3WUWA

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRTALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wuwA01
3GDBA 3QUYD 4U4BA 3VRJA 5I15L 2HMID 3TWCL 2F54D 3F65A 4KQ3H 4PRNB 4HF5H 4GXVL 5HJ3A 2V9RA 1PZUB 2X4SA 2EEBA 2YPKB 4NZUL 2Z91B 1U3HB 4LLWA 1SYVB 4JZNB 3UTZB 2DIJA 3VD4A 3P9LB 1EJOH 4F37F 5F6IB 4TUKL 1PG7X 1JZ4A 1H3XA 4GRLC 1F58H 1F97A 2OX5A 2RCSL 2Z93A 1OAQL 5SWQA 2QADC 1GYAA 2OI9A 1DBBH 2R23A 3FT2B 5E00B 5C0GA 4OZIE 1F4YL 3EYUL 4JY5L 4ODTL 1U8KA 1G7IA 4FQJH 5I8KL 4OFDA 5FYLL 2PYEA 3HC4H 3OGCB 4HC1L 2AJ3B 5DRWA 3LRSB 1S7QA 2BMKA 3GMRB 4KU1A 4MHHI 3VMOA 4KAQH 4Z95L 1D6VL 3VDBA 1I3RA 1NEZB 4WFGD 1CFTB 4CJ0A 4UT6H 5D7JD 3ARFA 4N1HB 3M07A 2MQ3A 5EZOL 2VSDA 4CADA 1PX3A 5FYKH 1INQB 3JVGA 3OZ9L 3CMGA 3GUTB 5D5MF 5T5FH 5EO0B 2F5AH 1T66C 5CIPA 4QRSA 1D9KC 3TBVB 3PXHA 3QI9B 3BGMA 4HH8A 2V2WB 4R96B 2Z35B 3AS2A 2VIRB 3BMWA 3CSGA 3I3EA 2CLRB 2W91A 3VFUA 1MWAH 3QJHA 4PJ5E 3DWTA 3LD8B 1N6QL 5DEFB 3BKML 3LKPA 1IZJA 3V5KB 4BZ2L 1DQLL 4O2CA 4YHKL 3BWAA 3QQ9D 3TT1H 5C09A 1OM3H 3RA7H 1TQCC 4P2QD 4GUPA 3NFSH 2VR4A 1BVKA 3PGDB 1KXVC 4DAGH 2VZTA 1N59A 4G3YL 3HR5B 3V7MA 3NPZB 1IC4H 1KCUH 1HEZB 1WISA 4TSAH 4I9WD 3VDAA 5I66B 3FONB 3FTGB 3KPNA 5J57B 1S7XA 4QRSB 4Z5RB 1YC7A 3BKMH 4JZJB 4BZ2H 4EUPG 2QHRH 5E6ID 1ADQH 1I8LA 4X7FC 4Q9QL 4NHCH 3LIZL 4DN4L 3UZEA 1DCLA 1PGRB 4UMGA 1NC2A 3OJVC 2R1WA 4BKLA 1D5ZA 5L2JA 3M8OL 4XB8A 5LCVH 5TDPA 2CGRH 3MV8A 5EO1A 2Q8AL 4R9HA 4XCYA 1H3PL 1ND0B 3K2UH 5HHMA 1I9RH 1ONQA 1HXMA 1C5CH 3WIHA 1JZ5A 4OLYH 3L95A 1H3UA 1T1YA 3KS0H 1MHHA 5T1KD 4UNTA 5F9JA 4IS6B 1T3FB 4MQ7A 5JW4Q 4AH2B 3HC4L 2EICA 1UJ3A 4UILL 2HT4C 4JY5H 4WWKC 5D7IA 5CZKA 2XRAH 4JHZA 3TYGH 2HVKB 3DIFB 3ZDYF 1ZT4A 5IHZB 4BUGA 5DGQA 5TPWL 4WFED 3F7VA 4F57H 2J8OA 5IW6A 4XNMA 3S37L 4EVNB 1HH6B 4J3VA 1S9VB 4Y4FD 4OGAD 1BGXL 1U91B 1AY1L 1D6EB 4M1DH 3NZHL 3V6OA 2JB5H 4G9DB 4XAWL 3IFLH 4J1UA 5D7JA 4OIBA 2H8PB 1S7SA 2EH8H 4EI5B 2VZ3A 3MLUH 2WUBL 5D5MB 2NMSA 2Y5TA 3TPUE 3IFLL 4Y89A 5KSUB 1CTNA 5GZNC 2BJML 1CGSH 5E08H 2LAGB 4FFVD 3GBLA 4NJAL 2F53B 1NKRA 5GJTL 4RISL 3S36L 4M7ZB 3MLWH 5IJVA 3VXRE 4KI5C 5MENE 4G9FB 4N8CH 1ZWIA 3AY4A 4LK4A 2BVTA 4Y4KD 5C92A 2O5XH 2ENSA 3MRNA 2WUCH 1MAMH 1SBSH 1AP2A 4NCDA 5IB1B 3QEGH 4NSKB 2DWDA 4QYOB 3MBXL 3ZDXF 5IVXE 4TVPH 3S8WA 3LMJH 4PJXE 1IT9L 2FO1A 1NKOA 1QQDA 4PRNA 3WN5B 3K0WA 4AM0B 5BV7L 4R4BB 4ODHH 4KPHL 4KJQD 4G7YH 4TNWF 5LVEA 1HQRB 4PJBB 3P30L 1MHCA 4HUNB 4F7MB 3S5LG 4U6YA 3SJVA 3WHE1 3T3PE 4MLSA 1J05A 4LP5A 1I1CA 4YPGA 5IGXH 2RBLA 4CADB 4MA8L 1D9KA 3WO3B 4QLRA 4HLJA 4N9GA 2EDQA 1CICB 4HV8A 2H3NB 4WW2F 3MUY1 1QFWI 5GRWA 1T0NB 4G7YL 4H88H 4F7TB 4WV1C 4N90D 2VH5L 5DQ9B 1FZMA 4PBVC 1WC7B 5J7CC 4G7VL 4C54A 3T08A 4Z7WB 2VR9A 4I2XA 2VXSH 1IEAB 4NQXB 2K7PA 3E6HB 4TTDD 4NM8L 4PV8A 4LPUA 5FA4A 1MFAH 3PQYE 1PFCA 3IGAB 3QP3A 1LP9B 1JPST 1UACL 4FFYH 1G9NH 4HXAH 2PETA 2YK1H 1FIGL 4LLWB 4NFDA 1QFWL 5J1AA 1G7QA 2CDGB 2FBOJ 4HIHA 4HDIB 4NQEE 5IBUG 4JFDD 1DANT 3KYMB 3NCBB 2XNAA 1K85A 3VGEA 5KSVA 5T1MA 1BAFL 1UB5A 4K23L 3BEVA 1FL3A 3BO8B 4Z95H 1FSKB 1AGFA 2X40A 2C3VB 5IB4B 4OM1H 4XCEB 1J1OL 4XVUC 3VXUB 5LAXA 1U8KB 1MHHB 1BOYA 1XGQB 1NCAH 3D25A 3T2NH 2XTLA 3WJJC 2Y6SC 3I75A 4LSRL 3VXPA 1ROWA 3L3HA 3PDDA 4JO1L 4EI5D 3CLEH 3PDGA 3RTQD 4OLZH 1NAKL 4YXHL 3P2TA 1MFCL 3C5JB 1GOHA 1S7TA 1UWGH 3G9AB 4QHKJ 1N2RB 3BP6B 3ZKND 4OCLC 1DBAH 3QXAA 3LIZH 1TTGA 3H7LA 2B2XH 3BMVA 4LGPB 1J1OH 1JN6B 1Y18B 2VDLL 4XCCL 1G0XA 3P0YL 5CD5C 1I1FB 5IMMB 1MFEL 4LLVB 4NHUE 2FIRT 1AHWC 3VXNA 1WITA 3ARBB 3DVNB 2Q87A 2XT1B 4RGND 3D39D 4DK3A 2ICES 2D7QA 1UCBH 2ADJA 2X9YA 3SJVD 2PYEB 1SJVA 2PR4H 4I18C 1NUGA 3T0ED 3EDKA 1T6VN 2EH7H 3HRPA 4EDXB 4L8DA 4Z7UB 3RDTD 3ZL4H 5LXGH 4LSUH 2WK2A 3SGEI 4X6EB 5GHWH 1I8MA 2FHBA 5E94B 2VH5H 5JW5A 3NBNA 4DN4H 4TNWK 3WNLA 3OAZH 1UXWB 4CAGA 5KW9H 2YBRB 4N0CA 1U42A 3VA2C 3IDYC 3RVTD 4DTGH 4Y4KC 5CD3A 4PJ9D 1PKQB 4XNQB 3IS0X 1A6ZB 3UTPE 4Y7MA 2XN9A 3BGMB 4NM8H 1I8KB 1WIUA 3K1DA 5E5MA 5FECA 1KYOJ 3E8UH 3WJJA 4N0FA 3SE4A 4OV5B 5DK2A 3V5DA 5D2LB 3OV6A 4PJEF 4JY4B 1T1ZA 2GJZB 1FP5A 1GGIL 3VXUE 3VJ6B 1JVKA 2VISA 5I75B 2PXYA 4H88L 5FO7B 2D4FA 5D72H 1SHMA 3V4UL 2KH2B 4JVWA 4YDJA 3EGSA 3ZYJA 3VW3H 4YXKL 3ARZA 3GHEL 2XWTB 3QYCA 4MAUL 3H6JA 4EQ2A 1JTPA 3ZSTA 4PREB 5HHXH 5FK9B 5I8CB 2CKBB 3JTTA 3QUMA 4UV4H 3LPWA 3BP7B 3SCMB 1LO4L 2KL6A 4K94L 3LD8C 4L29B 3U1SL 3C60A 3EYVB 4RX4A 4PJ7E 1TMCB 2AEPL 2VDRL 4P59H 1K4CB 4XMPL 3GI9H 1E28B 1XH3A 1EDQA 4N8CL 2HFGH 4WY7L 1JNNH 3IDIA 3VWJB 2VISB 5T1KB 4NQDB 5JOEA 1ETZB 4UB0H 4W6YB 4YDVB 4ESKA 3RNKA 4DN3L 4EEEA 3PWPE 3RUGE 1Y0LB 7CGTA 1FNSL 3LQZA 5F7DA 1S5IH 4DWHA 3EJZD 2FX7H 2WWMD 3UDWA 4DVRH 1T0MB 1JZ6A 1EAJA 5CFHA 4DGVH 4N5EC 1PLGL 3C09B 1TZGH 2AJVH 1WWBX 4N8PA 5DVNA 3WSQL 1LE5B 2C3WA 8CGTA 3ZTJG 1L7TL 3BD3A 3HPLA 2A1WH 4X98A 3KJ6L 4LNRA 1FG2A 1VEMA 1J5OL 1QVOB 3I02A 5HY9B 1QYGH 4PJDF 3OKYA 5IT2H 1SEBA 3PV6B 4R7DB 3PXJA 3HCVA 3F8UB 4ELMF 4ZUSB 3S34H 5K9QG 4KQ3L 2BNUB 3DI3B 4M6ML 5HXMA 1J1XH 4UT7H 4X4ZA 4GW5B 5DJYA 5T1LD 4I2XB 3KYOA 1DSFL 4U6TA 3MXVL 