3MRNA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns4b-1807-1816 decapeptide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with HCV NS4b-1807-1816 decapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrnA01
3SDCD 3OAUL 4K8RL 1T21B 3TH2T 1KYOK 4PJ9C 3RFZC 1OOAA 1DZBA 1U8QB 1PKOA 2C5DC 3IFOA 1PZ5B 4LLMB 1P7KB 4DFIA 4GG6F 1U8NA 2BC4B 1FNEB 1II4E 1NMBL 1UKQA 6FABH 3REWB 4OFYA 3R06A 4EIGB 4X4YA 5F3BA 5DA4A 4Y5VC 2V5RA 1A7NL 2JIXB 4JAMA 1A7OL 2DKSA 3NH7L 2ADJB 1G7MB 2YXFA 4Y5YA 1L9NA 4M1GL 1NDGA 1Q9LB 1IGYB 4RAUB 3KAAA 1C08A 3QEGL 2YUVA 2EIEA 4H20L 1HN1A 2R1XB 2CUHA 4LK4A 5E1AA 4S1QL 3RTQC 3VXSD 3NZ8A 1RJLB 4TVPD 3LN9A 4OIBA 1D5IL 5DYOA 1A6WL 1CXHA 1UT9A 5AWNH 2FIRT 4JO4H 2UWEE 3QHFH 4AT6B 4MQXD 3P4MB 2R2HB 3O2DA 4LCWE 1AGFB 1JPSH 2NY4D 1N6UA 5HPMB 5H35A 1EVUA 5L2KA 1AHWB 1L0YA 4MYWB 3GBNH 4OF3A 2ENYA 4G80A 3LKSB 1VB9A 4XXCA 3IFNH 3MLVL 2B0SH 3PWJB 5DZLA 5IROA 2ATPA 4AEHH 4XRCB 1H8OA 2WM0A 4CJ1A 1G7LA 1F4YL 1SHMA 3O6LH 3OX8A 3GKWH 3ZTNH 3IS0X 3VXME 2N7BA 1AKJB 2VXSL 3QZWA 5C0IB 4Z6AT 2XTJB 3RVTD 1J18A 1BZQK 2D4FA 2YK1H 1CFQB 3MJ8A 4GMSH 2CLVB 4DN4L 3GO1H 4QRTB 2VDKL 1YN6A 1U3YA 4CMHB 3KLAB 3GKZA 2NTFA 1VSCA 5F7EL 1NMAL 3EYQD 1OPGH 3VMNA 4MHHI 1I1YA 1UXWA 2B4CC 1FCCA 4HIHA 5IBUG 1AGDB 2VL5A 4UNTA 2CRZA 1IEAA 4NDMB 5EZOL 4ZUUA 4L9LB 3VFMB 3EJZD 1T21A 4JFYA 2OQJB 5IQ7H 3FHQA 1DN0B 4LCCB 4FABH 3VXQB 1J87A 3EJYD 3N9GH 5C0EB 2B20A 2D31A 1T7XA 2ICWJ 4XMLH 4PLOB 3T0BA 1XGUB 3UZVB 1A2YA 1JPTH 3D1MC 4ONGH 4YDKL 4YFLF 3JVGC 1DQQA 4G59A 5E2TH 3LS5H 3V5KB 1F45A 1A9BB 1QRNA 1UM4H 3VFPA 3MV8D 3QNZB 3O6FD 3D3VE 3MLYL 1CF8L 4PS4L 3S3PA 5SX5H 4WU5B 2X4TB 5DQDL 3G6DH 3GSOA 4K8RC 2IAMB 1MFEL 3IU3A 1MFAH 1DCLA 4EDXA 4P2OB 5I74C 3MOBL 3ULVH 3VFUA 3F58L 2QQNH 4WHYG 1QSED 1I8KA 5T3ZL 2ADGA 4R4FL 3DPBA 2G60L 3FQXA 4Y2DB 4S0UC 4K7FB 1INEH 3LHPL 3B9AA 1MWAL 3BKML 3K4AA 3MMEA 2YPLA 4MWFB 1S7RA 1Y0LA 3DV6B 3QFJA 4GW4A 1U8PA 4PJEF 1ORQB 4N8VA 3ARDC 1UZ8A 1KEGH 2H6PA 2E27H 5JOFB 3CZFB 2F54A 3RX7A 4F7TB 4X9BA 1TXKA 2VITB 3PHOA 3ARVA 1ZLVK 3ZSTA 1KJ3L 1VACB 2FECI 3ZLQC 2DL9A 2FB4L 2Q6WB 3VU2A 1FG2B 2VDQH 1ZA6A 5EUKB 4JFDB 3REVA 3ZT6A 2I26N 4S11A 5C6TL 1KXQE 1Q1JH 4ONHB 3ZE0E 5FYLE 2ZUWA 3LEVH 3G08B 1TZIB 5D5MA 4DEPC 3MNVA 2EXYC 5GSVA 4LLMA 5IGXL 5CGYD 3TVMC 1IGJB 1S7RB 1Y0LB 1MCFA 3FFCA 3VA2C 5BRZE 1NFKA 4MVBD 5HGHA 4RMWA 3P0YH 3FO0L 1DQJA 4JHAL 3UTZB 3W9DA 3HG1D 1IC4L 5IEHA 2BFVH 3EOAA 4V1DD 1H3XA 1XAUA 4DCQB 2Y72A 3NIFF 5L88L 1YMHA 1KIPB 3LQMA 5EOCL 1F5WA 3UYOD 2HJLA 2FX9L 5FKAA 4R6UA 1RHHB 4N0UB 3RVVC 4BSJA 3PWNA 4L4JA 3E6FA 2F53A 2X5PA 5CJXC 5GRYA 3X11A 3OZ9H 4HJJH 3RBSA 1WBXA 4JY6B 4MVBC 4ZO6A 1JHLL 1I7RB 2Q3ZA 5HHXH 1KJVA 1U91A 2BNUA 3IU4H 1OT2A 5ITBH 2A0LD 1I3VA 2NY4C 2VLKB 3ZMRA 2F15A 4DFHA 3GSNB 2A9MH 4YPGB 3ILQC 1HHIB 4NO0D 4QXGL 4W4NA 3O4OB 2GJZB 4PRIB 2I5YH 4HG4K 3OB0H 1J1OH 2IPTH 5C7XH 3RNQA 1TZGH 2AK4D 1WQVT 1SVZA 3LSOB 4HHAA 2DJSA 4M7LH 5DUBA 3K4ZA 1JHTB 1OGTA 2OL3A 5EZLA 1PAMA 4QHKJ 5KN5A 3ORJA 3L6FB 5J06A 2GK2A 2DICA 1A6AB 3RTQB 1VGEL 2R2EA 2CIIA 4Q7DA 4B50A 4IRJC 2ZUVA 2IQAA 1WBXB 2FR4A 3MJ9L 1K3ZA 3RUGA 1JGLL 1L7TL 2Q76B 4PRHD 3W0WB 5IB2B 2Q8BH 5GGRY 5DFTA 3WIIH 1TJGH 5JOPD 4WUUA 4MJIB 5IVZB 1LK2A 5I2IA 4Q2ZA 4JVWA 5EU5A 1T03L 5IK3B 1GPOL 5GISL 2HN7B 4NUGL 4GXVH 3ZL4L 3BQUB 2EC9T 1ZSDB 3K2MC 2GAZA 5T1LD 2A77H 3GRWL 4MNGB 1N3NA 4HKJA 4JZOA 5F88A 4NN7B 3T2OA 4BZ1H 4OTXH 4M7LL 1TQBB 2AP2A 2OM5A 1FZKB 2Z35A 1JGVH 3ZKMD 2BSED 5JW3L 5IFHL 4UDTA 5ISZA 5TE4L 2J8UA 3V6OC 2J6EL 1KLUA 2XKUA 4UT6H 4O9HL 4G8GD 5MERB 2W38A 4NRZB 3KPSD 3QUMA 2BXYA 1KTDB 1X5KA 2X1PA 3UTSA 1YJDL 2GFBB 4HWBL 3TNMA 3VXMD 3IAPA 3RBGA 1JZ2A 1AKJA 1MWAA 3EOYG 4Y1AE 5HYSA 4NJAH 3PHQB 1NEZB 5GGRA 2AI0L 1TJIL 1Y18B 4HKJB 4F7PB 3H9HA 5JDJA 2LTQC 3ARDD 2IPKA 2D4DA 4K3DH 4KDTA 2EH8L 4ZAKB 5F1KC 2LVCA 2O5XH 1CLYL 3EO1A 1BF2A 4JY4A 3T77B 1T1XA 1I8MA 1AD0B 4U49A 5H94A 3LN4A 5DJAA 1IC4H 3EYOB 3AMLA 4OF7A 2R4RH 3U0TB 3BKYL 1Y6KR 1QTYT 2HMIC 1RUML 4X5WB 1Q9WA 1ED3A 4JRYD 2ARJB 5GGVL 3S4SB 3UZEA 5TFSL 5J6GB 5EOQH 5J12B 1J5OL 1WBYB 2MFNA 4X9IA 5E5UB 4BH8A 1L0QA 4Z8FL 1P1ZA 4PJXE 1P2CA 2ORBH 1JGUL 2QQKL 2P5EA 5GGQL 4XP9H 1Z3GL 3Q0HA 3RTQA 4NJ9L 3VGGA 3LAFA 3VFTA 3A67H 2Z92A 1TQCB 4PJBB 2XKSA 4TUJA 1NBZA 3H6JA 1KEML 4JFQA 5HGDA 3U9PL 5D96C 4R2GD 5D2NC 5J6HA 1XF2A 3WMSA 2LAAA 1FO0B 4YDJB 4AEFA 4JJ5A 4MJ6B 3SDAA 2YBRB 2CJUL 3REVB 2X4UA 4CVXB 3A67L 5CBAB 2A6DA 1K4DA 1MWAH 1EH9A 2BHZA 5GGQH 3QXTA 1OLZA 2Y23A 4NM8H 3STLB 3KDMB 2GUOB 5CSBA 4ZXBC 5HY9B 3QJHA 4DKFH 3KLHC 5KVFL 2R9HD 3OJDA 2IMNA 1AI1L 5DQ9B 3GMNB 1IAIH 2FX7H 4I77L 2NXYC 3QYCA 1G9NH 2IH1A 3QA3B 1CFTB 3KPOA 2DMCA 4ZO7A 2FDBP 3KR3H 4PJFE 1KIPA 3C6LD 2E6QA 2R4RL 3SO5A 5HYQB 3LRSA 2LVEA 1Z9OA 2BVEA 2NY3D 4WHTB 4L3EE 3CJJA 1YNKL 2VE6A 2WANA 5F7DA 5BV7L 4F7CA 3ZKXC 1G6RL 4OFDA 2EH8H 1G7JB 3VXNA 1RZIA 2DDQL 3QRFM 4K3DL 1TJIH 3OKDB 1AGCB 5IQ7L 4JQVC 4XVUC 1J8HD 5FYJD 1U8JA 3KXFD 3BVNB 1YJDC 3OJMB 4M8QB 2MWCA 3ALWA 1MH5B 2GTWB 4J23A 1MCQA 4BFIB 3SPVA 5BRZB 5ISZE 1F6LL 4KUZH 5SWZE 5I16A 1GHFL 