3MRNA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns4b-1807-1816 decapeptide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with HCV NS4b-1807-1816 decapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrnA01
2OLDA 1TJIL 4W4NA 2F53D 1WITA 5DO2C 4DEPB 1UWGH 2XIDA 1RZGB 3PWVB 4P3DB 5F1KC 3CLFH 2DOCA 4JQIL 4ODUA 3V5HB 3KPLA 3QULA 2JCCE 3SE9L 4EUPB 4RGMB 5FKPA 2ZZUT 1BVLB 1FFNA 1X5FA 1NCWL 3V0VB 5F7YC 3BO8A 3FRPG 4XH2B 2A83A 1ZLVH 3HZKA 3JUZA 3QO1A 3JVGC 3VFTA 1TZHA 4NRXB 5HPMB 2UWEF 1XAUA 1CE6B 2OMNA 2ZSVB 1JHLL 5ICXA 1NC4A 5JMOC 2WBKA 5JW3L 4P2QB 1QSFE 3HNVL 3O8XA 5C0AE 4ELMB 5ESVA 1EDQA 1H9VA 1JUFA 3TV3L 5L9DH 2X9XA 2B1HL 3RHWF 3QRFM 4WFFE 4QEGA 4JZJA 5F7NC 4OGAC 4O51A 2B4CH 2WNGA 3KLDA 5ERWB 4FQHB 1K8DB 2CUMA 2HTKC 1FE8H 2YUWA 1JGDB 2AEQH 5D1ZB 3O3DA 4KAQH 3REWB 1PKQA 4N5EC 3L3GA 5JZ7D 1DE4A 2ORBL 4CKVX 1JMXA 2EYSA 2DYPB 2HG5A 3E6FA 4LSQL 2KPNA 3BGFC 5HHVL 2I9LB 3WHE0 3JBG7 3HR6A 3QXAB 1T5XA 4ISVB 4H26A 2ZOLB 5DHXB 4LSRL 5IHLB 5C0GA 2GITB 2GJ6A 2F19H 1BWMA 1B88A 1NBVH 2ZWLT 3ALPA 1ZT7B 1A3QA 4KHXH 4MQ7B 5EIIB 1OAQL 4PGEA 3ZKXB 5HHOA 4WFHE 4WENB 1XGTB 1CBVH 3WFCH 4PGJA 4I0PB 1U8KB 2YA1A 4B7LA 4ZOAA 4NT6A 1M71B 4GBXC 4G7YL 4HBCH 3CFBA 3T3MF 2C9AA 2D31A 1FLTX 1QZ1A 3SDDD 4NO2A 3JWDC 3DO7A 4DUVA 3P30H 5DFTA 3SE9H 1QFUH 3GJEA 5DC0A 5D2LA 1A4KB 3MXVH 4P5MA 2FGZA 1MFBL 5HDOA 1S7RA 2BOCA 2I25N 3ZT6A 4NQTA 3BUTA 4OGZA 1F90H 4PR5A 1R24A 1YMHA 4U1SB 1HK6A 1C5CL 1LK2B 4M02A 4BKLB 3RL2B 2A77L 5LCVL 4N0CA 2RHEA 4PJAB 3UDWC 2V2TA 4HKZB 3U0PA 4LSTH 1GC1L 5FYJL 3I2CL 1CD9B 2QHLA 4N0CC 4IDLA 3C2AL 2P7TA 1JPFA 4XRCB 1D5MB 2BNQE 5C0AA 4P2OA 4FFEX 1D6VH 2ZJSH 4S0TD 1NGZA 5C07D 1O0VA 1N26A 1Q8MA 1T1ZB 3KPPA 1N0LA 1DFBH 2XKSA 1NPUA 1IBGL 4DKDC 1F11A 5EOTA 3MRJA 2UY7A 1GGYA 3VRLE 1WBZA 3BPOC 1U58B 4BQ9A 5C0BB 4G8FB 3QQ3B 1U93A 4OCMC 2ICEB 3BZ4B 4FA8A 3GMLA 1CFVL 5DK2B 4PGDA 2FWOB 3SPVA 3GBNL 5F9WC 1BVZA 3EGSB 1OW0C 1KIRA 5EOCH 3EOAA 1FRGH 1YYMH 3CNKA 3AVEA 4LHUD 1F00I 3Q3GB 4X6DE 4V1DB 5CIPB 4UQ2A 4K7PL 4I2XE 3JWDH 3ZYJA 1WWCA 3LRHA 1HHIA 1AKJD 4NSKB 4AEHL 1YYML 1RU9H 4WUKH 3MOBL 5JO5B 5KVDL 2W0LA 1GZQB 3KWWA 1PX4A 1HEZA 4L1HA 1L7IL 2ADJA 2ADFL 2AV1A 4LCWE 3X3GL 4TVPL 5L88L 1OARL 2VZSA 4PB0L 5TDPA 3D2UA 4X6BA 1WGOA 1BBDL 2FX7L 3CU1A 5E5RB 2HRLA 5DK3A 3DXAD 3JTCA 2VLRA 3PWLB 4POZC 4U6YA 2X4RA 4AEEA 3KPSE 3VFWB 5EBMB 5GRWA 1H15B 3ZTNL 5JMRA 1RZFL 4O02L 5IW1A 3QDJA 4J3WA 3EO9L 1EFXD 3GSVA 1KXVC 4LDOB 1DZBA 1TZIA 1NMAL 4G6FB 3JWOH 4ZXBC 3MV7A 3SE4C 5EO0A 5GJTH 1PKOA 4APQC 1QO3B 1AO7B 1YNKL 4B50A 1LILA 3BXNB 1DUZB 1JZ7A 4H25A 4HLJA 5ANME 1N4XL 3GSRA 3V4UL 2P5WE 2DQUH 4XPGH 4PLJC 4IOFC 3VU2A 4TPRL 4XNUH 3CXDH 3B43A 3NA9H 4KK8D 3DTXA 5HHXL 4NJ9H 4JY4B 4JFHE 1U58A 5H94B 3PABA 4JAMA 4KKCD 1B0WA 3SKNB 2ZSWA 1F11B 1E27A 4RX4D 1ZVHA 3KXFB 1YYLH 4QYOB 2PYEB 4RFEA 4MDJA 1W0VA 2APTA 1W8OA 3E8UL 4NP4H 4OLXH 4JFEE 3ZYOA 3QUZB 4P5TD 3OKEA 1WC7A 4JN2B 3U7AA 2ENYA 4EDXA 4B7IA 2WP3O 5EUOA 1RJCA 4CW1B 4JQVC 4QRTA 5LGKA 2F8XC 2I26N 5F7DB 2X2YA 2MJWA 4QYOA 1S5HA 1JN6A 3RL2A 5C0CE 4F7EA 4HWBH 4GSDH 1Q94A 2FJFB 3H9HB 2R0LH 2Z92A 5A3IC 1A0QL 3E3QA 4KFZC 4ZS7H 5I66B 2CLZB 4JKMA 4LSQH 5CBEB 4P4KA 2AJUH 5DRWA 2GJZA 4WI3A 4F15C 5E6ID 1J12A 2HKHH 1M6OA 4X4MA 3DO7B 3IFLL 1A3LL 1Q72H 4M7LT 4FTVE 2FATH 3KLAA 4BFIB 2PF6A 4XC1H 5FM8A 1EEYB 3ES6B 2NY3D 2D31B 5I1JL 5EO0B 5DD5H 3CFBB 3TFKA 4M6OH 4NFDA 1YECH 5FA4B 1JFQH 1Z3GL 4CJ0A 1I1AC 5MERA 1NH6A 4Q58C 1EFQA 2F9BT 5BS0A 4HS6B 4TTGA 2Z8WC 1PSKH 4TSBL 3P0YL 3REVA 5F9OL 3MBED 2DQIH 2H1PL 1I1AA 2HWZL 4GKNA 1KTDA 3UO1H 4G5ZL 4Z95H 2X44D 3DUSB 4PJCE 3NAAH 4ISVA 1VESA 2YRZA 1CIUA 1RHHB 5GRUH 5C0CD 4HPYH 3I6KA 1FVCB 2KQMA 4K71C 4NKOB 3UZQA 2XACC 3H3BC 3B2UC 4AEIL 5CAYB 3H0TB 3U2SA 1G6VK 1HHHB 3MCKB 1RJLA 3BZEA 2PYFB 2B2XL 3L3IA 4X80H 2H6PB 2ERJC 3P4MA 5KANG 5LXGH 4HMDA 2VZOA 1WAAF 1IQWL 5D9SA 2NXZC 2ZOKA 3RIFF 1OGTB 3I2CH 5DYOB 4MXWL 4B0MM 1JNHB 1NCTA 2E7BA 4OZHF 1WIPA 2IANA 2Y72A 3OR7A 4OF7A 3O3BB 1ZLWK 3F7QA 5C0RH 4GG8B 3O41A 3KJ6H 4X6CA 4HHAA 1FNFA 1PZ5A 4D2NA 1FG2A 4BA8A 4K94C 1BOGB 2V2WA 4BQ6A 1NGZB 5D1ZD 4MA1B 5EB9A 3QISA 1E4XH 2APBA 5B3NA 2HT2C 2LABA 4XXDA 4MNQE 1N3NA 4GS7C 1BZ7B 1J1OH 1GPOH 4IRJB 3TYFA 4ALAH 3WNNA 1FYHB 1A21A 3D85B 2R4SH 4Q9QL 1WWWX 2UZYB 1ZSDB 2DQGH 5B39A 1J1PH 2CJUL 4PREB 1ED3A 2GCYB 4L3EA 4JFFD 3MGTA 4JFYB 4DGIH 2X4TA 2B1HH 3PG2A 43C9A 1PG7W 2IGFL 4XVUC 1S7UA 3HNSH 3MJ6A 4U1GB 2JJUA 4ODWA 4FQJL 4PJAF 3BE1H 4PRNA 1RUKL 3FONA 5JPMA 2A1WL 1VENA 1BBJB 2DQFA 3W11C 4P0DA 3MRQA 5EUKA 3MJGX 2EXWC 1CICB 2JIXB 4R26H 2B5IB 2FECL 4CAGA 3BP4A 3IJSA 3LPWA 2A1WH 1LE9A 5D1QD 3RGVC 3MJ7A 1HILB 1Q9WB 4LK4A 3MJ8B 1FJ1B 1QFOA 3MXVL 3VXUB 1KJMA 1Q38A 2VB5A 2GK2A 3D18B 5HVHB 1HWGB 3BMWA 2NY6D 5KSUB 2AQ3A 3L7FB 2GAZB 3Q48A 3PWNA 4G42A 4L4VB 1P84K 1SJXA 1X7QA 1E0OB 5HHOB 2JB6A 4MQ7A 5EUOE 4RMUA 5FCUL 1EBPA 2BC4B 5TE6H 5I1LB 3MLVL 3THMH 1FFPA 5D7KD 1LHZA 3PUCA 5DR5L 4OQTH 4JM2B 4ZS6D 4ZAKD 4H26B 4QRPA 1T22B 3ARGD 5ELIA 4J3UA 4XGZB 4H5SA 4J3OC 1A6TB 3LQAL 4OD2A 4I48B 1L8JA 4HEME 4WFEE 