3OR6B 4NHUA 4KQ4L 2F54A 3UBXB 4X4MA 2YD6A 1NLBH 4Y19B 4LCCA 4AT6B 2AKRA 5I1IH 3BX7C 1NCNA 4F9PC 2OP4L 2C1PA 4PJ9A 1QLFA 5LBSL 4KZEL 5A43C 1CK0H 3HE7C 5IBUB 1FCCA 3RWEB 4IMKA 5JHDE 1JV5B 4D9LL 5DD6B 3L7EA 4JZJC 4HJJH 5F7MC 4G59A 1X5HA 3B5TA 1INEH 3CU1A 5DHVH 3QDGB 4LEXL 4HIHB 1A3RH 4YE4H 4M9OA 1K8DB 4DUXA 3SY0B 5TJWK 5BJTA 3Q5TA 4GW4A 4U49A 1U3JA 1YUHB 4Y1AE 1AE6L 3GSQA 4JLRB 4J3WA 5GSVB 15C8L 4U1KA 2IGFH 1KN2H 2X4QB 3BQUB 1UA6H 2QR0A 1BOGB 5F9OH 4KRPD 4PRID 3H3PL 3MRCB 3GIVB 1I3UA 2UY6A 3VGAB 4G80B 5CEZE 5KBNC 4TUJA 4U6VH 4Y4HC 2BVOB 4ZOEA 4Z7WA 2HG5B 5IBTH 2CIIB 5LWYL 5GS1C 3VXMD 1M71A 2VC2L 1CDBA 1S7TB 4OFYD 5I0ZA 1X5GA 3G5VA 3O3EA 3RIFK 4CN4A 4C4KO 1YNTA 3UXFA 5D2NC 1XF3B 3LEYL 1LWRA 3SJVE 2ARJA 4JO4L 4UI2A 4KK9C 1NGQL 1FFPB 2FECI 2AJZA 5FUZH 5GGSY 3D1MC 1INDH 4CNIA 5DFTA 1B4JL 3O6FB 4AT6A 5EFIB 1LP9E 3TVMB 3C8KB 4Z7NF 4YQXH 1B6DA 5FUZL 4Y0GA 2LVCA 1I7UA 4WI7A 2GAZA 4J3UA 5B38G 1B0GB 4LSQL 4L3CA 3FO0H 4DCQA 3I9GL 3BEVB 3OJ2C 2WIMA 1T2QH 2CUHA 1A7RH 1R3KA 3CK0H 4P48A 4V2BA 4YHIB 5F6IC 4H26A 2EE2A 4P3CL 1RVFL 1BIIB 2B1HH 2BNQA 1OCWL 1SBSL 5JQ6H 3S3SA 1ZV5A 4MNGA 5HDQH 1ZT7B 5ILTL 3C2SA 3QUXB 4A6YH 2D03L 4C57C 2C26A 1HH9A 5HHPA 1JWSA 3KYNA 4ZFZB 4CMHB 1Q0XL 1T89A 1RIUH 1YECH 3F5WB 2BVQA 3K4DA 5GGQL 3VFVA 5CEZD 1NMCB 4JFDE 4ODHL 4FA8A 4Q9RH 2NY3D 2J2ZA 1MCOH 4KJYA 3ARPA 1KTDA 1T6WA 2NXZD 4PJIE 2MTPA 1A02N 3CUPB 2HVJB 2V6HA 2R0KH 3EO0B 4NC2B 1ZVSB 1T20A 4TUKH 5EH1A 1DUYA 4FQ1H 2HT2C 3EOAB 3JXAA 1AFVH 1QLEH 4NBZB 3AREA 3G6JB 1QFWH 4E42B 3C60B 3EYVA 5TDPB 3WUZA 4LVOC 3DMMA 1IGJB 5EUKA 1NC4A 4J3XA 3TH3T 1KIPA 3WLWC 1ZEAH 1O0VA 2YHGA 4DGVL 3VU2A 4X80L 1Q0YL 3MUGB 4PRHE 2M26A 1MIEL 4MYWB 2B1AL 4EUPA 4F2MB 2R29H 1QLRA 4KY1L 3SJVB 1G0DA 1N0XH 1XIWC 2VJXA 3DVNA 5KANG 4R90L 1G9ML 1DR9A 5EZLA 2CO7B 5ALBL 1NJ9B 1PG7L 2EXWD 3H9SB 3ARBD 1U6AH 1P4IL 4LCCC 1D5MA 3D3VE 1T1XB 4N0YL 3ULUH 3HPJB 4YNYB 4ZOCA 4IS6A 4OLUL 4LKCB 2JB6B 2P5WD 1UWXK 1CDJA 1JGEA 4PRPD 1Z3GL 5E6IB 3JWNC 4U1SB 2E6QA 1L7IH 3MV01 3U4AA 5J6HA 2AK4B 3C2AH 2J1KA 1FPTL 4DVBA 4PLJC 3HN3A 2CMRL 5I1GH 4L9DA 3D85A 5I1DA 3HUJF 2FX7L 3QEHA 3RWIB 4CW1A 1YNKH 1OAXH 35C8H 1YDPA 4NWTL 1KB5L 3DX9B 4OD1L 4JREC 1G7PA 3OR7A 4PB0L 2GJ6A 2P5ED 3DSFL 1ZS8B 3TBVA 1CT8B 4NO2B 5BVJA 3V8OA 3WHE0 4JREB 1FH5H 4KH2A 4RWYH 3S7GA 4PY8J 2CR3A 2XZAL 3LV3B 1OP5K 2XA3A 1BQHA 1PY4A 1R5WB 3PIQB 4FQXB 4X6BA 1LO5B 3UYRH 5J9PB 1JYWA 3HAEG 3MOAH 3N1GC 1H3PH 4OZGA 4YC2B 3D18A 5MP6L 1H3VA 2RHEA 3MRKB 1RD6A 5LCVL 1BX2A 3M8OH 4K7FA 1JPGA 2ZG1A 3Q3GB 2AXFA 4YZFF 2P47B 1XR8B 1KJMA 1HZHL 1I85A 5D7LB 3NIDE 5I18H 2IBBA 2ZCHL 2HMIC 3JTCA 5KG9A 3QNXA 3ARWA 3MLZL 5L8JB 4HJGA 2DQHH 3DURB 4FFEX 1NUDA 1KNOB 4B0MM 2W92A 5JW4N 1U9KA 1MI5E 1CIUA 4RQQA 1F6LL 1XR9B 5LGKA 1NFIB 3PWLA 4U6HB 1CGSL 4NZTH 1FYHB 4MDIA 2HRPL 1ZTXH 4XPBH 3IJYB 1K2DA 2DQCH 4Y5YB 4GKNA 1RZKL 3E6FA 3I50H 4GUPB 3TP4A 1L9MA 5GZOC 4KI5E 4Z7QF 3QPXL 3RWFB 1BZ7A 5C0IA 2NY2C 4KTDH 4XHJD 4JFDA 3RTQB 5F9AC 3QG7H 1OTTD 2VDKL 3KYOB 1CICD 4ODTH 3DXAA 1ED3A 4WHYH 2CDFB 3ARDD 4OKVB 4LASH 1HINH 2XOTA 3WS6A 3QFJB 5CGYC 2X42A 3HI1B 3P77A 4XRCB 2IG2H 2AJZB 3RWEA 4ZFGH 1FVEB 2X4TB 2J8UA 4XNYL 5FOBB 4X7SH 1A0QL 1NGPH 4HWEL 4AMKH 3DX8B 2EE3A 4JFOB 2HJKA 2X4NB 3BPLB 3CFIC 4DVRL 5DS8A 2FD6L 4XNYH 4HIIB 1CL7I 1S5IL 4XP4L 1H0DA 3BGFB 3BPNB 2HKHL 1DBAL 3RAJL 5DVMA 1RSFA 3SEPA 4Z7VE 4WUKH 3ULVC 1CIDA 4OBSA 1V8HA 3IRZA 3W5NA 2FHCA 4WHTA 4QOKB 4LCWB 2GJ6D 2P5EA 4I9WE 2VLRD 4YHYB 1ERNA 4RAVB 2NZ9D 2A1WL 1D5IH 3RVVD 3SDXE 2I25N 2YOCA 4P4RB 2CKBL 3EO9L 1KBGH 4IRJC 4G6ML 1MJ7H 4LMQE 5FDWB 1BZ7B 4JFYB 4HUWA 2DKSA 5BS0B 5F1SA 3QIUD 2IALB 5DDHA 1AC6A 5F88A 5CCKL 2XICA 1A6AB 2VXTH 1UZ8A 3OKKB 4BZYA 3NA9H 1LQSR 3C5SA 1HI6B 2H6PA 5HHVH 2NTFB 3BN9D 3EYOA 4OJFH 5E1AA 1AD0A 4V1DB 5E8DH 4Y4HB 3DYPA 1SYSB 4WW1B 4LFHG 5DK3A 5I1DB 2HWZL 2MPAL 2I27N 2GCYB 2J8UB 4S0UC 3QNXB 1NDGB 4JFOA 4FNLH 5INDB 1EUTA 5CJQL 4JQVA 3L3OB 2DD8L 3WL9A 2XWJB 3GSVB 1MWAB 1RZ7H 4M7LT 2YC1A 4K3GA 2PKDA 1OTTC 4M5ZH 1H8NA 5IMOA 1FAIH 2BNRE 4R4ND 2C3VA 4HQQH 1RQ5A 3TBWB 1B88A 1WK0A 3I3DA 3RIAK 4R90H 1EEZA 5I8EB 5DJ6B 4DKFL 1V3LA 4LAJH 3VXSA 4PGCB 4JJ5A 4X6BB 2XZCH 2JCCF 2OYPA 2R29L 3HRZA 4CU7A 1VKXB 2DKMA 5E8NB 1FFOA 3GSUA 1T7XA 3VFTB 2R23B 1G7MA 5E5MB 3MRBA 2B39A 3D2UA 4UT9H 5C0NC 1N8ZA 3LKQB 1G9EA 3MLYH 2DICA 5BMFH 2UYLA 4NJAH 3AUVA 3PP3H 4GQ9L 3VXQB 4MDIB 1EMTL 1BZ9B 1YPZA 3MRGB 4E41B 4EKXA 3S98A 4IBLT 5E2VH 2ZUVA 3MRFA 3HAEB 5ERWB 1S3KL 4PTUA 1DZBA 4XCNB 2QSCL 2ZPKL 4KDTC 2YPKA 1WC7A 3AXLB 5DS8B 1CXFA 4PG9A 2XWTA 3QCUL 4W6XB 3TPKA 3NCYS 5C9JB 3O3AB 2NY4D 4ENEC 4XNZC 3B3IB 4R2GB 3AAZA 3ZTNL 1CD1A 1T2JA 4HGWA 1RZFH 1NMBH 1KJ2H 3O3DB 1V05A 2BFVL 2A77H 4I3RH 5GS0C 3GBNL 2YZ8A 3DX7B 1UZ6F 3FQUA 4FQQB 5CINL 4WI2A 3SDDA 4FRWA 2JJTC 4YEEA 4FQ2L 1UB6A 2L7UA 4Y5VB 1I1AB 4P5TD 3IDXH 2OTUB 3BUYA 4UILH 3S3PA 1CLOH 1I7TB 3LRSA 4O2FA 5TE7H 1AKJB 4CW1B 1JF5A 2DMBA 3HLAA 3HUJA 3TZVD 1VFAB 2A77L 1MH5B 4I48B 4XVJL 3KLSA 5EC2B 4IOFC 5J56B 4QY8B 4XT1C 3MLVL 1L4IA 3D87B 1PG7W 1RMFL 5EU6E 2G9HB 