3WUWA

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRTALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wuwA01
5EC1B 5F88B 3TN0D 5E00A 4H8WH 2NY6D 5I75B 3KLAB 2XZZA 3EOAA 3BVNA 3KS0H 4JJ5B 4QRRB 4HV8A 1RHFA 5GGTH 3LD8C 3G5ZB 4Z5RB 5L6YL 1OTSC 4U6XA 1CGSL 5IJKC 2XYCA 3QNZB 5DK2A 3F5WB 1UQSA 2ZPKL 5DZLA 1G9NC 3NTCL 3RFZC 4L4JA 4JREC 1I8LC 4X6CE 1S7VA 2NW2B 1UWEH 2FJGA 3DMMB 1D5BA 1XF3A 2FSEA 3GBMH 4YHNB 5CKAA 4PJ7F 1IAIM 3KYMA 1SBSL 2VDMH 2WLZA 3TVMB 1Q9LB 4FTVE 5IGXH 3HCVB 1SJXA 2B1HH 1F3JA 4RQQB 2APVA 2BSTB 3ARTA 1F3DH 1F90L 3OAZH 2OI9A 4RRPG 5ENWA 4PREA 5J06A 1PAMA 2OS7A 3WIFA 4LRIC 1UWEL 3ULUE 1YECL 5I1IL 1H5BA 5DUBA 3T2NL 3I3BA 3W0WB 4MX7A 4QRQB 2R2HB 3QDJE 1FZKB 5I8OH 2AJ3A 1T2JA 2QV2A 3WS6C 2DQCL 5JLZB 3WHE0 2A6DA 4LSPH 2QSVA 4ZUWB 5FAAA 2ATPB 3AM8C 1V3JA 2C4XA 2GIYA 2HFGH 1LEGB 1NUNB 1BQUA 1F3RB 2JKXA 4WV1C 3T2NH 2NR6C 4U1HB 2YN3A 5HYIA 4OCYL 3PE9A 5GRVK 5IEHA 1I1FA 3OB8A 4Y5VA 2Q8BL 4L3ED 4UT7H 3MLZH 4XRCB 5HHNB 5HGBB 3U46A 2NY5L 1YY8A 3BN9D 4PJAA 3QPQC 5K9JH 2WBJA 1N6VA 2IAMA 4PBWD 3VXUB 3VW3L 2IQ9L 4OF7A 2NY2B 3LEXB 3FN0H 1V3MA 1EK3A 1KCGC 3KPRE 4Y1AA 3FTGB 3EFFB 2G60H 1R3KB 3TT1L 1DP0A 1M71B 4UT6L 1BAFH 2JTDA 5EUOA 3THMH 1CXIA 15C8H 1YYMH 2IH1B 3CXHK 4M1DL 5HYJA 1OY3B 4MQ7A 4R7DA 5IG7B 2EEDA 4GS7B 4EI5B 1DQLL 1Q0XH 5EA0H 1MHPL 3X3FH 5FO9A 1KELL 3DECA 3O3EB 1ZHNA 2X4OA 4PY7A 4WFHD 4KK8D 2O5YH 3IT8D 2CDGB 2MHAA 2A77H 2B8OT 4JR9L 4EVNB 5HSFA 3TJHC 4Z9KB 2EXYD 3MLUL 3FFCE 5F7MC 4HKZA 4ZFFB 5CBAB 2NX5B 4OI7A 2V9TA 5DVMA 3DSNA 4M7KH 5DRWA 4I0PB 2DF3A 5T1LB 2X4TB 4C56D 4PLNC 3QFJD 5EORL 3FQTB 5EOTA 3IKKA 3TV3H 4HK3J 4HWZB 3ARPA 4APQA 3ZKXC 3ZKNC 2P46B 3UDWC 2WBKA 5FFLA 2BNRD 1ORQB 4R2GD 3C5ZD 3BEVA 1ZLSH 1L7IH 1REIA 3BKYH 1J8HD 3BYYA 2P1YA 3RTQC 1GCFA 2HKHL 2UVEA 1FVDA 3MLVH 3K4ZA 1U8JB 4JQVC 4P2OD 2PO6B 5D9SB 3GBNL 1J11A 4UT9L 4S1RH 5CJOH 4ZDHB 2A9NL 4S1DD 2VL5A 4F33A 2Y72A 5IJKA 2CKBL 2J8UA 1QRKA 4G5ZH 2A74B 5DJ8B 4LCUA 4P5KA 2YPLD 3I3EA 5LKNA 2HRLA 1R0AL 2OL3L 3EUUA 3DX7A 4M43L 3H9HA 1I7UA 1X5IA 2H9GA 3I84A 5AZ2H 5DEZA 1ODAA 1P4BH 4HEME 1DQDH 1IE5A 2VZ1A 1JP5A 1XGUB 3FQWB 2RCSL 2ZOLA 4U33A 1JZ8A 3SKNA 1KTRL 3GSNA 2NY5C 3MRFB 1OAQL 2HVJB 5HGHA 1OSPL 3MLYH 4Z7VE 3ALXA 1U95A 2B39A 4NKOA 5TQ2L 5C0JA 1ZVHA 2R4RL 3BDBA 3VGBA 5DURB 3TIEA 2E5EA 1CDJA 3R4DA 1NLBL 2ICCA 4BFGA 1L7TH 5ACMA 5D2NB 4JHAL 4LLYB 4RMVA 2F58H 3HC4L 5F7NC 1MHPH 1KPUB 3X3FL 4OGZA 3VCLA 1KIQA 2P24A 2CJUH 4NKIL 4JY4B 4CU8A 1INQA 2A77L 4M8QB 1HI6B 5TDPA 2X7LA 2EEAA 1DBJH 1XF1A 1FE8L 1GIGL 2VN4A 4G8GD 3V79C 4QRPB 4APQB 4J3WA 1D5XB 1LEKB 1RHHB 5CCKH 4P5TD 2AK4E 5KAQF 2XWJA 3B9KA 4KKAC 5C0CD 2O93L 3LMJL 4J6RL 3UBXB 4Y4KC 1JNHA 2XRAH 1PY9A 1TTFA 3QO0A 2FJFB 1FL6A 4DGYH 4WWKC 4WHCA 5EUOF 4JKWA 3RKPA 5I1LA 4U6HB 4ZPTA 3G5YA 2P8LA 4WFGE 6FABL 4LCIH 4N0CA 3SDXF 5DJ8A 4YXKL 5IBUB 4DW2L 3TBSA 1IAIL 1G9NL 3BZEB 2IALA 3WFBL 1NDGA 4NC1C 3WNLA 1UWXK 2VLRA 1Y0LB 4D9LH 5KVEL 2ZSWA 2GSGA 2AXGA 2Z31B 3NA9H 5FYLD 4GKOA 4ZS7H 3UJIH 2H3NA 3PQYA 4GRLB 4QYOB 2V2TB 1UWGH 4PJ5D 5DUML 2YA2A 1AGCA 3O41B 3VGGA 1T89A 4PFEA 1B2WH 4R90H 4BH8B 5HXMA 4Y5XB 5CSGA 1FLTX 1VDGA 3RGVD 4PJIF 2IADB 1IGIL 5DWUH 3MRKB 4AZ8A 5EULV 2W1NA 3W39B 4JQXA 2HT2C 1GHFH 4JB9H 3WO4B 2VDQL 2Y6SC 1DBML 2FYYA 2XG4A 4KZEH 1NGWA 3BMWA 4R90L 1ZGLB 4R9HA 4LPVA 1HQ4A 2ATKB 2YRZA 3RTQA 4P2RD 4N5EC 2VKWA 4QWWC 5IB1A 2Q7NA 4UV4L 1AQKL 3U1SL 2VDOH 4UQ3B 3IETA 1CFTA 3LIZL 2F74A 4JFQB 1MREL 1NH6A 3NIGF 1XGRA 2X44D 3HPJB 3FO0H 3CCHA 3E2HC 2HFFB 1PKQA 3Q6FA 1WT5C 4U1LB 3O4LA 2CIKB 2JJWA 5KG9B 4PV9B 4XI5D 4RGMC 3WHXA 4Z0XB 5IUSA 3IFLH 2VXUL 1IC1A 1LO5A 2AV7A 1A7QL 5JR1L 2XI9A 1HCVA 1TENA 2VXQH 1SBBA 3WFEL 4HK3N 5C2UB 1F4XH 4YNYB 3EDFA 3EYOB 4KHTH 4ELKA 4IHOB 3NFSH 4GSDL 4XCYA 1MCWW 5IESH 4DAGL 1MHCB 3HE6C 1NGZB 1S5HA 1RV6X 2OJZH 3JWOC 2GTZA 3QXTA 5DHVB 4ZUTA 3H42H 3JV5A 1IAOA 3VI4F 4F15B 5MENE 1XMWA 3Q3GA 2J88H 3KLHC 2D7NA 4NM8H 1Q0YL 1EA9C 4NM4L 4NQSB 2VDLH 3VXSE 3ZDZE 1N4XH 3NCEB 4L4VD 3KYAA 4XTRC 2EIDA 2AV1A 2VO5A 3B5TA 4KRPD 3GMRA 2IF7A 1ZLWH 3UJIL 3MUY1 3V0AC 2F5AH 1LO2H 1MIMH 3REWA 3RWDB 2ITCB 1NFDB 4TTDD 4NCDA 1NEZA 3VD9A 5IQ7L 1XGTA 4QTIL 3PWJA 4EN3A 5EG6C 3N1FC 4LCWE 4JKPH 4BSVB 1N4XL 1S8DB 3QDMB 1TLKA 1VGEH 2Z31D 4ETYA 1H3VA 4KQ3H 4TNWK 5FCUL 2X9XA 4Y0GA 2AEPL 5JHLH 1RK1B 1FYTB 4L8DB 3SKOA 3QXAA 3N0PB 3F7QA 3M45A 3GSUB 4WWKA 1XR8A 2Y5EA 4LCWA 4XAKE 4OZIB 5IQ7H 3JVGA 1QQDB 4PRDA 2L0DA 3BKMH 1BVLA 3JWDH 2RHEA 2DN7A 1B0RB 5KG9A 1BOGB 1J0JA 2DQIL 4JDTH 4P46C 1FG2A 1BHGA 3Q6GH 4XP1H 2MWCA 4XNQA 5AZEL 4HGMA 4LMQI 3MFFA 3QEGL 4AIXA 4RAVA 3VD3A 1KTKE 3KJ6H 3ARDA 5L7XH 3VH8A 3BHBA 5CEYA 1DBAL 3VW3H 2ZJSH 4OCRH 4XP6H 3PV7A 1V5JA 3SDAB 3CSBA 4PTTA 1KLGA 1TVBB 3QWRD 1NGPL 4LSTL 3ZHDA 4LPXA 4JM4L 3STZB 1QBLH 5FOBA 4H5SA 4WGVB 1NDMA 2QBWA 4OUOA 4FN0A 3DIFA 3FT4B 3TBTB 5J8OA 1E6JH 1TMCB 3HAEB 3O45B 1JF5A 4GW4B 2KH2B 1F00I 4FQXC 2MMXA 5SWZD 2I9TB 3HZKB 1NCNA 3OAYH 3KPSA 1FZJB 3K81A 1GGIL 2DQGL 3HNSH 5B38G 2CQVA 3TLRA 3CD4A 3IFNH 1R5IA 1UGNA 2DDQL 4N5EA 4OLZL 5B4MD 