3ROOA

Murine class i major histocompatibility complex h-2kb in complex with immunodominant lcmv-derived gp34-41 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Murine class I major histocompatibility complex H-2Kb
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rooA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rooA01
2Q3AA 5C0BD 3O3BB 3MCLH 3P0VH 4TNWF 2O5XL 2YZ1A 5E03A 2C7UB 1N4XL 4XMPL 2EH8L 2XV6B 2GQHA 3FQXB 4PLOB 1I8KB 2IMMA 1YQ2A 4S1DD 3KJ4B 4JM2C 5C0BA 5I9QB 3KPRE 1DBMH 1FL3B 1UKQA 2VXVH 4G7YL 1EJ6A 5JA9A 1KLGB 3SE4C 3ZDZF 3S37H 1IGJB 4FN0A 2YD4A 4JFHD 3ABZA 3CMGA 4HKJB 1XR9B 3PIQB 2UVFA 2GY7B 4N5ED 4TUOB 3IAGC 1OAZH 3VFUB 5D96C 3MACL 5ENWA 2DOCA 1I8LC 1IGIL 4RZCB 4Z7QF 3WDHA 5DUPL 3LKRA 4PJXA 3ARBD 4LP4A 1J0HA 1A7OL 3OR6A 1AGEA 5DVKA 4M03A 4C59B 3UJJH 3Q6GL 4KKLD 3MODH 3PXJA 1B4JH 3AFLA 4HUXB 4HG4K 2F53B 2ESVE 3VXRA 2HJLA 5M95B 2FATH 3HS0B 2NLJB 1B0RB 4ZDHB 3O6FC 4M6NH 1BZ9B 2DMCA 1MFDH 3MA9L 5D2LF 5DYOA 4OBRA 1B0GA 1Q9KA 1ZSDB 3H6JA 3QEHB 4ZSOA 5JO5A 1MCNA 3ULUF 3OKYA 4OLEA 4FQQB 3U4BL 4HWBH 1VGKA 1WTLA 4AIXA 5EU4B 5AZEH 3RY6C 5D5ME 5IHBA 1I85C 3A6CH 2VR4A 3LV3B 4X7TB 3QFJA 4AM0A 1MUJA 4M1DH 3I2CL 4N0YL 2EDDA 4PRBA 2C4XA 4U2YA 3K2MC 4LAJH 3C8KA 4IM8A 1XGRA 3GMRB 4RQQA 1UACH 3SJVE 2KBGA 4FQJL 3NA4A 1NMCB 3W0WE 4YHKH 3P9WB 5T5NG 4ZXBD 3MRIB 3Q1SL 5FO9A 1FRGH 5EDXA 5MHSE 2DLTA 3LKNB 3KPMA 5GGSA 4LAQL 4NSKB 1HNFA 3DX8A 1J8HE 1MCJA 5ITFB 3VXME 5J6GB 1I3RA 1W8OA 4JFYA 2HVKA 4MQSB 1DVFD 3ZE2F 2AEWA 5I8OH 2IWGA 4ZXBA 4YDJB 4YO0B 1KB9J 1KPUA 3O41A 1HCFX 3U7WL 3MUY1 4WEMB 3I6KB 2DQHH 2CIIB 5DZOA 4Y4FA 3IDXH 4MD5B 4P2OB 3SGJC 2EECA 3RWHB 2DWEB 1UXSA 3KG5A 4ONFH 5IF0A 1DVFA 1HI6B 1QRKA 4HW6A 4TRPL 3TIDA 3CUPB 3HPJB 4JM2D 5JPNA 4P49A 3D3VE 3FCTA 1UWEL 1JNHB 3O3EB 4LPCA 4KI5C 1NC4D 4HH8A 3KPRD 2L7UA 1X5XA 1YEIL 3DRQB 1JWMB 4ZPVB 4EI6B 1WZMA 3MLPA 3CLFH 2PW1A 3KS0H 2YUVA 5MEPB 4F7TB 5EOCL 3ES6B 3HUJF 3P11L 1T20B 4JM2A 4WTZA 2AXFA 3BPCA 3RL2B 4BK4A 3SE4A 3U4AA 1NC4A 2XKNB 1ETZA 2JB5L 3BO8A 3KPRA 4PUBL 3HC4H 2F8VA 3SEPA 3C2SA 4KKAC 3VH8A 3LS4L 5HI4C 5MERB 3IKCB 4QF1B 1CG9A 2EKJA 1I8LA 4UBDC 5JHDA 2ICWJ 3M17B 4OLXL 1DN0A 5MENA 1OF2B 2C3GA 2MTPA 1OWWA 4L8CA 4HMCA 3S36H 1T03H 3G6DL 3ETBF 1P2CB 2ESVD 5BS0B 3O6FD 2UZYB 1KIQA 2WAHA 4LLDB 4JPWL 5CLTA 3RBGA 4N0CC 4DGYL 3UMTA 4D9QE 3TZVC 1Z0MA 4OLZH 3EYUL 4MB3A 5DMGC 2EXYC 3O6FA 3NACH 4YWGL 1BVKB 2DM7A 3PHSA 4NQXB 3MGTA 4NJAL 5FAAA 1U8JB 4JO3L 4JG1H 5L2KE 4YHOH 1X6NA 3RY6A 1I85A 4DKAA 3Q2CA 4PJ7B 5TE7H 2P24A 1FAIL 5BVPH 1FNEB 3BKML 4OZIF 5C3LD 1E4WL 4XNMB 2DBJA 3MV7B 4G9FB 4OZGB 5DURD 4WHTA 3CSPA 5E6ZA 4NN7C 3V6ZA 5JZ7D 2A2QT 3PP4H 4TPRL 3S3PA 1PYWB 4BFIA 1J8HD 3EYFB 2O5YL 1JWSA 2YD6A 4ONGH 3O2WH 9CGTA 3HC3L 1H15A 2A74B 5HHQB 1AHWC 4XNXL 1DFBH 3VA6A 2E27L 4M00A 5H37G 5DTFB 1ZHBA 3RDTC 4DUVA 5D1XC 2ZUXA 3QI9B 4TULH 1J8HA 1RY7B 5TE6H 4WV1B 5J89A 5IMLB 4WCYH 5FCSH 4RA0C 1QSFA 4HS3B 2B4CL 2DKUA 4J3VA 4TSCL 4XP1L 3IS1X 2X4TA 1Z5LA 2IMNA 5HSFA 1G7LB 4M6MH 4PV8A 1IAIH 3M8OH 1P5UA 1C08B 1L7IH 2XZAL 3SGJA 3SY0A 4OCXH 3QCTL 4NKIL 3SE8H 3AMKA 1GIGL 2UWEE 1QACA 3DROB 4PJFE 1MHCB 2GITB 3L3JA 4JQIH 2RJMA 1F4WH 3FONA 1C12B 3DVGA 4HULB 4O58H 1FBIH 2YPKA 5DR5H 4N8VB 1FZJA 4K3EL 1GGIH 3DTXA 5IVXE 4KKAD 5A3IC 4KK6C 1BX2A 2WBJC 5HI4D 1V3LA 3G6JE 2LU3A 1XF3A 1RHHA 2BVOA 3C60C 4QTIL 4UBDD 1E4JA 4JPVL 5E0QA 2WZPD 4MGXA 3TN0B 1CFVL 4ZFOA 1NSNL 1XT5A 3PL6B 4JO1H 2W07A 4G6KH 3P4MB 1KIUA 4Y16C 1QSEE 4HCRA 3LRHA 4NYLA 1J1OH 3FKUS 3U36A 4I3SL 1I9IH 2Z92A 5J7CC 1QLEH 4N0CD 3RU8L 5SX5K 4DW2H 3ARRA 1I8IB 1DJSA 1GZQB 3TZVD 3L5JA 5L2JB 5DMGD 5I1DA 2EXYD 4D9QD 1U91A 2VXTH 3KR3H 3JWNC 4LARH 1D3CA 2IH1B 4GBXC 1KJ2B 2FJHB 5GGUB 3MXVH 3B5HA 1IC5L 1TVBB 3W39A 3EO0A 3HMXH 4CVWA 3TZVA 2D7TH 4I5BA 4XVTL 4Y8DC 3VFRB 1E4XI 2I5YH 3MOBH 5L2KD 3Q0HA 1NAMH 1FGVH 1UWXK 4M43H 4TQEL 3H7LA 5FYKL 2ATKA 3LKQB 1UVQB 3H42L 3LKPB 5E24E 4P3CL 2WW8A 4LRIC 5LG1A 3DLQR 1V7NH 4EUPB 1JPGA 2W0PA 3MRRB 4CUCA 5HYJD 3RA7L 5MP6H 4WUKL 4KDVA 1N6QL 1CBVL 4NDMB 1PDKA 5L2KA 3T0EE 2CPCA 2H45A 3BXNB 1CT8A 4Z0XA 1P69B 4PJBE 2X2YA 3RDTD 1RUAL 2OP4L 4G7VH 4LIQH 5IVZA 1JGVH 5HYJA 3MMEA 1HQ4B 4N8PA 4AEEA 5C71A 1IC4H 2EYSA 1YNLH 1JVKA 4UNVA 2X70A 3BPOB 3RDTA 2LV4A 5D1XA 1DL7H 4X7EC 1KPVA 1R3JA 5GRJL 2Y07L 5F9JB 1WTGT 3BMWA 4P2YA 2FECL 2WWKO 3MRKA 3EBAA 1IM3B 4KTDL 3SO3C 4L8DB 2FB4L 3FRPG 5A3ID 2DQUL 4KK6D 2WBJD 5EPMB 4XBEH 5CEZH 4PJCA 5DHYA 5HJ3A 3C60D 1T0NA 5EU6D 4OBSA 2OZ4H 2PN5A 2UWEA 4GQPH 4OSUL 1CIUA 1L6ZA 1HXMA 4HK0A 4M7LT 3SDXF 4I3RH 4X9HA 1F3DJ 1T5WB 4MMXC 2ZCLL 4Y16D 4U49A 2WBJA 35C8H 1DQJA 5E8DL 1S78C 4JVPA 5J13C 3T2OA 5HVHB 5IVXA 2DLGA 3C60A 1RU9H 2CLVB 3WV0A 3BX7C 4QRPA 1MVFA 1RFDL 5EU6A 4FXLA 1AO7B 4EKXA 5I1KH 2FYYA 1BAFH 4MYWB 4GH7B 4Y16A 5FECB 4JPKL 5D93B 1OY3B 4FG6C 2HH0L 1X5JA 1NAKH 1LP9B 2FZ3B 3B83A 1UM6L 4H5SB 4GBXD 4LMQE 3TO2B 5J8OA 1OWRM 1CS6A 1TZGL 5DGRA 1CICC 4JN1H 4Y19D 1L0XA 3JUZA 2GT9B 4J1UB 3DV6A 2FEEL 3ARFB 1PKOA 2VWEC 2AQ1A 5JW5B 3TNMB 5C0AE 1F11A 4UT9L 2IBZX 4GBXA 3G5YA 3ROLA 2YMXH 2Z31B 4NN5B 