 3MNVA 4IDJH 1KEML 5T1MA 4HFUH 5A16A 4TPRL 1U8NA 1YY8B 3LKOB 5EPMB 2R1WB 5EA0L 1JHKH 3LOWA 1UEYA 4HKBA 3PG2A 3AS1A 5D1XD 5L0QB 1CT8A 3L3HA 1IEHA 2A0LC 4AIXA 3AGVA 4LLYB 3MJ9A 1GGIH 5AAMA 2D7QA 1WISA 3RJQB 1T1WB 1BWMA 4LVEA 4HXBL 1AXSB 3O6FB 1U6AH 1ZVYA 3ZO0A 1LO4L 1UCBH 5L2JA 4URTB 4HV8A 3K80A 2YD5A 5BV7H 1RJLB 4NQSB 1RZ7H 4LSSH 5DVLA 5JHDB 3D2UB 4DWHA 3VXQB 1V8HA 4LDEB 3SDAD 3BSZL 4KDWA 3CVIL 5FUOH 2ADGB 3I3BA 4V3DB 3BWAA 5H35B 3BJLA 4H20L 4LU5H 2OSLB 5LCVL 5DJDA 2WINA 2UV3A 1UH2A 4UV7H 5CJ8A 5FO9A 1MAML 4KRPB 4QXWA 2R9HD 4OFKA 1NCBH 4PJ8D 2NY3C 5DK0A 5FYKD 4ELKA 5D2LF 4M7LL 4FQQA 4L3EB 2J8UF 3FZUC 3MV7E 4Y16A 5M95B 1MFCH 2DDQL 1EJ6A 4OLZH 1W0WB 1FFPA 1AC6A 5GGRY 3RDTC 2YXMA 1I85A 3T09A 4ZPVA 1IM9D 2HJLA 3BP5B 2EIEA 4I2XA 3MV7A 1ZT1B 3OGCA 1BQHB 2X5PA 1YUHA 4F15B 1ZOXA 1H0DA 2HT2C 3BH9A 2WIIA 3ILQD 1KELL 4ZFGL 1VB9A 5D7JA 1BOGA 7FABL 1JWMA 5FDWB 2HTLD 1S5IH 3L5HA 4U0RB 2VDQL 4YZFE 3WHE1 4KJWC 5EZLB 1GGTA 4X9FA 1AI1L 3U4AA 1RJYA 1R3KA 3LIZL 3O2VL 4UTAL 3ULSB 1PG7X 3QO1A 2X9YA 1GSMA 3VI4F 4M1GL 1IKFL 2X70A 4L3CB 3MROA 4D0DB 2BJML 4LCWE 1GC1H 2FNBA 5IP4A 1YN7A 4I3SL 2H3NA 4CVWA 1UT9A 3GMQA 1FRGL 1ES0A 1HN1A 3NFSH 3L5XL 2Q6WB 1N7ML 1OAKL 2R1WA 2X4PA 4LAQL 2HVKB 4RFEB 1FCCA 1OAYL 2M1KA 5E8EB 5DD3H 4F33A 2BVOB 3JUYA 1ORSA 5GS0D 2V7HB 1T5XB 3PQYA 4CAGA 4U05A 1T2XA 1N2RB 1GXEA 4EJ1C 1PSKL 4GW5B 3BI9X 2W65B 2YR3A 3RFZC 4NJ9H 5D1QD 3VXUE 3HC3L 3IVKB 1OP9A 3D9AH 1SBBA 3LS4L 4QTIH 1WITA 1BWWA 1YQVH 2UZIL 2XTJD 2GTZB 4KUCF 1MHEB 3C6LB 3IDXH 1FDLL 4PV8B 5F6IC 5DFVD 2EXWD 4X6CE 4N0YH 1OT1A 3QIWD 1XF4B 5BJTA 2H2PD 6FABL 3KWWB 1A9BA 2R39A 4LKXB 4JG1H 4MXVE 1G7LA 2EH7H 1ES0B 3IJSA 2Z31A 3QEQE 5KJRH 4XP5H 1FFNB 5GS1A 3CXDL 3INUL 3PDGA 4RNRA 3TA3A 2D0GA 3I6LD 3MRHB 4PJ7A 1WT5A 4YHLL 3GBML 1K8IA 2YC1A 3NIDF 3PHOB 1OGAA 1U3HD 1CICD 2VDML 3CX5J 3DXAB 3GJFA 1IGJA 2DIJA 1F2QA 3C6SA 3GZKA 4JRYD 3UBXI 2E8ZA 3FTGB 4FFZL 1N2RA 1NMAL 5CGYD 3LMJH 4XP9H 4GKSA 2G75B 5FA4B 3P73B 3L3IB 4WHYG 1HHIB 1QRNB 5FO7B 1U8OA 2A1WL 3IFLL 3VGFA 4NP4L 2H45A 4KDTC 3NBNA 1FJ1A 3MGTB 4NOFA 