2XQBL 3GMPB 5HHOE 3EIFA 4YIQA 5E4IA 4A6YL 1F2XK 3RHWF 1C5BH 3FCTA 5HDQL 3BW9B 1FNGB 3RP1A 1AGDA 4NWUH 3R0MA 3VH8G 4HEME 4W4OA 2FATL 4OLXL 3MRLB 4X6CE 1SEBB 3EW3B 4OZGF 4G8EB 4GBXC 1CN4A 1MCFA 3H9HB 4DKDC 1T22A 1FGVL 4GRLD 4MB3A 1B3JA 3T3PF 3O4LE 3QDME 3V95A 1LD9A 5J0BA 3D48R 4M5YH 1IFHL 1RUAH 1DBJL 4DAGL 2NY5C 4QHNA 4X9FA 1ODAA 5GS0H 1YEGL 2C1OB 1R5VA 5AG9A 5KZCB 1XGRA 3SGKA 2XV6B 3ISWA 1RUAL 1F3DH 3MJ8B 1DLFH 1FNFA 1XIWD 1D3CA 2XKSA 3H3KA 4K9EH 2KUTA 2WP3O 3BD4A 3RIAF 3RGVD 3DO3A 3MRLA 5GGUB 1NBZB 1F90H 3UPRA 3TFKA 4PGBB 1RURH 5IB3A 2WWMC 3GK8L 5A40E 1FNLA 2FBJH 4HK3N 5D4QA 3TPUA 2D31A 3B9KC 4MA8H 5HYSB 2YD3A 3GB7B 2OTWB 3GO1H 5EZJB 4U1JB 1GHFH 3FFCD 5FYJU 5KVGH 5DMGD 1V3JA 5I1IL 4QXTB 3NFSL 5HVWA 3QFDB 5BW7A 4YR6B 4HUVA 4QOKE 4E41D 4PJ8B 5E8NA 2K1MA 5FV1L 1MCLA 3QUMH 3MRRA 1JNLL 3MRCA 3CFBA 1YQ2A 4K7PL 3QCTL 1L8JA 2WBJA 5DJ6A 3FQRB 3BH8B 4BFEA 2ZUUA 4PJ5D 5AZEL 5SWZA 3MA7B 2CO6B 2ZSVB 4X99A 5KSBB 3ILQC 4WUUB 1J86A 3QQ3B 5C70A 4NO0A 4CU8A 1FFPA 4HUUB 5H2BB 5GGQH 4M7LH 1UM5H 4KI5F 5I6XC 2VABA 4PJEA 4TN9A 3W82A 4JFFB 4TOYL 2MHAA 5EFIA 2EDKA 3FOLA 3EHBC 1IKNC 1U8QB 4ELKA 4I1NB 1TQCB 1QSEB 3W39B 1JMXA 1ZHLB 4APQA 4UIKL 3UDWC 3ARBC 5ERWA 1DVFA 1HXYA 2X4NA 2EKJA 3AGVA 3QZWA 5AYUL 4JQIH 1EUUA 4O2CB 5KVDL 1JGLH 5ICYB 5HGDB 1KGCE 5IHBA 1HQRA 1Z9LA 2VSCA 3OTTA 3PP4H 5EBMB 4BUHA 2ICEA 1N7ML 1WBXB 3WE6A 2MNUA 3LN5B 1XCTB 2OSLA 5JXAL 3ARGD 3U7WH 1UQSA 4Z0XB 3SDAC 4DZ8A 1NFDA 5C2BH 3SPVB 2R2EA 4JKPH 1G6RB 2KKQA 1S9WA 3MUJA 5CJOL 4GKOA 4UV4L 4OTXH 4JO2L 2I26N 5EUOF 2DLIA 1PX4A 2LQRA 4Z78A 2EO1A 4IIQA 4AEEA 1DDHA 3EFDL 3GK8H 5IR1B 5TDOA 1Q94A 4TNVF 2Y36H 5JORA 4ZPTA 2F54E 3WDHA 1GGCL 3QPXH 3H3BC 3VFPA 5SWZD 3EAKA 3EOAA 1KTDB 2XN9E 1I1RA 1REIA 1UG9A 3OR6A 2VTFA 3NACL 3MRJA 5DJDA 4R0LC 4EI6B 2Y5TB 4PJAA 1YEGH 3D0VB 1F4XL 4X8XA 4JJHA 3KNBB 3ZYZA 5JR1H 4UZGA 1MRDL 3B8YA 3NABH 3ZKMC 2FGZA 2LV4A 5D6CB 2CRMA 3T09A 4U7MA 5CGTA 2IQAB 4CVZA 5FCUH 3R1GL 5J4MA 3DJ9A 3GEWB 3KLAA 3VGFA 4JPKL 1GC1H 1HH6A 2QSTA 2YD8A 3MLXL 4PJFE 2X89A 5GRZA 3WFCL 2QSVA 4QXTA 1GAFL 3GKWH 5LWYH 4MNGE 3OBAA 3T1FA 2UY7A 4UNUA 5FM4A 4LSSL 3S35H 3NABL 4PG2A 1P7QA 3EZ8A 4XP4H 4DEPB 4WFFE 3W2DH 1ZVSA 3G6JF 4PBWD 2XYCA 4L4VA 3KNBA 1UCTA 1XCQB 3UPRB 3MRIB 3BEWB 1XEDA 3QDAA 2H1PH 3EDJA 4O00A 1RZGA 3DUUA 4OM0H 5FB8A 4AG4H 2BRRL 3PWJB 3MACH 2CKBH 1OAZH 3ABZA 1U8IA 1NCBH 3TO4C 5CBAB 1T2XA 4PRDA 5MENA 2IJ0C 1JHKL 2W0FA 4NCC1 1YYLH 1J8KA 1W8NA 4OD2A 4P4KA 3MV9E 1CFSB 5ICXA 1INEL 5C0BD 4PLNC 4NKOA 2OJEB 1FNEB 5IVNA 3OWEA 2IPKB 4PGEB 5CJOH 1IGFL 1DEEA 5J6GB 3EYQC 4JKPL 3BH9A 1GZQA 2A0LD 4YJZL 2DYPD 2DLHA 3BH8A 4M6OL 3RFZC 2R4SH 2FSEB 4KHTH 4N8VG 4C56E 4JRXE 2AAVA 3FQTB 2LU7A 3FFDA 4ZUTA 4H25A 4WTXA 3KYKL 4L3CB 4L8BB 2R0ZL 4D0BB 5EIIA 4FQJL 3K4AA 1KENH 4Y2DB 5GZOD 1JZ8A 2B1AH 3IXTA 3AS3A 4X5XA 3WKML 2HA1A 5FO9B 3QWRA 1LK3L 1ZLUK 2XPGA 2P24B 1KB9K 3D0LB 2DQGL 2DOCA 2EKSA 1FNEA 3KPRD 4H20H 1TETL 1VDGA 1BEYL 2B5IB 1U8NA 4P9HC 4AJ0A 4NZJA 4Q7DA 1JCKA 1N5AA 5D2NB 3IDMB 3QUKA 1AFVL 4GAYA 1BD2A 1PQZA 5ADOH 5E1HB 4Y5YA 5JUEH 1VHPA 1XGYL 2AXGA 2FRGP 3QWOA 4L8DB 2GCYA 4O9HH 5KSVB 1WVZA 3GSOB 4OI9A 5HYSG 3LH2H 1A64A 1MCQA 1VPOL 5GRYA 2F58H 4FQPA 1NMAH 1QZ1A 2BY3A 2DIBA 2DWEB 4LPWA 1IGCH 4F8TA 4QHNB 1A3QA 4WCYL 4YXLH 4FQXD 4JAMA 3IDNB 3SDXA 3DUSB 4RGOH 4XPTH 3O11B 4X5LA 3MMEA 2YPLB 1RIHH 5B3NA 1IKFL 3O6KL 4CVXA 4YEFA 2OK0L 1WTLA 3BZDA 4ISVA 5SWZE 2H2SC 4R7NB 4GMSL 4JGJA 1N2RA 1MRDH 2D03H 4NQVA 4KUZL 3IFNL 1NAML 3MO1B 5MP6H 4KKBC 1UWXH 2ITDA 5IHUH 2VXSL 1OGAB 3CXHK 4BSJA 1VACA 3TPUB 2FNBA 2JELH 1R0AL 1X4XA 2NZIA 4P2YA 4OFIA 4HGMA 4JRWA 2DQUL 5F1IA 5IWLC 5IVZA 2BDNL 2HN7B 3TVMD 5L88H 1XCQA 5HDLA 4MWFA 3DSFH 4ACPA 1IL1B 3CFCH 4LOUD 1P84K 1U8HA 1DANU 4ONGL 4X9HA 4XCEA 3LKRA 3ULVL 2JJUA 1T7ZA 3GM0A 1AO7A 3EYSH 4AIZB 1S9KC 4QF1B 4DJMA 1BP3B 1MHCB 1QVOA 3I02B 3O81A 5JXAH 1ZLWK 3QSKB 4JFZL 4MD0A 4XP1L 3RL2A 1MLBA 3MJ9A 4Y8AA 3RZWA 5A16A 1GGYA 1JNJA 1V5JA 4PG2C 3LN4B 1OP9A 4O51A 2QKIB 4Z7OE 1IAOB 3ELAT 3OQ3B 3RQ3A 4LVOB 2O5ZH 3W0WD 2YPLA 2FZ3A 3RVUC 3HHRB 4KK8C 4RMQA 3T2NL 4XNXL 3OAUL 4O5LH 4M1DL 1LNUA 3ZLQC 1U3HC 1OT1A 2VZOA 2UVFA 1RULL 1JGUL 3S37H 5MERB 2EE9A 4JRXA 5E6YA 3IDJB 5L2KB 4QKXB 1VPOH 3L7EB 3BQUC 2R0LH 4NKOB 1M7IB 4PD4K 2GHWB 4WO4A 1M6OA 3MCKB 1KJMB 5M7QA 4G8GD 2A6KA 1K3ZA 5KVFL 4XB7A 1Q38A 1U8NB 1WWWX 1YEJH 4OIAA 2EO9A 2HLAB 5DT1L 2A9MH 4MQTB 4NHUB 4HJ0D 1XGTA 2R0LL 4PGZA 3B5HA 3VFRB 4I3RL 3BFOA 3N1MC 3U9PL 3STLB 4JPWL 1NGZA 1FL5A 2VQ1A 3VG0H 4URTB 5F1OB 4N1CA 2DQTH 3BKCH 3OB8A 2A0LC 4O4YL 3GMRA 1IGIL 3QIUB 3KXFD 4XPHL 2I60H 2VLJA 2ZNWA 4HZLA 4JPIA 4H0GA 1MPAL 1S5HA 2AV7B 2DQFA 2HRPH 4OQTL 4GKSA 1XGPA 2VL5A 5BJTB 2B1HL 1BM3H 3KPTA 1EHAA 4HBQA 4KDWA 4Y8DC 3DO7B 1XF4A 4HAGA 5DF0A 4WWID 3KJ6H 5D2NA 4ZQKB 2I07B 3MRGA 3SE9H 1NANI 3QIBA 1RUKL 3SE3A 3QDJE 2RFXB 4XVUD 5IMKA 4RAUB 4HX1A 1UH4A 1J1PH 2CXKA 3QIWC 1A6UL 4I8DA 4RNRB 4U2ZA 3D39A 4JRXB 4KK6C 3U0TB 3WIIL 1AD9B 5D71H 1FGNH 3IDIB 1I1YB 1S9YB 4YHOH 5FIEA 4NN6C 3C6LD 4KGJA 1A2YB 3GHBH 1OLLA 2Q8BH 