3D39E 3IJSB 5DXWA 1CFQA 2DQJL 5DC4B 5I8CB 4O9HH 3TLRA 4PGBB 4DN4H 3CFKB 5KN5B 3STBA 2Z9TA 1OD7A 3D25A 1DANT 5E99H 2KL6A 3BPOB 4XNZB 5FM4A 2BP3A 3QJFB 4ZODA 2VDML 4OTXL 3BSZH 4HIHB 4FS0A 3SE4C 1H0DA 3CAFA 4YFLI 3FQXB 4XI5C 2OS7A 2GTZA 4C56D 2BOCA 1S5HB 2OX5A 3MLVH 4PGEA 1DE4B 3IFNL 5C0BA 1FNHA 1JWUA 4NUGH 5GISH 3CDFA 2VZ1A 1F13A 4QRUA 2GTWA 4P0DA 1P4IH 1VPOH 3BZ4A 4KK6C 1W0WA 4L8SC 4JZJC 1TJGL 4N9GA 3BHBA 4M3KB 1J05A 4ZUVA 1MI5B 1NBYB 1DQML 2NPLX 4GKOA 3GJEA 1RULH 2DS4A 5C2UB 3DI2B 4P49A 4TUOA 4LIQH 2ID5A 2YN3A 5CUSH 3GK8L 3IFLL 1F3DH 3AS1A 5DJYA 3FQWA 43C9A 1KLGB 4LKCA 4XP4H 4HUUA 1RZJC 2E6PA 3DRTB 1DL7L 2YUZA 3CFDB 1FP5A 1WFNA 4JFOB 6FABL 5J13B 4L3ED 2C3VA 5D1QD 4I8DA 5C08E 1CE1L 3L3DA 3QRGL 5H37H 7FABH 4P2RB 2I5YL 1XH3A 4P3CL 1H5BA 1H3TA 2QADC 3V8CA 4QXGH 1NGXA 4XPBL 1NCUA 1XIWD 1QRND 2L7JA 4K8RH 4KRNA 4YH6A 4E0RB 4DZBA 1UCBH 3K4DA 2R29H 2W9DL 4UMGA 3QT2A 5J13C 5EC1B 1YEFH 12E8L 3BEWA 2ZKHL 1IJ9A 1JHLH 3VXRA 1K8IB 1S9VB 4QHUB 2ZG2A 2DMBA 1JGDA 1KN2L 3KG5A 3T77A 2PTVA 4R8WL 2LAGB 1AGEB 4ETYA 1RK0B 4XC3H 2IF7A 3G5YB 1JK8A 2WBJA 4LGPB 4LHJB 4O51A 1LDPL 2K1MA 4TN9A 4KTEH 2BFVL 1FQ9C 4YBQC 3VDCA 1H5BC 1U2HA 3SGJA 2FGZA 3FO0H 4GKZB 2R2HA 1WBYA 1WAAE 1KG0B 1ZA3B 2Q76A 3TNMB 3FFDA 3H3PL 3V4PL 4AY0A 1NFDB 4PGBA 2VC2L 3CVIL 2DLEA 3QCVL 4NWTH 1OTTC 4PP2B 5SX4I 3RUGE 1HXYB 3ZE2F 4G7YH 3V7MA 1Q1JL 3W9EA 1E4WH 4HQQL 3M45A 2YA1A 1ORSA 4ZOBA 3HI6L 1IAKB 4HCRA 5DC0A 1OAXL 3HAEG 3L5IA 4WWID 2AJYH 3H7BA 4MCYB 1TTUA 3BWAA 3N1MC 2WINB 3RI5F 3MXWH 3OAZH 4IMLA 4IMKA 4MMZC 3MLRL 3VWKD 4GQPH 4K55A 5JZ7C 3BD5A 3JUZA 4MD0A 3L3GA 2BC4A 3Q5TA 3ETBF 1KEGL 1YMMA 1IM9A 4PJEE 4XNQB 4TULH 3KPRA 2F74B 5IK3A 3AREB 1FIGL 1NGPH 2FEEI 4LSTH 3WNOA 1WITA 1NCNA 3D39D 4LLVB 1QHPA 5IBTH 1S9YA 3S35L 5F93C 1FN4A 4G3YH 4FHBD 2IADA 4GMTL 3PABA 5F97E 1VFBA 5FUZH 3NPSC 4LPUA 2X6MA 5BS0B 1K6QL 3QXWA 5E8EA 3D3VA 2VLLB 4HUVA 4GG8A 1MFAL 3V0VA 1MFEH 5C0IA 1GC1H 1I85C 3MNZA 3RP1A 1WBZB 5TJWK 2JE8A 3TFKD 3H9ZA 3L95B 3T65A 1PBYA 4G8FB 5IEKA 4Z7WF 4H8WC 4HKXA 4YHOL 4H26B 1UM4L 3L9RA 4ZAKA 4CN6A 4GOSA 1OAQL 1BD2E 2PF6A 2EKJA 3RPIA 1IZKA 1RUPH 4XNQA 4PJFF 4YFDB 5IP4A 4TTGA 5M95B 3DXAA 5TE6H 3SY0B 3ROOB 2EDWA 3N9GL 1HHGB 2CIKB 3ULVD 3NN8B 2CLRA 1V05A 3VFMA 4AG4H 43CAB 1JVKA 1BD2B 2BVPB 4QCIA 1MQKL 4NZJA 4X7EC 4NHUB 2FGWH 5AZ2L 1A6ZA 5HDLA 2JELH 3MGOA 1NLDH 2YPLD 3WFBL 1C7TA 2NTFB 3TYGH 2VXVH 3T0EE 2C4XA 1C12B 2J8UB 2VDKH 3UXFA 4LCWD 4XP1H 1SVCP 3BXNA 4K94C 2AV1B 2APWA 1T1YB 3O8XC 3Q2CA 4P46B 4OI9A 2DLIA 3LIZH 5J6HB 3ROLB 5CHNA 2L0DA 4CAGA 4HJGB 5DJCA 1QBBA 4J12A 3KPSE 1QKZH 1ZHBA 3MUHL 3MROB 1F4YH 4MDIA 2ARJQ 2MMXA 1EAPA 4QEGA 2FHFA 1QRNE 3O45A 2UUDK 4BUGA 3H9HB 2VL4A 4FQJH 1EHAA 3T3PF 3ZO0A 1IAKA 1WFOA 5GSVB 1J05B 2VAJA 1GIGH 4UV4L 4OIIH 1AD9A 1NC4A 2DM2A 3HNVH 1BIHA 5IROC 3QHFL 3S5LA 5CINH 1GC1C 4KDTC 5BMFL 4O2CA 5I6XB 1A3LL 2KZ1B 3CVHA 4UT9H 3UBXI 2H2SD 1CGSH 3WV0A 2RJMA 2A38A 1JYWA 5J9PB 2IAND 3KPPA 2APXA 3J8F7 4ODXB 4Z7OE 1I3GH 3STLA 3LVEA 2BMKA 4XVSL 2V7HB 5F21B 3KPRB 4QRSA 1C5DB 3MRMB 4YDVB 3PP3H 3Q6FB 2C3VB 4KK6D 2Q1EA 3W82A 1AKJD 1U95B 3NIGF 5FO8B 2HKFH 4N0FA 4ZUUB 5F96L 5F89B 3R06B 4X4YB 1KJ2B 2CRMA 1UH3A 5D5MB 2FSEA 2YMXH 3VI3F 2DQIL 2SEBA 4PGDA 2DQHH 3SPVB 3I84A 1GCFA 4JR9H 5LQBH 3DUUA 3T04D 3EDDA 2ZUYA 3LH2H 1CK0L 1I3RB 1FO0H 3KPNB 4P5MA 5K59F 5E7BA 3OAYH 3MGOB 4LLYB 4GLRH 5F7WC 3MA9H 3MNWA 5TPWH 3QQ3A 1KB9K 1XCQA 4Y2OA 1CS6A 3AY4A 4NC2B 2H2PD 5D1QA 3NPZB 4OJFL 1MPAL 2D7OA 1BFOA 3V7AE 3C5ZA 1JNNH 4OF5A 4Y1AB 4YHPB 4ZOEA 5FV2A 5CEZE 1U93B 4ZO9A 4G42A 4AH2A 3EOBA 5EOTA 2GTZB 4XHJC 4OZ4B 4OLZH 3MRFA 4NPYA 2BVQA 2F74A 5JLZB 1AQKL 4LU5L 1PGRB 1HWHB 1CLOL 4M43H 2HN7A 4Y5YC 5GIRA 5C09D 1KCVH 4G9FE 2UVEA 1O0VA 3BZDA 1FAKT 5IR1B 2GITA 4G6MH 4U0RC 5JUEH 3T08A 4IRSA 4G6JH 5SWQB 2F58H 3FB8A 1A64A 3SKNB 4F7MB 3LPGA 3AFLA 2BNRA 4OM0H 3EZ8A 2AV1A 3QI9D 5BXFA 5ICYB 4Z77A 1VACA 2I25N 3O11A 3JWNC 3Q5YA 5GJSH 4N0CA 4OZIE 1IGFL 3ARSA 1FLTX 2BX5A 1MREL 3L7FA 4FFZL 3UTTA 4YXHL 2VISB 4DKDC 3RNKB 2YN5A 3BZFA 2WP3T 4N0RA 5EC2A 1YQVL 4XPGH 5HD8D 5IFJA 2IH3B 4HWUA 3B5HA 1MSPA 1ZTXH 1YN7A 5HBBA 1WICA 3TIDA 4M1CD 1NCTA 5HHVH 3U4EB 1IL1B 4JPIA 1DBAL 4OGZA 1JGEB 2QQLL 4YXLL 2NXZD 3LPWA 3UCRA 5JW5A 2R2BB 5LAXB 3I02B 1B6DA 4L4VB 1J0ZA 2Z91B 1YY8B 3SBWA 1MJ8H 4L3AA 3U7YH 2UZIH 3O3UN 3N1PC 4WJ5A 1CDCA 5EO0A 4DUXA 2ZUUA 3P4LA 3FMGH 1NAMH 4JFDE 3SE4A 3Q5OA 5IW1A 2VDOH 1U8OA 2PXYB 1ZT1B 5DJ6A 5CEXB 1I8MB 1HKFA 3NOIA 4J3SA 3VXRD 1OD9A 1OSPL 4FTVD 4ORZC 2GJ6A 5MEPB 5F9WB 1QSEE 3WIHL 2YD9A 3FRUB 5I17A 5SWSD 2A9NH 1A3RL 3OKMB 4L8SA 1J9CT 1NUDA 5DUPH 4GAYB 1JUFB 2XTJC 4PGJA 3V4VL 4H0IA 4PJCF 2AS5M 4DVRH 2GSGA 4MS8D 2PW1B 2E7LA 3QXVA 4DEPB 3FOMB 4YHIA 2BNQE 3IXTB 1CGTA 5CJOH 3WNKA 5TDPA 4E41A 1RIUL 1T2QL 4ZAKD 4Y19E 4JDZA 3CMOH 4HIXH 1ZLSL 4AEIH 1ZA6B 4LOUC 5EUKA 1YUHA 3RY6C 4ISVB 4RRPG 5D93B 2V5YA 4LLAA 2VB5A 1NCDL 3ARUA 4NZRH 5FYJU 1KBGH 3LKPB 4PR5B 1H5BB 4TVPH 3QDJB 4Y4KC 1WT5A 4O00A 3B2VH 3TT1L 5EG6C 1Q0YL 4Y19B 2CIKA 3BKJL 1IM3B 5IMMB 4HLZH 2IALA 5SV3A 1EXUB 5HYJB 