3WUWA

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRTALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
molecule tags Protein binding
source organism Homo sapiens
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wuwA01
5EUOF 4LL9A 3UAJD 4JG1L 2R69L 3TFKC 3NH7H 2I24N 3W0WA 2DI8A 3QG7H 1EUTA 4IMLA 1MRDL 4LHQB 3BKML 43CAB 5IF0A 4NP4H 1WWBX 5TE7L 3AS0A 4FQQA 5AG9A 3HI1A 4GMSH 4EUPA 3RWHA 3B9EA 4HK0B 3R06A 1SBBA 5BRZB 3HS0B 1JVKA 4JFQA 5E8EA 1H3GA 5CJ8A 1N0LA 4YO0B 4YBLB 3QUMB 2WP3O 4LHUD 4TVPD 2AERT 2Q87A 3FFDA 4ELMB 2M2DA 3MRBB 5F89B 4KJPC 4G6KH 4MXWL 1KEGH 2ICWB 1P9MA 5ESQA 1OGAD 4Q58C 5EULV 5F7WC 3HUJA 4RMTA 4OZIA 1PDKA 3ARRA 3HZKB 5K9QI 4POUB 2C7UA 4G7VH 1T7VA 2XA3A 3MODH 1U8IB 4LNRA 5J57B 2CPCA 4JPWL 1R5VB 2YS4A 4L8BA 5D4QA 3EDKA 4Z7VB 4A6YA 3QUYB 4CMMB 1YY8B 4Y19E 15C8L 4ZFGL 1QFUH 4R8WH 3MLZH 2BVYA 4L4JA 5F7HA 4V3EB 3B9KC 4MNGE 4OM1L 2WW8A 4NO5B 3FOLA 2OI9C 5F7EL 2XZZA 3LH2L 1F6LL 3QNXA 4MNGB 1BREA 4X7EC 1YEHH 2BCKB 4RGOH 4HIIA 3NBNA 4M43L 3TH4T 4KJWD 1NBVH 4P59H 2NCMA 4LK4A 4WHTB 4GKNA 4AT6B 5IKCB 1SEBB 2DQGL 1U93B 4X6CA 2BSRB 5HYFA 4JO2L 4M00A 3PWJA 3NAAH 4F80A 1EFQA 2WAHA 4WUUB 1Z9MA 2VZSA 2A0LD 2VE6B 1B90A 3W0WE 4APQC 4UIMA 3KR3L 3CU1A 5IGXH 3L1OL 1A6VH 5GHWL 4XAKD 1SBSL 4JJHA 2BHUA 5JIIA 5KVGL 3TH2T 4LLYB 3HMXL 1T5WA 4CDGC 3ARSA 5ACZA 4JLRA 3U48A 4PJDA 1M7DA 1IEAB 4KDTA 1Z2KA 5MHSE 4MQXC 1U8KB 3F7VB 3C9NB 3BKJH 5CLWA 3G6JB 3RAJL 3UEZA 1SEQH 4WEBL 3N1QC 2X4RB 3OR6A 1FLTX 2QQNH 4XP1L 3EJZD 5JXAH 3H7LA 5LWYH 3OKDA 1CK0H 4Z7NE 2P43B 4HMEA 5TGBB 3B3IA 4G9FB 5D70H 1EGJL 1IFHL 3RUGF 2G5BB 3O8XD 2MSPA 5K9OA 4OCWH 1LQSR 2HAZA 5JW5B 5CZXD 5HHPB 1JYVA 5GRXG 2FHFA 1FNGB 1I4FA 3O8XB 4BK4A 1P7KA 5DHVH 3O81A 1P4IH 1NSNL 2AV1A 3AREB 2HJFA 4HKZA 3D18B 1NFIB 5JTWA 3BQUC 1JGVH 3QEGL 5C0AB 5IMLB 1P7QB 3PGFL 4HZLA 1HINH 5MENA 4AL8L 5ISZB 4EUPB 4F37F 3PWPB 3R06B 3LIZH 5DRNA 3MV11 2LFGA 3RIFF 4IRZL 4KRPB 1S7TB 5J6GB 1BQLL 5DURD 4N0UB 1HXMA 1E6OH 3RKPA 1LE5A 1H3TA 1CICA 3VWKB 2DQJL 5GS1B 1WVZA 2EXWC 1T4KA 1F90L 2JTDA 3KLAB 4ERSH 1JN6B 4OZFA 5HHXL 1A3LH 3OTTA 4I8DA 2A6DB 1OY3B 4U6VH 2Q8BL 2D0FA 2IG2H 5EIIA 5E03A 2WZPD 2EXYC 2OQJB 3FCTB 3VFTB 2P5ED 1JWMB 2AJYH 3F8UB 1Q9OB 2ITDB 4YGVA 3JWOL 2YD1A 4FG6D 2R56H 1TTFA 2ESVA 4EJ1C 1PY9A 1MCPH 4HWEH 1MJ7H 3T3MF 4E41B 4HC1H 1J7VR 4M93B 4UZGA 4X4ME 5MHSD 2V17H 1JNLH 4NT6A 1TVHA 3QG6B 2HRPH 1JZ7A 4E0RB 4JY6B 1NEZG 3VMOA 1DQMH 4HK3J 4QXGL 2HVJB 1NFKA 1U91A 1MFDH 5KANG 3S5LA 4OCYL 3T0ED 4U1MB 4NOBA 3RGVD 3B6SA 2R2HA 3FQNB 1IT9H 4NQXA 1IKFH 4X5XB 3BVNA 3RZWA 2NLJA 2CD0A 3WO3B 4EDXB 1DCLA 2RB8A 4WRLA 2QKIB 3LCYA 3QDGD 3CVIH 4H0HB 1BEYH 4YDKH 1B0WA 4NRXA 1TVBB 2P8PA 4RMUA 4Y5VC 8FABA 2EEDA 2PUQT 4MX7A 5IEKA 2D7MA 5C07A 1ZHNA 2YC1B 4WI3A 1MI5A 4MJ6B 3BPCA 4UIMB 1NL0H 3QWOA 4P5TC 2H2PC 2FL5B 4R26H 2AI0L 2DL2A 4FQHB 5C3TA 5KJRH 1KCUL 2DM7A 4QRPB 4WTZA 2WSKA 2VDQL 1MAKA 5D1ZD 3SCMC 2CO7B 4M7LL 1I7TB 4NSKA 2EDDA 4UOJA 4L4VE 4LARL 2VXTL 1U8HB 1WAAA 4A6YB 3GMLA 4GW1B 2W0FB 2UVFA 3BJ91 3MFGB 1ND0A 3RWIB 5KSAB 4PRNA 1ZLUK 2O26U 4XVTH 2DOCA 2Z0BA 2V5YA 4KPHL 5FHAL 2OMNA 3MJGX 5IVXF 5B39B 4Z0XB 3QXUA 3SE3C 3WHXB 4M62L 4XNXL 1A6UL 2ZJSL 5F88A 3HPJA 1P7HL 4ALAH 2B7DT 2F5AL 4ZYKB 4RA3A 3MV7A 2XPGA 3TBVB 4J1UB 1Z9LA 1GZQA 5I8KH 5D96C 1IM9B 5ICYA 5ERWB 2BNQE 2VLRD 4K3DH 1I3RA 4HW6A 2WNGA 5C0CE 4J4PC 5EZOL 1FZOB 2VZOA 2ADFL 3SEPA 4G8GA 1R3LA 4XVSL 1INEL 1WBXA 1TNNA 4M03A 1I3UA 5MI0C 2VLKD 4YNYA 1BOGB 1CF8L 1GGIL 1NUNB 4YPJA 2K7PA 4M3JA 2XWJA 5E8DL 3BGAA 4KRLB 2FIKB 3RTQC 3KS0J 3KPPA 1H8NA 2X9YA 4IOFD 1IE5A 1DLHA 1GZPB 2W0PA 5DRZB 5GISL 1HHKA 4RGMB 4CN4A 3LD8B 5C3LD 4HUVB 1TJIH 4JM2B 4N0UA 5K59E 1D5XB 1S7XA 5IEHB 4AQOA 5DGRA 1CICB 3M1BA 4FQIH 4QHUA 1RMFL 1UCBH 1EVUA 3CX5K 4WU7B 4XH2A 2VXVL 2PCPA 4HHAA 3QULA 1EXUB 5KS9A 1YPZE 3A6CH 3W81A 1M4KA 5C09E 2O61B 1MRDH 4Z7UF 2AKRB 2P5EB 4RNRB 2BOCA 2R69H 1AQKL 1AQKH 1RZKL 1RZKH 5E4IA 3OKEA 2N4IA 4ENEC 1KJ2B 3B3IB 2IH3A 3BAEL 4KROC 4D94A 3I2CH 2JE8A 1K4DA 1TQCC 4AIXA 3HPLB 3RQ3A 4RMRA 4UT7H 4NNPL 2OXHA 3QUYC 4C56E 4QXTA 1UWEH 2CR6A 4IRJA 2HP4A 4LGRB 4Z7QF 5FYLL 1R3IL 1R3IH 1T04A 2WY3A 5FGCB 4NKQB 4ELKA 3FB7B 4XMPH 4MCYB 1FZKB 1L9MA 3EOYG 1I1FB 4P23B 4UDUA 1K2DB 3ARDD 4JY6A 1N64L 1FFOB 1K8DB 3G6AA 3OWEA 4TPRH 1JPTH 1E27B 3AREA 5D7SL 4QT5A 5F7LB 4M8QA 2EC9T 3C2SA 1ITCA 1ZK9A 3EFDH 2R0ZL 1VGEL 1FVDA 3NABL 5GJSH 5I1JH 2HLAB 3WIFB 4PG2A 3LHPH 2IGFH 5EZLB 3RWHB 3INUL 1HZHH 2YOCA 4HK0A 3CK0L 2H2PD 2J2ZA 5AEAA 3IU4L 4N0CA 2IF7A 2FX8L 1QP1A 4L4TB 1DBBH 3L5IA 4NQVA 3VGDA 4WJ5B 2H3NB 5CUSH 1J8HE 2CKNA 4JRXE 1ZSDA 5I9QC 4WUKL 3AMLA 4CRPA 3AS3A 5J9PA 3OKNA 3QDAA 1ZMYA 4PTTB 2N1KA 4ZUSA 3F7RA 1D6VL 5D93C 4XVJL 1J1OH 3BD3A 2AJ3A 3KPRA 1WZ1H 3RIAF 3MV9E 1KIRA 1LEIA 5ENWA 4C83B 5JUEL 4ZTOH 2YD7A 1SM3L 5J13B 2NNAA 3P73B 4B7IA 4PJHE 1AR2A 3LN9A 1IEHA 2GSIA 5D72L 4M6ML 5HI3D 1DBJL 5JW3L 4I2XB 3MLRL 3TYGL 3QXVA 4Y16B 4B5EA 5A2IH 4RISH 1RU9L 2XT1B 4K9EL 3RDTB 3GSRB 4IRJD 3S5LG 4U7KA 2VLME 3QCVH 1KB9J 1M1SA 2PN5A 3C60A 4KKNA 4DTGH 1B6UA 2F5AH 1FORL 