3ROOA

Murine class i major histocompatibility complex h-2kb in complex with immunodominant lcmv-derived gp34-41 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Murine class I major histocompatibility complex H-2Kb
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rooA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rooA01
3P0GB 3K1KC 3SGJC 1OCWH 3P0YH 4OCWH 4DTGH 2JB5H 1FAIH 1UCBH 1JF1B 3QIBB 3O45A 1JYVA 5LVEA 1M7XA 2GCYB 1Q94A 5KZCB 4OCYL 5SV3A 4ELKB 3T2OA 5D2NA 3C6SA 2A6DB 3SDDB 4NJAH 4NGHL 4F8TA 1AE6L 4X7TB 4J3SA 1VFUA 1EHLL 3IVKB 1XF2B 2DOCA 2DAVA 3BX7C 4LLDB 4OCRH 3QRGL 5JHLL 4F15C 2D03H 1ND0A 4QRPA 4MQXC 1S7XB 3U30C 1KCRH 4XP9H 3W11C 1DLHB 4EI5D 5AZEH 2WWMD 1B2WH 3LS5L 4DCQB 3C09C 4ZFGH 2B4CC 1E28A 2NXZC 3FMGH 3ECBB 3ARDB 4WFFE 5TE4H 1MREH 3O8XD 2AXJA 1CD1B 2NY3D 1EJOL 1AR1D 4KUCF 1PX3A 4PJDA 1IM3A 2EIZB 3WSQH 2HRPH 5SX4I 5LQBH 1TNNA 2BY2A 3K7UA 1CLYL 3JWOC 1CFVH 2WBKA 3UC0H 5J6GB 3P9MB 3QHFL 2FWOB 4A6YA 2E3VA 4JN2B 2RIKA 1FPTL 2P4AB 3FRPG 1GGIL 3QXAA 4IMLB 3WNKA 4KHXL 3HLAA 1JHTB 4NNPH 4WNQA 5HYSA 2OL3B 4BQCA 4MWFB 3FT3B 1JGLL 4OSUH 4OLVL 1DZBA 4HGWA 3QO1A 1SM3L 3ULVF 1BWWA 1AQDA 3E0GA 4UNTA 3GMLB 3KPRD 4OQTH 5T1DL 1KGCE 1CDJA 1YMMA 4FQPA 1RUAL 2Q8AL 1K5NA 4FQXB 5MEQB 3LY6A 3KPPB 4GAGH 1QFWI 4D94A 2NY5H 3MBEA 3MRRA 4AIZB 3QEUA 2UUDK 1WC7B 4NN6B 4LHUB 3CFJA 4ZUWB 2HKHH 1CU4L 3H42L 1AGEB 4NO0D 2WIIB 3NCCB 4N0YL 3HE7A 3VXPB 4IRSD 1R3HB 1N8ZB 4U1MB 1WICA 2IBGA 4ELMF 5DJAA 1A9BA 2CK2A 2R39A 1XF5B 2BNQA 3M8OL 4O2CB 4PJ9D 1DQJB 1E4WL 3PDGA 5GSVA 3VWKD 2X7LA 4XNZC 2CRIA 5DJ0A 1I85C 1HINL 4Y19A 4P46A 4OGXH 5DJXA 3UTPD 5ICYB 3JUYA 1CGWA 2P44B 1Z9LA 5F1OB 4N90D 1Q0YH 2BY3A 2BJMH 3CPLA 4OGZA 4HUVB 4CAGA 4F7EA 1MQKL 3VGEA 4F9LC 5EU3A 5E8EB 1KJVA 4XCYB 4NM4H 4PJ8B 3RDTC 1M05B 4R4FL 3QUKA 3MUZ1 5EOQH 1IAIL 4Z7NE 3BRDA 2Q76A 3KPTA 3BDXA 4MJIE 4OZFH 4UV7H 4KUZL 4LQFH 4S1DD 