3GMMB 4GSDH 4D9RE 3IAQA 3L3GA 3T1WA 3PABA 5GXBB 4PLKD 4CJ0A 2VLLA 3JXAA 5IVXE 4XBPA 5IVZA 3BJ91 4CKVX 1NBYB 1XZ0A 4J7RA 5H94B 5CEZD 4X8JA 3EAKA 3VXNA 5CP3H 3GMNB 5A2KH 1LE5A 4IJ3B 4PJHB 4ZTOH 3VGEA 3OBAA 4HH9A 1FFNA 1NMBH 1S7VB 4ORGA 5D1ZD 4Y4HC 5J0BA 2NY3D 3PWPD 1MJ7L 3O3BA 3FQWA 5IB5B 5F9WC 4L4VE 1CG9A 1T80A 1DUZA 5KSUA 1FNSL 4N5ED 3G08A 2VUOA 2CKBA 4PJGF 2X9XA 5B39A 4Y4KD 2OZ4H 4Y2OA 4EI5A 4DZBA 1EFXA 4IMLA 1CLZH 3H9HA 2CMRL 3L6FB 1XIWA 2P46B 4JAMA 3VA6A 4M1CC 4XAKD 1RHFA 1CI5A 5MI0C 4I77L 4HWBA 3VFMB 3FT3B 5L9DH 5I16A 1ERNA 3U0PB 1B2WL 2IBGA 2BVQA 4OIIH 2IALA 1FYTB 4N8VB 4DEPB 2D31B 2NY1B 5FOBA 3UYPA 2F74A 2X40A 3B5TA 3NFNA 1FAKT 1HH6B 2JELL 1QHOA 4O2EB 4HS3A 5J57B 4NO3B 3L3KA 3BP4A 4NYLA 4GKNB 3ZT5A 4EQ3A 4G9FB 3GMPB 1WCBB 3DXAE 2YRZA 3O45A 5E5MB 1FN4A 1AGDB 4L8BB 4WV1C 1OTUD 4G8IB 2JCCF 3RVWC 1IZKA 4ZO6A 4ZQKA 1XGTA 4Y4KB 4IIQA 4MNGE 2W0LA 4UINL 4ODVH 5CEYA 5GS1B 4NCC1 4IRJB 2NW3B 3VFGH 1S3KH 1KCRL 4GS7B 1JTOA 5IVXF 2QKIB 1L0XA 3LH2H 3I75A 3D39B 3F7PC 4DKDC 3F5WA 5ISZA 2BVEA 3SE9L 3IKKA 3CLFL 2JB6A 4JFDA 3D3VD 1CE6B 4PD4K 3VGAC 1FG2B 3ZDYF 2NY4D 4MA3A 1AGCA 1MCIA 4XMLL 4ZYKA 1S7RA 3WNMA 3ZSSA 4CMMB 3OB0K 4LRNL 3L9RA 1J18A 1T4KA 4G8FA 1H15A 3SDYL 2HFEA 2EYTB 4PG9A 3G6AA 5IG7B 2JLLA 2I24N 1A7RH 2FX7L 3QEGL 1AXTL 1B9ZA 2BNRE 4GG6E 3HG1D 2J88L 2NYYC 1QBAA 2PYFB 5C09A 4ORGB 4APQC 2D03H 2GAZB 3L3JB 4KHTL 4K7FB 4S1RL 1LDPL 3TP4A 3V5DB 3ZKMC 4MD4B 2A9NH 3WEXB 4JQIH 1YECL 1NSNH 2UZYB 4MD0B 4FQLL 1P4IL 2ZZUT 4F7EB 1FH5H 3GSNL 1N6QH 5EIVA 2UYLB 2R0WL 4GAJL 4O02L 5E2VH 1LEGA 2DAVA 4YXKH 2FR4B 1RUPH 4X6FA 1HILB 4PUBL 3BRDA 3MRPB 5F3HB 5A2LH 3FT4A 1EO7A 5EU7E 5IFJB 1A6TA 2AV1B 3U30B 1NGXA 4TSAL 1CL7L 4NN5B 4HC1H 4P46D 4R96B 4NBXB 1X7QA 4OD2A 3T0WA 4EN3B 3WLWC 5DS8B 3MBEB 2C9AA 2XIDA 1IBGL 43C9B 5JR1L 4X5XA 1QEWB 1A6ZB 2E9BA 1WFTA 2NW2B 2OR7A 4K7FA 3EO1B 2BSED 5FAAA 1T03L 3WEXA 1A21A 1N64L 1P4BL 2Z4QB 5D1XC 2AK1H 4CDGC 1Z2KA 5JHLH 5DJZB 4HH9B 3O8XC 4ZQKB 1G0DA 1QOKA 1OAZL 3WDHA 4P5TB 5KSVA 4UT6H 4HMEA 3RWHA 1MRDL 5IVNA 3CD4A 1FSKB 1PAMA 1YMHA 3E6HB 