4I3RL 3FOLB 1NDGB 1UT9A 1MPAH 4UNVA 4OB5L 4KMLB 4WO4C 4NUJB 3ZYOA 4KVCH 2HG5A 5K9KA 2ADJB 5E56A 1ED3A 5DEFB 4JFZL 3SKUD 3GSUA 4DK6A 4GXVL 4NHCH 3M07A 3GB7B 4BQBA 2HLFC 2GK0B 4ZPVA 3TNMA 3MLWH 4XZUB 2ZCLL 4K7FB 1A1NB 1KCLA 3V6FB 3DX6A 2KPNA 4RMQA 4ZFFB 1QLFA 4TSBL 5I8EB 4OLEA 4P2QE 3DSNA 5D1QC 3KVQA 3BGFC 3DX9A 4AIOA 4FTVE 1CBVH 1QFWM 4F3FB 1ZGLA 2BXYA 4XCYA 5D6CB 4DKDC 4NKOA 3FOMA 4YX2L 4GXUM 4AMKH 3MRNA 1E28A 3STLA 2V17L 4MNQE 5DEZA 2IQ9L 1FGVH 2GJZB 2H41A 4HC1L 2V2XB 1ZANL 4ZO8A 4JM4L 1YDPA 1QVOB 1NAML 3WFCL 2I9TB 5HY9B 1U8HA 5D7LD 3HKFA 1L0QA 3F65A 4MA1C 3MCKB 4LKXA 3DUUB 5FO8B 4N0RA 3N1FC 3Q3GA 4G8FA 4X7TB 2OTWB 4YPGB 2AKRA 2NX5A 4WHYG 3QJHB 4XNZB 5SWSD 3F58L 4PJ7B 3O3DB 4XPFL 2FBJH 1RVFH 4HT1L 2WBJB 5D1ZB 1A6ZA 1U8JB 1I7ZB 1CFTA 4NQED 1DEEA 1QFWH 1N0XH 3WS6C 1NANI 3VGHA 3TVMB 3HAEA 4H20L 4QOKD 3F62A 5K9OB 1OGAB 1IL1A 4QHLB 3QI9A 1BX2B 3DTXA 1UEMA 4NM8H 2WLYA 3DXAB 3W5MA 2ED9A 3UPCA 4XBPB 1VFUA 4H8WL 3WIIL 2E7LA 4ZO6A 1VENA 2HFEA 1XZ0A 2R56L 4YXKH 4Q6YA 3TVMC 2EDEA 3RY6A 2ZKHH 3TJEL 5JQ6H 5KW9H 3VWJB 4JO3H 1RZIB 1TCRA 2AABL 1CXIA 4RAHA 4F7MA 5DT1H 5KAQG 1PY4A 3TBYB 4L5FH 4L5FL 1INQA 2BVOA 2IAMD 4XC3L 4K7PY 3CLFH 2PYEE 5EA0L 5HI5D 4K3EH 2OP4H 2ORBL 1U8LB 4LSSH 3WFBL 2BDNH 2VIRA 5BV7L 4CMHB 3ULUE 1OL0A 1UYWH 5FO9A 1LO3H 1I8MB 1W72L 4P2OB 4RFNC 4HUXA 4EOWH 4C59B 3TO2B 2DQIH 2X4SA 3B9AA 4LBEA 2FLRT 2P8LB 1G7PB 3I85A 1XCTA 3KPRB 1SJEB 3KLHD 2W60B 4H88H 5HYJB 1JTOA 5IQ7H 3QIUA 3NOIA 4L3ED 1MRCL 2XWTB 3LQZB 3L3IA 1G9MH 3BDBA 3VFTA 1SMOA 4Z7UE 1SEQL 2WIIA 5DJAA 2Y5EA 3CX2A 4O4YH 5EU7C 1N6UA 3VRJB 1G9NC 3HFML 3ZKQD 3UTQB 1OP3K 4HAGA 3IAQA 1FL6B 2AXGA 4V1DA 4JVPA 1X5XA 3V5HB 1ZT7B 4TQEL 4EN3B 5T3XE 3QAZC 1M71B 3MCLH 2ILLA 3QFJB 2UWEA 4QT5B 5C71A 4OLUL 3BP4A 3CFDA 3NFSH 4AENB 4NPYB 3RDTC 5ECJE 3ECBA 4LCUA 1N5YH 4NQXB 1ORSB 4PJIA 2NLJB 3BH8B 2G75B 1MEXL 3VXSE 2DQGH 2AK4B 1CBVL 4Z5RB 3BKJL 1TMCA 2A83B 5F9WC 5I1CH 3ARBD 4NO0D 3SCMB 4N5EA 4OCLC 5EU6D 4GKZA 4J2XA 1CDYA 1ZSDB 3WJLA 1C16A 4LLQB 2DQEL 3BIBX 1NCCH 5C6PB 2FL5A 2IBZX 1KIUA 4N9GB 3O2WH 2JELL 4KJWC 5JW4Q 4NO2B 4ORGB 4ZFOL 2VLLB 5I9QB 4PDCE 4PJAE 4OCXL 1CDGA 1E4XH 1NGXB 1RZKC 4FZ8H 1BD2A 2J6EH 2ARJB 2VQ1B 3WDIA 1KCGC 1OCWL 3CU7A 5GZND 5HY9A 5I76B 2VDOL 3IJSB 1NMAL 5HPOA 4NWTH 1NLDH 5EWIL 4JPKH 4JQXC 4KK5C 1UZ8B 3PV6A 4L4VD 2R1XA 5LJYH 32C2B 2OM5A 1R3JB 25C8H 3HMWH 2F54B 2P5WE 3ZSSA 1FZMB 3ZSTA 1IAIM 1YEKH 2BNUA 3W39B 4AIZB 4XBPA 2IH1A 3KJ6H 1GZQB 3VWJC 1MFAH 3MLZL 2JJSA 5L9DH 4JHBA 2VH5H 5TE4H 3S96B 3ARGD 4U31A 4H1LA 2AAVA 1RZJC 4AG4L 2FIRT 1G7HA 5C8JA 4JM2C 2IPTH 3HLAB 2GHWB 1WBXB 2AW2A 4FQXB 3RPIA 5L8KB 1WSST 3OG4B 5HHOE 5LVEA 3LN4A 5D8JL 1IC5H 5C08E 1HSAA 1I3VA 1G9NH 1I7RB 2YPLB 1GC1C 5BV7C 1LVEA 2PW1A 1ZT4B 3RWFA 1P4BH 4P49A 1SY6L 2MCPH 3TO4C 5CJ5A 4OM0H 1MJJB 2BRRH 3S37L 5J56B 1Y6MR 4RGMC 1AXSB 1TQCB 1DQTA 5F3BB 4XMKH 4L9LC 3QI9C 5JXEA 5I2IB 3OAZH 1I9IL 1MREH 3FQTB 3NGBC 3QUML 4NNPH 1DSFL 4J8RB 2AJSL 1FYTA 4KKBC 5EU5B 3QG7L 1FJ1A 5FECB 3C5JA 2NX5D 1QRND 5IESL 5DEGA 3WIHL 1I8LA 3ESVF 3RL1A 2EZ0D 3WD5L 3QI9B 4HJ0D 3V6OE 1R6VA 1PSKL 4MAYA 3V4UL 5CJQH 5IM7A 4RMVA 4NC1C 1KIQB 4E41D 1L7IL 4WY7H 3CLEL 1FH5H 1IQDA 4X4MA 4W6WB 5D7IA 1BQSA 4K7PX 1PBYA 1PX4A 1IC1A 2A77H 1VEOA 3EOBA 4LVNB 5F7KC 2WV3A 4FXKA 2RQ8A 2PO6C 5I16B 1T2QH 2ATKA 3BPLC 2VSCA 3WIHA 2ZNWA 2GAZA 3VXPB 1QSEB 5EO0B 3WLBA 3MA9H 4HGWB 2A74A 1WJ3A 3L7FA 1CTOA 3T09A 4ZOCA 2X9WA 3PQYE 4OD1L 5I73C 2QSCH 3ULSA 1T2JA 5EBLB 2NXYC 5HGAA 3EJYD 3VCLB 4XBEH 4Q9CA 5FO9B 4JZJB 4EDWL 1JHLH 5IWLA 2HT2C 3EDJA 2OI9B 5DC9B 1ADQH 4YC2C 1EUUA 2V2WA 3L5JA 5B3NA 3ULVL 5CEYB 1OTTC 2FR4B 3L3DB 1NBYB 1AY1L 4I18B 4HQQH 1P84J 1JZ6A 5KSBF 3PGCA 1B88A 1SY6A 1YUHB 3FHQA 2IANB 1EZVX 2IPTL 1ACYL 2APTA 2N56A 1NFDF 3C5ZB 3CXDH 3VRJA 4NNXA 5GGQL 3OXRA 3HG1E 3JUZA 4G6JL 4R4ND 1E4JA 1MFEL 1R24A 3L3GB 3UZVB 3PWVB 4ODXA 3WEXB 5CINH 1CFVL 5E2VH 1OAZH 3WUWG 4WDIA 4MNQB 3SDCA 3VI3E 3VD5A 4WUUD 1FL3A 3NZ8B 5H35B 4F7CA 4HKZB 1M71A 1JYXA 3MNZA 1UKQA 3WUWB 1SVZA 3I6LE 4XT1C 4LCWD 1IC7L 1T7XA 5IBUG 2C4FT 4KJQC 2LU3A 5BCAA 5IMOB 2DBJA 4PB0H 3AC0A 1ES0B 3BP7B 4RGND 4I5BB 1MHEB 4R2GB 5K59F 4K7FA 2D03L 4WHTA 4M9PA 4AT6A 2OL3L 2FRGP 1B4RA 2P46B 4S0TD 2FB4L 2ZUWA 3GHEH 1F00I 4R7NB 4LVEA 3GKZA 4Q74A 2DQIL 1OP3H 4UTBH 3A67L 4S10A 4NC1E 2JKXA 3UYRH 5D7LB 4R7DB 1DE4B 5D6CA 5EU6A 1B0RB 4I48A 4KI5C 4UMGA 3RZCA 5GGRY 2XNAB 2DQEH 3QDGB 1F4WL 3FO9A 2Z91B 3AB0C 3EHBC 2PTVA 1B9ZA 1U3HD 2Z8WC 4OFDA 3RX8A 4CDHA 5IVXB 3P40A 1XR9A 4J4PD 1B0GA 1A6WH 4Q2ZA 4YWGL 4ZS7H 1L7TH 4KUZL 1D5IL 2JB6A 2NX5B 2WUBL 5F9OL 1K85A 5IFHH 3KDMA 1CXFA 5TFSH 1JFQL 2NY3C 3QUZB 2WUBH 2AEIT 1W0VB 5DQ9A 2XYCA 4GSDH 2G5BA 5IIEA 2UVEA 4XPAL 4QCIB 2VYRE 3Q6GH 4Y5XA 5EUKB 1U8NB 1CGVA 4NQCA 1BX2A 3TYFA 5JHDD 1CR9H 4LSTL 1E4XI 1CLYH 4KDVA 1XGPB 3CZFB 5BVPH 4ZNEE 5ELIA 1BZ7B 3E6HB 4PGCA 3TIEA 3AY4C 4LLWB 4TVPL 1PKQE 3RVTD 1XGQA 2XZAH 4J3TA 4MA8L 4QGYA 1I75A 4WWKC 3JTTA 4RIRB 5CCKL 3AROA 2X1QA 1U42A 3GHBL 4MLSA 3QQ9C 4TRPL 1N26A 1T20B 1DR9A 2MHAB 4JZJC 4IOFC 4WCYH 4ZXBD 4RFEA 