2HJKA

Crystal structure of hla-b5703 and hiv-1 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen B-57
publication title Strong TCR Conservation and Altered T Cell Cross-Reactivity Characterize a B*57-Restricted Immune Response in HIV-1 Infection.
pubmed rcsb
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hjkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2hjkA01
3GSQB 2X5PA 4WWKB 1NCBL 2I60H 4ZD3L 1UGNA 2IAMC 3DIFB 1FBIH 1KEGL 2X4PB 5FYKL 1TZIA 4N5EA 3KG5A 1AI1H 2NR6D 2IQ9H 5T3XH 2NY4C 4RBPH 2H2PD 1UM6H 2XQYK 5FGBC 4JREC 4MSWA 3DBXA 4O5LH 1GGUA 4Y4HB 5EDXA 3GSVA 4P3CL 5FFLA 1PYWA 5IF0A 3RGVC 4XNYL 3IFNL 3GSRB 4FP8L 1NBQA 3NCYP 2Q8BH 1DQJB 4NWTL 3SE4C 1DL7H 3EUUA 3EO1A 3F58H 5IR1B 2EYTA 3K4ZA 5I1AB 4G42A 2NY6D 4UQ2A 2A9ML 3KPQA 2PYEA 2C1PA 1W2KT 4KK8C 5F9OH 1OCWH 1WZMA 4MAYB 7CGTA 5EIQA 3MGAA 5SX5K 1AD0A 2X42A 3MQIA 2XKNA 1ZAGA 2FBOJ 3RNKB 5C9JA 2IPUG 3RWHA 5IHLB 4Y4KA 4CUCA 2ATKA 2OJEB 4F15B 4JHAL 2HT4D 4OIIL 1NFIB 2YPLD 3DI2B 3DSNA 5EBLB 1YY8A 4P0DA 3NGBB 2VL5A 4U3HA 3RNQA 1PVHA 2UUDH 4XBEH 3CFBA 1P7HL 1KF9B 2K9UA 3F7VB 4F7TB 1AIFB 1I8LC 3ETBF 1N7ML 3OAUH 3X3FL 2EDNA 1OD9A 3ILQD 2ZZUT 2G2RB 4OB5L 3SCMA 3CNKA 3BRDA 3PWJB 1OF2A 1RUPH 4UZGA 4D9LL 3S88H 1YPZB 2EIZA 3SPVA 3K80A 2ADIA 4PRBB 3MX0A 4ELMF 3VCLA 4G6AD 5DMJB 1T1ZA 1IGIL 3BDXA 4X6DF 3BQUA 3LB6C 4V2CB 3FB5B 4XVUD 4FQCH 4P4KB 4OSUH 2G75A 5DJ2B 1KLUB 3C60B 5JQ6H 1PEZA 2VABB 5F7DB 5K9OA 3DWTA 4HJ0D 4LCWE 4WFED 2IFFL 4BUHA 4OZGA 3QRFM 4LCCA 4HBCL 2R2HB 3N1FC 1T20B 1ZANL 4XBPB 3MBXH 3W0WE 2VDPL 1NUNB 1J8KA 3TA3D 5GSVB 4QGYA 4EQ2A 1CICD 5C0CB 1N5YH 1T3FB 4M9PA 3E3QA 2YA0A 4JRYD 5F96H 3UC0H 2R8SL 1W8NA 2C3XA 5DC9B 1BF8A 1LEIB 3T8XA 1UQSA 2P47B 3RY5A 1G9NL 4CDHA 5TE6L 1IM3B 3MV9B 2VZVA 3I6GA 5BJTA 4KI5F 3U46A 4JHZA 4HKJA 5BVJB 2XZQH 2OTWA 4S0SD 2A9NH 5TDOA 5F7HA 3SJVA 1YNKL 5EH1A 5FA3A 1DLFL 3T3MF 3P9LB 2EE9A 4UILH 2QLVB 2FNBA 5SX4H 1WBYA 1E4XL 5LAXA 5CWSA 5D5MF 3L3KB 3B2UD 1NGPH 1R3LB 3H3PL 4OUUB 5FUCE 3RWDA 2GK2A 2QADD 3TBSB 5DD5H 3MV7B 3DI3B 4XX1E 2H41A 5CEYB 4UB0L 1ZGLB 4P5KB 4WO4C 4HUXB 4YBLB 4HIJB 2SEBA 4GAYB 4ZUTB 4Y4FB 5I2IB 4HCRA 4RSVA 4N8VG 5SWZA 3TF7C 1BZ9A 1KFAH 1JGLL 5GGSB 3UP1A 3C2AH 3IXAA 1YEDA 3MRCB 4OGXL 4KTYA 3BD5A 2EC9T 1T7YA 3ILPB 4X9IA 2DBJA 3EYQD 2DKMA 3O2WL 1YEJH 3AROA 2OL3A 3B9KB 1MH5B 3KYAA 1CN4A 5ESAA 3MACL 1I1AB 4I2XB 3TO4B 1ERNA 5JR1H 1WIPA 5I1EL 5DMKB 4ZUSB 5I18H 4YFLF 1FAIL 1S7QB 2WM0A 4K2UL 4WW2B 4XP1H 1OGAD 1F6FB 3BMVA 3R06A 4R96A 4UNTA 4IOIB 5DJ0A 1RIHL 5I17A 4KPHL 5E2TL 5I1IL 1JMXA 1JZ6A 4R7NA 1AQKL 5ISZE 3UTTB 3VFWA 4RGMC 4RRPG 3HHRB 3TT1L 5EOCL 4QRSB 3O3BA 1WC7B 4RAVB 3HI1B 5KOMC 5J12B 4KHXL 5EU5B 3EAKA 1FLRH 4WDIB 1B6UA 1H8OA 4JFEE 4X5XB 3CLEH 3K81A 1BOGB 1UYWH 4DGVH 4I48B 2R4SH 4L3EE 1CLOL 1QNZH 3L1OH 3VRIB 1GIGL 4OJFH 4U49A 5FB8B 3O9WA 2VDRL 3MJ9L 1CCZA 4LAJH 5MEPB 4MLIA 5I8OL 1H8SA 3MOAH 4BH7B 1M7IB 4BYHA 3HC4L 3V6ZB 4MXQA 4YWGH 3MJ8A 5KSBA 2FLBT 4EI5C 2IGFH 3BIBX 3QPQD 4O2FA 1BJ1H 2GJ6B 2W9EL 4G80B 4M6NL 5KOVC 3QWRA 5E8EA 1EXUA 3PWPD 5DTFB 4M43H 1JTTA 1WZ1H 4TTDD 3ZDZE 2KKQA 2RQ8A 4YIQB 3SO3B 3MZTA 3Q48A 2VDLH 4DVRL 1C5DA 4GKZB 3UTPD 5D1ZB 3RP1A 3L5WA 5IMMB 5DUMH 5JDJA 4WI4A 1QPPA 1JHTB 3KLHC 2AEIT 4OLYL 1HEZB 3ULVC 1E0OB 3E2HB 4Z77B 4U1MB 3QFDB 4YHKL 4KDTC 3WNNA 3RY6A 2MCPH 2WWMD 3QUYA 4YX2L 1LQVA 5C07E 5GJTH 1BP3B 2AK4A 2HTKC 3WUWG 4BFEA 2AV7B 4NIKB 4J3TA 2JB5H 5AG9A 1A2YB 5JZ7C 4RQQB 4NWUH 2QQQA 1KBGL 1G9EA 2E3VA 2AXGB 5IHZB 4L8SC 5F7WC 5CEXB 2BHUA 4AQ1B 3QXVA 2VDKL 4OZFG 4KUCF 3ARPA 1XGQA 1NEZG 3DROA 5KTEL 2P5ED 1RZGA 4KI5D 5T3ZL 1RK0A 1FNSL 5SWSE 3QUXB 4WNQA 1UWEH 3QG7L 4OAWB 4APQB 4XXDB 2ZJSL 1VA9A 2AXFA 3TCXA 2H8PA 4Z76B 3CH1B 4NJ9L 2IQAA 4TN9A 4ZQKA 4V1DB 2VZOA 4Z7WB 1NGXA 5HXMA 3IDUA 3PHQB 1M7DA 4DK6A 2ESVD 4JLRA 2ZKHH 3OXRA 5ENWB 1QO3A 1EUUA 4KRNA 1DQQB 1IZJA 1UH4A 2YA2A 1AKJA 1E4WL 2XWJA 3AREC 3BXNB 2AV1A 4BZ2H 5KS9E 4K3JH 1IAMA 5IROC 5F97E 3VFUA 4NJAL 3MOBL 1DUYB 4CU6A 3VGBA 4RGNB 1OTTD 4XAKD 2DQUH 4RZCA 4Z7VE 3WN5A 3QA3B 1E4XI 2NXYC 1IL1B 2XN9E 2F58L 4YNYB 2OR7A 1X5GA 1CDJA 1Q1JH 2FO4A 1KSRA 3VRJB 3UTSA 2AJZA 3PABB 2R23A 1G7IB 3T0ED 1HIMH 1A4KB 1BEYL 3GRWH 5GXBB 2VC2L 5KSVB 3F65A 4JY4B 3MV8D 4OD3L 1FFNB 2ZCKL 4LDLB 2APFA 3JWOC 1NDGA 4JQXA 4NN6B 4ZUUA 5I16A 1K4DB 3QO0B 4JFZL 1KJ2A 2I07A 3CK0H 3D2UB 4PJEB 2A6JB 4AZ8A 3PWUB 1ACZA 1R3HB 1QSEA 1IC7H 3W11D 4BZ1H 1S9XB 1UM5L 5JW4N 2YPLE 3VXUE 5HI4D 4Y5XC 4ODVL 1BQHG 3ARDD 3WFBH 1D5XB 5L7XH 4XP4L 4WGWB 3SDDD 4HJGB 4RDQG 1GC1L 2EYRB 3WFHB 4F9LA 3VXQB 1VB9A 5KN5A 1JZ3A 1OAQL 1G0YR 1A22B 2X4OB 3JBG7 2E7HA 1YPZF 2FIRT 3G9VA 5GS3A 1JGEB 3HMXL 4MDJA 4L9LA 5D1XB 4B41A 1INQB 1WK0A 1QLRA 5I74C 1OM3L 5MHSD 5CSZB 3M45A 1GGBH 3BO8A 4UOW1 4GKNB 4PP8C 1XCQA 3MXWH 5E4EC 1BQLH 2BSRA 3UAJD 4JFDB 3H9ZA 1MCOH 4L4VA 1L4IA 3ET9F 4YXHH 5F9JA 2XFXB 1D5ZB 1YEIH 1NFDF 3MRFA 5B3JE 1BM3L 4WFEE 1RZJH 4PGCB 4MZ2A 4BSWB 2DQTH 3BEVA 3FO9A 3QEQB 2AEQH 4R3SA 2CLVA 3RGVD 5JPNB 2D7TL 1ZHKB 5GS1C 4LAQH 5GQBA 4HCRH 5C9KA 4F33A 4KKCC 1Q72H 3IGAA 3VFPB 4IBLT 3IDXL 1MFDH 3QHZL 2QSCL 