5J6GB 5T1MB 5SWQB 5TDOA 3ZE1F 4M7KL 4AJ0A 5CHNB 2NY6B 1AGDA 2X10A 3QHFL 4OUUA 4C59B 5EOCL 4HIIA 2YD2A 3TBYA 4GG6E 1A6ZB 4L3EA 1I1AC 3EO0B 4K7PL 4LLQA 2HRPH 1NEZG 2LQRA 2HKHH 1UZ6E 5D6CB 3L3OB 3P77A 4LL9A 3MV11 4XXCA 1RFDH 5D1ZA 5IMMB 5IIEA 3GB7B 2VLJB 3VH8B 4EIGB 4N8CL 4PLJD 5E6IC 3RVTD 3ULUD 5BS0A 3VFUB 1U2HA 1FFRA 1K5NA 3V5HB 3R1GL 1MCLA 1A7OL 5LXGL 5I8KH 3O2DA 4QLRA 5FHBH 5DMYA 5E9DA 3DX8B 1WWAX 3WSQL 3TBWB 5DI8B 3ABZA 1JPTH 4LVHB 3V6BR 3QEQB 1GSMA 2DQDH 4MNHB 3RIFK 4ZTOH 5IMOA 1U58B 3RPKA 3U4EB 4CN4A 4FXGA 5HI5C 4XBEL 4NO3A 2MKLC 3WO4C 2DD8H 4NZTL 3TO4A 3QI9C 4PJGF 3TCLB 3QG6B 1OTUC 1OSPH 3MLYL 2DI9A 3RWHA 5AYUL 4F7EA 1JZ5A 5ICZB 1T83A 5C6TL 5LBSL 3RWJA 3FCTA 3GSXA 3DRTB 4JLRB 4IOSD 3MO1A 4D0DA 2QQKH 5EOQH 5FUZL 5EU7C 2MOVA 1X7QA 4XPAH 5HHQB 4HPYL 3WKML 2EE2A 2FX9H 2F54B 2CDFB 1NGXB 4XP9L 3LKOB 4OD1L 3W9DA 4HXAL 1MCOH 2GSIA 5T3XH 4MAYC 2EDQA 2P8MA 4UQ2B 1DQJA 5BV7L 4WDIB 1HZHL 4ETQB 1H3WM 4WI3A 1ED3A 3RAJH 3KLSA 3MCKA 4GBXD 2B7DT 4YR6B 3MRHB 4Z7NF 4I9WD 1JMXA 3ELAT 4NC1E 1B9ZA 3FB8B 4EUPH 7FABH 3OJVC 5ADPH 1SVCP 4PLKC 1MHEB 4M1GH 1FBIH 2WV3A 1PY4A 4TN9A 5E94B 5I1EL 1YEIL 3OZ9H 1CYGA 4ZO9A 1J86A 4LSQL 1ZXQA 2J2ZA 3MRLA 4GBXB 3RWIB 1JWSB 3DUUA 2WP3O 5JPNB 1RZIA 4ALAH 1P69B 2Q8AH 3VD7A 1FVCB 2RB8A 2H8PA 1NBVL 4LOUD 1Q38A 1QEWB 5E99L 5KVEH 2N7AA 3V6ZA 2XN9D 5IT2H 5A16B 5IR1B 2DWEA 4LIQL 4U1NB 3V5DB 3AB0B 35C8H 4YHLL 4BUGA 1XEDA 3WCYA 2EDLA 4PV8B 1NAKH 1OCWL 3GRWH 4JE4B 5E2WL 5IBUG 5CD3A 4XP5L 5C9JA 1KIRA 3U6RA 3N9GL 1QFWL 1JRHL 3QUMB 1PQZA 4DCQB 3WFZA 4LIQH 4KV5E 4YC2B 4TVPD 5IFAH 5D7IE 3Q2CA 4Z7UE 1MEXL 3MA9L 3TZVB 4PYHA 5EU6E 5CLTA 3V52L 3GMMB 5KSBE 3SDDC 1ZSDA 3B9KD 5KSAD 2GAZA 4ZO6A 1AO7A 2HVKB 2VKXA 4KJYB 4S0UC 3O81A 4RA0C 1R6VA 1ZHBA 3D39B 4PBXA 1NLDL 4X0KA 5D7LE 3QISA 4YBLB 4HHAA 4XXCC 5C3TA 4UIKL 2VLLB 3EO9H 5HPMA 1UB5B 5FDYA 1IKNA 1FVEA 1RUPL 5GGSY 3MV9D 4OJFL 3D87B 5AEAA 1JBJA 1G6RH 2CLRA 3F7YA 3T0EE 4U1GC 1AFVL 4JFYA 5E1AA 1NC2D 3LOWA 2NY2C 4JGJA 5I76B 1HKLH 4IOFC 1I8KA 5T1LA 4NN7B 3D25B 1P7QA 3O6MH 3T0ED 3MBXH 3I6LD 5CIPB 4MD0B 3SQOH 1T21B 1H0DB 5I8CA 3I85A 2DQFA 4KHTL 1FBIL 5EA0L 3WS3B 2WY3A 2WINB 1KFAH 4MMZC 1TJIL 4M4PA 4U1IA 5D7LD 3BDYH 4LSQH 2YD9A 1URLA 4PRBB 4ODXB 3V6FA 2X6MA 1C7TA 1LP9F 3QDJD 5KBNC 5J12B 5I30L 2Y5TB 5KVGH 4JPWH 2Q8AL 1INEH 3SDXA 4PRPE 5I2IB 1OP3K 3ILPB 1Q9LA 3LH2H 4HUXB 1FGNL 3G08A 5L8LB 3I50L 2X1OA 4DCQA 1QRNB 1T6WA 2X89D 1DDHB 4EI5C 1SBSH 4HWNA 3PG2A 1F8TL 1C12B 3ZE2F 5C08A 2UWEF 4JKPL 2G5BB 3N9GH 1C16A 1IAKB 1CD1A 2P7TB 1VFAA 2CR3A 1K3IA 3G5VA 1JK8A 3LH2L 1OP5H 4JFDA 1XZ0A 4FRWA 4RX4A 5IFAL 5DC9B 1LO4H 4NQVB 5DK0A 2AXFA 2VLLA 2LVEA 5DD1H 1JWMA 2R2EB 1FNGA 3EO1B 4JN2A 3MRPB 3FO9B 5E6IB 4YLQT 1N3NB 3ULVL 1T03L 3LSOB 1OAUL 3FB7A 5MEQA 5C86A 3LZFL 2DIJA 4I3SL 1B3JA 4RIRA 4L3AA 4JY4A 5CJXA 2AJXH 2EDWA 3VRJB 5J3HC 1NANH 3KPMA 5KSAB 1KPRA 3VRLE 5I1KL 5F97E 3CFCH 2CK0L 2QQNL 3MC0A 2XQBL 3VMOA 3NCYS 3L3GB 4L1DA 4CADB 3J7HA 5C2BH 1QTYT 3C8KB 3HG1B 4CDGC 1FZMB 1RD6A 2AJXL 4JAMB 2E9JA 3U83A 3WL9A 1DQQA 1D5ZB 4NJAH 2QHRH 4OM1H 1N64H 4NRZB 3D3VD 1QKZL 2WMPA 5KVFL 1M7IA 5IB4A 5IK3A 2E7MA 5H35A 4ZUVB 3IDIA 1DBJL 2FH6A 1U0QA 4LP5A 4LSUL 3VG0L 1Q1JL 4DN3H 2R9HC 4HMCA 2FH8A 1H15B 1J5OH 1EJOL 1X5FA 1NUDA 5TPWL 4DQOH 2W07A 3ULSA 3MRDB 2DDQH 1N64L 2BVQA 3OAZK 4KTDL 1FGNH 3KYOA 4I8DA 4K3GA 4N0CD 3GIZL 4V1DB 5T3ZH 1UJ3C 4MCZA 2X4RA 5FGCE 1LDSA 2VZ3A 2AW2A 1UCTA 1MCPH 1A6PA 3NN8A 3PP3K 4BM7A 4LPWA 3TBVB 4P99A 2UZXB 3PQYB 3V4UL 2EDOA 1KEGH 3STLA 5EOCH 1A6WL 6FABH 4WGWB 1BZQK 3IAPA 4KUZL 4LAQL 3KLDA 4X5WA 3QCUL 4OCLC 2FRGP 3CX5J 4TRPH 1TJHH 2FHBA 1A5FH 4LSVH 1PBYA 1GJIA 3DBXB 5GGTA 2ZNWA 3GSWB 5HDLA 1O7SA 5EZOL 5HGDB 5TDNB 4XCNA 2BVPB 3OTTA 4Q0XH 3TYGH 3TNNB 2KQMA 3PGCA 3F7VA 43C9A 4YDKH 1C08B 3RGVA 3DHJA 5F3HA 4WNQB 5FO8B 5HHMA 2P5EB 4FFYL 1F4YL 3U0WL 2A9NH 1BQHG 4MXQD 5IHBA 3SY0B 1FV1A 1K4DA 4GXVH 4GQ9H 3RI5K 4LCYA 3VWKC 1F42A 2DLHA 3TESA 3TNMB 2PR4H 4OLVH 5I16A 4M43H 5ETUA 1OARH 4UU9A 3AU1B 4ODHH 3SDXE 2OTUB 2ZUYA 3RUGA 1ES0A 3C87A 4LSSL 2VLKD 1IZKA 4M1CC 1LK2A 4BFIB 2XTJE 4JQIH 4XPBL 1HH9B 1RUMH 5J4MA 5C0AB 3EYUH 2FHCA 3C6LD 1EHLH 3SN6N 3BP4B 4IHOA 5ID0A 5EZJA 3FAXA 3O3UN 5KANG 1H9VA 3WDIA 4CVXB 2DMBA 1EEQA 2VQUA 4JO4L 4WTWA 1VFBA 2CLVB 1MVFA 2WZPD 3C6SB 4PR5A 2OMBA 3CFBA 5D5MB 5DGRA 2NXYC 5C0AD 4HUUB 1FO0L 1MCOL 5JW4Q 1GGTA 2VOTA 3UPRB 2BNQB 1CR9H 3K2MC 1MCJA 3V0VB 4FQQB 1E4WL 1MRCH 1DVFA 4HJJL 1ND0A 1GIGH 1OT1A 4K3JL 5GS1C 2NXYB 4LF3B 4P4KB 4X4MA 3T2PA 3MODH 3W2DL 1AGEA 4XBPA 5B22A 3PDDA 4O2CB 2I9LB 1N59B 3V9FA 3NABH 3V4PH 1B4JH 3H8NA 3S36X 4DKEL 4R4FL 5GSVA 2V9QA 4Y4FA 4JZOB 1TZGL 4NQEA 5F3HB 1R24A 5FO8A 5I1EH 1OQXA 3EFDH 1G7HB 2J88L 3D5OF 3O6FD 1XF4A 1D9KC 4L4TD 3EYFA 3ARFD 3FKUS 1BJ1J 4DKFH 1KENL 1AQDA 3P3YA 5T1DL 5BV7C 2F5AL 2PW2A 4TQEH 5JIKA 5T5NG 2AXGB 2Z31A 3DOSA 2R4SL 4QTHB 1IM9B 5IWLC 4GRLA 1AKJB 1HXMB 2H32H 4HWUA 2OBGA 1H3XA 3DETD 3GHEH 2YSSB 4LCWD 5FF6B 4LBEB 3WUZA 1JGDB 4KKCC 3SDAA 4QXGL 2G5RA 2Q8BH 4KKBC 1FL3A 4LK4A 4X99B 1FC2D 4ZFOB 4LFHG 