4BH7A 2VQTA 4OZFA 1YNTB 4G43A 5C0BE 1EBPA 1FAIL 2AEQH 3RDTA 1OSZA 1CFBA 5H37G 3WNKA 2FJHA 1MRCH 6FABL 3DO7A 3IF1A 1HHGA 2XIDA 4R26H 3QUYA 4YE4L 1T7YA 1KPRB 1DEDA 2FX9H 3AVEA 4PJGF 1A1MB 4NBYB 4HKBA 3L3JA 2APBA 5M94B 4HUKB 3AS0A 2YKLH 4PB9H 2GJJA 2KBGA 3IFPB 4J23A 3BKYH 3R06B 2FX9L 5TGBB 4KMTH 4ZS6D 3B83A 3L3OA 5HGGS 5EPMB 4YAQA 5EOQH 3TO4D 4XNZB 2PO6D 5FOJA 4F9LC 3QHFL 2IGFL 4POZC 3SKNA 5MEOA 3T4YA 5HDBF 1K8IB 1Q8MA 4DKAA 5MHSE 3CVHA 4KK9D 1U8HB 3FT2A 3MV11 3HI5H 3LH2L 3UJIH 3SQOL 3HS0A 2HVJA 5D1ZB 3SDYH 1OW0A 4ONHB 4I0PA 4MJIA 4Y4FC 5BO1H 1T3FA 1YEDB 1PBYA 2ED9A 3OKEA 2EC9T 2V2XB 3H7BA 2YPLE 2H3NA 2NTFA 3KPPB 3O9WC 4Z0BL 3ARRA 4X4XB 4NUJB 1J5OH 3C87A 2GYSA 1DP0A 3TLRA 3MXWH 2E9WA 1E6JL 3MRBB 1ZHBA 1J0ZA 4WDIB 4LBEA 3UJJL 2Z31A 2PO6C 3QEQD 4LSUL 2OMBA 4OIIH 1NEZG 4K8RL 5I8CA 4J4PC 2CR6A 4KQ4H 3ZL4L 1QEWB 4WIQA 1XCTA 2FZ3B 1DFBL 3MRPB 4XP6H 2EH7L 4PJ8A 3T2QA 4Y4KB 4ZAKA 4MNHA 2W0KA 2CD0A 5I1HL 1S7QB 4MD4A 4S1DD 1HHKA 3BIKB 3MV9B 1EO8H 2WQRA 4S1SL 4PJ5A 3MYZA 3WIHH 2VDLH 1FNAA 3S96B 1D9KD 3VFNA 1EJOL 3VWJD 4OZHB 1CD8A 3CNKA 2XG4A 3IU4L 4PJIB 2W0LA 1XF4B 1O7SA 4KDTA 5IJVB 5K59F 2D31B 5CIPB 4UIKH 1ZHLA 3Q5OA 4WHYG 2NY4C 3RPIA 4GBXD 4NQSA 4YXKH 1KSRA 5JDJA 1S78D 4L8SB 5K93A 2F9BT 4WU5B 5BXFB 2BOCB 3O9WA 4QO1A 3VFMA 4D8PA 1OTUD 2LABA 2X4QA 4P2RB 4RRPA 3V0VB 3JWDH 2UWEA 1CR9L 1VACB 3STLA 4XNXH 4QTIH 5F7YC 1JTTA 1ZVHA 3QFJE 5F3HA 1OP3H 3CDGA 3G5ZB 5ECJE 1MIMH 4JKWA 3EFFB 3AAZB 4K7PX 4WW2A 4U1JA 2VUOA 4M8QA 1T7WA 3WMSA 4FP8H 3RPIB 2ICWI 4L8CA 2DB8A 3GIZL 2ARJB 2EYTA 2C1PB 4FFYL 1CDGA 4PJ9B 4WENB 4UV7H 5CEZH 1HYSC 3GMLA 3QULA 4X7DC 4UDTA 3BPNC 2UWEE 4GSDH 1WTGT 5D7IF 1XT5A 2F8XC 1F4XH 2SEBB 4JGMA 3MLRL 4ONFH 5CBAA 5ACZB 2EC9U 4MZ2A 1CGYA 2VXTL 1FRGH 5ESVB 1EH9A 1NJ9A 1S9XB 1ZA3B 4P57B 4NKQB 5EO9A 1MFBH 1SJEA 5F1IB 1CDUA 2AJUL 4GQPH 2QQKL 3Q6FB 1CBVL 2QKIA 4Y2DD 4S1QL 1NBYB 4YZFE 1MFEH 4M43L 1S7VB 4TUOB 4I77H 2NY0D 4C56A 4JEGB 4R97B 3EUUA 2VIRA 4MS8A 4Q6IB 4M1CD 1AGEA 1KIPB 3RVUD 1G7HA 1DQQA 1BF2A 1KACB 1ULVA 3QNYA 5TQ0H 4OLZL 4OF8A 4BH8B 1CXIA 2YWZA 1T1WB 2EC8A 2R1YA 5B3JF 3RTQC 5FHBL 4QTHA 2NW2A 1T22B 3LSOA 4P2OC 2NCMA 2VLLB 5HGDA 2ZUXA 3QI9D 4KK5D 1BFOB 1HWGB 4JDVA 1KPVB 1CU4L 1C5DB 4HKZB 4HH9A 3MFGB 4PRHA 1LK2A 1EXUA 4Y5XB 3WNMA 5DHYA 3MRJB 2EDNA 1MHPL 3NN8A 5EOTB 3GHBL 2B20A 3DI2B 1DSFH 1EIBA 1QSFB 1V3KA 5C0AE 3IRPX 1KJ2B 3NTCL 4I0KA 4R6UA 5I1HH 3BWAB 5AWNL 2VXQH 2FLRT 1Q9KB 1NCTA 5ITBH 1ZXQA 4HJGB 5JIHA 1TETH 1I9EA 3L5JA 4U1NA 2DLEA 3C6LB 3B2VH 4LSRH 3UO1H 5CZXC 5EBWB 4UIMA 3MRPA 4N0UA 3V9FA 1YY9C 4ORGB 3MUGA 4AYFA 4FXGB 4ZFOA 1MCWW 3EDFA 5DD3H 5EU6D 5LKNA 5AWNH 1IM3A 1SY6H 4OCRH 1QLEL 3HR6A 4BJLA 1A7QL 1JUFB 4NO5B 4JRYE 2IBGA 4L8BA 5HGBB 2UWEB 4EN3B 4N68A 2Y7QB 4XC3H 5GIRA 4M3JA 1SY6L 3ALPA 4PJHB 1RULH 3REWA 4TRPH 3MROB 5IW1B 2A38A 4G6KH 1ZLSH 4PJIF 4EI5C 3IFOB 2ZP0T 3VD9A 5TE6H 3P9WB 4M02A 1XF1A 3WL9B 4F57L 5F7FA 3CSPA 3ESVF 4NKDA 4PJIA 2EDHA 2VLRA 2I5YH 3AS1A 3X13A 1JZ2A 4AEHL 1U8OB 5JA9A 2GK2A 2V9TA 1A9BB 1SJHB 4Y2DA 1LGVA 3C5ZC 4RAHA 3SDAD 1E4KA 2HJFA 2I9TA 5FB8B 4KTEH 4PGCA 4ZPTB 2Z91A 1ITCA 4WWKB 2OJZL 3CDGB 4XPGH 2PXYB 1MCPH 3GSUB 4K9EL 1MNUH 4O2EB 1HKFA 4ONGH 4PIRF 2P5WE 3AM8C 1KXQE 5F70A 3PHQA 2YD5A 4QEGA 3D3VD 4HWZB 4NN5C 5B8CB 1OAKH 2IPTH 5ANMB 3O4OB 1FZJA 3MODL 4APQC 4PJ7A 2JJWA 4XP5H 5DD0L 5JOPE 1H5BA 3IDMA 4OLVH 4KTEL 5CKAA 4ERSL 5IB5B 1YN6A 2P7TB 2WQ8A 3O4OC 5HI4D 4NQSB 2BX5A 2F8VA 3VXSD 3D69B 1A6TA 1H8SA 2AQ3A 4U1IB 5FEBA 4JG0L 1CI5A 1VFBB 3OJDA 3BDBA 3HR5A 1CDHA 4DKEL 1U6AL 3KPQB 1YMHA 5IEKB 5DD0H 4QGTA 4LU5H 2C4XA 5DXWA 4XPHH 1RU9L 3VFOB 4M62H 1TIUA 4GXUN 2EH8L 3BN9C 1M71B 1ZANH 4XHJC 2LTQB 1P7QB 1PSKH 2R2BA 2WBJC 4MSWA 3RGHA 2HFFA 3H3PH 3ZKSD 4QCIA 1A7NL 5CEYB 4U1MB 1N3NB 1A6WH 2NY6D 1OGAD 3C9NA 1UEYA 2GFBA 3MBEA 2APVA 2PYFA 4Y2DC 5L2JB 3WJLC 1OAUH 1I7ZB 2H2PD 4OQTA 4OCYH 4MVBC 1RUPH 2BHUA 4FQLL 2B2XL 3FT3A 4IOIA 2LAAA 2J6EH 4JFYA 5EZOH 1K5NB 1AI1L 5EBLA 2YC1B 4LLYB 1CFSA 5ICXB 4HG4K 4HJJL 5DRZB 4P2OD 3CXDH 1Z6JT 2IF7A 2NLJB 2DI7A 2JKXA 2J88H 5E70A 2Q3AA 4ZDHA 2EDXA 3QUZD 3ZTNH 4P23C 5GGVY 2ZCKH 1RZFL 4YIQB 2W9EH 4PY7A 4UUJA 2CKNA 4R8WH 3TJHC 4HKZA 2DBJA 3QRGH 5IHZA 1F42A 2E7LA 2DKUA 4RRPG 3J8F7 4Q58C 2WM0A 3DXAD 3MLPA 3MJGX 4O9HL 1SEQH 5J11B 2VLRE 4F37K 1W72H 3TZVA 3S88L 4L4VE 4FQCH 2VZVA 4K8RH 1MCSA 1AXIB 4GQ9H 5SV4A 1AC0A 4B7IA 5AG8A 3QA3B 3FL7A 3ES6A 1T2QL 2J4WH 4QTHB 4QRQA 4D3CH 4GRLB 4IHOA 5J6GA 2NX5A 5IB2A 5C1MB 1MELA 3RDTB 3SKMA 1KFAL 2QL1A 5DVLA 2CK0H 1W0WB 2PCPA 1QNZL 5FHAH 4K94C 4OT1L 3QUYB 4P23B 3SDCA 2XTJE 2H8PA 4U1KB 3OG4B 4WWKA 1KLUA 2D7NA 2DLTA 3G6JA 1F11B 3TN0C 1II4E 4QXUH 1MVUB 4IOSD 2BNRA 5IM7B 4PBXA 3OB0K 3FFCA 1P7HL 2JELL 4Q2ZB 1CU4H 2MCG1 3RUGF 4NQCA 5DJ8A 2DL2A 4UTBH 3GB7A 3RX5A 3ZKNC 4P46D 5CP7B 5C0CE 4E41A 1T4KA 4PB9L 5GZND 2P44B 4QRRE 1KEGH 5TF1L 3PWPA 4Y1AD 1XIWA 4GRWF 3D0LA 4M7JL 1AQDB 1MLCB 3HC3H 1DLHA 3HE6C 3KPLB 3RX7A 3MA7A 5CJ8A 3FB5B 1JGEB 3O45B 4KI5D 4PJAF 1J88A 4JFEE 1UADC 4MXQC 4FN0A 4HC1H 1CFNA 1FZOA 2GTWB 2ICWJ 3F12B 