2G5RA 1FH5H 4U0QB 2HT3D 4AL8L 1BLNA 5DMIH 1IQWH 3E6HB 3MMEB 1YMMD 4GBXB 2YWZA 1AXTL 1NCWL 2C1OA 1TLKA 1P2CB 4YHMH 2V17H 1DTUA 4LQ1A 3SDDC 1I9IL 5HHNB 4GAGL 3RY6A 5DJDA 3D39B 3SDXF 4X98A 3H3KA 3S96A 3S88H 3A6CH 3DLQR 1PD6A 3CUPA 1Q9KA 2P8PB 2Z31A 1HHHB 5KVEL 2ESVE 1U3ZA 3UPRA 2DM4A 2V2TB 1LO0L 3O3DA 5E6IC 4BQ6A 1ZT7A 3AREC 3NA4A 5F1IA 5LBSH 4NQDA 3P11L 2QKIA 3RUGF 3TO2B 3ERYA 4KDVA 3P40A 4AMKH 2FBOJ 1A6TB 1FVEA 1NGXB 1N8ZB 3GGWB 1NSNH 5T33H 3KYOB 4RFOL 1FLRH 1IKFH 4GJTB 3IDIB 3VXSE 2E5EA 4KY1H 1KTRL 4NYLB 1KC5H 1ROWA 1OB1A 1XR9A 1N5AB 3QIBD 3SBWC 2FD6H 2QSCL 4K8RD 1J0JA 5GRJL 1HYSD 5DRXB 2AJXL 4K94L 4DAGH 1YEKH 4JB9L 1SYSA 2J4WH 5M7QA 1S5IH 3GSXB 4YX2L 3U4BH 5FAAA 3E2HA 5MP6L 4S2SA 1Q9WB 1KCSH 3HUJA 5EBMA 4UB0H 2ICES 1REIA 2AJUH 43CAA 3ZE1E 1T5WA 1AGCA 3GSNH 3WO4B 1X5ZA 1L4IA 1QSFD 3ILPB 1PDKA 1F02I 3B6SA 3J7HA 3HPJB 3SGEI 2R1WA 4P3WA 3HZVB 3UO1L 3WN5B 2DQEH 4ETQA 4S0SD 4PY8I 1ZSDA 2XICA 1P6FA 1P7QB 4R97C 2Y5TB 4M1DH 5I8OH 3VXOA 4U6YA 1HSAA 1UWXK 2JB6B 1I7ZB 3WHE1 3OKYA 1BJ1J 2EXWC 4JQIH 3LSOA 4X6CF 5DUBB 4MS8A 1KB9J 4P2YA 5FA3B 5GRXG 2G2RA 1YECH 1T89C 4Z7QF 1MIEH 1ZHNB 1Z9SA 5CHNB 1N4XL 2W1NA 1NDMA 3B9EA 5ANME 3AMKA 4MNHA 3EGSA 4W6YB 3R4DA 1UA6L 4JY5H 5DD6A 32C2B 4LRIA 4X5XA 4X4ME 3ARQA 3QHZL 5EC2B 4KQ4L 3ZE2E 2YS4A 3QNXB 4TUKL 1AGBA 4KRMB 1T0PB 3VG9B 1AXSA 2JB5H 4LARL 1Z0MA 1BIIA 1PKQE 3D85D 3P9WB 5C70A 3OPZL 3NFSL 1XF3B 5IKCB 1ZGLB 4EIZC 3S37L 1IEBA 4ZFZB 1AY1H 4NBXB 3S9DB 3HC0B 3AY4C 1RZJH 3BQUA 2IPUK 3LEXA 5IESH 3C5ZC 3O2WL 1I9RH 2CXKA 4LHUG 1JK8B 3TPKA 1VFUA 1FYTA 4QO1A 4H26A 3BRFA 2ZP0T 3GIVA 5CP7B 4Q58C 2X4SB 2CDGB 1H3WM 2UUDH 1VA9A 2Z31C 2GCYB 4RMVA 1AHWC 1LK2B 3E3QA 3SGJC 1MNUH 1KPRB 4GUPB 1A4JA 5IB4A 4HIJA 5ID1A 1OARH 1SMAA 5EO1B 4U1SB 3FT2B 3QUMB 5DLMH 3TZVA 4Y2DD 4GKZA 5B3NA 2R1XA 4QTIH 2IBBA 5BOPA 1HQRB 2I60L 1KFAH 5GGTH 1DR9A 2R56H 3D2UB 1IGCH 2YUWA 3N1GC 2BSTB 1E4XH 5IQ9A 2IAMD 5GXBB 5D9SB 3TV3L 3MV8A 2W0PA 4PRPE 3K1DA 2RAMA 2A6IB 1FVDB 4X6DF 3HZMA 3U36B 4FQIH 1UXWB 5T1LB 4ZNEE 5GGSB 1BZ9B 3BT2L 4P5KA 1T1YA 1LDSA 1TJHL 3STZB 3INUL 1NANI 4U31A 3RPIB 4GRLA 3QUXD 4P99A 1HIML 3CC5A 1U2CA 5MEPA 3TV3H 3MLUL 4LSSL 3MLSL 4HWZA 4QF1B 5F1IB 3WE6A 3HZVA 5SWZB 1UM5H 3V6OE 2O61A 5EORH 1JF1B 1CVRA 4D9LH 2DL2A 1LO4L 3FOMA 1BPVA 4XCYA 1HH9B 1U8PB 1TTGA 3RWFB 4Y7MA 1CR9L 1WF5A 3PWUB 4WHTA 5I8KH 3SO3B 5KAQF 4PJGF 5T5FL 5GS1B 3EOTH 3BESR 2EIDA 1MELA 5ALCL 3E8UL 1KB5L 3JTTA 4O2FA 4HDIB 3SGKC 4E42B 2OQJA 3BZEB 4CVUA 2I9TA 2HRLA 1EVTC 3O41B 4G6FB 3EO9H 3MZTA 1YN7B 4IOIB 4LL9A 3SDDA 3RWHA 4R96A 4ZXBA 5IFAH 1M05A 4LRIC 3FAWA 2IALB 3RWEB 3EYFB 5JORB 2NY0B 4ELMB 4R2GB 3GEWB 4OGXL 3OPZH 4JCMA 4MXQA 1B6UA 3BN3B 4GKNB 1FN4B 2OR9H 4M4RA 5CIPH 2Q86A 3ME0A 4BSWB 1QR1A 3GMRB 2VKWA 1A6AA 3ULUF 2VABB 1SJHB 4OZIF 4KJYB 5F7KC 4WDIA 5T3ZD 3B9KD 3AVEA 3C9NB 3AXLB 3MRGB 4TRPH 1TNNA 5BV7B 3RX8A 1YEGH 2B1HH 4GQ9H 4E42A 5CAYB 5GZOD 4N0CC 3QFJD 4O2EB 4HK3J 4QRSB 1KPVA 2DJUA 2IFFL 2ITCB 4PP1D 3D6GA 4RX4D 4ZG1A 2AJZB 2NY1C 2ZNXA 2DQGH 1OP3K 1RZGB 2W0KA 5FB8B 3TBSB 5I8OL 2VLJA 3QWRA 1JZ5A 1N26A 2DI8A 2BSRA 3QZWG 4FQQA 3UO1H 4K71B 5JMOC 3MNZB 4U1GC 3SOBH 1IBGL 1C7SA 4A6YA 3IS1X 5A40E 4LPXA 3V6ZB 2WLYA 5L7XH 3ECBB 5D93C 3UAJD 1CDIA 4OKVA 1HKLL 5TDOB 5ENWB 4YX2H 4GRLB 2VKXA 5GHWL 2J4WL 2VQ1A 2ESVD 1EJOH 5IHLB 2DLFH 2W91A 1HI6B 2IG2H 3B3IB 4ZFOB 4LHQB 2YPKB 3SJVE 4F57L 4WU7B 3DXAD 4W6WB 1DEDA 5I1DA 4X4XA 1U3HB 4WENB 2IANA 3MRRA 3MQIA 3X3GH 2WW8A 2NY5H 3QUZC 1NAMB 2A6JA 1U6AL 4U3CA 1FLRL 3PE9A 1BF8A 4JGUA 4Y2DC 3ZHDA 1YYMH 3NABH 5K9KB 4ZQKB 1JHKH 1GAFL 1F58L 2JK5A 3P4NB 4U7MA 2V7NB 2YR3A 4FQCL 1D3CA 4KI5F 2LFGA 1OM3L 1TTFA 5E1HB 4MNGA 2VWEE 3TA3A 3EYOA 4NQCE 1T3FA 1DUYA 4PJAE 3BI9X 1MAMH 4KK5D 1P4BL 4LBEA 3FQWB 3QUYB 3U82B 4KKLC 5EOTB 4K7FA 4DW2H 5ERWA 1A7QH 4Z7WE 1KPVB 1SJEA 1D6EA 1EMTH 1NCCL 3CPLA 4L3EB 5E24E 4PLKD 4PFEA 4ZUWB 1NKRA 3GJFK 3EYSH 5CIPA 4KJWD 3GBLA 4HD9A 5AYUL 4ZMAT 2AK1H 2M1KA 4ALAH 2OMBA 4R97B 1XF3A 5JO5A 1FNFA 4NKDB 1ODAA 1RZ8A 5DZNA 3FQRB 5I71C 1ND0B 4HMDA 3AU1A 4Z7WB 1QA9B 4FQQB 2XWTA 4ZUSA 1T1ZB 1JNHA 3U6RB 5BO1H 3H9SE 4JJHA 5HI4D 4GRWE 2DI7A 5KW9L 1KPUB 1E28A 1U3HC 4NQCA 2XTJD 4CVXA 4L4TE 4JM2D 5EIIB 5ESQA 5C07E 5A2LH 3UPAA 5D7LD 1QFWL 1QFWH 1ZHNA 5B3JE 3H9SB 4HJGA 5C0BE 5HXMA 3IFOB 4YHYB 3VH8G 4XPFH 5JIPA 4PJDE 4DUVA 4FFVD 3BO8A 1URLA 1GGUA 4LNVA 4RX4A 3JVGA 3WL9A 2WNGA 1P7QA 2PW2B 3F5WB 4R0LA 4XBEH 2ZPKH 2DIJA 1NBVH 5FGCE 5C0DB 5CZVH 4PJ9D 2NYYC 3MLTB 3ECBA 4TQEH 4HV8A 4H8WH 3VFOB 4P57A 1FNAA 5DI8B 4NNPL 5DRZA 5HYJE 2ZSVB 4X5WA 2VDOL 4H1LG 1XGRB 1E4JA 3RZCA 1Q9OA 2O5YH 3MR9B 4UI2A 2W60B 2I9TB 2DLHA 3WHXA 4OLVL 4BKLA 2HP4A 5L2KD 3GIVB 1LE5B 2ZJSL 3U7YL 1F2XK 3FB7A 4XAKD 4BSVB 4R0LC 1F11A 3LS4H 3PL6A 4GG6E 1OM3H 3QUZB 1Y18A 3VG9C 1I1CA 3L3HA 4PLJD 4L3CA 1R24A 4LEOA 3T8XA 4YXLH 5JW4N 2BHYA 4FQCH 3VRLE 2H1PH 1PG7H 3VRJA 4JE4B 3A6BL 3F65A 4YDIH 3EHBC 1JFQL 4XMPH 3VFOA 2AAVA 5LKNA 1VFBB 3U1SH 3ARFC 1A6VL 3MV7D 1DQDL 4MAYD 4WFHD 1EO8H 1OT1A 3NA9L 4D0CB 1IAOA 3PQYA 2NY5L 1IEHA 3IXTA 4H0HB 4R26L 1T4KA 