1OPGH 1OW0C 2NX5D 3C60A 3EBAA 4LRIA 3V4PH 1ND0A 5T3XH 4GMTH 3MCG1 3PV7A 2C3HA 3MODH 4MDJA 4K94L 3GUTB 3RNKA 4WI3A 2HRLA 4U3XA 4F58L 2AV1A 1TVHA 3WNOA 5F9OH 3CSPA 1CXHA 5JW5B 4WEUD 2RCSL 2Z91A 2IFFH 3DURA 1G6VK 3P4OB 4H26B 5F96L 2YUXA 4P2RD 4YDJA 4I9WD 3V6OC 1FG2A 5TFSL 1TIUA 1MAKA 5GJSL 4P2CG 4LCIL 4OI7A 1VFOA 1HHIA 1QRNA 1I9EA 1RUQL 4MS8A 4FXLA 4FQ1L 4J8RB 2AJYH 3SO5A 4AG4H 5INDB 5GGUA 4JQVC 1BJ8A 1EO8L 3FZUD 3V52H 1I1RA 4JEGB 3IU3B 5D1ZB 1HYSC 1TLKA 2MCG1 1HHGA 3GO1H 4YGAB 3SY0B 1MJJA 1LD9B 4PTUB 3HE6B 1WV7T 5E24E 5F7MC 3B2VL 2ICWI 5D8JH 2IMMA 1O0VA 1KB5L 1T0MB 4KXZI 1Q9OB 1BFVL 5MENA 5HGBB 2EH8L 3FQTA 1T2JA 4HS8L 5CCKH 4HUVB 4XGZB 3PWJA 4KK9C 2B4CL 3KHOA 1BBJA 2A83B 3KYKL 5KVFH 1IGYB 3KPRA 1PY9A 2NY2D 5GGQH 1RZFH 1L4IA 5DTFB 4LLWB 1BP3B 3VDCA 1BZ7B 5I16B 4KI5F 4XPTL 3O6FA 1FIEA 2B2XL 5BCAA 1FZMA 2AJXL 4XI5D 4DQOH 5ACZB 1F2XK 2I9TB 4TSCH 3BVNA 1A3QA 1GZPA 3N85L 5IW6A 1A4KA 2W9EH 5TQ2H 3DUSB 5MEPB 5MEQB 3I02B 4OCRL 4X5XB 4RFNB 3TVMC 2X2YA 4OT1H 4Y2DD 1E4JA 1YEJL 1WK0A 2OSLA 2HKFH 9CGTA 2VABB 4DUWA 3SKJL 2VXVH 4GRLC 4O2FB 1I1AA 4HF5L 2NR6D 5I1EL 4K8RC 3D0LB 5EUKB 1EHAA 1T66C 2KDGA 3KPNA 1Z9SA 4U0RC 4CN4A 3FQUB 5BVPL 1B4RA 1J0HA 3RTQA 1IAII 1R5VA 2F54B 2XA3A 5IR1A 3RY5A 3CFJA 1KACB 3TO4B 1J8HB 1DUYA 1N26A 3D3VA 1C7SA 1S9WB 2FBJH 5JOFA 3SGDI 3LN5B 2VXQH 3RWGA 4OF0A 2YSSB 3E8UL 1W0VA 2XFXB 4LLWA 1NDMB 5TE7H 3ALWA 4KZDH 2EXWC 3O2DA 3ARBC 4MLIA 3ZTJG 4PRHB 3V5KA 5ALCH 4FFVC 1CGSH 4HBCL 25C8L 1OCWL 4V1DB 3PWPB 3ULVD 5CZXC 2W07A 2NY5C 2VXSH 5C0RL 1PZ5B 4ERSH 4JDZB 3MREB 3PWPE 4KUZL 4ELMF 2QR0B 1QFWI 1R24B 4ZO8A 5EO0A 1U91B 4M3JA 3EJJX 3QQNA 4ODTL 5JIPA 4GG6B 1IC7L 2O5XH 4B41A 1E6OH 4NM4H 1SQ2N 5J6HB 2P44B 4KJYB 1X5YA 4U3CA 4JFZL 1SBSL 3IJHB 3BDBA 4P4KD 4M48L 2HKHH 3A6BL 1UEMA 4KQ3L 4QHUA 5CKAA 5D7JC 4G8GA 1A6WL 5GGSA 5E00B 5MEOA 4NN6B 3MUJA 3RDTD 2JE8A 1XF3A 2DOCA 2YA2A 1EK3A 1LO2L 4WWKB 4FABL 2CK0L 4H25B 2NNAA 3F7RA 4YR6A 4KHXH 4AK1A 5C0EB 5DRXA 1F58H 4JY4B 1OWWA 2GITB 1A5FL 5C07D 4Y4HD 3WS6C 5JW5A 5GZNC 1T5XA 4P46B 4U1SA 1UJ3A 3QDHA 4M5ZH 