4Y19A 1JV5A 4MNQB 1J0JA 4AK1A 5A40E 5GQBA 5HDLA 2Y25A 4HEPG 2R29L 1MWAB 1F4YH 2RR3A 1EERB 3KYAA 1KCSH 5EC2A 5J11C 4DTGH 2DTSA 4LRIA 3UYOD 4KXZI 2AK4E 5J0BA 1UB5A 2P5EE 2BSED 3VDAA 2F5AL 5D70L 2XN9D 5GGRB 1DQQA 1WGOA 3MNVA 1S9VB 3PDGA 1N64H 1CGWA 1EMTL 1ODAA 3UO1L 1T2JA 1F97A 4YDVA 2P8MA 4ZAKB 3B5TA 4PJEE 3I84A 5H2BA 2IBGA 1TJIH 3ESVF 4NRXB 3ZDYF 1DUYB 5E2JA 4Y5VB 1V8HA 4OUUA 3JTTA 4CN1A 4PJBA 1HQRA 5HDOA 5FM5O 1S8DB 2XN9A 1HKLL 1RJYA 2G60H 5T3XH 3QDGE 2BHZA 3V5HB 3AB0C 5LGKA 2E6PA 4Z7WE 1DQMH 1OHQA 2EIZB 5SWQA 1SEBA 2GJ6E 3ULUH 4OZHF 4OFDA 2VDLH 4M8VA 2DD8H 3O0RH 4ODTL 1TZIB 1U8HA 5C0FB 1S7RA 1FG2B 5E8EB 4QCIB 3OKOB 3VFNB 4RNRA 5E2WL 1MFEL 3T8XA 4Z7OF 1UJ3A 4APQB 4XCYA 4OI9A 1SJHA 4GW4B 1FFPB 5SV4A 1HZHL 3ZKQD 4K3DH 1XR8A 3HZKA 2ADGB 4OD3L 5JUEL 3VH8G 3TCXA 4M6OL 4HBQA 2BVTA 4LP5A 2HJKA 5AUMA 1MAML 2B4CC 4PBXA 4M7KL 4KUZL 3S4SG 1CICD 3JV0A 5IFAL 4KJQC 1CXEA 3MFFA 4QRQB 3WO4B 3DV4B 2O5ZH 3NZHL 4MNGA 2OQJA 4EN3C 5BRZE 3G5XB 5D9SB 1YY8B 5HPMB 5M94B 2IFFL 3FTGA 5D71H 1GXEA 2EE3A 4YFEA 1QA9A 4K8RC 5CGYC 5F44A 5EH1A 5IR1B 1IBGL 2YN5A 2B1AH 2YKLH 4PTTB 3RGVB 2IEPA 4K23H 1CICA 3GKWH 2FHCA 2RFXA 4PYGA 3P30H 3RUGA 1ZGLB 3BZFA 3FQNB 1AFVL 2Q76A 2EDOA 3OAZK 3PHOA 4ZFFA 1LE5B 3MACH 2C9AA 3BGAA 4J6RH 1HH9B 5E1AB 3GBNH 4PLJC 4X7SL 4BYHA 2FO4B 4GKZA 2JB6A 4KTYA 3BP6A 1OAUH 4X4YA 2D2OA 2YN3A 4OCLC 3KJ4C 2HLAA 5I9QC 4GKNB 2RQ8A 2R1YA 3KPNB 4YR6B 1KJ2L 3GI8L 1T89C 2P5ED 4FNLL 4CVZB 1N5AB 3MGOA 3HE6B 3U4EB 4F9PC 2X5PA 3Q3GB 3CFDB 2BVYA 3GSRB 43C9B 1KNOB 3BUYA 5CHNA 2BDNL 1ZLSL 4LEOA 2A1WL 5A2IH 4UT7H 5FOBB 1A7PL 1N7ML 2P5EA 4P59L 3BGMB 4MJID 2Q7NA 5DMIH 4LCYA 3RWJB 4O4YL 3TPUB 4FMFA 4JY4B 3QDGD 3GSWB 1TMCA 1LK3L 3P73A 3FMGL 3MLXL 3RY5A 4GAGL 4HFWA 4RMRA 3T1WA 1HHKA 2XWBA 5AZ2H 2F9BT 2GJ6D 4XPFH 2H3NA 2BNQE 2ADFL 4FTVD 4MJIA 5DD0H 3OXSB 5I2IA 1DLHB 4ZQKA 3QDGA 4S0SD 1ZA6A 3QUYC 1FGNL 2DQFA 4Y4KB 5GRUH 3OMZA 4RRPA 4X80L 5C07A 1XGYH 5KS9E 1RVFH 3DVNA 4OD2A 1CIDA 5DDHA 2NNAA 2CLZB 2QQKL 2YEZA 3H7BA 1XGTA 3U9UB 1C5CL 3H3KA 3IDJB 4FTVA 3SDAB 4GXVH 2OJZL 5JOPE 3R8QA 2VZTA 2Q20A 4MDJA 5CGTA 5EC1A 2AXGA 1KIPA 1U8QA 3H0TB 4O02H 3P0GB 1NEZB 4Z7UB 3KYKH 5EBLA 1QPPA 3CVIH 1MIML 3WFHA 1NMCC 3NIDF 5GIRA 4EN3D 1LO3L 2VLMD 3AVEA 5DUML 4AEHL 5I1GL 2DF3A 1U8IB 1EAPB 1SVZA 1DTUA 3UJTL 4K8RD 5C0GB 5CGYD 4C58B 1ES0A 1VB9A 3KPSB 1UM4L 1W72B 3PJSB 1Q1JL 4MB4A 4EN3A 2XNAB 1OB1B 4Z7VE 1MHEA 1UQSA 1NANH 5CD3B 1PGRB 3TO4B 3BE1L 1NFDB 3LRSB 3MLUL 4R90H 3B9DA 4P2OC 4NOFA 4NWUH 3RWEA 2JCCB 5HY9B 5E7FA 1XGPA 4QHLA 1FNSL 4LFHD 2NZIA 2NXZB 3LEVH 3KYNB 5DRNB 5HYFA 3O3BA 4PY8J 2MHAB 4YNYB 3VXSB 2XWTB 1WEJL 2IQ9L 4BZ2H 4M7JH 4NM4H 5IJKC 1IEHA 1D6VL 4YHNB 4O2CB 3FQXA 1I8KA 3DSFL 1YYMH 3FN9A 4KAQH 5FO7B 2K7QA 1T89A 1KLGA 3NVQA 5IW3A 4M7LH 1IGJA 5F7YC 1RSFA 1MSPA 2C1OB 4YHYB 3UEZA 4HKJA 4JFDE 1XR9A 3PIQA 2V5TA 4DKEL 3VXOB 2NXYC 4TUOA 4XVSH 1BBDH 4P5MA 3VFUA 5D7JD 2ICWB 3RGHA 1MWAL 4LLYB 4RZCA 5E2UH 3V52H 3FB7B 5DHVH 1MCOL 5FYKD 4J3SA 3BP7B 1A6WL 2F53D 3O6LL 3QIBD 4ISVB 5DRZB 4EDXB 3OL2A 2XQBL 5F9OH 1WLHA 4KJWC 5GZOD 5GHWH 3QUYD 1KXQE 4PJXF 5TDNB 3LQZA 2I07B 4UILL 4HUXA 3VI4E 2F53A 1I7RB 5AWNL 4L4VE 5TPWL 5E7BA 5HD8D 3SGEI 3JSSA 4PGJA 3HS0A 4YHLL 2NLJA 2R15A 5I6XB 1B0RA 3F5WB 4ZDHA 4CN4A 3QUYA 1BZ9A 4R4ND 1F13A 1ZSDA 3QEHA 5JOPD 5K9QI 2PR4H 3WFBL 4PJ7E 4FQQA 1FFQA 1MCBA 1MCEA 4AG4L 5EU4A 3MLZH 4LRNH 1HYSC 1YECL 3LV3A 1I9JL 1OSPL 4X7TA 2QADB 1ZHNB 1MJ7L 4CW1B 4L8SC 4OLYL 4A6YB 4CMMB 3GMRA 5I18L 1WFTA 1CVSC 5DD5L 1PSKH 5EOQH 4XP5L 3MCKB 5DRWB 4POUB 5TE4L 5GS0C 3MRIA 4PP2B 2HFGH 2W9DL 1WZLA 4HC1L 3U0WL 1Q0XH 3LKNA 4NM8H 4YDKL 5F9DC 2W91A 5ITFA 5J6GA 1H3UA 4P2OD 1RZGB 2YD7A 4PBVC 4ZUSB 1QYGH 3WXWL 3HAEB 4P3DB 1RZ7L 3JTSB 3QI9C 3CDCA 1CDUA 4OCSL 1T04B 4Y5YB 5EBGA 3RI5K 4WV1C 4IHOB 1FC2D 4YDJA 4YO0A 1FV1B 1RULH 4QXUL 3GMMB 1NMAH 3I6KA 1W2KT 3FQUA 5DT1L 2CIIA 2YA1A 4Z7VA 4MD5A 2APWA 2DL2A 4P2OA 3RWHA 2V17H 5DLML 3RPKA 4X5LA 1HI6A 4KKCC 1LILA 3CUPA 5DD6B 3TPKA 3HPJA 3HR6A 1REIA 3MPCA 5CJQL 4D8PB 1D9KB 1JNHA 3O3EA 3FAXA 4WEBH 1YNKH 2DJ4A 3MBED 3IF1B 4PRHB 5IJKA 3W9EB 1JFQL 3RU8H 5LVEA 3DRQA 4LSTL 3CFJB 1JWMA 4XP4L 4HF5L 4ZPVA 4EI6A 2NXYD 5MEPA 4F7TA 3ES6A 1T20A 2YD9A 4JFDD 5I30L 3L3IB 3TN0C 3RL2A 3IFNH 2BNRE 1KYOJ 2XKNA 1Z9SA 3PL6C 4C4KT 1EVTC 5JXAH 4JM2F 4KJWD 1IM9B 3O2DH 2NY6D 5MERA 5B21A 2CDFB 3IKCA 4QF1A 5DJ0B 1W0YT 3EAKA 3O6MH 3M17A 5HHME 3ZYJA 4PJ8B 2NW3B 4OGXL 3FAWA 1OF2A 3ZTNH 4OB5H 3BZDA 1P2CA 5BS0A 3PGCB 3ARWA 1ZGLP 3C2AH 1ZEAL 4LLDA 4KJPD 5BMFL 5CKGA 3MNZB 5CD5C 1S9WB 2CRYA 3P77B 4BK5A 1AGFB 2AI0H 5IEKB 1CZ8H 3X3GH 3RFZC 1JMZA 3LDBB 3D6GA 3MV7D 4G9FD 2IALB 5C7XH 1M71B 3OKMB 5K59E 4CGTA 3HNVH 4NQXA 4OTXH 4L4TE 1U8JA 4AH2B 1L6XA 5KVDH 3QO1B 4KK9C 1PVHA 4PJ7A 2B20A 1FNEA 1N26A 1A3LH 5GS0D 4XNMA 3MV7A 4G9FA 4OZGA 4KPHH 4DQOL 2CR3A 3QHFH 4NHUB 4P46B 3LHPL 4Y1AB 2YWZA 1NLDL 4YGAB 3C5SB 4EXPX 3QI9D 5D5MF 2Y07H 1PYWA 4UQ3B 4AMKL 3EYFA 2B2XH 5JHLL 3NIFE 4M62L 2CLRB 2A74A 3DI2B 1PKQE 5HHQA 2VLJB 2HMIC 3OBAA 5FYJE 4Q9RL 3BPOC 1A3RL 5DTFA 5E6YA 3QI9A 2FL5B 1MCDA 