3KLSA 4ZS7H 4O4YH 4H88H 3I85A 1A4JB 4E41D 1QYGL 4PV8B 5C0BD 2NW3B 2DLFL 4JG0H 1JZ7A 4EDWH 3ZDXF 4PREB 3M17A 5D1QC 1VHPA 5JUEL 5E5RB 2J88L 2Z92B 4XVTL 1Y6NR 2VZ3A 3QUZD 1S7TB 5FGSA 1Z0NA 4LRNL 5IQ9B 1FG9C 4X5LA 3B9VA 5T5NF 2Q8AL 4CU7A 3LRSB 4Y4FC 4RGNE 1BEYH 3DX9B 4DTGL 4ZPVB 5HVFB 2HTLD 4NO3B 2HLFD 3HN3A 1V3LA 4LPYA 4OQTH 4JDTL 5JW4R 2ESVA 2ZSWB 5DEGB 1HHHA 1MPAH 2DWDB 4QHKI 3MGTB 5FUCE 1RZKL 2VLRA 5E2WH 3C8DA 3U0TA 4QHNB 3OG6B 2VMFA 4P9HL 4R90L 3CDCA 1IRAY 3LH2L 4X6DB 1JE6A 4WI8A 1DQJB 3ESUF 2JTDA 4JM2A 4OFIA 2IMMA 4G8EA 2HLFC 4TRPL 4KUCF 4L8DA 3VD5A 3HI5H 4HXBH 1IKNC 4GRWH 1EFXA 3Q1SH 3DV6A 3NTCL 4F8QA 1J1PL 2D7NA 3CFKA 1MWAB 3RWJB 3ULSA 3DUSB 2AJ3B 2KBGA 1IQDA 5FIEA 4CW1B 1K2DA 2V7NA 1A4KB 3HRZA 2HJKB 4Y5XB 4NO0A 4PJBE 4PRDB 5CLTA 4WCYL 4QXTB 3OAYK 3KPLB 5E8PA 3T4YB 3VWJD 5HHOE 5CEZD 1S9KC 1FAIH 5KVDL 4MXQD 1MRDH 3F7QA 3VE0B 1NUNB 1M05B 4BM7A 2OI9C 2Q7YB 1Q9KB 4JM2C 1FDLL 2VERN 3HUJB 1FZKA 4I3SH 4JFEA 1TVDA 3O6KL 1JPFA 3WNMA 1R24B 4LEOB 1SJEB 1I4FB 4UV4H 1QSEB 4AIZA 3BH8B 3LDBC 4OD3L 5FYLL 1Q0XH 1CR9H 3TC9A 1HSBB 4RWYH 4XNMB 4LCCA 3QJFA 4DKEH 1CBVL 3A6OA 4XPTL 4ETQB 3C9NA 3IT8D 1WFUA 2C3WA 1QLFA 3PWPA 1UM6L 4UTBH 3PHQA 4NQCD 3BEWB 4MXVE 1CZ8H 3CSGA 3HS0A 2EYTB 1NGWA 4NQCB 3MLUH 3FZUD 4LSSH 4F8TA 1QRNB 2B5IC 2X4NB 3RWIB 3VFPB 5JDSA 1MCPH 4QRUB 1WUNT 4QRTA 1CD8A 1O7VA 2QKIB 2P4AB 3UZQA 3U46A 3I3EA 3V9FA 4LOUD 4NGHL 1A7BA 3G9VA 1F8TL 1SYSB 3OMZA 1S5HA 2XZAH 4ODBD 3TBYB 3T2NL 3JWOC 4ELKB 3K8KA 4U6HA 1SEBB 4XC1L 5GRZA 2DI9A 1JGEA 1U3HA 2ZOLB 2R0WH 4PJ9A 2IBGA 3MBEA 3G6AA 1IMHC 3C2AL 4DJMA 4HGKC 4KKCC 2FO4A 3CH1A 5GGTA 1P6AB 2LQRA 2XQYG 1E4XL 5F7YC 4OKDA 1UQSB 4HUNB 2XPGB 1HILB 3O3EB 4PJXF 4JFFE 1UB6A 1M7IA 3T0DA 1CXKA 1UWGH 4U6YB 1BD2D 3VWJB 1K5NA 2CGRH 1OARL 4YHPA 3L9RB 1QBLH 2FX8H 1J8HA 3N50A 8CGTA 1I7RA 5SX5K 4YHOH 1OGAE 2X4TA 4MQ7B 5I0DA 5CEXA 2K7QA 3RU8H 4ONHA 5F9OH 5FYKE 1KPRA 2V2TA 4KK8D 3ARZA 1P4LA 4JM4H 1M6OA 3W0WA 5IB2A 2D03L 3CXHJ 1GYAA 1SEQL 2VH5H 2BSRB 3F7PC 3QDGA 4FXLA 2YEZA 4ZYKA 1MCHA 3IXAB 3O2WH 1AJ7H 2PNDA 5D7IA 2F19L 5FUZL 1R3IL 2LU3A 2P49B 2FEDC 4NC1E 5IESL 5FHAH 3C87A 3LKQB 3QNYA 5D7KE 5CGTA 1F00I 4JRYA 1KENH 1ADQA 1FIGH 2WBKA 2CR6A 1RZ7H 4OAWB 4S1RL 2AXHA 2NY6C 2A6IA 1T3FB 1ZANL 4WV1B 4NM4H 3PXHA 2GK0A 1T22B 5EDXA 3BD4A 2Y36H 4XVJL 3MNWB 4XBPB 1YEHH 4HXAL 4PR5A 3MXWL 1CL7L 2VJXA 4M3JA 4N1EA 5KSAB 4V2CB 4N1HB 2NY7L 4Q0XH 2E7BA 3HE7B 3QDGB 4HJ0D 3QQ9D 3QXDA 4YBQD 1ZT1A 2FJHB 4I48A 4O5LH 4FP8H 5K9JL 2PUQT 1CLZL 4UZGA 4KJQC 4FNLL 4JQIL 4XZUA 4KI5D 1NMCB 2FJGB 5HJ3B 1KIQB 3T1FA 1FBIL 5DFVD 5BW7A 5F3HA 4APQA 4ZFOA 1RY7B 2E9IA 4NQDE 2Y5TA 1HXMB 4N8VG 4XP6H 3DBXB 1QLRA 4PB0H 4PB9H 5EN2B 3JTSA 3MRPA 1EEZB 2NXZB 5FYJL 1P5UA 4DK6A 3VFRB 2R8SL 1GRWA 3MO1B 3BEVA 3KPPB 2WLZA 2EXWD 4JQVA 2APVA 3MA7B 3VG0H 1FPTH 3RHWF 1NCBH 1KCSL 2FYYA 3RL1B 4NZDA 4D0BA 4Y4HC 3T1WA 2IGFH 2EKSB 3JWOL 3WFEH 5MHSD 2AKRA 4RAHA 1B4RA 2XIDA 2D9QB 2CKBB 1T83A 5KJRH 3TBVA 2UVFA 3TN0A 3PP4H 4LSVL 2C7UB 2R69H 3BW9A 2R0KL 1QQDA 5KTEL 1CXEA 5E8DL 4HWZB 3WE6B 4NFCA 3UTTD 4LCYB 2NY6B 3O3BA 2OP4H 3EYFA 4DQOL 1KC5L 4MA7H 1ZVHA 4OLUH 4NZUL 5IB5B 4F7PA 2HRPH 5C07D 5C3TA 2ZCLH 25C8L 7FABL 5E2JA 1EHXA 5I73B 3FKUS 3GMPB 3WO4C 2B2XH 4BH7B 3MRDB 3AXLA 3MRGA 1UACH 2WWKT 5F9DC 3MBXH 1OHQA 4P3DA 4N8CL 1DBJH 4OQ1A 2OI9B 5D1XB 1DBBL 1HI6A 2UV3A 1HHKA 1AO7B 3VFWB 5AYQA 2ED9A 4NP4L 3C5ZD 3UEZA 3QQ4A 4KQ3H 1YZZA 3GK8H 3IFLH 3MRKA 4FZEL 4XBGA 1EJ6A 4HUXA 4NQEA 5KSBF 4I3GA 4XWGL 4M61B 4W68A 3ZKQD 3RDTC 3GI9H 4PRNB 5IBUB 4HIJB 2EO9A 4U1IB 4M9OA 3RVTC 1CXFA 3BOVA 3U9UB 4KK5C 3F7YA 1MCIA 1J12A 4WGVB 5ESAB 4ZFFA 1KV3A 3MC0A 4LKXA 1VPOL 5DRWA 3TVMA 4X9GA 2JJTC 3FAXA 4PRAA 2HG5A 4AL8H 5ALBL 1PKQA 3U48A 2X10A 3FL7A 5L2JB 2HWZH 2IPKB 5TQ0H 1AP2A 4MJ5B 2AV7B 4UNVA 2G5BA 5T1KD 2VDMH 5GRUL 2FJHA 4JVPA 1RUQL 1NCDH 3E1F1 3QCTL 4FQXB 1FVEB 2C3HA 4KKBC 1JNJA 4QLRA 4FOMA 1FRGL 1RU9L 1HEZB 3MV9D 2DQUH 1I7UA 4NRXB 2VDLL 3QBTB 2X4OA 2VDPH 4ZTPL 5MHSE 1BBDL 3OF6D 4AK1A 5C0NC 5J6GA 2FEDD 1T0MB 5FECA 3ZT7A 2AEPH 3WFDL 3AROA 4D9RE 3PGCB 4G43A 4NHUE 4MNQE 2P5WD 1OAKH 5I71B 4HMEA 5FYJE 3FZUC 5DUPL 3R8BB 2GI7A 5KBNC 1HK6A 4PJ7A 5CP7A 4MQXC 1RJYA 1G7JA 1RPQA 3CD4A 3RIFK 1XZ0A 3RY4A 1GGTA 4X6DA 1C5BL 4KAQL 2BDNL 5HPMA 4QXUL 3EO0B 1QBML 4LVHC 5JPMB 3HPJA 3SGKA 2F9BT 3IDXH 3ARWA 3S4SA 3SDCB 3WKNA 2X4PA 1H8SA 4NKDA 2E9BA 3QPQC 3AM8C 4NSKA 3VMPA 3D2UD 3O2DH 4ACPA 4I18C 4DVBB 1CIUA 3DTXA 4KTDL 1N5YL 3QIWC 4LCWA 4KUCD 5H94B 3QDJE 3KPLA 5HYSG 5EWIH 4ODWA 1GZQB 4NM8L 1YEEL 5GS0D 2AK4B 4PTUA 1YEJH 5D2LF 2GK0B 3KJ6H 4HF5L 4FQXC 4JHZA 2QADB 4Z7UB 3STZA 1C8PA 4W70A 3QEQA 4NC0B 1M71B 2HFEB 5J1SC 3HZKA 4CGTA 4HUUB 4B5EA 5C8JA 4UQ2A 2HH0H 2OJEB 4KI1A 4J6RH 1MCBA 4HUWB 2YKLH 2AERT 1IC7L 3HE6A 2EYRB 2HAZA 1T7VA 3U9PH 4PRIE 5GJSL 3UC0L 1HNFA 4Q6IA 1Z5LB 3QH3A 3C09B 2RCSL 1MEXL 4NQED 1H8NA 3VWKA 1JN6A 1Z3GH 2YRPA 2UWEB 2HJFB 1JGUH 2R23B 5C09B 4XX1E 2BNRB 4PG9B 1HEZA 5LGJB 4V2BA 4WTZA 4B0MM 4K07A 4PYGA 4F7TA 1L0XA 4JFHE 5M94B 3TZVB 4K3JH 4N0YH 3O9WA 3WUWG 3ARPA 2P5EE 4CBPA 