5CMAB 1RZKC 3E2HC 3STZA 4W68A 3JV4A 4JRXE 1TNNA 4P57A 1CXFA 2XOTA 3KDMA 5D1XD 3OF6D 3OKLA 1XGUB 4LLDA 1S9VA 4NQEE 4RWYH 1NCUA 5FCSH 4HH9B 5E99H 3VXRA 3RKDC 4OZ4A 1MJJB 1FVEA 3RU8H 4ETQA 5DJ2A 4JPIB 5TGBA 1NDGA 1T22A 1W72L 3DGGA 4FQ2H 5B3JE 2UWEA 4U1MB 3O3AB 3BYYA 2WUBL 4NHUA 3SCMC 2YXMA 2GQHA 1I1FB 5GGQH 3RWDB 3GSQB 5DEFA 2W9EH 3EDEA 4RGNE 2EDFA 3B8YA 5FKPB 1F58H 1C5DB 1DQJB 4U05A 1MCDA 3V5HA 5I73B 1VSCA 2JJTC 2YN3A 1PY9A 3VXSB 1O7VA 5KOVC 1UZ8A 2YPKA 1YEKH 4MB3A 4GXUN 2HJFA 4LSPH 4GW4A 1ZHBA 1WBXB 3PWUB 2C3VB 2EDQA 1HILA 1Q9WA 5D70L 4H1LG 4V3EB 4ZXBD 3IJSB 4QNPE 4L4TD 5IJKC 4RA3A 4JRXD 1QFWI 3O2DA 4NDMA 5DVOA 1XMWA 4PJEB 4DVBB 3PQYB 5J11B 2P5EE 2EIZB 1XR9A 4XMLH 4OZIE 3L3HA 3ECBB 5L2KB 1JZ5A 3FQUA 2YC1A 4HWNA 3LB6D 3VXMD 1AGBA 1UM6H 4QTHA 5IMMA 3WNPA 5DXWA 4R3SA 4NPYB 4HKJB 3QWOA 3S97C 5SWZA 1M05A 3UJJH 4U6XB 5H37G 3ZHLA 3JV5A 4ZG1A 2V2XA 2A0LC 5K33A 4CN1A 2EYRA 5BOZG 4D3CH 2P8PB 4M7LH 1OSZA 1XGPB 2X6MA 4G80A 4PY8I 1FCCA 3HUJF 3U4BH 4HKBA 4L9LC 3TJHA 2YEZA 1S5IL 1NFIA 5GSVA 2X1WL 5C0AD 5DJXA 4NHUB 3L5XL 3P0VH 5KN5A 4I3RH 5DD1H 5MEPA 4UT9L 5L2KA 2WWMC 5HGDB 2HRPH 4JM2D 1FGVL 3RTQB 3WHXA 3NFNA 4DZ8B 2P43B 1XR8B 3DXAA 3S35H 3CFJB 3BP5B 4P2RB 5BV7B 3EOTL 3F12A 5ABDE 1OGTA 2O93L 2A9NH 2Z35B 3BQUC 2IQAB 4HIJB 3W0WE 3ZDYF 1Z5LA 4NKDA 1KPVB 4ZQKA 2PETA 3LEYH 5C08E 1WBXA 1KLFA 1WIOA 2AW2A 5IF0A 4P23A 4HBQA 1P5UA 1WUNT 2NTFA 3N1QC 1LNUB 4MLSA 1ITCA 4P99A 5KAQG 5GZND 1I8LA 4MLIA 4AIXA 4MCZA 1ZGLA 3MO1A 1NCAL 5F9AC 4ODVL 5F44A 1HIMH 2Y6SC 1TMCA 1U36A 1T83C 1NL0L 1MQKL 3SO3B 3OXSA 3FQNB 3O9WA 1EHXA 2NLJA 3AC0A 2A6KA 4FN0A 5IROA 3KPMB 1RK1B 2WINB 1C12B 5CCKH 2PO6A 1KCVL 2EZ0C 3WE6A 1O7SA 4B5EA 4MJID 4PRAA 1CGVA 4BZYA 5IB2A 3STLB 4M61A 1AC0A 2UUDH 2XA8L 4J7RA 2N1KA 2XTJB 3QG6A 4X8XA 2VLJA 1A1NB 2W9DL 3HFMH 1I7UB 1F42A 4MD5A 4ZD3H 1FL5B 1G84A 1V3KA 1UFUA 1YEDA 2VMFA 3RWGB 3M17B 1MCEA 1DL7H 2R69H 5CEZH 4PS4L 4Y19B 3SE4A 1EMTH 5I30H 1H3GA 1A9EA 2E6JA 3AB0B 3KXFD 3S4SB 4K7PH 2AJVH 3ZT7A 3NABL 2DQEL 1OSPH 4JFPB 1R0AL 4YGVA 3VXNA 4Y5YB 1GVIA 5DSCB 1B2WH 5K9KA 5C1MB 1ZOXA 4P2CG 4PJBE 3LEVH 3PWNB 3QIWD 4G42B 3IAGC 4NO5A 4NUJB 5E8PB 2PXYD 1DQLH 3CZFB 1WCBB 4O4YH 3D9AL 2F5AH 2P5EA 2JJVA 4JLRA 5DVKA 1BECA 1CDGA 3S98A 4MXQA 3SKOB 1JPGA 2EKJA 3SDDA 3BPCB 5ILTL 1YEIH 3CVIH 2NY4C 2HN7A 3C8DA 2R0LL 1CN4A 1BD2A 1E6JL 2DLFL 1ZLUH 5C6PB 2JJWA 3KYKL 3FB5B 3B9KD 2F5AL 5IMOB 4I3SH 5E8DH 5HYSA 3O4LA 2R2BB 4U1HA 1V7NL 1LDSA 3O41B 1AGFB 4ZUVB 1PY4A 1J1XL 3DVNB 1P7QB 3H42L 4TNWF 5T1LD 4MVBD 1FO0B 1P1ZA 2J2ZA 2ZUWA 2PYEE 3C87A 1NDMB 3VFOB 4OLWL 3BPNC 4JFXB 1Y0LB 3P4MB 3QPXH 4DKAA 2EKSA 1SJHB 2QV2A 5GGQL 4QRPE 4H0IA 4QY8B 2F74B 3ILQC 5TQ2H 2I9TB 1A3RH 4KKBC 2HJLA 4EVNA 2FECI 4YDKL 3WBDA 1PYWB 5TE4H 4XCEB 4XMPL 2VLKA 1DUYA 1SEQL 5IW1B 3IU4L 1LO5B 3DX6A 3U36A 3GRWA 5KSAC 5L6YH 4K8RD 4ESKA 1QFWH 3UMTA 4XP5L 4AK1A 4JO4L 3ISWA 3VFNA 1A1OA 2XWJA 3DUUB 3RWFA 1F2XK 2OCFD 2MMXA 4MZ3A 3UPRB 1IL1B 4KRPB 3K80A 3QQNA 3O3BA 4M4PA 3OGCA 1HSAA 3RNQB 2D4FA 2MCG1 4ZUTA 1A7BA 4HJGB 2P1YA 4LLUB 5HHQA 2KUTA 4ODTH 3L3DA 4QHNB 3B9AA 5DD5L 1BGXH 1C16A 1BFVH 2CXGA 4WW2A 4P3CL 4YUEL 4OLYH 1BQHB 2NY5H 1XF2B 5IVNA 4OD3H 3RL1A 3LKOA 4XVTH 4I77H 1IC7L 5K9JL 3BIKB 5HHMB 1LP9F 4K3GA 4KZEH 4KQ4L 4UB0L 4OQTL 4BFIA 4Y2DA 4XVSL 5DMIH 1BP3B 3GSOA 3FO9B 4P3CH 4KROB 1NCCH 1KIRB 5HHXH 4R26L 2OL3H 2DIAA 3MLTB 2JELH 3FMGL 4XNQB 1I8KA 2WAHA 3S96A 5IQ9A 4HUWA 3RKDD 3V52L 1R5WA 3DI2B 3PQYE 3D0LA 4O2FA 3OXRA 2EXYD 2ICCA 1IL1A 4EXKA 4U3CA 1AGFA 5FV1L 1BQLH 4KXZH 4IJ3B 2EDKA 1M7IA 2EIDA 3RY6C 2L4OA 2YBRB 2EIBA 4EI6A 2IQ9L 3S36H 1W0WA 2CDFB 3SKOA 5JQ6L 4NM8L 2X1QA 2P49B 4S1DD 3EO0A 1EEYA 3ES6A 1RUQH 3G6JB 4GJTB 3ZDXE 1NSNL 4JPWL 1T20B 3OB0K 4WV1B 2AERT 4P4KC 5TE4L 3NIFE 3T0AA 1U8IB 1X5IA 1QHOA 2XN9D 5E8NA 3JTTA 4YDVB 4YBQC 3GSNA 3QJHB 1N5AA 5F9JA 2NZ9C 2PW1A 3CXHJ 4OZHA 3AY4A 3CPLB 1R24B 3DO3A 3HE7B 4TVPE 2MPAL 1M4KA 5DF0A 3FQXA 3D6GA 4PP1D 3KYMA 3SBWC 3GKZA 1GOHA 5DR5H 1WSST 2E3VA 4NYLA 5FYKH 4X6CE 1MFEL 1IQWH 3M17A 4OIBA 2IH3A 4G9DB 3UXFA 3ARBA 5HYIA 1Y6KR 4MJ5A 4QF1B 5EN2A 2X9YA 5KSBF 1NKRA 4LFHG 5E6IB 4JE4B 4M61B 5KSBE 3GO1L 1OM3L 2AJSL 2FYYB 1AD9A 2Z31A 1TZIB 5I8OH 1KOAA 3RDTC 5J9PB 1ACYH 4K9EC 2Y5TB 4JFDB 1XGTA 3CMOL 4Y8DC 5TFSL 3SKJL 5DA4A 3MCLH 4PJ7F 1XT5A 3PP3H 4YX2L 1JNNL 5E8NB 2D0FA 3D3VB 5K9QG 4K3DL 5EOQH 1L0YA 5K93A 3WYRA 4X4YB 4RDQF 1CL7L 4YHKH 1B6UA 3H9SE 3S96B 1F3JA 3BZFA 2BVQA 3KYNA 3LMJH 3O6ML 5FUOH 4HD9A 1ZK9A 4NCC2 2R8SH 4YHMH 1EV2E 1OGAE 1DUZA 1MCPH 4F37K 4OUOA 1QSEE 4IS6B 4PP2A 1UYWH 2F54E 2PO6D 4UV4L 1E4KA 4M1GL 3VI3F 5E2VH 5EU3A 4BM7A 3PJSA 1WWAX 4JG1L 1F3DH 3QEUB 4PBWD 3WEXA 3E6HB 3VRIB 1YMMA 2IBBA 2XG5A 3OKMB 2GSIA 3F12B 4WW1A 1S7VB 2DS4A 3BN9C 4O2EA 1DCLA 3RQ3A 3RTQA 3X12A 3UTTE 5F8RC 4E0RB 3KJ4C 3LRGA 4D9QE 5DC4B 5M95B 1QFUL 4NNYA 3PWJA 1MNUH 4XMLL 3ZKSD 4OZGE 3UPAA 5FF6B 1BAFH 4HS8L 2QQNH 1B4JH 3PIQB 5EOTB 5EU7E 1V5JA 4ZSOE 2BNQD 3CAFA 5DQJA 2FEDC 2BY0A 3RWIA 5D70H 1DBKL 4FRWA 1P4BH 2D7NA 1J1XH 3LKPB 2WY3A 2VLJE 5T1KA 3MYJB 2Q76B 5C0AB 3F7VB 