2HJKA

Crystal structure of hla-b5703 and hiv-1 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strong TCR Conservation and Altered T Cell Cross-Reactivity Characterize a B*57-Restricted Immune Response in HIV-1 Infection.
pubmed rcsb
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen B-57
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hjkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2hjkA01
4F8TA 3L3DB 2CLZA 1XGRA 1KCSH 3QUZD 4P23A 5HSFA 3VFPB 4CU7A 3MFFB 4YZFE 5ECJE 1Y6NR 4ZPTA 4YDIL 3KWWA 4ZO6A 1N6VA 32C2B 3HC3L 4PRIA 4NQUA 2QJDA 5EU7C 4KMTL 1VADB 4JFED 1RY7B 5LCVH 5MI0B 1QRKA 4NUJA 4GRMB 3HFML 2EE9A 2HN7B 1W8NA 3QIUD 1RZ7L 2HKFL 1B90A 1M6OA 3EUUA 1LE9A 4UDTA 3QSKB 4GKNA 3HAEA 3EYUH 2XT1B 4ONGL 4LLMB 4LNVA 1KTDA 5F7YC 4YHML 3PQYD 4G8GD 4OLEA 3C2AL 3KYOA 5DMIL 3OJDB 2DMBA 2Z31C 4KRNA 4XB7A 3MYJA 1RUKH 4ZO7A 4LIQH 3QCTH 2AXFB 3D18A 2D03H 5FGBC 1TJHH 3VFWB 1H3WM 2W91A 5DK2B 2YMXH 3GM0A 4RDQG 2GTWA 1B3JA 3MA9L 2VZ3A 5D96C 1MCLA 5EIIB 3BIAX 3LD8C 5F71A 4LHUD 2HVKA 1EGJH 2APVA 4UT7L 3KJ4C 2VZUA 5FECA 5L8LB 4Y88A 5FYLH 1M05A 2VN7A 4OLZH 4PJEA 5GIRA 3V8OA 3AU1B 3KYAA 2HTKD 3ZKNC 4P2QA 3LRHA 1H5BC 2NY4D 1XZ0B 3MZGB 3F12A 1TETH 5DJZB 3DV6A 4P2QE 4GG6F 3U36B 1WT5A 4QNPF 4Y4KC 2V7HA 1RZKC 3MR9A 2ICCA 4K7PX 2EDXA 3MLVH 1PSKL 3GHBL 4QF1A 1P69B 4OD3H 4PRPE 5GSRA 2NTSP 3T77B 4B41A 1JYNA 2GW5A 5CJQL 2M8XA 3H9SA 1IAMA 1LNUB 4YC2C 5C08D 1IAIM 2AK4D 1YYLL 4Y2DA 1T7ZA 2A6JB 2Q86B 1DBAL 1YZZA 5AAWA 3VFTA 4E0RA 3I6KA 1MI5D 3KYNB 3QUKA 4YXKH 1WEJL 3MNVA 4JFOA 3RWDA 2EDBA 5KVFH 1QNZH 2OMBA 1J8HD 5DJ6B 5IBUG 3O0RH 1A4KB 1AKJD 4JPIB 3JV4B 3BH8A 4UDUA 4NN7B 3V2AR 2HLFC 1GVIA 4AT6A 2F9BT 2HFEB 4XVUD 1NL0L 2C1OB 2FIRT 4Z7VB 3IETA 2PYED 3DHMA 5BOPA 1A6AB 1N2RB 2ADJB 4JRXA 1F6AB 4YNYA 4AIXA 4NQCB 4JGMA 3HNVL 3U4EA 3GKZA 1NGXB 5C70A 3WJJC 1FPTL 1UG9A 5CINL 2X4UA 2X9WA 3RWIA 5JW3L 1FL5B 1UJTA 5E1AB 2UWEB 5KSAC 3DX6B 1A1OB 1HILB 1H8SA 2ZG3A 5HDBF 1EHXA 3J7HA 2C3WA 4ISVB 4LASH 4QOKE 2JK5B 4IDLA 4N0CD 4H1LB 4KTDH 4WFHE 4BQ6A 4NQVB 1OAXH 1EEQA 1F4YL 1P4IL 3VXNA 4CMMB 4JFEE 3GHBH 3T0EA 2GAZA 3VGDA 2BNQE 2DQHH 4JRXB 4HJJL 1T0MB 4FQJL 3CCHA 4ZUWB 1U3HD 3LEYL 1JGUL 3JZ7A 3MLXH 4D0DB 4DUWA 2DJSA 3DXAD 2D7OA 2DLFH 1YEHL 2R0WH 3QI9B 2GQHA 3F7YA 3TWCH 5E9DB 4WI2A 1OSPH 1KNOB 1WAAF 3BQUD 3KYKH 4NQDA 1DEEB 1N5AA 2C1OA 5GGVY 5F6HJ 3T3PF 3T0XA 5ANMA 3SKMA 12E8L 5DQ9A 4OQTA 2GUOB 3CFIC 5A1AA 4XCFH 1D5MA 4ODWA 1HSAB 3REWA 5L0QC 5KBNC 3OR7A 4NGHH 1M1SA 4NNXA 2X4TA 5TE6L 1BF2A 5HYSB 3ZO0A 1ITBB 4YFDB 1TZIB 1I9JL 4PB0H 3V0VA 3ARRA 1WJ3A 5E1HB 1ODAA 2GSGA 4WWID 3T08A 1OW0C 3CFKA 1TVDA 1VCAA 1NCBH 2QSTA 3EJZD 2F5AL 4QXWA 4YHKH 4NZTH 3BHBA 1RZ7H 4PG2C 3W9DA 4HS8H 4WI8A 2OR8A 3BQUC 1INEH 4F9PA 2OP4L 3O3AA 2I9LA 4HEME 3VXMA 3UTQA 3TO4B 3WIHH 3EJYC 5HGAA 1UJ3B 4NKDB 1HIML 1LD9A 2EIBA 3CMOH 4MAYC 3QNYA 1I1AD 2DOCA 4FXKA 4IHOB 5EIIA 3V4UL 4JFDB 3KPMB 5J0BA 3FCTA 3NA4A 1FNFA 1YQ2A 1VSCA 3UYPA 1SBSL 4HX1B 4JZOA 1JZ2A 3MRJA 3TNNA 3ILPA 2DWEA 4X80H 4DOHE 3VCLB 1D3CA 4LDEB 3V5DA 4P2YA 3UTPD 4BZ2H 4HZLA 3PWLA 2IEPA 1ADQL 1G7MA 1T89C 3QFJD 3FAXA 1FL3A 5SV4A 2V2TB 4WU7A 2VR9A 4KTEL 2ARJB 3VFUB 1NCDL 4P9ML 4YBLC 4YHYB 3D18B 4P9HL 2B2XH 4G8FB 4M02A 5EZOL 5D2LA 4QHNB 3T8XA 1U8HA 1DQQA 4OSUL 3QEHB 1RVFH 3BEVB 3VD7A 4PJ8C 1MWAB 2B8OT 3NIDE 1RULH 1YPZF 3OWEA 1YJDH 4XB8A 4MNQD 5JW5A 1DUYA 3CX5J 1GYAA 4CVZB 2AQ3A 2VLLA 3AB0C 1P2CA 5JLZB 2EC9T 1GCFA 5BXFA 3GK8H 2NW3A 3RVTD 4Y5VB 5JDSA 3O9WD 4XVSH 4Q97A 3CU1A 3CXHJ 3L3HA 4MA7L 1HEZA 3EOBA 3B2VL 4H0HB 3S96B 3HNTH 5TE4H 1IEBB 1FL5A 5E1AA 3WL9B 1FNSH 1VGKB 5C0JA 1XGTA 4XTRC 4X5XB 4X7FC 5GRZA 1H3VA 3V7AG 5DJCB 1YNLH 4ALAL 1N4XH 5ICZB 2C4FU 4PJIE 4LCWA 3FOMB 5HHQB 4PGZA 1FG2A 5KVDL 1FHGA 3HPJB 4MSWA 3MRDB 1HDMA 3JUYA 1S7SA 3CH8A 5FGCB 4WU7B 4Q9RH 1I9RL 3VXSA 3BUYB 2QHRH 2XTJE 4KKBC 2DBLH 4JE4B 4RMQA 4B7LA 2GIYA 1CG9B 4KK5C 1WIUA 5EU3B 3D85B 1IT9H 3KPPB 1F8TH 3EOAA 4Z95H 4D3CH 1E28B 4YUEH 3VXMD 4FQXB 3WNNA 3VFSB 1EO7A 4M1DL 1XIWB 1EDQA 4HAFA 5ADPH 4AEIH 5D5ME 5DT1L 4Y5YA 4LAQL 3BZEA 1JP5A 1F58L 1H0DB 1KJ3L 2ZOLA 1T22A 3E6FA 2EH8H 2NY0B 4HKZB 1AD0B 5INDB 1MSPA 1HSAA 3OKNA 4MGXA 4OZFB 3K2MC 5I1GH 2YN3A 2MCG1 1XF3B 2C1PB 3F58L 4PJIB 1MJ8L 4D9RD 3B9KC 4TQEH 3RUGB 5T3ZE 5DR5H 4OUOA 2R23B 4U3CA 1FJ1A 2BNUA 2P8LA 3OKDB 5E8NB 2W1NA 1J0YA 4PBWD 4XZUA 2WAHA 4DQOH 3GB7B 1MJ7L 3BO8A 3CFKB 2FD6H 2R2EB 4ETQB 5F7DA 5BVJA 1G7LB 1PY9A 4S1SH 5F7HA 4D9LH 5C0RH 3HG1A 3RU8L 4L3EA 1T4KB 1UXSB 3I3DA 4JPWL 5KN5B 4CADA 3G6JE 3TVMA 3H9SE 3O6LH 3GDBA 3GGWB 2VC2L 5I17B 4JFFD 3PWUA 1FCGA 1DR9A 3PNWA 1S7VB 4HS6A 4MB3A 1NC4D 5A16A 3KR3L 5E8PA 2E9JA 3KYMB 5E8DH 3MNVB 3DOSA 2JIXD 3TPUE 5I1AA 5D1QC 3HI5H 5FF6B 4AG4H 5ELIA 2OR7A 1J11A 3S36L 3RDTB 5J6GA 4L29A 2JTDA 5KSVB 3ARBD 4Z0XB 1WCQA 1U3HC 2XACC 1CXEA 2MFNA 1TZGL 3HMXL 4YXHH 3IFPB 4BKLB 3PNWB 3S5LB 3LOWA 1QD0A 1KB5H 4NQTA 2E7LA 4LVOC 5IEHA 1CVRA 4MNQA 4M43H 2IPTL 3P9MA 3PP4L 1A7QL 4OZGA 1JZ4A 4UOW1 1AD9B 1HQ4B 1YPZE 1RZFL 4HUNB 1ZT4B 1QBLH 4HIIB 3ES6B 4Y4FA 4NBYB 1S5IH 5IMOB 1AQKL 4J1UA 1XZ0A 1I7ZB 