1CGWA 4Y89A 3TIDB 4QO1A 2NZ9C 4TULL 5JXEC 2FJGA 3QEGH 5D7IE 5B8CA 4AH2A 3DIFB 4AMKL 5B39G 4ZFOB 3DLQR 2E7MA 5HGAB 3VCLA 3OBAA 3ERYA 4NQEE 1XMWA 2BDNL 3VDBA 4NHUE 1OT1A 1A6TB 5DJ0B 5E7BA 3RWIA 1A3QA 1MJUH 3F12B 4PRHD 4X99A 1W72A 1NBYA 4XPTL 5I73B 3OKLA 2MKWA 1YQ2A 1EHLH 4Y4HA 1NH6A 5H2BB 2J3SA 2CKBH 5A2JH 4DVRL 1G7LA 5FCUL 2B1AH 2BHYA 2XPGB 3TBVA 4LIQH 3SJVE 3P0VL 2I9LA 1YZZA 4RBPH 3SDXB 2Z8RA 5F1OB 5MENE 1FYTD 1KFAL 4HGKC 2FO1A 1WTGT 5HHME 3BZEB 1IZJA 4WDIB 4C58B 1NAMA 4ZS6D 2R0WH 5F44A 4S1DD 1N3NB 4F7TA 1MOEA 1BGXL 2ATPA 1RZJH 2QQKL 3QIWA 2NY5C 2EIBA 3ELAT 1HIMH 4LAQH 3I6KB 1CLYL 3GZKA 1BOGA 5SX4H 1T66D 3RWDA 5TQ2H 5IB3B 5C07D 1R0AL 2GYSA 4EDXA 4IRSA 1AKJA 4NDMB 1UA6H 2ZCHH 5LQBH 1NC2B 2J4WL 2NZIA 2X4UA 1BIIA 5GGUB 5DHYA 4OLZH 1D5XA 4YHKH 4XVJH 1KACB 4N5UA 3SE4A 3M1BB 4G6AD 4QHUB 5IW6B 2P1YA 2FZ3A 2VDLH 3STBA 5HGBA 1NUGA 1MCIA 2CUIA 4TNWF 1C16B 1QQDB 4LLQA 1YNKH 2GJJA 2GI7A 4AYFA 4JFPB 2AEPH 4OTXL 4U1SA 5DJCB 3QO0B 4NWUH 3OJDA 3HI1B 2FHBA 3NPSC 1Z0MA 3MA7B 4HJ0C 4R4FH 1HN1A 2H2SD 1WWAX 2Q86B 3M45A 4WY7L 1P1ZA 5C6WH 5IP4A 3DMMD 3LPGA 1J8KA 5DD3L 1XGRB 1VADB 3FRPA 4U2ZA 2IGFL 4YDLC 1C5CL 3C6SB 5CP3H 5HDOA 4QXTB 5GGSB 3ROOA 1HHHA 4QRUA 3RU8L 3O45B 1QLEH 4WHDA 3PV6B 1UZ8A 2EDRA 1EAPB 1BM3L 1YNTA 1PLGL 4KKAD 4KGLA 4XP5L 2D9QB 2YK1H 2HJKA 4NN6B 3MR9A 5J6HB 3PWUB 1MHCB 4HF5H 5GGTA 3THML 1BFOA 2NXZD 3QCVL 3GRWL 5E2WH 4OM0L 2WBJC 2MMXA 2J6EA 3VGGA 1PGRB 3I84A 3HI6L 4QRPD 3IFNL 4OZFG 4WV1C 4YO0A 1CZ8L 3UPRA 3X14A 4FFWC 5I1HL 1GGUA 3NIFE 1OQOA 2E8ZA 5TQ0H 3K0WA 4MNGA 3U6RA 3RPIB 1RIHL 2DIAA 2A6KB 1F58H 4IOIA 4QOKB 3HC0A 1GSMA 3NMEA 3AGVA 4OZIB 4LU5H 1I1RA 4XAWL 5L2KB 5GSVA 5DVMA 1RZFL 1LO2L 1LK3H 1QACA 3B9KA 2FJFB 5ACLA 5DRZA 1JV5A 1ZT4A 3RWFB 2R4SL 3CDFA 3TT1H 5E8DH 1ZKAA 1ZEAH 1ZHLB 2PXYB 1ZWIA 4HDIB 4RA0C 5C07E 3CMOL 4OZGB 1TJHH 2ZSVA 3QHTC 2WP3T 3K2UH 5KVMC 3OZ9H 3GGWA 2ADFH 3UC0L 4C4KT 4XNYL 3FQTA 4YDVB 5IOPB 3BGMB 1IJ9A 4HFUL 5DTFA 5EC1A 4HS6A 4MLIA 3BMVA 4P2OC 4RFNB 3GSQA 1P5VA 4PP1D 4FN0A 5IBTH 5FYJL 2X6MA 1G0YR 4LASH 3QEQA 3JUYA 4WWKA 4OLWH 2DF3A 4YHNB 5FYJH 4KAQL 2XY2A 3LV3A 1A6AB 4HKXA 4DQOL 3UO1L 2AJZB 3ARXA 5KN5B 1JF1A 1JGLL 4LF3B 4RX4D 2K9UA 5KANI 4NQDA 4YC2B 2ZCKH 1HQRB 4LHUA 2ZWLT 4OD2B 4NZUH 3FQWA 5FYJD 4TUKL 3CH1B 1Z9OA 3VXMB 5A3ID 3O11B 2HFFB 5JO5A 4F57L 5ESAB 2CDEA 5HHOB 4TTDC 4OQ1A 5LBSL 3BX7C 3KPNA 5FB8A 4EQ2A 4GW4B 4N90D 3LVEA 3B43A 1Y6NR 1U3YA 3IDXH 5GGUA 5IV2B 1IAOB 5BW7A 1N2RA 5CZVH 4UIKH 5EBLA 1FFNA 4Z8FL 4GAGH 3BPLB 3C9NA 3BEWB 3ORJA 4HWBA 4UQ2B 2A6JA 1RIHH 3FO0L 2DQFB 3QO0A 3QUXC 4PD4J 4ZUSB 3T0VA 1MJ8H 4AJ0A 2F54E 2P5WB 3O6FD 4HS8H 1BZ9A 4CAGA 2MCPL 4P4KA 3LS5H 3HAEG 4O2CA 4Q0XH 1KNOA 5H94B 4X9HA 1KENL 3T4YB 3DGGA 3HAEB 5E4EC 3MX0A 4U1NB 3V5KB 3EZJB 4JO1H 2HJLA 1OQXA 5IHZA 2DWEB 1RPQA 4GW5B 2C3VB 5E9DE 3MRIA 1FNGA 3LKRA 2X4OA 3PV7A 2JCCB 4WU5B 4LVHC 1I85A 1UB5B 3GSRA 3T0WA 3KHQA 3IF1B 4UOW1 4XHQA 3RBSA 1D5MA 4IMLB 2VXSH 1N3NA 3NN8A 2GTZB 2ZJSH 4CVZA 3VFNB 1BFOB 4H0IA 5HHMB 3DVNA 4X80L 5HTSA 3GMQB 3RU8H 5L7XL 2AQ2A 2Y5TA 5GGSY 1KT2B 4CU6A 3VFMA 3WDJA 4QNPE 4X6BB 1IEBA 3U7YH 1FCCA 3P4NA 4Y4HD 5ACMA 1MY5A 3C5SA 4LEOA 1A1NA 3JTCA 3CGTA 4NT6B 2NY7L 4U6VL 3RI5F 4DUXA 3KS0H 2R15A 1VDGA 3NIDE 5HHXH 5C0FA 2Z4QB 4NWUL 4QTHA 3LB6C 5ADPH 4LGSB 3Q5OA 2NY2C 1AJ7H 3VXOB 4M1GH 4QXWA 1HNFA 3MMEA 3SO3C 5JPMA 1OLZA 4IIQA 5T3ZH 4XCEB 3ZKXC 1KBGL 4X5XA 2J88H 2PTUA 3SDAC 2YD4A 5D5MF 3MOBH 4HJJL 4JHWL 3MA7A 2F8VA 3G5XA 4LEXL 4O9HL 3LQZA 1AQDB 3I50H 3L3IB 3BOVA 1CFBA 2ZG1A 5TDPB 5F21B 4OSUH 4P9HH 1BOYA 3SDDD 2FYYB 3OAYK 4Y19B 1A2YA 2DBLL 4G3YL 1B0GB 1LO5A 3TJHD 5T33L 4Z7UB 5IW1A 1EVTC 2C1OB 1EPFA 5J89A 1NBQA 4L29B 4Z6AT 1AI1H 1ZT7A 4OZHA 2NY5L 3EOAA 4XPFH 4RWYH 3U7YL 3G04B 5L8JB 3X11A 3KPRE 3W9EA 2Y6SC 5GGRA 4HWZB 2BY2A 3TV3L 3VXRB 1WBZA 4ISVA 4YR6A 4U1GC 4X6DF 1O0VA 1UEYA 3FO2A 1ND0B 5DJYA 2ZSWA 4DVRH 4U1HB 1A6AA 5CGTA 4LSPL 2XZCH 2XZCL 3CFKB 2DWDB 3EFFA 1YEEL 2B39A 1TMCB 3B5TA 1CT8B 3SCMA 2DQHH 5DJDB 1FNLA 3MBEA 5E5MA 3JTTB 4RIRA 1ZLSL 3VWJA 5DQJA 4OBSA 4MCZA 4GJTB 1KB9K 5JIKA 3VFGL 5JW4N 2HH0H 5FYKU 1KENH 4PJ5A 1ZA3B 4H5SB 5CILH 5IB2B 5J06A 5IV2A 4FS0A 3DROA 2FJGB 4XNMA 4Y1AA 4FHBD 3CFBA 5C08B 1JUFA 1FP5A 3S4SB 1NGXA 3GIZL 2NW2B 4DGVL 1QSFA 1UH4A 3I75A 1TZIB 3FO0H 1NCNA 3OJ2C 1LP9F 4OAWB 4P2OA 5B4MC 4LOUC 5KVFL 3D0VB 4L8DA 5J12C 1QRNA 4EOWL 5JOPD 2F9BT 1MHHB 5CSBA 3BT2L 3O6KH 3NGBB 3CCHB 3SDDA 4JRXD 4H25A 1QKZH 2XZQL 5H94A 1S9VB 4HUVA 4OKVA 1X5KA 1FBIH 2RIKA 5F1IB 5CJBA 1I9EA 5C86A 3RJQB 4M5ZH 2Y1VA 4ZUUA 1QBLH 4F33A 4G7YL 4GKSB 2DLTA 1OB1A 3DECA 3LKRB 3K8MA 5I15L 1JPST 3WUZA 2F8OA 1OTTD 3SDYH 1CXHA 2IADB 4ODSH 2G9HB 4RGNE 2QL1A 1CLCA 5A16A 1WZ1L 5KOVC 4OZHF 4I9WE 5TFSL 4DQOH 5IFJA 5FM4A 1JRHH 5C8JB 1GGCL 4JFDA 1D6VH 1VB9A 4KAQH 2FO4A 3ULUD 1UB6B 4M1DH 1XF2A 3WNOA 3DVNB 3O2DL 4NFCA 4KROD 4P5MA 4RAUB 5DMKA 4S1SH 1IGYA 3QIBD 4BZ1L 4YNYB 3MRKB 5EBGA 2CDEB 2AGJL 2VAJA 4PJAB 2X1OA 2VLKE 5CSZA 5EOCH 3KPPB 1J9CT 1FZKA 4WI6A 4YQXL 3IB4A 2Q76A 4LEOB 3KPOB 1I1FA 2X70B 4EDWH 3JSSA 4LQ1A 4L8CB 