1EEYB 3V9FA 3L3GA 3QEGL 1I3GH 3DO7B 2JB6A 4KK8D 4EDWH 4G6KH 4JRXB 1PKQA 4LHUB 1RPQA 5A40E 1X5XA 4ZUVB 2DWEB 1IMHC 4D0DA 3FHAA 4XX1G 3X17A 3FO1B 3S3SA 4S10A 5I8EA 2YEZA 4KUCD 4U0RC 3MCKA 2VLRB 4ZO6A 2GAZB 3A6OA 5FHBL 4WUUA 3WO4C 2GSGB 3TFKA 3QDJB 2ZCLL 2Z92B 4NN7B 4GRMA 1QBLL 3EJYD 1K8DB 1FH5H 1HXMB 5E1AB 2VDNL 3FQWB 4PJIE 4ODTL 4U6XA 3ARWA 2HN7B 3RWIA 5JLZB 3ROOB 3S4SB 2BY1A 1IM9D 1X5FA 5HDLA 1JF1A 2I5YH 2FEEL 5AG8A 4JB9H 3LZFH 4U1NB 4JO1L 4OT1H 2MNUA 1VFAB 2FJHA 4Q6YA 1U91B 1QKZL 3KYKH 35C8H 4HD9A 1U8LA 4PREA 4ALAL 3RWCB 5KG9B 1EUTA 5CKGA 1GYAA 1I3UA 2FR4B 3K74B 1TJIH 4Y4HD 3D6GA 3LB6D 5K9KA 1TJHL 2XY2A 3MLZL 4WW2F 1YMHA 5C3LD 3BIAX 5FOBA 4P9HL 3WS6A 1HHKA 5DA0B 5TQ0L 2FX9H 3AS0A 3H9SB 2I26N 4LIQE 2CRMA 1OGAE 3RDTB 3T0AA 2BVEA 3VFGH 4QO1A 5JA9A 1S5HA 5BVPL 3RBGA 5E2WL 5DJAB 1R5IB 3L7FA 2HVKB 1S7UB 4XPAH 1HYRC 3O3AB 5IGXH 4F37K 4H1LH 2H1PH 1GHFH 1JTOA 4Z7OF 4AENB 5DRNB 5IB3B 1UFUA 2B4CC 2ED8A 1VPOH 1PEWA 1M1SA 5H37G 2WINA 3SY0A 4CN6A 1XF4B 1U8IA 4KK9C 2DL2A 1HWGB 2AK1L 3PE9A 3T04D 4A6YL 3N1QC 1CFQA 1CR9H 2P24A 4PJXB 3CMOL 4YGVB 2ENSA 2IPTL 3PV6A 2PO6A 5DR5L 3O11B 3FOLB 1L8JA 1FYTA 1FL6B 4NKQB 5HDOA 5KSAC 3DGGA 4HFWB 4LVHC 3V0VB 3LIZH 3VJ6B 4JFYA 1UACH 2HA1A 3VFTA 5T33H 3HAEB 3F6IA 1BAFL 3VWJB 4HWEH 4F7MA 4OQ1A 4N0UB 4NBXB 3U48A 3VFOB 4R97B 3SDXA 1OSZA 1ADQL 3PWPE 2AJUH 3WS3B 4ELME 4P4KD 1T6WA 3PQYA 5E5RB 1OPGL 3D0VB 5JIHA 4X6DE 4O2CA 3C60D 1EV2E 1CK0H 1OTUC 3KS0J 2F53A 2XRAH 1S7XA 4HXAL 4FXGA 4PB0H 4KQ3L 3FZUD 4I77L 3RIAK 3UTPE 3V6BR 3VA2C 1LK2B 3I6KA 3L5XH 3TEUA 2AQ3A 2BXZA 3U4BH 2R2EB 1FSKB 3IS1X 4UT7H 1MUJB 1DBAL 3P9WB 4GQPH 4Q7DA 1YY9C 1IEBA 1SBSL 1RVFH 1NGQL 5KANI 5C0EB 4NQDA 4Y19D 3LN4A 3HNSL 1JGUL 3FQXA 3P9MB 1IRAY 5DJZA 4MJ5A 2GTZB 3STLB 4P5TC 3ULUD 3WCYA 1B0GB 1IARB 5F7EH 3MLUH 2E7LA 4EVNB 3MV9D 5D71H 1KENL 1I7RA 1VADB 1BPVA 3VFNB 5C71A 4WJ5B 4YUEL 2Y36H 3CVHB 4YK4C 5IBTH 5E08L 1A6TB 3VI3E 4KI5E 2ARJA 1G0DA 1J0IA 3C5ZA 3TBVA 4P2OC 5IVXA 1UB6B 2OJZL 3HZMB 2BVYA 4Z7WF 3O3DB 3T3ME 1A1NB 3QCTH 1RUQH 4KKBC 5GZOD 4R4NC 3MV7D 2N7BA 1N6QL 2Y06H 2FIKA 5D5ME 4LNVA 1BIHA 2EIDA 1K5NB 1U93B 3KPRA 3U83A 4JN1L 4Y4FD 1QYGL 2VSDA 5CP3H 2QR0B 1HQ4A 1J11A 5HYEA 1I9RL 1T2JA 3TT3H 1W8OA 3QG6A 5DVOA 3B6SB 4MJ6B 2I24N 3CZFB 2VE6A 1IKNC 4PGZA 3B9KD 3OPZH 4ODSL 4O9HL 2VLKA 2PTTA 1CGTA 2P7TA 4XAKE 1I1AD 2LU4A 5LBSH 3TO4D 1T21B 3EYSL 1CFVL 5EA0L 5ACMA 3PDOA 4PJCB 2W0LA 1EO7A 4ENEC 5LQBL 4L9DA 1CS6A 2G60L 4KVNH 3VW3H 1MWAB 1P1ZB 3L3OB 1MQ8A 1HWHB 2UVFA 4AEIH 1AHWB 3ABZA 2UWEE 3RWGA 3U30B 5JXEA 1XT5A 4YHOL 4J12A 5JW4M 1RUKL 3FFDA 1HILA 2FEEI 3GUTA 3MJ9A 3T0EE 3QUMH 4ODXA 4KDWA 1TZIB 4G7VL 4HK3N 5CINL 4QHLA 3LS4L 3UTTD 4MSWB 3DBXB 3T0XA 4PJEF 2Z93A 1YUHA 4M3JA 2XZAH 3GSVB 4ONGH 5E8PA 1PYWB 5IF0B 4RGOH 3EDDA 2W1NA 2ITCA 3RL2A 2DLFH 5F1OB 1AXIB 3EO1B 1MEXL 2DB8A 4PJ9A 5I1HL 4PIRF 3W9DA 1AXSA 4XNUH 1FJ1A 4NPYA 2EYTB 1C08A 4HWBH 4G42B 5I15L 2J6EH 4UQ2B 3V4PL 3SDAA 1I9JL 1FORL 3KPQB 2PYEB 2C1PB 4FQIH 1Z5LB 3KPOA 4XCFL 3ULVH 3MRPA 3X11A 2WUCH 3ARSA 5GGUA 1AD0B 1P9MA 2GIYA 1PZ5A 2XKNB 3P4NA 5C9JB 2VXTH 3RWHB 4PB9L 4Y4KB 1NMBH 5KJRL 2ATKB 1KYOK 4LSRL 3REVA 1I8MA 2VXVH 3OBAA 1INEH 1NMAL 1YY8B 1E4KA 3ZKXC 5GSRA 2VL5B 3RNQB 1H0DA 2C9AA 2GJ6D 1LK3H 4CN1A 1S9WA 4PS4H 3CFBB 1HNFA 1NCBH 1M7XA 1UWGL 4ZD3H 2D03L 5MHSE 3N50A 5F9DC 3V52H 5GHWL 4GXVL 4PV8A 3C08H 2HT2C 1YJDC 3V7MA 1YEEH 1N4XH 1DUZA 4JPVH 1CDBA 5F6IB 4RAUA 3SCMB 5D1ZD 4L3CA 1OF2B 3H8NA 2DTSA 3SE3C 2EIZB 4XNYH 3SPVB 4AY0A 2RAMA 4NWTH 4M6AA 3MLWH 3ZZ1A 2ADIB 3AS1A 4I0KA 4Y2DC 3VCLB 2NXYD 2OMNA 1T1ZB 4BKLA 3GSNL 3BQUB 4HQQH 3I75A 2QL1A 2Q8AL 5EU3A 3KR3H 4YE4H 2G75B 1UJ3A 5CZVL 3MRJA 1VACA 5K9OB 3LVEA 3BKYL 3ARBC 2YD3A 4OZGB 4LCCB 5DD0L 5A3ID 5I1CH 5JMOC 4HMDA 1OGTA 2EXWD 4POZD 2JCCA 3N9GL 1W72L 3WFZA 3ZKQD 3QUXD 2LVCA 4APQD 3T8XB 5GGVL 4LKCA 1UQSB 2V6HA 3FO0H 1T0NA 5C2BL 4V1DD 4JKWA 5EOQH 3X3FH 2OBGA 1JHLL 3UYRL 1C5BL 3FT2A 2VDML 4OB5H 1H8NA 3T4YA 3JWOH 4WI5A 3I6GB 5BJTB 5IMLA 3U46B 4IRSA 4HKJB 2OTWB 4QTHA 5TDOB 4ZO9A 3SJVB 3ZKMC 2ZNWA 5JDSA 3MXVH 5FA3B 4M5YL 1WBYB 4QRPA 3D1MC 5DJ8A 5C6TL 5LAXB 5CWSB 4RGND 2XYCA 1N0LA 1FO0H 4PG9A 2DL9A 3RWDB 1WV7T 1QFWL 2C3HA 2X4TA 4N8CL 1MVUA 4G43A 4XP5L 1CF8L 4CKVX 1HHJA 3ZE2F 1MAKA 4PLNC 4LF3A 3SKJL 2SEBB 3QNZA 2L7UA 1MI5A 4Y8DC 5SWZB 1BZ9B 4TSAH 3IXAB 1RFDH 1YEDB 4MD4A 3RX7A 5HBBA 1JRHH 2QSQA 5JHDA 1UVQA 4NO3A 3TIEA 2P5WD 3ZHKA 4C59B 2VDPH 4TVPD 2W9DH 1Y0LA 2IPKA 3PDDA 2OL3B 3HRZA 1FNFA 3NTCH 1NAML 2V17H 5CMAA 5ESAB 1NEUA 2M1KA 5DD1H 3H3KA 4U1JA 3D2UD 1J1OH 2XY1A 2HJFA 2AJYL 4NP4L 4QHKJ 3WYRA 3HMXA 1CLYH 1A6ZA 5I73B 5I76A 3ERYA 1U2HA 3IT8D 4Z95L 1DFBL 4X4ZA 3R06B 4R96B 5HVHC 1KEML 4JG0L 2WY3A 5AZ2L 3JTCA 5DJ0B 2C4FU 1D9KB 5ICXA 5I17B 2YMXL 4XAWL 5BV7L 4UTAL 4TVPH 1MRCL 3KLDA 4K71B 4PJXF 4R7NB 4XZUA 3BH9A 5KAQF 2K3TA 4UT9L 5C86A 3VFWB 2IBZY 2ZUQB 1DBJH 3O3BB 1U3HB 1EHXA 1MHHA 3H3PH 4X9GA 2GFBA 2ZG2A 4H20H 4UB0H 5DD6A 2V5RA 2OSLA 1YPZE 4K7PH 5D1XD 1IKFL 1F3DJ 3R8BB 1IBGL 4ACPA 4BFGA 1NMCB 4OLXH 3O9WB 5TGBB 3W9EA 4X8XA 1U8KA 4JFDD 3SE9H 4DCQA 