3QDGA 5LKNA 3ULVC 4WEUD 4RWHA 4OZ4B 1AHWC 2DQEL 4Z76A 1T0MB 1LVEA 4YK4C 4P0DA 3I2CL 4LSQL 2CDFB 4XC3L 3OKLB 4WWKD 3BPNB 5J1TC 3LKQA 2BSED 4F7MA 1LQVA 4DZBB 4H0GA 5CBEA 4YBQC 3EYFB 5E9DD 1R3LB 3WIHL 5HHNB 1F3RB 1RJLA 2JELL 5GRYA 1BAFH 1NC2D 3RTQD 3DV4A 3WO4B 1T7WA 2VDKH 1MIMH 1BD2D 4Y4KD 1T4KA 2YEZB 1CGYA 1JUFB 4N0UB 4XP5H 5E2VL 4BQ8A 1HWHB 4UILH 2PXYB 3S34L 3RAJL 1QLRB 3FCTA 4TTDD 3WE6A 5DT1L 1VERA 2E7LC 5D96B 5JQ6H 3ZYOA 4OD3L 2QR0B 4YR6B 4MAYA 2G5BB 2OR7A 3ZDXF 2AJUH 3MLVH 1RUQL 3O81A 3TN0D 5D93B 4HMDA 15C8H 5C0AD 2R4SL 4AEHL 2EDEA 4XH2B 1I7UB 1RZIA 4ACPA 4R8WL 2Z93B 2LVCA 1BZ9B 1D5IL 1FFOB 1CL7I 4PJIA 2VXTL 3O2DH 4BKLA 2B1HH 3D2UB 4GG6F 3VGAB 2IGFH 2BHZA 3MLTA 5GGRA 1ACYH 5L9DL 1WFUA 5J13B 1J05A 2CKBB 3QFJD 3LQZB 3MYJA 1KIRB 3GSRB 4ZFZB 3IF1B 4HJ0D 3JSSA 5B38A 1C12A 2DJUA 1IC1A 4XPGH 1URLA 3V95A 1LE9A 1J5OH 5LGJA 3KPRE 3RGHA 3TA3B 5FOJA 1I1FA 4PTTA 1DE4B 4PD4J 4GW4A 1N3NA 1IKNC 5SX5K 4OFPA 4KRPB 4OLYH 1NGYA 3T3MF 1EHAA 3QHZH 5F9WC 4PB9H 4GXVH 5J9PA 1PD6A 2DQGL 2R69H 4X5XA 4YQXL 4KROC 2R29H 4YAQA 3RWEA 5MEPB 2AQ3A 2YRZA 1G7IB 2BZDA 3HCVA 3ULUH 4JDVA 4ZFOL 1G9MC 2V5RA 2X10A 3DX8B 1UQSB 2Z35A 3WN5C 4N5EC 4JO2L 1JGUL 1QPPA 1EO5A 2ZSWB 3BD4A 3QXDB 3B3IB 1X5AA 3HNVL 4F7CB 1SJEB 5DQDH 4GXUM 5DC4B 1NLDH 1KTLA 4XC1H 3H3KA 1FO0A 1I75A 1NQBA 3PGCA 3ZKMD 5F93C 4LCCA 2R56L 4FFWC 4ENED 1T5WB 5TJWK 4HW6A 4HQQH 3AY4A 4N90E 4NQDA 5KSAA 2AVGA 2O5ZH 2F19L 3ORJA 1PGRB 4M6NH 4APQB 3MV9D 1S7RB 4WUUA 3OAZK 1DUZA 3MV7A 2AV1A 3TYFB 4BA8A 1RZJC 3QUXA 5C0NC 1I8IA 5C0GB 4JFHD 3RJDA 4B5EA 4YO0A 2GJ6B 3F12B 1OAZH 1G1YA 5L7XH 4BSWA 1L4IA 1RZFH 2AGJL 5C0DA 1PAMA 4XPBL 5E95B 4LEXL 5EWIL 3VFVB 2FBJH 5IWLC 1KCSH 5T3XD 1D5XA 4NSKA 1IKFH 3BP5B 4HHAB 4KDVA 5IK3A 3WEXB 5E9DE 1RURH 2AAVA 4X98A 4JPKL 3AVEA 4OFIA 3STLA 1JV5A 5HXMA 3KLDA 3MUJA 4KTDL 2EDRA 3KLHD 1QBBA 2HFFA 2HMID 1A3LH 4F8QA 1CFQA 4NOBA 1BD2E 3GMMA 3MRNB 