1GGUA 5FOJA 4ZYKA 2G9HA 2R1WA 5K9JL 3C8DA 1MCFA 3LS5H 4GO6B 5IFJA 1FFOA 4HKXA 3BZFB 1CN4A 5DWUL 3BPLB 4WUKH 1X6LA 1IGFL 4JO2L 1NMCB 1JGEA 3QUYA 4OGYL 4MWFB 4LSPL 1U3ZA 2IPUK 1G6RB 5FYKD 3SJVB 1UKQA 1CGUA 4OZHE 1QR1A 5C8JA 2Z91A 3ZKSD 5EU4A 4G9DA 3P0YL 4KK5C 4JANB 1R5IB 3TO2A 4M03A 5FUCE 3QXDA 2H32B 3ZYOA 1S9XB 4P3DA 3OKDB 2AK4B 3IKCA 1A3LL 2A0LC 3OR6B 3UO1H 1F6AA 1GC1C 3KPSD 5CWSB 1TVHA 5I0DA 3TN0A 1D5BB 1LD9B 2WBWB 4JFOB 4M48L 2XN9A 4NUGL 5D2LA 1MI5B 4I0KA 4N5ED 4OZHA 4U1JA 4Y16B 3OKLB 1XIWD 1A9BA 5IW6A 4BKLB 4NT6B 3ZTNL 4ISVA 1BX2B 3B2VL 3ARXA 2FIKA 1FGVL 4XCEA 5DJ6A 3CFEA 5J11B 3BRFA 1IGMH 3L6FA 4D2NA 3F62A 1JTPA 3SE8L 2CO7B 4X9FA 2MFNA 1YECH 5I1IH 2LABA 1HQRA 3PF2A 1TCRB 4MD5B 3I75B 1J1PL 4ZUUA 3RWGB 5CFHA 1W0VA 5I75C 3KGRA 2NCMA 2YD5A 1BM3L 3OKKB 1QSVA 5DMKA 3RJQB 5IMOB 5I19L 4YHPB 2I07B 4TOYL 4KK6C 3RPIB 3QDME 5GS1A 1FYTA 4L8DA 4YQXH 3SKOB 3UZEA 3KPPB 4S1SH 3QUKA 2AJYL 3TV3L 3JUZA 1VGEL 4NKDB 1KCLA 1UB6A 1ZLUK 5JNYA 4CRPA 2J6EA 1X4YA 3R1GH 1JHTA 4GAYA 5DEGA 2D7TL 5FHBL 1K8DA 4UI2A 3RL2A 2EDXA 3BKML 1D9KA 4WFGD 1U2CA 3O9WB 2D9QB 4LLWB 1QUNA 3MNVB 4BQ8A 4V1DE 3TH4T 4ACPA 1XF2A 2ZUXA 5CZVL 2OL3H 2JF1A 2XN9B 3QDJA 1F2QA 3MRCA 5FO9B 1ACZA 1YPZB 1H5BC 4P23A 2AEQH 4MXQC 3V7AE 1HHKB 1HEZA 4QT5A 1D5MA 3BEWA 4Q2ZB 4P4RA 2ZJSL 3FMGL 4OCRL 4J23A 3MV01 3T1FB 4EBQL 3BMVA 5FYJU 2EICA 1MHHB 3OMZA 5KN5A 1DQLH 1MELA 1LE9B 5EB9A 1RURL 4XC1H 4LKCB 1MCDA 3AM8A 1S7SA 3DV4B 4ZXBB 2BDNL 1BFTA 4FQLH 2AEQL 4IRJB 2DYPB 1WBYA 5GGQL 1EGJH 3VE0B 4DKAA 5KSUA 3I75A 4JFZL 4OLWH 5CAYB 3F7PC 2FR4A 5CP3H 3QUYC 3O11B 5GIRA 3INUL 3B9VA 2XV6B 1ZS8A 1VPOL 2BDNH 4UBDC 4P57B 2EIBA 4P2RE 4PJGE 2NY4D 2DYPD 3SE9L 4YIQA 3ULVD 4KAQL 3MNZB 2VZUA 3IDNA 5B3JF 4C56A 1S7XA 2R69H 4DFHA 1JUFB 5DDHB 1LVEA 2GJZB 1TJHL 4UMGA 1OGTB 2W60A 2KZWA 3QEHA 1I7UB 3OKYA 3C5ZA 4JJHA 5DO2D 4AYFA 4PJEE 4M3JA 1I1RA 3T09A 4K7PH 3RY6A 3M8OL 4WI2A 4LLDA 1ZT7A 2C9AA 4HUWA 4P2OA 4X4ME 5SX5H 2AJ3B 3HFMH 4D94A 4YXKH 3CLEL 3GSQA 4GG8B 2V6HA 4NHUA 3VFTA 3UPCA 4TULH 2AP2A 3W9EB 4OKVA 3E6HB 2BNRE 3ZE0F 1NJ9B 3AS1A 4HFUH 3D69A 3WLWD 2CO6B 3D3VA 1HCFX 5HYQB 1DQMH 1BQHA 1NCBL 4P2CG 1XGYL 5D4QA 1AGBA 4HS3B 1CE6A 1Q94A 4GW1A 1BEYH 1MJUH 3NMEA 2DRUA 5F6IB 3BZ4B 5CJBA 3W11C 2EC9U 1P4IH 3MA9H 3IDYC 1LILA 3QUXA 3UDWA 1T04A 4UDUB 5CIPA 4N0YL 4PJHE 3HE7C 5BZWB 3WYRA 3ZKQD 4ZD3H 4NZTH 4NUJA 4CVZB 3H3PH 3OAYK 1I9EA 1JV5A 2BOBA 1KNOA 1X7QB 5I66B 5T5NF 1CD8A 1MQ8A 4JZJA 4LHUD 5LBSH 2VDQH 3KPNB 5F89B 4JFFD 2ED7A 3OR7A 1NGQL 3UCRA 5TE4H 2DS4A 4UNTA 3ZHKA 3LB6D 3GSNH 1KT2A 3C9NA 1II4E 2EE3A 5E8DL 1NCAL 5HJ3A 4U6VL 5HVWA 3U0TB 1ETZA 3FB6A 3CDCA 4G8GB 4GKSB 2ZUSA 1SEBB 1NGQH 1QLEH 4KK5D 3ARGA 2IAMD 1OTTC 1HHGB 5FA4B 4PGEB 2NNAA 1FNEB 2YMXL 3EJZD 1ZV5A 1A6TA 1BPVA 2PW1A 1ORSA 5DVLA 2APBA 4P23C 4MXQA 2VWEE 2VIRB 4NHUB 3GK8H 3M1BB 1BVKA 4QRRA 3QNYA 4CU7A 3GBML 1SJEA 5MI0C 1ONQB 1RIVL 2P47B 4MS8C 4DKFL 4QRTA 1NAML 2EH8H 1TITA 1M4KA 1P2CA 2IPKB 1WUNT 3I50H 4UDTA 1X44A 5FO7B 4QHLA 4GW1B 3L5XH 4M6AA 2YPLE 2NZ9C 4M61B 2R1XA 3ROOB 3SE4C 3E8UL 1CICB 3MMEB 1IGIH 3UTSB 4U6TA 5I8OL 3WDJA 3BSZL 3DGGA 4TNVF 5IM7B 2CPCA 2X41A 2BSTA 4F9LC 2CDEB 5CD5C 1PQZB 5ISZD 4OCXH 3Q1SL 2ZZUT 3SGDI 4HT1H 4PRNA 3WE6B 2V2XA 3O4LB 4GRWH 3U4BH 4U1MA 4NRYA 3C5SB 3IVKB 2FCBA 1A9EB 5BVPH 1LEGA 2XTJC 4MNQB 2YA1A 4U3XA 4OI8A 1F45A 3RHWF 3AMKA 1T5XB 5J9PA 3VXQA 1IFHH 4MCYB 3JWDL 3O3DA 4ONOA 3GKWL 1NCAH 4ZAKC 5FV1L 1OGAB 3S5LG 1DANT 3BWUC 2MCG1 3LEVL 5SX4H 4CU6A 2FEDD 1UKTA 3Q6GL 2P43B 1PDKA 2UZYB 3VXMB 5AZEH 1FN4B 4OJFH 5JHDD 3S9DB 1BAFL 5C0AE 4GRMA 4EOWH 5L7XL 4GH7B 4I3RL 4Y2DC 2SEBA 2ED9A 5ITFA 1MY7A 4YO0A 4Z76A 5CGMA 4OV5A 1CD9B 1SQ2N 3RX8A 3BGAA 3GK8L 2ZKHH 4PBVC 2XA8L 2XZCL 3QIWC 3M07A 4Y2DB 2ZOKB 1SHMA 3QYCA 5L2JA 5JXEA 3RWEA 4FABL 3ILPA 3B9DA 2DB8A 2X1QA 2KBGA 1N6QL 3NIFF 1YN6A 2XY1A 4MB4A 1WF5A 3QXWA 3OB0K 1ULVA 3DWTA 3N50A 2GY5A 1CVSC 4R4ND 3QULB 3CXDL 1Q9KB 2Y23A 2V2WB 3TYFA 4GFTB 3TJEL 4ZFFA 5C0CB 3I6KB 3D39E 3OXSB 4P5TA 4GMTL 5C09B 5H2BB 5I16B 1PGRB 4E41D 5ETUB 3CVHH 3FN3A 4WHYG 5I8KL 2AJZA 5EZOH 1EERB 3MRNA 3B83A 5E8OB 4XNMA 4HT1L 5IW3A 4LVOC 1WZ1L 4UT9H 1X5XA 4RAVB 4WO4B 2Z93B 5C0FA 3U30C 5BV7B 4OFYD 5DJZA 5J9PB 3U36B 4NZRH 4WWKD 1I9IH 3PWPB 4G6FD 1FORH 1IQWL 1J0KA 2BSSA 2BNUA 5EOCJ 1ZVYA 3DVGA 1FQ9C 3AAZA 3CVHB 5DFTA 2IBBA 4K3HA 4NQXB 1B0WA 1K6QH 4NWUH 1J05A 1KIPB 4MSWB 4PJXB 3D2UB 4KK8C 1HK6A 2Q20A 3FFCA 3QUZD 2I9TA 4Y4KB 1AKJD 1WFTA 2VDNH 3X3GL 4NQDB 3BT2H 1DUYA 2NY0B 2VLRE 1MLCB 3A67H 2UUDK 4Z95H 1PLGL 1YY9C 4WJ5A 2F53B 5C2BL 1Z9OA 2CRIA 4FXKB 4A2MA 1XIWB 1J1XL 2VISA 3U7AA 3D3VE 3MFGB 4U7KA 5FDWB 5HYJE 3MREA 1DVFD 4NYLB 3MCLL 1AGDB 3CLFL 4U1SB 1L0YA 4OM1L 5DJAB 1MFDH 1XGQA 3P30H 1QD0A 4HIXH 1H8NA 1A6ZA 1FJ1A 4GRWF 1KJ3L 5ADPL 3IXAA 7FABL 1CFNB 3GSVB 3UTOA 1CFBA 1NCCH 4AEEA 1HWHB 2YBRA 4WU5B 2VNCA 2OQJB 2X7LB 4PREB 3UTTA 1Q9OA 1MH5B 3ARDC 4MJ2A 4KI5F 3CLFH 4OD1H 2LV4A 2Q3ZA 2R2BA 7CGTA 5T3XL 1YZZA 1HSBA 4HAFA 3GIZH 1PG7L 1LO0L 4LCIL 5A3ID 4NQUA 5I0ZA 1A21A 4K7FB 3ZLQC 3BPOB 1IAIH 5IB3B 