1RMFH 1QSFB 1GPOL 3MTRA 4LLMB 4TN9A 5E2TH 5D6CB 1P69B 3WLBB 2XZQH 1O7VA 5LAXB 1XCQB 3JWDC 4CW1B 3QIBB 5FUCC 1J1OH 3Q6GL 2C3GA 2Y6SD 32C2B 3DETC 4MDIA 4LKCA 2V2WB 5ETUB 1G84A 4RDQG 3W39B 4MGXA 5I1DA 1NLDL 4C56D 4UT7H 12E8H 2AKRA 2WUBL 2CXKA 4XC1H 1EXUB 5T1KD 2H6PA 3CVHL 2N56A 4U1MB 2YOCA 3MCLH 4LASL 4AENB 4GAFB 1I9JH 5BW7A 3VGGA 1Q38A 4TOYH 3ZT7A 4L3CA 5IK3B 1HCVA 1W2KT 4L4TD 1J87A 4ENEC 3SKNA 1F3JA 2NY2C 1QQDB 4XNQB 4QRUB 5K59E 4NQEE 5F71A 3OAYK 1RVFH 4F37K 1L7IH 1TETH 1JGVL 5M94B 5D6DC 4EOWL 2G75A 4JO2L 1OTSD 2P8LB 5I9QB 2BXYA 2DQEH 4Q2ZA 3HG1E 2WQ8A 3SE4A 4G59A 4F2MB 1U8HA 1U8LB 1EV2E 4M02A 2X4SA 3FOLA 1GHFL 3BUYA 1MCRA 4L3AA 5C71A 3DBXB 4PV9B 5IHLB 5ETUA 4MA7L 3O6KH 4JM2B 4KPHH 3DO7A 4G5ZH 3L7FB 2F53D 4HJGA 4OLUL 5GGVH 1IVLA 3BT2H 3RX7A 5GGUB 1IL1B 3CXHK 5C2BL 5DLMH 1RUML 2EEAA 2EDFA 1S7VA 4TUOA 5HHMD 1SJHA 1DL7H 3GNML 4LNRA 4N0UE 5I1KH 1C12A 3GB7B 1RK0A 1P84K 4FQHA 4MJ5A 5FHAH 4QKXB 2IC2A 4JHWH 1NEZB 3KYAA 3FT2A 3JV4A 2FWOA 1P2CB 4ZUUA 4CNIA 35C8L 3O41B 2IADA 5GZOC 3KPSD 4L5FH 5MENB 4PB0L 4Z7UA 3T0EE 1JZ3A 3S98A 1V7ML 3DTXB 4APQD 5HGAA 3TNNB 4KMQA 5CEZE 4RAHA 5HY9A 3UC0L 1FO0L 4OZGB 4NRXB 5FGRA 4LLMA 1OD7A 1ZT4B 4R0LB 5FM5M 4Z78B 4D0DA 4HS6A 4OF3A 4MCZA 4ODUB 3ZT6A 1RULL 2DQJL 5EULV 3SKOB 5KVGL 3GSQB 3MRRB 4MB5A 3LRSA 2Q76A 4JRWA 3RUGB 4NO3A 4Y4FD 4JHAL 3BP4B 4P2OD 2ZCLL 4RAVB 1YMMB 5C7XH 5FK9B 1X5GA 3QQ3B 4WFHE 4PTTB 4N5EC 2VLLB 3CC5B 5HXMA 3VWKA 1OARH 4G8IA 5KTEH 2XZCL 3QDJB 3DI3B 4MJIA 1I8MB 4E41B 1RY7B 2DWDB 4FQHB 4WEMB 2LAAA 4K9EL 2V7HA 4YJZL 1PZUB 2EDEA 1WIOA 5HDBF 1JRHH 2J5LB 3PGCA 2W1NA 3TEUA 2PTTB 3O3UN 3VFNB 4JVPA 1NLBH 4LARH 1XF3B 3SJVD 2QKIA 3IVKA 1HXMB 3QEQB 4HZAA 4FQXC 4YIQB 4NHCL 3GIVA 3TO4A 3TBSB 1ZT1A 3OGCB 4HIHB 2VOTA 4U1GB 2OI9B 1EFXB 1CFSB 2BSRB 2Z8SA 1ORQA 4E0RB 3ULVF 1G0XA 4PY8J 4PB9H 5HPMA 1WJ3A 4P5MA 4X4YB 3GJEA 1INQA 3VFMA 3CFCH 4XVJH 5IT2L 3RWFB 5JHDE 3BZEA 3MPCA 3RUGF 1LWRA 2A77H 4Z7NF 4U4BA 3V4VH 2NXYB 1KENL 4HMDA 1WAAF 4NQCE 1EBPA 5KG9A 3MV8E 3NA9L 2V9QA 1LP9B 3L3DB 4MZ2A 3QPQD 1FO0B 3HS0B 4KUCD 4L8SB 2F5BH 