5E2UH 5JORA 3VD4A 1NCCL 4WEUD 3I50L 3MJ8B 3W2DL 5KSBB 3OTTA 3U1SH 4JKLA 1V7ML 5CJQL 4TRPL 3IXTA 2A6KA 2HMID 5E70A 4KTEH 4O2FB 1A7RL 1DBBL 2CH8A 3O6KH 4Q9QL 2OK0L 3QEQD 1EXUB 3OSKA 1QSFA 3DVFA 1I7UA 4KROC 1U8MA 3RI5K 4L5FL 4K9EC 4Y19E 1S7WA 3N85L 4JN2A 4NUJA 3TCLA 2Y07H 2P4AB 1G6RH 1TCMA 4U33A 4WY7L 4X6CA 5GGQL 4LSTL 4L8CA 2VISA 3WIIL 2WW8A 5L2JA 1C5DB 4QHUA 3L5WB 1QR1A 1IEAA 3ULUE 5B4MD 3LQAC 1D9KC 4JRXD 4LHUD 5ICYA 2D31A 2VAJA 1X5KA 3MV9E 4ZAKC 3VG9C 3MMEA 3QUYB 2ZSVA 5DJCA 1ZT7A 1J8HA 1U3HC 4XB7A 5F3HA 4F2MA 4Z7QE 2AK4B 3IF1A 4JPKL 1YNLL 2VLRD 4DUWA 4ISVA 3PWLA 5JW3H 5EBMA 1IGJA 3T0DA 2YUZA 1T03H 1R3IH 3A0OA 4N1HB 3S6CA 5SX5H 4PTTA 1LP9A 4YC2C 2QQKL 4KC3B 4GQ9H 1IAKA 1MQKL 3MV7E 4JDZA 2LFGA 4HZAA 4I0PA 3GBNH 5DRXA 3RGHA 1XGQB 3DROB 1WLHA 2RFXA 4ZNEA 1RZGB 1RK0B 2AABH 3FRPA 4WHDA 3WHE1 4WNQB 1AJ7L 2B4CH 2Q3AA 3OAZK 2AXFB 3CLFL 2H8PB 3AAZA 4HT1H 3WJJC 4CMHC 4ZQKB 1RZKC 5HGHA 3GI9L 1V3KA 3C09B 3I3BA 5JOPD 1JZ2A 4PJCF 4NGHH 1NGXB 4GRWB 2QHRL 4PJ7A 4I2XE 1M7DB 2X10A 4G6FB 4DVRH 2A73A 4JLRB 3S35L 5DEGA 3OXRB 1QO3B 2YPVH 2JJSC 1CGYA 4FFYL 1IT9L 5C0IA 1WEJL 5A2FA 3RVWC 4P49A 4XWGL 1AKJB 2XWJB 3H9SD 1AR1D 2AV1B 4A6YA 4YHKH 3RDTD 3W5MA 3VFUB 4KZDH 2DWDA 3VFSA 5ANME 4X6FA 5TQ2H 5HSFA 2NY3C 1U8QB 4HIEA 4OKVA 4DN4L 5EU6A 4RZCB 2GQHA 4QWWC 3WN5B 3I02A 5GGTH 1EEUA 3UTTE 3WFCL 2CIIA 1J9CT 2FECL 4RX4A 4XMKH 3HPLA 1L7IH 4PRNA 2FO4B 4MAUL 5K59E 3UTSB 4HPOH 2AJZB 3TPUA 2R23B 1JFQH 4P5TD 3O6FC 3QJHA 2FGZA 3LKPA 1EFXA 3KXFE 4QXUL 4D9RD 4W68A 2E27L 1ADQA 1WGOA 2EDJA 2L4OA 1SYSA 3EYUH 2BP3A 3SKMA 5LWYH 3F7YA 2IBZX 2ITDA 1TMCA 1NDGB 4ZUUB 5I16B 1KJ2B 2I07B 3QG7H 2R1YA 4NFDA 3DTXA 3V0WH 1OAUH 5I1KH 2NZ9D 4NOFA 5DO2D 1QSEB 3LQMA 4ODWA 5IKCA 5D8JL 3MV01 1NLDH 4IOFC 1PDKA 4U6HA 3IFOA 3WHXA 1DLHA 2XQBL 4R4ND 5FYLL 3VWJD 4D9QD 5CD5C 2GJ6E 1KCSL 4M7JH 5DI8A 2F8OA 4OV6F 3Q3GA 3MOBH 3RAJH 1WZKA 1CXKA 3OKLA 3P4LA 5KN5B 1S78D 3LD8C 4GFTB 4UV4L 4MLSA 5B8CA 5I1JH 4YEFA 4MDJB 1MCIA 4L9LB 4K94C 1KB5L 5CZXC 3OWEA 4TQEH 5DHYA 3SDYL 2ARWA 1RJLA 4J2XA 5KVDH 1QLRB 2H9GA 4LPXA 1HOCA 1KC5L 4PPTA 1B4RA 1HSAA 3BO8B 4JQIH 1ONQA 1XCQB 2BSRB 2NPLX 2W65A 5HHXL 3VXNA 1DEDA 2VLMD 4JO4H 4L4VB 4M00A 4W4OA 4DKEL 5I0ZA 4GBXA 5F9JB 4OZGF 3MRFB 5L2KA 1JE6A 3BISA 2MKWA 4Q6IB 5JA8B 4R8WH 1HH9A 2WIMA 3BEVB 3FO9B 1JTPA 3GJFK 3FT4A 4R3SB 2CLVB 3QDGA 1X7QA 2XZCH 1CBVH 3RVUC 2MCG1 4YJZL 2FX7H 2CKBH 4F33B 1OP9A 1O0VA 2OR9L 3BMWA 3IGAB 2YD1A 4DQOH 5TE7H 3H9HA 4F7PA 4J3UA 2DQCL 3DLQR 3L3GB 4J6RL 4TUKH 2E9WA 5I9QB 2NNAA 2JB6B 4KJQC 1TNMA 3U9UA 4ZS6C 3C9NA 2DTML 5DHVA 1PKQB 4Z7WE 1JPTH 4Z8FL 3BGAA 1ZLVK 4X80H 5CHNA 4D0DB 2UVEA 4XP9L 3SOBH 4FFWC 4W81A 1T04A 5I8EB 1NGWA 2EDHA 3U7YL 2YEZB 3MCKB 5D7SH 1N2RA 1F6AA 4WUUB 1OW0C 4M7LH 3WO3B 1P4BL 4YPGA 4XPHH 4M7ZB 4N8PA 2X1QA 4GRMB 4RGNE 4JY5H 4EOWL 5CILL 1BJ1J 4F58H 1OAXL 4F7EA 4U6XB 2K1MA 3RWIB 1K4CA 1H5BC 5EORL 4BA8A 3THMH 2J2ZA 4U1SA 3MTRA 1JF1B 2EICA 5BV7C 2ZUXA 1LEKA 1WCBA 1V3MA 2FJHB 2D3VA 2B20A 3HB3D 3CXDH 1U8LB 5DFTA 4PREB 2P5WE 1C16A 2NY2C 4N5ED 4TVPE 3WLWD 4LEOA 4Q6IC 3SQOH 4HIHA 4A2MA 4KK5D 5I6XB 2VO5A 1AE6H 1RULL 5K9KB 1YMHB 4PJEE 3L6FA 5FOBB 1YJDH 1HHKB 2YD7A 3MBEC 4XPGH 1BD2A 3HC3L 5HI3D 1CGXA 4RA3A 4ELKA 4OFVA 3STBA 3TP4A 2ICWJ 5F9WB 1S5HB 2PYED 3S34L 3BEWA 3D9AL 2DJUA 2XT1B 1U92A 2VZ1A 1RY7B 1T89C 5D4QA 2Z9TA 3VU2A 3U9PH 1WICA 3P0YH 3PV7A 2ZPKH 1KCVL 2ED9A 4Y4KD 2VWEE 2VDNH 3GSXA 2FECI 3VWKC 3G6AA 4OUOA 1FRGL 3KLAA 4P3DA 2WINB 3D0LA 3SY0B 4PDCE 3GSNA 3DMMA 3LKQA 2A83A 1CFQB 2P24B 5HHVH 4M62L 3PV6B 1F4WH 2PO6B 5FECA 3JWNC 3QEHA 4NQCA 3U0PA 1FYTB 4NZRL 2JTDA 4YDKL 2QQNH 4IRJC 4JFDE 1MRFH 5KSBF 2HWZL 3DGGB 2B0SL 3SCMD 3RA7L 2CDFA 4TYUA 4JFYB 3MLRH 3QXDA 1TJHH 2YA1A 3VFTB 1VERA 1UH2A 4GT7A 1Y6KR 4WV1A 4HUUA 4F7MB 4JZJA 3SDXB 3MRKA 3B9AA 3BQUD 1OSZB 1H3WM 3GHBL 2Z31C 3PQYB 1R0AL 1MCCA 4Y88A 5ITBL 4PBVC 2WP3O 4O2CB 5KVGH 2F53B 2ORBL 1S7XB 1NBZA 4FXGB 1D3CA 3CXHJ 1ZTXL 1I1FA 4HAFA 2Q87A 3I6KB 4LSVL 1T83A 2C1OA 1Q9LA 2VB5A 4IOSD 2YD8A 3LEYH 4JRXE 3MLVL 3QIBC 4NZDA 5C09A 5TJWK 2DKSA 1IEBB 1F4XH 4LARL 1LDPH 2Y6SC 4NQDB 1ZSDA 4OZIA 1WWBX 4PYHA 3O8XA 3LN4B 3HG1E 2ICCA 3FQXB 3OX8A 4FG6D 3V4UH 5DJZB 3G5XA 4MJ5B 4DZBA 2WV3A 1QQDA 2VLRE 1EAPA 4YHLH 5FCUL 2C26A 4Z0BL 3KNBA 3BZFA 5D2NA 4PGJA 1YNTA 4AG4H 2OS7A 3I2CH 3ORJA 4HLJA 4AIZA 3OQ3B 3TVMA 1FZOA 3N1MC 1I7RB 5E7FA 1N26A 5F7KC 4JVPA 3SJVD 1GOFA 4UI2A 1FIGL 2IWGA 3OJMB 4OZHA 2ARJB 1D7FA 3C5ZB 1NAMA 2AJ3A 3VGAB 1MFCL 3GZKA 1ZLSL 3TBVB 2EYSA 5IVXB 4V3EB 1L7TL 2B7DT 1MAML 3IKKA 43C9A 2NX5A 4GRWF 1UG9A 4P2QA 1DBML 1OPGH 4WHYH 1Z9OA 5JOPE 5BW7A 4HGKC 2FIKB 5MENE 3GMNA 4ZDHA 5BO1H 3FB7B 4KQ3H 2YXFA 3KPRB 4PY7A 1A7BA 5FHAL 4Z7NF 4K3DL 4RMWA 5SWZD 3ZE2E 3BYYA 3MFGB 2J8UF 1PSKL 1HQ4B 3MRLA 5EZOH 3NOIA 4MJ2A 3WKNA 3H9SE 3QG6B 3H7BA 4XWOD 1MIMH 1NGQH 2EZ0D 2VE6B 4Y5YC 3CSYA 4YBQD 4KGJA 1JGUH 5CFHA 2VLKB 4QXTA 2PTTB 2P7TB 4G6JL 3HE7B 4KJYA 5J1TC 3O2DL 3VD7A 2PR4L 3PDOB 4CJ0A 5EWIH 1QBML 4OFDA 5D7LA 5HDQH 1G0XA 5MERA 2Q3ZA 4PJBF 3VGEA 4PLJC 3RWGB 4JKPL 4JAMA 5I8KH 4LGRB 4HW6A 1KENH 3FFDB 1HILB 