4KKCD 1A47A 4WV1A 3K80A 3QFDB 5IMLA 5C08E 1E4KC 4ETYA 4HS3A 1INEH 3CC5B 1W72L 1A1NB 1G7LA 3VMNA 1MCQA 1QR4A 2D0HA 4XHJC 3V4VL 1C08A 3ALXA 3GJEB 1KJVB 2NTSP 3M07A 4R26H 4XMLL 3DROA 1MHCA 2GITA 1HK6A 1UEYA 1C12A 3TN0D 4N8VA 4ZS6D 3PL6D 4NJ9L 3VG0L 4BM7A 1Y18A 1FCGA 1AJ7H 4GRWE 5DJ6B 1L0YA 1NLBH 4PJDE 4XI5C 5J12B 5KSVB 5F3HB 1ZWIB 5JIIA 3T2NL 1GGBL 2WQRA 1DEEB 5ICXB 3TN0A 4DUXA 1JGDB 2QHRH 3PL6A 2AJ3B 3K4ZA 3MV9B 3P4MA 3MA7B 3R06B 5D93C 1U92B 3RQ3A 4OIIH 5BCAA 1MCWM 3GIZL 4TSAL 4ALAL 2VR9A 4LSPL 3M1BB 5CD5D 1IARB 3SOBL 1P84K 2ED9A 4K7PL 1I8IA 3HI6L 3WNKA 1GZQA 3EOAB 3LPWA 1RZJL 5L2JA 5L8KB 1QKZL 5H37H 1CXFA 3ARFC 1J05B 2ENYA 2HWZH 4DK3A 1NKRA 2CRIA 5DGQA 2IH1A 4RRPG 1IQWH 1KJ2A 2FJHA 2ZCHH 5GGUA 4O51B 1TVBA 1F3JB 1IGTB 2Z31C 4NN5C 4QRUB 4OF6A 4HFUL 1YQVL 4KK9D 3VFRA 4L4TD 3LMJH 4R97B 4HLZG 4CNIB 4LCWE 2RCSH 2YZ8A 1NCAH 3BN3B 3LKQA 3O6KL 1UVQA 3LKPA 2E7LE 5F9WB 4EUPA 4HXBL 3MRRA 4Y2DB 5LBSL 1VEPA 1NQBA 4NDMA 1I9RH 3BXNA 3T2PA 3TWCL 4LLQB 2HMID 1CGVA 4MXQC 25C8H 3PNWB 4MLSA 4Y5VC 5JA8B 5FYJD 4PJIE 1HQ4A 1QBBA 4K94H 1DQLH 3IJHB 4A6YL 1U93B 3A6BH 3CXDH 1JPFB 4NZUH 2ARWA 2XFXB 5K9JL 4BH7B 4XHJD 1MCLA 3RWGB 4B50A 5HHPB 4GUPB 2D03L 4H26B 5EUOB 1JNJA 5IB5B 1E4KA 3FQRA 1CTNA 3X13B 4IIQB 5F9JA 1NCWH 4DVBA 4N9GB 1XFPA 3U83A 1PG7X 4DFHA 5TQ2L 3X3FH 1IM3A 4FQIL 4G43B 2MSPA 4WFGE 3MRFB 4L8DA 4LFHG 4XI5D 1P53A 4O5LH 2YS4A 5EPMA 2XZCH 2VAAB 4A2LA 3Q5OA 3WBDA 4APQC 3F58L 3L1OH 4YUEL 1YMMB 1J11A 1T5WA 4U1MB 2V2XB 1NH6A 2UWEF 3MBXH 2EE6A 3TYGL 4PJFF 2CLVA 3KPOA 2ZJSH 4NO0D 3WO4C 1RIVH 1KTKE 5IVXF 1QSZA 5FECA 3ORJA 4RAVB 4P2QE 2ZKHH 1LP9A 2FZ3A 3G6JF 5CJBA 4H5SA 3LRGA 3RGVC 4LSVH 4YE4H 4KVCH 2J12B 3O11B 1GCFA 2Z31D 1T2QL 4HUNB 5DMKB 1TJGH 1S7QB 2GT9A 4J1UA 1JPTL 4ZFZA 4CRPA 3ARFA 1U36A 3EDEA 5JW5A 3TNMA 3H9YA 2VZ3A 4NRZB 3GMNB 2HN7B 3EHBC 1ZLWK 4MCZB 1QFWI 1BF8A 1U9KA 4G3YL 4XPAH 4FOMA 2Z31A 4NQCE 4MNQA 3GUTB 1YA5A 4P2RB 2DQTL 1ZHKB 3LEYL 4G6FB 1MWAA 5ADOH 3HE6C 3D39B 2EE9A 4UT6H 4MXQD 4ZMAT 1AGBB 1Q72H 2IAMB 4RFOH 3UBXI 5J1AB 2NPLX 3ALWA 1AXTL 4ZUVA 1BM3L 1MCIA 5IB3B 3OX8B 1DP0A 4LLMB 5GGRA 2WWMC 4BZ1L 1G6RB 4ZAKA 4ONHB 4MXQA 1IGFL 3R0NA 4M9PA 5CP7B 2E6JA 4RBPK 4LPWA 4NRXA 1DUYA 4XWOC 4Y5VA 4K07A 2VDOH 1JL8A 2X4SB 1S8DA 3CVHL 3H9SE 1EIBA 3V5HA 4PJBF 5I16B 1NCCL 4FP8L 3HFML 2AABH 4UNUA 3VGBA 2EIZA 2DYPD 1T7ZA 4Y4KC 2DQDL 2O93L 2VN4A 1MEXL 1XCTA 3HMWH 1MAJA 4WFHD 4ERSL 3TT1H 3MOAL 4RISL 1ULVA 2QKIA 5GPRA 3TP4A 5HYSB 2QHLA 5F7EH 3SDAC 1TZIA 5KOVC 5C0FA 1RUMH 1FG2A 5E8EA 4QCIA 4UI2A 3OKOA 3VFNA 5C2BL 2WLYA 1ITBB 4ZS7L 3RWFB 4KROB 5F1NB 5HGGS 4HC1A 3HI5L 2IBBA 5CJOL 4APQA 2QJDA 3NFPB 3EFFB 4GW4A 1KCKA 1FFPA 3ZKNC 3D18B 4ZG1A 3LQMA 1P1ZB 2ADGA 1AXSB 4OGZA 3GK8H 3SCMB 4CN6A 3B8SA 4RA3A 3RGVD 4LPYA 5TQ0H 4P2QD 4QRQA 4YIQA 3DV4A 5HPMA 2BFVL 3G5XA 5D9SA 1YY8A 1YPZB 1S7SB 2FR4B 1NBVH 3TO4C 4K9EL 4HWNA 2JCCE 3FB8B 1HWGB 4TNVK 5IR1A 3GI9H 2B1HL 3EHBD 3RGVA 4PTTA 2EXWC 5ETUB 4NP4L 4P2QA 1MRFL 4XPBH 1RJLB 2BSTB 3UCRA 4K3JH 2NXZC 2N7BA 1ZGLA 3FQNA 5I1IH 4R96B 3SDDB 4NQCD 4QRRE 3ZSSA 4JLRB 3CMOL 1LE5A 3ARED 4LVHB 2EDLA 1HH9A 5E1AA 3VFGL 3ESUF 1A64A 2F58H 2FO4A 3KLAB 1QBAA 2GYSA 4I48B 2IG2L 4GKNA 4YR6A 3KPNA 4NQVB 1S7UB 2WWMD 4CVZA 3EOYG 1N5AA 2VQ1B 1B6DA 3HE6A 5K9KB 5B38B 2N4IA 3S3SA 3QXAB 3U4EA 1KCVH 4YHYC 1CI5A 3Q3GA 2ZG2A 3CFDA 1DBBL 3GSRA 2J88L 43C9A 2VUOA 1KNOA 1RZJC 1P4IL 3IETB 1S7XB 2F54B 4XWOD 1VSCA 1VGEH 2EE2A 3GSXB 3GZKA 2BRQA 5FOBA 1SJEB 2CUIA 2ZPKL 3EDFA 1I1AB 3BGMA 1QFOA 5SX5H 2X4OB 3RWJA 1BWMA 3TPUA 4WW2B 4JY4A 3GSWA 4RSVA 4PD4K 3ARXA 4OKDA 2BOBB 4Y4KD 1Y6NR 3GMLB 3DX9B 3O8XB 5GSRB 3B5GA 1FO0B 3WLWC 4FHBD 3OXSA 4WHCA 3SHSA 4JFEB 1DLHA 5LQBL 2Y23A 1D6EB 5I6XC 3AU1B 3IU3B 4Y4KA 1UWXH 2O26U 4EVNB 4NHCH 3ZSTA 3BDYH 5A2KH 3IFPB 2CLZA 3NN8B 3ARVA 2MCPH 2MQ3A 3O2VH 4M5YL 3U9UA 3DARA 3U0WH 4N8VG 3IDJA 3SDAA 4X5WB 3NABH 4Z7WF 2QADC 3ZKND 3MRJA 4YFLI 4HIEB 1H3XA 1OGAE 1E6JL 5BW7C 3H0TA 3KPSD 4Z8FL 1OP9A 1NEZA 4Z7UA 4PRDB 5E6IB 1EEYB 5BOPA 4NWTL 1PFCA 4OV6F 4YDLB 4XAWL 1R3KB 4OJFH 1JYXA 4DGIL 1U8IA 1EAPA 3TO4D 1DLFL 5KAQG 5C0GA 2AERT 3KPSA 3MLTB 4HUWB 1W72A 2EXWD 1VPOH 3PJSA 3OV6A 4XMKL 5F8QC 4AL8L 2OR9H 5JQ6L 3SBWC 4M48L 2K9UA 2NXZD 1F6LL 4XGZB 5IKCB 1LO4H 2XNAA 3OZ9L 2IC2A 1OB1A 3MUGB 5SWSB 2YPLE 3SKJL 3BEVB 5CD3A 3TO4A 3VXSD 4JR9H 3LRSA 3RI5F 4OLVL 5C09B 1BVZA 1QBLL 4M1CC 2EDNA 4XBPB 2JCCA 5HY9A 4QRRD 1MFBH 5I19L 1C5DB 1HINH 4NGHL 3KYNA 1LEGB 2FRGP 3AMLA 4PRHE 5DRNA 2MHAA 1DQTA 4YNYA 1D9KC 2X1XR 3VXSA 2XWTA 3BOVA 2E7BA 2Y7QB 1U8NB 1OTUC 3V0WL 4U05A 1RIHL 4YFDB 5EZOH 4YHNA 4O2CA 1QFPA 1WUNT 3FN3A 5D72L 5EO0B 1U3YA 2KDGA 1WZKA 4CAGA 5FO7A 4LQFH 1YEDB 2C1OA 1BJ1H 4L1HA 3GM0A 5C0RH 2GJZB 3VXOA 5TH2B 2A6KB 3CFCH 5KSUB 3WIIL 2ICWA 4GG6B 1K85A 1RMFH 4LLYA 4HCRH 3LPFA 3FB7A 2CMRL 1AKJB 4XC3H 4PJ8C 3BP7A 5DC9B 1CQKA 4PYHA 4ISVA 5DRZA 3WLWD 4EDXA 3S96B 2AJUL 2GTWB 4UUJB 4XP9H 4FZEH 1PZ5B 5TDNA 1J87A 2R1XB 2I07A 3UZVB 1T6VN 2ZUVA 4OZFG 2JLLA 2GAZB 1G6RL 4QEGA 3RWDB 1I7RA 3DMMB 5J1TC 5I1CL 1MRDL 2QADD 3F5WA 5LJYH 3LDBC 1X4XA 3D2UD 1QBMH 