2HJLB 4ELME 4EVNB 1DN0B 4FFYH 3HE6D 2ESVD 2IADB 3SGDI 4KKNA 2XNAB 1IGFL 2PTUA 5IB4A 3ZHDA 4GBXD 3KXFE 4HIJA 2H8PA 1AGCA 4GRMA 3TT1L 1KENL 3AB0C 4MXVE 1R3KB 3FT2B 4JG0L 4KKAC 2J3SA 3G08A 3O2DL 4EI5C 3MRGB 4HV8B 4X7SH 1S7RB 4HIIA 3CX5K 3O6KL 2I9TA 4LLYA 5T3XD 1CF8L 4J3TA 2F74A 5E03A 4ZFZB 4NZRH 2DYPD 4XVJH 1BPVA 1QSEA 4NO3B 1FO0H 3RP1A 3QXWA 2C1OB 1EAJA 4KK6C 1KN4L 4KZDH 3NPSB 1UZ6E 4P5TB 4UV7L 1EHAA 4CMHC 3IRZA 5EU6D 5HHPB 4PY7B 4MD0A 1M71A 4Q0XH 3QIUA 3B9EA 2CLVA 4YBLB 2EDDA 2R39A 4KZDL 1ZWIB 3M1BB 3UROR 5C8JA 1IGTB 1UB5B 3WJLA 1KFAH 4IRSB 4Y5YA 2AJZA 5HHNB 1I1FA 2AK4A 3K1DA 1R3IH 4EIZC 2VZ1A 5DMIL 5DUPL 4X5WB 1W2KT 1MSPA 3GJFK 4UB0H 4AG4L 3DBXA 3TEUA 4JRWA 4TVPH 4KROC 5DJ2B 4P2RE 1MIEH 5JIHA 3VXQA 5I71C 4PRPA 3QDGE 1AO7D 3SCMB 2QBWA 4GRLB 2OSLA 1EPFA 5GQBA 4NO2B 3C60B 5MI0B 1O5DT 5JLZB 5FGRA 4JRYD 2B39A 1QRNE 5SWQB 1BQLL 2P48B 5KS9F 1ZHKB 3ARXA 5EIQA 3U4BL 4G6KH 5J6GB 4W81A 2Y07L 1IM9A 4JRXA 1H8OA 4KKBD 4C56E 5F70A 3P77B 4J23A 5KW9L 2CK0L 1FO0L 5A2IH 4NM4H 3HFML 3RWCB 2PTTB 3VWKB 3J7HA 1J1OL 1GPOL 4ALAL 2EC9T 3PL6A 5DD6B 3O3AA 5IVOA 3ARBD 3RPKA 2A6IB 4EDWH 3OHXA 1BM3H 1MCKA 1AXSB 5DRXB 3MRCA 3VH8G 1H0DA 4CN4A 5CEXB 1CLZL 2FDBP 3F62A 3QBTB 4Z5RA 3LHPH 4S1QH 1E4KC 1UWXK 4G9FE 3HPLB 3UBXG 4HG4J 3V5KB 3GUTB 2D4DA 2OTWB 1X5JA 3VXUA 4IHOB 1I4FA 4NWUL 4LVNC 2QJDA 4PV8B 5FO8A 1GC1H 3MJ8A 1NJ9A 1RUPH 4I18A 5FYKL 5GXBB 3BDYL 3RIAF 2O5ZL 4EN3D 3QCUL 4OD2B 4JY5H 4WU5A 1MFNA 3PL6B 5DD6A 1F4WL 1I9JH 5EUKB 3OKKA 4DZ8A 2VC2H 4OTXL 1Z6JT 2P24B 4PJ9B 2DQFB 2HFGL 4XP1L 4UU9A 1DQQB 1OGAA 1H8NA 1U3HB 2VR4A 8FABA 3MNWB 1N0XH 5T5NG 3QIWB 3TJHC 5DWUL 2X4TB 3MCG1 2IMNA 3THML 1TDQA 1X7QB 3KPLB 4R6UA 3VFPB 5MHSD 1A6AB 5KSUA 2BVEA 1RZGA 3OKDA 3S37H 3GRWL 4BJLA 2CK2A 1N3NB 3DXAB 2DAVA 1JWMA 4PY7A 3WHXB 1CGTA 3MQIA 4Y19D 4P5TC 5H8DA 3IDGB 4AIOA 2YPVL 3MJ7B 5DLMH 3SGJC 5IT2H 2BNQB 3SE3C 1MCPL 4MQTB 4HGWB 1RPQA 2XKUA 3C2SA 4L8DB 5F7UA 3INUL 1GIGH 3TZVB 2FL5B 2ZG3A 3O6FB 5D7JA 4UTAL 3TYGL 2H45A 1A14H 3IGAA 4LPWA 4NJAL 4J3XA 4ZTPH 5JUEH 1JHLH 5K59F 1QFWL 1EVUA 4WFHD 4HWBA 2HAZA 4Z7OE 2Q86B 5J6HB 4PFEA 4G8IA 4XNXL 2ZCKL 3QXUA 4LLWA 2HYMA 5GGUB 3HZVA 4QTIL 4LCCA 5LAXA 4HX1A 1KB5L 2G2RB 3EJZC 3EYSH 3WXWH 3VDCA 4IRZH 3RBGA 5DK0B 5E6IC 1MWAB 1P84J 1DDHA 1T66D 3LV3B 3AS3A 4PLKC 3VJ6A 1JZ4A 1MCBA 1DVFB 2P8MA 4P46A 1FL6B 4MB5A 4DCQB 2LVEA 4OLEA 4H1LA 2AP2A 3K81A 4WUUB 1UZ8B 2YPKB 4KHTL 3C60C 1N7ML 3MRGA 1RULH 3SQBA 3V5KA 3HG1B 3OB0H 4RWHA 2A9MH 3IAQA 2NW3A 4PJ5D 4C83A 3C6SA 1BOYA 4HUNB 2D0GA 1KT2B 1YZZA 2P24A 4NKOA 5KZCB 4JCLA 5DGQA 2BSTB 2VOTA 4R96B 3RVXD 1OWWA 1NBYB 4IRSC 4PRBB 5C0ND 1Z0NA 4E0RA 1J9CT 2OL3A 5T1LA 2DQDH 2GT9B 4OZ4B 5GS3A 5T1KB 4WGWB 2J12B 3AAZB 3UTPD 4WNQB 3W5MA 1IRAY 4MQXD 5DQJB 1AP2A 1YPZB 4XNMA 1UH3A 5K9QI 3GSQA 1FDLL 4MNQA 3OKLB 4XMKL 3IDMA 2P4AB 3B2UD 5FHBH 3E8UH 4NP4L 2YOCA 3RFZC 3N85H 1B0RA 4G8GD 2Z0BA 5SX5K 2JCCA 1SHMA 4FQ1L 5JIKA 4X4ZA 1QUNA 1F6FB 4ZTOL 4DUWA 3BZFB 5LQBL 2PXYA 5KTEL 3WFCL 1EXUA 4KGLA 5HI3D 3QDGB 5DRZA 3LKNA 4LCUB 1KB9J 4NQDE 5D5ME 3BRDA 3ARWA 1HH9A 1MRFH 1YQ2A 1I3RA 3C9NB 1ZHKA 2BC4A 1EZVX 3MRLB 3QO0A 4NC1C 2CSPA 1JN6B 4XWOD 2VIRA 4NQVB 5C0CA 3C60A 5C8JB 4P46D 5EU7C 1I3VA 3QUXC 1B6DA 2NY0B 2CPCA 3QCVH 3RGVA 5JXED 5HYJD 1LWRA 4YDIL 4AZ8A 1I9IH 3T0EE 5E6IA 5TQ2L 1ZXQA 3QUZA 3CUPA 4XWGH 5ALCL 2LTQB 3DHJA 2D7MA 3A6CH 3P73B 2I27N 3HE6C 4KJPC 5FYJD 4LDLB 2FBJL 5B8CB 4NYLB 3OJDB 1CICA 5DQDL 1Z9MA 3QEQE 2VXVL 3V4VH 3V0WL 1TCRA 5FYLH 1IKNC 3WUWG 2GJ6E 1T1XB 5DJDA 1NGWB 5I71B 1INEL 4DFIA 1ZWIA 4OZFA 2HH0L 4YXHL 3IFLH 3R0NA 4WIQA 1IGML 2PNDA 3OZ9H 2FJFA 4XVTL 1QD0A 1KJMB 3UBXB 3T2NL 3A6OA 4HCRH 4L3AA 1FJ1A 1L9MA 2F15A 2Q3ZA 2E9IA 4LSVL 2IALA 4X7DC 2N56A 5BV7H 3W11D 2BZDA 2H8PB 3MR9B 1IGMH 1X4ZA 4C55A 3MRIB 1SEQH 1UM5H 4U0QB 3EIFA 5D1QC 3RGVD 3RZCC 3ULUC 2XZQL 5CJXC 3DVGB 5T1DH 3VD3A 3GJFH 2CDFA 1AY1L 1AFVH 5L2KE 4BELD 1OAXL 1YJDL 2YMXH 4W6XB 3EJJX 2PCPB 4M8QA 1KXQE 4MA7L 2OL3L 3PWLA 4PJBA 1SJEA 4YDIH 4NQDD 1F13A 5EZIL 2VH5H 1E4XL 5IG7A 4UNVA 3RI5K 3MRHA 4HUWB 2HJKB 2XI9A 4ODHH 5IJKA 5GGRA 2AK1L 4MB4A 1NSNH 1VADA 4JPWH 2JF1A 5IMKB 3O11B 2OI9A 3MUHL 4YDLB 4YR6A 4PJFA 3ARGB 1MWAL 2H2PD 5AG9A 3L3JB 2H6PA 5ADOL 2NY0C 2XA8H 5CHNB 2BFVH 3R8BB 3T3PE 3LKOB 2A2QT 4GG8A 4XPHH 2DMCA 2ORBH 2C26A 2IEPA 4OJFH 1ZA6A 1CE1H 1FZJA 4GW5A 4V3DB 3BKJH 4HFWB 4KPHH 3SKMB 5M94B 1FPTH 4JREC 4JGJA 3GSNL 4OBSA 1AHWC 1T7YA 1CDIA 3DRQA 3CK0H 3H3PL 1OSPL 4F8QA 3L5JA 4QXUH 3OAUL 3OQ3B 3O6MH 1DEEB 1KBGH 4MGXA 3P2TA 2CRMA 3QH3B 2Z31C 2GK0B 2OM5A 1CXIA 4MS8D 1GHFL 3X11A 2DQUL 2Y5TA 4XPGL 3GK8H 4ZPVA 4H1LH 3NZHL 4RQQA 3GBLA 4OCYH 2Q7YB 4MNGB 5HY9A 1JPFB 5HHMD 4PJCA 5L2JA 3BESR 2VISB 1JTTA 3R0MA 4PRPE 5FOBA 4YXKL 3WJJA 1PG7L 4JZNA 4KI5F 4X4YA 1P7KB 3ARBB 2YN5A 4PTUA 4RBPK 3EOAB 4HIHA 4ZOCA 4R4ND 5C08A 4ZFFB 5GGVL 3VGBA 2P45B 3CK0L 2IAMD 2CLZA 2ICWB 2ID5A 3QWRD 4FFWC 4LHUA 3DXAE 1KCUH 1WBZB 1NC2A 1T5WB 3IT8D 5GGSY 3L3KA 3G5XB 5E9DE 1IFHH 1ES0B 1T1ZA 3MACL 4R2GB 1CLYH 5JW3H 4G9DA 4WV1A 2M26A 3MLSH 3VRJB 4M7JL 4ELKB 4P2OB 3B3IA 