3GUTB 1D9KD 3BGMA 4ODXB 3QQNA 1U9KA 4YUEH 4D9RE 1TJGL 3S7GA 4JVWA 3JVGC 4QHLB 3VG0H 1JPSL 1SMAA 4YQXL 1XIWA 1ACYH 3HZYA 2WBWB 3EZ8A 2Z93B 1YUHB 2XKSA 4K8RC 4OGAC 4Z18A 1ZT1A 5E8PB 3LDBC 1U3HD 2ITCB 2VIRA 3RL2B 4L1HA 4K9EH 3RFZC 1LO2H 4PJ9B 4JY6A 3WSQL 3W9DB 3LEVH 1AXSB 1FJ1B 4NPYB 5J13C 1C08B 4GRLC 1KN2L 3WIHH 5M95B 5IP4A 1P2CA 3SDAB 1IFHL 3LQAH 3D5OF 3UTQA 4C58B 4D9QE 3KPOB 3O9WD 4OLUH 3MRPB 2DRUA 1L9MA 4N0UE 3X11B 1A1OA 1WTLA 5GGUB 4OKDA 4GMSH 1PZ5B 4Q0XH 3P4NB 5E99H 3GMOA 3FHQA 4O9HH 1TQBC 4P59H 3UYPA 1FYHB 1IGML 4MXQD 5BRZA 5EUOA 3QSKB 1L0QA 3AU1A 3REVB 4GAGL 1JGVL 5LQBH 4DGYH 5GSRB 5M94B 3BN9C 1H0DB 1XCTA 5GS2H 4PJAA 3QWRD 1S9WB 4LSUL 4FQPA 3HE7C 3TV3L 1QUNA 4PV8B 3SGEI 3BD4A 3TBYA 5IT2L 1OARH 1DUZB 4LP4A 1BFVL 4RAUB 2VLME 3NCCB 2VXSH 3TZVC 4XHQA 4LVOB 2XOTA 4L3CB 1ZXQA 1DQML 1F8TH 5ACZA 5DC0A 1RZKH 1JI2A 1OAYL 3QIUC 1KOAA 1O7VA 2B5IB 2D7PA 5AD0A 4O00A 4P23C 1UKTA 3DETD 4XBGA 4BKLB 4MQSB 1ZT4A 3QUYD 3FKUS 3I75B 4HZLB 1S3KL 2AK4D 5EU3B 4OQTH 1MREL 3OV6A 4E41A 1UJ3B 3CAFA 2Z91A 3ULSA 3SGJC 2LV4A 1H15B 1VACB 1NAKL 3MFFA 3MRJB 4DAGH 3WD5H 2WBJA 3IAPA 4XC3L 1WAAA 3VH8A 3EOAA 1G9ML 4JANA 5E8DL 5ICZA 3O6MH 1BIIA 4XMPH 3HCVA 5KJRH 1OGTB 3O3EA 3QQ4A 4OCSL 3P73A 4F57H 3AMKA 2JCCB 1NMAH 1GGCH 4KAQL 4NHCH 4KI1A 4F9PC 3ARRA 5LJYH 1BBJA 1KN4H 4LKCB 2NY0C 2COQA 1YEKL 1T0NB 1F42A 3LN9A 5CD5D 5FOJA 4OLVH 4HAGA 5DLMH 4X98A 5J57B 4Y5VA 4CMMA 4UV7L 4G6FD 1T4KA 1I85A 5TE4H 2BNRA 3T4YB 2CXGA 2EDOA 5IMLB 1RMFL 4PJCE 2J88L 4IRSB 1J18A 4GKSA 1AKJD 4QTHB 3FN0L 1C7SA 5JDSB 2ZUSA 4DKDC 1S7SA 5T1MA 2XZZA 1BWMA 2D0GA 4QRPB 5L6YH 5DJ8B 4NRZA 5CUSH 3FQTA 5GS0L 5EZIH 2Q8AH 1DVFC 2DQHL 4UQ3A 4PG9B 5CGYC 3QIWA 5KVMC 1CE1H 1MFBH 2X4TB 1MVUB 4G43B 5CZVH 3RJQB 4HH8A 3CZJA 1HHJB 2IBBA 4LF3B 5JW4Q 3MC0A 3BW9A 2R29L 5CP7A 3QNZB 1MI5B 3BI9X 5E03A 1QLEL 3UTSD 3FN3A 5IQ7L 1ITCA 1MFEH 25C8L 4MD4B 5JHDB 3NABL 1UVQB 4NO3B 4WCYL 3TIEB 3P0VH 3N9GH 1Y0LB 2IPKB 3VMPA 3HRZB 3UJTL 2LE9A 2FLRT 2GY7B 1W72H 3ECBA 4K94H 3FCTA 5CMAB 1RUAL 2PYEE 1KLGA 4OFKA 1A21A 2QSVA 4U1JB 4ZFOL 2PYFA 2ADJA 1TPXC 4GS7C 4N0CC 3SDCA 2FO1A 2HJFB 2YC1A 5DVNA 1A6ZB 5I76B 1ZGLP 1KB5A 1QSED 5ECJE 1IC5L 3UDWC 5C0BE 2Z8VC 6CGTA 4TOYL 4ZS6D 2B1AH 5ICXB 1Z3GL 5J6GA 5D6CA 1VGEL 4NC1C 1E4JA 4M7KH 4XZUB 3BH9B 2MTPA 4NC2B 1FFRA 2XA8H 3OGOE 2F8XC 1KIRB 3RUGF 1MHHB 3WFEH 3QAZB 1LO3L 5I66A 3MOQA 4MNGE 2GFBB 5DD6B 3M17A 2OSLB 2VL4A 1J0ZA 3B5GA 2ZCHL 1U6AH 3OF6A 4IMKA 1QFOA 2BOCA 3SDXF 4C4KT 5DURD 3TN0A 1BBDL 4FQ1L 4XNXH 4XVJH 1FGVL 4LHUG 4BFIA 3W9EB 1PG7L 4NQXA 1U8KB 1H3VA 4FZEL 2IG2H 8FABA 4DCQB 1S7VA 4L4VD 5F7YC 1NAMH 5IFAL 4JM2A 5JORB 5HHOB 1GAFH 1JYXA 1A3LL 4XI5C 4HMEA 4LLDA 2I60L 2YUWA 1FN4A 1FBIL 3MRGA 3EGSA 1YQVH 1A6UH 2A6KB 3IXTB 4C4KO 3QWQB 3LH2H 1AI1L 2R39A 4HDIA 2IQ9L 5T3XL 2ADFH 3FN9A 1DFBH 1QSFB 1UM6L 1I7UB 1U8MB 4O5LL 1S7WB 1B3JA 3I9GH 4JN2B 4NUJB 5BV7H 1V8HA 3S4SG 1F00I 3TCLB 3IDYC 4X6CB 2Q8BL 4L8CB 1T7WA 2VISB 5L2JB 1DL7L 4QHUB 4MMZC 3ZKNC 5CAYB 1QR1B 1IEAB 3NIFF 3F58L 1K6QL 1QRNA 2E9BA 4KMLB 4R7DA 4MHHG 5ICYB 2D31B 2X4SA 2O61A 2DQDH 3MMEB 1BHGA 2ZSVB 2VUOA 5DJCB 1ZT7B 1J8HB 5F3HB 4F2MB 3IF1B 1DZBA 5FYKD 3SJVE 2HRPH 3BGFC 5IVXF 4WTZG 4LVNC 3VDBA 1KIUA 4ISVB 3PWLB 4WUUD 3TFKD 1RHHA 1IGJB 4IEFB 4OCRH 4YDVA 3CSGA 3RVXD 4PTTB 1KYOJ 3GMQA 4R26H 1LP9B 1URLA 3MREA 1IAKB 1TZHA 1UCBH 4JDZB 3GM8A 3V8OA 1J86A 3AM8A 3WNKA 4EN3A 2XTJB 4RNRA 4XBEL 4I0PB 1BVZA 2WZPD 5DRXB 4CW1A 5CJQH 3I84A 2RFXB 1HN1A 5SWZE 4X6EA 1AFVH 3OAUL 5JW5A 2X1PA 3VXSA 3O3UN 5GRYA 3AAZB 4L4TA 3Q1SH 1RUPL 5DUPH 1WT5C 2EKJA 5BS0A 5HGHB 1SJEA 3S88L 5IB2A 2GUOA 4PJ7B 5HHMA 4NT6A 2A73B 4XC1H 5DEGB 2YRZA 2Z31D 5C0IB 4ZPVA 5DJXA 3X12A 4UMGA 5LKNA 3L3DA 5KAQG 4OFPA 4PUBH 4FQCL 1NLBH 4YDLC 2XKUA 4DJMA 4OSUL 4A6YB 3O4OC 3NCFB 1U95A 5E5UB 2OP4H 2DWDB 3DX6A 4G9DA 5JQ6L 1JP5A 4P9ML 3VFSB 4JQVC 4X6FB 5C92A 5J8OA 4HIEB 4OKVB 4UT6H 2A6DA 5EU6B 4LPTA 4NHUA 3HAEG 4S1SL 4MXWH 3I02B 4P46A 2NW3B 2CIIB 5F7NC 1SEQH 3PL6A 3HPLB 3MBXL 4PRNB 5C08A 1GZPA 1Q94A 4HXBH 2HTLC 1LO0L 3QR2A 1S8DA 5B21A 3TPUB 1N5YL 4R2GB 3QJHB 5EU4A 3LKPB 1EFXB 5F96L 4NCC2 5F3BA 4LOUD 3UC0L 3U2SA 3OB8A 3WKMH 3QQ9D 1SYSB 3ARGA 3SKMB 4EUPH 1E28A 3F7YB 3GEWB 2ITDB 3TYGL 1TMCB 2AEPH 2JJTC 5DVKA 4FQXA 2R1YB 3DTXB 3CLFH 2PO6D 1I8KA 1A64A 1FYTD 1MCRA 4UAOB 3BRGC 4ODWB 1NL0H 5IKCB 5FUCC 4R0LA 3IYLW 5KSBE 4U6HB 4UILL 1IILE 3IFOB 4OI9A 3WHXB 1DLHB 1Q9KA 4NN5C 4XWGH 2LU7A 4DW2H 3NACH 3LRHA 4JJHA 1NGPL 5DI8B 5DD5L 2R15A 2F54D 3WNOA 5ACLA 1INDH 3Q3GB 1IGYA 3PQYD 3OKLB 4DN4H 4LCUA 4X5WB 2J5LC 1UWXH 1FG2A 3VXPA 4OLWH 5FM8A 1KFAL 1NFDA 2YKLL 3C2AL 5B8CB 1PAMA 1T22A 1RJLB 2H9GB 4M1CD 1HOCB 4S1RH 1I8IA 4NQDD 3MUGA 1HSAB 4EIZC 5JR1L 3K4DA 1ONQB 1J1PH 2E27H 3RVVC 4BFBD 2W65B 3MRBA 2AK4E 3VXNB 5J1AA 5DQ9A 5I18L 3GHEH 1WSST 4R2GC 4GBXB 4XP1L 4MA7H 5SV4A 1CTOA 5L2KB 4PRIA 4WHCA 1T1YA 3HE6A 4TULH 1HH9B 4W6XB 2JCCF 4YHYB 3HI5L 3FT4B 3QDGB 1X7QB 1SQ2N 4J3WA 1QG3A 1IGTA 5IJVA 3CFKA 4NC0B 1EHNA 2XQBH 1LQSR 3MGTA 3HMWH 3C5ZD 3H9HB 3OMZA 4F7PB 2AERT 1FLRL 3DURA 4GLRI 4Q97A 1YDPA 2NNAB 2AJSH 