4XPBH 4FMFA 2FX8L 4XP6H 4TYUA 3D69B 5E2TH 1RUAH 3FQXA 4UU9A 1HINL 3TBWB 1NBVH 4QGTA 3RL1B 2D7QA 5D5MF 3MJGX 3QIWC 3RP1A 5IV2B 1Q0YH 4P9HC 3B5TA 4PS4H 4NO0D 1U8JA 3HZVB 5DTFB 3S35H 2MSPA 2WINA 3H7BA 3QO1A 4Y19A 5IT2L 5IVOA 1A6AA 2IC2A 1EAPA 1GHFL 1K8DB 2QADD 4XMPL 4ZMAT 5C09D 5F93C 1RHHA 1KCVH 2AJVH 4FXGA 4TTDC 5E7FA 3EO0A 4HH9A 2FX7H 2P45B 5I8KH 3BPNC 1QEWB 1PW3A 3MV8A 1D9KB 1ZHNB 4FOMA 1NGYA 2IH1B 1RUPL 4Y4HB 1CLZL 3C60C 4YHLL 5GGTL 3RL1A 5EBMB 1R3KA 2F19L 3MACL 2CDFB 5AZEH 2VE6A 3MRPB 1TTGA 1GC1C 4FQHA 2IGFH 4B5EA 4L8SA 1DVFD 1IGFH 3C60A 5EZIH 2H6PA 3GUTA 3MRIB 1JN6A 1XGTB 3ES6A 5D70L 1WFOA 1ITCA 1HHIB 5IFHL 3IKKA 4KDTC 5J56B 4NNPH 1Y6MR 2V2XA 4R90L 5HI5D 2E27L 4KZEL 5I1KL 1XGRB 5AZ2L 4MS8A 3ULSA 2GJ6B 3O3BB 4D9QD 4M3JA 1TVBB 1BD2A 3T2NL 2O61B 2DM7A 2RJMA 3RGVA 4LPYA 3WUWB 4PJ7B 4Y2DC 4HW6A 3KWWB 2R4RL 1IZKA 4LLQA 4DKAA 1FRGH 1YY8B 3PWVB 2HFEA 5ITBH 4NCDA 5D7JB 5JIHA 4Z78A 1FFOA 3WFDH 1P5VA 1HHIA 4RX4A 4U1LB 4LRIC 4WENB 2WBJA 5EU6E 5L0QB 4PIRF 3QUYA 4WTWA 2R4RH 5F9DC 4IDJH 4JFZL 1A6WH 3CX5K 1FGVL 1P4LB 2I60H 4PFEA 4WGVB 3LN5B 3IB4A 1MFBL 5T5FH 4XP1L 5EUOB 4LRIA 2ZUYA 4JHWH 1KENL 5JXED 3ZMRA 1YUHB 5C0EA 1MIML 1EHLL 1XGYH 1JV5A 2ATKA 2VOTA 5E8NA 3PP3H 5CIPA 5EOTA 4RGNB 4LSPL 2BVOA 3KPRB 4WIQA 5CBAB 1GGCH 4MVBA 4MA3B 2BNQD 4UOJA 1F4XL 1IC4H 4WO4D 2BHYA 3QO0A 1T5WA 2F8VA 3Q3GA 5C8JA 4K3JH 5C0AD 5BZWA 2EYSA 3ARQA 3TYFB 1ZVYA 3FOLA 2EKSB 5C07A 3ALXA 1MWAH 3HCVA 5FA3B 3EHBC 2BXZA 4XNUH 2JKXA 3SE4C 3S36X 2IPUK 4O2CA 3K4DA 4IJ3B 1XGUA 1KYOK 3SGDI 4O58L 4DUXA 1KCVL 1N3NB 4G8EB 4HULB 5BRZE 2F53A 1BQHA 5KG9A 2EO9A 4POZC 3LRGA 4MS8D 4YHIB 1FE8H 1WQVT 4PR5A 3SGEH 4F9PC 1L8JA 3P11H 3L5JA 5EO1B 2IF7A 4JCLA 2GEEA 3QULB 1A0QH 4X6EA 1FVEA 3BPLC 3N50A 3CSBA 3OQ3B 1JPGA 1GH7A 2N4IA 3QDHA 2Y1VA 2R29H 3QZWG 5F1KC 4ZFGH 3IJHB 3WN5A 3WUWA 1R5VA 1UENA 1ETZB 3QO1B 1CFQA 3AGVA 4JM2A 1RZFH 2CPCA 3ILPB 1P9MA 5C0FA 5JPNA 1TNMA 3M17B 1OCWL 4RIRA 5B8CC 3QEUA 1ZLWK 1NCWL 1T89A 5T1LD 5IVXF 2HN7A 1DLFH 4OFYA 2YSSB 5TFSH 5ADPL 2VLKD 5CSGA 2H2SC 5IHUL 4DUVA 1T66C 2OSLA 4ONOA 2VXQH 3WIIH 2DN7A 3VXUE 2H1PH 1QBBA 4CMHC 2ICEB 3ARFB 4AG4L 2DD8L 3EIFA 3ULVD 4FQXC 1EHAA 1NDGB 4LHUA 3VGBA 1RIVH 4NRZA 4O2FB 1KEGL 1YMHA 1Z0MA 3SGKA 2H45A 3IU4H 3P40A 3UYRH 1B2WL 4EN3A 3CFBA 1Y18B 4NKMB 4BZ1H 4ELMF 2YUWA 1QACA 1FQ9C 3FQTA 3IXAA 4G6AC 5I30L 4JPWH 1MQ8A 2A6KB 4UIKH 5DK0A 5AYUH 4A6YL 1CZ8H 3IF1B 4G8GA 1NUNB 3RL2A 3G5VB 2X7LA 2GK2A 3FB8A 3MPCA 2H6PB 3GUTB 3E1F1 3MNZB 3LZFL 2I9TA 4Z0BH 1ORSA 4U3XA 4KI5C 1BM3L 2ADGB 3IFLH 4OD2B 4ODTL 4XX1E 5B38B 1LK3L 3S34L 4APQD 1IJ9A 1KJ2L 1S9YB 1NAML 1Q9LB 1L0QA 3FRUB 1TTFA 4DCQB 3U2SB 5FUZH 4MNGB 2J5LC 5EO1A 2QLVB 3BO8B 4JN2B 3DSFL 1NC4A 4FQIL 5FHAL 2DI7A 1SY6A 2MCPL 4YDLB 5FCUH 4I77H 1HH6A 4L9DA 4I0PB 1RU9H 4RQQB 4X6FA 3JWNC 3TVMD 2VDLL 2VDLH 4PJHB 2B2XL 3LDBC 4OF5A 4WRLA 4OIIH 4GRLD 5E03A 1QFUH 4KUCF 3VFTB 4E0RB 3HG1D 1IEAB 5D1QA 1DLFL 4U0QB 4NKQB 1T22B 1Z9LA 2VTFA 2GJZB 4X5WB 3TBTB 2XV6B 4H1LG 3GMNA 5AG8A 5ILTH 4OJFL 1ZHLA 4XP9H 5GQBA 3MTRA 3TYFA 2OK0H 1B6DA 5HHPA 4ZS6C 2Z31D 1U3ZA 4PP2A 5FM5O 2VXVL 1PZUB 4EDXA 2ATPB 4QY8A 1QVOB 2JCCE 3T0AA 3UTSA 5HI5C 2MHAA 2UWEE 4TVPH 4YPGA 4PG9A 2NY2D 3PJSA 5E5RB 2YD8A 4X0KA 4O9HH 1OPGH 1NMCB 3N1FC 2COQA 4NHCH 1YMHB 3CXDL 5HHOB 2D31B 4N1EA 5E99H 2ZUWA 1E6JL 5HHNB 5DLML 3V4VH 3GM8A 4Y89A 3GK8L 4JJ5B 1NMCC 4LLWA 4WUUE 2EC9U 3VG0L 3U4BH 2ZP0T 3DUHA 5DO2D 1MRCL 1TTUA 5D8JH 1JNJA 3G5VA 1LO2H 1OSZA 3VFNA 1IAOA 1GOGA 3GSWA 1U8KA 4M61A 5E94A 3B9KB 3P0YH 2RFXA 2GITA 2OTPA 3UTTB 4RBPH 5TFSL 4ZFFA 1CICC 1EJ6A 5CEXA 2W60B 3IDIB 3IVKB 1FH5H 3QULA 3L95A 4WV1C 4K8RC 4R26L 5E4EB 1SJXA 2ZCHL 2NW2B 5I1CL 3MR9B 1KUMA 4KKBD 4WU5A 3GSXB 2IMMA 5INCA 3VD4A 4TRPL 1KLGA 5TDPB 3VXQA 1Q38A 4JKPL 5F97E 5L2KE 4J8RA 1DLHB 4GRWE 4I0PC 4WEBL 2O5ZL 4N0UA 4P5TA 1IGJA 3OKKB 1IRAY 2PR4L 5HY9A 5KAQF 4L8SB 5ITBL 1MFBH 5CHNB 4XCYA 4RGND 4UQ2A 4JFZH 2R0LL 3HMWH 3HMWL 3VMOA 3RVVD 4LHUG 1JNNH 5DJCA 1MH5A 4E5XA 3ARGD 4IRSB 3I6KB 1A21A 4KV5F 4PLOB 2FX8H 1MFEL 1CICD 3B83A 4JFDA 4TTGA 2EDOA 4QRRE 5IQ7H 1UM4L 2E6JA 4WO4C 3EO0B 4LSRH 3EO9L 5F6IC 1X4XA 3PGFL 1JPGB 3DXAE 3HC0B 3HHRB 3DLQR 5IF0B 2H32A 1YQVL 1PEWA 2W07A 3L6FB 4P5TB 2XN9A 4M43L 1IZJA 2VQ1A 2WBJC 5SWQA 2VLJA 3QNXA 3BN9C 1B9ZA 5JMRA 2NPLX 1MAKA 2A0LC 2VDKH 2XXMB 3FO0H 3ZT5A 5EZIL 43CAB 3I9GL 2ZJSL 4KKAD 3PV6A 1NKRA 3AREA 2A6IB 2Z8WC 1RZIA 3FO2A 5TDNB 1ZA3B 1U8HB 2Z93B 2V2WA 3GJFK 5LQBL 4G8IA 4F33B 1U3YA 4YHLH 1P84K 2O5YH 3VGAC 4X8JB 2I07A 2OI9C 4PJ8B 3MUHL 4LLUB 1V7NH 1GC1L 4APQC 1CE6A 3SGDH 4IRJC 3LQZA 2NY1C 4XGZA 2CLVB 2O61A 4YGVA 4QRTB 3IT8D 3S35L 4Y8AA 4IM8A 4WFFD 5E2UH 3T0EE 1Q94B 3G5YA 2P5WE 5TDOA 1IAKA 4OTXH 2R69H 4POYA 5J13C 1MWAA 3SCMB 5IBLD 3QDMA 1A1NA 3GMLB 5IB4A 1JRHI 1OM3L 2DIBA 3V4PH 4X6EB 4OLUH 3WFBH 4EUPB 4M6OH 4JREB 5F7UA 5T1DH 3KJ4B 4ZUSB 1S5IL 1J1OH 4KUZH 2ZNWA 2VH5L 2RCSL 3L5WA 3QDGD 1ONQB 1TETL 3ZSTA 1MCDA 3PL6D 1KB5L 4WV1A 2D31A 3QDGE 3P4OB 1AQKH 2YZ1A 4FQ2L 3LEXB 4PRHB 3QEQA 1HSBB 4XRCB 3I2CL 4U1NA 4OGAC 3CVIH 4AK1A 4NNPL 5DT1H 3IDJB 1NPUA 2VWEC 