1MWAH 1FO0A 4PBXA 2VSDA 4FQXD 3SGKC 3U82B 4Y5VA 4TUJA 4JJHA 3T09A 4F7CA 4GT7A 1NC2B 1RU9L 4WUKL 4TQEL 5MHSE 1VFBB 3LEYL 2YD5A 3HE7A 2W60A 4GOSA 3O6FC 2X4PA 4JO3H 4QXWA 2BMKA 5T33H 5HYSB 2H9GA 1F4YL 1JYXA 1DEEA 1UADC 3HZYA 4JCMA 5FYJH 2EH7L 4YEEA 1MI5B 3MNVB 5EZOL 2O5YL 4N8CL 3FQWB 4F15B 4BZ2H 4ZD3L 1JVKA 1D5BB 2ZUSA 3EHBD 1UH4A 3BKYH 4G6AD 1TJHL 2NX5D 4MNGA 4JM2C 5HY9B 15C8L 4HMEA 4ZPVB 5CD5C 2ADGB 4U6VH 4N0UE 3JV0A 1ZS8B 4PJHF 2VIRB 4M1CD 4OCXH 1LO2H 5C09D 4EI6B 5C3LD 3I50H 3MLRL 4K23L 5IGXH 1QLFA 1RIUH 2VL5B 4OLVH 4TQEH 1T66C 1K8DA 4PLKD 5IB2B 1MJUH 3RJQB 4BUGA 3NAAL 3C9NA 4GRWH 2BCKA 4OV5B 3DGCR 4EOWH 4YEFA 3D0LB 4LCUA 2R2EA 4C4KO 3GDBA 1AC6A 1J88A 3G5VA 2WINA 2VLRB 2QKIB 1MCWM 2GJ6B 4EOWL 4DTGL 5DJYA 3QG6B 3MXWL 4EEEA 1P9MC 2WK2A 3H3KA 5E5UB 5FEBA 5F1NA 5C0IA 5GPRA 3GSVB 3MLYH 1NFDE 4QHNA 3B2VH 3C6SB 5CP7A 1NANH 3REWA 1KGCD 1QHPA 4U1IB 3HG1D 4Q97A 1C12A 1X4XA 2EZ0D 1CFQB 4MQXC 5AUMB 5GGRB 5IF0B 5AAWA 1QFHA 3KNBB 4M3JA 5KS9A 3U6RA 4JHAH 4JZJB 3VJ6B 3ROOA 1ZLWH 1XCTB 3KJ6L 1VEPA 1NDMA 3VFOA 5HD8D 3O4OB 4J3VA 3VGAB 3S34H 1SJEB 7FABH 1DTUA 1YEJH 2ARJQ 1NUDA 1P6AB 5I8EB 2BJMH 4XNZB 5GGTH 1EAPA 4JN1L 3TO2A 1GGIH 3CFEA 3BWAB 3HG1A 3HKFA 3H7LA 3KYOB 4UMGA 4O2CA 4ZNEA 5KN5B 3ZLQC 4P9HL 4UV7H 1PEZA 2AK4E 5FXCH 3O4LB 5KVGH 1WZMA 1A7NL 4AMKL 3U4EA 4YO0B 2UY6A 1HOCB 2DBLL 1J8HA 2YEZB 1DVFA 2FATL 3MTRA 4P46B 1Y0LA 2KKQA 3LIZH 4N1HB 1DDHB 1UWEL 3QFJA 3D87B 3STBA 4RISL 1AR2A 3IF1B 4NN6C 5F96L 5DK2A 2AVGA 3AUVA 1R3IL 5FKAB 4ZFOL 4NUJA 5B39G 4PG9B 4DKFL 1MREH 5I76A 2MKLC 2DIBA 6FABH 4ZFOB 3LZFL 4QXGL 1I9JL 2E27L 2NY4D 1NFIB 2MFNA 3TN0C 3GMOA 1LK2A 3B5HA 4G6FD 3V6OC 1IAKB 4PJHB 2CDEA 2HVKB 4LKCA 1VFMA 4I9WE 4ZUWA 3QHFH 2YWZA 3DMMD 4Z0BH 4J3SA 4X7TB 1A4KA 2PTVA 2PXYB 1AHWB 5F8QC 3RGVB 3NFSL 4P2QE 4KHTH 4U2YA 4GBXA 5C92A 2EDHA 4DOHE 1UXSB 4MVBC 1NCWH 1RHFA 4R7DB 3BKCH 4U6HB 4PV8A 4AT6B 1RVFL 4GAFB 4KTDL 3AFLA 3BSZH 4D0DA 4F9PC 1ORQA 4EBQH 4NT6B 3NN8A 5DRNB 5SWSB 3QIWA 3CH1B 3GUTA 1HH9B 3ILQD 4XBPB 1IAIM 1RUPL 3ULUD 3ARED 4QRRA 1EGJL 3QEGL 3NBNA 5EIIA 3PQYA 3RWDA 3CSPA 3OAZK 4Z95L 1XF1A 3RVUD 1HI6A 2WSKA 4KK5C 3FQNA 3O9WB 3NACH 5BJTB 3L9RB 1G7LA 4NO0D 3CU7A 3WFEL 5GS1A 2HJFB 5E8OA 3NTCL 3EO1B 2Q8BH 2YD1A 4FOMA 3L3GB 2WUCH 2Y7QB 4TULL 1MEXL 4KUZH 1RUML 2F54A 1ORQB 1E6OL 5JXAL 1CLYL 4Y4HA 5C7XL 1CXHA 3KAAA 2GITA 5DD0L 3O2VL 1UKTA 3TVMC 1N8ZB 4MDIB 3GB7A 2ZCKH 3WDJA 4BYHA 1JNJA 1KIPB 3ARUA 2NR6D 2G2RA 1HI6B 2V5YA 1MJJA 3O0RH 4PD4K 4X7TA 5CWSA 4G8IB 4ZUWB 4C83B 5KVFH 5TF1L 1SBSH 1YNTA 2CDGA 5DS8B 3ZKXC 4DQOH 3V7MA 1GGUA 3PP4H 4WTZA 4DZBB 4JKWA 3GJFA 2HVJA 2FL5A 4MXWH 4GXVL 2C4FU 2M2DA 3AXLA 1U8OA 1VPOH 3PP4L 5D2NC 4Z7QE 4KDWA 1I3UA 4J6RH 5LAXB 3D18A 4GKZB 5I1GH 5DMGC 4NN7C 2K1MA 5J1TC 4YHOL 2E8ZA 1CQKA 3SE8L 1ND0B 4OCXL 5DJCA 2C1PA 1ZLSH 4M8VA 1G0DA 2FB4L 4JHZA 5E9DB 5HHME 1DBJH 5IV2A 4OM0H 1MFCL 3MRQB 3ILPA 4KRNA 4C4KT 4MD4B 4NZTH 1QACA 1DBAH 5D2LF 1IGTA 1FGVH 2OYPA 3GMQA 4GS7B 5J89A 4PGBB 2OK0H 5TPWH 3BEVB 3AGVA 3U30B 5FHBL 2C4XA 1FZKA 5F3HB 1HHJA 4FFWD 4GQ9L 5I8EA 3MRKA 2X4SB 3KGRA 2J5LB 3TT3H 3UTQA 4PP1C 1FYTD 2XZQH 1JIBA 1CIDA 1LO0L 2DLTA 5MP6L 1N59B 2CKBH 3VH8B 1B3JA 1M05B 4FZEH 5IB4B 1S9YB 4HJ0C 1KC5L 3K2UL 2JK5B 1UG9A 4NQDA 4B53A 1SBSL 4GG6A 3DRTA 4V1DE 3PV7A 3TIDB 4XAWH 1PBYA 2BVPA 3LN4B 1FAIL 3LKPA 2OJEA 4LRNH 4LBEA 4YHNB 4PUBL 4HLZG 4FFYL 5CWSB 2IPTH 5DEFB 4XVSH 1T80A 3EYFA 2R1WA 1INEH 3MRCB 1NMCC 1AGCB 4GRMB 2APVA 1CU4L 4HWEL 4LLQB 4LQFH 4UBDD 1NJ9B 4I18B 5E4EC 1LP9E 1CXKA 4JPIA 2B0SL 3NCYS 3V6FA 4PJ9C 2ZOKB 3X3FH 5IIEA 1U3YA 3VA2C 5GGVY 5TQ0L 1W72B 3TF7A 4KI5C 4GKSA 1Q1JL 3VMPA 4OI8A 3MCKA 4OLUL 5GHWH 1QR1B 1AIFA 2OI9C 2GY5A 4GQ9H 4XX1G 2H26B 5IB1B 4H0GA 4ZUUA 5J13C 5FIEA 4PJXF 2WP3T 5KZCD 2GTZA 2QQKH 2W9LA 3U1SH 3HAEB 4URTB 3FTGB 1KC5H 2VZUA 1KELH 3WV0A 1X5AA 4PP8C 4Z8FL 4YHYC 4X98A 5D7LA 1HH6B 5CZXD 4M4RA 4W6WB 1KGCE 4N0CD 2HFTA 4QKXB 3ZDXF 4IDJL 2F54B 1HHHA 2LFGA 1NBQA 2AK4B 5A40E 3VXRD 1MH5A 4N90D 4C54A 4OT1L 4YJZL 2RJMA 4UT9H 4K3EH 2XQBL 3EFFA 3W0WA 1RZJC 1YY8A 3QIUB 1JRHH 3VXQB 3DIFB 4KRLB 3M07A 3BQUA 1JMZA 1D5BA 1FQ9C 4JM2A 1KLUA 2CUIA 5FV2A 4MJIE 3CDFA 1F4XL 5HD8C 2GJZB 2APFA 4HCRL 5HDBE 4P4KB 3PV6A 1EX0A 1A7PL 2MQ3A 3MFFB 4FXGB 3MOAH 5D93C 3W81A 4RMQA 5E1AA 2FHBA 4PJEF 3HRPA 5F88A 4PRID 2BSRA 3GSXB 4Z77B 3NN8B 4KKAD 5SWSA 1N5AB 5IW3A 5F9JB 5C70A 5IFJB 3WL9B 3QEQD 2BVOA 2WANA 1DBMH 1YEHL 4J8RB 5JXAH 5F1IA 1AE6L 3IXAA 4N8VG 1FZOB 3TPUA 1ZSDA 1BFOA 2IH3B 4DGYL 2VDLH 4OGXL 1MAML 4AIZB 5L7XL 1BVKA 1M6OB 1I9RL 1T89C 4LRIA 4WDIA 5T33L 4KK6D 1WC7B 4AJ0A 1VGEL 3J8F7 5CILL 2VDLL 1YUHB 1HSBA 1B4JL 1J8HD 3CFCH 3ARQA 4TVSa 3CCHA 3C08H 2ED8A 4KUZL 5E1HB 2NYYC 5C08B 1IGJB 4KTEL 3EW3B 1GHFH 2DTML 1N64H 3FHAA 2EC8A 4WEBH 1XF5A 4LNRA 2AJXL 2DDQL 3WLWC 1A7QH 3S6CA 3OR7B 1R5IB 3U6RB 4O2FB 2WMPA 1NCBL 3WUZA 4Q74A 3KNBA 5CCKL 5L2JB 1TVDA 1U8HB 1DN0A 4KTEH 5F7FA 4FQ2L 4AM0A 1IBGH 5C0BD 1MHPL 3TT1H 3WJJC 2Z93B 4WY7H 3VWJD 3OTTA 3W2DL 3UJTL 1MF2H 2V5MA 4F58H 3QSKB 5ISZA 3TP4A 2XT1B 5I9QB 2IG2H 4JANA 5HBBA 