1CL7H 1MQKH 4JB9H 4G6AC 5KVGH 2Y1VA 3HC0B 4GQ9H 4JRXB 1QUNA 2XWJB 2Z8WC 1HWHB 3T08A 4J23A 2FX9H 1E28B 4HJ0C 4OLWL 4OI7A 1UADC 4Y1AE 4CW1A 1YDPB 2QQLH 5FDWB 1W8NA 2AAVA 4A6YA 2YWYA 3QNYB 4CMMA 5BW7A 4P46C 5KS9F 5F7FA 1A7RL 4EOWL 1A6TB 4XP6H 5F96L 5JMOC 1F4AA 4JFOB 3MCKA 4WFEE 5DRWA 2EZ0D 4BQBA 4D9LL 2VLJE 2D0FA 5GJTH 4ZO6A 4PP2A 2R2BB 5DVLA 5GJSL 1LVEA 4M1CD 1P6FA 2BZDA 1RZGA 3SE9H 4ZUSA 1DANU 3HAEA 4P3DA 3UPAA 3JTSA 1UYWL 2KKQA 5E1HB 3SBWA 1T04A 3P4OB 4Y5YA 1P4LB 1FV1A 4O9HL 3AM8C 5E5RB 4FQHB 4I77L 3ZYIA 4P9ML 3D0VB 1ZLUK 3GMMA 2N1KA 1KGCD 4PRHD 2B7DT 1VADB 2GJJA 4EBQL 2IPTH 5IT2L 3QISA 1NGQL 5E4EB 5I15L 4XNYH 4JM4L 5DD6A 3QEUB 4FFYL 5AYQA 4Z7VF 4EEEA 4D8PA 1QG3A 4AIZB 4FABH 2HKHL 1D9KA 2ZWLT 3VW3L 4BSWB 2MJWA 2QSCL 4JCLA 3IF1A 3RZCB 1AXIB 4PRHA 5GS3A 3TLRA 3W9EA 4MA7H 1IKFL 3I6LE 2YPVL 1JNLL 3NCJH 3CFJA 4G5ZH 2AJVH 4LPVA 4ZD3L 4K9EC 1IEAA 3MV9E 1D5BB 5ALBH 3L3IA 2FGWL 1H3WM 1SBBA 4LGRB 4ENEC 4S1SL 1BOYA 2HT4C 1IM9A 2CDFA 1R6VA 4LDLB 5DJ0A 2VMFA 3ARUA 1FFRA 4PRIE 4PJ8A 3LN9A 2NW3A 3T65A 4QY8B 4WI7A 2OS7A 3QZWB 3W2DH 3WSQH 2XRAH 2CJUL 2XQYK 3PGCA 1EO8H 1V7MH 2NW2B 4X4MA 4G6AD 5FYLL 1BGXH 2WP3O 3OAZH 3CGTA 3MNZA 2F19L 4RGNB 1S9WA 3NCFB 1MIEH 2F5BH 3BQUB 1YN7B 2GCYB 3P77A 2XT1B 1AGFA 3UC0H 5GZNC 4HJ0D 3DUSB 1W0WB 5IEKA 4R97C 1D5IH 4UU9B 1JP5A 2VITB 4MJ5B 2IALA 4JG0L 1M71A 1FO0L 3OKMA 4WU5B 4P46D 5IHUL 1HOCB 1OAKL 5F9WC 4Y1AD 2FX8L 3VI4F 2BK8A 3CX2A 4AH2A 1JPSL 4TN9A 1WWAX 5HHVH 4Y2DC 3H8NA 3WO3B 3LS5L 3QO1A 2FO1A 4A2MA 1P4BH 1SMOA 4HKZA 2VLJD 1ACYL 4NHUA 4P46A 3DGCR 4PJ7F 4Y1AA 3C5SA 1ORSB 2IGFH 2DQEH 3N0PB 3C5ZB 3S5LG 4UQ3A 1OW0C 1U6AL 5CUSL 4LLUB 1EGJH 3KPLB 1FIGL 2CLRA 3EYOB 2ATPB 2AQ3A 1AQDA 2VLJA 4D3CL 1A14L 2D7QA 3TESA 1F90L 3VA2C 1FYTB 3BYYA 4HPOL 5K9QG 2FL5A 1J5OH 2GUOB 3S97C 3MJ8A 1HXYB 1WV7T 3QFDA 5IHZB 3AM8A 3WIFB 1JN6B 2IADB 4IIQC 1A1NA 1NMBL 1NANI 3NPSB 2KPNA 1MNUH 3U9PH 5F7LB 3DOSA 3GJEA 3MUZ1 4V1DE 2AP2A 1KJVA 1TJHL 2APTA 1YMME 1PG7W 3R8BB 1X5LA 3DBXB 5FCUL 5CINH 2JJTC 5IESL 1F8TL 3TCLB 1GPOL 2ARJQ 3MV9D 4HZLB 5DJ6A 1JTPA 4DOHB 4HX1B 4ENED 2BC4B 2HT4D 4KY1L 5F3HA 5KSVA 1PG7L 3MLSL 1ZWIA 4GLRI 1OM3H 1UCBH 5EZJB 1KPRA 1DEEA 4NC2B 3UTOA 4JRYB 5ICXA 4EXKA 4B0MM 1JGDA 3RVWC 2AJ3A 3MV9A 3MA7A 4R0LB 5ADPL 1KSRA 3QXDB 3R06A 1JTOA 4OQ1A 1A6UH 4FZ8L 4YBHA 5GS1B 1NL0L 2BP3A 5F6HJ 3M1BA 1F42A 1J1PH 2FWOB 2VERN 2W60B 3EOAA 4F37K 1AGDB 4KZEL 2Q8BH 4F7EB 1J05A 1KN4L 4U3HA 4LK4A 1QHPA 1JF5A 5D8JH 32C2B 3ARDB 1NCDH 5L88L 1U0QA 4O51A 1F3JA 4LHUB 1IGTA 4QRUA 3GJFB 4LCIL 1JHTB 3VRJB 4LVOB 1MFCH 4CNIA 2P1YA 3N1MC 1N3NB 4C55A 3IDIB 4GS7B 2BERA 1KC5H 3CVHH 2IAMC 1UM5H 4X9BA 4LNRB 4Y2DA 1H3TA 2A73B 1S9YB 5HHNB 2WUCL 4HPYH 4DJMA 4LLQA 3SQBA 15C8L 5K59F 4PRPE 4DWHA 4RISH 3PNWA 2PXYB 3RBSA 5IMOB 2WUBL 3S88H 1OW0A 4DGVL 2AJXL 2P5WB 3QEQE 4YXLH 1H5BC 1JPFA 1QRNE 2XFXA 4HWEH 3V4PL 1TTFA 1DSFL 4BH7A 1CXIA 2B0SL 4KFZC 4JDVB 3L7FB 3RWGA 3MJ9H 2Q1EA 2RB8A 5HHPA 4GUPA 3GSVB 2QSTA 4PGZA 5ESAB 4H26A 5EUOA 4I0KA 4OF3A 1OPGH 3MJ7B 3NIFF 5IB5A 5CIPH 1NCBL 3ZL4H 1Z2KA 3X13A 4IIQA 1YMMD 4N9GA 1R0AH 3QHTC 1FZOA 4G43A 3MRFA 4IJ3B 4Z0BH 5IOPB 1WBXB 4XPHH 5KG9B 4KHXH 4EDWL 4KROC 4HLZH 3UJIH 1RIUL 2NY4D 2CRZA 3OF6A 2JJTA 1YMMA 4JDZA 1M05A 3RVWD 1I3GH 5IQ7H 4LSSL 4U1MA 2J2ZA 1HHIB 4OT1L 3IXAB 3SCMC 2V2XA 3DUUB 3ULVE 1WSST 5FGRA 4P4RB 5IFHL 4D0CB 4OM0H 3ULVC 1J1XL 3B9VA 2XQYG 4GRWF 4WEUD 5CP3H 2E3VA 4PJDF 4TUKL 4RAVA 5SWZE 4AQOA 1JPST 2DM2A 1MHPL 3NCYP 4EQ3A 4K8RH 1UZ8B 3MXWL 3O11A 4TYUA 5DMKA 2GY5A 4TNVF 1A6VH 1S7QA 5B3JE 4P2RD 4PS4H 1FLRH 5CZVH 3P40A 4P5TB 4NRZA 4LVHC 3D39D 3GMNA 2HN7A 2VZOA 3MLYL 5GGSY 5K93A 1H3GA 4MCZA 2IAMD 4E0RB 1AD0B 4D2NA 2IF7A 3GUTA 4P2RA 5B39B 1DBKH 4OCWH 1ZHKA 4OCNC 4QOKB 1A9BB 5L9DH 5HHXL 4WDIB 3D39A 3T2QA 3PGFL 2IAMA 2D9QB 4HS6B 5D6DC 5H94B 3QPXL 4JPIB 4HK3N 4LPTA 3U7AA 5IB3A 3OX8A 4LLMA 2DKMA 5KSAB 1I1AC 1KBGL 3NPZB 3EO1B 3QHZL 3U7YH 3ZDXE 1BWWA 3QEQD 4WW2C 1G6RA 1A5FH 4ONHA 4UB0H 5GGQH 1WJ3A 5CP7A 1WBZB 3HE7B 5J56B 2X4SA 3O8XC 3QO0B 4ZFGH 1H5BA 4P99A 3UROR 1YYLL 1RUPH 5JW3L 4DKFL 5CILH 4HIHB 2FH6A 4X6DB 3J7HA 5I16A 2AK1H 3VRIB 2K1MA 3ZT5A 1X5YA 5TF1L 4PJIF 1I1YB 1ZGLM 5I71B 4KROD 3WNNA 4HS8L 4D9RE 3OAUH 2R1WB 2VXSH 5GRWA 3FQTB 2VOTA 2GI7A 1CGXA 2HFEB 5EOCJ 2I60H 5J57B 4QXTB 3LZFL 2V9RA 5E00B 3GRWA 2IH3B 3RWFA 5F1NA 4GMTH 3NFPA 3EFFA 4YDLC 2DLFL 5E9DB 2WWKT 3ULVD 4DVRL 5DD3H 3ZE0E 3D18A 2X9YA 3PABA 1P1ZA 5J1SC 3DO7B 4X83A 1G7QB 1FVDB 1AXSA 1MREL 4NNPL 1URLA 3SCMA 1U8PA 1RZ8B 2DLHA 1JJUA 2VLRE 3WNMA 2BSSA 2VSCA 1R3IL 5DO2D 5SWZD 5E2VH 3FT2B 5EO1B 1FL6B 4PRAB 4UIMB 2EO1A 5HI3C 3IKKA 1YPZA 2LQRA 1S7SA 5F72S 5GSVB 1CCZA 2FR4A 3WN5B 3FB8A 2AGJH 1T1WB 4LASH 4M5ZH 2Z4QB 2N56A 4ZPTB 3IT8D 5KVEL 4XX1E 4JFFE 5ETUA 4GAYB 4P48A 1RJLA 1TZHB 2BSTA 1E4XH 1E27B 4R96A 3SDDA 5JR1H 4UQ2B 2NTFB 1EPFA 2H2PD 4I2XE 2Q8AH 2Y36H 2R0WH 4JLRA 4AYFA 2Y6SC 4Q9BA 2CDEB 4JFZH 3KJ6L 3N9GH 2UY6A 2JJVA 1QFUH 2MOVA 4FFWC 5CMAB 1IFHL 4PB0L 1AY1H 3KLAA 4I48A 2D31B 4NQVA 1S7UA 2ZCKH 3U48A 1K4CB 1I1AD 3QJHB 1G9NL 2VQ1A 2X1OA 5FYLD 5K9KA 