2BHUA 2R4SH 1A9BA 3D39A 4Y1AD 5GGVH 4G8IB 3PWVB 4GRWF 1AE6H 4MJ5A 2IQAB 1Y6MR 2G2RB 1OVZA 5JR1H 3GNML 3BKYH 3ZT5A 4EJ1C 4ZD3H 4Z76B 1T7YA 3TP4A 3ILQD 5GGSY 2WBJB 1NLBH 5IWLC 1A1OB 3FRUA 5I17B 3FJTA 3B8SA 1MCWM 5I15L 1LGVA 5CILH 1OL0A 5E8NB 5HGHB 1VFAA 3GM0A 4OD1L 3MR9A 3GBML 1W0VA 4WUUE 3H9SA 1FCGA 5IHUH 1NGZB 3MA9L 4U1NA 3VXPB 4NJAL 3TM6A 4KVCH 1BFVH 1DEEB 2X4RB 3FFCD 1FGVH 4G43B 3O3BB 1LNUA 2YWYA 5EC1A 4XNXH 1FIEA 4OLYH 5I16B 1QFUH 1ORSB 3OKLB 3LKNB 3FONA 4JKWA 5JA9A 2Z91A 3QIWA 1QSFB 3CZFA 4ISVA 4RMUA 4GAJL 4I4WB 3V6FA 4I0CC 2YMXL 2CKBH 4OUOA 2J6EH 3KNBA 3CNKA 1BBJB 5IIEA 2DKMA 4PJDF 4HKBB 4HS8H 3I6KB 1CD0A 4Y4HB 1I1FA 3C2SA 3L3GB 1KUMA 4IRSC 3PQYD 4BZ1L 1QD0A 5FK9B 1KLGA 3ISWA 4B41A 3QDMD 3GHEH 3MRFB 4NPYB 5I1HL 5ECJE 5I8CA 5B38G 4DVBA 4FQ2L 4GXVL 5C0AD 1GPOH 4Z7NE 4R9HA 2WAHA 1VFOA 3QUYD 5ESAA 4ZFFB 1F4WL 5C2BL 4MS8C 5JXEC 3VXRB 3HNVL 4CKVX 4LASH 3D3VD 3FQRA 5FFLA 4NN7C 2FATH 4DGVL 1J8HB 2BRRL 1FZMB 4FQJL 2PXYD 2P8PA 2Z31B 2ZG3A 4MQ7A 1T1XB 5JHLL 5DUMH 4KPHL 3UJTL 1JGLH 3P3YA 2FH6A 1WWCA 1A1NB 1N59B 1N6QL 4HIIB 4IHOB 5CKAA 1UH2A 2OL3L 3OKKB 3VRIA 5DC9B 4UQ3A 4I9WE 3VFNB 2E7HA 1CICD 1FFQA 5HJ3A 3DRQB 1FFOA 5FXCH 3VGEA 4NDMA 2DKUA 3MOAL 4WO4A 5D6CA 1CD1B 4LPTA 5TF1H 2Q86B 3O0RL 4RGMB 1TCMA 5KSBA 1KULA 1F3JA 1IE5A 3OXSA 4LCUA 1J88A 4OF6A 1K3IA 4RBPH 4XNYL 1A6ZB 1W72H 1PG7W 1B88A 3O6FA 3NACH 3KLAA 1MQKH 4MAYA 3KS0J 1MLBB 2JCCF 1BECA 4A6YB 3IU4L 5ITBL 3MZGB 4JJ5B 3WDIA 4WFGE 3C60C 4FTVA 5I1LB 5DSCB 3HHRB 4PDCE 2B5IB 2EICA 3LN4B 2ATPB 3TT3H 1S7QA 4PJHE 3C6LA 1OAQH 2YPLE 2YPKA 3ZSSA 2NY4B 1RJZA 5E6IA 3FO9A 5L88H 5L2KE 4F33A 3LKSA 4P4RA 2R1YB 2BVOB 4Y2DA 1GOGA 5GGRB 3W9DB 2VN7A 1JPFB 4Y4KD 4X6CB 1OAUH 3ET9F 3DWTA 3D0VB 1XGPB 5LGHH 1S7WA 3MRBA 3WXVL 3NFPA 4PJ5A 3KNBB 3H7LA 3VFGL 2AXGA 3S35H 3C60A 2PO6B 2GYSA 4X83A 2Y6SD 2GHWB 4PRDA 1W2KT 1FC1A 1ITBB 4RMQA 5T1MA 4QXTA 4XNZC 4IRJD 4IDLA 1U8JB 2OJEA 1Q38A 3CGTA 4J2XA 2WUCH 4HLZG 1V7NH 2X1OA 5KSUA 5C0FB 5F89A 4AJ0A 4S10A 1TZHB 1EZVY 5BZWB 4OSUL 5ICZB 1NBZB 4L4VD 3H7BB 2QADD 5AAMA 4PRAB 3PV6B 3BKMH 4QRQA 3U2SA 1MCEA 4LGRB 3ZHKA 4JO3H 5ILTH 1HQRA 2VC2H 3CVIH 4RMTA 4NFDA 4NHUA 2QQNL 5DD6B 2ZSWA 1MCCA 4LPVA 4KRPC 3MLWL 4WNQB 3CFBB 2G9HB 1XCQB 3GSOB 2CDFA 5HHME 3GB7A 5C3LD 1D6VL 4GRLD 1D6EB 3SDDB 5D1ZB 2B8OT 2P5WA 2PYEE 2HFFA 5EH1A 5GZOC 1JZ4A 1F11B 1NFDF 4P2OD 1MVUA 4R8WH 2YOCA 2XXCB 4X4MA 4I0KA 5E2TL 5E9DE 3BQUD 1WZMA 1MI5E 2ZCKH 4HZLB 3FRPA 5C0EA 1U8NB 3LEXB 1KCRL 4HBCL 4NQVB 1ZE3C 1IGML 1YEFL 5IT2L 2XTJE 1U8MB 2R29L 5JXED 5ADPH 4E9LA 2DBJA 3P4NA 5EZIL 3S4SG 3BD3A 1TETL 1LO3L 1MOEA 5J8OA 3WIFB 4XPBH 4HV8B 4KROC 5F7NC 1NMAH 5D70H 2H8PA 2DWEB 3C60B 2YD2A 3MOAH 1KLUB 1FGNL 1T7ZA 4LGSB 1DLFL 2WZPD 3B9KB 4GMSL 4LAJH 1T66D 1FL6A 3MPCA 4LF3A 1A9EA 4NKOA 5H8DA 4XP4L 5HDOA 4KJWC 4Z0XB 4UQ2B 4JVUA 1FSKB 5IVXB 4I18A 4BUHA 3CX5J 4Y4HD 5GS0L 1HYRC 4HAGA 4R96B 2X70B 1BWMA 5ICXA 1F90L 3SE3A 4FQLH 3UTZA 1ETZA 4XNMA 4AEHL 1RULL 5I1CL 3I6LE 5KS9E 4LKXB 1DQMH 4NHCH 5DURB 3GBNL 5DD0L 4Z95H 4KXZH 4LLUA 2VLKD 3T1FB 4YPJA 5HYQA 2B39A 1NQBA 1Q9OB 4QRRD 4O2CB 3T3PE 1DBMH 4G6AD 2XWJB 4JFDA 3VGAC 4K3HA 4HULB 5KS9B 4V1DA 1GZPA 2OSLA 1SJVA 5EUOA 3QO0B 3WJLA 3D85A 4M93B 1Q72L 3GSXA 4OZHB 1BFSA 5E03A 3BSZL 1DBKH 1U8HB 4Z7UF 4E5XB 2QEJA 5E6IB 4C59B 2XN9E 5EZLB 3HG1B 5A16B 3WL9B 4OCSL 4HUMB 4WHDA 4X8JA 1ORQA 1MAJA 1YPZA 2VXTH 3M17B 1A7NH 3OGOE 4HX1B 3PWLA 4GW5B 1FGNH 5ETUA 3AGVA 3X13B 5HI5C 4GAJH 1S78D 3SKMA 5I1KH 4C4KT 1VCAA 4HC1L 1KIRA 1R3LB 1S3KH 1UC6A 5CFHA 1X5JA 4BQ9A 3OAUH 3MRMA 2I9LA 1MFCH 1I8LA 5F9WC 4NQEE 1BFVL 5C0ND 5IW6A 2C3GA 5INCB 4CDHA 2RB8A 3QO0A 4HWNA 3PGDB 1IGMH 1OTSC 1VKXB 4YGVA 1J11A 1P5VA 2AABL 3MCKB 2VLRB 3GBMH 3EW3B 4XGZB 4MNQD 1J86A 5HTSA 1G6RH 5I15H 4XTRD 4Y4KA 5I1DB 4NC1C 1RURL 1J1XL 3ARYA 1LEKB 4GAFB 2P47B 1N3NB 4X7SL 1CFBA 1QLRB 1NGQH 2E9WA 3GNMH 2EIBA 4ODSH 5K9OA 5CWSA 1IAMA 2BY1A 1FFNB 1AE6L 4UUJA 3OR7A 3X3FH 2ICEA 3KWWA 4HS3B 2AQ2A 5IEKB 2W9EL 4WDIB 1WIUA 2VLJD 1OCWL 4U4BA 4KRPD 4BELD 3N85H 5ILTL 3SCMB 5FOBB 2G9HA 4MNQB 5E8PB 1ZK9A 4YAQB 5D7JD 1A22B 4GRWB 2HKHL 2X7LA 5A2JH 1U8KA 3CMGA 3TBTA 1RZGA 4K7PX 5JORA 3C8HA 2AJ3A 4M7JL 2FSEB 1NFIB 4N5EA 5CZXC 5CZKA 5ICZA 2P8MA 2UWEF 2WUCL 5HGDB 5FYLD 1IL1A 1FFOB 3MRDA 1D5MB 4PRHE 3V0WH 5D7IF 4PJIB 2FO1A 4XP9L 1CGYA 5HHNA 5I1EL 5J89A 1QPPA 3WUWB 5DJZB 3D2UA 3MRPB 4NBZB 5IVNA 4JKPL 1FZJB 1I1AC 1NCAL 3GJFB 4Q9RH 2MKWA 1I8KB 3FN3A 1E6JL 4OKVB 5JMRA 3ARBD 4AT6A 4PJBF 5I6XC 4PTTB 4G5ZL 4TSBL 2XZCH 4OCWH 5LGHL 3W11D 4Y19A 3VXTA 2W92A 4FQXD 3ELAT 4Z7NF 3WNLA 1Q94B 1BQSA 3LKPA 4FQ1L 1KG0A 2HJFA 3DYMA 1OQXA 1NAKL 1YY8A 2ADIA 2OTUB 5DDHB 2H45A 5I1AB 1DSFH 2WWMD 3TT3L 1BOGA 3AUVA 4HIEA 4P9MH 1WEJH 4WV1A 1OAKL 2NLJA 4ZPTA 4Y4FD 3QEQE 4MHHG 1JNLH 1DP0A 1UXSB 4Z7UA 1EEYA 1WWBX 3QIUB 1W72B 4LKCB 1BBJA 3RVWC 5IIEB 3P9MA 3VRIB 4LMQI 5D2NA 4HKBA 2VAAB 1SY6A 3QEHB 5GJTL 4UBDD 5DRNA 3VE0A 4UT6L 2F53E 4Q97A 1MVFA 1LD9B 1AO7E 3UAJC 2F8VA 3HE6C 3ZTJH 1ADQH 3O0RH 5TF1L 1HWGB 3QCTH 1C16A 4ORGA 1S8DB 3OF6A 3SKJH 3ZKND 5GRUH 5D1XD 