4H0IA 3CCHA 3O2DA 3NPSC 3CLEL 3U9UB 1UYWL 1EH9A 3B8SA 2R4SL 3C9NB 2VZSA 4LSDA 1QNZL 3I3DA 3LMJH 4PGBA 3L1OL 5DHVB 4M6OH 1CG9A 4OI7A 4GRWE 3MODH 4GOSA 5CHNB 2PXYA 3KPRD 4K8RH 1E6JL 1UCTA 4LLQA 1T04B 2Z4QA 2VYRE 3V79C 1NGWB 4U1GB 4MVBA 3SDYH 3MOAL 1N2RB 3FFCD 4Z7NE 1F6AB 1RZFH 1SVCP 4Y16A 4M02A 4YPGB 1ORSA 3UMTA 3BN9D 4YWGL 1KXQE 2VLKD 1KXTB 3HE7D 3OJ2C 4OBSA 4F7EB 2IGFL 1K4CB 2CGRH 2X4NA 3UBXA 4U1SB 1LEKB 4FS0A 1WCBB 4H8WC 2WMPA 4S1DC 4M43L 3C6LC 5CD3A 3ZT6A 1WZ1L 3RZCC 4JDTH 3PGFH 1T80A 2WSKA 2CRZA 1BVLA 5JXED 5CS7A 1PY4A 3CDCA 5EOCJ 2YS4A 3EHBD 2VDLL 5JTWA 4EDXA 1C16B 2FH6A 2BRQA 5DUML 4LEOB 4U7KA 1J7VR 4HIHB 3C8KA 2OTUA 3E6HA 1ODAA 4EQ3A 3L6FB 2MCPL 3ARQA 1D5BA 4NCC1 1BD2B 2DTMH 1UB5A 5GJTL 1MCPH 5DMGD 3RKDD 5IESH 1QSEE 4ZO7A 5E5MA 4ELKB 2X41A 5FO8A 3NFPA 4AT6A 2JB5L 4XP6L 3SDAD 5TF1H 1SJHA 3BEWB 3QNXA 1N59A 3ARFA 5DYOA 3R1GH 4ZFFA 2LABA 3ZMRA 3HN3A 5D70H 2FHCA 2EDWA 2R9HD 2VR9A 1JHKH 3GSXB 3E8UH 1DJSA 3G6AB 5HVGB 4S1QH 3KLAB 4P3DB 2D7QA 3D0LB 4MJIA 2C5DC 1UWEL 4JPWH 4N9GA 3GSNB 4G5ZH 4WFFD 15C8H 5ID1A 3DMMB 5B39A 3LKQB 2A83B 2UZXB 1CYGA 2P8MA 4KV5E 3UJJH 3NAAL 4M93B 5FECB 1AXTH 1PY9A 3QEHB 4NQCB 2ZKHL 3U0PB 3ZE0F 3OAZH 3GMPA 1QSVA 4GAJH 4L4VE 2FJGA 2W38A 2CDFB 1RULH 2NR6C 3QXDB 4BZ2L 4K3JL 3G6DH 2H2PC 2QV2A 3T0VA 4Y8AA 2XACC 4WV1B 4HUUB 3BPLC 5T3ZD 4JZJB 2BOBA 2DQUL 2MJWA 3B43A 5E6YA 4NM8H 4QYOA 4X6CF 1WIUA 5IJKC 5GJSH 1Q1JL 3EDKA 1NBZB 2NY6C 1I1FB 1O7SA 3D48R 2C1OB 1F58L 2VNCA 1Q9LB 2C3GA 3GRWL 5C09B 1RURH 4FFVC 4LCIH 1WTGT 1A7PH 1FRGH 1ZSDB 4OZIB 3O8XB 4QRRA 1CIDA 3CK0L 3OX8B 3GSUA 2E5EA 4JFEA 2HT4C 3G5XB 4DZBB 5DHXB 1QQDB 1EAPB 4L3EA 5LXGL 2P43B 4WUUE 3KNBB 3BZFB 1AGEA 1LP9F 4H26A 4RMUA 5D2NB 4BZ1L 4PJ8A 1YNTB 3DUUA 5INDA 2FGWH 1MCEA 1M71A 1NKRA 5CEZH 1GPOH 4AIZB 2MWCA 4M8VA 3TVMB 1FLTX 5BQ7A 1FZOB 5L7XL 2HKFH 4IRSD 2CK0H 3OR6A 43CAA 2VLLA 3ILQC 3MYZA 3MNZA 5F89A 2X4QA 2HFFA 4OZHB 3LQZA 1NAMB 2AJ3B 1QHOA 1YEHH 4UBDC 2EYSB 3CSPA 3FQUA 1KCRL 2I9TA 4ZFOA 3GHBH 43C9B 2NX5B 5MI0B 4PJ7F 3CFCH 4G6AC 1GSMA 4P2QB 4RCAA 5ITBH 1FHGA 3GMNB 3CDGA 2ORBH 4XVUC 4ZDHB 2DIAA 4BQCA 2WWKO 2ERJB 4PY7B 3JSSA 1N64H 1MI5D 4XT1C 1GGBL 3OKOA 4HJ0C 1F45A 5JHDD 1BQLL 3MRLB 5FM4A 2NY1B 1MCOL 3H7BB 5IFJA 3GSOA 4HS6A 4YXHL 3CSYB 4OZFH 4ETQB 4N90D 1YEIL 2V9QA 4KH2A 4QXTB 5CBEA 1AGBA 3RX5A 3TA3C 4KJYB 1RZJL 1CICC 3EOBA 4PY8J 5FCUH 5HGAA 1K2DA 3PGDA 5C07A 1EEQA 1OAZL 2AEQL 5D7LB 5GRZA 4AEFA 4OV5A 4JGJA 5MERB 4HUWA 5D93C 4BK4A 3ZYOA 4JAMB 3P30L 4MA8H 4NBZB 3ZKND 4JZOA 1Q72L 3K3QA 3MPCA 4NO0A 1MFDL 4TPRH 4EZMA 3BGMB 3GJFH 1W0YT 3MYJA 1I3GL 2QKIA 4XCCH 1JPFA 2F5BL 3VGFA 1I7ZB 1XIWB 3HZYB 4G6KL 1OL0A 4Y89A 1I3VA 4EDWL 1ZLSH 4P5MA 1L7TH 3QI9A 1T2QL 4XPFH 1A14H 2O5XL 2VIRB 4RFNB 4KQ4H 4XCYA 3SGDI 1FYTE 4HS8H 4JY6B 1FV1A 2BY2A 3B2UC 2HLAA 1UXWA 3QQ3A 5DWUL 5D72H 2GHWB 1WWCA 2QADC 2E9IA 2OI9A 4FXKA 5JIPA 2E8ZA 1P2CB 3SE8H 3UTQB 4O4YH 5I71B 3GKZA 3DVGA 3I85A 1FH5L 1A1OB 4I3SL 3SDXE 4H25A 3NZ8A 1RSFA 2F54E 2IEPA 3QDAA 3OGCA 3GMOB 4G9FA 3PQYE 2VTFA 5KS9A 1YEGH 3EYQC 5HHOD 3K0WA 2CUIA 3DUHA 5LVEA 4JB9L 3LZFL 5BRZB 5EUOB 1H3TA 3AU1B 4OT1L 2NY7H 1UZ8A 3KYKL 35C8L 3V6OC 1XCTB 5C7XH 4PJAB 5D6DC 1B4JH 2C4XA 2XN9A 1QSFD 4WVRA 2O5YH 1EAJA 2R0LH 5FGSA 4NQDE 3WXWH 1TJIL 4LCYA 2X1WL 1EHLH 3TBYB 2YOCA 1F4HA 3QULA 2JK5A 1F4YH 2ZNXA 1U8PA 2J1KA 4BQBA 5ACZB 3QUZA 2E7LE 3RQ3A 3VFGL 1NBVH 1AQDA 3NIFE 1HI6A 3WSQH 1LHZA 5AD0B 4XBGB 1BF2A 1ZT4B 4XPAL 5ADPH 1J8HD 2HTLD 5IGXL 4ODHL 2H1PL 1IFHH 4E41B 1GHFL 3HUJF 2Z91B 3ULSB 4WWID 2EEBA 3MFFB 2WBJB 4M61A 5DT1L 2BNUA 3VXUA 2R1XA 2LTQB 3ESUF 3VH8B 3EOAB 4JANB 4OF7A 4X4YA 4PLKD 5ICZB 3T08A 1NANH 2EH8H 1BIIB 3HCVB 3UYOD 2XTJD 3QQ4B 3P73B 1LMKA 4I0PD 4K7FA 1KTLA 1CR9L 3KPRE 2IH3A 5FO7A 4LMQE 1AY1H 1HINH 4X6BA 1YECH 2RBLA 1Z0MA 3FFCE 3ARUA 1BBJB 3QPQC 3LIZL 1CXHA 1X5ZA 1KPUA 1UACL 1UEYA 3WIFA 5T33L 2VLKE 4X98B 1WVZA 4Y5VB 4CMMB 2DQEH 5E24E 1T4KB 5F7LB 3ES6A 5EU7E 1BQUA 2BNRB 2VUYA 1P69B 1DQMH 4GKSB 4JVUA 2AJUL 1NQBA 1S7SB 1OSPH 4MX7A 4QT5A 7FABH 3Q0HA 4XNQA 2CMRL 3EJJX 4C56D 1CK0L 3LKSA 2XRAL 4NRZB 3SQBA 3FQTB 4TUOA 2FEDD 4UQ3B 5EU6D 3QIWB 1MCFA 3L5XL 1X4ZA 2WWMC 1KNOA 2OQJA 3U4BL 4HGWA 5DGQA 4I18C 4UT7L 4RX4D 5D7JA 4LRNH 4P2RB 3HA0A 3BW9B 5CP7B 4WI9A 1RVFL 4JEGB 3TESA 4R2GD 5LGHL 4RAHA 5CCKH 2BMKA 1EFXD 3WJLC 1M6OA 5D96C 4KK6D 5IBLC 1MCBA 3Q6GH 3D25A 3CD4A 4TTGA 3K2UH 4KAQH 3FB8A 5F7EL 3ECBB 1J0HA 3FCTB 4ESKA 1RZIA 1KLGB 3MLUL 1P6AB 5GRXG 3P0GB 4KUZH 5JXAL 3Q5YA 2PYFB 3RX8A 2ADJB 1N0XL 4JO2H 5DJ6A 4KI5C 4KRPB 2X09A 3SDCB 1TTGA 4QCIA 2YC1B 3MJ7A 1ZA6A 2BZDA 1KB5B 5KVFH 1A47A 1MPAH 2B2XL 1MJ8L 5D6CB 3F62A 2ZSWA 3ARVA 4WFFE 3ULUL 3QCTL 4XNZB 1RUQL 3BP5A 1H3UA 2GTWA 1LE5A 5F6HI 2Y06L 4R9HA 5CLWA 3QXWA 3OKYA 5I1LA 4NDMA 3BPOB 5J11C 2V9RA 5I66B 1U8NA 2YPKA 1OTTC 3WUZA 4OCWH 1UM4L 1VDGA 3M17B 1XGPA 3TT3L 1A8JH 3GDBA 3QCVH 3BPNB 4Z0XA 3RVTD 2BOCB 1QLEH 3OPZL 4WU7A 4LSQH 5TDNA 2IALA 3NABH 2YZ8A 5T3ZE 2DDQL 4BFIB 5LBSL 4NQXB 1TDQA 1LNUA 4XMLH 3S8WA 1MFAH 8FABB 5H37H 1S7VB 4X8JA 3PHOA 3T0EC 4JM2B 2F5AH 4KVNL 3VW3L 4AEIL 4GBXD 1XF2A 