3HZMA 3IU3B 3MJ7A 4ZQKA 5ESAB 3MRBA 3LQAL 2B1AH 2VXTH 4N0FB 2CLRB 4C4KO 3EJYD 1IL1A 4YXHL 1P4BL 4FG6C 4R7DB 3VWKD 2MCPH 3KPRE 2LTQB 4LKXB 3VXOA 4BFBD 3W39A 5J1AB 1TJHL 3TA3C 4JANB 3T0ED 2KQMA 2J7LA 4MDIB 1KLUA 1U8MB 4NM4L 2AEPH 3CDYA 2DQJH 4OLVH 1VPOH 3SDCA 3TCLB 2OR9L 4OUUB 2NXZD 3PGDB 3QDJB 3F6LA 3JWOC 2FL5B 5F3HB 1CLOH 5KS9B 2KKQA 3OJMB 4AIZA 4WHYH 1IFHL 2XWBB 4OCNC 2Y36H 4ERSH 1SVCP 3CIQA 4X7TA 2X4SA 5FO8A 2HRPL 3NCJL 4NP4L 4QHUB 3ARBB 3L3GB 2QQKH 3PQYB 4GMTH 1U42A 2XZAL 4WCYH 3VD9A 5IEKA 5KVMC 4HV8B 3TVMB 1RUML 5BS0B 1PAMA 1XCQB 3C09C 3OF6D 5DJ8A 4P23C 2NY3B 4FQPA 4HJ0D 4HH9B 1FNHA 1HDMB 1A9EB 4PREB 1NJ9A 4J6RH 3NABH 1DEEA 1HNGA 3O2WH 5FYLD 3MYJB 2QR0B 5FOBB 3MRRB 4HPOL 1QBLL 3JTTB 1IC7H 3D0VB 2RGSA 4GSDL 2R2HB 3WSQL 4DGVH 2UVFA 5D6DA 2YK1H 4APQA 3H3PH 1UCBL 4FNLH 4ZAKB 3O8XC 2VYRE 3VG9B 3HLAB 5I1EL 3HN3A 3BMWA 4NO0B 1UEMA 3P77B 1YNKL 4RFNC 4BYHA 2CO6B 5MP6L 4QOKB 3QUMB 3AU1A 4YZFF 3VWKB 5K9OA 3BAEH 1FIGH 1L6ZA 3BD5A 3MROA 4ZNEE 4JM2B 1YN7B 1AO7D 4TNWK 2VNCA 3O11A 4HKBB 3MODL 1KJMA 3FO1B 1BFVH 1WVZA 4PLJD 3RZCA 4JGJA 3PWJA 1SJEB 2VSDA 3F7RA 4HGMA 2BVUA 5MEOA 4ETQA 3MSPA 3OG6B 1INDL 3IFOA 2IH3B 4HIXL 5CS7A 3KPLA 5DVNA 3UTTD 3PJSB 4P46B 1ZEAL 4P0DA 1K3IA 2VLKA 1ZLWH 3MRQA 3JTTA 4KUCD 3KYNA 5I0DA 1T7VA 3O11B 4CJ1A 4RGOH 5T1LA 1UCTA 3B3IB 4JY5H 2XPGB 4F7MA 3VDBA 4PB0L 3UZEA 4LSUL 5HHPB 2CUHA 4Y19D 3QDME 1AGCB 2A6KA 4JM4H 4FFYH 2IPKA 2H2PD 3QDJE 3SE4A 4NGHL 3S3SA 4FQXA 4HIEA 3VA6A 4YIQA 4XNXH 3EDJA 4K9EC 4RMVA 1EEZB 5J3HD 3IRPX 3QHZH 3P4NB 2NZ9D 5DFTA 3S5LA 1K6QH 5L9DL 4NRYA 3MJ7B 4ZQKB 5GHWH 1FAIH 2H3NB 1FCCA 3CSYB 3BN9D 2XKNB 2P8MB 3NIFE 2B4CH 4PJHE 1KXTB 4U2YA 3U46A 1RPQA 1L7IH 3GSRB 4K7FA 3WLWC 3MBEB 3R1GL 1OQXA 3U2SA 4DCQA 5TE7L 3CMGA 1MCEA 4NYLB 5DD3H 3G08A 1E4WH 4JHAH 1OY3B 1PG7H 1U3HB 1D7FA 1FGVH 1BJ8A 5D7IB 5GRWA 2FJHB 1F97A 3CK0H 3N9GL 5SWZE 2VZVA 3LPGA 3VRIA 5C9JB 3OX8A 4Y1AB 3BJLA 2JJTC 4B50A 1B0RA 3FQUA 3MX0A 2YC1B 2NTFA 1NCBL 4PBVC 1G7IA 2BOBA 3CUPB 1I7TA 4K07A 2WY3A 3GSXA 2NY5H 3QEQE 4U33A 3VMPA 5I1KH 1OAQH 4XC3L 4K3HA 5C0CD 4N5UA 4JY6B 1MRFL 5EUOE 4LL9A 4KZDL 3MRFA 5FFLA 3PHOB 4YFLI 3EBAA 3TC9A 3ULVC 4M5ZL 3MRIA 1U8PB 5DRXA 2AJXL 3D39A 1IKFH 4H0IA 1RZIB 3DBXB 3T3MF 3HE7D 2W0FB 3RVWC 1LDPL 1QLEH 4XNZC 2EKSA 4W70A 5C07B 5KSAD 2F19H 4PJCE 5C6WH 2XICA 1AHWC 4PGEB 4DWHA 4NC1C 1XF4A 1WEJH 1OQOA 3ORJA 1U8NA 1FYTE 5GS2H 5IB3B 5C0AB 1X7QA 4P57B 2Q8BL 2D7MA 2FDBP 3QDGB 5KG9B 3A6BL 2FX7L 5I8KL 1SBSH 43C9B 2BNRB 4OGZA 1N59B 1JNHA 2DF3A 4PY8I 1U8QA 3RWCB 4FXKB 4IHOA 4NWUH 3AREB 1IAKB 3ARXA 1RZGB 4RGMB 2ADIB 3TEUA 1FVEB 2RHEA 5I8CB 5F1SA 3GSOB 3MRJB 3TNNB 4DTGL 4ZTOL 3KNBB 3N0PB 5JHDD 1C08B 4OF3A 1DVFA 4R96B 3RVWD 3ZKXC 1BWWA 3RBGA 4NKOB 4XPBL 3QG7L 3T1WA 3QWRD 5DUPL 4J8RB 2CGRH 2OQJB 1NBZA 2KL6A 2Q3ZA 3FO9A 5KS9E 4J4PD 5GGUB 2Y72A 1JTPA 5LG1A 5D7KD 1QSZA 4GRWH 1T83A 3O41B 4PJFF 5DVLA 2J8OA 2AERT 3LEXA 4E9LA 3DX6A 2Q7YB 1YEEH 4OI8A 1JCKA 1DDHB 4JFDE 5F9WB 4J3OC 4HUWA 3JWOH 3TP4A 2FO4B 1FSKB 4YIQB 3QIUC 1A7OL 2AJXH 2V5RA 5EZLA 2PTTA 1IGCL 1N64H 2VLKB 4Z7QF 5F6HI 1J0ZA 2D4DA 3GBLA 1G7QA 2BOCA 3DROB 3CC5A 3QXUA 2XFXA 3N1GC 4Y16B 5E8DL 3QIUB 2X44D 4C56B 4PY8J 2Y6SC 3DX8A 1UZ6E 4F8QA 3QH3A 2NY2C 5I15L 4PJDF 3WFCH 4PP2B 5D72H 1KFAH 2DQEL 2NY5L 4MAYD 5EUKA 2RCSH 4G8GB 3LN5A 4RAUB 1U9KA 4NO2B 3R8BB 3RAJH 5T1DL 2UY6A 1MFDL 4OCYL 1F4YH 1P4IH 1VA9A 4X98B 1DN0A 3UZVB 4CVXB 3IDXL 1AE6L 1TCMA 1PSKH 3MLVL 5D5MA 5IEHB 5FYLL 1KN4H 3TIEB 4OZHB 2YPLB 3ARTA 2HG5A 1KBGH 5D7LE 1I1AA 2QR0A 5CEZE 2X4RA 5CINH 1P1ZB 3BWAB 4XWGL 1E4XI 1NC4B 3RPKA 4UAOB 2ITCA 1F2QA 2R2HA 1AY1H 2FIKA 1H5BA 4V2BA 4MDJB 4BSWA 4FABH 2VL4A 2BSSA 1IM3B 3O4OC 1AD0A 1I4FB 3BWUC 4PJHA 1X9QA 1KN2H 2ZOLB 5JO5B 2D0GA 5E2JA 3TH2T 1IKFL 3CH1A 3KS0H 1EFXD 5AD0A 4U6VH 2ICES 1AI1L 4KKNA 4KY1H 4PJIA 1ZHLB 1YA5A 3U48A 3JWOL 5MERA 1XR9B 3MV9A 4N8CL 5LAXB 1Z9SA 1JF6A 3VXUA 5KVFL 4FXGB 3BX7C 1MHHB 3QDJA 5GGRB 1KNOA 3VA2C 4DKFL 5AYQA 3C08L 5BVJB 4Y5XA 3U0PA 3FN0L 4P2OA 4P49A 4PBXA 3BISA 1QSFE 2VN4A 4FP8L 2HLFD 1P7HL 1NFDE 3X14A 3GI9L 3SDCD 4P3WA 3HPLA 5F7FA 2PXYB 4JDZB 1EXUB 3HFMH 4K9EL 5I17A 4X9HA 4PJ9A 2P48B 4Z7WB 1CG9A 3K4AA 4J3TA 4JHBA 2J1KA 3MROB 4FFWD 3SO3B 4DK6A 2CRIA 5DDHB 5GIRB 3I85A 2EIZA 1X3DA 4K8RH 5FF6A 2YZ8A 1F00I 2B0SL 4KQ3L 1OSZB 3VFNB 5I75B 1U3JA 3VXSD 3SDXF 1XIWA 4LCIL 1BQUA 3QUXA 4JEGB 2P1YA 4LSQL 4KRMB 2Z35B 1CXFA 3DURB 1HZHL 3AC0A 4WTZA 4ZSOE 4R26H 4PJCA 4WHCA 4UINL 4KTEH 3M8OH 1HHKA 4OZFA 4HJGA 3HB3C 1OLLA 3RX7A 4HHAA 3QJFB 3LKNA 3CZJA 4UINH 2VZOA 3DYPA 5DD5H 4JRYE 3CVHB 4OAWA 1RUKL 3VXRE 2NX5A 5BW7A 1UCBH 5FGBA 1T03H 2FR4A 3A6OA 2XRAH 5EUOA 3UEZA 4MXQD 2DYPB 1A7PH 5C09B 2P5EA 1ZMYA 2A74A 1CK0H 3CC5B 3O2WL 1EA9C 4RGOL 5HVWA 3HI1B 2PO6C 3JXAA 2HKFH 1ZEAH 2OZ4A 1CDCA 2YA2A 3RVXC 4PJ9C 3ARSA 2ZZUT 1AKJA 4P4KD 5E6IC 3HC3H 3OKMA 4OCWH 5CD5D 5K33A 1QFWL 5KSAB 1QLFA 2F5AH 4M7LT 5BO1H 5SWQB 5J4MA 5CEYA 2XG4A 4WI6A 3FONB 5IHZB 1U93B 3T8XB 2CMRH 5L2KD 1I9JH 3B9EA 1YMMB 4IOIB 4XP9L 2OR9H 1RJLA 3H9SD 1JF1B 1L4IA 1JN6B 2AEPL 2DQIL 5BVPH 3BAEL 2IG2H 5CP7A 1F4HA 3DUUB 