5B38A 3QXAA 5DFWH 4NRYB 4DAGH 4WI5A 1ZA3B 3IETA 1OARH 2R2CA 5D6DA 1S7XA 2F54A 3CK0H 2C3XA 1IKNC 3GSXA 1SJEA 3O4OB 3O8XD 1I1AA 3BIBX 5GGVH 4DN4H 3VFTB 4N8CH 2ORBH 2X4OA 1W0VB 3ROOB 2DQIH 4WW2A 1XF2B 2I9LA 4PB9L 1OQOA 4IRZH 2QBWA 4GOSA 5T3ZL 2D4DA 4I1NB 2BOBA 3GMLA 2FJGB 3GSUB 3DX9A 3O8XA 1CLZL 3PP3K 5GSRA 1FO0A 3BKCL 3DMMC 2W0LA 5IP4A 4JFEA 2HLFC 4KDTC 1D6EA 5F7NC 4S1RH 1TETL 5E94B 3HNTH 3AU1A 4KZDH 3IU3A 4L3EE 2NY7H 5C6PB 4EVNA 3UBXG 5EB9A 3EOTH 3IFPA 3KXFE 3NN8A 4LSUH 1OT2A 2NY3B 5A2FA 3ZE1E 4X5WA 3WFCH 4JHWH 5ID0B 1FAKT 5LWYH 3EYSL 4HIEA 1SY6H 2E9JA 2Y72A 4PRDA 5E6IA 1MH5B 1EEYA 1JF1B 4NN6B 1C16B 3FHAA 5EG6C 2VLRD 4MZ3A 1R3KA 3MCLL 5SWSD 3P0VL 5HI3D 4XNUH 4OD1H 2L0DA 1BVLB 5C09D 3H2WA 1M7DB 5T5FH 5GS0H 2DLEA 5EOTB 1UA6H 4E41B 3MLTA 4HUWA 3G6AB 4PJ5E 1UEMA 2J6EA 3CFKB 3QXVA 5ISZB 5KVMC 4CVUA 5IKCA 4XGZA 4BSVB 3MUGA 1DBML 2VDRH 2VXVL 1S3KH 5SWSA 3BEVA 1T22B 2H6PB 3S37L 2HVJB 3I3EA 4FQPA 5IW1B 1CQYA 2Y6SD 5C09A 3QUKB 1DE4B 2X05A 3DECA 4XBPA 1EV2E 5JW4R 3FJTA 5KZCD 5E4EC 1OAZL 1C5DA 4FFWD 4R4FH 4JKWA 1LEGA 5D1ZC 3QDAA 2JCCF 2Y7QA 1U8NA 3RZCC 5CBAB 4NQUA 5IB1B 3LCYA 4KXZH 1CXKA 3VFVB 4GRLB 1LHZA 4I2XA 3QCUH 1KLUB 3UJJL 4X6FB 1NAMB 1ZOXA 2YR3A 5EO0A 3MODL 1B4JL 4PGCA 1AKJD 5KW9H 1J0KA 1YEDA 5DQJB 3V6OC 1ACZA 3DHJA 4YBLC 3OTTA 4M6NL 4RAUB 1MFDL 2GJZA 4NKDB 1FNGB 5TH2A 2A6KA 3BVNB 1IKNA 5KSUA 3HN3A 4GG6A 1YUHB 1ZVHA 1HHJA 4ELMB 5EIVA 4HWBL 4NUGH 1AKJA 3T0BA 1HSBB 5AZEL 3OJDB 3A6CL 3S96A 1B6UA 1V3KA 3BRFA 3E2HB 2HLFD 1KTRL 4M1DL 2GTWA 4XPGH 4UUJA 4M93B 1PZ5A 5D7LB 4N1EA 2R1XA 4XXDB 1UACL 3SGKC 5IMKB 2MKWA 1QHOA 4RGNC 2GAZA 1KCUH 4NUJB 4JRXD 3RWDA 2V2TA 1Z9LA 3BQUC 3DMMA 1ZLWH 3SPVB 1Z0NA 4YHKL 5ACLA 1NUNB 5IWLC 2VH5H 2R2HB 4HMEA 5INDB 3ZT6A 4KDTA 3KXFD 4H1LG 2YRPA 1FRGL 5E08H 5LKNA 3BKYH 3I9GH 5ANME 3HC0A 4JRXA 2EEAA 2XWJA 1MRCH 5I8OL 2GTZB 2A6IB 2X4QB 4KI1A 1E28A 2FX7H 1MJUH 3AXLB 1YDPA 5FDWA 5A1AA 2DQHL 2J8UB 3QNYA 3IDXL 2JTDA 1A6TA 4ONFL 2SEBB 2QQQA 3C5ZC 5DEFB 1X6LA 5M7QA 3IDYB 4RBPH 4PJ5D 3FOMB 4ODVH 3QPQC 3IAPA 4N1HB 3IU4H 1FYTE 1TJHH 5F1KC 4HMDA 4IDJH 3WKNA 2NYYC 4JANB 1FVCB 2ICES 4YBQC 3OXRB 3CLFL 4MAYD 1P4LA 1MFAH 1KEMH 4FQHA 5D1ZD 3S34H 3D0VA 5FYJH 5I66B 3NPSC 3RZCD 4KUCD 4OZFH 2J5LB 1VADA 3HC4L 4X9IA 4FXKB 4MS8C 3LKOB 4JFXB 3AAZB 3QUMH 1KB5H 4OLUH 2NX5E 3QEUA 1V3JA 2BJMH 5D1ZA 1JE6A 4AIZA 4BSWA 3D69B 4DOHE 3RZCA 3S36L 4WUUE 2MCG1 1T03L 4N0UB 2AV1B 1TITA 3QH3B 3QNXB 2OK0H 2AV7B 1NGPH 4BQ9A 3JWDC 4JZOB 3G9VA 4OLZL 1KYOK 2OMBA 2VN7A 4GRWH 4R0LC 5FM8A 3V6OA 5IUSA 3NACL 4XB8A 2R0KH 1EZVY 2EH7H 3HA0A 1PW3A 5GS1C 4JG1L 2DMKA 4YHOL 4HK3J 4QY8A 1G84A 2DM4A 5TE7L 5BVPL 3QZWA 4XVUC 1IZKA 1U95B 2XIDA 4ZODA 1IAOB 3TBSB 2NW2A 4F37F 3ARGB 4WWKB 3X11B 3ZKXB 3ARDC 1G9NC 4NKQB 5JORB 3U1SH 4S2SB 4Z7OE 3PP4L 3BI9X 3O9WD 3BQUA 1YN7A 1F2QA 2GCYA 4BELD 4AEFA 5ITBH 5D2LB 5IWLA 1F02I 1BQHB 4Y0GA 3DUSA 1W0WA 4ONGL 4LVOC 3O2WL 1CE6B 4UU9A 2VITA 4MJ5A 1DFBL 4GS7C 4WU5A 1N6VA 1HOCA 5T3ZE 5DJXB 3C5ZD 4TULL 1TXKA 5EU3B 5TE6L 2LVEA 4WCYL 2B0SH 3IFOB 4W4NA 3E3QC 4P9HH 4MVBC 4M6ML 1G6VK 5KTEH 1Q8MA 1IAIL 2AEPH 3M8OL 1JHLH 1L7IL 1XIWB 4HQQH 2NYYD 1ORSA 1N0XH 3C5ZA 1FYTD 4OCXL 4YBQD 1PEZA 1LMKA 3SE8L 3VE0B 1S7WB 1EJOH 2G9HB 3BZ4B 3I3BA 4JQIL 5EBWB 4UV4H 4LLUA 2VABB 3EYOA 4O58L 2ATPA 1FBIL 5DR5L 2EC9U 4KV5E 1GGIL 3D85B 3MYZA 4IOIB 3OHXB 4PR5B 1KTDB 1FYTA 4DN3H 3PWUB 2GUOA 1A7BA 2ED8A 5CZXD 1HXYA 5FB8B 5IHZA 3WIFA 1JN6A 3IB4A 2IADA 1KEGH 4JO1L 4G6KL 4IJ3C 4MS8A 2VLKE 1EUTA 1J1OL 4WUUD 1I9IL 1QLEL 4Z6AT 1ZT4B 3DBXA 3DXAE 2BVQB 2AEQH 1CDJA 3ZHKA 4DW2L 4QGYA 12E8H 2OCFD 3TCLA 1HEZB 5B38G 4XPTH 5IFJB 1SJVA 4JHZA 4HZLA 2VXTL 3KR3L 4HX1A 4LARL 2BC4A 1C5BH 1FYHB 4QRTB 3FFCB 1ZAGA 4OF5A 1ERNA 3MXVL 5EZJA 1FPTH 4HBCH 4JRYA 3HMXL 2D7TL 3QDJB 1A6ZB 3GHEL 1VHPA 2I5YL 3Q48A 4XVUD 4R0LA 2ED7A 3MOBL 3QXDA 1Y6MR 1NAML 1FGVL 4M43L 4XT1C 3VWJB 5L7XH 3Q5YA 2PTTB 3CNKA 4MXWH 4YHPB 4PJAE 4PDCE 2V9QA 4LDEB 5F70A 4MQXD 3HG1B 3CSYB 5GS1A 1MF2H 1V7NL 4Q9CA 3SGEH 3JWOH 4K71B 4LHUD 2FWOA 2F8XC 2W60A 5E70A 5MP6L 3MV8E 1AGDA 3WFDH 3RVVC 1GSMA 4F7EA 1IC1A 2QL1A 2KQMA 1U8KB 4JJ5B 3MRBB 4P5TC 1WFUA 4WJ5B 4HUUB 32C2A 2H1PH 3ARDA 1SVCP 3IDGB 3HHRB 2X4RB 4LHUA 1NGYB 1TQCB 4G7VL 3GJFA 4LIQL 1JGVL 4QOKE 3NIDE 3B2VH 4Q58C 3VRJA 5LGJB 5T3ZD 2E7MA 4JGMA 2ZUSA 1SBSH 4FQCH 1N3NA 4C56E 3IDIA 1IC4L 3NTCH 4MVBD 1YNLL 5I73B 3NH7H 5D4QA 3K7UA 3MZGB 4LNRA 2YSSB 4RFNB 1SJXA 2A73A 1S9YA 3B43A 5C9JB 1HH6B 3VWKB 5HHNA 4U1LB 3E3QA 1X3DA 1BQLH 2ICCA 4XTRC 2VL4A 4MVBA 3ISWA 2UZIH 5CLWA 3WE6B 3MNWB 3HE7C 1YEGH 5DSCB 3ARSA 2PYEB 1KJMB 5IMOA 4YEFA 4XBEL 5CEZL 2P5WA 3HLAB 1L0QA 2OZ4L 3HZYB 3KVQA 2UY7A 4IS6B 3CFEB 2APVA 2MKLC 4I3RL 4JDVA 3L7FA 35C8L 3GSVA 5ESAA 3HRZA 4XX1G 5E8PB 5I17A 5I71C 3MJ7A 1RU9L 5LGHH 1YC7A 3LB6C 3GNMH 1MI5B 4NC0B 4HEME 5I1KL 3NCYS 1K5NB 1N6UA 3B9KB 1BAFL 4R7NB 4FQXB 1UKSA 5C0BE 2W0FB 5IOPA 1Z3GH 1WBXA 1NAKL 5EFIB 2P8PA 5KG9A 1Z9OA 5E9DE 2YXFA 2W0KA 4JN1L 1ZKAA 4Q9QH 3MLRH 1I3UA 4UAOC 2YD2A 3QQ9C 3JV5A 1HHIA 3P4NB 1HDMB 3IXAA 4PJXE 5GRVL 2NR6C 1AR1C 3DUUA 4F57H 