5KSBA 1UKTA 3B9AA 5EC2A 3RRQA 4KV5E 5KW9L 2ENSA 1G9MC 3WNNA 5C0DA 2XZAH 3P0GB 1QSZA 5DJXA 3DVIA 4MNGB 2ITDB 2VLJE 5C08D 4KMTH 1Z5LA 5CINH 4NQEA 3QUKA 1A2YB 2EXYD 5TGBB 2LU3A 2AEPH 4F7EA 2JCCB 3LDBC 4OLYL 3TN0A 3VXUA 4UDUB 1MY7A 2YZ1A 1AP2B 5SX4I 1T7XA 4I3RH 3O3DA 2BVOA 1BVLB 5E7FA 4G43B 3SKNB 4DKEL 1JYXA 3PIQB 4KZEL 1YNTB 2W91A 4HLZH 3QXDA 4DCQB 1JV5B 4E42B 1H3GA 4PJIB 4WW1A 4OZHB 4FG6D 3OHXB 3P9LA 3WD5H 4CMHB 5FCUH 1AO7E 4P3WA 3BQUC 5CZVL 4YQXH 4R7DA 5EU6B 4BFIB 3BZFB 4P59L 1I9RL 1IC4H 1I8IB 2XG4A 1RUAL 5LKNA 3UTTA 4QY8A 1ZT4A 1IFHL 3O8XA 2FHBA 2YPLE 2AABH 4HX1A 4UI2A 1YEEL 4Q9QH 4JQXC 1SY6L 4JN1L 4Z8FH 4DTGL 4P9HL 2GJ6E 3PDOB 5DS8A 2ARJQ 5F88B 2WWKT 3AVEA 1K4DA 2V9RA 4YFLF 4LIQE 3KVQA 1ACYH 5C0AE 1M7IB 3PHQA 4OLVH 2DWEA 4V1DD 5C08A 2Y23A 1H5BC 4P2QA 2PXYC 1XCTA 1VSCA 4LCUB 3LKSA 4C4KO 5LQBL 1IQDA 1T1WA 1HKFA 4Q0XH 2ICES 2FDBP 4PJ5D 3QRGL 4U1LB 1JPST 3UJJH 1NFIA 3F62A 1N5YL 1CFNA 1R6VA 2VLRE 5HJ3B 4W6XB 4Y8AA 3TPUE 3X12B 4PFEA 1EGJL 2F15A 1QA9B 4NO2B 5F1NA 3M07A 1LEKB 4M93B 1YNLL 4J1UB 4GKNA 4GKOA 3KPSB 2CGRL 3WLWD 3V5HA 2ICEA 4GRLD 1SYSA 3KPRE 4K8RD 3REWB 3S5LB 5ADPL 3D25B 5KVMC 1P7HL 5KZCD 1A4JA 5HY9B 4JJHA 4I2XE 2D4FA 1A3RL 1VACA 4Y4FC 5C3TA 4M62H 4FQ2H 1WBYA 2PW2B 3JVGC 4LEXH 2ADFH 3MLSL 4P3CH 3O9WC 4PJHA 5EOQH 3EYSL 1VPOL 2WWMC 5DT1H 5E8OB 5FUZL 3PNWB 4H0IA 3EHBD 4XNXH 1JNLL 1FL3A 2IAMA 3V6FA 5IF0B 3DV4A 4FFVD 2XQBL 2IPTL 3MRMA 3TT1H 1KG0A 3VXMA 1MPAL 2NTSP 3P0YL 1YEIH 3FO0L 1XMWA 3MYJB 1G7QB 2BOCB 4LP4A 5AZEL 4QRRD 5L8LB 4S1QH 3MBXH 5E6ID 4CVXB 3X11B 1BD2A 2CLRA 2OMBA 4NNYB 4P2OA 5DRNA 1EUTA 1F45A 5T33H 4EQ2A 3REVB 5E08H 5CUSH 5HI4D 4KJQD 3Q5TA 4NC1E 3NCYS 4HAFA 4FFYL 4OCXH 1KFAL 4M93C 2IQ9L 2GT9A 1VA9A 2BNQB 5F44A 4F9PC 5TE4L 1OF2B 4F3FA 5HVHC 3P3YA 5F9JA 1OSPL 4D9LH 4KK6D 3UMTA 5J9PA 5D7JD 1FLTX 1AFVH 1OM3H 4QXTB 4LCWD 1G9NC 2RHEA 2JJSC 3KPPB 1DFBH 2I27N 3P30L 3ZKXC 1FVCA 5CEXB 5ERWB 3LB6D 3CZJA 1BBDL 1GIGL 2AV7B 1VEPA 3P9WB 2PXYB 4WDIA 5I15L 1U2HA 4XBEL 1M71B 5CSZA 4BQ6A 1KB5B 3NN8A 4GG8A 3UPAA 4CADA 5BXFB 3O4LB 5EBWB 3KPQB 2B39A 