2IEPA 4QHMA 5CILL 2R9HD 3CDYA 1ADQA 1A6UL 5I1LB 2DQJL 3F7RA 3CH8A 1A6AA 3JV6B 3P73B 5FKPA 4K3DH 3VWKD 4M4RA 4E41B 2HKFL 3GMLB 4OF5A 1JRHH 3ARRA 4XVSH 4CAGA 2NXZD 4NNXA 3BUTA 1EO8H 3CSYA 3QSKB 4HH9B 5I17B 3H7BA 1MWAL 4NQDA 1FO0B 5IB2B 4ZTOL 1DFBH 4K3EL 4U31A 1GGBL 4G6FB 1Z0MA 3PWPD 1JVKA 1NCBH 1IC4H 1SVZA 5ICXA 5JOFA 1I8IA 2X2YA 3T2QA 5BRZD 5BVJA 1LE5B 2VDNL 2JB6B 4HC1H 4QHUA 2GCYA 4RMWA 5J1TC 4GXVL 2AJSL 3DRQB 2E6PA 1PLGH 2UWEB 3KWWB 4G8EB 1BJ1H 1UACL 5TFSH 5D72H 3WXVL 1FNLA 2A6KB 2DMKA 1P4LA 4DTGL 4NQEE 5ENWB 4R2GB 4XNZC 3O6LH 1ADQL 3HA0A 4HFWB 3W81A 4WI4A 4Y89A 1U3HB 1XCQB 4HUNB 3EYUL 3MBXL 3GMOA 1WVZA 3DIFB 3TVMD 5F9JB 2HA1A 4PRHD 1WBZA 1LP9B 3FN0L 3AS0A 1Y6NR 4IS6A 1QSFA 2F19L 3VRIA 4BZ2H 1UVQB 1JTOA 5DRWB 4L3CB 3EO9L 1YEHL 2XFXB 1RUPH 1AHWA 1G7MB 1BJMA 2DTML 4E5XB 1HHHA 4PJGB 1U8OA 1MFEL 4KRNA 1SJVA 5KW9H 4YC2C 1WBXA 3KPRA 4AEHH 1N5AA 5LVEA 3IXTA 3VGEA 2DM4A 1MSPA 3S88L 1A6UH 1EX0A 3P4MA 3SQOL 5ALBL 1CDCA 5JZ7D 3JWDC 3OKEB 4DKEH 3QIUD 3EYOA 4PJFB 1T0PB 3KYMB 4JHWL 5F7EL 3WJLA 4F7TA 1G7LB 3QFJB 4KY1H 5D1XD 1OB1B 4JM2D 1YEFH 4NO5B 2JB6A 4PB9H 1A6VH 3PGDB 3D1MC 1X4XA 4U3HA 4U1KA 2BNRB 4DEPB 1WZLA 4FNLH 4JN1L 1A1MB 4OKDA 4PJ8B 5T1DH 5F7EH 3T3PE 2XN9E 5H37G 2ADGB 1D5IL 3EYQD 2D7QA 1EMTL 4YGVB 4DGIH 3QDJB 1D7FA 3WXVH 3GBNH 1CGYA 1T4KA 3NIDE 3MRMB 1FVEB 2AQ1A 1ADQH 1Y6KR 4JKMA 3FT3B 1NSNH 1OAKH 1U8NB 4M6MH 3L5JA 3PDOB 3CZFB 1XCTB 3RIAK 3BQUD 4NO3B 3TFKA 1QFWI 2KZ1B 3FN9A 3MRQA 1IEBB 4QKXB 4D8PA 1U92A 3LKQA 4XCFH 1P4BL 5DD1L 1KACB 4HF5H 1BF8A 4ODVL 3QHZL 4U3CA 3VD4A 3GKWH 1T7WA 5LWYH 2PYED 2FEEI 3DARA 1S9XA 3NPZB 4P3DB 1X6NA 5CP7A 1XIWC 3FTGA 1S3KH 2ZP0T 1X3DA 5EIIB 2FJGB 3T4AA 1CU4L 5DD5H 2K9UA 1AD9B 1DEEB 4FTVA 3SGKC 1EJOH 5C6PB 1A02N 2UYLA 4PJBB 2QQNH 1CVRA 2BRRH 2R29H 3FFDA 1DN0B 1FFNA 1OSZB 4R4BB 3H9SA 3MV7E 2NX5E 2YZ1A 2CUHA 1NL0H 4QF1B 4JFPA 3RVUC 4WTZA 2EKSA 1YJDL 1XGUA 3HHRB 2ADIA 1QRNE 1S9YB 3FT4A 1GZQA 3TBTA 4DVRL 2FIKB 1M6OA 4KQ4H 4YBQC 3BD3A 5ISZA 4N9GB 3VWJB 2GK0B 1R3HA 3DUSB 3L95B 2J8OA 2A0LD 5E94A 5GHWL 4V3EB 4LSUH 3AXLB 1Q1JH 2P44B 3F65A 4LHJB 1KYOK 3VXTA 1RULH 1IGML 3GUTA 4KZDH 4Y19E 5D7SL 5CEXB 4KPHH 1A1OB 5J13B 2E6JA 5JW4N 1YPZF 3I3DA 3VFSA 1RFDL 1I4FA 4JEGB 4CN6A 1KEGL 3NAAH 4A6YB 1RULL 1J10A 1G84A 2CH8A 4FFVC 4M02A 4JO3L 4AMKH 3CLEH 4LNRB 4Y19A 1I9IL 5F44A 4TULL 2RGSA 4O5LL 4XPHL 3H9HB 4KPHL 2CIIB 2X42A 1BD2D 1KPVB 3OR7B 2XQBH 3WJLC 1QVOA 2R2HA 3LPWA 2UVFA 4R2GC 1LO3L 4JFHD 4QRUA 5JLZA 3PHOB 1T0NA 4PJ9D 3HC3L 4TUKH 4XVJL 2BSRB 3P4NA 1DBBH 3S3JA 4JFPB 5L88L 5GISH 4TUJB 1RJLB 4H26A 4QHNB 4DFIA 2FWOB 1G1YA 1QSEE 4KHXH 3ROLB 3UYPA 1NGZA 1RMFL 4TUKL 3U0PB 4BH8A 4G42A 2ITDB 4ZXBA 4YHIB 4P4KD 4LSSH 5KVDL 3QA3B 2HT4D 1H8SA 4LQ1A 4I0PD 1KGCD 2B4CC 1JGUL 1I7TB 4X6FB 3VXNB 2AJUH 2NY3D 3CC5B 5GS0C 4G8IA 3H9SE 4NIKB 3P4OA 1J0HA 4JFEB 4M9PA 3PWVA 3VFWA 4YGAB 2H6PA 5D1QB 4G7VL 3LQZB 4UUJA 3L1OH 5IBTH 1Z9SA 2BRQA 1IM9D 4PJAF 1JGUH 4HCRA 4WUUE 1QRNA 1OL0A 1XR8B 4NM4H 1CK0H 4DGVL 3NIGE 4X7SL 3S5LA 3LV3B 4AL8L 2APXA 3VXME 3QUZA 2R0LH 3LAFA 2V17H 4FFYH 3T08A 1F4YH 3QEUA 2YXFA 3GSQB 4GG8A 1KJVA 2AAVA 3BIBX 3QFDA 5F9WB 4X6DB 3UJJH 1Z6JT 4GQ9L 1EO8L 1OWRM 1V3LA 4X7SH 1T0MB 3FO9A 5D71H 4FQHA 1F3DJ 5I1AA 1T3FA 2EYSA 4XVJH 1Q9WB 5ILTL 5JHLL 3RVVD 3H7LA 1PVHA 3OJDA 2Z8WC 4OD3H 4OCXL 3RNKA 3CUPA 2NY0C 5FYKU 5FOBB 1AP2A 2X4NB 5AUMA 2C3XA 1GH7A 4NNYA 2AERT 5CKGA 2MCPH 4F37F 3X13A 4PP2A 2LFGA 4GW5A 3IFPB 4J2XA 4G9FE 1J12A 3UTSE 4RGNB 4POZC 2Z9TA 4HK0A 5GGUA 2OLDA 4EDWH 5F1IB 1HSAA 3TA3A 1J8HB 3GSUA 1CGWA 4P3WA 4PRPA 4QCIB 5HHOE 1NFIB 2W59A 3IU4H 5F70A 4D0CA 2DTSA 4PJCB 2AKRA 3VFVA 3SE3A 3V4VH 4X9BA 4QGTA 4WW1A 5CLWA 8FABA 5KTEH 2BOCA 4LLMB 5L6YH 3QJHA 3NFNA 3A6BH 4I2XE 1WFOA 4XRCA 4UTBL 3U46B 5J6HB 3ALWA 3AREC 4JPIA 4JRXE 1N2RA 1CQKA 1A3LH 2X4RB 3MOBL 3GJEA 3UO1L 2AJZB 4ONGH 5IROA 1KJMA 1YYML 4M1DH 5EC2B 2VDML 4HIHA 4DAGH 1I1YB 4DZBB 3R0MA 1A3QA 3MUGA 2IADA 4Q6YA 1OP9A 2Z0BA 1U93B 3AMLA 1MAML 3MNWA 1QACA 2ESVA 4X99A 4GXUN 4X83A 2IMMA 5BO1L 2FYYB 2QQLH 4W6WB 4W70A 1ROWA 1NCDL 5C0IA 3BPCA 4MB5A 5E8NA 3OJ2C 4TSAH 1X5LA 4Z78B 2VL4A 4Y5YA 1RUKL 4X8JA 5GZND 1UJTA 3L5XL 4ELMB 3PABA 1MRFH 3B9AA 1F2XK 2MPAH 5BO1H 1TNMA 3FO1B 3RWFA 2IALB 3CNKA 4PUBL 2FD6H 5T3XE 5J1AB 3RDTC 2Q76A 5C0DA 4KI5C 1QSED 1K8IA 4RAUA 5CSZA 5KSBA 2VSDA 4CL7A 4MS8D 1RUKH 3QDGB 3QIBD 1XZ0B 3S97C 2HYMA 4WI5A 3PWNB 5ITBL 2MPAL 3T8XA 3LDBC 4KROB 4EDWL 3WSQH 4YDVB 3P0YH 1QLFB 1WZMA 1W72A 3U4BL 2XPGB 4ODVH 5DS8A 5DVKA 3BHBB 5I1KH 3RDTB 5IKCA 2A6JA 5C71A 4XI5C 4GG6F 1IM3A 3LKSA 2Z31C 2X05A 4D3CH 5C0CE 4H1LA 1TETL 2RJMA 4FMFA 4WO4C 5IWLA 4MXVF 4H5SB 3HZYA 3X3GH 3IJSB 1NKOA 3VFRB 5DTFB 2H45A 4I5BA 5HDBE 2RFXB 1NGPH 3PWLB 4X6EA 4PJXE 5BJTA 1QBLL 3ZT7A 1R5WA 4ZSOB 4M00A 4AIZA 4O2FA 4NKMA 2XXCB 1GC1H 1MJJA 3H6JA 2R4RH 1T1YB 3QJFA 1TCRA 3RL1A 5C70A 3L3HB 1EZVY 3KPOB 1R5VA 5HHXL 4RISL 4P59L 3GGWA 5DEFA 1U8QA 4O00A 2DWEB 1F58L 5DURD 1MVUA 1NGYA 2E27L 3NCYP 2X4SA 1D6EB 4Z77A 5F7UA 2PYFA 1NBQA 2VE6B 5CINH 3BKYL 4BK5A 2NYYC 4RBPH 5I9QC 