1BQHA 3OMZA 5BZDB 5DJYB 2Y36H 5E2WL 5I2IA 25C8L 4JO3L 2IANB 5DHVH 3DRQB 1R5WB 1EAPB 1FVCA 3WXVL 5HGAA 5F1OB 4DW2L 4XNUL 2R2HB 4QRRD 3PJSB 1F45A 1NANI 4LAQL 1ZLSL 2LQRA 2PYFA 4Z7VB 3WIFA 3LQZB 15C8H 4XP4H 2AV1B 1JNLL 3L5WB 2WLZA 5B4MC 3SDAD 3N1FC 3MBXL 3QDMB 5JQ6H 4LCWB 4OZIF 4WHCA 4GRWF 4ZYKA 1CT8B 1MPAL 3ARTA 4YIQB 3P4NB 1AD9B 2O5YH 2Z31B 4N8CH 5GS0C 2RAMA 1FN4B 4Z7VA 3HE7D 1OAKL 2OR9L 4RNRA 3CLEH 1HNFA 4QT5A 3TBYB 3LD8C 1EUTA 3Q2CA 5HGAB 2V7NA 3FRUB 2VDOL 3FCTB 5IK3A 2AEIT 3CCHB 5D7JC 2OZ4L 4NQCE 1GGCH 1ZAGA 2FLRT 2CLRB 4DWHA 4LPTA 2X9WA 4M7JH 3UTSE 5D71H 4CU6A 3JSSA 5C7XH 5JHLL 3TJHD 3OJDA 3QWRA 1Z9OA 4J12A 4GO6B 4P4RB 2J4WL 2FEEL 3IDYB 2BP3A 4AM0B 4CW1A 1P1ZB 2YPVH 3IDUA 3EO0B 4PGDB 3SPVB 4Y89A 2R56L 3ETBF 4XTRD 1KCGC 1C5CH 5DEGB 4MAYA 4YHYB 4PJIF 5TQ0H 5F88B 1GC1C 3GM8A 4PJBF 5TH2A 1QP1A 3FQWA 1Q94B 3H9HA 3KXFA 2R2BA 5DA0B 3QJHA 1TCRB 3R06A 3MRJB 3FT3B 4TSCL 3ULSA 4NQSA 4NBXB 4LARL 1RJYB 3GMMB 4R97C 4W4OA 5FYLE 3ABZA 2HN7B 2WV3A 5D96C 4OAWB 5D6DA 1BQHG 3LEXA 3QUML 3CVHH 4AMKH 3LKNB 1FVDA 4TUJB 3QQ4B 3NCJH 1RIHL 1DQTA 2XZAH 1NGPL 2GJJA 4WCYL 2NXZD 3OAUH 2HA1A 3EFFB 1A5FH 3JWDL 3WO3B 5JHDA 3VW3H 1D7FA 2YKLH 4JVPA 3QH3A 5HHMA 4YQXH 1KB5B 3ESUF 1IGIL 4HS3B 4HJ0D 4RAVB 4MNQB 5LXGL 1OPGH 4Z77A 1C16B 3VXTB 3MYZA 3SEPA 2DD8H 1T0MA 4N1CA 3QI9A 1V3MA 4FXGA 1T2QH 3E1F1 1SBBA 5IK3B 5IQ9B 2DQTL 3QDGA 4PGZA 5DRZB 2GY7B 1YDPA 1I8KB 3BGAA 3KPSB 3MLTA 2A6KB 2IPKB 1KEGH 1IEHA 4HFWA 5BOPA 4NUGL 1I7UA 3VFSB 1F4XH 3D2UB 4JO1H 4JZNB 1TMCB 3RVXC 2ZUTA 3DIFA 3RL1B 3E6FB 2DYPA 1CYGA 1JGLL 2HG5B 2JB5H 2Q7YA 4Z6AT 3FAXA 1TNMA 4D9LH 4G43B 4MAUH 5E6YA 5MEND 2NZIA 1I85A 5DZOA 2EDXA 3KR3L 5D1XA 3RWHB 1D9KA 2BSSB 2EE3A 4H1LB 2W0PA 4QRSB 4FQHA 4I2XB 5F21B 3SDCA 2YRPA 1U3ZA 2MWCA 2VL4A 4NKDB 4YHLL 2XWBB 3HCVA 2CMRH 4H8WL 5IHZB 2J6EA 5TDPB 1WT5C 5DI8A 4O02H 4PJ7B 2EYSB 2JTDA 1VFOA 1MIML 4DEPC 1KN2L 4ORZC 3SDCD 1UGNA 3M8OL 4JKLA 1CZ8H 4BH7A 4KKLD 5D2NA 3FAWA 4U7KA 5J6HA 3TA3A 4LBEB 4YHNA 1MHCA 3CC5A 3OBAA 4UT7L 1OQOA 3OJVC 2FR4A 5DMYA 3ARDB 4H20L 3TIDA 3O6FA 5D7JB 2NY6C 3UTTD 1K2DB 2EKSB 3BN3B 4JFFB 3MRIA 1EGJH 1KCLA 3T2NH 3TFKC 3BPCA 5IOPB 1H3PH 5SWZD 5GGUA 1D5MA 3O8XB 5J12C 4LLWB 4ELMA 4KTDH 4XCYB 5JXEC 1OTSC 2V2XB 5ECJE 4QXUL 1XF5B 4OZFB 5CUSL 4HGMA 4Q9BA 5SWZB 4FTVB 3K4ZA 3FKUS 3V0VA 5IMOA 4XPAH 4OLXL 2DMKA 3FB5A 3UPCA 4YGVB 4HEPG 5ADPH 3BMVA 4U1SA 3EOYG 4CDGC 4KPHL 1I1YB 1ONQA 5E6ZA 3FQUB 4OD1L 3UTTA 4CADA 4OKVB 5JHDD 3QQ9D 1E6OH 4FQLL 2BVPB 5EORL 1GOGA 1AGEB 4LCWD 5HYJB 1JHTA 2V9RA 1CVRA 5D6CA 2HFEA 2V2TB 1EEZB 3UJIL 3NVQA 2VE6B 1TVHB 4OCLC 2CGRL 4XP6H 5GGVH 1TETL 3R4DA 2HKFH 3VWKC 1AQDA 1BQSA 1D5IL 1KACB 5C0EA 4PJ8C 1EH9A 1IMHC 3JZ7A 3SCMD 1EIBA 4P49A 4I4WB 5GSRA 43CAB 2I24N 3SY0B 3OKKB 1CDHA 1MPAH 4HUUB 4OGYH 3WO4C 1TTUA 5GJSL 3VXPB 4NBYB 3KPMA 4MXVF 4WU5B 5KVEL 2OK0L 2W0FA 3EJYC 3O45A 5JW4R 2Y06L 1CDYA 2BNRB 1UJ3A 4GRLC 1DQDH 1OP9A 1I4FB 4JFED 5GGTL 2OQJA 4R2GC 4PRAB 3OF6A 4PTTB 2WBJA 1BGXL 2BXYA 1A64A 5GRJH 3HI5L 3T0EC 4O00A 1EEUA 4D0CA 1P7QD 5DD3H 4Z5RB 4JFQB 4RMRA 2ADFH 1VPOL 4E41B 3MRLA 3QO0B 3VWJC 2HVJB 3TN0B 2H2PC 5FGCE 1E4JA 5HDQH 3MACH 3MUZ1 1C8PA 2UWEB 1U8QA 4U1MA 4TNVF 3OZ9L 3DGGB 4HIXH 5I75B 5TGBB 2R8SL 2I9LA 4FQCH 2QSQA 4I3GA 5E4IA 2J8OA 4EZMA 2CGRH 5HVFB 2GJ6D 3DMMB 2GYSA 4WY7L 4HS8H 1PKQB 1NFDA 2Z91A 3EUUA 4XPFH 2CXKA 3QNYB 4WFFD 5DRNA 5ALBH 2E9WA 5DO2D 1J7VR 3I9GL 4HUXB 3NA4A 3GHBH 1BREA 1OF2A 2R29L 2VLME 1KULA 2IFFH 2ZUXA 3QB7C 1UXSA 2ZNWA 5I0ZA 1R3JA 1L7TH 1ZT1B 5B4MD 4OM1H 2Z8RA 1AD0A 2JJSA 1XR8A 4FFZH 3VFMB 4Y4FA 3NABH 3WS6A 4HCRA 3S88L 3DETC 4LLQA 5GS0D 3ARYA 3UEZA 4Y4FD 4AENB 1IAKA 2NX5B 1NC4D 4OFKA 3BHBA 3BQUD 4JM2F 4LLYB 1NGXB 1DEDA 4OI7A 4R4NC 2EDRA 3S37L 2HRPL 3GKWL 2RCSH 1I9EA 4TN9A 1S7UB 2HTKD 1OSZB 3ERYA 1T4KB 4LOUD 2XN9E 5IVZB 4DCQA 4PJEA 4AT6A 2A38A 5IB3A 2DMBA 1ZEAH 4ORGB 4KRMB 5CEZD 5JZ7C 3F7YB 2VZTA 3ZO0A 4LCCB 3LKSA 4YGAB 5E7BA 3RUGF 4OZFG 2Y6SD 3ULUH 3RA7L 4MZ2A 2R2CA 3TZVD 5IP4A 5ENWA 1EERB 4HUKB 4FQXC 2J8UE 4BSWA 1I1YA 4XTRC 4NM4L 2X7LB 4ODWB 3CFEB 1UZ6F 2CR3A 5CP3H 2Y36L 1L4IA 3FT2A 4MWFA 4X6FA 3D69B 1QRNB 1BZ9B 1RZIB 1TJHH 5EG6C 1LDPL 1WEJH 4XAKD 2C1PB 4NHCH 1XCTA 1OGAD 3DV4A 4UDTA 2OXHA 3TVMB 3GI9L 5C0JA 1RJZB 1RMFL 3WNMA 5I16A 1N7MH 4HUMB 4ETQB 3FFCB 3CFIC 3LHPL 2VJXA 3OKMA 1R3JB 1ZT1A 2W92A 1BX2A 3SQOL 5EBWA 1CQYA 4BZ1H 4YPJA 1ADQL 1YQVH 3MV7D 3SDYH 3VFUB 4YO0A 5HGGS 3VD7A 4AG4H 5L88H 4QXTB 2K9UA 3PWPD 5EC1A 5FF6A 4M1CC 3PGCA 3QDJE 5DJ6B 4GQPH 3MNWA 1J11A 3HMWL 4Y16A 3ZL4L 4MJ2A 5BZWB 1JRHI 2J88H 2QHRH 1HKLH 1A6TA 5ISZD 3LN9A 4MXQD 4NGHH 3MOBH 5KVDH 4J2XA 2P46B 4JDTH 3RIAK 4WHYG 3NCFB 5D9SB 5IESL 4WCYH 3FB8A 4JRXB 3LDBC 4LLMA 3KPRD 3D25B 5KS9B 3EDDA 1V3LA 2VDPH 5I1DA 2YK1L 1DBBL 5AUMA 4ONGH 1MHPH 4IS6A 4PP2B 3REVB 5FO7B 1IM9D 2ATKA 4IMKC 1H3TA 3LQAC 1DQLL 2CKBA 2R0KL 3UAJC 5IHUL 2OQJB 3RZWA 5JDSB 3T1WA 4A6YH 1QLEL 2ZCLH 5AD0A 1T03H 4OLYL 5DMKB 5FB8B 3Q5TA 5ID1A 4PB9L 2VITB 5IW6B 3BZDA 3TBSA 4LEOB 2DLIA 2PTTA 3BT2L 5E2UL 5C2BL 4MJ4A 5EU5A 1G9ML 3FONB 4KJWC 3P4OB 