1T7WA 5SWQB 5C0AA 1NC2B 5SV3A 3OAZK 5ISZB 3HPJB 4PRAB 4JFDD 1C5BH 1IT9H 2Y07L 3S9DB 1T6VN 1QSED 2BOBB 3VW3H 2IANA 1ZWIA 4YK4B 1T0MA 5IGXH 2H41A 4HXAH 1KCVH 3D0VB 5I74B 3DMMB 5GS1C 1A1MB 2JCCE 4OCLC 1GYAA 4MQ7B 1DEEB 2VZ1A 4QTHA 5JPMA 1A9BB 2XN9B 4O5LL 4KK5C 4FZEH 4JZOB 1NCWH 4NO0D 3HI5L 1JF5A 1QLFB 1U92A 4RNRB 3TA3B 3U46B 1D5BA 3MFFA 1DLHA 5J7CC 1RFDL 4PJFA 2XNAA 4LF3A 1CFQB 1P7QB 3QYCA 3GSWB 5EU4B 1ZHKA 3O4LA 5CJQL 5EBWA 2MTPA 4EI6B 3LS5L 5J1AA 5LGHL 4LCYA 2Z0BA 2WWKO 4M6ML 4IRSD 2BRRH 1CK0H 1GOHA 2VDLL 3BP7B 3DX8B 3S37X 1A6AB 4D3CL 1MNUH 3GSRB 2XKNA 2BERA 5GSVB 3EO9L 3LEYH 2Z91B 1MCSA 1F6FB 1WBXB 4XPGH 3GKZA 4LFHD 5E94A 4XX1E 4DUXA 1U9KA 2NXYC 4OCMC 5DJXB 3MLUH 4MWFA 1UQSB 3HUJA 2FX8H 3NGBC 4LVHC 4RX4D 3S96A 4NWTH 2CUMA 1V3LA 1YYML 2CJUL 5HGHA 5BOZG 2P8MB 4WU7A 3UTOA 4L9LA 4TVSa 1TITA 4YXHH 4YHKL 3BH8B 5I1JH 1TXKA 1MIEL 4MB4A 5T3ZH 4JANB 4P3DB 4DCQA 3QDJD 4BSVB 5AWNL 2OYPA 3DSNA 1AO7B 3B83A 2NLJA 3UTPD 2WK2A 2L7UA 4ESKA 5EU6A 1P7KA 1U8PB 1Q0YH 3PWPA 2NW2A 5CD5D 5I19H 1E4XH 1W0YT 4PJ7F 3WDJA 4L4TA 4JJ5A 3U2SA 3L7EA 3PWNA 3MV9B 4HHAA 5GPRA 3UBXA 4HZLA 1VEOA 5SWZE 5BVJA 1A6AA 3OR6B 4JREB 1Q9KA 3WS3A 5TH2B 1P6AB 3PWLB 2JKXA 5E8DL 5ILTH 4C55A 3ARWA 1QKZL 2BVYA 4LRIC 4XNZC 5IIEA 1N8ZA 3W9DA 4Y1AD 4NKOA 2PO6A 3MLVH 1UH3A 5F1KC 3CSBA 5ITBL 1S7UB 5DJCB 3FRPG 4PRNB 5C07E 2CR3A 1FNFA 4S1SL 4MNQB 2RQ8A 5HHVL 5C0CB 3C5ZB 5D5MA 2VLKB 4JKLA 4P2OC 5I8CB 1S5HB 4ODXA 4LP5A 3OZ9L 1EIBA 3U83A 4BSVA 1NAKH 1UA6H 1G1CA 1X5FA 1T21A 3T0XA 5T1KA 3JV0A 3QCVL 2X6MA 4KK6C 3N50A 4NN6C 4NGHL 4WFFD 4XVTL 2KBGA 4OZHF 1YJDH 1AC0A 5D5ME 2XQYK 1ZA3B 4FTVD 2MCPH 2AQ1A 4B50A 1S78D 1QNZH 2ICEB 4YPGA 3HI1A 4S0UC 5E4EB 1FVEA 2VLJD 1BX2B 4JPVL 2Q86B 2ARJB 1GGCL 2HT2D 4XCNB 1HNFA 1RJLA 4NQSA 3QUYD 2R29H 1YNKH 1AY1L 3WFCH 2RR3A 4X5WB 2HTLC 3RZCC 1F5WA 1XGYL 2G60L 5K9KB 1AH1A 4PJXE 5T1DL 2CKBL 3BDXA 2GKIA 3VD4A 4D9QD 4HUKB 1EZVY 2IAMB 3RA7H 4XB8A 2XWBA 4ENED 1AD9A 4LPYA 3QDJE 1HQRB 3K74B 2EC9T 4EBQL 5HYSB 5FEBA 3ZYOA 2NTFA 4X98B 5C9JA 4JGUA 3FCTA 4R4BB 3U0WH 1MLCB 3VWJD 4JY5H 5IVXA 