4U31A 1FNAA 4HIXH 3DX9A 4LLDB 5L2KD 3MCLH 1FN4B 3A6BH 3EGSB 2Z8RA 3QUML 2QJDA 4Z9KB 4OZIF 4HDIB 2JELH 5CGTA 4KRPC 2H2SD 2XZAL 4LSPH 4ONGL 3K8MA 4RGOL 3ARXA 4H8WH 3W11C 5J9PA 4LPVA 2DLFL 2DN7A 5HI4C 4UUJA 1F13A 3HI6H 4HLZG 4XNUL 4YFEA 1NBYA 2PTUA 3SDDC 4HWBL 1QRNB 1LE9A 3BSZH 3CFJA 4R7DB 2X4SB 2J6EL 3RTQA 2O61B 4FQIL 3B3IA 2APWA 1BVKA 1AGFA 3ULVL 4OZHF 2WUCL 1NCDL 5DQJA 4FQLL 2AS5M 3IDNA 2VXTL 2J8HA 3NCMA 1RHHB 3LRSA 1NMBL 2DAVA 3SBWA 4AK1A 4YDVB 1TQCB 2VXVL 3CFEA 1INEL 3GMQB 1C1EH 3MREB 1TZHB 3ZLQC 4J4PA 1LK3L 4PS4L 3UAJC 1EMTL 4EN3B 4RNRB 4RBPK 3V52L 2LQRA 5IOPA 2A74A 1MI5E 2DMCA 2GT9A 3C08L 4EEEA 4HUVA 4X6EB 1YEEL 3M8OH 5JW5B 1N4XL 3VXSB 5JHDE 2ICWA 1G7QA 4JPVL 4UOJA 1BJMA 4GLRH 4L4TB 1ZOXA 3N06B 4U05A 5BS0B 1SJEB 4N90E 5EIIA 4IIQC 2GUOB 2GW5A 5IB2B 4NUGH 5HHMB 4NT6B 3MLWL 4JFPA 3GK8L 2A1WH 4QNPF 1F3JA 1KIQA 5DJXB 3X12B 2A6IA 1K6QH 2V5MA 5DC4B 3PJSA 4HQQL 3L3DB 1BD2D 1G7HA 1P7QA 32C2A 3AY4A 1DP0A 3KR3L 4YE4L 2AVGA 3MRDA 1U95B 3KDMA 3DX6B 1ZEAH 4G9DB 3PGCA 1HK6A 3CDFA 1CDHA 1MJ7H 5IB1A 3HLAA 3I3EA 2A6DB 4FFVD 4LL9A 4NHUB 4U1KA 4XNMA 4GKOA 3UPAA 4KTDL 4P46B 2LAGB 2W9LA 1QFUH 3PL6B 4ZXBA 5I1CL 4RMTA 2FX8H 1C5CH 1GZPB 1Q94B 5C08B 1JIBA 1WZLA 5C0GA 1S8DB 4OIAA 4MA1B 5EU4B 1G6VK 3EJYC 3NH7H 5F3BB 3MRIA 3ZO0A 5F1SA 3U2SB 5HD8D 1EBAA 1PX3A 3DMMD 3JWDC 1A3RL 3NIGF 4XPBH 3ARGB 3FO0L 1E28B 1MY7A 3MA7A 1QLFA 4O2EA 5EOQL 4JJ5A 2YXMA 1I8KB 4WWKC 2X6MA 4NQCD 1HQRA 3JWOL 3EO0A 5EUOF 5GRJL 3SHSA 4PTUA 4AL8H 4OI8A 3KPLA 3GRWA 3QISA 5DK0A 5HHOE 4UBDD 5EPMA 4MCYA 3IS0X 3MXVL 4R0LB 4PJAF 3IAQA 4HEPG 3D18A 2HYMA 4JFQA 3BYTA 2AGJH 1Q9KB 5A2LH 4Y4HC 2YD4A 4I5BA 1QTYT 3TGXA 1FO0L 2EDRA 4JO3H 3IJSA 3D3VA 3IDMA 4G8GA 1QSFE 4P9MH 2GEEA 1IGYB 1YQ2A 3QRGH 2UWEA 4LCUB 1CZ8L 5GRVL 3IAGC 2F8VA 4S1SH 4GG8A 3DV6A 1FG2B 4X6CE 3VXPB 4M1GH 1RQ5A 1NFDB 1P4IH 4IS6A 4TSAL 4D3CH 1RFDL 1JRHL 2WLZA 4MAYC 1LO0H 4WENB 2QBWA 1T22B 5CIPA 2W9DL 1VGKA 4K23H 5C09D 4HHAA 1RK1A 1ZVHA 3NTCL 2V17L 1I8IB 2VMFA 3TNMA 4R90H 3MUGB 4EJ1C 3N1PC 3O8XD 5DD1L 1UENA 4F15C 1J8HE 3MRBB 2V2XA 1PJ9A 1J1OL 3ZL4H 5J1AB 3LEXA 1S7TB 5DQ9B 5E6IA 3NIDF 4JR9H 4S11A 1WAAF 3NGBC 3TYGH 1Z9LA 2N4IA 1CLYL 2E8YA 2FATH 4DFIA 1EERB 2EECA 4FQ2H 4PRIB 3VFRA 5D1QA 1T1YB 5IUSA 2A77L 3ARDA 3HE6B 3MR9A 1MLBA 2D7OA 2OZ4H 1X3DA 3TVMD 4TVPL 3ROLA 2D7NA 5BOPA 2XTJE 3GIZH 5T1KD 3KYNA 1IGTB 1DBJL 5ALCH 5IJVB 3CFKB 2XPGA 1BGXH 5DA4A 4ZNEE 3MGTB 5EBWA 1TFHA 1YDPB 4U7MA 2P45B 3CCHB 4G3YH 5DVLA 2NX5D 4H20L 4P2QD 1Q0XH 4CNIB 3TJHA 4PGBB 4K7PL 2FDBP 2CIKA 1CG9B 4ODUA 1VEMA 4P4KC 3DARA 4PJ7E 1KCGC 3WL9A 5IWLC 3UPCA 2YKLH 2PXYB 4OLXL 4LLQB 3C60C 2Z4QB 5F8QC 1VESA 3FZUC 1A7NH 1NCTA 5C0ND 2IAMA 2NY1D 3SE9L 5E2UL 3E0GA 2AXJA 4Y16B 5JQHC 4C56E 3OAYK 1AO7E 1U3YA 4QGTA 2H32H 5FGBA 3U1SL 5EU6E 3BAEH 5L8JB 4KTEL 3RGVA 2X4NB 3O6KL 3UBXB 1L6ZA 3EJZD 5D7LD 3SE4A 2J4WH 2KL6A 1CT8A 5CD3B 3ULUC 4WTXA 4FMKA 1BVLB 3QXTA 3HI5H 2Y07L 4J7RA 1G6RL 4YHNA 5I1DA 5LG1A 3IB4A 5C0AA 2X2YA 2MQ3A 5HI5D 1NGYA 3C8KB 2OTUB 1XIWD 3RRQA 3E6HB 2NY5C 5HYSA 1OY3B 3TWCH 3NCEB 3T1FA 3S96A 4YDJA 3ZDXF 2C4FT 3QHTC 1NH6A 1I4FA 3FT3A 4LIQH 1D5BB 3OG6B 1N6UA 2BVPA 2W60A 3VD9A 3UCRA 1UB5B 1D6VH 4OFIA 1IGCH 1Q0YH 3T3PE 4V2BA 5FYJU 5E5MB 2DBLH 5GZOC 5FO8B 1E6JH 5JW3L 3NFPB 4AT6B 2ILLA 5LGJA 5DK3A 1T03L 3QJFA 1R3IL 4TUJA 1SJHB 4PBWD 3JV6A 1BFTA 4YBLC 2R2BA 2DI7A 4Y4FC 3QNXB 1I8LA 1N59B 3ARFB 5DYOB 1CQYA 4N68A 1IM9A 4GQ9L 4ZO8A 1P5VA 2O26U 4CADA 1OT1A 5FV2A 1X5JA 3GBNL 4WI6A 3U82B 5BRZD 3B9KC 2AABL 1ZWIA 4MJIB 1I1AC 2B4CL 2LVEA 4N9GB 3TO4C 1IZKA 4HGMA 4HT1L 1RJZA 5ID1B 5B39B 2HFGH 4H1LA 5IEHA 3G6JF 2P8MB 2JJVA 4NGHL 3NCBB 5C70A 4JM2F 4PG2C 4WW2C 4HC1H 1JMZA 3GMPB 2YPVL 4WI3A 4MZ3A 4PFEA 1TTUA 2FJGB 2RIKA 3SGDH 3QBTB 5EIVA 3MV11 5L2KE 2VDOH 1FG9C 1FZKA 3RKPA 4KZDL 1A3QA 1WBXA 5H35A 4QTIH 5TQ2L 5J12C 3ARTA 1RHFA 4DVBA 2WUBL 2BOBB 4NQTA 3RHWF 3MRMA 1CDUA 4QYOB 1Z9MA 5GGTL 5BXFA 2R69L 1HHIA 4EI6A 4XP6H 4XMKL 1MHCA 4LLVA 1L7IL 1F2QA 4PD4J 5IBLD 5FGCB 2WBJD 4HPOL 1JF6A 1JFQL 1V3LA 2PW2A 5HGDA 5IFHH 2PKDA 1JRHI 3EYUL 5LWYL 1S5IL 1SMOA 4MCZA 4QRRB 1LDSA 4OZ4A 3V0WL 3GSUB 1OAUL 2P48B 4JFEB 5I1KL 4EXPX 1BZQK 3MRQA 4P57A 4Q2ZA 2ED7A 4L3EB 3EO9H 2OM5A 1AGEB 4LHQB 4H26B 3NAAH 1FDLL 3DUUB 4PJ8B 1NLDL 5INDB 1CU4H 1M71B 3QPXH 3DGCR 1I9EA 2BNRD 3H9YA 4WO4A 5BQ7B 3DXAA 3SO3C 4M7JL 3OR6B 43CAB 2VLLB 1AGCA 3MNZB 2V2WA 3A6CH 3TF7A 3H0TA 5D1ZC 2AW2A 2J8UA 3RAJL 1NC4A 5F89B 2X4QB 2HFFB 3RZWA 1A5FH 3LQZB 5KANG 3KJ4B 4AMKH 1U58A 5EO0A 3FQUB 2I9TB 4ZFOB 1KCUH 1NDMA 3E2HC 5FEBA 1MCLA 2VXUL 5I1JL 3CXHK 2APTA 4TQEL 3CDGB 3MGOA 5KVDL 4KKLD 4P2RD 2DF3A 4Y19A 2DLIA 1EO8H 1F58H 3K8LA 4PJBA 3OG4B 4MS8C 3OKOB 4JQIL 3RBSA 5FYLD 2YUXA 1BD2E 4HULB 3DSFH 4JO4L 5IFJB 3GSOB 5A3IC 1CD1A 4HS6B 5HDBF 2IANA 2EXWC 5CBEB 4POZC 1AGBB 3UROR 1C7TA 1J12A 4LLYA 4R8WL 2E7MA 4CVZA 3EOBB 2BHYA 5LXGH 5HGAB 1K8IA 1K2DB 3PGDB 4HJJH 4KRPD 5C07B 5CP3A 3SDCD 4IJ3B 3QUXC 2XZCL 4OV5B 1CBVL 5DMIL 2FX7L 2BFVH 4APQC 4HUWB 3JV5A 3ZT7A 1QRKA 2CKBL 4NOBA 2VKXA 3FB6A 4BJLA 4JZOB 3KVQA 4NO0B 4LLWA 4DQOL 5TE7L 4NKIH 2VQTA 