4MA7L 4HT1H 4P4KC 2NY1D 2H1PH 1DP0A 2HYMA 4Z77B 2QSCL 3CUPB 4WU7A 5DXWA 1AXSA 2ESVD 2YUXA 3U4BL 2Y23A 5T3ZE 5JPMB 4JG0H 3LS5L 5GS0D 3QHZL 2OJZL 4Q97A 1OAKH 4M5YL 1FG2A 1U36A 4PGDB 4I0PA 3L1OH 1A9BA 3RWGA 1PW3A 4X6DE 2VLKA 3PWNA 2HKHL 4RQQA 3GUTA 3KPLA 4L4TA 3FCTA 2OQJA 5FF6A 1LDSA 3FFCA 1G7JA 1AD0B 3VXME 1Q94A 3C6SA 1U8PB 4P3DB 3ARYA 3M17B 4P4KD 3SJVD 4MZ2A 2HJLB 3V6OC 2PYFB 5EC2A 4YAQB 4BKLA 2B4CC 2JJTC 1ZLWK 3OB8A 3JXAA 4PJ7F 2K1MA 2QQQA 3O3UN 4JFHE 2R23B 1S9YB 1GC1L 4J23A 4LPUA 4NQDD 2E27H 4GLRH 4NZRL 5E2UH 1TCMA 4K7PL 1G6RB 1IAKA 4G6JH 2MFNA 5JOPE 4G5ZL 3EOTL 1T83A 2B8OT 2QR0A 4EN3D 1HE7A 3FT2A 4K94L 3VDCA 2B5IB 3ARED 5EO1B 3D85B 5DHVB 4ZFZB 5DJ6B 2HKHH 2A74B 3FQUA 4HGWA 5FYLD 3IYLW 3PQYA 1T1WB 1BVKA 1K3ZA 3TA3C 5BZWB 2AQ3A 1H3VA 5DK0A 4NZDA 4G80A 5C07B 3SKOB 2YC1A 1KOAA 2GFBB 1BQHB 4ODHH 2QBWA 1TTGA 2EC9U 3ZDYE 3U9PH 1BWMA 1S9XA 3PHQA 4S0SD 4PJ9B 3U0PA 4Q9RL 5D72H 4Y2OA 2ZUTA 3SN6N 3VW3L 3MGOB 4GRWE 3BO8B 3LZFH 3OMZA 4BQCA 4LVOB 5I8KL 3MLPA 5I8EA 1TZIA 5FGCE 2XFXB 4CL7A 4P46C 2FSEB 1YNKL 1ZWIB 4HDIA 4GW1A 4BZ1H 1XH3B 3LS4L 4F7PB 3QFDB 4M1DL 1A2YB 1G9MC 4PJXA 2OTPA 1H5BA 3QQ9D 5CSGA 3FOMB 1A0QH 4FFYL 5EOTA 4UINH 3N85H 3KYOA 5B39A 4BSWB 2Z93A 1C5DB 1H0DA 5L88H 3PP4L 4YHPB 3ES6A 1OGAE 5C6TL 4QKXB 3CDGA 2XTJB 3EO0A 2VKWA 5BS0D 2A9NL 3NABH 5GJSL 5I1JL 1FVCA 3IJYB 3PDGA 2W9LA 5DUMH 1CLOH 2N7AA 2Y7QA 4LLDA 5F1NB 4FABL 1JGDA 4D0DB 3U0WH 5A16B 2O5YL 3O6KL 4G8GB 3KPSD 3T8XB 2YZ8A 1HILA 2B1HL 3IDIA 3EO1A 3TNNB 4OD2A 2AI0H 3JZ7A 1I9IH 4MHHI 5EFIB 3V0AC 2VDMH 2FWOB 5CGMA 3PXJA 3CFCL 3PL6D 4X5WB 2O5ZL 4ETYA 5EBWB 3GRWA 3MUGA 4E9LA 3BP6B 1T1XB 5F3HB 2VZ3A 1N8ZA 1IGCH 2YN3A 4QLRA 3GIZH 3MOAL 4GW4A 3ZTJG 4OCRL 3DRQA 1J05B 4KKCD 3C5ZC 5F7UA 1NANH 1DUYA 1BEYL 1SY6H 4DKFH 1KTLA 4ONGL 4U6XB 4APQA 3CFBB 1YY9D 1GC1H 3SDDC 5CKAA 1S7WA 4D8PA 4TVPE 2I26N 3ZDZE 4D2NA 3U82B 4KK9C 4JZJA 2EH8H 3AS2A 2FECI 3MXWL 4UQ2A 4CKVX 3C8DA 3DETD 4YPGA 4JRYE 4XNQB 3O9WC 1XCQB 4D3CL 5HHOD 4HUWB 3MLYL 2V6HA 3PWNB 1CL7I 1U8LA 1OTSD 1RQ5A 2F53D 3BQUD 5TE4L 3CXHK 3TVMA 1MFAL 3R8QA 3P4OB 3QQ3A 5I74C 1BQHG 5D2LF 2ZG2A 4IMKC 4OJFL 5LGJA 1OAQH 3V8OA 4DKEH 5M94B 4UBDC 4LPCA 1N59A 4PP2B 1G7PA 1S9WA 1A7RL 4GW5A 5DMIL 5EZJA 3IXTA 2EO1A 2P7TB 4RZCB 3D1MC 4O5LH 5HYJA 2QQLL 4WHYH 5BV7B 3SJVB 3L5HA 3SBWC 4KY1H 1BMGA 1N7MH 4OFVA 3S88H 3WUWA 1I8IA 3BGFB 4RAUA 5DMKB 4IOSD 3MLSH 3PXHA 4J12A 4QWWC 1IC4L 2VDOH 2WMPA 3O2DH 3D85A 4I18C 1R5WA 4JFDD 5HGHB 4C56A 1RURH 3P2TA 4RDQF 4B53A 3F7YA 4XPBH 1CI5A 4WFHD 1AR1C 1KTDB 5H37G 4HS3B 4MHHG 4PRIA 1KIPA 5JPNA 4K3EL 2DQTL 3KNBA 1ONQA 1KJ3H 4M9OA 4HIIB 4PD4K 3P9MA 1FPTL 1G0DA 2KH2B 5I1CL 3BO8A 2OR9L 1UXWA 3FN3A 4POYA 5JQ6L 3KPLB 4WEMB 2NNAB 3P73A 4MQ7B 2FATH 2EXYD 2J5LB 4NKIH 3WFEL 3FFCB 5F8RC 2WIIB 5DJAB 3NCCB 3O4LE 5CWSB 3BZ4B 1NCWH 5CEZE 2UUDK 5KZCB 1QFOA 4Q2ZB 1T83C 2E7BA 3GHEL 4HUNB 5DD1H 3WFDL 3TJHC 4NBYB 4DGVH 4LSUH 5HVHC 3V5HA 5MEOA 3VH8G 1A3RL 2AJXH 1Q9LB 5IVZB 1NFDB 4JAMB 2QSTA 2PXYC 1W0VA 3I3DA 5T3XD 3VFPB 3CDGB 2ARJA 1S3KH 5GGRB 4YDJB 1C12B 4OKDA 2QR0B 4NQCD 5DEFA 1IC7H 5IMMB 5KG9B 4Y0GA 5JDJA 3LKNB 4HC1A 3T2PA 3Q5YA 1YEGH 3CIQA 5L8LB 2X2YA 3TIEB 4APQD 4GKNB 4H8WC 3HMXH 1DQQB 1MQ8A 1MUJB 3OKDB 1HQ4B 3RNQA 3O6MH 1QLFB 4ZXBA 4JM4H 5HDBE 3DV4B 4JM2D 1A64A 3DOSA 4X9BA 1RUAL 4JFOA 3ZDYF 4KV5E 1OP5H 3MNWA 2JLLA 1EBAA 4I3GA 3GIVB 3SGJC 1MCQA 1T1YA 1UKTA 3QCUH 1A7NH 1CE1H 2V2XA 4PJDB 3DIFA 2Z31A 3RVVC 1RZGA 1EEZB 4J3WA 1A7PH 3G08B 4HIXL 1URLA 1HHHB 5D7JB 3BPOB 5C0AA 1NC2D 3VG0L 1C1EH 1Y0LB 1CDUA 3PQYD 1IGCL 1F3DJ 2PR4H 1BD2D 4GRMA 4WIQA 1S7SB 2E6QA 5E24E 4P4RB 1YYLH 2DAVA 3SDDB 2CLVA 4M1CD 2BSED 1HXYA 1D9KC 4HV8A 3H7BB 1MHCA 3NCEB 2DQDL 2V7NA 2EDXA 4ZAKD 4NJAL 4K9EH 5FDWA 5CEXB 1AGEB 4MJ2A 1JGVL 4OZFB 1HYSC 3FB6A 3SE3A 3H3PL 5GS2H 1DDHA 1K5NB 4ZOBA 3E2HC 1X6NA 2VZUA 1WV7T 2QADC 4R3SB 3ZE0E 4OUUA 4RDQG 2FBJL 1Z3GH 4KTDH 4Y5VB 4AEEA 5HHQA 5SWZA 4JY5L 5EFIA 4G6KL 1OM3H 4NQUA 1C8PA 3BD5A 3OQ3B 4DKEL 3MRRA 1T21A 5LGHH 5L7XH 5CD3A 1NCDH 1UZ6F 5DK3A 4NN5B 2P44B 2ESVB 3B2VH 4WUUE 1INQB 2BVOB 1U2HA 1ZHBB 4E41A 4WFFD 2EXWD 3O4OB 1V05A 4Y4KA 3WS3B 2H9GA 1IGML 2VR5A 4OFIA 1DBAH 3B4NA 1ULVA 5JORA 4X9GA 3VI3F 2FZ3B 2GCYA 4JGMA 1EZVY 4HMCA 2E9BA 5DDHA 1FVEB 1IAII 4X98B 3U2SA 3DX7A 1X5YA 1S9KC 4JGJA 1X44A 3P9MB 5E1HB 1Z9SA 3VXTA 3TCLB 1QSEA 2PO6D 1I1YA 1NFDE 4NQEB 3WLBB 4MJIE 2Q8AL 3TZVC 3L6FA 3CSGA 3KWWA 3OX8B 3ZT5A 1JZ8A 4J8RA 3DV6A 4RRPA 4P3CH 4Q7DA 5ALBH 3O41A 1N64H 5DVOA 3EYQD 3SBWA 4B50A 3RVUD 5KVDH 3NPSB 3THMH 3M17A 5DYOA 3QPXL 1FC1A 1EERB 1L8JA 4BKLB 3T0EA 4Y4FC 4PP2A 2NTSP 1R5IA 4L8SB 4WTZG 3MLVH 2EC8A 4E41E 5AG8A 1T2QL 1KLUA 4I18A 1CS6A 1DFBH 4GRLB 5L6YH 3MV9A 2VZTA 4UT7L 1ZTXH 1CXLA 1Q9KB 4PGBB 3BDYL 3WN5A 1Z5LA 4FXKB 4N8PA 4RBPK 3ARVA 5EZIL 2IALA 4RGOL 5HHOA 3VFRB 2IAMC 1X4XA 5TF1L 4X9IA 1JPFA 4DVBB 4ZTPH 5DD3H 4PJIB 4YBQC 3ZKXB 3TBTB 4CVXA 3OJMB 3A6CL 4GRLC 1K4CA 5DJ6A 3KG5A 5C0CD 3MROB 4F15B 2X1WL 1WITA 2P42B 5KSUB 4P5TD 1EEYA 3F7YB 2P24A 1JWUB 2EDFA 3D39B 2VN7A 3ABZA 5DFVC 1UXSB 4JPKL 4KRPD 4I3SH 