1NUFA 2Z93A 2GJ6D 3MLTA 1HKFA 4PR5B 4H20L 4XVJL 3KPRD 3O45B 2Q87A 5C0BB 1HYSD 2I27N 2BNQB 1F5WA 1Z6JT 2CIKB 2DYPA 1IC5H 1FIGL 3CVHL 1JPTL 2OTUB 1UFUA 2Z4QB 4PJAF 5E6ID 5MEPA 5CZVH 5E56A 4N9GA 5ACZB 2P7TA 4PJEF 1ZVHA 4XHJC 4UNUA 3RZWA 3CSGA 1DL7L 2VISA 4L4TD 3OR6A 3Q6GL 5CIPH 1NC2A 3VWJD 1JGUH 5CJOH 1P6FA 5TDOB 1G9EA 1LK2A 3MV9B 3MRFB 3RIAK 3I3EA 3D5OF 3EYOB 3PF2A 3TBSB 4KHXL 1QLRA 1BQSA 3S34H 3HPJA 4MSWB 3SHSA 5KSAA 5HGBA 1X6NA 1QRND 5CGTA 3MA7B 4Q6IC 5JO5A 3QFJB 1PQZA 4JFQA 3WHXB 3R0NA 2X41A 1YUHA 2CK2A 5GSVB 3EJJX 1BMGA 3VFUA 4IOIA 1TZIA 3O6MH 1J0HA 4WFED 4BFGA 4WV1B 2H9GB 2AK4B 2GCYB 3L7FA 3MJ9A 1QFWM 1RHFA 4BH8B 3DMMC 4I9WD 2AK1L 4R3SA 1CLOL 1IQWH 5SWSD 3N1MC 2F54B 1MVFA 1IAOB 4MNGE 3L3JB 4NRXB 3GSQB 3QO0B 2HG5B 3U0WH 4DFHA 2C5DC 1J9CT 1MQKH 5ETUA 1KEGH 4EUPG 1P2CB 5JLZA 2W60A 3IDIA 3IVKA 3DSNA 4LIQE 2C3XA 4NQXB 4L8SC 1N64L 5IG7B 2Y07L 4P99A 4U7MA 4MCYA 1VKXA 4OLVL 1T04A 3NBNA 4MD5B 3U83A 2Q20A 4KPHL 4PLJC 3SGKC 4XP4L 4IRSC 5HHXL 4JZOB 2EDJA 4KDTA 5F1IB 3CNKA 1O5DT 1PKOA 3CFDA 5K9JH 1C5BL 4NJ9L 2F8OA 1FZKB 3V5DB 4MVBC 1NGYB 1KSRA 3I75A 3DX8B 1HK6A 3ECBB 3OHXB 4GSDH 1BGXH 1KEML 4L3EB 4NPYA 2A0LD 3K81A 3HRZB 4O00A 4FTVE 4XXDB 1GZQA 4NO5B 1JF5A 5DUPH 4X0KB 2XA8L 3RWGB 4JVUA 2XXCB 2E7MA 3W2DL 5ID0B 5EWIL 1DUZB 4TVPE 1WK0A 1XCTB 1QA9A 3MRHB 1OW0A 3W0WB 4LPCA 3TCLA 5CFHA 5DJ0B 3TNMB 4HBCL 4IRJB 1MPAL 5DJZA 2ZCKL 1JYXA 5DS8B 1HCFX 3X11A 4MA3A 5HD8D 1RQ5A 1FE8L 5FOBA 1JPFA 4HUUA 5EOTB 5E08L 3RWFB 2APTA 3FN9A 1FL6A 3Q48A 3T2PA 1H0DA 2EIZB 2NY0D 5F9OL 1JFQL 1R6VA 4L1HA 4HT1L 3TF7C 4IEFB 5ESAA 4A6YA 2AJZB 5J6HB 2R1XB 4KK9C 3O2VH 2FEEI 4P3DA 4K23H 3MRKA 1GSMA 2YD1A 1NMAL 2PYFA 5IBLC 1FVCB 4EI5C 1JZ3A 1GC1H 5DD1H 4V3DB 1HXYB 5IQ9A 3TYGL 5DHVB 2XTLA 2Q76A 5KSBB 4WJ5A 4ZOAA 3PWPA 3TT1L 1CR9L 1GGIL 1NGWB 4ZFOL 2A6JA 2Q86A 1AGFB 4EI5A 1G7QB 3CFBB 5AG9A 4IIQC 3ARGC 5FUCE 1LO2L 3RZCB 1QFWI 3BMVA 5D8JL 5DK0B 1CD0A 4Y19B 3DX7B 4KHTH 3QJHB 1P7KB 2W0LA 4NQXA 4MJID 3GGWA 2XZZA 3DMMA 1IILE 4WW2F 4NSKB 2D7NA 3HS0B 1FVCA 4M1GH 1XF1A 4PTUA 4EN3D 1UB6A 3HE6C 5E8PB 1A7NH 2FECI 2Q1EA 2J6EL 4LGRB 4GG6B 1R3HA 2J8UF 3EO9H 4NC1E 1T83C 3NVQA 2YUVA 4QRPB 4YFLF 5B39A 3RTQC 4HKZA 5L6YH 3DTXB 3PWPD 4X6CA 5HYJB 4JFXA 4PREA 3RHWK 1IGYB 1JHKH 1BHGA 2AEIT 1PLGH 4WEBH 1A14L 3RUGA 2YSSA 1CFVL 2FLRT 1RIUH 3MV9E 2NXZC 1R5WB 4JKPH 1BAFH 1H3PL 5GS0D 4OFYD 1I1AB 1HILA 4I0PA 4ELKA 4BKLA 3RWEA 2IAMA 3RUGE 1EMTL 4OV5B 2R0ZL 4YEEA 5AZ2H 4MA8H 1WBXB 3BUTA 4P4RA 3V5HB 4Z18A 3NA9H 3EYOA 1CXKA 4HK3J 4NZUH 4ZUVA 1H8NA 3LEVL 4X98A 5C0DA 3TESA 3S9DB 2IPUG 3HG1E 3P0VL 3RRQA 1MCPL 1OAYL 4WWKD 4XP5H 1X4ZA 4PUBH 1LGVA 1Q1JH 1TENA 4XPHH 4Q7DA 5DEGA 4J7RA 2OJZH 4G6ML 5HGDB 3VI4F 1JRHH 3RQ3A 5DQDH 1S7VA 3EGSB 2DQGL 5D1ZD 4GLRH 3TO4C 1IGTB 3KG5A 5JIKA 1CIDA 5CD3B 1WZLA 2YBRA 1CLZH 5KW9H 4YE4H 5C3LD 4LSUH 4NQCD 2CD0A 3VD5A 4JQIL 3BT2L 4RZCA 1S7TB 3FFCA 4WI5A 5CEZH 2ERJB 5F7LB 4I3RL 3WKMH 5FEBA 1VHPA 5IQ7L 4TVPL 4I48B 5EU6D 2VDQL 1UM5H 5HDQL 1G7HA 1KJVA 2EYSB 2ZCKH 4YHNB 2JELH 2ZUQC 1KGCD 3MV11 5AYUL 4MX7A 4HK0A 1DBMH 1MCWM 2BY1A 5EN2A 4G6JH 3P30H 1F3DH 4MVBD 5EOQL 2HT2D 1A2YB 4F80A 1MI5E 2A74B 1S3KL 4CVZA 5E94B 3R8QA 4PY7A 5BCAA 3OX8B 4PRPA 3C09B 1I1RA 2CIIA 1KEMH 4QRTA 2PW2A 1B0GA 1DQDL 4KRLB 2D9CA 3BYTA 4LLYA 3GBMH 4WFHD 2R1YB 1FFPB 2Y6SD 5KN5A 5EA0H 3MLYL 3BKMH 4ONHB 3HC4L 1KELL 4N0UB 2BOCB 3DROA 1D6EA 1QRNA 2IJ0C 3DHJA 1G7LA 1P84J 3SGJC 4TOYH 2XOTA 3GBML 1FAKT 5IIEA 3KXFB 4G7YH 3PWJB 3GO1H 1EVTC 2ZKHL 4EDWL 5HHMB 1EHNA 3WSQH 1G7JA 3X12B 3BPOB 4XCEA 1BBDH 1KB5A 1JPSH 1J05B 4FQIH 1BQHG 4HZLB 1AXTL 4HPOH 5GRVL 3LMJL 5FUZL 5JOPD 1MRCH 5ERWB 1I1AC 2ICWB 3TBSA 4L4TA 4QHKJ 3NABL 1I9IH 1NMBH 5C09E 3D25A 1UJ3C 1QOKA 1LO3H 4PJDE 3VW3H 4NZJA 5EN2B 1HKLL 2BP3A 5E6IA 5HJ3A 5BQ7A 3RKDC 4HPYL 2FEEL 3VI4E 4NO3A 3S6CA 3GSNB 5GRJL 1XT5A 5GS0L 1BFTA 2UWEA 1WGOA 1VFOA 4S1SL 3UTSE 3OAUH 4L5FH 3ARDC 5D1QB 3KLHC 2Y23A 4JZNA 4RA0C 3Q5YA 1B2WH 1NGQH 1KCRL 3ARVA 1ZHBA 4Y4KB 4ZG1A 4TSAH 3KLSA 3OGCA 2GT9A 2OZ4H 3P4NA 4PJ8D 3SKOB 3SY0B 4JFDD 3VGGA 2C3VA 3SQOH 2ZKHH 1LHZA 3TO4A 5BW7C 4UV7H 5GGVH 3TA3A 3MRNB 3JV6B 2NY4B 3EO1B 3Q6GH 4LAJH 4P5KB 1ND0B 2E3VA 4L4VD 1F4XH 1IC4L 3MLYH 3WEXB 1TJGL 3FB6A 3MZTA 3ZE2E 1U8NB 2EYTB 2NY4C 2A73B 1Q1JL 5DJ6A 2O93L 1T5XA 5MERB 3LQAH 2YUXA 2AS5M 3VH8G 1CTNA 5GGSA 3U79A 1IT9L 4RFEA 1FO0B 3BIKB 2EDHA 4X4YB 2EECA 4XCYB 1CL7I 3QR2A 5L7XH 4FQ2H 5HHMD 1TQBB 5CP7B 2AI0H 3OR7B 3R06A 1DEDA 2VDMH 3SE8L 4Z7VE 2R2CA 4MA1C 1F2XK 4U1GB 1WTLA 2ICWI 4P4RB 4S1QH 1GAFL 2OZ4L 3EYFA 2EDDA 3WFHB 4UNTA 3UPRB 3C2SA 2EZ0D 1RIUL 2NX5D 2NYYC 2UYLA 3HPLB 5EOCJ 1MAML 3Q1SL 3SE9H 2FBJH 1WWCA 2GITB 1N4XL 1OAUH 1KCRH 3FFCB 3WFEL 1UH2A 3L95B 4G8GE 4QRRB 3TV3H 5FV2A 5GJSH 2NY1D 4Y7MA 4A6YH 5JW4Q 4U1NB 3SDDB 2OSLB 1HHJB 4Z7OE 3AXLA 3P11L 4UIKL 3WNOA 4DGYH 1U92A 4PRAA 2FJFB 4QHMA 1X5ZA 4UIMB 4CN6A 2BRQA 5ICXB 1T1WA 5FYKL 3IDGB 1YEFH 3MYZA 1JBJA 2BMKB 4J3VA 4ZS7L 4UT6L 3B4NA 4OLXH 1K5NA 1DQML 2Q8AH 3VJ6B 5F7WC 2PTTB 1A6ZB 4NT6A 3QXDA 3GMPA 1GGCL 4CADB 4G7YL 7CGTA 5C0DB 2DL2A 3CSPA 3PWPB 3QUMH 3H9HB 