1S7VB 5C0CE 1Q94A 2YMXL 4P4RA 4LSRH 4D0CA 2NY1B 1WWBX 2VDNH 3RVVD 4U6VH 4CMHB 3IJYB 3E0GA 1IGCH 3TBYB 1K2DB 3WN5C 1A8JH 1F4YL 5DHVB 4P5TD 3WS3B 1ZLUH 1KCSL 3DX7B 3VXRE 4DTGL 2HYMA 3QULA 1UZ8A 1FE8H 4J3TA 5TGBB 4ZSOE 4O2EB 4QOKD 3ZTJG 1N64L 2FBJH 3MO1B 4P5TA 2Z9TA 4P4KB 1IE5A 2W1NA 3QFJE 5KVFH 4Y2OA 5CEYB 4C56D 4E0RA 1KTLB 1TJIL 3PV6B 4U6XA 1YJDH 1AD0A 1M7IB 5EU7E 2XA3A 4U1KB 5HBBA 4YHZH 5B39A 1BZQK 1EBAA 3O3UN 2G60L 5T3XL 2IJ0C 1YMHB 4QOKA 1A6PA 1A9BA 4XTRD 4JVUA 4HWBA 4WDIA 5FYKU 3H9HB 1DQML 4X0KB 4HS6A 5H94A 3HE7D 5FKPB 3C6SB 4JPIA 3ULUL 3X12B 4KK5C 2VDLL 3QIWB 3O4OC 2DD8L 5KSAA 1EA9C 3FB5B 3O0RL 4XH2B 3EO1A 2NY2B 4J3WA 1GZPB 4Y89A 5DF0A 4Y5XB 4XCEB 1PY4A 4WFFE 3BSZH 2MWCA 2PF6A 1WBZA 3HE7A 4C54A 4NZJA 4LQ1A 3L6FB 3PQYB 3QO0A 4M1GH 3LB6D 1DBAH 1CLYH 3UYPA 2G75B 4YJZL 4LNVA 3MUJA 1J7VR 4HIHA 3T0WA 1WAAE 4GMSH 1M6OB 4K3DL 2EDQA 4W6XB 4X6DA 3VRIA 4OQTH 4X4XA 4G9DB 3CH1B 1I1YA 2APBA 3T77B 2AJYH 2R1WA 4XAKE 3FQTA 2CO7B 2O5ZL 2NY3C 2HFEA 3FT4B 5E9DD 3I6GB 2YUZA 5GGTH 5T33H 4PJGB 5D71L 4QXTA 1GVIA 2YC1B 5E00A 4NC1C 2IH3A 2NR6D 1YY9C 1AR1D 2B1AL 2YKLL 2XXCB 4K23L 5D1QB 3GKWL 4JGJA 4NN6C 5E9DA 3P30L 4G8FB 1GGTA 4X5XB 5C0CD 2DKSA 3DO7A 3AS0A 1IMHC 1G7QA 1FVDA 2H32H 5JHDE 4HUVB 5MENE 1RZ8A 4J6RL 3BRGC 3GBNL 5JOFB 3WLBB 3GMQB 1OAUL 4U6HB 3FT2A 3VXRD 5EO1A 1BJ1J 1FL6A 4PRAA 4UIMA 2R8SH 5C0CA 5GSVA 3OKDB 3WN5A 1QNZH 3TT3H 4FA8A 2Z4QA 4ZPTA 1Z6JT 3ULVF 2WIIB 2D7MA 4GAYA 1GH7A 1TZHA 3R0MA 1E27A 3WUWG 2PO6B 1I1RA 4UT7L 3QFJD 4RAHA 4UQ2A 2NTFA 1BD2B 2XTJB 5DMIL 5HHOB 3IGAB 2DJUA 4LMQI 4GRLC 2CDEA 1FNFA 2UYLB 5CMAA 1CFBA 5B3JF 4KK5D 3UYRH 2X40A 2D31A 5AZ2L 1K4CA 3QJHA 1KG0B 4XPFL 2XG5A 3CFBB 2I27N 1V05A 5DD0L 2Q6WB 1AI1H 1UH2A 4NRYA 3FOLB 5FUZH 4CL7A 5EZIL 1ZA3A 2QV2A 1QP1A 4HAGA 2E5EA 5GRUL 1A1OB 4U0QB 1XGYL 4WFFD 2ADIB 3TV3H 1RVFL 1B9ZA 5DZLA 5BZWB 3VFTA 3UX9B 4UMGA 3T3ME 4GXVL 1W0VA 3ROOA 3B4NA 3MOQA 3E2HC 1UJTA 3MRCB 4Y4FD 1XF2A 1HSAB 5FOJA 4M93C 3PWNB 1LO2H 1QSFE 1AQKH 1DCLA 1UB6B 4OCRH 4O02L 1ADQH 2FJGA 3GSUA 4JY6B 1J12A 1VEOA 2K7PA 3IS0X 5F3BB 3KYKL 5HYQB 2EDYA 4I8DA 3CVIL 2BVEA 2DQJH 3D9AH 3ZDXF 1Y0LB 3MRDA 2NY3D 3HB3C 1OGTB 4OZHB 2R0LH 3T09A 4ZTOH 2APFA 4UV7H 4XAKD 4S10A 5IV2B 2IPUK 5E94A 1WAAA 5EA0H 4KI5E 2R9HC 1YY9D 5C6TH 5FA3B 2A83B 5ALCH 4ZNEA 2VZVA 3VGGA 5F7MC 3WJJC 3NA9H 5ID0A 3L9RB 3LN5B 5D7SH 4R90L 2C3WA 2LTQB 4PGBB 4NWUL 4JN2A 4E41D 5JHDD 4PGEB 2CR6A 4PBWD 1MH5A 4X6CB 1JF1A 3BZEB 5I75B 5MEND 3IDYC 1C16A 3LEVL 2CSPA 3CFIC 3QDMB 4NOBA 2EICA 4BZ2L 1BVLA 4M7JL 4NM4L 1M7DA 5EOTA 4V2CB 4IMKC 4E41A 1LO5B 3G6AA 1K9TA 4JHAH 4N9OB 5EZLB 3CFKA 2R4RH 1A7QH 1YYML 3LEXB 1FDLH 1DBJH 1UKTA 3ZE0F 3WKMH 3L3GB 2X1PA 4KAQL 1T22A 3RWCB 4MJ2A 2H6PA 4ODHH 4M7LL 2HVJA 5IW1A 4IBLT 1QFWH 3DYPA 3FHQA 1T1YB 2J5LC 3QUKA 1DE4A 4KMLB 4GRLD 4F33B 4U2ZA 4DEPC 5TDOB 4XVSL 1BBDL 2YK1H 3O4LB 4NQEB 3V52L 5E2UL 3GSQB 3GSNH 3JV4B 1P5VA 4QXWA 5CBAA 5F9OL 5IB1A 1EHLH 1YEJH 4GRLA 4H88H 4JAMB 5GHWL 3S7GA 1KLUA 1LE9B 3EYQC 4X6FA 2EDXA 1NAMA 3I3DA 3PG2A 3C09B 3UZEA 2QQNH 4XVJH 3UTSB 1G7HB 1WBYB 5AYUH 5DQJA 3E8UH 4M7ZB 5HYJE 1NDGB 3B6SB 4RAUA 4NKDA 1FNGA 3MROB 2VDMH 3BVNA 2PR4L 4PV9B 1YUHA 4ELMA 4OAWA 1GGCH 1QSFD 1HSBA 3DPBA 3MLZL 4LRNL 3OJDA 3HB3D 3E2HA 4GG6F 1OTSC 3RRQA 2AJZB 4KQ3H 1T1XB 4QRSB 1KT2B 2KH2B 5D7LA 3ARGC 1R3HB 4WWKC 1VA9A 3ZKXC 4XXDA 3V5KB 2R9HD 5IMKA 4QHKJ 1JGUH 2BY1A 2VXQH 3FL7A 3MV01 4NUJA 1PSKL 5EOQL 3SPVA 4KI5D 4PG2C 5KN5B 1NUDA 5INDA 2HFGL 4HV8B 4JREB 4PJCE 3REVB 5HDBE 1OAXH 2ZSWB 4ZUUB 1Q0XL 4NM8L 4PFEA 1VFAB 3REWB 1QYGL 5LXGH 4HHAB 4IRSB 2GTZA 2A6IA 2X4QA 2GK0B 1CLOH 1U41A 5FM5M 1RULL 3AXLA 3WJJA 5FYJU 4QRPE 3JUYA 1NMAL 5EU6E 1GC1H 2X09A 1QLFB 4E42B 4Q0XH 2OZ4A 4AENB 2V17L 1G1CA 2SEBA 3VRLE 5HDQH 2BVPB 5DEFA 3F7VA 5HTSA 3ZE1F 3BH8B 3FOMA 3QA3B 1AE6H 3V0VB 3EYVB 4WEBL 2V5YA 1U8OA 1YNKL 3TBVB 3EO9H 4KDWA 1KELH 4PIRF 3VI3E 3P9MB 4IMKA 4JANA 1FVCA 2AW2A 3OXRA 2R39A 4J3XA 3TBWB 4TTDC 5L6YH 2AEIT 4ODSH 3HR5B 3IFNL 2IANB 1JHKH 1SEQH 4IEFB 4LCUB 5GGRY 4GSDH 1A21A 5I66A 3RJQB 4Y19E 5TF0A 4GW5B 4IRJB 5JXAL 2DDQH 1WFNA 4AJ0A 3LKOA 5HGBB 1FZKB 4JFXA 3O2DL 3AAZA 5D2NB 5CJ5A 3EYQD 3O6ML 1ZHLB 3GHEH 4H1LH 4X99B 1LQVA 4JY5H 1MLCB 4PJHE 5F7UA 43CAB 3D69A 5JXEA 3ZTNL 2ARJB 2X89A 2OTUB 1H0DB 4OB5L 3FFCE 4HLJA 2AJSH 4N0UA 2AV1A 2UUDK 3C2AL 3QH3A 1OTTC 1MY7A 3QNXA 2CKBH 2AV7A 4KUCF 4FFVC 4JZOA 5FM4A 5IIEB 2EDEA 2HAZA 2AI0L 1CZ8L 3GHBH 3X3GL 3WIHA 3VWJC 2VC2H 5F71A 3RZWA 2XN9E 5D1XD 1OTSD 5C7XL 3ARGD 1YEHH 3EJZC 4WWKD 3HNVL 4NNXB 3MTRA 4OTXL 5IBTH 3V6FB 4K71C 2Y9RT 4NKOB 1JGLH 4ZOCA 5KVDL 3KLDA 2DRUA 1A3LL 2FEEI 2IPUG 1U95A 3QBTB 3WHE0 1IAOA 3MGAA 3BPNC 4KPHL 2JIXB 3QHFL 4Z5RB 3ARGA 3VDBA 4WWKA 3WD5H 3X11A 4RMTA 1G0DA 1RJZA 2C3HA 4NFCA 5JORA 4S2SA 1TQCC 4PREB 4MZ2A 4KHTH 2B2XL 2V5RA 3ARBB 4KMQA 4PG2A 1BQHA 1DQDH 4N90E 1KCGC 1CE6A 4Q6IB 5DUBB 3OG4B 4YEEA 4LKXB 5T1MB 1XH3B 5I73C 4WI8A 4YXHH 2VDKH 3MRNB 2IQAB 1UJ3C 4QRPD 5T1DH 5DJXA 4ZNCD 5EU3A 4RFNC 3SE3A 4CKVX 1L4IA 3BAEH 3VWKC 3IFOA 1BJMA 1INEL 5A2JH 3OB0K 2P44B 3L95B 3GO1H 4MNGE 3D85D 