5FUOL 5J3HC 2GFBA 1G9EA 2H45A 3RGVA 4MB5A 1EEQA 2R2BB 4N0UE 5D6DA 4ZAKA 2P5WA 5ISZD 1QPXA 5CEYA 2FR4A 5CUSL 3QFJD 4N9OB 4PLNC 2IBGA 5IVXE 2WK2A 1MCKA 2HVKA 4KK8D 3MGOA 4LPTA 1ACZA 1N6VA 2X7LB 4U1JA 5HYIA 5ICZA 3BYTA 3QRGH 4U6TA 4WFED 1MAML 4LDOB 3RVXC 1VESA 2BP3A 1T03H 3HNSH 2E9WA 5E2TH 3L3OB 2XKSA 2VABA 1JPSL 3OKYA 2PXYA 1QEWA 1O7VA 4K3DL 1HIML 3S35X 2R0ZH 3OXRB 1G6VK 4PLKC 3JWOC 1FV1A 5D1XA 4M6OH 1H5BB 4G8GD 1JMZA 4XXDA 1UQSA 3P77B 1AO7B 3I9GH 2VN4A 4G6FD 5HYJD 4S1SL 5D8JH 5CHNA 4CU7A 1HXYB 2D2OA 4PUBL 1R5VA 4CN6A 4XAWH 3REVA 2COQA 4XP9L 1AHWB 1DBAL 4PJFA 4LCWE 1QNZH 3MV9D 2ZUQC 4MJID 3GSOB 3EOTH 5HDBF 1MRFH 5GQBA 4UV4H 1P9MC 3LV3B 4JKLA 5ERWA 2CUHA 3OKOA 5D7KE 3LEVH 4JCLA 1TNMA 4H1LB 3U0TB 4PLKD 1RJLA 3RZCC 3EYVB 5FYKH 3MRHB 3HE6A 2Z4QA 3FQWB 1FFPA 3QNXB 2W38A 4HWBH 1IAIL 2XRAH 4NFBA 5J1AA 5C0BD 1KCUH 4R7DA 3KPSE 1RZ7H 3RHWK 3K7UA 4WI8A 4KUCD 1BZ7A 3WNLA 5KVFH 3VFWA 4YZFF 1J05A 5E08H 2DLIA 1IAOA 2D7QA 1FO0B 3A6BH 3SE8H 3W0WB 2H6PA 3NVQA 3G08A 4EI5D 1EBPA 3QULB 4KDWA 4M6NH 5H8DA 5K9QG 1YEIL 1RIUL 5IJKC 4EXPX 1NGQL 5BZDA 3O2WL 4XNQA 1RUQL 3NCJL 1INEH 1JL8A 1QLRB 4TVPH 4DN4H 4POZC 3VG0H 3QWQB 1HHIB 1OARL 1B2WH 3E2HA 5GS0H 4ZFOA 3AAZA 1I7UB 5DEGB 1G1CA 1AXTH 4JJ5B 3QQ3B 1U8NA 3WXWL 3FFDB 3ZKMC 3IGAB 1LP9A 2Z92B 1UM6L 3FO2B 4YGAB 5KW9L 1NAKH 4D0BB 5C0RL 3T0EB 1MJ7L 43C9A 2VDRL 1XR8B 3CDCA 3WYRA 2X4OB 3WBDA 2IC2A 5FHAH 3LD8C 2AK1L 3TV3H 3GBMH 3H9YA 5FYJU 3U46A 2H8PB 4R3SA 2OSLA 4H8WH 5IVNA 4PB9L 1Q9WA 1QA9B 5E5MB 4X7SH 3VXQA 5SWSE 3QZWG 4GG6A 1UENA 4G6MH 4MXVF 4FFZH 4NN6C 5HYJE 2VXTH 3TIDA 1GHFH 2QQKH 5F7NC 4L3EB 2WWKO 3G9VA 2RJMA 2CLZB 2XZQH 1QKZL 1JWUA 2VTFA 5KVEL 2WWKT 1U9KA 2KL6A 2OL3B 4U1LB 2C4XA 4UT9L 5KZCD 4D9LL 4TUJA 1NC4D 2C5DC 2VAAB 5D2LE 2GCYB 5DDHB 4RGNC 5D7KD 3G5ZA 5I66B 3VI4F 2BMKB 2XTLA 2VR4A 4LPXA 4HCRH 5C9JB 4QTIL 4Y4FA 2LTQC 2E7HA 4KTYA 3DX6B 4RMSA 4XP6H 1HXMB 1GRWA 1FNFA 2QTEA 4FMKA 1HKFA 5HSFA 2FATL 4NKIL 3WFEH 5IT2H 3NACL 3FRPG 4JFED 5T5FL 5T5FH 4OIIH 4PRPD 4Z7NF 2B2XH 3UDWA 2GJ6D 3D2UA 5K9JL 4KXZI 3EJZC 1MFDL 2ZCLH 5B3JE 5EU3B 1SJVA 1KJ2H 4GRLA 3QEUB 4JFDE 1P2CB 1YEEH 3WXVL 5ACZB 2GJZA 2VLMD 3ULUF 5ID0A 2ATPB 1UB6A 3BSZH 3UZQA 5F7DB 2BVPA 5INCA 3H9SE 2BK8A 5GGSA 4PRPE 4GMTL 3GSOA 4XP1H 5KG9A 1WISA 1ES0A 1MPAL 1EJOL 4G8FB 3B5HA 1W8NA 3LKNA 5DO2D 3MGTB 3O3DA 2GJ6B 1I3GL 1NEUA 4ZQKA 3TA3B 4NM8L 1S7RA 2WUCL 2XTJD 4G9FA 3MZGB 5DJDA 2W59A 3MLRH 5AZEL 1FGNL 3TZVD 1OARH 2APFA 2D7OA 3ARBC 4QHLA 1NGPH 1ETZA 3HZVB 4MJ5B 3WKMH 5CD5C 3KPQB 5T1KB 4PJIF 3NIGE 2D31A 5DLMH 3HNSL 1E6OL 2XNAA 4U1JB 4XCFL 1YEIH 3RWGB 1JFQH 4NRYB 1OAQL 2I07B 2NR6D 4HJJH 3RVUC 3HG1B 4UIKL 1S5IL 1JJUA 2I9TA 1MI5B 1TJGH 1RZIA 4F7EB 3QB7C 5FYLE 4LPYA 3IKCA 2L0DA 1ZT1A 4OFKA 4QRQB 1U58B 5TJWK 4BELD 3ULVD 1ZGLM 4FTVA 2WBJA 3CVHB 4MA3B 1O7SA 4P57A 4F57H 5D1ZA 1I1CA 1J1PL 3CCHA 4H25B 1HHIA 1MCWW 1GJIA 4TUOB 3QPQD 4HWBL 3OAYH 3LHPL 4YHLL 1ZHKA 1H5BC 1EO7A 3RWEB 1A5FH 4A6YL 1MWAB 1NGWA 1FSKC 4HLZG 3ZTNH 3ILPB 3DNKA 4PJXF 1IZKA 3PQYB 1HOCB 1FNSH 2YUWA 4TYUA 4HPOH 3WHXA 5IBTL 3CH8A 4M3KB 3BISA 5IR1B 1BBJB 1QA9A 1Q9WB 2EYSB 2F19H 4WFHE 5JW4R 4HPYL 1JWMA 3QPQC 5D9SA 4X6EB 4XNYH 5ANMB 5IHUH 4P5KB 1IAIH 1OW0C 5CJXC 1A1OA 4P3CL 3AB0B 3PP3K 3O9WB 4HKXB 2JJVA 1OSPL 2R39A 4IHOB 4P5TB 2Q8AH 3LOWA 1Z6JT 1OAYH 1VFBA 3EHBD 5C2BL 1FO0A 2Y06H 4FOMA 5F9DC 5C6TH 1UCTA 3O11A 4TUJB 4NC0B 5L88L 3E3QA 5J8OA 4RCAA 3VA2C 2EDYA 3QRGL 1QNZL 3D9AL 3EUUA 1JRHI 3FN9A 3U2SB 5E8PA 2R1YB 3T4AB 1OAUL 4UT6H 2V7HB 5BZDB 4Z8FH 3IDMA 5C0NC 5EOTB 1WICA 1YEFH 1FAIL 1LHZA 1RK1A 2DYPD 3GBNH 3CAFA 2HN7B 1A9BB 4Y4HB 4JKWA 1ZVYA 4KKBD 3FFCD 4MX7B 5IEKB 2I25N 3I6LD 2IPUG 4X8XA 2PYEB 2UWEE 4O58H 3X17A 1YJDC 1EIBA 2P8MB 4DFHA 1JPSH 1F2XK 4LSVH 2V5MA 5SWQA 4TUKH 5GS2D 3RTQA 4QRPA 2E9IA 4LF3A 4U4BA 4OD1H 4HPYH 3TNNA 1FFQA 1KNOB 1K4DB 1CCZA 4LRNH 3GJEA 1LNUB 3DGGB 3WN5B 2DN7A 3D6GA 3UJIH 5DVLA 3GK8L 1XAUA 2VITA 4MB3A 4AEHL 1CG9A 4GAJL 5F3HA 3BEVA 5CD5D 3DX8B 2PW2B 3MGTA 4M61B 4NQSB 4YHYC 2GJ6A 3D2UD 5HPMA 1K2DA 3MROA 2X4UB 3UTSE 3DXAD 1FIEA 1N2RB 3N0PB 1MFNA 1L6ZA 4Z0XA 2PR4L 1T80A 5B22A 2IFGA 5DGQA 3ZKSD 5IVOA 2EYRA 5J13C 2HLAA 3WIFA 2A9MH 3ARPA 4M4RA 3MV7E 3CMOH 4S11A 1D3CA 3KPQA 4RAVB 4PGZA 3WIHH 3IT8D 1YC8A 4OTXH 1YMHB 5GRWA 3HZYA 1KN4L 2VLJE 1A4KB 5F1KC 4R96A 1XF3B 1MSPA 3GNMH 5E99L 2VXVH 2DQCH 3ET9F 2VABB 5C0GA 1LE9B 3NIDF 1FG9C 5EPMA 1ADQA 2OXGA 2R2EB 2VXQL 4LCYB 3NFPB 2OX5A 4S1DC 3VXOA 3OAUL 4PG2C 4AEIL 1YNLH 3MMEB 4NYLA 5DLML 2CUMA 5GRJL 4PP8C 5D1XB 4PJXB 4MWFA 1DUZB 2FIKA 1KTKE 1F4AA 1UQSB 3TEUA 4MS8C 5E8NB 3VE0A 1DLHB 2C26A 4P2QB 4N0CC 4UU9A 2I27N 1CD8A 1UADC 1H0DB 1JZ4A 4PJHF 1DQLL 4PJFB 5ABDE 2Y5TB 3TFKA 2PO6B 3G5YB 3MGAA 4UUJB 5HGHA 1RFDH 5DA4A 4O00A 3WNMA 3R0MA 3UPRB 1U2CA 3AVEA 3C8KA 3NA9L 1C08B 4PRIB 5MEPB 5JPNB 4U3CA 1JRHL 5I71B 4X5WA 4ODUA 3QXAA 3HRZA 5LGHL 4PJAF 4P5KA 4Y1AE 4J3SA 1YJDH 2XG5A 2HRLA 3QFJE 5T5NG 4BFIA 5K9JH 1F4YH 1D6EA 2YHGA 3UYOD 5JQHC 3VFUB 1UJ3B 4OIIL 4KJYB 3GMOB 1IQDB 2RHEA 4ORZC 2J8UB 4HIHB 1UXWB 4R4FL 4XC3H 3TWCL 1MCNA 