3QDHA 5JHLH 5I8KH 4N8VB 4MXVE 4PLJD 3AMKA 5DDHB 2H1PL 1GIGL 2BSRB 3KPSA 4ZAKC 3HZMB 4MAYB 4ZG1A 1YYML 5IF0B 5D1ZD 3BZFA 5IESH 1MJ7L 3V8CA 3EO1A 5F1KC 1EGJL 2BRQA 4FHBD 1NAMA 4ODSL 3H9HA 4UT6L 1CLZH 1CVRA 2PW1A 2DQGH 5JZ7C 1IAII 4PJCF 3U4EA 5F6HJ 1ZT1B 3QO1B 1R6VA 1FL6B 2IEPA 4U3CA 1FLRL 2N7AA 4S11A 5D93B 1MPAH 4RIRA 4MS8D 1DN0A 5E08L 1BQHG 1RPQA 3RAJH 2CMRH 1T1YB 5I1GL 4BSWA 1HHHB 3WXWL 1GPOL 3BRDA 5IVZB 4HS8H 3JV5A 5HI3D 2P5WA 3VFOA 1DQJB 1G7JB 1RZJL 2VNCA 2F54B 4UQ3A 2CRZA 3NACH 5FHAL 3T8XA 4YUEL 1UKQA 4W68A 3BUTA 2DS4A 1RIVL 2VXVL 1KFAH 2W9DH 4XBPA 4NT6B 4OCXH 2WBJD 2X44D 3SE9L 4PRIA 4L4TA 4HAFA 5C3TA 5JDSA 3QO0B 1HH9B 4P2RA 1NLDH 4RMTA 5CUSH 2F19H 3M1BB 2O93L 4F2MA 5D96C 1WV7T 3QDGA 4F15B 3RL2B 1ZS8A 4IOIB 1LO2L 2OTWA 5EZJA 4OQTH 1JHKH 5CMAB 4KZDL 3HZKA 4Z7UF 2BY1A 5EU5B 4LSPL 1S8DB 4GG6A 1BFVH 3TNNB 3ZMRA 2O5YL 2JK5A 2OZ4L 1A47A 1RJYA 3UAJC 1Y6MR 4MQXD 4XPAL 5CILL 3QDJA 4XP9H 5D1ZA 4OI7A 1XGQA 3C8KA 2R0KL 1MJJA 1L0YA 1IGTB 5EA0H 3MJ7B 3C6LC 2P8LB 3OKOA 2IH3B 3I50L 4M61A 3VWJA 4OZIA 1QSED 4UTAH 3ARFC 4JM2F 5CD3B 3ARGB 4YHML 3DBXB 3DX6A 4LCUA 32C2B 3REVA 5HHMD 1R5IA 3RWCB 3CFKA 5CLWA 3P3YA 3HZKB 1XF3A 5DTFB 4EUPB 2X4UA 3DOSA 5C7XL 4QRRD 1A4KA 2YK1L 2VDQL 1NUFA 1MFAL 2X4PB 1KCRL 3BPLC 1HYRC 5JO5A 3ULVD 1FL5B 2ADJB 3PGCB 3P4LA 3WN5A 3B9DA 2O5ZL 5D6CA 1E4WH 5CSZA 5D7JC 1A7RL 3CK0L 3F7YB 5FUOH 3BSZH 4M61B 4XMLH 3ZTJH 1NGZB 2VQ1B 3CH8A 5F96L 3TIEA 3NFPB 3HUJE 1NBZA 2DTSA 1A6ZA 3PL6A 4N9OB 4HFWA 2W0PA 1GJIA 3O8XC 4XZUB 1OQXA 3MRMA 5IFHH 1XH3B 2OCFD 4R97C 5C6WH 1HHJA 3WFEL 3GMLB 2JJVA 2PW1B 4PB0H 5IQ7L 3L5WA 3O8XB 3FN0L 1LDPL 1F6AA 4HCRH 4PP8C 1JWSB 3KYNB 4ZFZA 1NGQH 2X1OA 1QSFA 4YFLF 5DC9B 5BZDB 4FTVD 4XMKL 4FABL 4LCIH 3OHXA 1TJIH 1WFUA 3FQWB 4L3EB 2I07A 1RZGB 3DUUB 4FTVE 1YEKL 4OLUH 2K7QA 1JYXA 3OAYH 1IGMH 1NPUA 4KRPC 5ITFB 5DJCB 1IT9H 1BM3L 1X9QA 4QRUB 2ZKHH 4TVPL 2F5BH 5E7FA 5C09E 4DFHA 3EOYG 4O02L 4N8VA 4ZS7H 3HG1E 2VXUH 3V4PH 2I60L 1JNHA 5C6TH 2C9AA 4HS6B 3S4SG 3MNWA 2OJEA 1JHLH 1G9MC 1G1YA 1A6UH 1F58L 1RZJC 2FYYB 5FECB 5J1TC 2DI9A 3O6FA 5B4MD 2X1WL 4XWOD 3MRFB 4ZO9A 2X7LB 1XIWB 1LHZA 5IVXF 5D2LA 3JTSB 4QWWD 3BJLA 3BDYH 1JPSL 5T3ZL 1OY3B 1F4WL 3MV7A 4P3DB 1NL0L 1DL7L 3ULVE 3WFDL 4P4KD 3HE6A 3Q6FA 2Z8RA 4OLXH 1CXLA 1TQBC 3C08H 3TIEB 4HKXA 3CMOL 1RHHB 3STZB 3VFTA 2APTA 4FQ2H 4S0TD 4M1CC 5FO9A 1OGAE 4Q0XH 1INQA 1CXKA 2VYRE 1G1CA 1JYNA 3VFPB 1D5MB 2CK2A 3MLUL 1TTUA 3BEWA 3MRIA 4XP9L 5GQBA 3KR3L 3MO1A 3C08L 1VADA 3OKMB 5C8JB 5JW3L 4L3EE 1OQOA 1QSEE 2VERN 4IEFB 5DD3L 1HN1A 3CFBB 3MXVH 4ISVB 4X7TB 1IGFH 1P6FA 3V6OE 1E28A 1NCCL 4JDZB 5AYQA 3S5LB 3NVQA 1EAPA 2Q7NA 4UIMB 1ZHNB 4AEIH 4CVUA 1R3IL 3CFDB 2V7NA 2C3GA 3HNSH 2NY1B 4M62L 4PRAB 4AL8L 5HY9A 5HYJA 3NMEA 4K8RD 5E8OB 4S0SD 1AI1H 1FC2D 4QXGH 3RU8H 4HJ0C 4K3EL 1UFUA 4HW6A 5DJXB 3QEUB 5IFHL 5KVEH 5HYIA 2FBJL 3QAZB 5KS9F 1X5YA 2Y06H 3E2HC 3LV3A 4GJTB 5BMFL 5I74C 1DUYB 4GLRH 1NBYA 4NBXB 4MWFB 1A4JA 5AUMB 2CH8A 3FO0L 1WEJH 4GMTH 3FMGH 4LHUA 5T3XE 1A6WL 2AEIT 1T0NA 5E1AB 1KXTB 5DLML 4UU9B 3MRQB 2ZCLH 2GUOA 4HXBL 1GPOH 3C60C 2V2TA 3PWUB 4ONFL 3V4VL 4HIEA 1NBQA 1A7PH 5LGJA 3CU7A 4OB5L 5IGXL 4PRBB 2CJUH 4TSCL 4GG6F 1QBBA 2XA8L 3BP7A 1X44A 4J3SA 1RAMA 4WNQB 3SPVA 1YEHL 1KN4H 4DQOL 3QIWB 1QP1A 4NQCE 3UTQA 5L8KB 4TSAL 5J3HC 4CDGC 5C0BB 1A7BA 2IANE 1MCRA 3FQTA 4YO0A 1S7SB 4EI5A 5CSZB 1QBAA 3EJZC 5GGRY 2QR0B 3GKZA 4IRSB 4PJBA 3MOAL 5DJCA 3B4NA 1GZQB 1KCUL 4N0CD 4W6WB 4MNQB 3F12A 5DA0B 4XNUH 2FL5A 1HEZA 1HHHA 2FO4B 4RFNB 4RGOL 4XPTL 3LQZB 5CILH 2OL3H 3QPQC 4Z7WF 3QJFA 1U8LB 1RMFH 1U36A 1C8PA 2OZ4H 2EDFA 4JRYD 5B21A 2DWDB 4JPVL 1JFMA 1P53A 3S36X 1FAKT 3MCKA 1R0AH 4NJ9L 5FKAA 1YQVH 4WUUE 3UTSB 4Y19E 3FO1B 5DI8B 1O5DT 2UWEF 3VXTB 2PXYD 3TJEH 3X17A 4P49A 5MI0C 2ITDB 3IAGC 4ZFFA 1F3RB 5KAQG 2CDEA 4WFEE 1KLFA 3W11D 3HZYB 5IFAH 2B0SH 1KB9J 2FGWH 2JB5L 1DBML 2YMXL 4N0YH 5D7LA 3HC0A 3JWDL 5C0AD 1HNFA 5ITBL 1BFSA 3P40A 4TQEL 3LQMA 5DVOA 3WD5L 2GFBB 4JFFE 4X5XB 2ZPKH 3L1OL 4TSBH 2NYYC 4F33A 2PTVA 3TBTB 2RCSH 3QIBD 3SKMB 2JIXD 43C9A 3F58L 5B4MC 5C6PB 2W9LA 4KUCF 5CWSA 4C55A 1A7QH 1XGTB 3RBSA 3P4MB 4APQB 4QF1A 1RJZA 5F3BB 3KVQA 4JFHD 2C3HA 2DDQL 3MLYL 4OZIF 2O61B 3ROOB 2WSKA 2XTJD 2W0FB 1K4DB 2Y4SA 1N64H 3VRLF 3BVNB 4M7KH 4BZ1H 1P5VA 3GSNL 4D9QD 1DQTA 4GXVH 4Y16D 2YBRA 3K81A 5IOPB 2WANA 4RGNE 3S4SB 4NQCB 4KJQC 1A14L 1OSPL 4NZRH 3TT3L 4MS8C 1T04A 4JFPB 1J8HB 2EDEA 3QCVH 4UB0L 3C5ZB 1F00I 1RUQL 3VGDA 3WFBH 3Q5YA 5GS2H 3ARSA 1J12A 4KMLB 4PV9B 3KWWA 5L6YH 4ODUA 4M48L 4S1QH 3QWRD 4HULB 4IIQC 4WWKD 1RIUL 4ZUTB 5CJBA 2OTUA 3BUYB 1IGJA 5AAMA 1I4FB 4P2QE 5E99H 5GRVK 5EUOB 1CT8A 1QBLH 2ZJSL 2WAHA 5E7BA 1RHFA 5CP3A 3GI9L 1U41A 4KWUA 2NX5B 5IB2B 4JR9L 5DTFA 3P73B 1S78C 4X6FA 1OF2A 1MQ8A 4WU7B 2R2HB 5TQ0L 4P3CH 1ZK9A 3A67L 3IVKB 3B6SB 2ZUQB 3EJYC 4PJEE 3EZJB 2VAAA 2HT2D 4EI6A 4YBQC 3WYRA 5J06A 1QQDB 1G7LA 3UTTA 4NQED 4MCZA 3I75B 1Z0NA 4LKCA 4YHOL 1IARB 3QFJD 2FR4B 2EDWA 3KLHD 4WFGE 2FEEI 5GS0L 5IIEA 3ILQD 1FYTB 5HVHC 5T1KA 3DX8A 4XNQA 2VR5A 5E9DA 1Q94B 1DN0B 