1N8ZA 3JZ7A 2A73A 2HTKD 3MFFB 2EDYA 4GT7A 5EUKA 1JWUB 1U8MB 4H0HB 3DURB 2YK1H 3TN0C 3SE9H 4L8CA 2X4QA 1IQDA 5F9AC 3MV7D 5JW3H 2BC4B 3GMMA 1HXYB 2FL5B 1I9RH 4X4XB 5C9KA 2WANA 3MJ9A 2PN5A 3RNQB 1GOGA 2R69L 1JNLL 3RZWA 5C0GB 2FIRT 4XX1G 5B4MC 1ZGLM 4XXDA 5HTSA 2CKNA 1D6VL 4X0KB 3VJ6A 1S7UA 1W8OA 1CG9A 4ZTPL 1A3RL 5FECA 2K1MA 1I9RL 4X4ZA 3BP6B 4W4OC 1RJCA 3QDGD 2FLBT 2WLYA 2XY2A 1TETH 2C3GA 1V05A 5TQ2H 2XNAA 4EBQH 5BS0E 1UACH 1S7WB 4XWOD 4ZTPH 1P7QB 1VGKB 3VFPA 4DTGH 3QP3A 5J0BA 2D4DA 3MJ8A 1E4KC 2DD8L 3RA7L 3RVTC 3ULUC 1KULA 3CFKA 1WK0A 4PRIE 1PW3A 1QSFD 5FA3B 1ZS8B 1WTLA 5CS7A 1PEWA 1U8QB 4JO4H 3TPUB 1EFXA 3GSOB 4OLWL 3SQBA 1JZ2A 3LHPH 4DUXA 2X4UA 1TZHA 4DVBA 4XB7A 4I48A 5DHXB 5KANI 3K4AA 4P59H 3SJVD 3KPRD 1AO7B 2HVKA 5FM5O 4QRSA 1OB1A 4B41A 2Z4QB 3REVB 3VFMB 5EZIL 4CNIA 3I9GH 4RGOH 3RX7A 1GPOL 5KW9L 4ODSH 3GSNL 3LQAH 1B4JL 2OK0H 3MOQA 1ZA3B 3IFLL 5C0BA 5C0GA 4CVUA 4HULB 3KPSB 1A7QH 4DN4L 1E6OL 5JR1H 4JG0H 5ALBH 1T4KB 3ARQA 5FK9A 4M5YH 3MBEB 4GSDH 3S37X 4E42A 2FEEL 5GSVB 2W65B 4R0LB 5DJCB 2DBLL 2VDPL 4ZS7L 4JVWA 4NSKB 4LQFL 4KI1A 5HDQH 3BESR 5IQ9A 2BCKA 3HMXL 5JQ6L 5C07A 2J1KA 2XWJB 3C09B 4HFUL 1IEHA 1LK3L 3ZO0A 3IGAA 4K3DL 2C3VB 3DRTA 2K7QA 4Q9QL 4KKNA 4B7IA 2NX5D 1JNHB 3MYJA 3PL6B 4UDUA 3H9ZA 2WIIA 3FRUB 2AEIT 4LCUB 4ZXBD 4Y1AB 2VN7A 2DBLH 4PJ9B 1DE4B 4QXGH 2NPLX 4XNYL 3CH1A 2IH3B 3CSPA 3R0NA 3KYNA 3C2SA 4RBPK 1DBMH 1NAKL 1OCWH 1WZKA 2EYRB 3GRWL 5IP4A 3DRQA 1U8PB 3LKRB 3ARSA 5HHOA 2C7UB 4NRXB 2QKIB 4WU7B 4Q6IC 4MJ6B 1T5WB 5EU7E 4HS6B 1NFKA 1CDUA 2ITCA 4OGYH 4DEPC 3GSNB 4APQC 3HI6L 2HJLA 5F7LB 1AXIB 1Z2KA 4P23B 3U0TA 1C8PA 1JZ4A 1U91B 4NWTH 4F7PA 4YDIH 2GSGB 5HYJD 4G9FB 2H2SD 2ADFL 4IRZH 3KXFB 1E27B 4PGDA 4P2OC 3N85L 3RVXC 5CBAA 2FATL 4Z7WA 1K4CA 1JGLL 4YDJA 3T65A 4G80A 2DQIH 2ADJA 1MAJA 3T3PF 3QXUA 2BK8A 3ESVF 1E28B 4LHUB 5E08H 1PD6A 1S7TA 4JG1L 1BQLH 4XX1E 4ZUSA 4ZS6C 1QLEL 3MQIA 3C2AL 1NMBL 4RZCA 1T1WB 2ADFH 4IRZL 5ALCL 4W4OA 5EBWB 3LQAL 5FK9B 1LEKA 4XZUB 4TUOB 4P3CL 3ARGD 2A74A 4P9HH 2BFVL 4QRPE 4WUUA 4Y4HD 1I1CA 5EUOB 3L3GA 2I5YH 1A1OA 5K9OB 4C83A 3BP7A 3CFDA 3PJSA 2P4AB 4PJDB 3HE7A 4I3RH 3VGDA 1QFOA 3K8KA 1FGVH 1KFAL 5JPMA 3VXRB 4KTDH 4ZNEA 4CMMB 1A0QL 3VXPA 5I1JH 3CCHB 1AXSB 4KVNH 4ETQA 2JJVA 3BKJL 3FQRA 4CJ0A 1B88A 1OGTA 2W60B 3QEHB 1I1AB 2DLFL 4IIQB 2HH0L 3GO1H 3SKNB 3T0EC 1RQ5A 1EZVX 1OTSD 4KI5E 4S2SB 1EHNA 2WW8A 3TWCH 4IMLA 4OZGF 2GT9B 1ERNA 4OLZH 3BIKB 5E0QA 2YPLA 4NKQB 5F7DA 2C5DC 3O2DH 2ARJB 5ESVB 1YEFL 4NCC2 1EVTC 4HGWA 1FORL 4JFDB 2WUBL 4UINL 4P2QE 1ACYL 1UXWB 4YE4H 2YKLH 3ZDYF 2OSLA 4NQVA 2V7NA 3B3IA 4FNLL 1EAPA 2YEZB 3D9AL 5GS2H 3B9KC 5KSAC 5GJTH 3CSGA 4HWBA 3CVHL 2WUCH 1YDPA 2PO6A 2ITDA 1K3ZA 2APFA 4N0FB 2YPVL 4CVXA 3D85D 3MRJA 4CBPA 3SJVE 3D9AH 1NMCC 2PR4L 1JYNA 1O7VA 3LZFH 4NZRL 5MP6H 2P5EE 3LEVH 2GYSA 4L29A 1YNKH 3HTLX 4TUOA 4YFLI 4JDZA 2BOBB 4PGJA 1WTGT 3PP4H 3QAZB 3EOTL 3HI5H 3ZDXF 2YPVH 2YUVA 1IGYA 4P4KA 3GB7A 1VHPA 2HFFA 1B4RA 2OTWA 5LWYL 5TE6H 1A4JB 3DYMA 4HDIB 4M93B 1CXFA 5DSCB 3QIWB 1DN0A 1FFNB 4NWUL 3P9MA 5DD0H 4F7CB 4PJ7E 1AJ7L 1YMME 2XKNB 3PP4L 3JBG7 3MGTA 4IOIB 4Z7UB 2EYTA 3DSFH 4JDVB 4P2QD 5KJRH 5IEKA 5K33A 3PQYE 1U8IB 4CKVX 4LVOB 1A0QH 4KC3B 5DR5L 2YD7A 2V2WA 4Y1AE 4ZQKB 4JFYB 4JQXC 1BZ9B 3VRLF 2YPKA 2QQKL 5FUZH 2PW1B 1G7IB 4JY6B 5BXFA 3TCLA 3TZVD 5F93C 4HUVA 1MJ7H 2FX9L 4FFEX 5C92A 1IM9A 4G43A 5JORA 5CILH 4X7TB 3L3JB 4XP9H 3ARBB 4IRSB 4Y88A 4X6CB 4ZAKA 3LEXA 1D5XA 2GJ6D 3GUTB 4IDJH 1FL5B 5HYSG 3WEXA 1I9JH 1ACYH 4ONFH 3B43A 4XVSL 4JPVH 3E2HA 2GKIA 3REWB 4GXUM 5IB1B 1WT5A 1U36A 5IMLB 3HPLB 2BVUA 2Y1VA 5JW3L 2VC2H 4XCCH 4LAQH 4M3KB 3QCUH 5JMOC 3QDMA 3HPJA 3EDDA 1A22B 1GAFL 1IC4L 4OB5L 5HVHC 4MDIB 4U6XB 4PJ9C 5ANMA 1YEIH 3OZ9L 5KS9E 1DUZA 3NZ8A 2FGZA 3T0BA 1BREA 1YEJH 4PG9A 2XKSA 3SY0A 3N1MC 4EDXB 2VR4A 4MA1B 1BZ7A 2BNQD 1CD1B 1IAKA 3SKUD 4J12A 3RTQD 4HKJB 5ACZA 4H8WC 4NJ9L 1LEIB 5ERWB 1LGVA 1KTLB 2BMKB 2Y36L 1BEYL 1MJUL 4HIJA 1MCBA 1R3JB 4Z95L 4GAJL 1CDGA 4IDLA 4OLVL 1UJ3B 2NZIA 4K3EH 4GUPA 1AKJA 1HXMA 2HLFC 3L9RB 1N7ML 4F2MA 4Y4KD 2OMNA 2J7LA 1CD0A 5E7BA 5B8CA 3IFOA 5DXWA 4HUVB 1MFDL 4RDQG 2IGFH 4Y16C 3HRZA 3V52H 3OKOA 3KPTA 1XGTB 5GGRB 2JJTC 5IFJB 1KBGH 3CX5K 4MJID 5D93C 2X09A 3IJHA 1UWXH 1JL8A 3MNWB 4X6FA 3FQXB 2Q3AA 1S7QA 3ECBB 5BS0D 4O51B 5FUCC 4ZPTB 3VI3E 1IMHC 1T7XA 3GSRB 1E4JA 5E5UB 1CR9L 3A6BL 2BVYA 4XP4H 4P46A 2DKUA 4FG6C 1GPOH 5E9DD 3RWHB 3S98A 3V7AG 1WV7T 2ZUTA 1WAAF 2M2DA 3FCTB 3MOBH 5HPMB 4ZUVA 1KOAA 3UTPE 4G6JL 4P4KC 3ZKMC 4X6DE 2DQJH 2DTMH 4XNQB 4QXUL 4JRWA 3JTSA 2PTTB 2DWDB 4WHDA 3QRFM 1FSKB 2JCCF 2Z92A 4M7ZB 1INQB 3IF1A 1KN4H 2JJSA 4L9LC 4DGIL 2V2TA 3HE6B 3T0EB 3K8LA 1CL7H 1HYSD 2XTJB 2VABB 4HS8H 1LK3H 1NCDH 5IIEB 2MNUA 4KMLB 1NSNL 4Z7VF 5HBBA 3O8XD 4MA7L 1P1ZA 2ZSVB 4M6ML 2R4SH 4LDEB 1J0ZA 2ZUUA 3RWDA 1ZLVK 3MJ6A 3PV6B 1MEXH 3GHEL 2OJEA 3L6FB 2VXSH 1O5DT 3O45A 2F5BH 1ZGLA 3LRSB 4NQCE 3C08L 3MLXL 1F8TH 3QWOA 1SYVA 4JN1H 3MRLB 2HG5B 4GBXA 5ANME 1S8DA 2C1PB 1U8HB 3GI8L 3KR3L 3EIFA 3ARVA 3U4EA 1U8LB 1JNNL 1MCNA 1QSFB 