3SDDA 4G9FD 1I8IB 1RFDH 3CJJA 4EI5B 2ITCB 3LEVH 3KYMA 4G6AD 2MHAB 3QQ9C 5LGKA 3QFDB 1OGAA 4J23A 5EFIA 1A6VH 1UWGH 3DARA 5F7NC 2GHWB 3CLFH 3DNKA 5IHBA 1LP9F 2XZQL 3BKCH 4O5LL 3DVNB 4M9OA 4LSQH 5D7SL 3OV6A 4RWYL 3BZEB 5SWZB 2YEZA 2Y9RT 1SM3H 3MJ8A 3S3PA 1INQB 5E08H 25C8H 3K8LA 4MAUL 1WBYA 1V5JA 3PL6C 3E6FB 4KU1A 4RDQF 1UWEL 3FTGA 4ZO8A 3P9MB 3WIHL 1I8KB 2R0LH 1V8HA 4FFVD 1UWEH 3UROR 1PY4A 1JHKL 2W9DH 4H5SB 5CJXA 1BBJA 1A1MA 5IR1A 1C12A 1MFAL 3BKJL 3O6KH 5DYOB 1HYSC 1PVHA 2CLRA 1U8OA 1CDBA 4MXQC 3HA0A 5IGXH 2ZOKA 3HZKA 4WFGE 5BV7H 3G5YB 2X70B 3D9AL 3PG2A 4ZOEA 1BZ7B 4MMZC 4ODVL 3VXTA 4IRSA 1ES0A 5IQ9B 2YPKA 1Q9OB 4HBQA 1AC6A 1LP9A 1JK8A 1MY7A 2AXFA 3I50L 1URLA 3C5ZA 4UTAH 5JW4M 5KSBE 4BUGA 3O2VL 3UTPE 3W82A 3V6OE 3QIBB 5DZOA 3CFEB 3BKYH 1KN2L 4XT1C 1EHLH 1AP2A 5HHVL 1CTOA 1PKQB 2VL5A 4YXLH 1TFHA 4KJPD 3VG0H 5JW5B 2VITA 4LU5L 4WW1A 1KV3A 3IYLW 3L3DA 3HI6L 1EO5A 4PJAA 5FGSA 5ERWA 4NOBA 1BWMA 3PHQB 3STZB 5C0RL 3TN0B 2X9XA 2YPLA 3LS5H 5KZCB 2ENYA 1L7TL 2WBWB 4ZPTB 2V2XB 4AL8H 3EAKA 5E6IB 5HJ3B 5BQ7B 4P4KB 4QRPE 3L7FB 4BH8A 2R4SH 4W4OC 4OLYL 2FZ3A 3DO3A 1H3XA 4U1KB 3MOBH 1ZGLB 5C0NC 2R8SH 3L3JA 1D5IL 3B5GA 1YY9C 1DTUA 1EO8H 2GFBA 3H9ZA 4PJBB 4LGSB 1IAII 1MNUH 4HUWB 1NGZB 4JHZA 1KFAL 1HHJA 2DQEH 3O2DA 4M7ZB 5DMGD 2HMIC 4FS0A 3MLUH 1QTYT 3TBYB 1ERNA 4QHLB 1V7MH 2P8MA 3ULVE 4RWHA 3OJDA 2NY6B 4M1DH 4LDOB 4CBPA 3O3DA 4GAFB 1CFTB 3EFDH 3RGHA 5MEQB 2DI9A 3OGOE 1W0VA 4OLWL 4JFEB 2P7TB 2QL1A 1TJIL 1TZGH 2DTSA 2FJHA 3HMXH 3MCKA 3VGFA 4E41A 1U6AL 2YOCA 3F6IA 2A77H 5E8OB 2KDGA 4FZEH 3GMMB 2X1PA 3BW9A 4DVRL 3VXRA 3U6RA 4KK5D 4X83A 2CKNA 1I8MB 2Q6WB 3IDJA 2ZSVA 1ZTXH 5GS1B 2XPGA 1B0RB 3FQUB 3L6FA 3KR3H 5HHME 1EH9A 1T5WB 3GRWL 3U0WL 5B38G 3LZFH 4TUKL 2CGRL 2YEZB 3MBXL 4RFOL 2B4CC 2A1WL 1ZLVK 1N5AB 4HBCH 2WIIB 2FBJL 2GTZB 3KPNA 3LIZL 1OTTC 3E6HB 1XR8B 4H26A 1CF8H 1C5DA 4AJ0A 1IE5A 4ONFL 3QQ9D 1GGUA 5EPMB 1OD7A 1KLGB 5TDPA 1BF8A 4K3DH 2BX5A 4JFYB 4GRWB 5A2IH 3PWVA 1DFBH 5BZDB 1TDQA 5HHQA 2E6PA 1A3QA 1EAPB 3MUJA 3TN0A 2HRLA 1A1MB 1J10A 1S7WA 4BM7A 4NN6C 1FDLH 2OMNA 4MNQE 3QCVH 4NC2B 7FABL 4OGYH 1UKQA 5CJOL 1HXMB 4O4YL 3GSNA 2PUQT 4D3CL 1U3HA 4Z95L 2NNAB 4TOYL 5DMKB 1DSFH 3NCYS 1U36A 4DN4H 3FFCD 5D1XC 1IAIH 4IJ3C 3CXHK 2C7UB 3MQIA 5GGRY 4GRLB 5C08B 5EU4B 3N85H 1OTTD 3MOQA 1ZANH 1QO3A 5J8OA 3UAJC 1WFNA 3MV7E 1G7PB 3ULUL 2AGJH 1HH9B 4LGPB 1AP2B 2IAMC 4K8RL 3NIDF 1PFCA 5FK9A 3UPRA 5EB9A 2VC2H 2X70A 5HPMA 2D9QB 4L3EE 3BD3A 4G6JL 5I66A 4U1SB 1UQSB 3AMLA 1T2QL 2WSKA 5I1IL 2JK5A 4HIJB 4HC1L 1ZAGA 5IB2A 2VKXA 2XWJA 4KMQA 4P59H 2BVYA 2M2DA 3RY4A 4XBGA 1PDKA 6FABH 4E42A 1ZWIA 2VXUL 2G5BA 1WZMA 3BIKA 4WEUD 4ZXBC 3LSOB 4ZSOA 1C8PA 4CDGC 1YN6A 4DW2L 4J12A 5FA4A 4D9QE 4YQXL 2NXZB 3MLTB 3NFSH 3EJZC 1RHHB 1WZ1L 4YE4L 1NCNA 4I3GA 4P3DB 1AGDB 3U7YH 2IH3A 4LF3B 3LKNB 3VRJA 2IH1A 3EO1A 4U1JA 4U4BA 4EVNB 3ZE1F 2ZOKB 1D9KA 1NCDH 1Z2KA 4QRPD 5BJTB 4NIKB 1DP0A 5D4QA 4Y2DD 1JRHL 3BP4A 3KHOA 3C6SB 5BS0D 1Q9WA 3DMMD 3JV0A 1NFDA 3AUVA 4KXZH 4ELMA 3KVQA 2CKBB 1KTLA 4MJIA 4P2RE 3T1FA 3KPLB 4HGKC 5I75C 2JCCB 1ZLSL 3HRZA 3BRFA 4PRHA 1JNLL 35C8H 3HKFA 2DKMA 3RZCD 4JN2A 1A9EA 3DECA 2NZIA 2IG2L 3T0BA 4N9OB 1L9NA 1A1OA 4R4FH 3NIGF 3BW9B 1INQA 4U1HB 3P30L 3SDAA 1H3PH 1OD9A 1R3LB 3KJ6L 4LCWE 1AO7E 2NW3B 5HI3D 2A73A 4CNIA 3N1QC 4IOFD 4AEHH 2FB4L 4MHHG 2JJUA 2EDFA 4GAYB 1RZJH 3BGFB 2HVJA 5IP4A 4XBEL 3QA3B 1A3RL 2NY7H 4NZTL 2W9EH 1RURH 4OZFG 4UT9H 4BSWB 1FRGL 3FT3A 5JMOC 5CBEA 4K55A 4QOKA 4HZAA 4N5EA 2H8PA 1R5IA 1INEL 3OKLA 4EOWH 4C59B 2AJUH 1I1YA 4R7NB 1JYVA 4PV9B 1XR8A 4H26B 5I9QB 4Z7QE 3RBSA 1T3FB 4OCRH 5JA9A 1ORSB 4JPIA 3PQYA 5FHBL 1JI1A 1ZVSA 2X40A 1TCRA 5A16B 2N1KA 1IGYA 4HMDA 2FWOA 3H9YA 4EUPA 1LQVA 3EDDA 2VAAB 4U1IB 5I74C 4U6VL 1YPZB 3DYMA 3RVVC 4TUJA 4A2LA 4L8CA 3DVGA 3NPZB 2ZPKH 4RMSA 4BSJA 1FN4A 1IBGH 4UTBL 3ZTNL 3MJ9H 2IQ9L 3OPZL 3TT3H 1KIQB 3PWPE 5I74B 4NQSA 5B4MD 5DD1L 4RGNE 5M7QA 1NGXA 4QRUA 1O7VA 1QLRB 1YEHH 4Z5RA 5J06A 1OARH 1CDJA 4LQ1A 5BRZA 3H3PL 5BZDA 2ZG1A 1BFSA 3EOTL 4N0FA 4FABL 4JFPB 2K1MA 4EI6A 4XNYL 3QPXH 2OJEA 4G80B 1G9NL 1XF3A 2ZWLT 4JQXA 1GHFH 4HXAL 5C3TA 3EDFA 3NACH 1WUNT 4N0UE 2Z31B 1X4YA 1UM6L 3GJFH 1F02I 5C0GA 1WITA 1I3RB 2IANA 1AJ7L 5EORL 1KLFA 5F8QC 4X5XA 4K7PH 1IGJB 4K3EH 2NY2B 5IJVA 3LH2L 3KPMA 2X7LB 3QUYB 1I9EA 4Z7NF 4PY7B 4OZGF 1JNHB 3T04D 2WMPA 4JO3H 1TITA 2XNAB 3DI2B 5D6CA 5CHNA 1LO4L 1CXIA 1ED3A 2D4FA 4I8DA 3T4AA 3QP3A 2EDQA 1F6FB 1NL0H 5KS9A 4XXCA 1FYHB 4HKJB 4Q6IB 5I1JH 4QRUB 3ROOB 5T1MB 4N0CC 5F89B 1BQLL 2G75B 3ZDXE 3U36A 4G43A 1JTTA 4P4KC 1WISA 3GI8H 3BSZL 3BSZH 3C5ZC 3GI8L 2WP3O 4Y1AD 3IFNH 2C3GA 5DSCA 1MCKA 1JJUA 3MRLA 1EUUA 2H9GA 4UAOC 3V0VB 4M5ZH 3VWJA 4C54A 2C7UA 1AGCA 4C55A 1LEGB 3UTTA 5JORA 4L4TB 4YAQA 5D93C 4KKCD 3V0WL 5J57B 1F3DJ 4C4KT 3O0RL 4NKOA 1IMHC 4MNQB 2EDRA 3F7VA 2NW2A 5TF0A 3P4OA 3V95A 3GKWL 5IW3A 4NN6B 4PV8B 1FFQA 4IIQB 4J3XA 3U7WH 3BZ4B 3L5XL 4MHHI 1QQDB 4PRDA 1AJ7H 1PBYA 4GKZB 5FIEA 3QRGL 2R0KH 4RBPK 3X12A 5HHMA 1X5XA 1NCCH 3UAJD 4KK6C 2DQUL 4YDKL 4EIZC 2NY3C 1UM6H 5F8RC 3V5HA 1FFOB 4OFKA 2CLVA 1AHWA 1SJEA 4L3AA 