2DQCL 4G8FB 1M7XA 1LEGB 1E6OH 4KUCD 4C59B 2V17H 3BVNA 2NY2B 4NZTL 3UTSA 3NCFB 4N9GB 4XWGL 2ORBH 2NY3C 5F21B 1W2KT 2J8UE 1IGYA 4OUUA 2WINA 4Z7UA 2HT4D 3RY5A 1JWMA 4ZUVB 3RPKA 2G5RA 3RKPA 4Y1AB 43CAB 5IK3A 3MCLH 1K6QH 2WW8A 5SWSA 3ECBA 2WBWB 4TULL 5EWIH 2Q6WA 1DVFC 1KG0B 3EHBD 2ARWA 2Z0BA 4M3KB 3WNOA 4ETQA 2JF1A 4NUJA 4IRSA 4UTAL 5EU7C 3Q0HA 3U79A 5CHNA 1JF1A 1H3GA 4P2OB 2COQA 5SWQB 1AQKL 2NXZC 4IJ3B 2IMNA 4HHAB 4LPCA 1KCSL 4ZUUA 4BSVA 3RGVC 1FHGA 2ZCKL 5C7XH 1CF8H 1P4IH 4Z76B 3V5DB 2IQ9L 2G75B 1EZVY 2A9ML 3K8KA 4GG8A 3MYJA 1NGPL 4HWEH 1I8KA 4NKIH 4LEXH 2CUMA 5IB5A 4QXGL 4WV1B 1OP3K 2DBLL 1FBIL 4DUVA 3O8XD 3O0RH 2H32B 4WI3A 5CKGA 4P5KA 4PJBE 3HNVL 3ARXA 1FN4B 4POZD 5DO2C 4G5ZL 4OIIL 5FAAA 1SYVA 2AJYL 4H1LA 4NQEB 2XQBH 1JRHI 4ODWB 3LHPL 2Y07H 4EN3C 3QDMB 1NFDB 1VGEL 5E9DD 3U9UA 4PR5A 5EOCL 2OS7A 1R5VB 5CLTA 3SKJH 3WE6B 5ISZE 1A2YA 3OXSB 5BOPA 5MEND 1ZTXL 2N4IA 4KZDH 1BQLH 4JQIL 1CLOL 5IQ9B 4LGRB 3IDUA 3TO2A 4CKVX 1A7OH 1EAPB 4QRRB 1OWWA 3TZVB 1OARL 3DARA 1KOAA 3PUCA 4W4OC 4NJ9H 4RMVA 4D0DA 3KLHC 5FO7A 1S7XB 4YDLC 4QRPB 4YHLH 4OI8A 4XP5L 2WLZA 3K8LA 4J8RA 3MLZH 5D7IE 3IAPA 1UACH 4WI4A 4HIIA 4LARH 1B90A 3D25B 1G7LB 4G6JH 1P69B 1WUNT 3QH3A 3MJ8A 3W9EB 3FQXB 2V2WA 3QUXC 5B38B 1IAIL 1QA9A 2AI0L 3FQRA 2ILLA 5JHLL 4KVCH 3M45A 2D0FA 4MGXA 5E4EB 1WICA 4P2RD 3VFWA 4P59L 3MV8B 5EO1B 4OZ4B 4MD5B 2I9LB 4GRWB 4IMKC 1F3DJ 4HCRL 5FDWA 3EYSL 4V1DD 3L3DB 5BVJB 1DBJH 5HGHA 3TBYB 5IBLC 1EZVX 2F15A 3KPNB 4RMRA 4Q74A 3VXTA 3VMPA 1FPTH 1WIOA 4YFLI 4HZAA 4LVNC 4ZXBB 5DMYA 3NIGF 2F8OA 3T65A 1SJXA 1F90L 1BQSA 1IBGL 2E7LC 2NQCA 3D0VA 4XCFL 5I9QC 3KXFE 1KJ2A 5EIQA 2F58L 5K59E 3MBXH 3MOQA 4MMZC 3SOBH 4U6VL 1UT9A 5J1SC 1SQ2N 2LFGA 3H9SD 3OKDA 3LMJL 5ALBH 2X1PA 3NIFF 4LCYB 3ULSB 4H1LG 1SVZA 3BPOC 4IDJH 1P6AB 3E3QE 3GSRA 3PV7A 5HHMB 1KNOA 3QI9A 4XI5D 1JUFA 4AL8H 1BOGA 4NFCA 4NO0D 1KULA 2IMMA 1ZLVH 3SDCC 3VFUB 1Q0YH 1NANH 1NAMB 1KJ3H 1HOCB 2L0DA 1G9NC 1BF8A 1N26A 4CVWA 3VXMB 4CL7A 2QQLH 2X09A 1T5XB 5E8DL 3OMZA 5I1JH 5KVFH 1YMMB 2Y7QA 3RWFA 4ZS6C 3HG1A 5D1QA 4K3HA 2GJZA 3DVFA 2FECL 5HHNA 5F7DB 1FLTX 2B4CH 4MX7B 5CCKH 2NXZB 4DOHE 1X6NA 4HK0A 1DVFD 3UC0L 2MMXA 5GS1B 3X13B 2E7CA 3TN0B 4PJBF 5DFVD 2IPUG 4HWBA 3ZE0F 2HT3C 4RFEB 4OF0A 4LSPH 1F4WH 1QPPA 2Y5EA 2A6JB 4JY6B 3MC0A 1F4HA 3I2CH 2OI9B 4D9RE 2Z4QA 1FVEA 5JLZB 2VDOH 1MREH 1TENA 1A7OL 1MFNA 2K3TA 3G6AB 4M4RA 3PNWB 5TPWH 1A3RL 4U1SA 2H2PC 5C08D 3IJHA 4YX2L 1JHLL 3CFEA 5T33H 1A9EA 3OX8B 1HQ4B 1ADQA 4DGIH 2J6EL 5EA0L 1Z0MA 3P73A 3NCCB 5EIIB 2UZIL 4D0BA 5SX4H 2VE6A 5JMOC 4M6NH 3V6BR 2ZZUT 2N1KA 1H5BB 3TNNA 3ZKMD 2YA1A 1IC7L 4HC1A 4JVPA 4MNHB 3PHQB 3ESUF 2AJYH 4KVNH 4OCSL 4RMUA 3WS3A 3ZT5A 3OAUH 2PTUA 1BQHB 3TJEL 4M7ZC 5D7SH 2MOVA 3T2PA 1TJHL 4LDEB 4HSQA 3O6FD 2DM7A 3CC5B 5JXEA 5E03A 1INDL 3WFCH 3F7VB 3IJHB 2DBLH 2AJXH 3U7AA 2G2RA 2HJFB 4G6AD 2I9TB 1FIGH 1BMGA 4N0UB 3I6GB 4R4BA 4WJ5B 1NCWH 3BPOB 2IQ9H 1T20B 1CTOA 4BYHA 2D4DA 1JK8B 3MXWL 4L9LA 5F97E 3DV4A 3HNTL 4M43H 5IEHA 1MEXL 4JFXA 4HH9B 4AH2A 4MA1C 1AD0B 2GEEA 3DLQR 1C08B 5C0ND 4MCZB 4LEOB 1KUMA 2Q6WB 3VXRB 1OB1A 3K4ZA 2BY2A 5F7KC 3U0PA 2XQYG 2X9WA 3SCMC 4IRJD 1NGWA 1KTRL 5EG6C 4AEFA 1FL3B 1KPUB 3BO8A 5TDOB 2NY7H 3WIFB 4KKCD 5A16B 1L0QA 3CFDA 3A67H 4ZFOB 3R8BB 2AABL 1XGYH 3RVXD 1HOCA 3A6OA 3T2OA 4U1NB 4XVSH 1HSAB 1PZ5A 3IT8D 4KUZH 1K8DA 3KPRE 2YD2A 1QPXA 3OKLB 4FFZL 5FGBC 2MKWA 4GW1A 5I73C 5IVXA 5CEYA 1CK0L 3ALWA 1RFDL 2V2TB 1IQDA 4I18A 3A6CH 1WQVT 1XF2B 2VLJD 1MI5A 1MF2L 4KAQL 5ID0A 1WBZB 3BISA 4L4TE 1TVHA 4OJFL 5KN5A 4YBHA 2BSED 4C56D 1ES0A 3VMNA 5EPMA 1EEQA 2FEDC 4U6HA 2Q86A 3V6ZB 1ZT7A 4JR9H 2NY0C 1CFQB 2Z9TA 3HI6H 4G9FA 3RZCC 5DJXA 4N0RA 3GSWA 3O41A 3BRGC 2PTTB 5HI5D 5HJ3B 4Z7OF 2IG2L 4XC3L 3QQ3A 1F11A 4O2EA 2C5DC 4OZGB 3UMTA 1G9MH 4TVPD 4I2XE 3X11A 3WKMH 1RZJH 5BRZA 4WEMB 3E2HB 2HKHH 4U1HB 3WXWH 3P0VL 5LGJB 2RQ8A 2Q76A 4JPWH 3VG0L 1MIEH 2B8OT 3ME0A 1NEUA 1X5JA 1SM3H 3FOMA 3S9DB 1IL1A 4JN2B 2B0SL 3O45A 2J88L 4ZFFB 2J4WL 1JNNL 4Y2OA 5E2JA 3T77A 1IE5A 4NC1E 4EUPH 1U8PB 3LB6C 5HHQB 1CICA 2XKNB 1QRND 1QFWM 4Z7VA 5LG1A 2DQEL 4HUXA 5GJSL 1TZIA 4QRPA 1TVHB 5KN5B 5IUSA 1JGDB 5FKPB 5GGSB 3SCMA 4F33B 3D2UD 1BZQK 5E24E 3WFHB 2AXHA 5FCUL 1CF8L 3T4AB 4G8GE 1JGVH 3JWDC 1J0JA 1A1NB 2BRRH 3QT2A 1TJIL 1LO0L 4PJGA 5IROC 4IRSC 3V7AE 1LMKA 1FORL 3B9KD 3NAAH 3PL6C 1Q0XH 2XN9D 3L7FA 1NH6A 3BGAA 4NC1C 3L3IA 1WAAE 3WV0A 4DKEH 1C7TA 3P0GB 4GRWH 5IOPA 5KSBE 1EFXA 1FSKC 4ZPVB 4XXCA 3LPFA 1ZWIB 2ZUYA 5F7NC 4NPYB 1DUZA 1UWEL 4J4PD 4DTGL 1U58B 3I6LE 3P11H 1XMWA 4NKDB 4ONHA 4F8QA 1C16A 5I66A 1OAKL 2IPTL 2PW2A 4KK6D 4LEOA 2JB6A 4LL9A 5DJZA 3ET9F 5IB4A 3THMH 5IVOA 4X6DB 3MUZ1 3ERYA 5KS9E 1KGCD 4R7DA 1I8LC 2XI9A 15C8H 5T3ZD 2VLKB 4QTIL 4GW5A 4G42B 4X6FB 5FM8A 4TVSa 3ZHDA 3J7HA 3FRPA 3LN9A 4NRZB 2MQ0A 1LQVA 2ZG2A 5KVDH 1YPZF 3PV6A 4HWUA 5EUOA 3O4LA 2BNQD 4D9RD 1EHNA 2WNGA 3I3BA 3O2VH 2AJXL 3IKCA 3QEGL 2X70B 5I30L 1PYWB 3BH9B 1UKTA 3I6LD 4YXHH 3WHXB 3V0AC 1YEFH 5E6IC 1AQDA 5D6DC 1VB9A 3F7QA 4PYGA 4JO2H 1EFQA 1NSNL 4OZGE 1F8TL 1UYWL 2KZWA 