3RUGE 3WIIL 1UFUA 1J18A 4GUPB 5T1LD 3QH3B 4K3DH 1CLOL 1MI5B 4EN3C 2PF6A 1Z9OA 1PVHA 2OCFD 1H15A 3VFUA 4LSSL 3IDJA 1M7DB 5EUOA 3H8NA 3WMSA 2FX7L 3V2AR 1CE6B 1AFVL 2QBWA 3QI9B 5C6PB 2D0FA 4X5WB 3DSFH 1HHJA 2IG2L 4JHZA 5FHBL 4F3FB 2CGRL 3MRHA 2N4IA 4R26L 5DHVH 3MLSL 4WCYH 1JGDA 4LLUA 3RU8L 3EJZD 2WP3T 2HVKA 1VGKA 5T3XL 3EOBA 3ZO0A 3RVWD 3CXHJ 3ZL4L 3BKCH 3QNYB 4XMLL 1U93A 1YPZA 4HS3B 3KNBA 3OKOA 5A3IC 3MODL 1X5KA 3HFML 2HLFC 1X5FA 3B5GA 4JO4L 3SDCA 3NCEB 4L29B 3QFJE 4RRPA 3W82A 5D5MA 4YHYB 3FB8A 3VD4A 4YDKL 3MO1A 1KYOJ 2P5EA 2DJSA 3K3QA 4P4RB 5DDHA 1CQYA 1XCQB 3RWHB 2F8VA 2H41A 4KJPC 3PGDB 4AMKL 1X6LA 4P5KA 5HY9A 1NCAH 1ZHBB 3A0OA 2VLME 5DUML 4GW1B 1PX4A 4P23C 2NMSA 4M00A 5I1KL 2R4RH 4UDTA 1U3HD 1RUPL 5HGDA 1MQ8A 5D1XB 2X4QA 3FT2A 1MCPH 2CRMA 5IUSA 4X7CC 2GT9A 1EGJA 3W0WD 2FLRT 1SMAA 2VZUA 3DIFA 2AK4A 4GRLC 4IIQC 4UUJA 4S1SH 1CYGA 1JZ8A 2E7CA 4ZPTB 1ZE3C 3VW3H 4NO3B 3CMOH 2ESVD 4PP1C 5HHXH 3KPOB 3OAYK 2FO4B 3GIVB 5KAQG 3BXNB 4X4XB 1QHOA 1WGOA 3L5IA 3CFIC 4HWEL 5JXEA 3RI5K 5DHYB 4ZXBC 4HLZH 4XCCL 4KZDL 1UA6H 5EG6C 3MV9E 1YY9D 3TV3H 1LO2H 3HAEA 3GM0A 3MJGX 2Z31A 1A7PL 2AI0H 2FEDD 3V6FB 4JFHE 5DEGB 5EU4B 3G6AB 1FYHB 1UEMA 1JNJA 3HPJA 2MHAA 2WIMA 3X14A 1S3KH 1WCBA 4JAMB 4JJHA 3VFRB 5CD3A 2OYPA 1G6RB 3D48R 1OSPL 5F7MC 1QQDB 4J12A 5JA8B 3DOSA 1YN7B 3BHBB 3QG6B 4PJ7E 5T3XE 4W4OC 4GKZA 4KGLA 5CP3A 1FL6A 4GRWE 1WFOA 2K7QA 2OS7A 5D6CB 5D6DC 3TH3T 4XZUB 3OL2A 1SQ2N 3TBYA 4AQOA 5C6TL 4IOSD 1S7VA 4RNRA 2SEBB 3MJ7A 2DMKA 4RAHA 4HDIA 4POYA 3HZKB 1S9VB 4WDIA 5C07E 5C9JB 2BVOA 4MCYA 4X9BA 4HUUA 2Y36H 3VI3F 4XHJD 2H2SD 2G2RA 1MCJA 4H88L 5LCVL 2VNCA 2HWZL 3D87B 5IQ7L 2QEJA 3D0VB 1HI6A 2K1MA 1LK2B 5FO7B 2XY2A 3TEUA 2EDDA 3OJMB 4MJIB 3UPRA 4HWUA 2VDRL 5IQ9B 3H7BB 3BRGC 3BGMB 4AG4L 5CJ5A 4TVPH 1FZKA 3BFOA 4I1NB 5C08E 2Q6WA 2F74B 1G7QA 3RZCA 4M6ML 4RFNB 4Y88A 4ZDHA 3KPNB 1JRHI 4X7FC 3T0EA 3PXHA 5I1HH 