3OR7B 3MX0A 4RGOH 2YA2A 5CJXC 4JKMA 3RIFF 3I75B 4R26L 5DA4A 4F15B 3VE0A 1S7WA 2G9HA 3BZ4A 3BIKB 5EBWA 4TTDD 4OGYH 1BEYL 1LO0H 3G5VB 2VABA 2VZ1A 3FFDB 1OCWH 3PP3H 2QSQA 3D85A 3T04D 3EJJX 1AJ7L 4IOIA 5I8KH 3RUGE 3OHXA 1NLBL 4PR5A 1KTDA 4AT6B 5JTWA 2VWEE 3PWUA 2A77H 1PZUB 5EULV 4WU7B 5FB8A 4ZXBB 1LK2B 4MJ4A 3O41B 3B9KC 2QHRL 4FQXC 3RKDC 3KLHC 1B2WH 2AKRB 1U8LB 4OIIL 3MRMB 4GRMB 4K2UH 1BPVA 1OTTD 3MLWH 5CCKH 1X5IA 4ZYKB 4LU5H 3WXVH 3FFCD 1ZT4A 3TEUA 2ITCB 4FFVD 2BVQA 1U8MB 3BP4B 3GRWH 1BJ8A 1I4FB 2A38A 3QDJD 1HEZA 4JFQB 5IFJA 4PJHA 3VWJD 2HWZL 3TH2T 3VFWB 4QRTA 3WHXB 1A7NH 1IQWL 1RZFH 3OJMB 3FFCA 2ZCHL 3TIEB 1S5HB 2Z8RA 2DJSA 1RK0A 4Q97A 4M4RA 3S35H 4JZJC 1G7JB 1KENH 2NY1C 3QDJA 1INDH 1A6ZA 4EI5B 3IDMB 2CO6B 4CMHC 3LMJL 3KPRB 3VWJA 2PTTA 2RCSL 1NCAL 4YHPA 3ULVH 3VH8B 1X5KA 4MJIE 3HG1A 3CSYA 2VQUA 5D96B 5LCVH 4XNQB 1RURH 3S4SB 1TDQA 5EIQA 4PTUB 3EZ8A 4KGJA 4MDIB 1I9RL 5C07E 4QGTA 3NMEA 3TM6A 1OSZB 1U8KA 4JJ5A 2EYRB 3MRBA 1FVEB 1RZKH 4WJ5A 4HUUA 4P4KC 4N90D 4FTVE 25C8L 3IDGA 2X4RA 3FZUC 1NGYA 1FNHA 5D7IE 4K94L 1DQLL 3NCCB 3A6BL 3CXDL 3VWKD 5L0QB 4MXVF 5LGJA 4NZUL 3LOWA 1DANT 3PHQB 4UTBH 2ESVB 1S78D 2WP3T 2NY5H 3F65A 3V8OA 4WTZG 2YSSA 1WWWX 2KL6A 5IG7B 2PYED 2VIRB 3QIWC 5C9JA 1HH6A 3VWKA 4OZ4B 2Z35B 1CDIA 4U1LA 2NY2C 3ET9F 1NCWL 4FG6D 1JRHH 4Y5XC 5GS2D 5D5MB 4X7FC 3NZ8B 3X3FL 4HDIB 1MPAH 4WHTB 2VLME 5I8EB 5CJXA 3MNWA 4J3OC 5DSCA 2PYEA 1KJMA 3RL1B 4O5LL 3QUXB 2XZCL 3CXHK 3U30B 1LDPH 3L5XH 3SJVB 3HZYA 1MI5D 3L1OL 5EWIH 4IS6A 3CFEA 3B9KD 3W0WB 4FQXD 2Y06H 3RKDD 3KLHD 4NBZB 4KRNA 2HP4A 4K7PY 4OIAA 3MBXL 1C1EH 1DUZA 5E8PA 5FUOH 3QJFB 3GDBA 5CWSB 4UINH 4F3FB 3VXMB 5FFLA 2PTVA 2ZJSL 4PJGE 3QXWA 1MI5A 3P4LA 3BJ91 1K5NA 1QO3B 1XGQB 1RIVL 3B9KA 4KV5F 4FQXA 4R7NA 2X44D 5INCB 3TA3B 1JYNA 1GHFH 2W0FA 2ZKHL 4Q2ZB 5EFIA 5KBNC 4X6BB 3GMOB 5D1QC 4LSVL 4YE4L 4KVCL 3N85H 1LEKB 3T4YB 1TJGL 2CK0H 1EEQA 2NY1D 3BD3A 3LSOB 4MNHB 3D3VB 4N0FB 3P4NA 1HDMA 2HRPH 4RMSA 3MYJB 1Z9MA 2J7LA 3FO1B 1S7VA 4XPAL 4HGKC 4JZJA 4QWWC 1FFOB 2JJUA 3BDBA 3IJYA 2J6EH 3TBYA 1K2DA 5FYKE 1ZMYA 5ADOL 2F53E 4HT1H 5DHVA 4ZOAA 3WS3A 2DQGL 3DX7A 4P4KD 5C07D 4UT6L 1Q72L 3IAQA 4RFOL 2DB8A 5DWUH 3FZUD 2PO6C 5AG8A 2XTJE 4EJ1C 5FO8B 1DR9A 5TGBA 5EZIH 4R4BB 5HI5C 4O2EA 2XTJC 4OI8A 1T0MB 5I1DB 3MO1A 1KXTB 4PJAF 2FD6H 4P4KA 2ZNWA 5IVNA 5CEYA 4TSBH 1KTLA 3PV6A 1M7IA 3OJVC 2VDOL 5ERWB 4U1KA 2D9CA 3OB8A 4MHHI 2MMXA 5D7IA 2NY2D 1YMHA 5BOZG 1F58H 4DZBB 1MJ8H 2FSEB 3H9HA 4U1JB 4X0KA 2AABL 4DKDC 1WF5A 3KHQA 4UIKH 4HIXH 1BFVH 3C6SA 4KJQD 4M9OA 5FKPA 5SX4I 3X12A 5IGXH 3HMWL 1P6AB 3PQYD 3QIWA 3TT1L 3MRPB 2G5BB 1C7SA 3FB5A 4XH2A 2Q86A 5F7EL 3P0YH 4Y5XA 4QXGH 2YA0A 4XCEA 4OFVA 1RUML 4XBGB 1VESA 1WFOA 4O2FB 3CDGB 4V3DB 1NGXB 3L6FA 3PQYA 4XCFH 1KOAA 2ZOLB 3ZLQC 3MC0A 2KUTA 2G75A 2OYPA 5IK3B 2Y5TB 1M6OA 2LU4A 1AHWB 4PLJD 4QYOB 2WQ8A 5CGMA 3GK8L 2BHYA 3CH1A 1R5IB 4PGDB 1QFWM 3DURB 5TQ0L 5D1QD 3CDYA 3T77A 3ZTJH 4BFBD 3HTLX 3DGGB 3FT4A 5ILTH 3I6GA 2DN7A 2C7UA 1XGUB 4PJGA 4U6YB 2FBOJ 3KHOA 1NBVL 1L8JA 4GLRH 2R4SH 3QIUB 2YC1A 3R1GH 1MLBB 1K3ZA 1SQ2N 4JEGB 3GI9L 2LTQC 1BOGB 2YD3A 5D1QA 3AGVA 1FL3A 4H8WH 4YPGB 1OP5K 4XPBL 4K3JL 5I75C 2CGRH 3P3YA 3CX5K 5IBLC 4LVEA 4YH6A 4QWWD 5I1IL 4G8FA 2Q87A 4PJFB 4X5XA 4JQXC 1JZ3A 3F7QA 4HUVA 3JZ7A 5I1HH 1R3LB 4FQ2H 3GIVB 5JOFA 2A9MH 1M1SA 2F58L 2VISB 2EYTB 2F74B 3GMQA 1CFTB 5BS0E 4U6HA 2PO6D 5I0ZA 1GAFH 3G6JB 5F7HA 4G8EB 3OKDA 5HI5D 2XTJD 1IZJA 5HHOD 3GGWB 4OCYH 1G7IB 1KXVC 1KCVL 3O4LE 1BIIB 4NQEE 3C8DA 2WIIA 3V5DB 1J0YA 1QSEB 5HGAB 2EDKA 3V9FA 2PO6A 1VGEL 5F89B 3V4UH 1HE7A 1FP5A 1GOFA 2HRLA 1X5AA 1BD2A 5HHOA 5I1LB 3IGAA 5ACZB 1T6WA 1UXWB 3L5WB 1IAIM 1OAQH 1YEFH 2UYLA 3WJLC 3MV7E 4FQLH 4G9FE 4OZGE 3C09C 1Q9LB 1U58B 1KG0A 5A16B 3CFBA 2APXA 1YEKH 2Q6WA 4Q6YA 4M7ZC 4X8JB 5FHAH 3FOLA 4XCNB 3ZKSD 1QD0A 1A1OA 1D7FA 4NHCL 2ADIA 3BDYL 1T7WA 4H0HB 2MCPL 3O2VL 5EORH 4KJYB 4NSKA 3NABL 4HJGB 3MRCA 6FABH 1HSAA 3VGAB 3ILPB 3PWNA 3T0EB 1F4XH 1UB6A 4JY6A 3RY4A 5F3BA 5HYQA 3TFKC 1MCPH 4PJBB 1HQRB 3DI3B 5C0IB 1Y0LA 2VDQH 3QEGH 4OZHA 4Z77B 4OJFL 2W59A 4JREC 2DWEA 5IV2A 5F7KC 1I1CA 3K1DA 4TTGA 4TVPH 1VPOL 2PCPB 2EIEA 2OR9L 5FA3A 2A83A 4IRSC 1LO4L 4NPYB 2GSGB 5IBLD 3WUZA 1WAAF 2WINB 1XF1A 1U3ZA 4DUWA 4JR9L 2A9NH 3P2TA 3L9RA 3LN5A 1FCCA 2EC8A 4PGBA 5C9KA 1EXUB 3INUH 2VE6B 1E6OH 4RNRB 2P7TB 4PGEA 5DZNA 4X6CA 1MFBL 3BZEA 3WYRA 1HINL 3SDYH 1F5WA 4GAJH 3QYCA 3SGDI 1Q0YH 2BRRH 1H3PH 3DUHA 4JQXA 5BS0D 5D7KD 2VXUH 1FH5H 3QDMA 3MRHB 1T21B 5FIEA 2XYCA 1WT5C 3W11C 1LO5A 5EZOL 4MAUH 5EZLA 3LEXA 4WIQA 3O4LD 4NQED 2XACC 4TVSa 1OVZA 4QHNB 1M7XA 3DRTB 2OQJB 3L3GA 3UAJC 1AGCB 1H8OA 4LQFL 3OJ2C 4H25B 3RWCA 5DMYA 3TNNB 2COQA 5D2NE 1T1YA 4IRJC 4NCDA 5C2UB 3BDXA 4WI9A 4F33A 3UTPD 2P46B 5C0RL 1A4KB 5TDOA 4GAFB 1HYSD 5D2NC 3CFCL 3O4LA 4NQEA 5GRYA 1RMFL 4HCRL 3JV4A 3L3KB 3UTSD 4XC3L 2BY2A 3GBMH 1BVKA 3TJHC 1O7SA 4XP9L 4FZEL 4KH2A 5C0AB 1V3MA 3WJLA 1LE9A 4QNPE 5FGSA 3UTSA 4RGMB 3E6HB 1G7HA 4FFEX 3CVHB 1HIMH 1VFOA 1NDGA 3B6SA 1ZTXH 3JWDH 1QBML 1CL7L 2W9EH 1MQKL 3LQAH 3I50H 1EFQA 1AIFB 4JB9L 