5TDOB 1UACH 2XA3A 3ZSTA 1MAMH 3P9MA 5B38A 3CSGA 1FLRL 4OGYL 4F9LA 2EDTA 1FNLA 5FGCB 3SGDH 3JTTB 4YDVA 3UTPE 4YWGH 4ENEC 1YY9D 5ITBL 4P5TA 3GBML 1JTPA 2EEAA 1LE9B 2EICA 1NEZG 2HFGH 1ZV5A 1PFCA 2FX8H 1AHWA 3WFBH 1LVEA 1OP5H 4P9HC 4K71B 2R23B 4U6VL 3KYMB 5LWYL 4LKCB 3G08B 1CGWA 2FX8L 5GS2D 1MCRA 2CIIB 3K4DA 4LP4A 4NCDA 4PJIB 3V9FA 2BY3A 3MGTB 4JFYA 4G6ML 4L3EB 1FV1A 4LMQE 4N8VB 2V9QA 5B21A 3MRMB 4UILH 1UACL 1ZT4B 5I6XB 2WBJC 2Q87A 3HNSL 4EQ3A 3GM0A 4LIQL 3Q5YA 1HN1A 4LAQH 4MD0B 1UKQA 4XNQA 5GS1C 1BLNA 2PN5A 3MRBA 1NCNA 5DURB 3VXUD 5IOPA 1KJ2L 3H9SB 2YD2A 1W0VB 3BT2H 1CLOL 3RAJL 3D3VE 3EYUH 2VDOH 1T1WA 2OTUA 2DI7A 4IOFD 1G7PB 1JWUB 3MRDB 4K3DH 3BZEB 2DI9A 2JIXD 2YZ1A 2X4OB 3IETB 3HRZA 3WN5C 2IFFL 1UEYA 5JPNA 5FYJE 1OAKH 5HHOD 3TA3B 2C4FT 3ARZA 4LLUA 1AR1C 2X10A 3RBSA 1IEAA 1B90A 4CDHA 4OKDA 4PJ7A 3P9WB 5J7CC 2BK8A 1FFQA 4M7KL 3ROOB 4RNRB 1I8LC 4Y5VC 3AS2A 4L8BB 2X4QA 2X4UA 1YEGH 2O61A 4LVOC 1IE5A 2XZAL 1CT8A 3W9DB 3X11B 3KWWB 5H37H 1LK3H 5FDWA 1H15A 8CGTA 3MRFA 3H6JA 5IEKA 2W9DH 3GIZL 1LEGB 5FA4A 4ZUTB 2X4QB 5HHVH 5A3ID 3OGCB 4LGSB 1XZ0A 4LF3B 1MUJA 3HC3H 4PGCA 4X6BB 5DZLA 1BF2A 1KBGL 5D7SH 3DARA 1U8MA 5DVLA 3RNKB 4OF0A 2EIEA 3TVMD 2GSIB 1L0XA 2FSEA 4WW1B 2H3NA 4Y4HD 1LQVA 3FFCE 1DJSA 2NR6C 3AS0A 4M7KH 2LTQC 4JO1L 4AY0A 5ESAA 1JPST 1UM4L 4HKXA 1NAMH 1HQRB 4BFEA 4G5ZH 5C07A 4U7MA 5BZDA 5IJVB 2IBGA 4X6EA 3PXHA 2DWDB 2EDNA 3IS0X 3RDTD 1KB5A 2P5WD 4QHMA 3MV9E 1A7QL 5HGBA 3QUYA 3DX9B 1QBLH 4RBPH 5EC2A 3MBEC 5C6WH 1IAOA 3H9SA 3JV6B 3BUYB 4HW6A 4E9LA 1OT2A 3EO9H 5AEAA 4TOYH 4X99A 4JDZA 4G6JH 3I6GB 1CI5A 4E41D 1MFCH 1ADQH 1CD0A 1YQVL 4G8FA 3MA9H 3G04B 3WD5L 4N8VA 4YXLL 5DSCA 3VDAA 3HZYB 3QPQD 4FQLH 3FT3A 3ULSB 4NN5C 4M8QB 5CZKA 2BMKB 2CUHA 4HPYL 4JAMB 3M45A 4NM8H 3NPZB 3OG4B 1BD2B 3WCYA 2GSGA 2VUOA 2ZUQB 2PO6C 3ULVD 3D39E 3UZVB 1I3GL 5EZJA 4ODSH 2BOCB 2P5EB 4EDXB 1Q0YL 2UVEA 4JPKH 3V7AE 3LS4H 1IGIH 4QHUA 3AM8C 3KLSA 4MJ5B 1JF1A 2HKFL 3VRJA 3NIDE 4HKZA 3U0PB 5BQ7A 1NAKH 4PJAE 1V7NH 2DQDL 3QFJE 3K8LA 3PF2A 3T8XB 1E27B 1EGJA 2HTLD 3BN9D 4Q6IB 4EUPH 1C7SA 4M5YH 1HHKA 4KI1A 5IHBA 4ZNEE 3GK8L 2RCSL 6CGTA 2PW1B 5GHWL 2Z4QB 2GKIA 5IHUH 1JK8B 2AABH 5E2JA 3FRUA 5DHVB 3RTQD 1CGSH 1L6ZA 2X4RB 2FEDD 3UYOD 5D1ZC 3FQTB 1RUAL 5LG1A 4H0HB 1H5BA 1FNGB 4YPGA 1DFBL 2N4IA 5FGBC 4DN4L 1ACYL 4QWWC 5IMLB 3BGMB 4JKPL 4AEHH 3HC4H 4CUCA 4HAFA 1RUAH 1AP2B 2FZ3A 4OCSH 3TV3H 4MA3A 5JW4M 2R29H 2IMMA 2YBRA 4J4PD 4WUUD 1RI8A 2XQYK 1RK1A 4XBEL 4F9LC 3GGWA 5INCA 4U7SA 2WIIB 5A16B 1MQ8A 3KVQA 5BS0E 4WTWA 1JGEB 4Y88A 1LD9A 1LQSR 2EXWD 4PG2A 4ZFGH 3E2HB 2FWOA 3DYPA 5T3XE 3P0YH 2VQTA 1B0GA 1YJDC 2AKRA 1LO5A 3DX6B 5JXEA 3HS0B 4PJGA 2DQJH 1JZ2A 3V4VL 3ME0A 5D1ZA 2Z8VC 1QQDA 2DJ4A 1SVCP 4NWUH 3QHTC 5CS7A 5CZXC 1HKFA 1J0HA 3LIZL 5DT1H 3N0PB 5ERWA 1Q0YH 5CJBA 4LU5H 3QFDA 1ZTXH 3A6BL 4EUPA 5DD3L 4GAGH 4TUKL 4PJFB 4ZO6A 2XTJC 4LIQH 1R3LA 4HGKC 3WKNA 3RWEA 5DJZB 1QBML 4KVCH 1JPTL 1TETH 2AI0L 4C56A 3MRRB 1FNEA 3P0GB 4ZAKC 2Q86A 3CXDL 4UDTB 3TVMA 3UJTH 1ZT4A 5F6IB 4ZUVA 3O8XC 5J12B 4FG6D 4JDVA 1HCVA 4X6CF 1QRNA 4LSRH 4U3XA 1JPSH 4NPYA 1A6PA 1OP5K 3E3QC 3EDKA 2X09A 3QNXA 1UEMA 3PXJA 1UCBL 1LO0H 2IANE 1BZQK 1VGKA 3O4LD 1BHGA 4JJ5B 1ADQA 3PWPB 3TCXA 4EKXA 1VB9A 1XR9B 4KJWD 4XRCA 4ERSH 4ODBD 2P8PA 4S11A 4XCFL 2MCPH 3HB3D 1FE8L 5C6TH 1CK0H 1FBIH 4IM8A 3JXAA 3H9ZA 1BWWA 2R15A 3CMGA 2IBZY 4ZOEA 5I0DA 1YY9C 3GZKA 3HZVB 5E70A 1GSMA 1EHLH 1SM3L 5ITFB 3T0BA 1FZKB 5BCAA 4K55A 4JFPA 5GS0L 4PGBA 4Z78A 4FMFA 1U3HA 5DJDB 1QA9B 5BS0D 1N64L 1OP3H 5I17A 4P5MB 5DQ9B 2AKRB 4R0LC 1JGUL 1IVLA 4L8DA 1EO5A 3GBNH 4WHYH 4NOBA 3KPSD 4ZO8A 1DQMH 1JF5A 4FQXA 4D9QD 1J86A 1KCRH 2WIIA 5A16A 4UTAH 5KG9B 1IGCH 2F5BL 2ATPB 3GFUA 5CIPH 3IDJA 1CZ8L 3ARPA 1U92B 5DTFB 2WM0A 2VABA 2WBJD 3V7AG 1CFNB 1RZ8B 3AXLB 4CJ1A 2ATKB 1RIVH 3EZ8A 1FGNH 4LLVA 1XFPA 2ZJSL 4LLDB 4FQCL 2H2SD 2LAGB 1JBJA 3BKJL 5BVJB 1IILE 1A3LH 1JGVH 4ERSL 5AZ2L 3QNYA 3LB6C 1AXSA 2FX7H 4JVWA 5F9WB 2A6IA 1ULVA 1FNGA 4RGOH 1YNLL 4OZHE 3MLXH 3T2OA 1FH5L 4Z7NE 5T1MB 1FORL 4OI9A 4Y19A 5ALBL 3T3PF 2O26U 1MY5A 2VQUA 3DECA 1MFAL 2H26A 4I13B 4K94H 2VLKD 2X70A 2AXGA 1K85A 4IHOA 3JV4B 2O5ZH 2NXYB 3HHRB 2HLAB 5CMAA 1UWGL 4ELMF 3FFDA 4R7NA 4TVPD 3OKYA 5E24E 1RZ8A 2PO6B 4PJFE 4P3DA 1MOEA 1TZGL 4PJEE 2XPGB 5CEXA 3FOLA 5L8KB 1LDPH 1WEJL 2OJZL 3U9UA 1WT5A 1QEWB 2BNRA 3N50A 1MVUB 1FDLH 2HMIC 1EVTC 3WNLA 1NBYA 1ETZA 1DBJL 5J1AA 4FQXB 3U48A 3EYVB 2IFGA 2V9TA 4IOIA 5FUCE 3HA0A 2R1WB 4OZFH 3G5ZA 4MCZB 4MQSB 3WLBA 3Q6FA 3SY0A 4QRQB 1DL7L 5H35A 3QUYD 1VKXA 1CTOA 4WTZG 3TCLA 4Y4HC 3G04A 4RGNC 1IJ9A 4LARH 4P23B 2EDOA 2F8OA 4WTXA 3C60D 3CXHK 4YHZH 3MPCA 3S5LB 1AO7E 2DQEH 25C8H 5I1CH 4MJ6A 4TRPH 1N2RB 3TO4B 1GCFA 1Q9LB 5GZNC 5F7WC 5AZEH 4CN6A 1MJ8H 3NCBB 2QL1A 3MRKB 3S36X 5IUSA 4X4XB 5EA0H 4Y1AD 3KJ4B 4Y16C 1C08A 1OQXA 4S10A 4PJHA 3Q0HA 1RZJL 3ECBA 4X5LA 2QTEA 2EIZA 4HHAB 2HT4D 3V4PL 3G6JE 1R3HB 3G5YB 3O2VH 4X9BA 1JYVA 3M1BA 3MZGB 5I1AA 3GIZH 2ZUYA 1MAJA 4H88L 1NGYB 4PGCB 1GRWA 1BZ7A 1MFAH 1MUJB 4C56B 3SDXA 1A1MA 4PRDB 3UC0L 3QG7L 4HK3N 2VNCA 