1IBGL 2RB8A 5D1QD 4I4WA 3HS0A 1C08B 4N8VG 5CJQL 3RWGA 2A2QT 4LCYB 3IFNH 4MQ7A 3BVNA 4AL8L 3B6SB 3EYQC 4GKSB 4OI9A 4OKVA 5F9DC 2FJGA 4NJ9H 5C09A 5DQ9B 2CXKA 2H32B 1MCWM 1CK0H 1BVLB 1SJVA 1MJJA 5AWNL 4M7ZB 2YMXL 4RAVB 1MJ8L 3H2WA 5I15H 4XP4H 2QQLL 1DANU 2VUYA 3LKOB 1IEBA 1EXUA 1D6EA 3FOMB 2A74A 2P49B 3VCLA 5FKAB 3NCYS 3W0WE 3O11B 4PRIB 1C5CH 2R15A 4LCIL 3UYRH 4JO1L 3P0VH 3O8XB 2HFGL 2NY3B 3SCMD 2FRGP 5IF0B 3TJHA 3PWVA 5I8EB 3HI6H 4HS6A 1HQRB 3OKKB 4XMPH 4NFBA 3SJVD 1P7KB 1OAQH 1IAKA 4PYGA 4LLWB 3WNOA 4CMHB 4U1GC 1PZ5A 5H37G 3LRHA 2A6JB 4OFKA 3VFGH 4L5FH 1NMCB 4WW2A 1F4WL 4MNHB 1MHPL 5DK0A 3O6FA 5MENA 2EDXA 4NCC2 1ZA3A 2PNDA 2O5YH 4J7RA 4TULL 3JV5A 2AJSL 2VL5B 1JGEA 5IFAL 3QUYC 3UYPA 3KPRB 1IQWL 2MQ3A 2Z91B 4U05A 2UV3A 3LMJH 4Q9QL 4GJTB 1TTUA 2XZAL 2FGZA 3KYMA 1LP9A 5E94A 2A1WL 3D39D 4PJHA 5ECJE 1CVRA 1S78D 3ELAT 1QSVA 2MPAL 3S37L 3VXUA 3P9LB 2EICA 4GAYB 3ZE0F 5FDWA 2BC4A 4NO0B 4UIMB 2FR4B 1B88A 1G7HA 2XPGA 2GAZA 5JUEL 3ARWA 4XHQA 5DTFB 4IRSB 4K94H 4LVNC 1MVFA 2CIKB 3IGAB 3QNXB 4HK0B 1V7MH 1S5HB 5K9JL 1R5IB 5HHOA 3VXTA 1BBJB 1N4XL 2G75B 1FNEB 2BVQB 4L4VD 3EJYC 4PJ9B 3RKDC 4WHCA 5ACZB 4BH7A 3VWKB 3EO1A 3HPLA 3BW9B 3QULA 3HMWL 4LSPH 4R96A 5F7NC 2DMBA 1JJUA 4M7LT 5HJ3A 4NQED 3FONA 4CKVX 2R1WB 2VXQL 3RGVA 4LOUC 4DN3L 3KLAA 3QFDA 3D3VA 3G6JF 1W72L 1YNKL 3U7WL 5EOCJ 1EHNA 1F90H 3EYOA 2HFEA 3AAZB 3LKRB 1MY5A 1BJ1J 1U8OA 3RBGA 1KPVA 3SKNB 3F7VB 2P5WD 4NP4H 3L5XH 1MIEH 3TNNA 4OZIF 4E41B 5JW4Q 4YHOL 2BSTB 4KZEL 3QYCA 4ZNCD 1A21A 4WTZG 1U9KA 4H8WH 4OM0H 4KKAD 4O58H 3MRQA 1T83C 1E4KA 1CD9B 4PRAB 1N6VA 3CFEA 2XKSA 5JLZA 1S7QA 1MFEH 5TQ2H 4UT9H 1H3XA 4WWKB 1QSED 5E8DL 2AEWA 4P3CL 1OAXL 2ARJA 4OZHF 4HT1H 4YXHH 4H1LH 1JPST 3K8MA 5E9DB 4WUKL 4UT6L 1R3JB 2ICWJ 5SWSD 4PJAE 1WFNA 3ULUF 3EOYG 4V3DB 3WS6C 4KKBD 1NC2B 1CL7L 3RTQB 2NYYD 3FB6A 4OZGE 4U3XA 4OFVA 5BXFB 5KS9A 4Y4KB 1BD2B 2X70B 5EU5B 3RUGB 3Q1SL 