4XT1C 3M8OL 4MB3A 2EYRA 2F5BL 4IJ3B 5TQ0L 3SDAD 3KHQA 3AB0B 3K7UA 4P2QE 4J4PC 2EZ0D 3U36A 1RAMA 2BJMH 4NKMA 2NQCA 1NH6A 1X5IA 5IUSA 2HG5B 2NY1D 1ULVA 3TNNA 5D2LE 5DUML 5TGBA 2W60A 1JP5A 5D6DA 2YA0A 1D7FA 4JPKL 3WIIL 4FXKB 3RWGA 3C08L 3DOSA 2WQRA 3QFJE 4ERSH 4Y1AA 2Q8BL 1X3DA 2QSTA 2DMKA 4YLQT 1L7TH 2OTWB 3DVNA 3PIQA 1A9EB 5HVGB 1YEIH 2MCPH 5BS0E 3BIAX 3WS3A 2DOCA 4YR6B 3IDYC 3F8UB 1JWMB 1MJUH 1MUJB 1GGBL 2A83B 3OHXA 4U05A 4Q9QH 1DBBH 5BRZA 2EDFA 4LLDB 2PW2A 3THML 3RGVB 2H9GA 5KG9A 1J0KA 3NZHH 4ZXBD 3FO1B 3JV4B 1I9JL 3SKMB 5EFIB 4OFKA 3RDTB 2IPTL 2X09A 3DSNA 3QZWB 1H15B 1MHPH 25C8H 2PTUA 3P0VH 1FVDA 1HINH 4TVPE 1INDH 3D69B 3CLEH 1D9KD 5DD1H 1LMKA 3DARA 3FB7B 1F6FB 5E8DH 3OKEB 1BQHG 4KK9C 3B8YA 1G6RB 4YUEL 3D85B 2VQ1B 5HGGS 1RMFL 3W2DH 5KJRL 1EDQA 2LE9A 3R1GH 4M7LT 3S36H 4PRBB 3CVHL 5DJ2A 1BGXL 4JHWH 4X5XB 2FZ3A 2IGFL 2V2WA 3MACL 3FQNA 3GSRB 5ACZB 3VG0L 3X12B 4F9PA 4JRYE 1KCUH 2A6KB 3PL6C 1DUZA 2R8SH 3MO1A 1QLFB 1NLBL 4OB5H 5EPMA 3MRLA 5HHOA 2VLKE 4JHAH 1FYTE 5I1JL 1BGXH 3V95A 4U6XB 3IFPB 1DQLL 5BVJA 3L7EA 3R1GL 3V6OA 3HC0A 3WJLC 3WS6A 3TH4T 2XG4A 3L5XH 1B0RB 2I24N 2NNAA 1KB5B 4CVWA 1CLZH 5DFWH 2CQVA 4OD2B 3NCYP 5T3XE 4M4PA 5C92A 2VQTA 3SDXE 3CXDH 1I1FB 5DD1L 5I75C 1ACYH 2FB4H 3NMEA 1W8OA 1NANH 3W5MA 3K2UH 3P0VL 4LVNB 2X4OB 2IH3A 1CL7H 5JPNA 1UKSA 3UC0H 1IC7H 3QIWB 1JWMA 1ZAGA 4U6VL 1S9YB 1P84J 2WIMA 3KPRE 1BX2A 2YD6A 3NIDF 4J4PA 4NQUA 5JO5B 1RZ7L 3PWNB 3EYUH 4PJAF 4WW2F 5D7SH 4M6MH 4MXWH 4WY7H 5D7JC 5DJYB 1IT9L 1INEL 3CFCH 2RIKA 1S7VA 4YXKH 4MD4B 5EWIL 1YEIL 2MCPL 5CD3A 4K9EC 5K33A 5C0CA 1AIFA 2F19H 1N5YH 4L8DB 1CVSC 4UBDC 4CADB 3ULVL 4ERSL 3O2DL 2HFFB 5ANMA 5ELIA 4JPKH 5I19H 2BK8A 3F7YB 3EOBB 4UIKL 5I2IB 4M62L 1QSZA 3LDBB 5T3XH 2A74B 3IDXL 5C6WH 3IDGA 3K0WA 2VLLA 4HUVB 1MLCB 2YD7A 1RIHL 2DQTH 5C6PB 1NFDE 5EO0B 3S36X 2VLME 3M1BA 4DK3A 4HFWA 4LSDA 3SGEH 4BK4A 5E1AB 4NO3A 4X6CA 4JGJA 4NWUH 2DLGA 3P2TA 3MUGA 1ZS8B 4QGTA 4UV7L 5D72H 4K23H 3C2AH 3KJ4C 4PJ5E 2ZCHH 4P3DB 5EZOH 2VTFA 1H3GA 3FT4B 3SE8H 3WCYA 2AEPL 4XC1H 1CN4A 4P5KB 1ZLWH 1CICA 5HHPA 5E08H 3E3QC 2RFXA 3NCEB 3T0AA 2VDPL 5E7FA 2PTTB 1M4KA 1A6TA 1GGCL 4C55A 3QDJA 5GS3A 5FGRA 1EGJA 4YC2C 5GS2D 1T5XB 4PY8J 1FRGH 1MCPL 2P1YA 4XHJD 2Y06L 3OHXB 5DEZA 4I0PB 5K9KA 1ZT4A 3T65B 1TCRB 2VXSH 4OLXL 4EUPB 3CFJB 1CQYA 3BPNB 2GSIB 4LCCC 1TIUA 3ARTA 1V7ML 2ED8A 5DEGA 3KLDA 3S5LB 4KGJA 4HH9B 5IVXE 1OAYH 4CMMA 3KYKH 4OAWA 5J11B 5FYLH 3S96B 1KIUA 5MENE 4MLSA 5IVXF 3FO9B 5D7LE 4G5ZH 5J1TC 4RMSA 5EB9A 1LEKA 5CLWA 2YC1A 3P4MA 1OP5H 3QG7H 4KZDH 3VWKC 4GW1A 5I75B 5F8RC 1NCAH 4HK3N 1K4CB 2HTKC 4C83B 4Z7OF 2WY3A 1IGJA 2BY2A 4DKAA 2EYSA 2D0FA 1WC7A 5F1SA 1VADB 1MRDL 3FTGA 3L3OA 4H25A 5KVDH 4H20H 3FN0L 3V0WL 1F4AA 2JK5B 4M7KH 4NP4H 5C07B 4N8CH 3FO2B 3F7VA 4M7JH 3TIEB 1B2WH 2D3VA 4PGDB 3V52H 1KIRB 1CU4H 3KYNB 4QRPA 4YAQA 2BOCB 2H8PB 4JREC 2EYTA 2B2XL 4DGIH 8FABA 1MHEB 1BVKB 4EVNA 3H42H 1CD9B 4ODUA 3KGRA 4X4XB 5B4MD 3DVNB 1HDMA 4MA7L 2V9RA 1U8QA 2I07A 3NIGE 1KF9B 3VCLB 3N85L 2JJVA 2AVGA 1V3KA 3QUXC 15C8H 5KTEH 2R0KH 2YPLB 4F33B 2AXFA 4J1UB 3ZYJA 3P9LA 4QOKA 2UY6A 3IGAB 4F58H 2X42A 4NKQB 3PWVA 1NPUA 1E6OH 4NCC1 4MCZA 4LP5A 5C07A 1ZKAA 1F2QA 1NKOA 3WN5A 2AGJH 3O6ML 4BQ8A 2CMRH 1FNSL 2ICWA 1T6WA 2R9HC 2VLRE 35C8H 4DOHB 1GJIA 4UAOB 1J1XH 1Z2KA 4DTGH 5DVNA 1YQ2A 4ZS6C 3OGCA 1BP3B 2EKSA 2HFTA 5EU7C 1FG2A 1SM3L 5FYJH 3ZE0F 1DANU 4P4KD 3O81A 3RA7L 1KCLA 2A6DB 1AR1C 1RVFL 2YD3A 1NBQA 4P5TC 2XA3A 5MI0C 1VEMA 5J4MA 1XIWC 5ERWB 1FBIH 1S9XA 4EDWL 4KROB 1ONQB 3BUTA 4JG0L 4HUWA 5GGUA 3SHSA 3U0PB 4X0KA 2H41A 1FNGA 4XCFH 1SY6L 1KJ2A 3MBEB 4FP8L 2CXGA 4M5ZL 1UVQA 2GSGB 4QHUA 4JRYB 4HUKB 4YQXL 4D9QE 3BFOA 4RFEB 5TDOA 2ITDA 1YEHL 2VXTL 4OCSH 3SO3C 5HI3C 5HVWA 3MV7A 3QCUH 4U2YA 4U1JB 3LB6C 1FZMA 1CDHA 4GBXD 3SCMA 1KJVB 4R7NB 3VRLF 5A2FA 2C26A 3FB6B 1FO0A 4OD2A 3HCVA 1C1EH 4BZ2H 1N7ML 3I50H 3NAAL 2P43B 4MJ2A 3BP6B 4MZ3A 4PJ7E 5BVPL 5FHAL 1OP3H 5J3HC 5GQBA 1ZVSB 3AM8A 1MVUB 4LLWB 3OKKA 1ETZB 1IC1A 4G6FD 4K2UH 3I02A 4ELME 1GOFA 1QNZL 2P7TA 3ESVF 3TF7A 2BSSA 5AD0A 4JM4L 5I1CH 4PJIA 1G7IB 2XQYK 3RU8L 3IKCB 3GSRA 1F90H 2F54D 3ABZA 2J5LB 1Z9MA 2XWJA 5CZXD 1A7PL 5IW1B 2NCMA 5DYOB 6CGTA 3MLTA 3QQ3B 1T1WA 4JN1H 3QEQD 4XBEL 1S9WB 4FN0A 5H2BB 5I8EA 5JOEA 1MCOH 4KH2A 1KOAA 5D1XA 3WDHA 1JTOA 4PJAA 4WW2A 1N2RB 3T0ED 4C57C 5FHBL 4YO0B 2J6EA 2FECL 2ICWI 4XPFL 2AXFB 3QH3B 4PJCB 4KC3B 4WWKB 1AO7D 2FEEL 2R2BA 4I5BB 1BM3L 5KSBB 4KHXH 5B39G 1QPXA 2CK0H 1KN4L 4APQD 1G7QB 3ZDXE 3B4NA 4I0PC 2AEQH 3KYOA 4UOJA 2DN7A 4PJHF 3C5SA 5EFIA 3RDTA 2V6HA 1HHIA 3T2NH 5ADPL 1RZFL 1KCRH 3VFTB 3IRZA 2GT9A 3DVGA 5HYEA 3D87B 1KSRA 2VDRH 3EDEA 1PG7X 1A6UL 1ZLWK 2DWDA 4HH9A 4CMMB 1UCTA 1YDPB 3O11B 1CBVH 3V2AR 3MTRA 2FBJL 1U8OB 2PXYA 3ULVC 2BY3A 5DJ2B 4H5SA 3PWPE 2R0LL 5IV2B 3MLWH 4CADA 4MLIA 3HI1A 1P4BH 4TNVF 3RRQA 1A2YB 1CFVH 4WEBH 4U7SA 4KMTH 4R4NC 2O93L 3B9DA 1NEZA 3RQ3A 1TZHA 3U7WL 1UZ6E 3B9KC 2VLMD 2C9AA 5GS1A 1FDLH 1QLEL 2E6JA 1WZ1H 2XKNA 3QDME 5C0GA 4LP4A 5CJ8A 3HC3H 4D8PB 3QISA 3O9WB 1GAFH 1TVBA 4WCYH 4ELMF 2VABA 