3MROA 4WNQB 5ECJE 3T3PE 5KVGL 1QLRB 4PV9A 1IT9H 5JQHC 5TFSH 2V7NB 4S1DC 4WO4B 5IROC 4GQ9L 2AK4B 4NZRH 2FX9L 4RMWA 5F21B 4U7SA 3RX5A 2ICWI 1J0IA 1UC6A 4NZTH 2QQLL 2AJZA 1T1XA 4QRSA 1KT2A 1CDHA 1R3HA 3EKCA 5CJ8A 4L4JA 3VD7A 3V5KA 4UOW0 4XP6L 4PJEB 3B3IB 3TFKA 3QB7C 4HH9B 1CU4H 3T3MF 3ARBC 5KN5A 3QG7H 5GJTL 4XB7A 4HV8A 3REVA 4Q6IC 2ZSWA 4ZUUA 1NCUA 1G9MH 3QDGB 3ARQA 1VFAA 1L7TH 5E99H 1ZA6B 3REWA 5CIPB 5IEHB 1MCFA 3SE9L 5I1EH 4TUJB 4Z7WB 1BEYH 4HHAA 1QZ1A 4C83B 4N0RA 2Y4SA 4IRSA 2GJ6B 2DQCH 2GK0A 3B9EA 2ENSA 1A02N 4LSQH 3ZYOA 3KNBB 4OFPA 1IILE 1AH1A 1AO7E 4KI5F 5HVHC 1QLFA 4E42A 2AXJA 2IPTL 4AENA 3W11D 5ABDE 5ID1B 4G6MH 1GOHA 4F15C 4XNYL 1LP9E 3BH8A 3VGFA 5C92A 3QA3A 4FABL 3V0VA 4B7IA 3EYVA 3NBNA 3TBVA 4AEIH 5DI8B 4IRJD 3P9MA 4MA7L 1WT5A 4RMUA 5IBUG 3NCJL 4H20H 2C1PB 4G5ZL 2AJVL 3TBWA 1BFOB 5BV7H 1RHFA 5ALBL 1RUQH 3HR5A 2IANA 4LCUA 3K4DA 4R8WH 4R3SB 5BRZB 4GW5A 4IRJA 2X9WA 1A4JB 4MNQE 3TJHD 1CFNB 1FZKA 1SM3H 4JKPH 5HGBA 1GYAA 1P7KB 4L5FH 5D2NA 4LGSB 1ZHLA 4X99A 5JIPA 3B8YA 5FUCC 4Z7NE 3MREB 1MLCA 1TQBB 43CAA 3DJ9A 4GFTB 2ARJA 3WSQL 3W2DL 3NGBB 2OTUA 2XRAL 1H0DA 3TJHA 1OAYH 3F12B 1EO8L 1V7ML 1N8ZB 3QCVH 3FRPA 3HZMB 1BGXL 5JPMB 3MJ6A 1MIEL 2F5BL 1Q9OB 4BSJA 5IIEA 1R5WB 1E0OB 3UC0L 4EI5C 5D6CB 1FJ1B 2GKIA 4ZAKC 2XA8H 3U6RB 1CFSB 1D5IL 4L8BB 1CN4A 2JIXD 2XZQH 3K2UH 3CSBA 4OUOA 4TOYH 4P5MB 4NNXA 4F58H 5IROA 3V6FA 4NKOA 3MLVH 2VLLB 2EDFA 5HHVL 1VACB 1OP3K 1P4BL 5HGHB 2KQNA 1GL4B 2OL3H 5F6IB 4JDTH 2JIXA 4Z5RA 4N5EA 1ED3B 2M2DA 3LQZB 1ZXQA 5D7JB 2IGFL 2VDPH 2DQEL 4PREA 3ARBA 4FFZH 2WANA 3BKJH 5IMMB 3A6OA 3QIBB 5L0QC 1RAMA 1EGJL 4WFHE 2V5MA 1VERA 4Q6IA 5DUBA 4KTEH 4LKXA 2MPAH 5T1MA 1XH3A 1NGWB 2BNQB 3QUYB 4U1NB 3MRNA 2IQAA 5FHBH 3NFSH 4QHUB 1J5OL 5J6HB 3BWAB 3O3DB 1CD1B 1AO7D 3EOBB 5CSBA 1RK1B 2EDRA 5KS9B 4PJCF 3FN0H 5HDBF 3S3JA 4LEXH 3L95A 1MNUL 3E1F1 5BXFB 3U9PL 3OR7A 3EW3B 3SQOH 3I75A 5DA0B 1AO7A 4WW1B 3QUXC 1X44A 3U30C 3BIKA 3ARFD 3G5VA 5CINL 1NC2B 3FFDA 3IDNB 5GISH 2R56H 4U3XA 3TO2A 3AS3A 1F4HA 2OJEB 3VRLF 4OV5B 4AT6A 1LNUB 4FQ1H 4JFPB 5JZ7C 5CS7A 1OM3L 1UCBL 4MNQD 1A22B 4WU7A 1RUKH 1LK2A 4YDIH 4DCQB 3MUHL 1K6QH 1ORQB 4M02A 3VI3F 4WGWB 5I1JL 2H8PB 3TA3C 2AKRA 3FQUB 1U8LA 5DJCB 4Z7VB 2XY2A 3MRMA 4GRMA 3F7RA 1A6UL 5KJRH 2M1KA 4ZYKA 3THML 2ITCA 1TVDA 1U8MA 2OTWB 1J1PL 3BP4A 1ZVSB 1I4FA 4JFQA 4KMTH 2Q8BL 1UCTA 2DQGH 3ILQC 4EI5D 4ZAKD 3STZB 3VFWA 4KQ4H 3WHXA 2XY1A 5D8JL 1T1ZB 1NCDL 3TIEA 3W81A 1S5HA 3TPUE 3FO0H 1ZLVK 2KZ1B 4PJHF 4YC2B 4OIBA 2NCMA 1S9VA 1G7JA 1CK0H 4LCCB 4EI5A 3MBEB 3IDMA 4OF0A 4WTXA 1MFCL 1ZANH 1WITA 4BKLB 2DI8A 1KC5L 2X41A 3H3PH 2NXYB 2RHEA 3STLB 1UM5L 4FMKA 4XNQA 4JFDB 3S4SA 4MA8H 2I25N 4PTUA 4MDIA 1J88A 1HKFA 4LLWB 3BUTA 3ZHDA 1OSZA 1R24B 1PQZB 3K81A 2EYRA 1FVEA 3L3HB 4HPYL 2NY6B 5C1MB 3QR2A 1PX4A 3CZJA 4YXKH 4NZDA 3F7YB 4APQD 3S88L 3LY6A 4YXLL 4CADB 1ZS8B 4NFBA 5IB4B 3DYMA 4YX2H 4Z7UE 1OT1A 4HWEL 3PHQA 3EGSB 2ESVA 4L4VB 2MNUA 3MJ9L 4OFYD 4S11A 4XC1H 4DZ8B 5IG7A 2VIRA 3QUXD 1OPGL 4L9LB 3KPSE 4OZ4A 2Z35A 3SJVD 4NBYB 3ZL4L 5I76B 4MWFB 4R2GB 1R0AL 5D5MA 4IOSD 5E8NB 3NFNB 3NZ8A 3W0WD 4G59A 4L8SB 4HDIA 1CDCA 5I8EA 4Z0BL 2X4PB 3NAAH 4OFYA 3AY4C 2ICEB 5JNYB 3MZTA 4XPHL 3RL1A 4KHXL 4NO2B 3QUXA 5MHSD 1NFDE 4QLRA 2UZXB 1FORH 3UJIL 3D1MC 3TJEH 3WFEH 3LIZH 3VXMD 3SJVA 4U1SB 4YHIB 3RVXC 1T83C 3ZKMC 3C08H 3W0WA 1I3GL 5IQ7L 3TA3D 1OD9A 1IVLA 3BH9B 2FGZA 3UZQA 3VXSE 3PXHA 5FF6B 4G8IB 3QJFA 3EUUA 2JELH 5CWSA 5FA4B 4F3FA 3C6LB 3VXMA 3VU2A 1JGEB 1D5XB 2YUXA 2C3VB 1IAMA 5MEOB 2W65B 1XGQA 1QO3A 4OM0L 3HE6D 3ILQD 5INCA 3TA3A 4P57B 3RUGF 2HA1A 3D0LB 3D3VD 3QIUC 2ITDB 4Q2ZA 5IHLB 2H26B 3N1FC 5DQ9B 2X7LB 4X6BA 3GMOA 4K8RL 2F8OA 1JI1A 2HFFB 4EQ2A 1MY5A 1LEKA 3T4YA 1A6VL 1S9KC 4PS4L 3C9NB 1FLRL 2AQ2A 3LSOA 4MNHA 1YEEH 3RAJH 5CZVL 3D3VA 4N0FA 1Y18B 4HKXB 4JO4H 3MYJA 4IMLB 4WY7H 3FO1A 1K3IA 4LL9A 3OKKB 3D5OF 3IDUA 1KJ3H 2F15A 1A0QH 1FFOA 1DBKL 3ZO0A 4OCWL 3QRFM 4GW1B 5L9DL 2BNRB 1RI8A 1CR9H 1WZ1H 4PJ9B 3SDAD 2DI7A 1ND0B 3RVUC 5FO8A 1N5YH 4R4BA 5HHMB 3U7YL 1T0MA 5DD1L 5I8CB 1A5FL 1NGZB 4XCCH 4UB0L 5GGQL 5KSBB 1HNGA 4N0CA 2HTLC 5L8JB 4HJJH 5ERWA 4MQ7B 2UUDH 2XTLA 5CSGA 2EC9T 4ZFGL 4WI6A 1RUPL 5E95B 3QRGH 5CILL 4DZBA 2FSEA 7FABH 4CVXB 4U1JA 2AK1L 4Z95H 1KCRH 5DJDB 4ORGB 5D7IF 1YN6B 3TBTB 4WVRA 2DTMH 2PNDA 3MRPA 4MB5A 3OAUL 2G5BA 3SKMB 1CGSH 2VXSL 3RVXD 4L4TB 3FQWB 4OM1H 3A67H 1HHHB 3KS0J 3ZKMD 3PUCA 2MQ0A 2I60L 4MX7B 4XBGA 3VGAC 2NQCA 4O2FA 3CDGA 3G9AB 4UTAH 3T0EC 3AY4A 1NGXA 3BEWB 4Y5YC 4GMTL 2ZOLA 1NFDA 1T83A 5IK3A 2Y5TA 5DD3L 3L7EB 4HAFA 1AHWA 2G5RA 4Z18A 4QYOA 4GKOA 3QIUD 4KGLA 4NQDB 2R0ZH 1R5IA 1PKQB 3OPZH 5H8DA 1KGCE 4PGDA 3DURA 4YHMH 4OZFB 4WI3A 5E2VL 3FQRB 4ZO9A 2FH8A 3DGGA 1EBPA 4DVBB 3X14B 1XGUA 4U6YA 3QUMB 1KB5B 5C08B 1JNNH 1IGYB 2EDBA 4EUPG 3QIUA 2AGJL 5TDPB 5JDSB 4LASL 4M5ZL 1MLBA 3K8MA 5BVJB 1BOGA 3PGDB 3OB0H 4YPGA 4PJGF 1E4XL 4HIIB 5C70A 5HGDB 1VFUA 5JR1L 4PJFA 3BN9C 5E2TH 2VYRE 2Q8AL 2Y36L 3BJLA 2R0WL 5DQDH 1UWGH 4U6TA 4K7PX 5ESQB 1R3LA 4JFZL 3GIVA 4RWYH 3N9GL 1QSED 2VISA 4GRWB 2EYTA 2F74A 1QFUL 4PJDB