1U92B 3SOBL 1CT8A 4WFGD 2X4NA 2H6PB 4PYHA 3SE9L 4XP6L 4LARH 1RUMH 4P2RD 2CIIA 2J8UE 3H8NA 2DQDH 4Y5YA 2V7HA 3C08H 1RUPH 2X5PA 3MBXH 1LK2B 4FNLL 1OOAA 5ID1B 3IU3A 1WGOA 1JZ5A 1CFQA 2IMNA 3U9UA 4WW1B 4NO3B 1KPUB 2YXMA 1QHOA 3LRSB 4U6HA 1NGPL 3IDNA 4EIGB 3LQAH 4JM2F 3DSFH 4KV5F 1FGNH 1TZHB 4U1KB 4XP4H 3UTTE 5T1DH 1G7MA 5CIPB 2DWDA 5J4MA 5EUOB 3ARDA 1D9KA 4IDLA 2HH0L 1OWWA 5GJTL 3IXTB 3L5XH 4RZCA 1YPZF 3QCUL 3HE7D 1CFTB 5KAQF 5DMIH 3MFFB 5F7FA 3KXFA 4HBCL 3WL9A 3MV8B 4J3UA 1A7RH 4WO4D 5AWNH 4HFWB 4K71C 4HKBA 4P2QD 4MSWB 1SYVB 2VZVA 2V2TB 4FTVD 4WNQA 4HIJB 1RUPL 1A3RH 2AJXL 1IBGL 3NFSL 2PW2A 1KB5L 1N4XL 4HG4J 1DL7H 5BVJA 5LXGL 1PG7X 4NQSA 2D0HA 1JCKA 4XI5C 5E94A 1CK0L 3PWVA 4ODXB 5D2NB 3VRIA 3WEXA 1YQVH 3H6JA 1KB5B 3DBXB 1AXTL 5EOQH 5EBMA 4DN3H 1UACL 4XC1H 1MCSA 3WHE0 1PYWB 1T22B 2YD5A 4ELMF 4Z0BH 4N8VG 2J8UF 5DA0B 5IMOA 5DZNA 2IG2L 4PJGF 4WI7A 1RI8A 5FYKD 4E5XB 5DF0A 3BUYB 1YMHA 5B38G 1TQBC 4D9QE 2PF6A 5AYQA 4LSQL 3V6FA 1V5JA 1KCRL 3DJ9A 4PJ7E 5DS8B 5F1IA 2ARWA 3QUMA 3FB5B 1K9TA 1VKXA 3T3ME 4S2SA 3IFLL 1RZ8A 1DN2A 3BUTA 1HDMB 4ZMAT 4C4KO 2EEBA 3TZVA 4Y4HC 3K80A 3C08L 1UM5L 2G9HA 4I0PB 4LSSL 1NBVL 4P59L 4EKXA 3OKKA 1V3LA 4M43H 1J88A 5SWSA 3SE9H 1QVOA 1MCDA 3VFNA 5GPRA 1ZAGA 1T6WA 5FO7A 4YHMH 3SOBH 1T21B 5T1LD 3MRKA 5HI5C 4NRZB 5C0JB 1UWGL 4BZYA 7CGTA 1XIWA 5IHBA 4WW2A 3QP3A 1NGYB 1F13A 2X70A 2J8HA 3KDMB 2VL5A 3WN5C 1LO4L 3QIUC 4OJFH 2CLRA 2FJHA 2YPLD 3IFPA 4OCWL 3FB8B 4DCQA 4ZXBB 2QHRH 2UWEB 5MEPA 1DN0A 4Y5XB 2BVTA 4J3OC 4UDTA 3DYOA 1T7YA 5T3ZD 4GLRI 3NA4A 1KF9B 3CZFA 3WFZA 5EO1A 1XF5B 3RZCB 1OD7A 4KY1L 4NQEA 3EYOB 2E7CA 3MLUL 3HC3H 1LWRA 1CDHA 2CJUL 1KLGA 4L4VB 2Z8SA 3T2QA 2EH8L 3RUGE 2HT4D 5TDPA 5GZOD 1JPGB 5E9DA 3ZYZA 1T03L 1IILE 2VE6A 4PJ5E 4Y88A 4YHIA 1LE9A 4N8CL 4QRPE 2D7TH 3D3VE 3OSKA 4ELMA 4M6NL 3TN0D 3WE6B 5C0EB 3MRBA 4OQTL 3EZ8A 4P48A 4POZD 4I77H 4Y4KD 2DKUA 3S34H 5E0QA 1T20A 2MHAA 3TBYA 4CJ1A 1FNEB 1F3JB 1Y18A 2JIXA 3IAGC 4KRMB 3KPTA 2VXQH 3SKMA 1EFXA 5B4MD 4LNRB 1MQKH 5DQ9B 3B2UD 5E8EB 1GXEA 4OLVL 4X0KA 3LKSB 3OPZH 4HUUA 3AU1B 3EYFA 4N8VA 5E7FA 5FOJA 2XKNB 4NHUB 1M7IB 1A6TA 4OIAA 5T1MB 3U0WL 1TZHA 4R9HA 3I02B 5C0DA 2YPVH 4J3XA 4OF7A 4ZUWA 2FH6A 1U3HC 5BZWA 3I3EA 4P9HC 2FEDC 3PIQA 5IESH 3JV0A 3OF6D 4FRWA 1MVUB 2AJSH 2ICWJ 4YFDB 4X5LA 2MTPA 5L6YL 5F7EH 3FL7A 4MCZB 2F58L 3ARGC 4PTUA 1EV2E 5E2JA 5DHXB 3W39A 1Y6KR 4AIZA 3U0PB 2I9LB 4YIQB 3CFJB 4EVNB 1ACYH 4OB5H 3QXDA 1CL7L 4L3CB 4CADB 5ICZB 4OD3L 3DO7B 1KB5A 2K3TA 4NGHL 5B8CB 5MI0B 1KN2L 3LS4H 4P5TA 3QQ4A 2JB5H 1G7HB 2AV1B 2BNQD 2VLRE 3A0OA 1QSFB 1WQVT 3BN3B 4YJZL 5IHLB 3ZMRA 2XACC 2BXZA 4RISL 1VPOL 3U1SH 5KSAC 1BJMA 1NFIA 3ILQC 3V7AE 1MI5E 4JPWH 3VXUD 4DGIH 4B41A 5EBWA 3BDXA 4WI4A 3KPMA 2VQTA 3NCMA 3RHWF 3S35L 3BP6A 5CKGA 1W72B 5E9DD 1GAFL 4LSVL 2G75A 3BIKA 1UG9A 5E2TL 5CMAB 5F7MC 4URTB 5JUEH 1SVCP 5ID1A 1SEBA 3ZL4L 4OGAC 2NX5E 4APQB 3PL6B 4CW1B 3K4DA 1M7DB 5JDSA 4LDLB 1MJJA 1U6AH 3S36L 1VKXB 1S7WB 2DLFH 2EO9A 3UAJC 5FA3B 1Q0YL 1KN2H 3C5ZD 4U6HB 1WT5C 1AKJD 3V6ZB 1JN6A 5I1DA 1QQDA 2EYTB 4HJGB 4EI5B 1I1AD 3BP5A 5ITFA 4ODWB 4JFFA 3DHJA 3OR6B 3IDJA 1IARB 1S8DA 1DQJB 3SDYL 1HILB 2F58H 5DMGC 2NYYC 1WUNT 4JY5H 3BKMH 4KHXH 4M93C 3QUKA 2F8XC 3WL9B 1EO5A 1U8KA 3QDJD 2IALB 2ENYA 2E27L 4NZRH 3U9PL 3V0VA 5CSZB 2V9TA 4L9LA 3FAXA 5AAWA 3MRLB 3KXFD 5BVJB 5ICXA 2YPVL 3DRQB 2VDKH 3AFLA 1V3MA 3LN5B 1S7UB 5JZ7D 1QR1A 5E6IA 2QADB 1A6PA 2P24B 3QUMH 1NLBL 4G9FE 4FZ8L 3D39A 3MR9B 5J6HA 4JN1H 2F54A 3H0TB 2Q1EA 1MQKL 2H2SC 1YYLL 3G5VB 3UROR 4JFHD 2ATKB 4DKAA 4RAVA 4YHOL 2BRRL 2P5WD 1XGTA 1OAKL 5ISZA 3O6LL 3VXPA 4P9MH 1LDPL 3D39E 1FG2B 4PGDA 5DO2C 4DOHE 3I2CL 3KHOA 1P53A 3DVGA 2ICEB 3AAZB 2NW3B 1KPRB 2GEEA 5I8OH 5B21A 4P3DA 3E8UH 4MA7H 1X5HA 1AH1A 5EC2B 2ZUVA 3HC0B 3O6FC 4PJ8B 4FQHA 1XR8A 1WEJH 3PWPA 4BSVA 3BI9X 2F74B 2FDBP 4I9WD 1QFHA 3P77A 1AO7A 3MRDA 5E8NA 1FHGA 1XIWC 2HTKC 3ILQD 3MACL 5F9WB 1F45A 3SGEI 1G6RA 3LB6D 2CK2A 5LAXA 4P46D 5SWSB 4LLVA 2C3GA 3GFUA 1NPUA 3WXVH 5SWZE 3MRGB 4BA8A 3BE1H 5BS0A 1LQVA 5T1MA 1MY7A 2Y36H 3RY5A 4EBQL 3LMJH 3P9WB 3G5YA 2LAAA 1QHPA 1R0AH 3VXNB 1TXKA 1BJ8A 1JE6A 3RKDC 1FYTE 5IT2L 3NZ8A 4F7CB 1S3KL 5EIIB 2FD6H 3HE6B 1FYTB 1UH2A 2YEZA 3MQIA 4Z95L 5AYUH 5CBAA 4EI6A 1K6QH 1ONQB 3O3AA 3QEQB 1I3GH 1BP3B 1KXVC 4LSUL 5F6HJ 3T1FB 3CFJA 3BP7A 5SV3A 4EVNA 1AE6H 4I5BA 3ROLB 2AV7B 3QIBB 3P0VH 3GO1L 4E0RA 1HEZA 2CDGA 2EDHA 3UJTL 4DGYH 2YA0A 5F72S 2ADGA 3HA0A 3C8HA 3KPSA 3MLXL 5KSBE 4OV6F 4CU8A 1GH7A 4F7PA 2OZ4H 1CFNB 1NC4A 2YBRB 5ESAA 1MWAL 2XN9A 4M1CC 4R4BA 2ICCA 4FZEL 1PKQA 2J12B 4O2EB 5CILL 4GH7B 4HKJA 1A7PL 1FBIL 1MWAH 3QCTH 4GQPH 4U3HA 5SV4A 4EZMA 4YDVA 4KU1A 3RWJA 5EC1B 4Z9KB 1FFNB 2IBBA 5D96B 3AU1A 1N5YL 4MAYD 3RVVD 4YXKL 4WWKB 1Q72L 2W0FA 3IGAA 4BFEA 5D1ZC 3QEHB 4MQTB 5HHNA 1N6QH 4BYHA 2V2WB 1HYSD 4JZNB 2VXSL 4LLDB 5CAYB 1JGDB 3RA7H 1BZ9B 1OHQA 3IDYB 5IG7A 5JXAL 2X4TA 4YDKL 1LEGA 1JWSB 2QQNL 3QUKB 4X4ZA 4I0CC 5HYEA 3VXQB 4U1NA 2ZOKA 4TSCH 1JHKH 3NCJH 1X6LA 5IHZB 4Z7WA 3BD4A 3L3HA 2DKMA 5T1KA 2VLRA 5FOBA 2CO6B 3K8KA 3CNKA 5ICYB 