4PJXE 2VDPL 2AV7B 1HXMB 2H32B 3WNOA 1T0PB 5AYUH 3DURA 4NRZA 4Q6IC 3QFJB 1C5DA 1DQJA 1OF2B 5C2BH 5CGMA 2X89D 5HI3C 4HKJA 4X6CB 5EZIH 4X9FA 4Z7UF 4NGHL 4HIEA 5D93B 2OJZH 2CDGB 1ZTXL 4WI5A 2OZ4A 5JR1L 3IU3A 3O9WD 5I1KL 1LE5A 5I9QC 4PDCE 4NN5B 3GNMH 2FNBA 5JW4N 3RDTB 1QNZH 1S7VA 1AY1H 3QUZD 4XWOC 4RFNC 4U1JB 3GHEL 2GW5A 3BH8B 3BX7C 1YMMB 5E8DL 3HE6B 2BFVL 3WFBL 4K3JL 2K3TA 5A2LH 2BX5A 3P4LA 3M8OH 3IU3B 4Y4HB 1XGUA 2OZ4H 4O5LH 4JHWL 4GKNB 3V8CA 5TJWK 1D9KB 1UB6B 4GMTL 3D9AH 3MNZA 4KY1L 4D0CB 4J6RL 4OIAA 5CKAA 5D7IB 4NC1E 3EDFA 5EORH 2NY2B 3DYOA 4GW1A 4ODVH 3CLEL 1YN6A 1JYWA 3PIQA 1ZVSB 3TPKA 5DUML 5E08H 3T4AB 5SX4H 4HT1L 4YPGB 3DUSA 2WW8A 3OHXB 3SJVD 3QRGL 4HWZB 2H41A 4QGYA 1FFPB 2DRUA 1S9WB 2QQNL 1G9NH 1MREL 3I84A 3CSYB 4NKQB 4OSUL 5SWSE 3IKKA 2CIKB 3VXRB 2LU3A 1D9KD 3DUHA 1MJ7L 4MNQD 4HAGA 4IIQC 2QR0A 4YNYA 1JFMA 3SDCC 2UUDK 5EU3B 3LRSA 1BBDH 4JQXA 3VG9B 1BJ8A 3QXDB 4BK5A 1PG7H 3A67L 4LSPL 1KJ2A 3T8XA 3I75A 2XN9B 2E9JA 1ORSB 4K8RC 2XY1A 4ZPTB 1OAUL 3MX0A 1SEBA 1JHTB 1CICD 1OHQA 5EO9A 5FDYA 1OAYH 3HNTL 2W9EL 1DBKH 2XTJD 3EAKA 4HXAH 1U91A 1CBVL 2IGFH 1G7IB 4OD3L 4P9ML 3Q6GL 5C9JA 1UJTA 2FRGP 1J18A 3EOBA 3HZMA 4PJ5E 4X5WA 5TDOA 4X5XA 2APXA 1OTSD 3N85L 1AE6H 1RURH 1AH1A 3QUMA 1NCCL 5ESQB 3CSYA 4FG6C 3HR5A 1WFUA 4OF8A 5C0FA 3KR3H 5ID1B 2KDGA 1ETZB 1WFOA 4MAYB 3TYFB 4AEIH 4XB8A 5GRYA 5FA3A 1CGYA 1TVBB 4I5BA 3OKEB 3AROA 3P3YA 4QF1A 5EN2B 5L0QB 2OS7A 4ZUSA 3C08L 5KSVB 3O4LE 5HGBB 1QSEB 4NO3A 4XAWL 2J6EL 2VR9A 4HFUH 1M7XA 1N4XH 4UDUB 1UB6A 1BBJA 5C07B 1EEQA 2AXGB 4PRNB 1N6VA 5HYEA 4Z0XB 5HDQL 4WJ5A 3FCTA 2A74B 4ZSOB 4U6YB 2O5XH 4MA1C 2IPUG 1I85C 2AGJL 1YYLL 2XWBA 5DGRA 4YDKH 3IDNB 4TNWK 5DHYA 2DM3A 2AI0H 1FN4A 2DWEA 3OV6A 3ORJA 2BDNH 3MODH 4YIQA 5FYKU 3FN0L 2WIMA 5H2BA 3MRFB 4GRLD 4XPFL 4ZYKB 1MCWW 1A6VH 4LCWA 1J0YA 4EN3B 2DJUA 5HHQB 5FGBA 1PW3A 3I6KB 3RU8L 3IRPX 4L4JA 5F89A 3T0ED 1EUUA 2VDKH 5T3XL 5DMJB 5J56B 1VHPA 4H8WC 4UQ2B 2X42A 3H2WA 3VFSA 2CKNA 4XZUA 1A6ZA 4TSBH 1A1OB 5L8LB 5LVEA 4JFEB 4WWID 1A2YA 5J8OA 3U36B 1KJVB 1FZJB 5LJYH 1QA9A 1IZKA 3NZ8B 1ZA6B 2VLKB 2FJGB 4G8EB 4S1SH 5EU6B 3QHZH 1CFVH 1C08B 1NC2D 1QSED 1FG9C 1QLFB 3H0TA 3GMPA 3X14B 3U2SB 2MHAB 3QDMD 2Z8SA 3HLAB 3O6FD 5EWIL 2AABL 4UUJB 2QADD 4NKIL 3MA9L 2VKWA 5ICZB 3VXSE 1MLBA 1M7DB 2DLGA 1S3KL 2IBZX 3NIGF 5KW9H 3VA6A 3VGAC 4NHUE 4JJ5A 2VZVA 4RIRB 3WFDL 5IKCA 3PGFL 3MRMA 2XWJB 3PHOA 4OFIA 3HUJA 5I74C 3DETD 4GAYB 4PLOB 4JPKL 4BQBA 1F8TL 4YK4B 4G9FB 3EYOB 1P53A 4PJGF 3SDAB 5MENA 3W0WD 4UNUA 3FO2B 3TM6A 4L9LB 1SY6H 2DM2A 5E08L 3EKCA 6FABL 4K7PX 3L95A 3K2UH 2I5YL 4X4ME 4Y1AE 1LO2L 3D39D 2D7OA 1FIEA 4KJYB 1LEIB 4PRHD 3L3KB 1T5WA 3B6SA 1IC4H 1I7TB 1JTOA 1GAFH 5I66A 1U8KA 4WWKB 3KHQA 3V4UH 2ICWA 5DT1L 3AS1A 3H42H 2ARJB 4BFBD 1F4AA 3I3EA 3EOTH 5GGTA 2ZPKL 1FCGA 1PGRB 3G6AB 1OWRM 5IWLC 1JGEA 4H25B 3AMKA 4HF5H 4HQQL 1MCJA 2E7LA 3KYKH 5EUOB 5INCB 1MFDH 1JGLH 1QO3A 2BVTA 1J8KA 4LHJB 4DK3A 3KPOB 4AQ1B 1FFOA 4GMSL 4NO5B 2EDEA 4E41A 5C9KA 5JIPA 4XT1C 1JZ8A 2Y4SA 1EJ6A 2DDQH 4UIMA 4NNXB 2X1PA 4POUB 1SY6L 1GGBL 4G7VL 3OSKA 1S7XB 4DAGL 3OXSB 1K4DA 4MAYC 2Q20A 3TBTA 3L5XH 3P0VL 5JDJA 4F57L 1CTNA 4LSDA 4M6OL 2BRRL 1P9MA 3O9WC 3V6ZB 4OZIB 4NQEB 1CGXA 1U2CA 3QDHA 4HXAL 3D0VB 1PQZB 4PJDA 1IEBB 3C2AH 3D2UD 5LGHH 4Y2DB 5GISH 1LNUA 3L6FA 2ICWJ 3TNMB 4HSQA 3JTSA 1KN4H 2A83B 5DFVD 1HHKB 1QR1A 1QSFD 3STLA 1E6JH 4L8SC 4YHKL 3DVFA 4FFZL 3WE6B 3CZJA 3B8SA 4D9RE 3L3DB 1Z5LB 1IGYB 1T2JA 4BQ8A 3V79C 1UA6L 3BKMH 3OAYH 4WNQA 4A6YL 4M9OA 5I1IH 5BQ7B 1WLHA 3TN0D 2F54D 4TRPL 3I6LE 1SJVA 3V6FB 1OL0A 1KTLA 3PGDB 4YDJA 2GFBB 2M8XA 3L3OA 4V2CB 3VFVB 4BQCA 5ICXB 1T7WA 2ZG2A 3PWPA 3QR2A 4GMSH 4OKVA 1YMMD 3N1PC 4KROD 4XXCA 3RWFB 5MEPB 3DUUA 4RA0C 4XH2A 3MO1B 3BPOB 1OLZA 1MQKH 4ZAKB 3NH7H 5CILH 2BNRD 3K46A 3KPPB 5I1HH 2FHFA 1GZQA 1FLRH 2X7LA 2B5IC 2ZPKH 3ZE0F 2Q7NA 4LVNB 1MLCB 4W4OC 4Z0BL 4WFED 2NY4B 4Y2OA 2UWEE 4LVOB 3VWJB 4L8CA 4ODXB 4POYA 3SOBL 4JZOB 1A9BB 2JK5A 2AEPH 3HMWH 1WBYA 2A6DB 4M48L 1MWAA 3BP6B 4JHBA 4XNYL 4GKOA 4ORGA 4OUUA 3VCLA 1ZA3A 1IM3A 4U4BA 1IGYA 4HX1B 4ENED 5I8KH 1KJ2H 3FN0H 3IFOB 4RZCA 1U6AH 3QCTH 4KK5D 3UBXA 1NKOA 1T83A 4WI2A 4BZ1L 3MJ9H 1AGBB 4JR9L 4C57C 3JTSB 2DQTH 5I8KL 1VEMA 4MD4A 4WW2F 1OTTD 3HMXA 3WNKA 1KEML 4DK6A 4WW2C 3TWCL 4X7EC 3K8MA 3E2HA 2X1XR 1LD9B 1KLUB 1PKQE 1MVFA 2BNQA 1S7QA 3P9LB 1KIUA 2C3VA 3IDGA 1NUNB 1KIQA 5EFIB 1WCBA 2D9CA 2PR4L 3ULVL 2EYRB 3FZUC 5E8PA 3DLQR 3DV6A 3MBEB 1IT9H 3V52H 4R9HA 4L8SA 2Q8AH 3VFRB 4Y8AA 7CGTA 2XRAL 4LSVH 1YEIL 3VXMB 5HYQA 3QDGD 1CU4H 4GG6F 4QTHB 5IMMB 4OB5H 4LRIC 5AG8A 4TSAL 3PQYD 3A0OA 4N9OB 5DDHB 1HH6A 1NFDB 2Z91B 3HI6L 3MZTA 4RMVA 4Z7UA 2VQ1A 2OX5A 2IPKA 2VDNL 3IKCA 3GJEB 3O6LL 4LPXA 3UX9B 3CFKA 1AR1D 5TF1H 3MXWH 4CVZB 5CUSH 3KLHD 4PJ5B 1MHEB 3X17A 3QI9B 5DMGD 5JPNB 2VDNH 3IFPA 4P9MH 2YHGA 3SDXF 2C3GA 1FZMA 3T0EB 5AYUL 1BJ1J 4XNMB 2VDRL 3MLPA 4JFQA 1LEIA 2Z9TA 2BHZA 3ZYIA 5I1CL 4Q6YA 1GL4B 3T3ME 3AAZA 1HYRC 1P2CB 3FMGH 1UXWA 4ZS7L 2AQ1A 2J5LC 1PDKA 1E4WH 3TYGH 2L7UA 3MLUH 1TZHB 4NRXA 4OFPA 4ETYA 5EULV 1S7TA 3B2VL 