1U8LB 1UKTA 3MCG1 4O02L 5J7CC 4CUCA 5SV4A 2B4CL 2WMPA 2D7TH 4HUXB 4M93C 3TEUA 5JIHA 1K9TA 1YNLH 2IEPA 4JG1H 3UTPE 3X3GL 2OK0H 5D2NB 4KHTH 1MIMH 4N0UE 4XAWL 4S0TD 3QXAA 5DHXB 4X7TA 1H9VA 4YHNB 5EUOF 3QFJB 4JANA 2K9UA 4AYFA 3FFCE 2QJDA 4UTAL 5GHWH 4R90H 3LKOB 3LV3B 5FYKH 3WD5L 1MCNA 3MYJA 1RFDL 1MCKA 1JRHL 1NJ9B 2AEIT 1SYVB 1KJ2H 1MRCH 4WW1B 3OR7B 3BWAB 4WEUD 4UINL 5HI4C 3WLWD 3N0PB 4N68A 1KGCE 1DVFB 4KXZI 1RIVH 2V5SA 3OGCB 1A14H 3O4LD 3UYRH 5K93A 1LE9A 2EDOA 1D5ZB 4HT1H 1GZPB 2OSLB 5EBMB 5CMAA 2NY0D 5ACMA 3OKNA 3PG2A 3O4OC 5L8JB 2VLJB 5CEZL 2P24A 4G8GA 2Q8AH 5E4IA 4MA8H 5C0BB 1ZEAL 2WK2A 4I1NB 4YC2B 5L9DH 4E0RA 3QJHB 4OZFB 4PRBA 1RV6X 3QXUA 5IM7A 3CCHB 5JNYB 2IADB 5FYKL 3WD5H 1ZT4B 1E4XI 2DLTA 3PP3K 4IM8A 1JN6B 3DUUB 3QWRD 5E00B 1UEYA 3NACL 1H3PH 5TF0A 3DVGB 4Y5YB 4ZUTB 5CJQH 4PLJC 1XIWA 3PGFL 4LAQH 4G6KL 3CFEA 3RHWK 4Y4FA 4HKZA 1WT5C 4QWWD 1AC0A 4ZS7L 4U7KA 2BVYA 1HCVA 3SJVA 4MDJB 4X6EB 3MRIB 3QDGE 4XWOD 2A1WL 1A6VH 4OIAA 2ADGB 3TIEA 1HQ4B 2IBZY 2OL3H 1JFQH 1S9WA 5H2BA 4PJEA 1AXSB 3A6BH 5KSAA 3G5XB 4PJDB 1C5CL 2GQHA 3GMOB 5JQ6L 2YSSA 1WCBA 3HC3L 5IWLA 4HWBA 1E27A 3Q6GL 1VADA 4HGWB 3TJEL 2EDKA 2G75B 2ADFH 3PIQB 4KPHH 3UJTH 4CVZB 5L0QC 5JHLH 4YBHA 3QUML 4LQFH 3SN6N 5IB4B 4WEBL 4WFFE 5DO2D 3GSWA 4ZUWA 4RA3A 4PRHB 4OLWL 3Q48A 4YIQB 1FFNA 1AD9B 1KB5H 1NC4B 4OLVH 4UUJB 1F4WH 5C2BH 3GSVB 1BJMA 2GIYA 4Q9CA 2EE3A 3BPCB 3QQ9C 1G7HB 3HTLX 2JB6A 4LDOB 5EN2A 4XCCL 5D71L 3KPOB 2VDNH 2BVUA 4GS7B 3MRQA 1B0GA 1LO4H 1YMMB 4J3TA 1ZHLA 4C56A 5I1HH 4TOYH 5MEOA 4JFEB 3TPUE 3MRLB 1HDMB 3IDNA 1X4XA 2VWEC 3RZWA 4H8WL 4CNIB 4D9RD 4KI5E 5F1OB 1M6OB 5TQ2H 2XRAL 3GMOA 2V2XA 5T1KB 2B7DT 5IW6B 4HS8L 3BKCL 5LCVH 2EDJA 3MRJB 1RZFH 2EDTA 1BVLA 2CKBL 4RGOH 5DURD 1JPGA 2A6JB 5JOFA 5MEQB 1WK0A 1Z9LA 3DVFA 3W0WE 3DO7B 3RWJA 4MAUL 2PYED 3P73B 4QCIB 2DQDL 2HTLC 1LVEA 3D69A 4TUJB 3D0VA 2AV7A 2VZUA 3IAQA 4MQSB 1XR8B 3GFUA 2FJFB 4EI5D 1CGWA 1QHOA 3S7GA 2ILLA 5GGTL 4ODXA 1PFCA 4F80A 5L6YL 3UJJL 4GKSB 5BO1L 3VFSA 2Y4SA 4ZSOB 3JSSA 1E0OB 3LEYH 4V1DB 1IVLA 4U1SA 3ZDZF 2CO6B 5DQJB 1INQA 4RA0C 3B2UD 5T1DH 4QRRA 5I1IH 2JIXD 5JR1L 5AYUH 1ZV5A 3P77B 5C0CD 1MRFH 1VFMA 5DK2B 5J1AA 5FO9A 4EXKA 1WC7B 2ICWB 3S98A 3BZ4B 3OTTA 4K3JL 4N0YL 1F42A 4P57B 3VWKB 1I9RL 2O26U 2ATKB 4GG6A 4OLEA 1LP9E 2W07A 1MAML 1TQBC 1RQ5A 1OWWA 1XR8A 4OGAC 4G9FB 1AQDB 1N7MH 3I50L 1SJXA 3P9MB 1RK0A 4FG6D 3C6LB 3I6KA 4OZFG 3RIAK 1U0QA 1WTLA 1PJ9A 4KWUA 2HH0L 4U1HA 3QI9C 4R7DA 5D7KD 5C0FA 5KSUB 3RNKA 4TPRH 2NX5A 3NCJH 1YYML 3BP4B 3QPQD 5E70A 2A73A 4ELKA 3RWCB 1U6AH 1YEJL 3HE7A 4YQXH 1MY7A 1N2RA 1NDGB 3NIDE 1MH5A 1BZ7A 4DN3L 2CRIA 1YEEH 2Z8WC 5DD5L 3HAEA 2DQFB 2YUXA 1N4XH 3N1QC 4LHUB 1IQDB 3FB8B 3IDGB 2H6PB 4P23B 3EYVB 5B39A 4WI2A 3GIZL 4YHIB 5MEOB 1EJOL 1CDUA 5FA4B 1M71A 2HFEA 1X4ZA 2AJVL 4M1DL 5HI5D 3VXOB 4PRPD 3D9AH 4JFFD 4FMFA 5DHYA 3HG1E 2AJZA 2DQEL 4OCYL 1N59A 3MUGB 4NN6B 3KPQB 3DROB 1IBGH 4KAQH 4XB8A 3SOBL 1C5BH 1JL8A 2XOTA 4PJFB 35C8L 1VENA 4EDXB 3ARGB 3DECA 5IB3B 3WS6C 5EO1A 3B9KA 5AUMB 1EXUA 3U4BL 1U3JA 4QY8B 3GMRA 3BP5B 4M03A 1J10A 4W6XB 4K94H 1OP5K 2BXZA 4OZIA 2E8ZA 3PV6A 1IGYA 4LLQB 3L6FA 4NZTL 3QIUC 3V79C 4ZQKA 2B1HL 4X9HA 4ZTPH 4GKSA 4MA3A 3TA3D 2KQMA 4X6EA 3QG6A 1K2DB 2YHGA 4WHYH 3SKNA 1IKFL 5LG1A 4J8RA 5E5MB 3JWDH 4JFDD 1NSNL 3QSKB 5ESQB 2N7AA 5EBGA 2WINA 4EI5A 1CGUA 4PJIE 2X89A 1C5DA 1B2WL 1XGYH 3GSNA 3VXMB 2Z8RA 3TCXA 3QDJD 3F12A 1P1ZB 4OGXH 2HWZL 2VISA 5IM7B 5F7UA 4L8SB 5IMOA 3V4UL 3IJHB 3BP5A 1WAAF 4WI3A 3BIKA 3DURB 5KVEH 3O2VH 5DK0B 5ID1B 4QWWC 3SKUD 5HHQA 4JPWH 3HFML 1EHLL 5C1MB 4D8PA 4ZFGL 3BX7C 3QG7L 4KZDL 3DX9A 1J0YA 4FXKA 3RWGB 3AC0A 4YHML 1IARB 1T80A 1QFHA 3CDGB 3ARFB 4JKLA 3LN5A 5CEYA 5BV7C 3GI9L 2VUOA 4WW1A 5T5FH 3O2VL 3QUYA 1HQ4A 3VGAB 3S34H 5EU3B 1LP9A 3KYKL 1OAYL 2HT2C 2LV4A 1OTUD 3ULVF 1JYVA 3LQZB 3BGFB 4NRYB 1ZLUK 4MDIB 1BZ9A 3BKJH 3U4AA 5ADOH 1DBJL 3LB6D 1XGYL 3MUY1 4NKOB 4M5YH 1AC6A 2XA8L 5E56A 1T5WB 3P4OA 4F15B 1MHCA 1S8DA 3D3VB 2PR4H 1HIMH 1CT8B 2HRPL 2EDXA 4LCWB 3WBDA 4KZEH 3S37X 1RIUH 1LO2L 1T2QH 5GS1C 5F72S 3OKLA 4UIMB 2NY3B 2YPVL 2JJTA 3MRHB 5KS9A 1A47A 2X4UB 4QGYA 1EUTA 5BJTA 3OKEA 2R69L 5CMAB 2Z35B 2QHLA 4DVRL 3SJVB 4ZNCD 1F3DJ 2CPCA 3B3IA 2I27N 1FL5B 2CKNA 2OR8A 3UDWC 4NWUL 2A9NL 1MJ7H 2DBLH 2DRUA 4PJCA 4L9DA 3IETA 4AM0B 1OSPH 5E00A 4L8BA 1HH6B 3HR5B 3MYJB 1R5IA 1LQSR 3HI1B 2X70A 2GJ6D 1KIQA 1RIHH 1QSEA 2IPUG 4AIZB 4K3EH 5EPMB 5SWSA 4POUB 2CLZB 4JZNA 2CH8A 1NAML 2OZ4H 4FFYH 2E7LC 5DK0A 4FNLH 3H9YA 3OBAA 3MRCB 1B4JH 4O5LL 1ZHKB 5DJAB 4Z5RA 3BGAA 1RZJL 1U92B 5DJZA 4JKMA 1EHNA 4XB7A 4XH2B 1QP1A 4Q0XL 3EGSB 1T22A 4MXWL 4DN3H 4U1HB 4WW2C 3HPLA 3S37H 4IRZL 3KXFE 1MFBH 5D7IE 3GHBH 5D7SL 3O8XB 3CDYA 5CD3B 4KJPC 4YBLB 3N1FC 4AENA 2J8HA 2Y36L 4YWGL 5IVXA 1HOCB 1SEBA 4NRYA 5A1AA 4NM4L 4U6VH 3AS2A 2XZZA 4YWGH 5BCAA 4FQPA 5JXAL 3WJJA 4X8JB 1CFSA 4TUKH 4PD4K 1EO5A 3NPSB 3RY5A 3LD8C 2BNRD 4LNRA 2HVKA 3HB3C 4JPVL 5I30L 2NY2B 2MHAB 3CX2A 4RFNB 2W0FA 1RUAL 3C5JA 1RHFA 3MRCA 3UPRB 1B4JL 1MIEL 3MV8E 5FM5M 3WFHA 4PJ7F 4HFWB 3ARDB 1TVBB 3MSPA 2VLRD 