1DDHB 1S7UA 5JR1L 5D2NA 3VRIB 1KTLB 3W11C 5I17A 3IF1A 2VLJD 3V4VL 4NOFA 2W0KA 1J8HD 3QR2A 5GRJH 1TZGH 5F88B 5D1QB 5HJ3A 2UUDH 1FGVL 5CJXA 4W4NA 4PFEA 4F7EA 2X4QA 1KYOJ 4CNIB 2DDQL 5C08D 1P6AB 2XXCB 4LSDA 5A1AA 1KT2A 2HKFL 2NY0D 3VFMB 4E5XA 3L9RB 5GIRA 4P57B 3BIKB 2ZUXA 3IJHB 4IDJL 4LLMA 1I9JL 3Q48A 5J11C 1JBJA 2ORBH 2OP4L 3UTSB 1HHKB 1UM4H 3P4LA 3DMMB 2Q6WA 3FB5A 1OVZA 3ARUA 2E8YA 3OB0K 3IRPX 2HTKD 3MRCA 1IRAY 4ONGH 4KI1A 5D5ME 3VFVA 3OKNB 3RL2B 3HNVH 2C3VA 4P9ML 2XN9E 4FQLL 4XMLH 4LCCC 2C4FU 4W4OA 3HZKA 1B0RA 3BXNA 4E42B 1WAAF 3SDCD 3ARBB 4DAGL 2NY0C 5J1TC 1S8DB 4XPBL 5DMYA 3DGCR 4C56D 1T89C 4LHUG 3QSKB 2B1HH 4GAJH 3O41B 4LLVB 1QFUL 2BVPB 2DIJA 2W91A 4V1DE 4PJ8D 3IETA 5I1KL 4Z78B 4M1GL 3TBSB 3ZDZF 5E08L 5INDB 4QNPF 1LO5B 4H0GA 4YBQD 5AYUL 4WO4B 3O2VL 4RNRA 5CIPH 5MEQB 2FD6L 4X7FC 2EE9A 3MODL 3PP3H 1NAMB 1HHGB 3GM8A 4NO5A 4PB0L 4JO1L 2XRAL 1E4KA 5FM5O 3W9EB 3T0BA 1DQDH 4UINL 3LMJL 4YDLB 2HWZL 3T1FA 1J0HA 1J1OL 3VFRA 1J1XH 3JV4B 1XGPA 3LEVL 2NZ9D 2QEJA 4IJ3B 3VFOB 3WSQL 3QA3B 3CFKA 4QRSA 4PG9B 4UTAL 1RK1B 1PEWA 1HKLH 3LSOA 2NMSA 1HEZB 1U6AL 2CDGB 3S36H 1OAUH 1QZ1A 2IFFL 2J1KA 4MQ7A 4GAGL 1NCBH 4WUUA 1IM9D 5HGBB 3QIWC 2FX8H 4PUBH 4F3FA 4F9PA 5DYOB 3GSNH 3T1WA 5ITBL 3I9GL 3MYJA 2B0SH 2BY0A 1GGBL 1WZMA 3D3VB 5FM5M 4L29A 1MHPH 3STLB 1Q9LA 3LRGA 1F4HA 4JLRB 3DROB 1RSFA 2XY1A 4Y1AB 4RWHA 4LCIL 2C1PB 3GSWB 2AXFB 3MOAH 3LQAC 3LEYH 2H3NA 4ZNEA 3ROOB 5JZ7C 1DFBL 4ISVB 1A4JA 1EMTH 4P0DA 1NGWB 3MLVL 1T3FB 2OTWA 2YPKB 3TBTA 4CVXB 4PJ7A 5D6DC 1MHHA 5EDXA 4NNYB 1EMTL 3V52L 2AJ3B 4ONHB 4HXBH 1A14L 4UB0H 1KYOK 5BOZG 4PJBE 1QLEL 3TP4A 3O8XC 3PIQB 4PRDA 4I0KA 2CMRL 1OGAA 4FQJH 2KQNA 4NUJA 1VACA 3RGVB 4KZEH 1VFAB 5F8QC 3O3BA 1BVZA 1NDMA 2W1NA 4PJ5D 1T1ZA 1DLFH 4JRYD 1C5BL 4IJ3C 2LABA 3GSNL 1GOGA 4CADA 2I60L 4O2FA 2AEQL 3P9LA 3N85L 4HX1B 2O5XL 3CMGA 1D9KD 4GAFB 4ZFFA 1NDGA 1DJSA 4OV5A 3HE6D 3QZWB 1J5OH 1DSFH 4XXCC 3I6KA 3W9DB 4ENED 15C8H 3MV01 4ZFGH 1TJGL 4F9LA 4PJAA 4XCYB 4LU5L 4I77L 1GGIH 4J3VA 3U4BH 1A7BA 2MWCA 3RFZC 2VIRB 2WBKA 1Q38A 3ARQA 4N0FA 4WTWA 4U1IB 1WFOA 1Z3GL 2ZZUT 1I8MA 1KSRA 4JO4H 3WJJA 1IGTB 4NO0B 5AD0A 4D9RE 2ZUSA 3RKDD 4F33B 1OAYL 1GVIA 1WF5A 1TJHL 4FFVD 1AGEA 1E6JL 1MHPL 4U1SB 5DJCA 4IM8A 5ITFB 4AEFA 2EDKA 2UZIH 3W5NA 4G9DB 2VXUL 5I1KH 3ZKND 4EI5C 5IFJB 1A6ZB 1LO2H 2GIYA 4HS6B 4K07A 3WFHA 1V3KA 3LRHA 1DVFC 2F19L 3ETBF 3PJSA 1NCBL 1VADA 2JJSC 2APXA 4P46B 5BO1L 4PRAA 1WK0A 1Q94B 3VGEA 2ZUYA 4AG4H 3CC5B 4G8IB 3C60D 3DTXB 2YZ1A 4YHNA 3JWDC 1MI5D 4G5ZH 4DZ8B 5FKAB 3V0VB 4X6CE 4CMHC 3MRLA 1CE6A 4Y2DD 4PV9B 1CZ8H 4G7YH 1KELL 4N1CA 3RIAK 4JG1H 5KSVB 1D5BB 1U8JA 2P48B 3O4LB 3FFCE 2WLZA 5B38B 2IQAA 2VDQH 3FQRA 1JGUL 1WCQA 5IF0B 4CNIA 1NGZA 2PYED 5GSRB 3O2VH 5DD5L 3I6GA 4OLVH 2P4AB 4OGYH 3VXSA 4PG9A 3HRPA 2XQBH 1KGCE 3ARWA 4XP5H 4NRXB 4U0RC 3RBGA 5BQ7B 4JFQB 1JI2A 4IS6A 4XTRD 5MERB 1S5IH 1FE8L 1QPPA 3S34L 1U8PA 2Q7YB 4D9LH 4LCYA 4YAQA 4DAGH 4L8SA 5JLZA 1JGEA 1MCBA 1MCWM 2VB5A 4UAOC 3P3YA 4BSVB 3BXNB 2DI9A 4E42A 1I8LC 4UBDD 3VFGH 3WKNA 1XGUA 4S1QH 4ONFH 5EU7E 5ETUA 4MAUH 5EO9B 4MMZC 3VMPA 4JB9L 3CDYA 5JMRA 1FLRH 1Q9KA 3HB3D 4PGBA 2AXFA 4NBXB 1NKRA 4B0MM 1PZUB 3F7QA 5I76A 5C0BA 1ZHLA 1E4KC 3NCBB 3OKMA 4QY8A 1A7NL 1CE1L 3O0RL 3TBSA 4LKCA 2P8LA 4LSPH 2Q7NA 5DHVA 4ZFZA 4L4TE 4KVNL 2VDPL 3SPVA 3GBML 4XPGH 4M62H 1Q72H 4XNXH 5KSUA 1OF2A 1VCAA 3QI9D 4PRIE 1H3XA 4KPHH 1RUAH 2VDPH 3GMRA 4KI5F 3SQOL 2GTZA 4QYOB 1V7MH 2FBOJ 4YWGH 4OCMC 5I15H 1T22A 2CRIA 3ARFC 2EDLA 3MCLL 4IRJC 2MNUA 5BJTB 2ERJB 2DB8A 1EK3A 3O3BB 4TQEH 3K74B 3QXAB 3G5ZB 5I66A 1A3LL 1FL5A 3JV4A 1X4ZA 4FQXC 4PLJC 1RZJL 3BW9B 1SJXA 2R1WA 2DBLH 4G3YH 3PWLB 5IWLC 1TENA 3P9LB 1BF8A 4V1DB 4HX1A 2EZ0C 5DMJB 4V3DB 1T6VN 3O4OC 3CH1A 4OCSL 4S2SB 5HYSG 3PWJB 3T08A 2PKDA 2XWBB 2BY1A 2FWOA 5GRVK 2EIZB 4PJCE 4UTBL 1UC6A 3OGOE 1MCLA 4ODVL 4XVUD 3F6LA 1A7OH 3IKKA 3MRFB 4HKJB 1AP2B 3QUZD 3PGFH 4LLYA 3EIFA 2Z35A 2DS4A 1H3PH 4ZD3L 2A83A 2P5EE 5FV1L 2EKJA 4YHPA 4FQCH 3REVB 1BWWA 2NY7H 3N06B 2HFGL 2VLJB 1CDJA 2PCPB 2UYLA 1LILA 4N0YL 4GRLD 3EGSA 1A4JB 4HXAL 3SDCC 5EA0H 3SDAD 4HULB 4LFHG 3QDJE 5E8OA 3E0GA 4EXKA 2EIDA 1FPTH 3BN9D 5F1NA 4P2CG 1OT2A 3K1KC 1P5UA 2NY0B 3EYVA 1G7IA 4O2CB 5TGBA 5J3HD 2FJHB 3IFPB 4DCQB 1CGYA 4XWOC 3QBTB 5DUBB 4WCYL 4JDZA 4JANB 4JPIB 3FO1B 3GEWB 4MSWA 4EUPH 1INDL 1SYVA 5T1LA 4D3CH 2GT9B 3IDYC 5FKAA 4XPGL 2EKSA 1DEDA 2D31B 5F9OH 4MCYA 3WIIH 5AWNL 1P7KB 3HMXA 4PRHB 2R1XB 2NY5H 3E8UL 1BF2A 4R2GD 3MLSL 1D5BA 2UZIL 5J11B 4ZSOE 4OV5B 1DANT 3T65B 2J7LA 4CVZB 3DSFL 1FLRL 1EO8L 1CR9L 4LSTH 1EHNA 3LAFA 4ONFL 2EE2A 3HAEH 5ANMA 4YXHL 1WWCA 5CZKA 4DJMA 1UZ6E 2KQMA 5LGKA 1KULA 3ZE2F 3QO1B 5JA9A 2W07A 2RCSL 2J88L 2F53E 3EYFB 3P4OA 4JJ5A 4N8VB 1IQWL 4WTXA 4PJIE 5JOEA 2Q7YA 1MIML 2EDJA 3MRCB 1OPGH 3ZE0F 2OI9A 3KLAA 3RWCB 3VXRE 3ILPA 5I2IA 4LHJB 4QXUL 5FXCH 4NKMB 2A9ML 2XIDA 5GGVL 4OF0A 1C5BH 1CFSB 1WIPA 1BBJA 4NZUL 1F4YL 4DUVA 4QY8B 4PTUB 3SCMD 1T5XA 2JIXD 2CR3A 3PHOB 4Y16A 1WWWX 5D70L 3MNVA 4IHOA 1EX0A 1PQZB 3UJIL 3EYSL 4KVCL 2IPKB 4JFEE 4BUGA 3X11B 1AGDA 