5KSBA 3NMEA 3HR5B 1S7WB 4Q2ZB 3WFHB 5K9OB 4GLRI 1KT2A 3QUMB 4OCWL 3UZEA 4UAOB 4OCNC 3ET9F 3OJ2C 4PJIA 4ZTOH 4ODUB 4L4VA 5J6GA 1MCQA 2ZCHL 2NTFB 4YFLI 3I6GA 4JFZH 1LEKB 4P57B 4JGMA 1G9NC 1Q9OB 1G9MC 4JDZB 4M62H 5JLZA 4NIKB 5ACMA 5LWYH 2WLYA 4YC2C 2X05A 4NO0A 2OSLB 5D6CB 4F7MA 2XQBH 1A7PH 2ITDB 5L6YL 1HYSD 1NC4B 2DWDA 3RAJH 1M1SA 5C0NC 4QO1A 5I18L 1ZLVK 3LQAH 4F33A 3DX7B 1EFXB 3MOQA 3U4AA 2BDNL 3BO8B 5FM4A 4PJ9D 2YUZA 4OD1H 3V2AR 2H3NB 4M6ML 1IFHL 4FTVA 2Y06H 4N0UB 4GAGL 4TUKH 1T2QL 4ZFOA 1TENA 3MROB 1A6ZB 1QPXA 1VA9A 1K6QH 2CLVB 4PG9A 2YD9A 1Y18A 1H5BC 1NBVL 3T0XA 3HG1E 4OF5A 1Z9LA 5IWLA 5J3HD 4WO4C 4XCNB 1GJIA 1MELA 4WUUE 4O5LL 4FXKB 5F89B 1JV5B 1PZUB 2AXFB 2GI7A 5J4MA 1B9ZA 2W1NA 4XP9L 4X6DA 1F5WA 1XIWC 3KPQA 1CLCA 4KVNH 4WEBL 4YBLC 4U0RC 3OKNB 3H9SD 3RKPA 2O61B 3F6LA 3CVIL 5CKGA 3FO1A 2YC1B 3D25A 4IJ3C 1FORH 3L3HB 5ID0B 2J1KA 3BJ91 2DQHH 2SEBB 4APQA 4UTBH 3WN5B 4M93B 4X0KB 3U7YL 3ARFD 3ZSSA 2ADIB 4P46C 4D0BB 3IVKA 3QUXD 1ZGLP 1G7HA 4L4VD 4YHML 3FHQA 3GB7B 3RTQC 1UM6L 2XWTB 1KN2H 4LASH 3FO1B 4Z7QF 3D39B 1FNSL 4XXDB 1CFQA 2CRYA 2VXTL 3CSBA 1BEYH 2GTWB 2D0HA 3TNNA 3C5JB 1L7TL 1Q72L 3VFUA 4HXBL 4G43A 1FPTL 2G75B 4WFGE 5MP6H 1KELL 4YZFF 5F1SA 3V6BR 3EO1A 4Y5XA 1KJ3L 3CMOH 3OX8B 4JQIH 3VE0B 3L9RA 4XI5D 4J4PC 4RFOL 5BJTA 1CD8A 2DKMA 3MV7E 1NUFA 5C0FB 1W8NA 3DJ9A 2QKIA 1R6VA 2E5EA 2VLJD 4N0UA 3VWKA 1CR9H 4RFOH 3VMNA 4QRRB 3K8KA 5ANMB 1JRHL 5K59E 2XZCL 2BCKB 3HZMB 3RZCD 5C9JB 3QEQA 5EU6E 5ITBH 1CFTB 4X4XA 3X13B 4HMCA 2F53A 3TBWB 3TWCH 5EO9B 2WZPD 3QI9C 1NL0H 1F6AB 5JW4Q 3U9PH 3TH4T 3F7YA 1AFVL 4NO0B 2CH8A 4I48A 2YXFA 3C5SB 3DROA 4RWYL 2DIJA 4H5SB 5IB3B 1WZKA 4LL9A 3ZKND 3C5ZB 5CBEA 4XBGA 4YFDB 4D9RD 2FB4H 4CGTA 5IFJA 4Z7VE 1JPSL 4MNHB 5L8JB 1J0IA 2BSRB 4L4TA 5ISZE 1QBAA 2C3WA 3QXTA 5E1AB 1DP0A 3ZZ1A 4AYFA 4UQ3A 5DVMA 4ZDHA 1G1YA 2JELL 4LEOA 2X4PB 4RGOL 5D5MA 5EU4A 3WHE1 2GAZA 2BXZA 3TT3L 4G8GB 3BW9A 4PV9A 3P11L 1KCVH 3B3IB 1P2CA 2D7TH 2FH6A 4BSVA 3V0WH 4MDJB 4K94L 2BRRH 5EOCL 3MNZB 5HJ3B 5BV7C 1U8NB 4FHBD 3CGTA 5BXFB 3K4AA 4NBZB 5JTWA 3T65B 1NCBH 1A8JH 2IAMB 5FECB 1HKLL 2VWEC 4L9DA 2MOVA 3EBAA 3GI8L 4FQPA 1RIHH 4RGMC 4S0UC 1DQML 4U33A 5AZ2H 1HXYB 4ZFFA 1N0XL 1R3KA 1TQBB 2V7HB 1S5HB 5B39B 2XFXA 4DGVH 1T20A 5IGXL 2V5SA 3TBVB 4LCIH 2BOBA 2HH0H 3INUH 5CJ5A 3GMNA 1YN7A 3PDDA 4D8PB 4EBQL 5J1SC 1AJ7H 3RI5F 1MJ7H 3WFDH 5FOJA 1LMKA 4RFEB 1J87A 2DQGL 2IH1B 1BOGA 2W65A 5EZLA 4E41E 5IIEB 4XXCC 1JCKA 1BX2B 4NHCL 2G5RA 1KEMH 2ZSWB 4LVHC 5E00B 4HT1H 3PABB 2PW2B 4JGUA 3MUGB 3RVVD 2E7LE 2H2SC 3GI8H 1KIQB 2YSSA 3VD5A 4KMQA 4N0FA 4NQCA 3T2QA 3SKJH 2I07B 2W0FB 2J8UF 3O45B 3JWNC 1WK0A 5CJOL 2I5YH 4MWFB 1NMBL 4X6FB 5D96B 3NPSC 5I18H 2NY6B 2IF7A 4QRUA 4F7PB 1SMAA 2Q8AL 4R4FL 4JFDD 5A43C 4YK4C 3C8KB 3DX8A 5I2IB 3LY6A 1Z0MA 1F90L 12E8H 4PD4J 1KEGL 3KLHC 1RZ7L 1OAZL 4MA8H 1TPXC 3IDIB 5CHNA 4XNZC 1QBMH 3P11H 4KVCL 5HI4D 2YD3A 5EBLB 2ITDA 3LKSB 4PG2C 4LPVA 5IBTL 1QFPA 2M1KA 1T1YB 4WO4A 4UIKH 3BP6A 3K74B 4DN3L 1OAZH 4MA8L 1SYSA 1VADB 2A9ML 4MJ6B 1F3JB 4M1GH 4QNPF 2R9HD 4Z18A 1RAMA 3QQ3A 4JFOB 1C7TA 1ONQB 3UTTB 4CADB 3GMQB 3N9GL 2VN4A 3SE3A 1AXTL 5CJOH 1F2QA 3MJ9L 4WVRA 1NGXA 3ARDD 1NEZB 1S78C 2QLVB 2R0KH 4YDLC 1YEJL 1AKJB 3ESVF 5I1KH 5BS0B 4WI9A 1PD6A 2DQHL 1WFNA 4YWGL 5EUOF 1I75A 4M93C 1E28B 1A47A 1S9XB 4MCYA 5E8EA 4ZNCD 2YKLL 4G6KL 4ZO7A 1U8OB 3TPUB 5EBGA 4BSJA 2B1AH 3DOSA 1KUMA 5L9DL 5F1IB 4PRHA 1CR9L 1SY6A 4NC0B 5IFAH 1CXLA 3WL9A 4K07A 3SO3C 1YECL 3U7WH 3DSFH 1T3FB 3FQXB 3UDWA 2WQRA 2KZ1B 2B4CL 1HYSC 1NMCB 4NZJA 1YNTB 4UOW1 1SMOA 3FRPA 4LHQB 1MHEA 4Y16D 2J4WH 1X6LA 4OZGF 5AYQA 1EK3A 1B0GB 1I8IB 4ONHB 3G6DL 4L5FH 3GSWB 1A7OL 1N6QH 5JNYA 4UT6L 5B8CA 1U8IA 5I1IL 4I77L 4QRRE 2HT4C 4U1LB 4ZODA 3U0TA 2BY1A 3TA3C 5IHZA 1N8ZA 4MDIA 4LCYA 5MEOB 2VXVH 4HZLB 1U8QB 1X44A 2RIKA 4GSDL 1X5ZA 4S2SA 4M48H 3HTLX 4WO4D 1XF4A 4MA3B 1S7SA 4NZUH 5DLML 2CRZA 1HE7A 5CGYD 1M7IB 3BP7A 3U46A 3BGMA 2QHRL 1YMHB 2R4SL 4Q9QH 3WO4B 3QUXB 5C0GB 2VZ3A 1UJ3B 32C2B 2P8LB 3QXAA 1AGDA 4Y5YC 1E4XI 5D2LB 4PIRF 1WTGT 5C0DA 4K3JH 4IRJC 1F6LL 4R8WL 1IAIH 1XGYL 5DWUH 4K23H 5DHVA 4UT7H 2JE8A 3RWGA 3B9DA 3TFKD 4F7TB 1ERNA 4ZUUB 4E5XB 4OSUH 1U6AL 3QCTL 3NA9L 5EO1B 4XBPA 2VXQH 4FP8H 3F8UB 2DTSA 3BKYL 1IQDA 1D6VL 3CFDB 1NGQH 2YD7A 2AAVA 4JRYB 2OI9B 3O11A 3ULUE 3DHMA 4IMKA 2OL3B 5T1LB 3N1GC 3LS5L 5F71A 4TNVK 4U1KA 3WD5H 5DJ0B 5I1HL 5EZJB 3DMMC 5MENB 1S7QB 3QG7H 1H8SA 2HFFB 4M6NH 1FNSH 1XGQA 2BSTA 3VFNB 5D1QB 1G0YR 1P4IL 1DE4B 1MIEL 2PCPA 5EOQL 3FB7B 3I85A 3QULB 3LAFA 3EYSL 1KTRL 3S5LG 1T7ZA 3PWVA 5TFSH 4XCYA 5DUBA 2GFBA 3RVWD 3IFOA 3AREC 5EA0L 1N59A 1RULL 3MREA 3VCLB 1UYWL 4P4RA 3UTQB 3OPZH 4JFFA 5ESVB 1C5BH 1CFBA 2AJ3A 4NNPH 3U30C 4QHMB 3QIBA 5DEZA 1HIML 1CICC 3ARDA 5HPMA 1U93B 1TQBC 5C0BA 2CLRA 3HNVH 4YHPB 3LN5B 4HH8A 1MHCB 3CC5B 4R2GD 5ICYB 4H8WH 1NGQL 5IBLC 3SDDC 3FB7A 4KY1H 1BVLA 1FFNB 4JM4H 3O6LH 5JOFB 1KV3A 2XZZA 3QEHB 1KG0B 1IT9L 4IEFB 4JFOA 5BRZD 4QCIA 1V3JA 1G7MA 5DUBB 4LRNL 4MJIB 5TDNA 3QA3B 1PLGL 5IEKB 1IC5L 3PDOA 1MCOH 5JORA 3QWOB 2G60L 2JJTA 3VXNB