2BNQD 4IOIA 1PQZA 3RWDB 3VXNB 2ED7A 3SQOL 2C1PA 1AQKH 4LU5H 1K8DB 1U58B 5F9OL 3EBAA 4OLZL 1N64H 5MEND 2ZUTA 2DD8L 1ONQA 1X6NA 3AREA 2VR5A 4KK9D 5I1AA 1UWGL 3F6IA 2AJUL 5DWUH 3UJJH 3WIHA 5TPWL 3ILPA 2P8MB 4P2QD 5J1AB 1NGYB 4Q9BA 4P23A 1S5IL 1MLBA 1QEWA 4JFFA 1YEKL 5IJKC 4YUEH 4JR9L 4RZCB 5LQBL 3WHE0 4PP1C 4PTTA 5E4EB 2DQHL 2FD6L 2QSCH 3V5HA 3TCLB 1A4KA 3HRZB 3HUJF 3KS0H 4XNUH 4JO1H 2DQIH 5SWZD 5JDSB 1UFUA 3LKRB 1XGQA 1INDL 4NT6A 4ODTH 4NGHH 1CYGA 1XH3B 3PV7A 1HINL 5FGBA 3OKDA 2PR4L 3I3BA 1UJ3A 3RWHB 1EFXB 4NQXB 1LEGB 4YEFA 1HHJA 3JZ7A 2CRYA 3WN5C 2OLDA 2XRAH 4GAYA 4KRLB 4M5YL 4P46D 2YC1B 3THMH 3GSQB 3L3HB 1NFIA 4X80L 5KOVC 3EOAB 5B22A 5LBSL 4DKEL 4QYOA 4EUPG 3V6FB 1MJUL 4M9PA 2AXJA 4WFFD 5IJKA 2VDNL 2X40A 4XCCH 5D71H 4B7IA 1X5AA 4CN1A 2EECA 5E94B 1X5FA 3W5NA 1GIGL 5EBLB 3ZDZE 3C08H 1INQB 2E3VA 3C5JB 3S3JA 4CNIA 3FCTA 4QRRB 4I3SL 1AXTH 1NCWH 1FYTB 2I9LB 4JPWL 1IQWL 1A5FL 1NC4D 3QEUA 1QKZL 1C5CH 2R1YA 2BJML 5IMOB 4PREA 2X2YA 1G6RA 2XWBB 3Q3GA 1DN0A 1UZ8B 1DFBL 1MHHA 1LO5B 2X44D 4WI9A 5DHVB 4PRHA 1DLHB 2F5BH 3MLZL 4I2XA 2OL3B 3CXHK 3SKJL 5DQ9A 3G6AB 5IMKB 4UT7L 2CO7B 4OBSA 2L4OA 5JXEA 3GSUB 4Z7VB 1J1PH 3JWDL 3NTCH 1X5XA 1P9MC 3MYZA 3WFBH 3Q1SL 3L3IB 1DJSA 4U1JA 2WBWB 1EBPA 1CDYA 5FYKU 1P69B 5EUOB 4RMRA 5CJOL 4NZTH 1S7UA 2XZQL 4XXDA 3WYRA 5DVKA 4P9HH 3I75B 5BRZD 5T1KA 4JY6A 3K8LA 1G0YR 1ZEAH 5FOBA 1CD1A 5L9DL 1SQ2N 1WEJL 3V4VH 2QLVB 3KXFB 5IHZA 5J0BA 4BZYA 4AENB 1XF4B 1PZ5A 1LP9F 1HNGA 1G0XA 1R5IB 5B8CB 1K4CA 3VW3L 2E7CA 2D2OA 4HT1L 1WV7T 4U1MB 4JRXB 1AH1A 1NAKH 3UYRL 1A14L 2BVOA 1A1MB 5JW5B 3KPMA 3PHSA 2FWOB 1GC1L 4YHZH 1ES0A 3E6HA 5IF0B 4J3WA 3D9AL 2J88H 4XVTH 4WNQA 3DYOA 1RFDH 3UJIH 4Y16A 5CCKL 5HGAB 4KKAD 4YGVB 3KLHD 3TA3B 3KHOA 3LZFL 3D5OF 4L4TD 1E6JH 1UADC 1JTTA 3AS3A 1R0AH 4D0CA 5MERA 4Q9RL 4H88L 4RNRA 1K4DB 3I6LD 3U46B 2XG5A 3FOLA 4EZMA 4R26H 3C6LC 3QFDA 1XF1A 3FN9A 3JV6B 4PJEB 3V7AG 4YHKL 5DT1L 2BCKB 3C6SB 4JKKA 1G7MA 1T5XA 2V2XB 4S1SL 3BISA 4JFZL 1HILA 1KJMB 1PVHA 4TSAH 4Q6YA 4LVHB 3BAEH 4EOWH 3NCJL 4XMPL 3DUSA 1YQVH 2X41A 4TPRL 4XPGL 4YDIL 4NKIH 4DZ8A 5IB5A 3MUJA 1KNOB 1YPZE 3EDFA 2XQBH 3GGWA 4QT5B 1R3JB 1J0HA 4HZLA 3DGCR 5DZOA 4A6YH 1DLHA 2PXYC 1P7HL 3MV8B 3HI6H 3HLAA 3LS4L 1ZHKA 3WHXB 5J56B 2ZUXA 3G5ZA 3BPLB 4NCDA 3TWCH 3D0LB 3QWQB 4TUOB 1CFVL 5JHDB 2ZJSH 1X5LA 3TCLA 1U8KB 3DYPA 5CKGA 5KSAD 3FT3B 4WGWB 4KJPD 3V4PH 32C2A 3RJDA 2W9EH 1V3MA 5CS7A 3OKNB 4OM1L 4ELMA 2R0LH 4JFXA 3P4OB 3BHBB 1OF2B 3X3FL 5DK2A 3EO0A 1KCVL 4KTEL 3RGVD 4NNPH 4P4RB 2WV3A 3FQTA 4JQXC 4X99A 2NX5D 5KZCD 4OQTA 3JV5A 5HGBA 1BLNB 4CRPA 3GRWA 5CZVL 1JNNL 4HMCA 2VDRL 1JHTA 1DVFC 3DNKA 5HYSB 1IAIM 1A7RL 2BNQA 3PWUA 2ZKHH 3L95A 4O2EA 4U2ZA 3D18A 4EN3B 1BFOB 2W9DH 3E2HC 2VQUA 3SE9L 3WFCH 1FO0L 1U95A 2UYLA 1QRKA 3IF1B 5I9QB 2DQDH 1MFCL 5CGYC 4KHXL 1BM3H 4HEPG 1EEUA 1SBSH 2A73B 2C3XA 1KXTB 3KPSB 4R4ND 5FHBH 5I1KL 2NR6D 1X7QA 1ZWIA 3UBXB 3FT2A 1ZMYA 4R7DB 4WO4B 1NUFA 3RIFF 2FCBA 2EE6A 2IANB 3MRRB 1VEOA 1PY4A 5F96H 4QOKD 3T8XB 1ZA3A 1A0QL 1CQKA 3X13A 3GMPA 1NGYA 2WWKO 2BSSB 5AD0B 3BEVB 4GXUM 5F7LB 3T0EB 2X9YA 3O9WC 4JFPB 4XHQA 3S8WA 1Q72H 3QR2A 1QO3A 4WIQA 4MA3B 4U6XA 4F7CB 3BH9B 4NO5A 3I6GB 3FO1A 4Y5XC 1YA5A 3EYSL 1CGSL 3ARFA 2VXUH 1A3LH 5CBEB 4HS6B 4DW2L 1XGRA 5GRVK 5C86A 1DBML 1WBZA 3GMMB 2EH7L 4IIQA 1XGTA 3P77A 1P4IL 5DD3L 5DGQA 1IAII 5DD0H 4Z95L 5BVPH 1UB5B 3NAAH 3GMLA 5EU6A 1KTDA 3W0WD 4I0PD 2CLZA 1I1AD 4JZNB 2GJ6E 2A74A 2Z4QB 1H0DB 4D9QD 3BIKB 3CU1A 3CPLB 4L3EA 5D5MF 3ARBC 5JQ6H 4JQXA 2MHAA 4JLRB 4W81A 2C1OB 5IMKA 1KXVC 3NABL 5E99L 4KVNL 1QO3B 2F8OA 2JF1A 1FV1B 2PYFA 2PW1A 1YY9C 5ESVB 1L6XA 4WI6A 4JO2L 1FVCB 4UAOC 2R39A 5EA0L 5D70L 3OKOA 3RAJH 1NLDL 5KZCB 1SY6H 3NCCB 4XCFL 4PRID 2FGWL 5AZ2H 3V5HB 1KLFA 4XXCC 5CJQL 1TETH 4ODHL 4RNRB 3FQTB 4X99B 4D3CL 4V1DE 5EZIH 5D4QA 4LLDA 5D5ME 1RI8A 1U91B 1CFNB 5FCUL 2C7UA 3T4AA 3OXSB 4LCUB 4N8PA 4HBCH 1NEUA 3B2UC 3TZVD 2DDQH 5IB3A 2EYSB 5AUMA 2HJLB 1WISA 5CEZH 2CLRB 3NN8A 1G7IA 4AZ8A 1RUPL 3V5KA 5C0DA 1FNSH 1ES0B 1EEZA 4ENEC 5K9OB 3HRPA 4MVBA 4RQQA 5DRXA 1RIVL 3IVKA 1PKQB 1FE8H 1D6VH 3UTQB 2Z93B 1LILA 3OWEA 4I77H 4U3XA 4WFHE 2FX7L 1IAIL 4GSDH 4LSQH 1DUYB 4ZNEA 3WSQL 1JRHH 3B43A 3VGBA 4NQXA 4WUUD 4OFPA 4TTDD 1AGDA 2Q7YA 2VL5B 4J8RB 5E5MA 2IFFH 2IC2A 1D5BB 1CG9A 4QOKE 1UWEH 5IFJB 4GQ9L 1YEGL 4JFXB 3X12A 1RUKH 3SGDI 2BCKA 2GFBA 4U1IA 3QO1A 5DMKB 3LPFA 4MCZB 3SDXA 5EOCJ 4KHTL 4JDVB 2D7PA 3RL2B 4OSUH 1CFSB 1YNLL 2J2ZA 3TPUA 2APFA 3MXVH 2B4CH 3MRIA 1P7QD 2GT9B 3WKML 2EDDA 1XFPA 3JWDC 2EEAA 4HPOL 1V7NL 3GMQB 3RKDC 3PWPB 1UXSA 3DX8B 5FO7B 4MB4A 3ULUD 2DIAA 1U36A 3OB8A 5E2VH 3FN0H 1MJJB 4XCEB 2QQKH 1UJ3B 2ORBL 3RGHA 5GGUB 4KJYA 4XH2A 1TENA 5IFAL 1OAXH 4J3OC 1BVKA 4JREB 4HH8A 4Z8FH 3EO9L 4HQQH 5DMGD 2N4IA 5JW4M 4KMTL 3VFGH 3QFDB 2VLKA 3QCVH 4NWTL 5EU5B 1I8LC 2IBZX 5HHMA 3E8UH 3H3PH 2DAVA 3WXVH 2P5WB 3SQBA 2DJ4A 3K1KC 1HXYA 1ERNA 1TNMA 1I7TA 1R3HB 2H26A 4D9LL 3UTPD 1XGPA 1LDPH 3DX7A 3NCMA 3KJ4B 4PJHB 3MRNA 3PHOB 1ZVYA 2HLAA 2Q20A 2EDYA 1KN2H 1B3JA 4NQSB 5L2KB 2Y06H 4F7EB 3ZYIA 5DS8B