4TUKL 2BC4B 5CIPH 2QKIB 3ZDYE 1HCVA 4IDJH 1JPFB 2Q7YA 1J5OH 4OTXH 2NYYD 1L6XA 2C3WA 3K7UA 1KPVA 2ZUUA 5I75B 1W0VA 2YBRA 4P5MB 4YHPA 2X9XA 5FUOH 1JPTL 3QI9B 3BPCA 2NXZB 1KCRH 1PG7W 4LFHD 4X80L 2EO1A 4XCYB 1XF3A 4NQCE 3SOBL 4KXZH 5J7CC 3MRCA 1QHPA 3QUMA 4RGNC 3ILPA 1FV1B 2HLAB 5D7SL 1UXWB 3QQ3B 1T2XA 3VFVA 1CGVA 3OF6D 2OI9B 4EI5A 2BJMH 4FXKB 4M7LL 5CSBA 4GG6E 4XPHL 2AJXH 5C8JA 5TH2A 1E27A 4GSDH 5KVEH 4JY5L 3DVGB 1RAMA 4F58L 5DK2A 4H25B 3NZ8B 5IV2A 3THML 3PP4H 1ZV5A 3OGCB 2NW2A 4G9FB 4FOMA 4YEEA 1A02N 3V2AR 4JM2D 5KS9B 1C8PA 4HWBA 5FCSH 3MLSH 4E42A 2J6EA 3STZA 5ANMA 1UZ8B 2RCSH 3CXDL 3QWOA 2EXYD 1OAZH 4B7IA 1DR9A 4NN6C 3EOTL 2VKWA 4UOW0 5C09E 4KDTA 3ZSTA 2XN9B 3SQOL 3P30H 2V2TA 4NQVA 3B83A 4OM0L 4X0KA 3AUVA 2CPCA 2V9TA 4JRYE 4OZIE 1AE6L 4LCYB 2MOVA 5K9JL 5F70A 1X5IA 1SEBA 4E0RA 3EIFA 2F5BH 1TNNA 4C83A 1YJDL 3QULB 3KXFA 4XPGL 2LU3A 5B38A 2JK5B 2IADA 5DEZA 3FRPG 1U8PB 1T2QH 2DQIH 3PHSA 1U42A 4L8SA 2O5XH 1JNHA 4NKMA 5DF0A 2O93L 1D5MB 1QRND 3QUZB 1AQDB 1DANU 1HI6B 4AJ0A 4POYA 4L3AA 4L8BA 2VWEC 3T0WA 5DWUH 3NA9H 2NXZC 5J56B 1KJ3L 3U9PL 3P0YL 5I8CA 2ZPKL 4OZHE 5D1XC 1CI5A 5ESVA 4I3SH 4M61B 2BNUB 3VXUB 2H26A 2R1XB 4TSCH 3T4AB 3S37H 2HT3D 2NX5E 4X4YB 4P2QE 4OF6A 1CGSH 3L3JA 4PJHE 4JHBA 5T1LA 5IG7A 4YXLL 4EN3D 3U4EA 1LILA 4WWKD 4K7FB 1KTLB 4NO5A 4DOHB 5HHVL 2IH3B 5CJXC 5FO7B 3AREA 3U6RA 2BY3A 1AR2A 4X6BB 1F4WL 4JPIA 4DKFH 5IROA 3VXSD 1T0MA 3IDIA 5HVWA 2QQNL 3JUZA 4HKXA 1MRFL 4AH2A 5SV3A 2HMIC 3GBMH 2GSIA 4L4TD 1NCAH 2MFNA 3V6OE 1T5WA 3ISWA 1KPUB 4JFFA 3S5LA 5BS0D 3MLRL 3WIFB 1FPTH 3IFPA 1IGFH 3JWDH 3QFDA 3FAXA 5HHMD 3ES6B 3PWNA 5IW3A 3NZHH 3JV4A 4KY1L 3BE1H 4Z6AT 3MUJA 3DVNA 4OLZH 3EDFA 4QNPE 4P3WA 4MX7B 5B4MC 1NCWH 4XNQB 1BECA 5KVGL 3LKSB 2IMMA 3RPKA 4MAYD 1OLLA 4TUOB 1OTSD 5E9DA 5B22A 5DQDH 3V0AC 4ODHH 2V5YA 1KNOB 2OQJB 1SJXA 4P46D 4HGWB 3LEYL 5INCA 3LS5H 3PL6D 5D7JB 5DT1H 1BREA 5TFSH 5C08D 1F4XL 1FL3A 2MHAA 1LDPL 3Q5OA 4C55A 4UIMA 2P1YA 1UJTA 2X1XR 4NN7C 2YD5A 3V4UL 2BMKB 1M6OB 2FD6H 1FO0A 3D25B 4MD5A 4Y5XA 5GGRA 4YHLL 3HR5A 3PP3K 5L8KB 4GH7B 1JWSA 3FB8B 5EUKA 3GIVA 1RZIB 3CUPA 4AG4L 2PTVA 3I2CL 1P4LA 3NIGE 4GAFB 5DJ6B 3RUGA 3BUYA 3UX9B 4QCIB 3MJ7B 1ZA6B 1LO4H 4O02H 3KPSA 2ZSWB 3OHXA 3CU1A 4G7YH 2BNQA 1PLGL 4UIKH 3BP5B 2GTWB 2XG4A 3NCJH 2CMRH 1LE5B 2YN3A 5IIEA 1AR1C 5I1LB 5BO1L 1B2WH 4NDMB 4E9LA 3RDTC 1FL5A 1XGUA 4U7SA 1U8NB 2YPKB 2P5WA 1DQLL 3F12A 3HZKA 5EZOL 1XGPB 1OB1A 5KZCB 1MIML 1JYVA 2C7UA 4Z0XB 4GJTB 3OJVC 1NKOA 5C0CD 4WU7B 4PJ5A 5FDYA 5LGHH 5TDNB 2IALB 1I9IL 5GS1A 3R8QA 4K3GA 1LNUB 2EDTA 1N8ZA 5EWIL 4X8JB 2HAZA 3PHOB 3T2NH 5HDQL 1H3PH 5GGRY 3SGKC 2XA3A 1XF2B 3OXSA 5JXAH 2Q1EA 3DX9B 3GFUA 1N0XH 1XZ0A 3NIDE 5I8KL 2Q76A 4PRID 1WAAE 3P77A 4B50A 3EYVA 1U41A 2NZ9C 1Y18A 1D6EA 3O0RH 2OL3L 2P5EE 3VG0L 2B2XH 1ACYL 4NBYB 4BSJA 1MJ8H 4U4BA 5DO2C 3DRQA 3GMLA 5J9PB 4BQ6A 3ULUH 1WFNA 4K9EL 2H45A 4QF1A 4LEXH 4UUJB 3VWJC 1LO2L 2HFTA 3AB0B 3LEVL 4DN3H 1NBYB 3AFLA 2ESVE 4R97C 1LE9B 3CFJB 4HH9A 3WIHL 5CSZA 3LQAL 2MSPA 3RTQB 3SKNA 2NY5H 2PXYD 3CU7A 2BNRE 3B3IB 4OLUL 1BVKB 1UADC 1UM4H 1AGFB 5E2VL 1S78C 2LAAA 1G6RA 2NZIA 4J23A 3G04A 5K9QI 5DQJB 5D9SA 4MVBD 3BKCH 1V7NH 4GMSL 4Q0XL 1CIUA 3IDNB 5E99L 3KYOA 2CRIA 4P59L 4Y16D 2DDQH 3LRSB 1FSKC 1EGJH 4MMXC 3CFEB 5HYQA 3J8F7 1Q9OA 4DGYL 3R4DA 3QEUA 1PW3A 1ZHKA 3CVIH 4QRUA 4P2RE 2BVTA 5IOPB 1B0WA 3P4OA 4K7PY 3L3IA 2GT9B 3FMGH 4DEPB 4HUVB 1R5WA 3IJYA 4RMSA 4UINL 5F88A 5FYLE 3L7EA 1OARL 3S98A 2ICWB 1G7QB 1J0KA 3MV8E 2VXSL 4UNVA 4HG4J 2QTEA 1HZHH 2CO7B 3MUZ1 5EIIB 1F8TL 1GH7A 1PX4A 1U3ZA 5IHUH 4PJDA 1RZKL 3DX8A 4JFPB 5DJYA 2EDFA 2FZ3A 2N1KA 1MCQA 3HG1A 2R1WA 5CJOH 1F3JB 1KIQB 2A6IB 1WITA 2DS4A 3F7RA 3PJSB 1G7HB 1AGDA 2VLRA 1P7QB 32C2B 4XHJD 4LRIC 4OQTL 3ZDXE 3S97C 3MRDB 3O41A 3KDMB 4N5UA 4PGDA 4ETYA 3PGCB 4DAGL 1R6VA 1K9TA 3WD5L 4ONOA 1K8DA 5IB1B 3HLAB 4IM8A 1NCDH 4FQLH 5FYKU 4U1KB 1G7PA 4XNMB 4QXWA 4GMTL 4U6TA 4WUKH 4TNWF 2VQUA 3LCYA 3ARFD 2O5ZH 4ZXBB 3O6ML 2GY5A 4XMPL 1CDYA 5L88H 4F57L 5C0GB 2VDQH 5KSAA 4XXCC 2XIDA 1GGCL 3BWAA 3O4LA 4NHCL 4S0UC 4XTRD 2WQRA 3MRIB 1EMTH 4MJID 2APVA 1KGCD 1KN4L 5GGTA 5MENA 4OLVL 3MA7B 1QLFB 4O2EB 5DLML 3HZVA 4JJ5B 1MJJA 1AHWC 5KS9F 5TE4L 3U30C 1HQRB 3HB3C 3EO0B 4PTUB 4WW1A 3KPLB 2Y7QA 3TH4T 5DK0B 1VFUA 1NGZA 5EPMB 4MCYB 4N5EC 4N0FA 3WLWC 5EB9A 3GK8H 3U7WH 3D18B 1E6OH 4JFQB 4KK5C 3WEXA 5L6YL 4U2YA 1IC4H 1N6VA 1GJIA 3S36X 3R0NA 4I5BB 5CUSL 2DYPA 2R0WH 3RWEA 5EZIL 5DFVD 4YHZH 3IJSB 1MCKA 3D3VB 1QBBA 3IDMB 1CE1L 1MFBL 4G8GB 2AJVH 5T5FH 4P48A 1NCNA 3QT2A 3WMSA 5B3NA 5HI3C 2EKSA 4MS8D 3OKEA 2UWEB 2EE3A 4GG8B 3DV6B 3LHPH 4CU7A 4P5TA 4RMRA 4KTDH 9CGTA 4IS6B 2Y1VA 2C3VA 1MFEL 2OYPA 4IDLA 5JOFA 1S9YA 1ZLWK 3P0VL 5CIPB 1VGKB 4IMLA 1RK1B 2DQGH 1MHPH 4K94L 3OL2A 3TNMB 1S9VA 3OJDA 2MKLC 5MP6L 4Y4KC 4LLUA 4QRRD 4M4RA 2ZOKA 3V6FA 2N7AA 4D0CA 4XH2A 2V2XB 2Y25A 5GS0D 5JOEA 1A3RH 3LEXB 5E6IB 4P2OA 4L3ED 6FABL 5IBUB 1RZ8A 4FTVA 4PJ8D 3VFRB 2AAVA 5D1QB 2B1AL 3ARDB 3MR9B 5GRJH 1MLBB 2VAAA 5D7IA 3ROLB 3S36H 1XR9A 4M7KL 4FZ8H 4NM4H 5F6IC 3KYNB 1BWWA 2HJKA 1Y6MR 3SCMC 2XPGB 