1CD8A 3LY6A 4HX1A 5DHXB 2WINB 1MRDL 1I3VA 2J12B 1HHKB 1MUJB 1BGXL 5IB3A 5KVEL 4ZO9A 5C9JA 3PWUB 2Z91B 1VENA 3ARYA 2AP2A 2WP3T 4AEFA 2DWEB 1NBQA 1ORQB 4LSDA 1C5BH 1F42A 1NEZG 3SKJH 2NX5B 3GIVB 1A7BA 3ZKQD 3O8XB 1NLBH 4P4KA 1OF2A 3ARUA 1V7NL 1MEXH 3EOTH 4MD0B 4U1MB 4JDVB 4RAVB 4CUCA 4YAQB 4UMGA 4WHYG 3HE6A 2Y07H 4TSBL 3ILQD 2APWA 4I2XA 2IALA 2MMXA 4WW2C 5E8OA 5A2KH 1WCBB 3MRQB 4XNXL 3O3UN 4ONGH 1LDPH 1A3LL 1MQKL 5CEXB 3E8UH 3OXRB 1CGSH 2VDKL 2BK8A 1YEEL 4XNQB 5EBWB 3MGAA 3BPCB 2CMRL 4BH7A 4Z7UF 4KJWC 4JY5L 4ODUA 2HA1A 1YNLL 2YPLE 4ALAH 4CU8A 4KC3B 4JO3L 1I8KA 1WIPA 5DUMH 4IRZL 4QXGH 2BVEA 1XR9A 4K3EL 5C0AE 3ARBC 4AEHL 3MV7A 1KCSL 2EDKA 1J1XH 4EUPH 4OM0L 4DKEL 2F58L 3DXAA 3OKYA 1RSFA 4J3UA 5I19L 4U0RB 4NWUL 5I1LB 1ZV5A 2Z8RA 5SWZD 5AAMA 5DJXB 4Q6YA 2N7BA 3MGTA 3L7EB 2YRLA 3QXDB 4LSTL 1S8DB 5ESVA 3WJJA 4TRPH 3S97C 3DV4A 3VJ6A 3WS3A 2J6EA 2HH0L 4R6UA 5HTSA 5C0IB 4YC2B 4DK3A 1I8IA 3U4AA 4WFGD 1JYWA 4M48H 1OARL 3ZSSA 2NQCA 1L0XA 4PJXE 5D1XA 3WXVH 4X6CB 5HYJA 1U8KB 2X6MA 4P2OD 1C5CH 3GIZH 5FXCH 3AS0A 3RDTD 2JJSA 2FECL 4ZTPL 4F7TB 3WXVL 4G9FB 2D03L 5T3XL 2YC1A 5TJWK 4M48L 2DBJA 5DMGC 4FFYL 1B4JL 5F44A 4P3CH 2PYEB 3P77A 1SY6H 2FHCA 2CK0L 3MBED 4PJGA 5E2WH 4HLZH 5I18L 3LN4A 3D1MC 5JNYA 4I2XE 3R4DA 4O51A 1VFUA 1Z9OA 5LKNA 1MLBA 3GSVB 4NFBA 5J89A 1PGRB 3U7YL 3QJFA 5FKAB 4JPVH 1J0IA 1L9MA 3INUH 5E99L 1Q0XL 4AIZB 3NFSL 2F58H 3UXFA 2FL5A 2EH7L 4ZUTA 4XCNB 3AXLB 1OPGL 4S1RL 1V3KA 3T1FB 3OGCB 3QIBD 1R3IH 2W9EL 4UT9L 5EDXA 2QEJA 4UBDD 4OQTH 4MNHA 3CK0L 1A9BA 1CK0L 2AGJL 5J11C 5IEKB 2X4NB 4FMKA 4X9FA 5C6TH 1MJUL 4OF6A 4HSQA 3L1OL 5I1DA 2ZUXA 1LMKA 3VDAA 2HJFB 1A6UL 5INDA 3RPIB 2PYEE 5BOZG 4GS7B 5CMAA 5GS3A 4BSVB 1DZBA 1P1ZA 3FL7A 3M8OL 2C4FT 43CAA 5FYKU 1CICA 5B3NA 4JDVA 3TM6A 4LKCA 4I77L 2Q7YA 3ARFA 1JGDB 5F9JA 1OB1A 1X5YA 3KPSE 4ZDHB 1Y0LB 1XF5A 4WUKL 4NO3B 1KLUB 2VLRE 1HEZB 3K2UH 3QUXC 5DK3A 4P5TD 5ID1B 3P9LA 4GKOA 5IW6A 4PTTB 3QCVL 1WZ1H 5DA4A 3H3BC 4FQCL 1OVZA 3C9NA 3F5WA 1NGPH 5CWSB 3F65A 5ITFA 4YHIA 2C26A 1CLCA 4MZ2A 4ORGA 3X3FH 4J6RL 4MXVE 4X7TB 3PP3K 2XN9E 4UIMA 5GPRA 4ZXBB 5ENWA 5IMKB 4JR9L 4OGXH 4GKZA 4FP8H 2YPVH 4PGCA 1UT9A 3DO7A 3KXFA 5ABDE 3L5XH 2ADFL 4JO4L 5D1ZC 2H32H 3TBYA 1HE7A 4OZIF 3C8KB 3QQ3A 2Q3AA 2AV1B 4I5BA 4XMKH 3IU4L 4OKVB 3H7LA 1CDUA 1A3LH 3JSSA 5CEZD 5GZOC 4HKJA 4NQEB 1WTGT 2FZ3B 5EZJB 3MO1B 5GSVA 1FN4B 3AREC 2CDGA 3PV6B 1T7XA 2XTJB 3PHOA 3PDOA 4FXLA 4HS3B 3QQ4A 2HJLA 1KYOJ 3VFMB 3X3GH 2QQLH 3MNWB 5DJ2A 5GS2D 1JTOA 4QXTB 4FQQB 5JR1L 1RIHL 4N0YH 1M71A 3UTSD 1GXEA 1NLDH 5IBTH 5BRZD 1MHPH 4ORGB 2Z92B 3T0DA 4NNYB 4G3YH 3ZYZA 2GYSA 2OL3L 4K2UH 5D71H 3NCBB 2W65A 3WIHA 4HLJA 3JV6A 3MRNA 4H88L 5D7JA 1DQLL 4PYHA 3UC0L 1RZKH 2VLRD 4WO4A 3ERYA 5KVEH 2AV7B 1J1OL 1J86A 4P2OC 1MRDH 3O45A 3RWHB 5D1QD 3NFNB 4WWKA 3NGBB 5DMJB 4HDIA 4PJFA 4X9IA 4ODWB 4DN3H 3VFGL 1CQKA 4GW4B 4X4ME 1N0XL 1HHHA 1K2DB 3MJ6A 5D6CB 3CPLA 4JDTH 2X9YA 3QPXL 3CFCH 3PUCA 4H8WC 3S4SA 3DGGB 3MXVH 5HHVH 4PRBB 4JGUA 3FB5B 1V3JA 3NIFF 4PJHF 2O5YL 4MXVF 3FQRB 4JAMA 2VQTA 3VXQB 3IFPA 1VPOL 1W72H 2XZCL 5DZNA 1FH5L 5JUEH 1JL8A 4UOW0 1M7DB 2BSTB 5DHVH 1G1YA 5JHDE 4ZUTB 3Q3GB 4M7LH 1TJIH 4YBQD 5FDWA 4GKSB 5DRWB 4GW1B 2WUBH 5EULV 3OSKA 2ZSWA 1J12A 1D6VL 4V3EB 1ZSDB 4XC1H 2F8XC 3AS2A 1FFNA 2ARJA 1BD2D 4J1UB 2AKRA 1D5XA 3P4LA 3GJFA 5FHBH 3I6LD 2VLMD 2OS7A 4MJ4A 3N1PC 1R24A 3UBXB 1VEMA 4JRXE 5BV7L 1GRWA 3ZHKA 4AH2B 5HGHA 4GQ9H 3LPWA 2AJZA 2I60L 3VGHA 3C60D 3V9FA 1NEUA 5JQ6L 1RURL 2E8YA 4C56A 4EIGB 1IGIH 1LEGA 4QRRD 5JORB 3GBNL 4J3SA 4F57H 3QI9A 5IWLA 4LARL 4F9LC 1MHCA 4I3SL 1JHLL 1UGNA 3SDXA 5IBUB 1X6LA 3U4EB 1I85C 2A9MH 4L1DA 2HTKC 4BQCA 3KLAA 4ZUUA 5D7SH 1JE6A 5DJXA 2V5TA 1MJJA 4JQVC 1B88A 5EOCL 5F96H 2VDOL 3RGVC 4HXAH 5C0CE 3BXNA 3V6FB 1MCRA 4CW1A 1XGPA 1JNLH 2C1PA 3KS0J 1C16A 2FHBA 1A7RL 2Z8SA 4RFEB 5IFAH 2Y25A 1QFUL 4FZ8H 3CLFL 5FO9B 3R0MA 5GHWL 1EXUA 1OAKL 1AD9A 1HQ4A 1K8DA 1U8LA 3CPLB 2HFFB 2JCCA 4P46D 1IGFL 1BX2B 5IB5B 4WNQA 1HHGB 5KTEH 1OTSC 3HAEG 1R3JA 3S88L 2FO1A 2F74B 4HWBL 3WFHA 5DS8A 4HH8A 2CDEA 1AO7A 4Q74A 1X5FA 3MGTB 1T4KA 1UXSA 1U8OB 3D2UD 3UMTA 4DAGH 3ULUE 1X44A 4YWGH 1E6JH 3D9AH 2EC8A 4TSCH 2R2BA 2F53D 3ELAT 3BUYA 1QR1A 1OT1A 4NJAL 4XPAH 4DGIH 4Z0BL 2AXGB 3BH8B 4UDUB 2P5ED 4I2XB 4JKKA 4XBPB 2HFFA 4MJIE 4P2RA 3S7GA 4OZ4A 3ECBA 3ARBA 3L3GA 4ZUUB 4MQTB 1YN6B 4HCRL 1PX4A 1QSEA 1QKZH 2VSCA 4UQ3B 1B0WA 1CYGA 5K9QG 4LVNB 5EO9B 3BN3B 1A6TB 3MCLH 2YD3A 4JCMA 3VRLF 1K9TA 5FUOH 1ONQA 3RWGA 3R1GH 4JFFA 3SE9L 4GW4A 4PJGF 1E4KC 4GO6B 3KJ6H 3TIEA 2NMSA 1ZLVH 3W11D 3QEQB 4EQ2A 2DRUA 3RX5A 3EYVA 2KZ1B 2AEWA 3C6SA 5DJ0A 3TNMA 4H0GA 4NBXB 1CVSC 3MOAH 2VUYA 2X4RB 5L9DH 5IJKA 4BFIA 1UZ6F 4Q9BA 2AJSL 2P46B 1EJOH 5FGRA 1NCUA 2F54A 3FQTB 1QSFD 1KXVC 1CD1A 5FK9B 3QUYD 1NBYA 4K71B 1YEJH 4Z8FH 1YDPB 3AAZB 4QCIA 5DD0H 4MD4A 1U8IA 2HFTA 2LV4A 3AS3A 2J88L 5DHVA 2L7JA 1X7QB 4P57A 4I18B 3DSFH 2Q8AL 2ID5A 2EEBA 2AJYH 2R1YA 3WE6A 1U92B 4PRAB 4QHMB 1UEYA 4HC1A 3HE7C 1MF2H 3H42H 3RY6A 4D0CB 4LNRB 1UVQA 5I6XC 3WYRA 4OAWB 1X5HA 5I71B 1QRNB 4KH2A 1C1EL 3CLEL 1K85A 5IG7A 5DFVC 