1EMTH 5HHMB 1VACB 3SKJL 2HLAB 5C0RL 1LO4L 1H3GA 4JFXB 4XH2B 1TQCB 4F7EB 2I07A 3RPIA 1JHLH 2BXZA 3CAFA 5GSRB 3KPPA 2GI7A 3QQNA 2KDGA 2NY5H 1U3HD 5CZVH 1FFPA 1ZTXH 3GBLA 5D7IA 4P49A 1I3VA 2PF6A 3IKCB 1W8NA 2B20A 4FP8H 5IHZB 2VDRH 1FIGH 1MFEH 4MVBC 3EYFB 4PJ7B 3LSOA 1S78C 1UYWH 4AEHL 1OM3L 5L0QB 5K9KA 1ZTXL 1G9MH 1S7XB 3TT1H 1DLHA 1FNHA 3OHXB 1YYLL 5EBMA 1N2RB 1MIEL 2BFVH 4WW2B 3BD4A 5GGQH 2A6IB 1VERA 4RGNE 2F53D 1QO3A 1EFQA 1BIIB 2P8PA 2OTPA 4KY1L 1VADB 4BH7A 1MNUH 3QRGL 3B2VH 3PHSA 1EHAA 2DLFH 3SBWC 4S0TD 1NFDE 5HY9A 4Y8AA 5I6XB 4PTUA 5HI3D 1KB9K 3HG1E 3DXAE 3OB0H 4JM2A 3TJEH 3SE8H 4R7NB 5BOPA 3VXMD 2R56H 5J6GA 3MV9A 4ONHB 5EORH 4JZOA 1BIHA 4Z7WF 1A7PH 1AHWC 2Y07L 1EEYB 2DM3A 5MENB 2BP3A 5FYJL 5C8JB 4M7LH 4U0RB 2KUTA 3BKCH 3UXFA 1QSZA 5SWSE 25C8H 3CFJB 3SKMA 5I19H 1JNLH 1LNUB 3MLPA 5DQ9B 5DT1L 3F12A 4YQXL 3SKJH 1H3TA 1ZVSA 2AQ3A 2AGJL 2BHYA 4PLKD 4XNMB 3DPBA 4JZJB 2UZIH 3C5JA 5ICYB 4YXLH 1A2YA 3TF7C 3BKCL 3HS0B 3MA7A 4TYUA 4LNVA 4LLWA 4JO1L 4PJ7A 3BUYA 3HZVA 1WIPA 5E2TL 4FP8L 5IW6B 4ZUWA 4O5LH 4XPHH 1S7RB 5DD5L 4MA3B 4ELME 2UZIL 3MR9A 5DJYB 4NPYB 4GKSA 3RWCB 4NJAL 1VESA 3PXJA 4CNIB 2H3NB 4NQXA 5F9JA 1MCQA 2H26B 3HNTH 5E2JA 4HJGB 1QFWM 4RFOL 1X5JA 4HBCH 1VSCA 4KKLD 4ODHL 1DBBL 3ESUF 3ZTJH 4NOBA 4PJ5E 3SHSA 5I18L 4Q9RH 5F6IC 1QQDA 3S4SB 3DSFL 3EYSH 4OFIA 4N9OB 4I18B 1XF3B 2FSEB 4JZNA 5E8DH 4ENED 1G7JA 1T66D 2CJUL 1Z3GL 2AVGA 5CD3B 2VITA 5GHWH 4QRTB 3V5DA 2DBJA 1HKFA 3IDGA 3BGMA 3W82A 2QR0A 5FM4A 5I8EA 2NMSA 3MLTA 1L6ZA 4J8RA 3W5MA 2QTEA 5CGYD 5J13C 1X5ZA 1Z3GH 4PJHF 3T0DA 2PO6D 2WNGA 1JHTB 3NCMA 1I9JL 4Z7WE 2PCPB 4PJIB 1CFSB 4JGUA 3G08B 4HJJH 3SGKA 4KAQH 2NY2D 3MODL 1U6AH 3W2DH 5EU5B 3VDAA 1XT5A 1EXUB 1X5GA 3KPQB 3P9LA 1I7ZA 4MDJA 3MJ9H 4FG6D 2AK4D 1AD0A 4KDTC 4KVCL 2FX8H 2QKIA 5D7LB 3D39A 1QBML 4IBLT 1GAFH 3HG1D 3S6CA 1KJ2B 5EBGA 3BD5A 2D2OA 3F58H 2YK1L 3KNBB 3WFBH 5FB8A 3EFDL 1S7RA 4JRYA 1IJ9A 1NC4A 3V95A 1RUQL 2EXYC 3RWGA 5IV2A 3VGHA 4YHZH 3DNKA 1NBYB 4AM0A 2D3VA 3X14A 5DGQA 5JIIA 2CUIA 2IPTH 3AY4C 4O9HH 4XBGB 4ZNCD 2J8HA 1JPFB 5CGTA 5GZOC 1K2DA 1S7TB 4HLJA 4ZUSB 4NCC1 3BWAB 2ICEA 3S96A 4HWBL 1NC2B 1T7YA 4UDTB 3O8XC 2EDBA 5FO7A 3T1WA 3MCG1 4D0DB 1JN6B 5C09D 1JPGA 4V1DD 1V7NL 5HYSA 5ILTH 1FC1A 4FZ8H 3L3DA 4Y2OA 1CLYH 2VITB 5BVPL 1RIUH 1TPXC 4G6AD 1FL6B 5AWNH 4OGXH 3SOBH 3IDMB 4YIQB 4HKBB 4L4VB 1HHJA 1UENA 3JWOH 4QRRE 4G8IB 5DQDL 4ERSH 2EZ0D 4MMXC 2GAZB 5A3IC 1V7NH 2PXYC 2JB5L 2F19H 1BVLB 1E4XI 4YHOH 3DHMA 3BQUA 3TFKD 3DYPA 5TH2A 1DBKH 2VLKE 1T20A 3QDMD 4G3YH 1AGFB 1UZ6F 2ZCHL 1VEOA 4WFFD 3WN5C 4CJ1A 2ZSWB 3PNWA 3FL7A 1YY8B 4N8PA 2VZVA 4J3UA 1GZPA 2D31A 2BVOA 3OG6B 3D25A 1UXWA 2WBJB 3ARYA 5C0ND 3VDBA 2W9DL 4X6BA 2DQTL 1XF5B 2VRAA 1QFHA 5IESL 2B5IB 3EW3B 2XZAL 4LCCB 3RRQA 5I6XC 1WCBB 1F4HA 3MPCA 2VXVL 4MHHI 1NGWB 2GTWB 4D0BA 3B9EA 4ZXBC 1ZWIB 2M1KA 4RMQA 1DN2A 2XT1B 3BRGC 1V7ML 1MCRA 4NM8L 1UH4A 2OXHA 2AS5M 4HXBH 2IH1A 3VFSB 2J8UB 3TWCL 1LD9A 3MXVH 2XZAH 1ND0B 4PJ5A 2YD3A 3O2DL 4EZMA 2VR5A 1JFMA 2LU3A 2YKLL 5ITBH 4KMTH 4QXTA 1YNLH 4GAGL 3E8UH 1T1XA 1LO5B 2XZQH 2F5BL 5F9OH 4LCYB 4MJIA 3WHXB 2AEPH 4Z0XA 2VAAA 1BM3H 4TOYH 4BSWA 1WIUA 1LDPL 3HLAA 1WWBX 3L3IB 4Z7OF 4POUB 3RUGB 4S1SL 5FYKE 2F54E 1MLBB 2GUOB 3BW9A 5AAMA 3GI9H 3HC0B 4ZS6D 3VGFA 5L2KB 1AE6L 3QZWB 4D9QD 2CMRH 3LB6C 3LCYA 3NGBC 5E8PB 1SYSA 1CBVH 1OP5K 5C0EA 2R39A 1TCMA 32C2A 6CGTA 3HMXA 3I02A 1LDPH 4LARH 1FZKA 2JE8A 1R3LA 4BQBA 1BVKB 4Y4HC 4ZDHA 3NCBB 4P2YA 1BD2A 2CLVA 5GS3A 1MCWM 3IRZA 4M48H 3WNKA 3I2CL 3RGVC 2FO4A 1T22A 4KJPC 5DI8A 3AY4A 2NY1C 3M17A 1M71A 3ES6B 5TQ0H 4J4PA 4TSBH 4RFNC 1NMBH 4YAQA 4HUKB 2DQUL 2WWKO 5K9OA 4N5UA 1RK1A 3O8XA 2V7HB 3PIQA 3QQ9D 4KJYA 2ICES 3V7MA 1RJZA 2HJFA 5HHPB 1ZKAA 4OZ4A 5MEPA 4OTXL 4KQ4L 4QWWD 3S3PA 5F3BA 4F37K 4N0UA 4MA8L 4Z78A 5TQ0L 3LQZA 4Y5YB 5EZLB 4L4TE 1GGIH 2DQGH 3HNSL 4I4WB 5EO9A 1WFUA 3TO2B 5J89A 2AV7B 4NDMB 4P4RB 3QRGH 5BW7A 4P5MA 1CDIA 1EGJL 1F4AA 2PYEB 4TSAL 1OF2B 4LEOA 3V8OA 4PJBE 3ARBC 4I0PA 4IRSC 5AAWA 4HLZG 1QA9A 4ONFL 3DVFA 5IG7A 3PHQB 3O41A 3L3KA 1PJ9A 2G60L 4IM8A 4FS0A 1A7NL 2E3VA 4C4KT 2A6KA 1KB5A 3GM0A 4FQXB 3HI1A 25C8L 3AREA 2MQ3A 2GJ6E 3ISWA 2IG2L 5T3ZD 2F15A 4M7LT 3MROA 1NEUA 5DHYA 1HIMH 4QNPE 2AABL 5AZ2L 4PGZA 1MHEA 1QSEB 4S11A 4YXLL 1NBZA 2Z35A 4Y4FC 1CLZL 2FB4H 5L9DH 1FYTE 3MMEA 2Y7QB 4AEIH 2ESVE 2GITA 3BAEL 4EIZC 2EO9A 3M17B 3PQYD 1VFUA 1XGRB 1FZJA 3QWRA 2OP4H 4U0RC 1JYVA 1FCCA 2FO1A 2DICA 4ZPVA 4GKZB 2X70B 4EUPB 1RZJH 2XFXA 5MP6L 2G75B 2G5BA 4O51A 3LKPB 1IBGH 3O6LL 2R1YA 2OI9C 5IB4B 4Y4FB 2VTFA 4LFHD 4PJEB 3SGDH 2NXYD 4OBSA 5E24E 2DQUH 4XGZA 4F3FB 4HC1A 3V5KB 1PZ5B 3VXSB 4JVUA 3GIVB 4KRPB 4OD2A 5EZIH 4DZ8A 1NGYB 3D3VB 3VXQB 1IBGL 3VFOA 2P24B 3INUH 3DXAB 3S37H 2Q86B 4RQQA 5A40E 4P46D 2CKBB 4G42B 4NQED 3DX6A 3P40A 3UZVB 3D18B 3P2TA 4WEMB 1KPRB 3O4LD 2VLMD 1I7RB 5ESAA 3LHPL 4F58H 3ARFA 1HINL 1D9KD 4BSVA 3RKDC 5FYJE 3HZKA 1JYXA 1NEZB 4LQFH 2EDHA 4LLYA 1JZ7A 2HT3D 5JXAL 5HHNA 5HGBA 1A7NH 3IJYA 2CIKA 5B21A 2RR3A 4IMKA 2R0ZL 5DRZB 1PFCA 5D96C 1M7DB 5BQ7B 3B8YA 