5HHPB 1YC7A 5DJ6A 1PGRB 4OF8A 1ZHNA 4PGEB 4OZFH 4RMSA 2IGFH 3FMGL 4OZFG 5BS0D 3EYUH 5IB2A 3S4SG 2ZKHL 2ZUYA 5CBAA 5FYLH 4JLRB 3BH8A 5E2WH 3ARZA 1HHJA 1PYWA 1MFEH 3DMMA 4J3WA 1BVKA 4NZDA 4K71B 5FCSH 2JIXD 4OTXH 3V8CA 4K3EH 2F53E 2IH1B 5C0AD 2Y06L 3MJ6A 2V7NA 1RHHB 3H0TB 5DD0L 1LP9E 4YAQB 3BMVA 1PKQA 2F58L 2WIIB 2L0DA 1CDCA 3DWTA 1QSEA 4NUJB 5J4MA 3QUXD 5IB3A 3VFOA 1IE5A 2O5ZH 1BOGB 1H3UA 3L7EB 3IDGB 1FNEB 4H5SB 3W0WE 3QA3A 4X6FB 3EDFA 2CSPA 4OF7A 1D5XB 2VLMD 4JFXA 2PXYA 4WDIB 5DMKA 2B1AL 1M6OB 2UVEA 4W4NA 1EBAA 4E41A 2H2PC 5F1SA 3LZFL 1Q72L 4OFVA 5DRZA 4GG8B 5E1AA 1MREH 2OTWA 4XTRC 4L8DA 1K8DA 2VZTA 3P11H 3DX9A 2I25N 5T1LB 2VSCA 1BVKB 3CFKA 1NGPH 2JF1A 4MXWL 3MRLB 3W5NA 3D3VE 2P5EE 2L4OA 4GAYA 3TN0C 32C2A 4ONGL 4ZS7L 1CFSA 2BSRA 4X7FC 3WFBL 5E4EC 1I75A 1U91A 3S3JA 1T0PB 1YEHL 2CIKA 2OQJB 3K46A 3RWFA 2FEDC 4KROD 5D7IE 3U6RA 3O4LD 4OGZA 5INCA 5AZ2L 1MCLA 4FQCL 4LCCC 3NTCH 5HHNA 4YDIL 4QNPE 3ZHDA 4RMRA 4AQ1B 1KJ3H 2JTDA 1MFAH 3BISA 3QP3A 2WUCH 1Z9OA 1BQUA 2XI9A 4OLEA 3QJHB 1MWAA 2FLRT 2JJTA 5B39B 4MD5B 1HZHL 3WFHB 1OHQA 1DQDL 3TIEA 3DYOA 4I5BB 4PBWD 3CFKB 4DN3H 1A9EB 4PS4H 3IGAA 3E3QA 1ZV5A 4YX2H 1CF8H 2ZOLB 4Y4HA 1EAPB 3RUGE 3PHOA 2JK5A 1TENA 2ZSWB 5GS0H 1TZGL 2ERJC 4MWFB 1NFDB 2EIBA 1UJ3B 4RIRA 2DQTL 4ODXB 3OPZH 1HHJB 1PYWB 3RP1A 2CO7B 3OHXA 3P9LB 3RAJH 1AD0B 1SMAA 3QIBA 4G7YH 1DANU 1G6RA 4YIQA 5IFHH 4DJMA 3HTLX 2VISB 4HUWA 3QXVA 5GJTL 2GSIB 3IETA 5B8CC 2AK4B 5H35A 5HDOA 4G9FA 1RK1A 3ESUF 3MV8D 3FOMA 3EDKA 5EU3A 5HD8C 1BX2A 1ED3A 3SGDH 4JG0H 4M6NL 4K2UH 3ZDYE 4UBDD 3Q2CA 5FYJL 3ZYIA 1QSEE 5IHZB 3P2TA 4Q9CA 4M6OL 3HZMB 5HDQL 4PGBA 2Q6WA 3KYOB 2DI7A 1MUJB 3UTQB 1T7YA 1HDMA 3F6IA 3UTTD 5E8EA 3ESVF 2X4RB 3IU4H 2YRLA 2LFGA 43CAA 2XICA 4M9PA 5KVEH 3UPRA 5CD3B 1A47A 5T1LA 3GSOB 1WC7B 1Y6KR 2DMBA 3ROLB 4A2LA 1JUFB 3GMNA 1JI2A 4UDUA 4MAYC 2HVJA 3D69B 3SCMD 4YDKH 1WT5C 3F6LA 1CQYA 1FZKA 1S5HA 2XY2A 5DD1L 4PG2A 5HDLA 3DBXA 1PX4A 4PV9A 3TA3C 4RAUA 5FO8B 3VMOA 2VLJB 1KT2A 4JFHE 2O61B 1ZHBB 4MQSB 5DSCA 4KVCL 4E9LA 5EZLA 3HE6D 4DAGL 1HEZA 1JNHB 4XPBH 3FQUA 