2EEDA 1A02N 2P4AB 3L3IA 3MREB 3O3EB 5CKAA 5DHYB 1BPVA 5T3ZH 4N9GB 5A2JH 1I7RB 4DQOL 4EEEA 1NMBL 4RQQA 4U3HA 3EYVB 3CGTA 2XN9B 3VFPA 1RZ8A 1RUQL 3BP4B 4PG2A 2JJSC 3IDMB 1NJ9B 4S1QL 2ZSVB 3F58H 2YBRB 1CT8A 4ORZC 2OK0L 3I84A 1VADA 3UYRL 5ILTL 3RVUC 4G6KH 4XXDA 3KPSA 5F7EH 4PRBA 5C8JB 5IJVB 3UTQB 3ULUH 3O4LA 2AJYL 1ZA3A 1YNKH 1ADQA 3G6DL 3T0VA 3O2DL 4H8WL 3BP5B 5EA0L 5KZCD 1BREA 4HJ0C 5SWSE 2QQNH 4M3KB 5HBBA 1ZA6A 4I9WE 5KS9F 3BRDA 4X5LA 3PIQB 5EC2A 4EBQH 1DQDH 4DKDC 1R5VB 4XMLH 7FABH 2P24A 1MIMH 1JWSA 4XWOD 1DLHA 5JHLH 4N8VA 1V7ML 5FHAH 3CVIL 3UJJL 3TZVD 4OUUA 4KVCH 1XF5B 2EYRB 2BSRB 3LKOB 1I9RH 3KPSB 1ZHBB 3O8XD 5IR1B 5FDYA 1BBJB 1MCSA 2GFBB 2Z4QA 4KUZL 5MEPB 1FDLL 1P9MC 5FV1L 3UO1L 3MRCB 1UZ8B 4ZYKA 3ULSB 3PGCA 4ZFGL 3EDEA 5DFWH 2JELL 2VABB 4YHZL 2HT3D 2BCKA 4X6DB 2VDQH 1UKSA 1E6OL 4L3CA 5D2LB 3MBEC 4QHLA 3MV8E 4X7DC 4U7KA 5JOEA 1YNTA 4TUKH 5CKGA 2Y4SA 3HNTL 3I6GB 3TZVA 2P44B 1D6EB 1DANT 5GRJH 4O2EB 3LIZH 1U41A 2RFXB 3BT2H 4C58B 2B5IB 1FNEA 2W38A 5D7KE 4GJTB 1PQZB 4JFQB 1UM5L 4F7MB 2EXWD 1MFNA 4PJ7F 3DVGB 3ZHDA 3RVTC 2GJJA 4XX1G 3MBXH 1J5OL 3W9EB 5B39B 4XCEB 4CMHB 4M7KL 4P48A 4Y5VA 2E27H 3DX7A 5HDBE 5F89A 3S5LG 1PKQA 4NM4H 3AY4C 3QB7C 1PJ9A 4JPKH 3EYQC 1TVBA 2D3VA 2IADA 4PJGE 3QIBC 1X5LA 3BVNA 4HGWA 4I0CC 2FYYA 1T20B 5C0EB 2XY2A 4NBZB 3K3QA 4XP5L 2ATPA 1X5KA 3PHQA 3QWRA 2YD7A 4U6XB 5I1HL 4U05A 3U7AA 4PJAB 4U49A 3MACH 4D0DA 2XWTB 3LQZB 3SDAB 3F7VB 4PD4K 5GGTH 4XPHL 1GL4B 4XH2B 4QLRA 1OCWH 3TN0C 5D2LE 2APXA 1D9KC 3QPQC 5IM7A 2FJFA 1WBZB 1GOFA 5FO8B 3PGFH 3VXTB 3SOBL 2YN5A 5EU5A 5HYFA 4JHWL 4UBDC 4I3SH 1L6XA 1PLGL 3OG4B 1EBAA 2FGWH 2V17H 3BIBX 1EMTH 5FUOL 5HYJD 5KSBA 2X4TB 4OV6F 2D2OA 5CZKA 5D1XD 5E70A 3SN6N 5C7XL 2A9ML 4XBPA 1DBML 3TBVB 2FRGP 2UVEA 1NFDB 4XPGH 5ID0A 5JOFA 3FRUA 4RZCB 5HDQH 5BS0E 5FUCC 3O3EA 3OKNB 3O3DB 2ZNXA 3S4SB 4OQ1A 1EZVY 5E9DA 2F54D 4HQQH 5I16B 3T2NH 2IPKB 3WO3B 3TJEL 4LNRA 4HXBH 2DDQH 1H5BB 2X5PA 3BGFC 1KB9J 4M6NH 2W0PA 4WWKB 2X89A 3G5ZB 4XAWH 3LN9A 5JA8B 4QWWC 4HUXA 5HY9B 5ESQB 4G7VH 4G7VL 2PXYD 3C5JA 3FQNB 3QAZC 4K3GA 5AZEL 3ZDZF 4XAWL 4YHOH 3BKYL 4WNQB 1S9XA 4U1SA 2OJEB 2WIMA 3FB8B 4QOKD 3EW3B 3VFVA 5HPMB 4YHOL 4KDWA 4LSSL 1DQMH 3KPQB 2IADB 2V7NA 1VFBB 1NGWA 3UDWA 1T7YA 1KENH 1XGPB 5FKAA 1FZKA 1CLYL 3WDJA 5FB8A 1M7DA 2BSTA 2J8HA 2WANA 5LXGL 2A83A 3TBVA 4S11A 1Z5LB 4NKIH 3QJHA 3WNPA 3S35X 3U9UA 3AY4A 3MUY1 4JDTL 4NO2A 3TV3L 1I1FA 4KVNL 4DN3L 4XP6L 1TVHA 3TO4D 1SMAA 3IAGC 1HXMA 1N5YL 4PGJA 5L6YL 5CZXD 3DV4B 3C8HA 1GAFH 3QXAB 4HMEA 4IRJA 1IEHA 4OKVA 2OM5A 1HINH 1A4KA 4OZHA 2XZQH 3G5ZA 4KI1A 4XVUC 4M7ZC 1KB5B 1RZKL 3VWJC 5HGHB 3W2DH 4LCCB 4Q58C 5CGYC 1HYRC 5IBTL 4Z6AT 2RAMA 4S2SA 1BJ1H 4KVCL 4HWEH 5HI3C 2LQRA 2VDRL 5D71L 1S7QB 5JHLL 3K8KA 4NOFA 1S9YA 2ZUVA 2P8PA 2RB8A 5C08E 3GSNL 4ELME 1IQDA 2GT9B 2QHLA 1KTDB 3H7BB 1CDYA 1TJGH 5EPMA 4DZ8B 3RWDB 1CFSA 1BQHB 3TT1H 4U1HA 4BK4A 1XF4B 4XP4H 4WJ5B 4P2QD 4E42B 5F70A 2V7HB 4XMKL 1KCLA 1W8OA 4K23L 4Y16A 4GLRI 3NIGE 5DLMH 1BJMA 3V4VL 4WI3A 4BQ9A 1GGBL 2VISB 4WW2B 1LK3H 1S9KC 4JFHE 4TPRL 5ISZE 1BM3H 3IFLL 3QIWB 1CBVL 4AQOA 4NPYB 1EK3A 1NGQL 4M7KH 1JVKA 3CDGA 5ADOH 4XMPH 2LE9A 3PGCB 4ZOCA 2AK1H 2DJ4A 5J12C 3HE7A 4LCWB 3AM8C 1S5HB 2BXYA 3JVGC 4U1JB 4Y1AE 4EVNA 3QEGL 1ULVA 4DOHB 3JWDH 2FEDC 1ACYL 1DQJB 5D9SB 3TZVB 3GRWA 5J9PA 1Z9MA 3K2UL 4X4YA 1NSNL 2D0FA 3HZMB 4OF0A 5DR5L 5IHZA 1Q94A 2VWEE 4R0LA 3U9PH 4NZDA 2ED8A 1DL7H 4N5EC 4HG4J 4KQ4H 5I73C 1OOAA 5T33H 3D25B 5DQ9B 3IS0X 3UDWC 1MHPL 5DD0L 4CGTA 2H1PL 3B43A 1T1ZB 4YGAB 1KIRB 2B20A 3MA9H 3QUZB 5JZ7D 1F8TL 1AGEA 3MREA 5SX4I 1KELH 4KJYB 2E6QA 4XMLL 4WHTB 1DQJA 5D9SA 5TH2B 4ZUVB 2DQDH 3U46B 5TQ0H 3QUZC 3J8F7 1NCWH 5IVNA 3CVHA 3UJIH 1MCOH 3S36H 1I75A 3GSVA 4NNYA 1VDGA 4OIBA 5DMIH 2R9HC 3Q6FB 3E3QC 4PJ5E 2MKWA 1RUQH 4ODTH 5IIEB 2X1OA 5BVPL 4PP8C 4V1DE 2VLRA 2BNRD 3PDOB 3CFEA 5B4MC 1LE9B 1N26A 3MCLL 1IQWL 3RUGF 4AMKL 4L5FL 4FQ1L 3AM8A 4MJ2A 4X6DA 3WIFB 1QRNE 3O6ML 5CJ5A 2HMID 1GOHA 1FYTD 2PW1A 1PKQE 4KFZC 4I48A 5GGSB 5MHSD 3IJSB 3NGBC 5K59F 4ODXA 1QPXA 5BMFH 4JY6A 1YEKL 4GAGH 1QLFB 5JW4N 4N90E 2BSRA 3LKOA 4X6FB 1KJVB 4HFUH 1YEIH 4LVEA 4GT7A 1E4XH 1Q0XH 3NH7L 2IFFL 3LKQB 4P3CL 5E00B 1RVFL 4X6BA 1X5GA 5C2BH 1RJLB 1MI5A 1YEJL 4Z8FL 1MF2L 2Y5EA 4H5SA 2JIXB 3C60B 4EI6B 3C6LB 1XCQA 2DLEA 4S2SB 1G0DA 4XNMB 4FFWC 5HYSA 4GBXC 5JW4R 1U0QA 4ENED 5DUBB 2WV3A 5E4IA 5EZOH 1IC5L 1OAYH 4QXUH 3OMZA 4R0LB 4KK9D 3G5XA 5FGCE 5C0GB 3P9WB 3VFOB 1FZJB 2GK0B 5C1MB 5CEYB 1LEIA 4PJ7A 1D5MB 3DPBA 4C56E 3ULUF 3WCYA 1LNUA 4E41B 1BZQK 3PL6B 4UILL 2FH6A 4NC0B 1BAFL 3DYOA 3G6JB 4PTUB 2B1HL 2A83B 4NSKA 1A14H 2E5EA 1KGCE 1ZKAA 5K93A 1AKJB 2CXGA 5T1LB 1J88A 2KZWA 5CCKH 1QA9B 3MRHA 3MRBB 3QIWA 5KANG 1BOYA 3DTXA 5D5MB 4QRPA 3ZDXF 1G6RB 1JWMA 2L7UA 3B2VH 2I24N 5HYJE 4O58H 1DCLA 1JMZA 3PDDA 2EH7H 1HQRB 3C5ZD 4G9FE 4MA7H 4OCMC 4AH2A 1RJZB 5IM7B 5ISZB 1YC8A 4LFHG 4OT1H 5DUML 4W4NA 2X1QA 4PGDA 1CDIA 1R5WA 4FFZH 2J8UE 1CGXA 5FYKD 1DBKL 5DI8A 4PJ5B 4KKCC 4B7IA 2DQGH 1ZLUH 3C08H 2Y7QB 5K9QI 2N56A 1NCTA 2R1XA 4TSCL 1MHCB 4RNRA 3TGXA 3OF6A 2MTPA 2XRAL 