5D1QA 1NLBH 3IDUA 1TZIB 2MQ0A 2DQFB 3O11A 1CI5A 4HS8L 3V0WH 3Q0HA 1A3RH 3BXNA 5J1AA 3H7BB 2VSCA 3T0XA 5JOPE 4XB8A 1CXLA 3NH7H 4ELKB 4L3EB 4XCYB 4NO0D 3U9UA 4OZGE 4IEFB 1I75A 4R3SB 1KCUL 3LKPA 2OM5A 2ZWLT 5BZDB 1NAMH 3CFIC 4R7DB 3WDHA 4XPFH 2HLFD 4AG4L 1QBAA 3HCVA 4KRPC 3UYRH 3OR6A 4O9HL 3QFDB 3BZDA 1P6AB 5HGAA 2HT4C 3EZ8A 2V5TA 3FOMA 3RU8L 3HAEG 5HPOA 4C55A 1J18A 1TMCA 5JUEL 2IBZY 4I2XA 4OZFG 4UV4H 4YX2L 5CMAB 4LVEA 3G9AB 1EDQA 4HZLB 2NY3C 2OQJA 5D72L 3H0TB 1TVDA 3C6LB 3EGSB 3BEWB 3QHZH 2RIKA 1N7MH 5KS9A 1NLDH 4XNUL 3JV0A 4I3GA 2YA0A 3G5ZA 3GJFH 4Z5RA 3UEZA 3X13B 1I1FB 1JGEB 3IU4L 2ID5A 4HG4J 3E0GA 4P9HL 3HI6H 5GRVL 4D9LL 4M1CD 1CU4H 1NAMB 2I5YL 2VDRL 5CHNA 5CEZD 3MRKA 4YDIL 3DVIA 4HZAA 1KXTB 2YZ8A 3GMNB 4YHYB 2YMXH 3NIDF 5C1MB 4BSJA 5DD6A 1PSKH 1RZGA 2FATH 5I1JL 1B2WL 1YC7A 3GMQA 2W9LA 4P57A 4Q74A 4OLUH 2CLZB 2WIMA 2VDLL 4LLMA 3HR6A 1GHFL 1UH2A 2I60L 4M5YL 1WLHA 2GSIB 4WI9A 1MUJA 3T77A 1WGOA 1F3JB 2VYRE 4QHKJ 3VWJD 3OF6D 1DQJB 4P3CH 4PJ8C 4MYWB 3RVVC 5HDQL 4U1LA 3VXMA 2NY0D 2GCYB 4YR6A 5BS0B 5ID1B 5I30H 4WV1B 3HAEA 5K9QI 2VLJA 1MQKH 3MBED 5DC0A 5DJ6B 5A2JH 1KCUH 5FGBC 1S9VA 1XF2B 4OAWB 1FZOA 1HXYA 2FL5A 2VXTL 3MUGB 4X4XA 2ZOLB 5IVZA 5AD0B 3HZVB 5HGHB 2ADGA 3I6LE 4JJ5A 4LRNL 1K9TA 4Z0BH 4ODTL 1I8KB 4F7PB 2CLRB 1LP9E 3RWEB 3P73A 5FKPB 1KLUA 5MHSD 4KGLA 1BFVL 4YX2H 3IU3A 3MOAL 5B38B 1RJYA 1KCKA 4S1QL 4HWEH 1HI6A 3QEQD 4YE4L 3EOTH 3HI5L 2QL1A 3RWJB 2EIEA 3EFFA 5CEXA 3O0RH 4U2ZA 3FAWA 5D9SA 1YEDA 3ULVH 1K8IB 4RAUB 1NFDF 1RHHA 5TE6L 5HVHB 5SWZE 3GMNA 1AQDB 1KJ2H 5M95B 3LKNA 3OKDA 4JM4H 4KKBD 1I8IB 3NCJL 1QNZH 2UWEE 3GJFB 4OZFB 3C5ZC 1S9KC 1A7RH 4PPTA 1YJDC 1HHIA 4Q9BA 1EBPA 4MNQE 2BXYA 3RY6C 5KJRL 5LGJB 1LO2L 2KKQA 2CLZA 3OKNA 4XMLH 5T1LD 1YPZE 4C56B 1RPQA 5IKCB 1HE7A 1RZKC 1ZT4B 5D6DC 1SEQH 1FV1B 1K4DB 1NDMB 1RU9H 5I73C 2ZUVA 4YUEL 5C7XL 5DYOA 5HHME 1A7RL 3HZYB 2E9WA 5JA9A 5E00B 4Z7QE 2A1WH 1P7KB 1MOEA 1SJHB 3BE1L 1YMMA 5CJ8A 4E41E 3BVNB 4XMLL 1FNSL 4FABH 1EHXA 5FGRA 1J0YA 1RU9L 3NZHH 1J1XH 3CXHJ 2Y25A 4Y4HB 1N6UA 3OXRB 3HE7D 5DRXB 4QHNA 2ILLA 4XVTL 4OKVB 4NHCH 1KJVB 2Q87A 1IEAA 4PRAB 2XWTA 3UAJC 2E27H 5HY9B 1WWCA 4YK4B 1SMAA 3GM8A 3QCTH 5IF0B 2VC2L 4XCCL 3BDXA 1P84K 1U8KA 5MEQB 3KPRB 2VQ1A 4WHTA 5C08D 4UINH 4R96B 1R3KA 4LRNH 3QNXA 4GMSL 1WC7B 3MRBA 1U6AL 2HJKB 1VB9A 4U1SA 5DJAA 2ZG3A 3QAZC 2EIZB 1I8LA 1MFBL 2VE6A 4JRYD 4KVCH 1CICA 1MFAL 2JIXD 1E6JL 5GQBA 2R0LL 3WLWC 5FXCH 3P4OB 4RMUA 3OSKA 2DM2A 5C0BD 5IM7A 2CDGA 4GW5B 3UJJL 3SDYH 1DDHA 5CBEA 3TYGL 1PKQE 3P11H 2LVCA 3EOBB 5D2NC 3RGHA 1KJ2L 4LRIA 2VDKL 4PJ8A 1OSZA 2N1KA 4R4BA 3U2SA 3H9SB 3LN5A 3ARGB 2FLRT 1OQOA 3G5VB 2IPTL 3O3BA 3U0WH 3D85A 3VFTB 5F1OB 4RGMB 3VFGL 2OP4L 5C07D 3ULVF 2PW2B 3D69B 3ARWA 1LO3H 3BEVB 4FFVD 1TFHA 1R3HB 2YC1B 1KTDA 4OSUH 2YSSA 5FF6A 1FH5H 2YPKB 5IOPA 5FIEA 5TDPB 4HC1L 1E4XL 4OZGA 3HZMB 1W0WA 1RI8A 4Z7QF 2FZ3B 3TH2T 3DI2B 2AJSH 1MAKA 3R06B 5KSAA 2NLJB 4LLVA 4RFOH 5BZWA 2YUWA 5BV7H 3AGVA 1H3PH 4OQTH 5DMGC 1B6UA 4WCYH 1NFDA 1RVFL 3WUWA 5SX5K 1KXVC 3WIIL 1L0XA 3UX9B 3KXFD 1AD9A 1DEEA 1RSFA 3CC5A 2HJKA 3QWQB 3IDNB 4JREB 5K93A 3IB4A 1AI1H 1KSRA 2YXMA 1LO0H 1I8MB 1YMHA 3HNVL 1ZHBB 4FFWC 4L4VE 5E4IA 1X9QA 3H3BC 4LVNC 2DJSA 2KQNA 4WJ5B 4EI6B 2Q6WA 5JHDB 1RVFH 3QH3A 1UA6H 4OF6A 5GGRY 1C12A 2FJHB 1UKSA 4OLXH 4PJCA 1HHGA 3RI5F 1ZT7B 4OB5H 1DJSA 4U1MB 3WD5L 1HH9A 3GHBH 2P5WB 1MAMH 2YHGA 5D70L 2EE6A 3I6GA 3NFPB 1N5YL 3W11D 4HXBL 4ODWA 2LU4A 2QQLL 4P2RB 4WEBH 4KDWA 4OIIL 1UQSB 4KWUA 2DLIA 5E2VL 3B2UC 5D93B 3RZCC 1QEWA 3QO1B 5INCA 1DZBA 2E9IA 2AV1B 4J3XA 2NY7H 3VFGH 1P2CB 2IPKA 5ITFB 4PUBH 3MRIA 5JXEC 3ORJA 4LPUA 2PNDA 2XZQL 5DQJA 2C3VA 5D7JB 3PGCB 4OCSL 1HN1A 3UPRA 4F7MA 4JFDD 1BBJB 2WWMC 4YWGL 5EU6A 2H2PD 3WNOA 5IJVA 3OGCB 3LS5L 4BZ1H 4G8GE 1M05B 2EDJA 2YD4A 3GI9L 1DUYB 1AE6H 5L2JB 4P5TC 1WSST 1IGFH 1RY7B 4JO2H 4J3VA 1RJZB 2HJFB 2C3WA 3GZKA 5I15H 4M6NH 4HG4K 1HDMA 3VCLB 4MA1C 4UAOC 3MV8D 1OPGL 4EQ2A 5D2NA 5E6IA 5D1QD 4L5FL 4O02H 1MWAB 4YHOL 5EFIA 2MJWA 4PJAB 1CQYA 2GHWB 3U36A 4RIRB 5A1AA 3G04B 2NY1B 1UA6L 3T4YB 3P77B 5EPMA 1DSFL 5CIPH 3G9VA 3MLRH 1T0MA 2IJ0C 3KXFE 1Q0XL 3O6FA 3RVWD 4L8BB 3GMOB 4L4TA 1RZ8A 3D0LB 4M62H 3QO0B 4WI6A 4AIOA 1DVFB 1MIEH 2APTA 3EHBC 3C09C 5MEND 1IC5H 3EAKA 4LSDA 1S7UB 4PJBA 3QG6A 3O3AB 4YHKL 5IHUH 5JO5A 3DMMC 4GRLD 2HWZL 2JJTA 4PYGA 4Z8FL 4NO2B 3MV8E 4MZ2A 3RL1B 4H0GA 4PB0H 1AFVH 3SDAD 3MLZL 4PRDB 3C08H 3MV7B 4MAYA 3CSYB 1M05A 4Z0BL 4JANA 4YHKH 5IHUL 3LV3A 2GJ6A 3MRRA 3KYOB 3FQTA 3MLVL 1JYWA 2NY3B 5E7FA 3FFCD 2AXFB 4NBYB 4MAUL 3OKMA 4P48A 5M7QA 3QUML 5DDHA 3W9DB 3EBAA 3L3OA 5L2KA 4NT6A 3FB7B 2XACC 4JFOA 5E5MA 1R0AH 3LN4B 5EO1A 4LKXA 4EVNA 3W0WA 3CFBB 1I1AD 4MNQD 3G6AA 4O4YH 2OCFD 3UTZB 5D5MF 2H1PH 3B5GA 2PKDA 4GKNA 1RZFL 4K94C 5INDB 2YUXA 3MRJB 3VXOB 1EO7A 3RZCA 1I3RB 4KTYA 4PGCB 5CZXD 4PDCE 4O02L 3K74B 1ZANL 5K59F 3DI3B 1MFCH 1FDLH 5KVFH 2UUDH 3QCVH 5J7CC 2M26A 2XTJD 3EYVB 4FA8A 3OKKA 4LCWB 4M5ZL 1J5OL 5L88H 1DEDA 3CZFA 4QNPF 3JTTB 3ERYA 4X7EC 4N90D 3BE1H 5F1IA 5FYLE 4G59A 5IFHH 5MHSE 