1RIVL 4J3SA 3RTQB 2GJ6D 4P0DA 3MRCB 3MZTA 4MQXC 1OP3H 2HH0L 2AQ2A 2YKLL 2PXYD 4AEIL 1NBQA 5D96C 1IGTB 4GH7B 4PJ5E 3M8OH 2YC1B 3V6FB 5LXGL 1BGXL 2BVTA 1DQQB 4Z7UE 3VH8A 4FFEX 5DJ8A 5EZIH 4WCYL 3FB7B 2R23B 4KVNL 4LSUH 1HI6B 4RISH 3S8WA 1YYLL 2EZ0C 2AQ3A 3QUMB 1T5WB 5FB8B 3QFDB 1MCFA 2AK4D 3IDYC 5KBNC 3CNKA 3O2DL 1VDGA 3LKNB 4XP1L 2H9GA 2IPUG 5EBMB 2BZDA 4OB5H 4JPKH 3BZEB 1LK2B 4Q9RL 1KUMA 3Q3GA 3DX9B 1OSZB 1YEDB 2JIXA 3MJ9L 2EDQA 5D72L 3C8DA 4GG6A 3QXTA 1A6TB 4R26L 5KG9B 4QF1B 3LD8C 1BEYL 2ZSVA 3TBVB 5ESAA 5EO9A 1DLFH 5DWUH 1CLOH 4RZCB 2FECI 1CXLA 4R26H 2Q3AA 3AM8A 4OGXL 4LSVL 4WHCA 4KI1A 2MQ0A 1QPXA 1PFCA 3I6GB 3MJ9H 3S4SB 1YMMA 5IJKC 4GT7A 3X3FL 4Q9RH 15C8L 5E00A 1I7TA 4PGCB 1T1ZA 4UDTB 4Y5VA 1I1FB 3C5ZC 3B9KB 1R3IH 1DCLA 1LE9A 4XWOC 4OLWL 1RZJL 4LSUL 1I7UB 5D9SB 4DGYL 2WQRA 3IDGA 1J8KA 1Y6NR 4L1DA 3KG5A 1J05A 3FAXA 3JTTA 3STLA 1PJ9A 3WL9A 2DQGL 1IGMH 4XNZB 1I9IH 2DS4A 1Q9LA 1RURH 5KOMC 4WUUB 5IW1B 5HI4C 2AJ3B 3O2WH 3BAEH 2I60H 2QHRL 3G5VA 5CP7B 4CW1A 3BN9C 4FTVE 4Z7WF 3K2UH 5CD3A 3C2AL 1I8IA 2J6EL 1OT2A 1KC5L 2E5EA 4PG9B 1BIIB 4U6VL 3ORJA 1NCAH 5KSBE 3S7GA 3JBG7 4Z5RB 3C09C 4K7PH 3BZ4A 2BNRB 4XBGB 3V7AG 1I8KA 1MJUL 4JDTH 2VNCA 4U6TA 5DSCB 1RQ5A 4IS6B 4PRHE 2YD1A 1X5KA 4GMSL 4UOJA 5D7LB 4NHUE 5ICZA 3CH8A 3A67H 3DLQR 2APTA 4RMUA 1EVTC 2NY7H 4YDLC 5DJ2B 4Z0BH 3X17A 2R0KL 3IU4L 3T2NL 4L4VD 5F7HA 3GKWL 1NMCB 5D2NB 3S35X 1QFOA 3CDCA 5DJZA 5KAQG 5GISL 3B8SA 5I0ZA 1OY3B 1LP9F 3KYNB 3AMKA 1IARB 4G42A 3VFRA 4UV4H 5TPWL 1UWEL 2R23A 1DBKH 3VG9B 1HI6A 5CSBA 1FFQA 3TZVB 1YNTA 4K8RL 3ALPA 2J3SA 1SYSB 5JPNA 2X4SB 3FOLB 5EBMA 2CDGB 2K7PA 2FB4H 1I7ZB 1RIHH 5BS0A 2AJSH 1X6NA 4G6ML 5JDSA 1DE4B 1G9NH 4GBXB 1BZ7A 3SQOL 4I18C 1DSFH 2ORBH 2A6KB 3PXHA 4KK9D 4Z7WA 4HS3B 2V5SA 3T3PE 4IS6A 4DN4L 3RAJL 3I6LE 3A6CH 3S5LG 1X4YA 4WHTA 2FATL 4YC2B 3EJZC 2ATKA 2DQTH 4OLXL 3GI9H 4ZUWB 1AO7A 3T2OA 2EDTA 1JNNH 5GS0L 1G6RB 4LCCB 5I1LB 3UYOD 1N6UA 2LVEA 2E27L 4LFHG 2P47B 3WDIA 4HZLB 2HG5B 2FZ3B 4YWGL 4GAGL 4H1LA 2NXYD 1JWSA 5F6HJ 1YY8A 3LKOA 4NNPL 4JRXA 3QIWC 1F6AA 3RGVA 4ZXBB