5LGJA 1YN7A 2OJZL 1VFAA 1R0AL 5F7MC 5DC4B 2ADJA 5E8EB 1QPPA 3WO4B 3GSRA 4K7FB 4KAQL 5LWYL 4L4VB 4XNQA 4A2MA 2IGFL 3I02A 2DLTA 3G9VA 5CGYD 4XPFH 4Y4FD 5HI4C 3VXUB 4S1DC 2C9AA 3VFVB 3Q2CA 1C5CL 3GIZL 4OCSL 4AIOA 3BFOA 1AGFA 4X4MA 4JB9H 1RK0A 5MI0C 1YEGL 1EAJA 2L0DA 4QF1B 1EGJA 2VDOH 3RWJA 5CILL 4PJCF 4PP1D 1QBAA 4R3SB 1E27A 2SEBB 3SJVB 5F9OH 2EIEA 4YO0A 2D7TL 4PJIF 4ODBD 4MA8L 3B5HA 1BVZA 4Z7WA 2GI7A 3VFGH 1HIMH 4OM1L 4QHKI 5CJQH 2CRZA 4KTDL 4YBQC 4LMQI 1ZHKA 4OD3L 4OBRA 5DDHA 1HHHB 4JFOB 1CFVH 1KT2A 2JB6B 3BE1L 5T3XE 3D0LA 1WC7B 3EYFB 3QUYC 4X7SL 5E2TL 1JUFA 1OWRM 3EZJB 1EEYB 4JLRB 5A3IC 1IGIL 3SDDD 1MELA 4KWUA 5I15H 1NCCL 5EU5B 1AXSA 3WJLC 1Q72L 3PGDA 4NDMB 1U58A 4OCLC 3RDTA 3DV6B 3QDGA 3I75B 4R4NC 4YEFA 5JTWA 4OZIA 5F21B 1QQDA 1SVZA 4XWOC 4R8WL 3LSOA 1YYMH 3WFCL 4C83B 2JJVA 3ET9F 3O9WC 3SY0A 1M7XA 1AR2A 1QHPA 5AD0B 3T0WA 1CE1L 1CDHA 5LGHL 4P5KA 5D2NA 3GNMH 3C6LA 5DD6A 3SKNB 5DRNB 4Y4FB 4YXKL 3MUGB 1CR9H 1C7SA 1GGIH 1NDMA 2HKHL 2P5WA 2HJKA 4H1LA 1RMFL 1S9WA 4KRPD 4HUVB 2EDTA 2M1KA 3MV7D 2ESVD 4FTVA 4J2XA 1YJDC 3CFCL 1J05A 1W72L 2XZCH 1CDGA 2BSED 1N0XH 3O6FA 4TVSa 1A8JH 1UYWH 1G6VK 2UY7A 4JZJB 4Q0XL 5ESVB 5JOPE 4DVBB 2DQHL 1ZT7A 5KSUA 3ULUC 1QO3B 1FNLA 5IKCB 4CVUA 1S78C 1J0KA 4G42A 3U0TB 2AAVA 1FGNL 4GRLA 5M95B 2OYPA 3STBA 2FSEA 4L4VE 3RNKB 5ACLA 5DJAA 5D7LA 3RDTC 5DSCB 1RI8A 1U91B 2QADB 1IM9A 2XN9D 1EUTA 1EGJL 4UT7H 4MQ7A 5F88A 3BEVA 2EXYD 4CU6A 2EH8L 4M62L 3HRPA 3OKKA 2H8PB 2IQAB 1ZT1B 3GMLA 2ED9A 3SGEI 5CZVL 1ZHNA 1D5XB 4LIQL 2HKHH 1FFPA 3L5IA 4NJ9H 2ZPKL 3VRIB 1ZOXA 3MLPA 3IDMA 4PGBA 1LO0H 1AXSB 4PB9H 2EEAA 4N8VB 1T80A 1WAAE 1JWUB 3PHSA 1EFQA 1TPXB 5GSRB 5T1KA 3T77A 4KZDH 1KPVA 2I26N 2VLJB 3QNXB 1SHMA 3CDCA 2IQ9H 1CGWA 3OPZH 3REVB 1KPRA 5C0JB 2H32B 1YECL 2QBWA 4Y4KD 15C8L 4D9RE 4XHQA 3DUSA 5FYJE 2EDWA 5H8DA 1OAQL 2XNAA 3PWNA 5H35B 2YWYA 2X1WL 4QEGA 2XY1A 3ZTJG 3GMMA 1LO5B 5T5NG 1MRFH 3KHQA 3EYQD 1FP5A 4HCRA 4MNHB 1OGTA 3QFJA 4NQCE 4NFCA 1CIUA 4FFZL 3NAAH 2OQJA 1PEZA 4DZBB 4JR9H 1ZT4A 1KG0A 5T5NF 9CGTA 1BOGA 1IM9B 3UBXI 2AV1A 2LU4A 4LFHD 4LLDA 4OI7A 5EO0B 3ME0A 3NCYP 5HVHB 3QUXD 2R39A 1XIWD 2I5YH 1YMMA 2P5WD 3LKPA 2WQRA 1MHEB 4IMKA 5D7IF 3SKUD 2CDGB 2WLZA 3DGCR 3UZQA 3V79C 3BPNB 1NGPL 4L4TE 4DVBA 5B22A 1QVOA 4LKCB 3VRLE 5L88H 2DLIA 4OLZL 3THML 4KHXH 3LKRA 4M9PA 1W0WA 3VFMA 3MNZA 5D7IA 4PV8A 2O26U 3AAZA 2PW2B 1HOCA 4QCIB 5C0BA 4ODHH 5EC1A 1R3LA 4Y5YC 1JPTH 1NBYB 4M03A 4P9MH 3P73B 4I18A 2XWJB 1T3FA 2P43B 4Q2ZB 1WSST 1QFPA 2IFGA 2GJZA 1QLEL 1UVQB 1TCRB 1VESA 1IBGL 4UTBH 2OBGA 5IK3B 3ZTNH 5GZOD 5ENWB 5IMKA 5FYKE 3C5ZB 4HK0B 3BEWB 4WTXA 4NM8L 1FORL 1QFHA 1XIWC 4FQHB 5FCSH 3D0VA 4LSVL 1MJJB 1G7JB 1P7KA 1IARB 1ZK9A 5JIIA 2ERJC 3OB0H 4WI9A 1HH6B 1NUGA 2DQCL 4LQFL 4LSTH 2DKSA 3X14B 3K46A 2C3HA 5KVDH 5HGBB 5I1LA 3EYUL 1BZ9A 4EJ1C 4OBSA 2UZIH 3G6JA 4N8VG 4I5BB 1I85A 3T3PE 3FFDB 3H2WA 1A6TA 4KJYA 1H3GA 5E7BA 3ZZ1A 1UWXH 5IB1B 3JVGA 4G9FA 1FNSL 1E4XL 3NTCH 3OAYK 4S1RH 4HK3N 5GGQL 3TVMC 3LV3A 4LLYB 5CJXC 1FVDB 4PP1C 4OCXH 2IWGA 5D1ZA 4F7PB 2DICA 1FO0H 1YEKH 1U2CA 3K1DA 4IRZH 4QXGL 3G5XB 3CZFA 5F9AC 5DD6B 2OCFD 3QUXB 3NAAL 4OCXL 3D0LB 1W0WB 4HIXH 4Y5XB 3SPVA 5I16A 4OZFH 4WTZG 3CH1B 4QHUA 2QTEA 4DKFH 4M93C 3IDYB 2FX9H 1FORH 5GRUH 4Y5XC 5HYQB 5TE7H 4P9HH 3WHE0 5FAAA 3E3QA 2MWCA 4JG1H 1JGEB 4OFIA 4WY7H 4KV5E 4HV8A 1NAKH 2QADC 4LPWA 4OZ4B 4WUUD 4L9LC 1ZANL 1EFXB 1QSEE 3OKOA 3U30B 1KB9K 5CSZB 3ZT7A 4FNLL 3F12B 3U0PB 1EVUA 4U6HA 3VFRB 4IOSD 4YDVB 4JRXD 3RKPA 1GZQB 4N5ED 4HFWB 2X09A 4JZNB 3UCRA 3O8XA 4TNWF 4LCIH 2BVPB 3VXSE 5GS0C 3I6LE 3CAFA 4M61B 5SX5H 2B0SH 2BNRE 4LK4A 4L8DB 3LV3B 1EBPA 1A9BB 3LEYH 3OJ2C 5IJKC 2G9HA 1R3HB 5DEZA 5E0QA 5GXBB 2FBOJ 1DN2A 4HWBA 2FWOB 4XAKE 3MJ8B 1WCBA 4Y2OA 4WDIB 2HT4D 4ZAKD 4UUJB 4KQ3H 3RVUD 4OD2A 2EDYA 3I02B 3NZHL 2O5XH 4WWKC 1ETZA 3CD4A 2VO5A 3D87B 4RFOH 4K3DL 2DQUH 4YDKH 1FO0L 1N6QL 2X4QA 4X6CE 3V6FA 1GZPA 4DEPB 1K4DB 4JREC 4OV5A 5GGQH 5KSVA 4LCCA 1J1PL 1VB9A 3FO1A 4GW1A 4JVWA 4JM2D 4X99B 3OAZH 5LAXA 1QBMH 2OXHA 3QH3B 1VEPA 2G60L 2A38A 1T1WB 4G5ZH 1R3JB 5TE6H 2X4OB 1CBVH 2PNDA 3RKDD 5CAYB 4O51B 2XWTA 3V0WH 3CFJB 1P6AB 2NLJB 1AHWB 4G9DB 1OGTB 1R24B 4TN9A 1BEYH 2L4OA 4OZHF 3HUJB 4F37K 3B9AA 3EFDL 4F15B 4X5WA 1H3UA 4YDJA 2XKUA 1IGMH 4FZEL 3BRGC 2DQDL 3OXSB 5HD8C 5FKPB 1TLKA 1U6AH 5HHOE 3DMMB 4QRRA 3BOVA 5JXEC 3MCKB 4R9HA 5E6YA 3GSOA 1UB5A 4I0KA 2HT2C 5GS1C 3WUZA 3ULVF 2YK1L 4JFHD 4FQJH 5D2NC 2VRAA 4YLQT 5DGRA 3C8KA 1FNGB 1N8ZA 2CSPA 1MLCA 3CDGB 1YYLH 2MJWA 3MLUL 4R97C 1NCAH 1A1NB 3I6GA 1S7SB 4M93B 2KPNA 2QKIB 1SEQL 1NSNH 2YD2A 1OM3H 3PWLB 3V8CA 3IGAA 4K7PL 3WNKA 2HLAB 4ONFH 4DZBA 5F6IB 3X13A 5MENA 3ZE1E 3FT4A 4JY4B 4XGZB 5EBMA 3KPNB 4OLUL 3VFSA 5EO0A 1A4JB 3T65B 1LK2B 4XBGB 1GGTA 5D72L 4PRPD 3GSUA 4NYLA 3IF1A 3QRGH 2EYRA 2CJUH 3QDMB 1OLZA 4MCYB 1UXWB 1VKXB 2JF1A 2JIXA 3NFPA 1SJHB 5IMLA 1ZTXL 3MLWH 5LXGH 1MAJA 3IKCA 5AUMB 3BDXA 4HAGA 1IL1B 4DFIA 4KK6D 1TZHA 4K94H 5LGHH 4UDTB 1PG7X 5EU6A 2A77L 1RMFH 3K7UA 2ICWJ 3SDXB 5CD5C 4GMSH 3WBDA 5SX5K 5I8OH 3RIAF 3T0EB 2VAAA 2N7AA 3DGGA 2P5WB 3DO7B 2EIDA 3UYOD