5IQ9B 4ODTH 4JY4B 4WEBH 5DC0A 1RULH 4HWZA 1RJZA 4Z7OE 2ADJA 2GSGB 5KVDL 1GGYA 3MV7D 2Q20A 3B6SB 3RY4A 1HK6A 3U7WL 3T4AA 1AY1H 1FL5B 1RU9H 1WFUA 4N90E 2GAZB 3T77A 2Y9RT 4TNVF 3TYGH 1RIVH 1E6JH 3QA3A 4L8SC 3STZB 4DGIL 3EFFB 4PY7B 2A9NH 4LPWA 4BH7B 1J10A 2WWMC 5KS9E 2NY1B 1WTLA 3CVHL 2CIKA 4IS6B 5MP6L 1RUKH 2GITB 1A6VL 3BZ4A 1G7QA 1FAIH 4PYGA 5C0AD 3RP1A 4OI9A 2BC4A 3EDDA 4OGZA 3MYJB 4QHKI 4I48B 4KFZC 2BJMH 2GQHA 1CIDA 3JVGA 2Q3ZA 1F58L 2DQCL 4Q6IC 3FQXA 4HCRA 2V9QA 1A4KA 2VLKB 3GUTB 4XNMB 1KG0A 3SKMB 1T0MA 4Z7OF 3OXSA 5F7DA 3WLWD 4GXUN 3I75B 3ULVH 5IMKA 4BFBD 1YEKL 2D9CA 4M7ZC 3UBXB 3MTRA 3EGSB 3CSYA 2AEQH 2D7NA 1RY7B 4W70A 1F11A 4MVBC 1MVFA 1CDBA 2R0LL 4NNYA 2BNQA 2LV4A 4Q9RH 1LD9A 4I0PC 5GS0C 2ZCKL 1RULL 4EN3C 3ULUC 3C87A 2AJVL 4P2OD 1IAKB 5ADOL 1MFCH 3HZMB 3BDYH 2Y4SA 4JVUA 1MVUA 4N0CD 4I1NB 1BLNB 4NC2B 5BJTA 3DXAA 2R0KL 7FABH 4OF3A 5CEXA 3BHBB 2J6EL 4BSJA 2BX5A 3D69A 2EE3A 5C9KA 5BRZA 2AJUL 1MHEA 2Z8VC 2XQYG 1UWEL 4XMLL 4FQLH 1IM3A 1S5HA 1YECL 5GGTL 1SMAA 4YFLF 3GMPA 2YD9A 4NBZB 1C1EL 2FEEI 4PJEE 3FONA 1QSVA 3F7PC 1PJ9A 5DD0H 1C7SA 1NMCC 1SJHB 2BVUA 1DUZA 2XWJB 1G9NL 1ZA6A 2B0SL 2DYPA 2W92A 4Y8DC 2PETA 3GMOA 3PUCA 4JR9L 1IQWH 4L8CA 3BQUB 4U1IA 4CW1A 5GZOC 3Q6FB 4UT6L 4YXLH 2IFFH 5DMGD 1KEML 3D48R 3CUPA 3G6JE 2DDQH 3WJLC 4X6FB 1NMCB 3U36A 4LCWA 1EHAA 4M5YH 1NCTA 3BP5B 2JB6B 4NKMA 3E3QE 2BSSB 3VXTB 1HOCA 5C2BH 1K8IA 1QBLL 1A1MA 1CF8H 2OLDA 4N8CH 1QSFE 2BY3A 1RIVL 1BFVH 5M7QA 3UTPD 4WW1A 5IIEB 5E2WL 3T3PE 5ILTH 3D25A 4X6EA 3HRZB 1FDLL 2X89A 2PYFA 2GT9A 1KCSL 4FQ2H 4BFIB 4HWUA 1EJOH 4LVOC 3KJ4B 1UJ3A 4D0DA 3WS3A 2OS7A 2YK1L 3V79C 2H9GB 3PL6C 3EJJX 3RA7L 3MZTA 5TF0A 1PLGH 1XGQB 3ULVF 4F7TB 1T2XA 3TGXA 3G6AB 2QHRL 3L3KA 3FJTA 4W81A 3RPKA 3HE7C 3MREA 3T65A 3QEQE 3LPWA 2BZDA 4X98A 1MLBB 3ULVC 1QFWI 1JF5A 4LCUB 5DI8A 4HIJA 1ORSA 5HDLA 5FFLA 1JHTA 5IB5B 3R4DA 4PRBA 1K4CB 5DUPL 5DWUL 3RWJB 3NACH 4UAOB 1J1PH 1MIEL 4AH2B 4OF6A 2H32H 3HUJF 1QYGH 2YXFA 5DVKA 3SKOA 2YWYA 1TLKA 1RV6X 1MIMH 2SEBB 3ARGB 1R5IB 3S3PA 3SQOH 5KJRL 1XCQA 2GK2A 1JGEB 4OFPA 4R26L 4OLZL 2C7UB 5I74B 1KIRB 1UGNA 1U8OA 1P1ZB 3KYAA 5CCKH 1PZ5B 3CFEB 3GKWL 3MUY1 3N9GL 3RUGB 1CFSA 3IFLH 3LQMA 4UILL 1JYNA 3HB3C 2XZAL 1YY9C 5JW5A 4ELME 3QUYA 3H3KA 4XBGB 2DIBA 2WIMA 1YEGL 2EDBA 4O51A 2C3WA 1VFOA 1IT9L 5BRZE 4TSCL 4P9HL 3SJVA 3F58H 5HVGB 3IRZA 2BFVH 1AGDB 2FEEL 1JIBA 2DQHL 4L4TD 4G8EA 1U3ZA 2GW5A 4GG6F 4JHWH 5BW7C 5D7IF 2R29L 4H88L 1R5WB 1T7ZA 4OLUH 3PNWB 4KUCF 5IB3A 3S3JA 4PRPA 3V7MA 3S96A 3BW9A 2GK0A 4KJQD 3UZEA 2VRAA 1MCEA 3V8CA 3UMTA 3U0TA 1OLLA 4V1DD 5ESVB 2VJXA 1LE5B 2HTLD 3O4LD 4HS3A 3MJ6A 2ADGB 5GS1A 3TT3H 1AO7E 3QIUD 5F1SA 2X09A 5EPMB 3VXUB 5KBNC 4PJDE 1ZGLB 1X7QB 4TSBH 1XF5A 5T1DL 1U3JA 1AP2A 1KJ3L 4MVBA 4OLXL 1F90H 1JV5B 4OBRA 3X12B 4UU9B 4ERSL 4YHYB 4XCCH 3ULUL 5CGYD 4U6XA 4K3JH 2ED7A 4JFFE 4NHCL 1XEDA 3VWKA 1GCFA 4JFZH 2ITDA 4X6FA 1I85C 3QDMB 1CU4H 1FC2D 1U8MA 4FNLH 3WE6A 2VDML 3AREC 3JWDL 5ALCH 3DUUA 5FO8A 4U3XA 2QJDA 1H3UA 5IROA 1V3JA 5GRYA 1HHGA 2B20A 3QUYD 1YNTB 1NFDA 1BVLA 3ZDXF 1YMMB 3C60C 4UNTA 1AGCA 5EU5A 4LLUB 3ZHDA 12E8H 3FZUC 5HDQL 2JCCF 1DBJH 5JW3H 1N0XL 1QFWL 2ADIB 2R9HC 1X3DA 1JK8A 3KYNA 3EDEA 5FA4A 4YBLC 3L3HB 1MJ8L 5T1KD 2DMKA 5HHVL 5GGQH 3VFUA 2VLRB 4KJYA 5AAMA 4K2UL 5EZJB 5SX5H 1JF1B 4KROB 1A9EB 2MPAL 5D7IB 4PBVC 4Y7MA 4LHUB 4YXLL 1U91B 4BK5A 3GI8H 4RMWA 1AIFA 4WVRA 1ZHNB 3IDXL 1I8IB 1L6XA 4F7MB 1J5OL 4KTEH 4UOW0 4DZBA 4UI2A 1AXIB 3ZL4H 5JW4M 1DANU 5L2KA 4MGXA 4OZIE 3CSPA 3INUH 5J6GA 2NPLX 4OF8A 5T5NF 2NY1C 1SYSA 2ITCB 4TSAL 3BEWA 1MAMH 3BPCB 4MJIB 3UYRL 4WI9A 4KZEL 4OGAD 4Q0XL 1Y0LA 3VFVB 2ZSVB 3ARGA 5D7SH 1IMHC 4PLOB 5CIPA 2JB5L 1RJCA 3EO9L 2R0KH 7FABL 4YHOH 4GXVH 4HH9A 4U6YB 2H26A 4NGHH 5F6IC 4B7LA 5IGXL 4LNVA 3BGMA 3U79A 2RAMA 4XMPL 5DTFB 3D5OF 2Z31C 1YN7B 3H7BA 1BFTA 1JP5A 2N7BA 4NCC2 3TVMD 2O5XH 4XRCA 4K94H 5IB4B 4X8JB 5E99H 2A73A 1FH5L 2DWEA 3HE7A 4JQIH 2VO5A 2NTFA 4OT1L 1QBBA 3QXTA 3MBEC 5TF1H 5DJXA 1K5NA 1HWHB 4JFFB 2AJZA 3ZKMD 5MEOB 4X6DB 5FYKL 2UV3A 2YN5A 4MMXC 1D5ZB 3QEUA 3U7AA 4D0CA 1KELH 1Q1JL 5DD6A 1MNUL 3TT1L 2CXGA 3HPJB 3GSNB 4R90L 2R4SH 5ITBH 5IFAL 3MRRB 4HLZH 4WI5A 5JHDB 5CD3B 1RMFH 1UCBL 1IM9A 4XP9H 1X4YA 4KQ3L 4L1DA 1I3RB 1TETL 1X5IA 4PJFE 4XNUH 5F70A 5HI3C 5ICXB 1GZPA 1MCHA 1JF6A 4QRSB 2QV2A 3LSOB 3VWKD 4ACPA 5CP7B 5A2LH 3CVHH 2Y06L 3IDUA 4YDIH 2YD6A 4WENB 1L0XA 3HI6H 5DVNA 1EXUA 4DEPB 3IU4H 5E00A 3DX7B 1X7QA 4G7VL 1IKNC 2BC4B 2DQFA 4YHZL 3IDGA 5EU6B 3UC0H 3EKCA 1XGTB 4AK1A 2VNCA 3MNWB 1SQ2N 1P7QD 3QYCA 4RGNB 1U8OB 4O58L 2DICA 1X5GA 1YA5A 2G60H 5INCB 3HHRB 1CD9B 1W0YT 4GBXC 5IVXA 1XR9B 5D7JA 4R0LB 5CJOH 4XBGA 2JK5B 5L9DL 2O61A 2E6PA 4LCCB 2FGWL 2IANE 1KLUB 2F74A 5TE7H 4CJ0A 2DJ4A 1XGYH 2VL5B 1A5FL 3LKPA 5IK3A 1TPXC 2OZ4A 25C8L 1W0WB 5GS3A 4KH2A 3TESA 3VXRA 2APBA 4Q9QL 1O5DT 1HNGA 1FVDB 2DLGA 2EDTA 3FQRB 5BS0B 1VFAA 4BM7A 3H3PH 5FA4B 5FHBH 4Z7QE 2CDFB 4PGJA 3L95B 4PGCB 2KUTA 4JFYB 4TPRL 4P23A 4MDJB 1MAJA 4NWTL 4PV8A 1OPGL 2I07A 3BKYH 3ARFA 2NY4D 3BT2H 3HG1A 4OUUB 3OPZL 1IM3B 1S5HB