3VXUA 3HNTL 2QSCL 3VRJA 4X9GA 5KSVA 2O61A 4XPTL 5HYEA 1M7DA 4NQEB 1MCPL 1TQBB 3TPUE 5BMFH 1L7IL 3BN9C 4NNXB 3SDDA 1IGTA 2EYTB 4JDVA 5E9DE 4U6YA 4RFEB 1T5XA 4P5MB 5KVDH 5CCKL 4KZDL 3MJ9L 5IFHL 4LHQB 4X98A 1KXQE 5DJDA 1JJUA 1JTTA 3MNVA 3F12B 4MJIE 3L7FB 4MVBA 1U9KA 5CJQL 4HBQA 4QOKA 2XPGA 3IAQA 1HOCB 5D5MA 2EDTA 3K1KC 4HMEA 4XHJC 3PWPA 4D9RE 5TGBB 1J87A 3V6OC 3VG9B 3WEXB 4FTVD 4MJ6A 3IDXL 5BRZA 3CPLB 3TT3H 3B5HA 1ZA6B 1XCQA 3JSSA 1WCQA 3T1FA 4OIBA 1KN2H 4JFED 4OZIA 1YEJL 2QEJA 3PL6D 4M8QA 2APWA 5IEHB 1W0VB 3QT2A 4KGJA 5EU3B 5GRYA 3TBSB 1TTUA 5C07E 5TPWH 4EN3C 4E5XA 1D6VH 5CEZE 4NJ9H 5D5ME 2NTSP 3HC4H 4N8VB 5KSBF 1C5DA 2VERN 1ONQA 3SBWA 4LIQE 2WINA 1NDGB 2F8XC 1CGVA 5I17A 3VXRE 2X70A 4EUPA 4KXZH 2XICA 5D7KE 1T1WA 3VFPB 2BCKB 4HUMB 1XGYH 1IGJB 3MSPA 3BAEH 4RGNC 5TDNA 3VGAB 2YWZA 1KF9B 1G7JB 4K71C 5KAQG 4EI5A 5C0BE 2CXGA 1JI1A 4KZEL 5DMJB 4HSQA 5LQBH 5CEYB 5HYJB 4Z77B 3U9PL 4ZD3L 5DFVC 4G3YL 1EJ6A 2UYLB 2ZCHH 1GGCL 3SGJC 4XPTH 3OKLA 4LGPB 3VA6A 3VXRA 3MJ7B 1ZHNB 2UV3A 3DX9A 2CKBA 5A2KH 4UB0L 1MFNA 1RZJC 2AJUL 3WE6A 12E8H 1RIUL 2VLRB 3PGFL 3EJYC 3KYKH 1OWWA 2RQ8A 4NFDA 3TF7A 2B1AH 3VFRA 1CICD 2JIXA 3A6CH 4MNHA 5DVNA 4G6ML 1M6OB 5IHLB 3DO3A 4JCMA 1BLNA 4K9EC 5I1HH 2JB5H 1QR4A 3MRPA 2J5LB 3IFPA 3VWJA 2YN5A 1TZGH 2X1PA 5DK0B 5I76A 3PDOA 2AJVL 1XCTA 1F4XL 2L7JA 1HINH 3FT3A 4OV6F 2JELH 4HIIB 2OJZL 3BPNB 3IDXH 1XIWA 5DRZA 5GIRB 2HFEA 2ZCKH 2COQA 4P5KB 1G1CA 3UP1A 3B9KB 1S78D 4YHYC 4X80H 5F7HA 3OGOE 1S7WA 2VL5B 1CL7L 4A2LA 1K8DB 1F11B 1IL1A 2AI0H 4UOJA 5DUBB 2L7UA 4A6YA 3OKEA 1I7TA 4U2YA 3RVWC 3K7UA 1IGCL 5GRUH 1IAOB 3O4LE 5BZDA 1OTUD 2WUBH 2W9EH 2ZNXA 1ZLUH 4J1UB 5DLML 3K8MA 1INDL 2Q7YA 4FQ1H 1ETZB 3IDMA 4CUCA 4H25A 1HSBB 1KIUA 1YQVH 4K23H 5D1ZC 5FCUH 3QUXD 3MOAH 3U48A 4AG4H 3U79A 3LDBB 1KC5L 1U93A 4KROC 4NQCB 1CXHA 3NABL 3V4PL 2W9EL 1LE9A 5ESQB 5AWNL 4S10A 4N9GA 5SV4A 4R6UA 5F9WC 4V1DA 4Z7UA 1MCEA 1XH3A 3ILQD 1RZIB 1SYVB 1WQVT 5E1AB 4ZO8A 1JWMB 3V6OA 2VXQL 5GRZA 3WFEH 4Q97A 1ORSB 3MO1B 5I15L 2MTPA 4L3CA 1DBKL 4PJCF 4WFEE 1E28A 4LLUB 5SWSA 5FKAB 2EYSB 5DMIH 2BVEA 4X7CC 3A6CL 1OTTD 2VR9A 3J8F7 3CUPB 4LSTH 2FR4B 4L5FH 3BX7C 3AROA 3V6FB 1L8JA 3DVNA 4GOSA 1CFVL 3C2AH 3ZTNH 3CK0L 1TVHB 2AJVH 4APQD 3O6KL 4NGHH 2Y6SD 4WUUB 4HUXA 4PJXA 4HPOH 3SDXB 2JELL 4WWKB 1F11A 3L5IA 5HVFB 3LKSB 2EC8A 5CZKA 4LLDB 1CT8B 1FCGA 1Y0LA 4QCIA 1HHKA 3FB6B 2J5LC 2YUZA 3C5ZB 3BO8B 4UT7L 2YOCA 4MJ4A 5C0JB 4PP1C 1IC5L 5JA8B 1ES0B 3TNMA 3SGJA 2V5YA 2WAHA 3AFLA 5D7IF 5JPNA 4DUWA 3ARDB 3NVQA 4RISH 5DJXA 1HIML 2QADC 4ZUTB 5AG8A 1FNGB 3EO1A 4PRIA 2VXTH 1LQSR 2ICWA 1JF1A 3EDJA 3O3DB 3A6OA 4OGAC 5L2KE 3THML 5TDOB 3FT2A 4BKLA 4CN1A 4NQSA 4KRMB 3WNMA 5DT1H 4OI9A 1KTDB 1RIHH 3BZ4A 4NHUE 4OM0H 3T04D 2GFBB 3FZUC 1IT9H 4OZGB 2YD1A 1QG3A 3KJ4C 3D6GA 5HGDA 5GJSH 2H2SC 1YEDB 1RK0B 5CSBA 5ECJE 5F8RC 3DGGB 4Z6AT 3FQWA 4PV9A 3BPCB 5E8NB 5F89A 4ZFOL 3DURA 3MRFA 4GAJH 3QXAB 1FFQA 4MNGA 4HKBA 4O2CA 5JOPD 5DF0A 2V9RA 1T1ZA 1C5CH 4EN3D 2YD8A 5KVMC 2VMFA 4UUJB 5H94A 3TYFB 1S5IL 4MHHG 4F7CA 4ZFGL 5ELIA 4KKAD 2NW3B 1GC1L 5DYOB 2IQAB 4P5TB 4I4WA 3AS3A 2V5RA 4M5ZH 4UILH 3BO8A 3ME0A 4KJQD 3RY4A 3QULA 3KXFA 2GT9A 1BQHB 5GZOD 3FB5B 4YDLB 3H3KA 2IFFH 3QEUB 4ORGB 2FX7L 3ZE2E 5GS2D 3ZTJG 5ID0B 3MCLH 1MRDH 1FRGH 1GL4B 3NBNA 4HFWA 4ODBD 2OL3B 4PGBA 5CEZH 1RZKH 3HB3C 1HYRC 4TPRL 4TVPE 1KJ3H 5FHAL 2UY7A 4POZD 3NZHL 2R1XB 3ROOA 4PRBA 3FO2B 4HCRH 4HGKC 2RFXA 3NPSB 2BSSB 5KN5B 3IETB 1CFTB 2X4NA 3TA3C 2CDEA 4RAHA 4MWFA 4LKCA 1CF8H 4UQ2A 5E70A 1FFOB 1VENA 4LPCA 3SDCD 3QDAA 3BZEA 1Q72L 3UTQA 1CCZA 4YBQD 4HV8B 4N1HB 4PY7B 1B0GB 1J9CT 1AH1A 3V8CA 3ULUF 2Q1EA 1QSFE 4XPFL 3HE6D 2YRPA 5EUOE 3PWUB 4KRLB 1MCIA 2KL6A 2ADIB 5JXAH 4LGRB 4J3OC 1KPVA 4M6OL 4PG9B 4N90E 4OUUB 3WJJA 5DEFB 4MA7H 1WIOA 4HX1B 1PYWA 5JUEH 2BVTA 3QUZB 2X4SB 2PXYB 3KHQA 3ZYZA 1FFPB 2GTZB 5IROC 3GNMH 3SCMC 1L0QA 1BGXH 3LMJH 3WIFB 3HUJB 3TIDA 4F80A 1P6FA 1OAYL 4I0PC 2WM0A 2Y4SA 1Q9OB 5EZJB 1CDHA 4L8CB 1IQDB 2VLKB 4P2QB 4LASL 4OZHF 4FZ8L 3UYRL 4ORGA 5I74C 1UXSA 4RMTA 1JHLL 1GRWA 1A47A 1J1OH 4YJZL 1KB5L 4B50A 4PP8C 4YK4C 4R8WL 5D1ZD 3CFEB 1JFQL 1HQRB 1PKQB 3PWLA 3LS4L 3W5NA 2P45B 1KUMA 4ZUUB 3C60C 4PJFF 2F74B 3FRPG 4JFQA 3QR2A 4L4TB 3QNZA 5DK2B 5GXBB 4Y5VB 4W6XB 3ET9F 2H8PB 5T1MA 5A43C 4CDHA 4NWTL 3KYKL 3IDIB 3BYTA 4C54A 4N0RA 3IJYB 5SWZB 1S9WB 3UTTD 4G6MH 4JFEE 2B2XL 3GSXB 3GMLA 4PJDE 3FQNA 4HJ0D 1BOGA 3MUZ1 3ZT6A 5I1GL 1QFUL 5E08L 5EO9B 4DN4H 43CAB 3QUKB 1DSFH 4WW1B 3QDGA 1T6VN 1V8HA 1Q72H 3TO4D 5LCVL 4QTHA 5MENA 3HNVH 5IMKA 1F6AB 5EIIA 3ALPA 5DJ2B 4AH2B 4IIQC 2YRLA 1G7IA 5BXFB 1KTLA 2BMKA 3S88H 2NXZC 2WWKT 3UPAA 3JXAA 3MUJA 3STLB 4M6OH 4RCAA 5GZNC 3U1SH 4S0SD 1INEL 3QQ3B 1P4LB 5DJZB 3BH9A 2R0KL 1ITCA 3DX8A 4MAYD 3DO7B 3BSZH 4YPGA 4XNXL 3FO0L 4ODXA 1BBDH 1KN4L 3VI3F 4NQDD 5I74B 3UBXG 3QQ9C 5INCB 4XNZB 4HWEL 3QIBA 1VA9A 3NCFB 2G9HB 1C08A 2R1WB 3AVEA 1BIIA 3O9WD 5AUMB 4OIIH 2P5EA 1A6TB 5E2VH 4D9QE 4GAFB 1MQKL 3ARFC 1ZT1B 5D8JH 3PDGA 3VXRD 1KV3A 4KMQA 1JPSL 3S35X 1BBDL 5F1NA 2F54D 3QNYB 3VE0A 2J3SA