4PUBL 5KANI 4WRLA 3LKOA 3QRGL 3I85A 1OB1B 3SO3B 4BQ6A 3MGOB 2OLDA 1S9YA 4U7SA 5HSFA 4KRNA 4JM2C 1HIMH 4ZNCD 2XN9B 4E41E 5C0CA 1DUZB 1YEJL 4AEHH 1ZSDA 2EYTB 2E7BA 3CDCA 1MAML 3U82B 1JL8A 4QRPD 2A6JA 4ALAH 5CWSB 1CWVA 2UV3A 3FFCE 2N7BA 4IHOB 3U30C 1QFUH 1VCAA 5HGAA 1I3RB 3GIVA 2PTTA 4U0QB 3GMOA 3R06A 3IXTB 4LLQB 3HI6L 4HGWB 1UM5L 4AIZA 1A7NH 4X6DF 1IEBB 2R69H 1QRNB 3BP5B 3UC0H 4JN1L 4H25B 1OCWH 3PDOA 2FJFA 2YR3A 1CFTA 4M6MH 4TUOA 5AZEH 5I75C 1TZHA 1OW0C 5IMLA 3PWNA 1S7UB 4NRXB 4R3SA 4IJ3C 1AR1C 4XBEL 5F6HI 4PJAB 4U2YA 5FFLA 1WIPA 2IBZX 3ULUC 1PKQA 4Z77A 3MCG1 4ODBD 5IFAL 1UKSA 2XKNA 2EDLA 1L0XA 2AXGB 2DMCA 1F6AB 4U1GB 1RZ7L 2ZSWA 4NYLA 1HKLH 5BZWA 2YS4A 2NR6D 3ROOA 3QQ9C 4PDCE 4GAJL 2VDMH 3MREA 4IOFD 1NGYA 5A2FA 4WHCA 3VA6A 2VLME 2HWZH 4MA7H 3ZE2F 1B6UA 3GMMB 1BJ1J 5I30H 2VLJB 4HZLB 1YN7A 3ARFB 4LMQI 2ZUSA 3PGFL 1CQKA 4YDJB 1S7UA 5C0DB 3O3DA 3MV9D 5I19H 1EEUA 1W0WA 4MDJA 2X1QA 4KTYA 3BZ4B 3N0PB 1VFUA 1ACZA 3EJJX 1DLFL 4PY8I 4BH8A 4LQFH 2ENYA 4GRMA 4MA3A 5ENWA 5BZDA 1YMMA 5JOFB 4I4WA 1OM3L 2P45B 4X98B 4ODUB 4FXGA 4OQ1A 5C09B 3SDDC 3UP1A 1YEIL 3U0WL 2XA8H 4PV8B 3MGTB 1FO0B 1U58A 5FM5M 4V1DA 3FOLB 3QR2A 5HPOA 3GZKA 1JPTL 1FZJB 3JZ7A 3GJFK 4PJ8C 3WNPA 4R4FH 2X4SB 1KJVA 3ZE0E 2W07A 4PJ5B 5F8RC 5ADOL 2R69L 1NMBL 4JFEA 1KT2B 5CSBA 4F3FB 4AMKL 2R1WB 5F9DC 1LILA 4QNPF 2BSRA 2Y9RT 4G9DA 3L3GB 5TE7L 1T1WA 1JFQL 4MD0B 2PXYC 1W72L 3WO4C 1CLCA 2IPKA 4PGEA 4L29A 2J5LC 4Y4FA 3VE0A 2AQ1A 3X14A 1JWMB 5A2IH 3VFGH 1KELH 4LRNH 4R4NC 4YHZH 1RJLB 2NZ9C 3OSKA 4PJXF 4Y88A 4AM0A 3IJSA 4QHMB 5I76B 2GAZB 4HIEB 1EA9C 4GS7B 4LLAA 3V0VA 1IQWL 2P46B 2HTKD 4Z7VF 3WIHL 1QA9B 4LDLB 3IFOA 1TZGL 2AJVL 4OM0L 2W65A 2R4SL 3CD4A 3PL6B 2WWKO 4PGBA 5C0CB 4KHXH 5D8JH 3AB0B 3MJ7A 1R3JA 1S9XA 4EDWH 1JE6A 5L6YL 4ZUWB 1ZVYA 3MRNB 1YDPB 1F5WA 1UB5B 4KKBD 3LKSA 5FYKE 4QXWA 3RY6A 1K6QL 2DQJH 3FN3A 1IAKA 4PLKD 3O3BA 4PP1D 5BZWB 2FLBT 3QQNA 1CICC 4HFUH 2EIZA 4R2GD 5F1NB 2E27H 3PJSB 4P23A 1TNMA 4FQHA 3CVIH 3QO0A 3MOBL 4KDVA 2YSSB 2FO4A 3IDGB 3MZGB 4YLQT 5CIPH 1N5YH 1NFDF 5ABDE 4LIQL 2ICEB 1EO8L 1X5IA 3GMQA 4H26B 4W81A 3CX5J 1ZANL 2GT9A 5DJ2B 5C0DA 3TV3L 1SJEB 4W70A 4QCIB 2A9NH 1NC4D 2VDNH 1JN6A 5C9JA 1A1NA 3T1FB 1RZKC 1YY9D 3U83A 1ZHKA 4X6CF 3QB7C 4KKCC 3V6FB 2OZ4A 3S35X 3T0EC 2EECA 3UPAA 3DMMB 4DUWA 4KGLA 1IMHC 4WU5A 5BXFA 2X2YA 1MLCA 4LPXA 4HD9A 2BXYA 3AC0A 5TE4H 1JV5A 5FO8B 1YNKL 4JQXA 1P4BH 1V3MA 3RZCA 4YFDB 5BQ7A 1CGXA 2FDBP 4J3TA 3IXAA 5DWUH 2ZJSH 1IM9A 1I9JL 1L6ZA 2ZSVA 1DBKH 4P5TB 5KSBA 1PYWA 4OSUH 2GJ6E 2JJSA 4LHJB 5A2JH 2OK0H 2LVEA 4G6FB 4L1HA 3O6FC 5D7JB 5FK9A 3T0XA 1HNGA 1MCNA 3ARDC 4YBLC 3ULUL 5J3HD 5DMKA 3BZFB 3PE9A 3UPCA 1X5AA 4ORZC 1RV6X 5J8OA 5GRJH 3LQAC 3HE7B 3IB4A 4RWYL 4J12A 2J8HA 5ESQA 5IR1A 3IETB 2DQDL 4DGIL 4GAGL 3O3UN 3VFMB 3MNZA 5HHVL 1EGJA 1M05A 4PP2A 3LAFA 1A6VH 3DX9A 2X4RB 3L3GA 1FVCB 3IAQA 3ES6B 4JFHE 3SDAA 3MLTA 1PY9A 4IRJA 3CX5K 5CZVH 5D70L 1QRKA 3ZE2E 4P5TA 4L5FH 2CLZA 4HPOH 3FTGA 2H9GB 2ARJQ 1KCVH 4PV9A 2XTJB 5GGTH 1CGTA 4LVHC 4FZEL 4I18B 2E27L 3MSPA 3C5ZA 2YWYA 3VG9C 2C7UB 3MRQA 2DF3A 3O4LD 1EBAA 3RKDC 2DLFH 1BREA 4PY7B 4DZBA 3L3HB 3CLFH 2YPVH 5DEFA 3FFCB 5DD1H 3SKJL 5GGTA 5I1JL 4MX7A 1AY1H 3WEXB 4IM8A 3KPOB 3UO1L 3B2VL 5FGSA 5JORB 4YPGB 4ZUSA 4HUWB 2V5YA 5BRZD 4BFBD 4XX1G 5EBLB 4WDIA 1W72A 4Y5VC 4LF3B 2UZIH 4FQXC 4HS6A 4WU7A 2BOCA 2G60H 1Q1JL 5I1EH 3KPLA 5TFSL 1ZA6A 2FIKA 5E95B 1I8IB 3L6FB 2B4CC 3MPCA 1C08A 1H3WM 4WGVB 5INDA 3VGGA 3L1OH 1J9CT 4MXQD 3TCLA 5J11C 4E5XB 3BE1L 3HC0B 5EU3A 4ZMAT 4NQDE 3DRQA 4WEBL 3TBSA 2OQJB 1VGEH 4O5LL 4PLOB 5FA4B 3WFZA 1CDIA 3DRTA 4PJCA 5HD8C 1CGVA 5KVGL 4AENB 4LP4A 4PJHE 1YEFL 2FIKB 4XP1H 4UAOB 4I3SL 1ADQL 1MSPA 1FBIH 1AHWA 2O61A 1FH5L 2P8MB 5D9SA 4QHUA 4RX4D 3FO2A 4B53A 1CS6A 1K5NA 3G08B 3QHZH 2CIKA 4MAYC 1EX0A 4M1GL 2P49B 3R8QA 3QQ4A 1C5BL 5INCB 3TH2T 5T3XD 1CFNB 4Z8FL 4G3YH 3X11B 1JPFA 2R2EB 4NP4H 2NY5H 5C0FB 5DZOA 4EBQL 3MLVH 2Z93B 4JLRA 5FYJE 1A22B 1T89C 3KPMA 4M93C 5C07D 3AXLA 1U8OA 1GGTA 3MUHL 4JM2A 2XFXA 1TJGH 1GOGA 5FYKU 2EIZB 5IHUL 2NY2D 4QWWC 4LSVH 4I5BA 3U4EB 1NCUA 3VCLA 1JK8A 1FYTD 4GT7A 2WIIA 1MQKH 2BNRD 5DK0B 3IU3B 3OAYK 1HWHB 5D7SL 4GH7B 3I6GA 4HHAA 3OJMB 5TE4L 5HVGB 3WN5C 2ZCLL 2AKRB 2YA0A 3BAEL 5T5NF 1D6VH 4POYA 4YHPA 4L4VB 1Z3GH 4KXZI 5HVFB 4Y5YC 4MJID 5BV7C 5K9JH 3UBXG 4EDXA 1NC2B 3FQNB 1TTFA 2VQUA 2BJMH 2IC2A 4N5EA 1ND0A 4CBPA 4OZFH 2VDNL 4HBCL 5IV2B 3HCVB 4FFWD 5AYUH 4LLQA 2XWJA 5GJSH 5EC1B 1YEEH 4LVNB 4ZXBC 4LNRB 3SGJC 3CIQA 1J7VR 4CN6A 1Y18A 5JA8B 5K9OA 1MREL 3HMXH 1IJ9A 3JV6B 3ROLA 2PO6A 5FXCH 5DJAB 4NQTA 4DW2L 9CGTA 5FKAB 4ZAKD 4D0CB 5I17B 4P46A 4G6KL 1KCSH 3V52L 2EYRB 3OGOE 3KYAA 3VWKD 4Y4HA 3LQAL 1LK3H 4FXKA 1T0MA 1NFKA 2V5MA 4I0PD 5HYJE 3HMXL 5C09D 5D7LD 2HG5A 5EOTA 2QSQA 3DRQB 3DROA 5C07A 1LE9B 4WTWA 3CAFA 2ERJB 2GT9B 5DJ2A 2ID5A 2C3XA 3G5ZA 4LLYA 1VFAA 4HK3J 4I48A 2NY4B 5L9DL 1WJ3A 5GSVA 2R1YB 3ZO0A 5C9KA 2EKSB 1MLBB 1P7KA 5CMAA 4APQD 4JG1L 1Q9LA 1KTKE 1A9BA 1SJHA 1W72B 1P2CB 4I13B 1I9JH 5D70H 2XKUA 2JE8A 5BOZG 1A4KB 2A83A 1UM6L 