2XA8L 1A6WH 4URTB 3ZYZA 5L0QB 5EBWB 1T1XA 3WFEL 1HHHA 5C0DA 1TIUA 1CGUA 1T7XA 3VXSE 5CLTA 4RWYH 1IKNA 5CSGA 5FK9A 1JK8A 2YK1L 5A2KH 3TYFA 4U1IA 4L4TE 5BS0E 1U6AL 1CZ8H 3PDGA 3BQUC 4PRDA 4PLOB 2CIKB 3CGTA 4IRZH 4ODUB 2R56L 2CKBA 5HHME 3WL9B 5D7KD 5C0EA 4XNXL 4XVJL 4GW5A 4K7PX 4Z78A 4JHWH 1NPUA 2HFEA 2IAMB 2IG2L 3TBTA 1QFHA 4RMVA 4LCCC 1GAFL 3MUY1 1SY6H 3GI8L 3ALPA 2AI0H 2BXYA 3WDJA 4Q58C 2NY4B 4JREB 4NHUE 1YQVL 1A6UL 1KULA 3RGVB 1A6VH 5HDBE 3LH2L 3E3QC 4NNPH 4PJGA 4FG6C 2ADFL 3U36A 5C08E 3B5HA 1BFSA 1CT8B 2A77H 3I9GL 1EJ6A 4NO0D 1B9ZA 4P4RA 4PP1D 3RWFA 4YHNB 5I1DB 1VEOA 5C0AB 4Z5RA 4PGEA 1XEDA 1NGYB 5EC2A 3M1BA 5HYSB 2DQFA 1WJ3A 3QI9D 3T1FB 2NXZD 4M48H 4OFYA 4YDJB 3S96B 8CGTA 2DQDL 3INUH 1I4FB 3FT3B 3RJDA 2ZUTA 4LDEB 3QDMA 1Z9SA 2BVPB 2W60B 4R6UA 4CN4A 2F74A 1VENA 1MOEA 2HRPL 3GGWA 4H5SA 4X9BA 2HH0H 4LPYA 5T3XD 3QCUH 1N3NA 1M4KA 5LGJB 3DO3A 4OLEA 3QJFB 4DWHA 4XGZA 2DQJH 2Z35A 1R24A 4OCRL 4TUJB 2XV6B 2UV3A 2R2BB 4R26L 3BKMH 3DYOA 4BQ8A 1IM9B 3REWA 1UCBL 4WU5A 4W6WB 4CADB 3QZWA 2CD0A 4Z7UA 4G9FD 2QQLL 4XWOC 2EZ0C 4KFZC 4YBQC 3VA6A 2CDEA 3SE3A 4CJ1A 1ZWIB 1NFDE 1AFVL 3WFDH 5E8EB 1T7ZA 1T66C 1RJZB 3MRRA 4Y2DA 1OQXA 3Q1SL 3VH8G 4AEHH 4H1LB 5DUPL 5IEHB 3F5WA 4G6ML 2XN9D 5C0CE 5IB5A 4NRYA 5C2UB 5I73C 1F90H 5K33A 2GITA 4JFOA 4XC1L 1HDMA 2ZG1A 2I27N 4ZSOA 5C6WH 3QHFH 3BKJH 1XGYH 1MIEL 1MVFA 3ARBA 5GZND 4PRAA 4PUBL 3IDJA 1NLBL 4K71C 3TC9A 4PRIE 1FZKB 2ZUQC 2OP4L 3QUZD 3RIFF 4F3FA 1WBXB 5IB4A 1Z5LA 2CR3A 5H35B 4DVBB 4UT6L 4MXWL 3MRMB 5BXFB 3V4VH 1HHIB 3LRGA 4EI6B 2ICES 3QDJD 1SEQL 1MHCB 4LLVB 4HXBL 3X13A 5C0BA 4NSKA 3GBLA 1ND0A 2YWZA 3VXUD 1NMCC 2PW2B 3O9WC 1T0PB 2X89A 5HGDB 3DRTA 2VJXA 3PWVA 4HX1A 3WKML 1CWVA 4MCZB 2AEPL 1J0YA 5KBNC 1YN6A 5AYUH 4MXQC 3LSOA 5EN2A 2DLTA 4OZ4B 4MNGA 4YAQA 2IQAB 1IE5A 3MRQB 4P57B 4Q2ZB 2PW1A 1ZHLA 2CKNA 2ZUWA 2F19L 1NL0L 1NCUA 2QEJA 5AWNH 4DW2L 4WO4B 1FGNH 1JL8A 3NACL 3DXAB 4X4XA 1EJOH 1I3RA 3WHE0 1NJ9A 1AGCB 2V2WB 1Z6JT 3H0TB 1INDL 2J8UB 1NC4B 1A9EA 4N0RA 2WUBH 1U58B 4I3RL 5EO0B 4OLWL 3ZTJG 1NDMB 2R69H 2ZOLA 3V7AG 4HV8A 3VGGA 3RY6C 3DETC 4NFBA 1T1WA 3QUYC 1PZUB 1YMMA 3MGOB 4HFUH 5D7JD 1RIVH 4Y19B 4S1RL 4Z7OE 1RJYA 3OR7A 3L95A 5JPMA 4PJBB 1MNUH 4JKKA 1J1PL 4LFHG 4UTBH 4N1CA 3BP4A 4H0GA 3FQRA 1S5IH 2VITA 3MCG1 5C3TA 3GHEL 1CD1B 1U3JA 1CL7I 1HCFX 4MA7L 1NUDA 2PNDA 2IANB 5BZWA 1G1YA 4RGMB 4LLYB 5JUEH 4TULL 4CVZB 3VI3F 5J6HA 2CJUH 1K8IB 1S7RA 3BFOA 1ROWA 5C6PB 1FDLH 4HIIA 4DTGH 3GJEA 3AGVA 3FB6B 2VR4A 4LLWB 3E1F1 2VH5H 3C09C 3HMWL 2DJ4A 1CFNA 1D5IH 5LGKA 4MJIE 1KGCE 2AJSL 5HJ3A 4GW1A 2Q7YB 3OB0K 1JNNL 2G5BA 1KPVB 3LMJL 1W0VB 2YBRB 1JNLH 4M6OL 4YLQT 3ARZA 4YHPB 5FUZH 3TPKA 3BPCB 3MODL 1UA6H 5J0BA 1WUNT 2HLFC 1XF3B 2VXUH 4K8RL 1KB9J 2JJUA 3QUMB 1X5AA 3HAEH 3VFVB 4V3DB 2OCFD 3WN5C 3MRNA 1RZFL 4EI5B 5KZCD 3K1KC 4XVSH 5C8JB 3IETA 5TH2B 4KZEH 4J3SA 1E27B 4X7TA 1DE4A 1XF5A 2E7CA 4U1HA 3D85A 5DK2B 4R4FH 2UWEF 5IV2B 1NSNL 2CGRL 4ZS7H 2D9QB 2NW2B 3OAYH 4QXGH 3BX7C 4JDTL 3PGFL 4E42B 4ZTOH 3WIHA 5FGCE 3STZB 4W4NA 2GCYA 3PUCA 5ANMB 1D9KA 3TO2A 3QWOB 2R0ZH 4HPYL 2ATPA 4KJPD 4JQXC 5IEKA 5DMIH 4OCLC 3TJEH 3MA9H 4ZAKA 3L3HA 2BVOA 2V2TB 4NQVB 4X0KB 4WEBH 1HXYA 1U3HA 4OD1H 1KJMA 4QRRE 3HUJA 1RJCA 4MD0A 3CC5A 1SEBB 4E0RB 4C83B 3FTGA 5DUBA 3KXFB 4V1DE 5B38B 2IADB 1EFQA 1MCPL 5IESL 5FYJD 4TSBH 4M6ML 4L8SB 5IW6A 1JNHB 4NKMB 5TGBA 2VLJA 3RTQD 4F9LC 4NZUH 5TF1L 4YHIA 4L8BB 3CVHH 1BLNA 5FA4A 2PUQT 3RPIA 5L9DH 5H2BA 3R1GL 1R3JA 5I8CB 4K3EH 2Q86A 2HRLA 4WIQA 5D70L 1CD9B 4L9LC 3H42H 3WJJA 4J1UA 1LO5A 5ESVB 4MYWB 1JHKL 3E8UL 2H26B 2W92A 4RA0C 2CLRA 3K1DA 4S1QL 3OKDA 3CX2A 4JPWL 4ZUWA 5FYJH 3L3JB 4NQEA 4G5ZL 1RIUH 4YHMH 4J4PD 15C8L 3GNMH 5T1LB 5IG7B 2JJSA 2UYLA 3O6LH 3U4EB 3W82A 4OQTA 5D7KE 3KPTA 4NO5B 2APBA 3AREB 1YYLH 4J8RA 3U6RB 3EOTH 3BDBA 1ZLUK 2AEWA 3UJJL 4JPIB 1AXTL 3RWJA 4JG1H 1T0MB 1TETH 3ALXA 3IDIB 4HKXB 4AH2B 4GAJL 2WANA 4OM0H 2GSIB 4ERSH 3KJ6H 1A7OL 4KVCH 1T5WB 3S5LB 4JFFB 5DFWH 3IFPB 5K9JH 1KELH 3G6DL 5ERWA 3M07A 4U3CA 4CVUA 2NXYB 2G9HA 1CFBA 4YZFF 1N5AA 3PWNB 1MWAH 1PFCA 2WLYA 5DD3L 3JV4B 1WFTA 3GO1H 1MRDL 4NM8L 5IVNA 1YEFL 5I9QC 1IEHA 1P7QD 3DVNB 3O6FA 2AP2A 3O2VH 1VFBA 5EO1A 3L7FB 1A1MA 5GJSL 5E9DB 5GPRA 4BELD 3S3PA 1KJ3H 5DS8A 3B2VH 1I7TA 5INCB 1RURL 4ZXBD 3IFLH 4FABH 4LCIL 1A7PL 1FL3B 2MHAB 3JV0A 3WNPA 1Q38A 3TFKC 1U8IB 2VQ1A 4UIMB 2EDEA 4M7ZC 3RVXC 4YXLH 1FO0B 4MD5B 4Y5XB 5GGRB 5T3XE 5HY9A 3HR5B 4AQOA 4RISH 2BY0A 5E56A 1JWSB 4FFZH 5EUKB 3GIVB 2Z0BA 3QNYA 2FGWL 3GM0A 3CUPB 5CEZL 1GPOL 1P4LB 3NMEA 1HKLH 4X4ME 3RUGB 1A7QH 3BUYB 1QVOA 5ALBH 1GGIH 2HKFL 4OBRA 2CK0L 4G9FE 1UXSA 2V7NA 1W72A 1U8QA 1YEHL 5I6XC 2EDBA 1EO5A 1L0YA 3QEQE 4KY1H 3KPSB 5I74B 1OAKH 3OHXB 5L8LB 4EBQH 1QEWA 3CFCL 1ES0A 3DHMA 2BNQB 3D3VD 4G8GD 1IAOA 4W70A 3WS6C 3ZHLA 4LPCA 5E4EB 5IIEB 2VZTA 3DUSA 2W59A 4ZTPL 2DD8H 2ADGA 1N64L 4P2CG 1FL5B 5F9WC 1XGUB 4AIXA 3VI4F 2P5WB 2PETA 3F12B 3HZKB 3CFDA 1MF2L 1OB1B 1PBYA 5HYJA 2C7UB 4PRHA 4PJ5B 4Y2OA 5GS1B 1N8ZB 1AC0A 3BT2H 2GK0A 2J7LA 3QDJE 2IH1A 5E6ID 4LOUC 1DCLA 3CMGA 3OXSB 3NBNA 3QQ9C 1XZ0B 4MA8L