1WCBA 3FRUB 3AREB 1VKXA 3FQXA 2HKFL 5DHVA 1I7ZA 5JQ6L 2F53E 1NCBL 3RZCB 1WAAA 3HI5L 3UJIL 2WY3A 2AK4D 4DZBB 5ANME 2AP2A 3O6LH 2F5BL 4PRPB 4XXCC 3NZ8B 3B9VA 1MY5A 2IH3A 4XVTH 2P5WB 2AV1A 3NCJL 4N0UE 1GGIH 1MCEA 2IADA 2ITCA 3V5HB 4XNUL 1BZ9A 3D6GA 1FO0L 4EBQH 3K2UL 1K4CA 2NY5L 2YD9A 3T0BA 4F7TA 2DD8H 2EYRA 3TO2B 2ADFL 3HG1B 5D1QB 3V6OC 3LKPB 2QADD 1QR1A 3ZYIA 5HHME 4H0HB 3GHEH 1TJGL 5E2UL 5FGBA 4TPRL 4KK8D 5FYJH 43CAA 2P1YA 4UOJA 3MACL 3W9DA 1JHTB 5SWZB 3QDMA 2ADFH 5DD5L 1QD0A 4WUUD 5D71L 4UDUA 3T0VA 4NQEA 1A21A 2DYPA 4IMLB 3EJYD 1CD1B 1N6VA 3W9EA 1FRGL 1KIQB 1S7RA 3TJHD 1UVQB 4N0FB 3ARED 5B38A 5F7EL 3RA7L 3OKNA 2VZ1A 2Y72A 3QZWB 2D9QB 1B0RA 4JDTH 2MSPA 4HMCA 2FR4A 1QTYT 3G6AA 1N5YL 1IAMA 1NDGA 4NWUL 2RFXA 2ZNXA 1AXSB 3MOBH 4P5KB 4WFHE 2IAND 3CFEB 5I1KH 5SX5H 3F5WA 3MX0A 3PHSA 3NCMA 3EOTH 1QR4A 3GJFB 3BQUD 3I84A 4P46B 1DE4A 4WVRA 4OB5H 3RGVA 3H2WA 4O4YH 2Z92A 2ICWA 5FYKL 2CKBA 3RWHA 2JIXB 2DQTL 4OKVA 2RJMA 4MJ5A 5ESAB 2W60A 3TVMC 2CPCA 3QDJB 4WO4C 5HGBA 5IROA 2BNQB 1RIVH 1GSMA 2VXVH 1V7NL 3N1QC 5E2WH 5C0FA 4KHXL 5D8JL 3VGHA 4YUEH 3HE7D 5C0AB 3UEZA 2OMNA 5FUCC 1I7RB 3TA3C 5D1ZC 1VADB 1KG0A 5C8JA 1SM3L 2JCCA 1CL7L 4KJWC 2FEDD 4PRPE 1LD9B 3V79C 3IDXL 4QNPE 3U6RB 5IFJA 3QNZB 4YH6A 5FGCB 1KELL 3IKCB 4TYUA 1YQVL 3KDMB 4N1EA 1QYGL 3VFWB 3UJJH 1G84A 1DL7H 2QQLL 4X4ME 5JIPA 2ESVD 4BQ9A 3S4SA 4OFKA 2E6PA 1LEKA 4TOYH 1PDKA 5MEPA 3VXRA 1JWUA 1NDMA 1ORSB 4WEUD 1RK1A 3BIBX 3EO0A 4PRHD 3N06B 1BD2D 5TF0A 1AXTH 2JTDA 2J5LB 2VWEC 4MJIB 2YPVL 2Z31D 3RNQB 5AUMA 1E27B 4PRPA 2EYSB 1FG9C 1WWAX 2GQHA 1SBBA 3F7YA 1RJZB 5HDBE 3ULSA 3ARDB 4YBLB 3QJFB 2NNAB 1JNLH 3TBSB 1MUJA 4JFED 3NGBC 5IV2A 4JPIB 3V4UH 4HDIA 5KSBF 2D7OA 3U9UB 2IALA 1YNLH 2R56L 5H35B 4YPJA 1OPGH 5HYJB 4GG6B 1JTOA 3DTXA 4MJ6A 3ROLB 3BZEB 5L0QB 4Y5VA 1T5XA 4M5ZL 4K8RC 2ZCHH 1A7PL 4WI9A 1YZZA 5LQBH 2VDRH 5K9KA 3RDTC 4RGNC 3CGTA 3EDDA 5DEZA 1CDYA 1DQQB 5C0IB 5C0AA 1L7IL 2D7MA 5JDSB 3K7UA 4R26L 4PTTB 2P8LA 1B0GA 3QI9C 3K8MA 3VDCA 1NCDL 1P1ZA 2QQNH 2VE6B 5IIEB 1PAMA 1RUPL 1WBXA 1HHIA 5F7HA 1HSBA 3VFNB 5E00A 5C0GB 5F96H 3LS4H 4CRPA 5DRNB 1NCDH 1XR9A 1QKZL 2AV1B 2X89D 4L8SA 3QIBC 1KIUA 3SE3C 2DI8A 3QH3B 2J7LA 4HV8B 4D94A 1UH3A 2Z4QB 4C4KT 4M5YL 3NN8B 4PJ9C 1RK1B 4JN1H 1VFMA 5FA3B 4XC1H 1A6TB 2X7LA 1TVBA 3C09C 1LDPH 4P23D 1RJLA 5JQHC 5IK3B 3G6JE 2XXMB 5CEZL 4L4VD 1HK6A 5EC1A 1U3HA 3P0YH 1CG9B 1KIRB 4WCYH 5IJKC 1IM9D 3DXAE 2IAMC 3BIAX 2GW5A 2VL4A 4S1DC 2CDFA 2BNRB 5IM7A 4ALAL 1JP5A 1UWGL 3JV0A 3QFJA 3QISA 3INUH 5LXGL 5ESQB 5BV7B 4RA3A 2NXYD 2V2XA 4L9LC 4NZRL 5ID1A 1AXTL 4OZFB 1QNZH 5DQJA 1T5WB 4LIQH 5C07B 1LE9A 1CLYL 1X3DA 5CS7A 1QHPA 1NGXB 2D0GA 2O5YH 4YDVA 3QUKB 4BK4A 5F44A 1AGCB 4E5XA 3E6FB 4KXZH 5JNYB 1IQWH 3ZT7A 1I3GH 1VA9A 5BQ7B 5DMIH 1U2HA 3Q6GL 4UINH 3B6SA 3TYGL 4LLDA 2DQJL 3CSBA 4KKLC 2ADGB 3QUZA 3GNMH 2Q20A 1UJ3B 3DRTB 3GJEB 2P24A 4O02H 3BKJL 4P9ML 2G75A 3C60D 3MNZB 3I2CL 4FG6C 3V6FA 4AK1A 2E8ZA 4CGTA 1SMOA 3NPSB 1UVQA 3MRHB 2X4RA 4X7SL 4UBDC 4ZYKB 4NNXB 3QIUC 3RVVC 1BX2B 4R0LA 3VD7A 1BD2E 4LHQB 5T5NG 1S7WA 3AROA 1FG2B 1OF2B 3X12A 2AVGA 4KROB 4NDMA 5JPMA 4G7VH 1IILE 3DGCR 3U7YH 5JMRA 1P7KB 2ESVE 2NY3B 3RKDD 4QGYA 5FYJD 5JOPD 4OCRL 4P5MB 3VGBA 2BCKA 5C08A 1JZ3A 2PNDA 4NNPH 4MQ7B 1ZGLM 4Y19A 3TYFA 4WW2C 2OR9H 3F6IA 4FMKA 1FNSH 3DVGA 3S35L 3L3IB 4G6FD 4BSVB 3MLSL 2RB8A 2EDTA 3E2HA 4MQSB 1HHKB 3NZ8A 3GI8H 2BDNH 2Q3ZA 4LNVA 2AGJL 3LS4L 2AXJA 5EC2A 1MAJA 3R0NA 3SOBL 2OM5A 4NGHH 4JO4H 4JE4B 1OAYL 1CE6B 2E9BA 5GGTL 3KS0J 4X0KA 1IBGH 4K71C 3HI1A 3PWPD 4Y1AA 1NUNB 1HZHH 4LPTA 2WV3A 3L9RB 3IVKA 4NM4H 3IFNH 2I5YL 3FB5A 4WTZG 1I8IA 3WLBA 4GMSH 4E42A 1QACA 1Q9WA 3DETD 3DYOA 4M4PA 1KEGL 1OAXL 35C8L 4NWTH 4NKMA 3QEQA 3IXAB 2MPAH 4QRTA 4WO4B 4UTBL 2VDML 5IQ7H 4B50A 1VEPA 5F8QC 2CUIA 4XXDA 5AD0A 5F9OL 1XF5B 5L88L 4M48H 4DEPC 5GGRA 1FYTA 3O6LL 5I8OH 2DQUH 2NX5E 5C0EA 1NMAL 4HQQL 4MJ5B 2EIDA 5ESAA 4JCLA 5GSRB 1M1SA 1CDCA 2H32A 2Q76B 2HT3D 3S34L 2W1NA 2EDJA 2VLRB 1OAQH 1I7TA 1A4JB 1YMHB 3TO4A 3KGRA 2R39A 1EFXB 2VLKE 2EDOA 5BS0E 1JMZA 3PP3K 2R1XA 4HWBH 4EZMA 4BFGA 4TUJB 1XR8A 4ENED 5GHWL 3AREC 1TCRB 1ZE3C 3SDXB 5CHNB 4F7MA 5C0CD 4HK0B 5EDXA 3C5SB 4TNVK 3F58H 3ULUD 3BW9A 5TH2B 3MRHA 4PR5B 4OGXL 3T4AA 2BP3A 4YK4B 4TSBL 3IETA 3CFJB 4OZHF 1FLRH 1R3HB 2AK4E 3UJTH 1J11A 1IC7H 1E27A 2F53D 5ETUB 2AEWA 1KYOK 4JKMA 5A2LH 4BZ1L 3FO9B 4RWHA 1VFBA 2PN5A 3T0EE 5D96B 1NGYB 1HCVA 1QO3A 3JWOC 1MWAA 2IH1A 4JFQA 2H9GA 5H94A 5IBLD 1YA5A 3BRFA 3ORJA 1ZLVK 1VERA 5HHOA 5BO1L 1KB5A 1OHQA 2C4FT 3KAAA 3MQIA 2X10A 12E8H 4K7PH 3CZJA 4UU9A 4NCC2 2APXA 1JNHB 4RFEA 2HN7A 5E2TH 1YC8A 1RVFH 4MAYD 3WS3B 1CL7H 2FD6H 3S5LA 4U3XA 5MERA 1OOAA 1T0PB 1R3HA 3SE8H 4OF7A 2PYFB 3WLWD 3I9GH 5EB9A 4PGJA 1M7DA 1RI8A 5GRJL 2XNAB 25C8H 3MR9B 2HFGL 2PF6A 4B5EA 5EOCJ 2R8SH 1FZOB 2GTWA 4RZCB 4GRLA 2EE6A 1SY6A 1BQUA 4JKKA 1Y6NR 4PRAA 4OZ4A 1IEHA 1I85C 5EBGA 1RURL 5KOMC 4LLUA 1W0VB 3MRDA 4ORGA 1H15A 3QUZB 4MNQE 5DFWH 3N50A 3X3GL 1HILA 4GKZA 5TDNA 4LCWA 2GUOB 1U8PA 1TXKA 4MMXC 4MVBA 1TLKA 4RGNB 2EZ0C 5J89A