4HAFA 4U2YA 1D6VL 5DWUL 3T77B 2XN9A 4POZC 8FABB 4U1LA 2DJ4A 4HKBA 4MJ6A 1DBKH 4NKIL 4KQ3L 1WT5A 4ZODA 1A1OB 1I3VA 3RY4A 1NJ9A 5GJSH 4Y16A 3E3QA 4M6OL 5T5NF 1RZ8A 1BOGA 3ZZ1A 3AS3A 4P2OD 5FCUL 2R0KL 3SDXA 1X4ZA 3TN0B 2ADJB 3MMEA 3EUUA 3W81A 5C0AB 4G7VL 4YHNA 1DBAL 3AFLA 1RFDL 2HTLD 1X5JA 3P4MB 4ZFOB 4RA0C 3GSOB 2G60L 2AEIT 3T65A 5IMOB 5DVKA 2QKIA 5HHVH 1J0KA 1UZ8A 1QA9B 1WK0A 5J11B 1IMHC 2X44D 3NPSB 1JHLL 3QFJB 4XP6L 3ARFD 3GJFA 1DBMH 1PG7W 2X1XR 1MCCA 4FFVD 1Q9OA 4MNGA 1ERNA 3MBXH 3FFCA 2OZ4L 1BM3H 3WDHA 1T1XB 3ZKND 2X1QA 1Q9LA 2X1WL 4C57C 5ISZA 2K9UA 1HH6B 2JJVA 5CJXC 4KJWC 5FA3A 1HNFA 4ONHA 2DD8H 1ZA6A 5B8CC 3L3OA 3JTSA 3I9GH 4J3UA 3D39E 2G9HA 1VADB 1RVFL 4Y5VC 5FIEA 3DUUA 1U58B 2PO6C 4NRYA 4E9LA 5I8KH 2AJVL 4QRPD 5K93A 4HH9B 4PS4H 4MAUH 1KLUA 3MV8D 3QA3B 3V5HA 5IHZB 2BFVL 1MFAL 2PYFB 5E8PA 4E42B 5E00B 3DX7A 3E2HC 3F65A 4CDHA 3VWJC 1D9KA 3RWCB 2GJJA 3ILPB 4I48B 3QP3A 4J3XA 4L4VE 5L2JB 3F7RA 2NR6C 1HILA 3MTRA 3L5WA 4MVBD 1LK3L 3V4PL 4BQ9A 4AY0A 4UTBL 2R1YA 4NQEE 1GAFH 3LKNA 3UDWA 4P57B 5B39A 5EPMA 5HYIA 1ZT4B 1AP2B 5GHWH 3QRFM 1N59A 1U8MB 2VXVL 1C7TA 2V5YA 4NN7C 3MV9B 1F8TH 5IMLB 5EUKA 4OD1L 2M8XA 4WI3A 4JGMA 1U0QA 3IDGB 3QEQD 2DMCA 2PCPA 3WFCH 4PJEF 1BGXL 1YJDH 1YMMD 2BOCA 3T08A 1AO7E 4CU7A 3P11H 4L3CA 1MHEB 2YS4A 5A16B 3WHXB 3L3DB 3PIQB 4XBGA 3NH7H 4Z7UF 1K2DB 3UBXA 3SBWC 2JK5A 4GH7B 3KPQB 3RA7H 1QSEE 2I5YH 1B0RB 5SWZD 1QR1B 4GRWB 5FM5O 5E2UH 1ZGLA 1KCLA 1XGYH 3E6HA 2AK1H 4BH8B 4TUOA 5SWSE 3MRKB 2YC1B 4TSBH 4YBLB 3S35X 3ZDZF 4Y4HC 1G6VK 1XMWA 5FYJU 2H3NA 4A6YL 4U1HA 3ARBC 5DD5L 4HGMA 4NBYB 4N8VB 3S4SA 2GYSA 1UWEH 5T1LB 1TJHH 5DRXB 2H26B 4AEFA 4I3SL 3K2UH 2D7NA 4NKOB 3WL9A 4AM0A 3SE8L 4CADB 1LHZA 4GW5B 4JN1H 4TN9A 2R8SL 2GTZB 3QIUC 1TETL 2OJEB 3BGAA 1IL1B 4TPRH 2R9HC 3MOAL 4HUKB 4PJCA 4R7NA 2AXFB 1Y18B 1J12A 3L3IA 5CJBA 4HH8A 3LQMA 1J8HD 4LSTH 5EZJB 1OGTA 1IZJA 1OLLA 5T33L 4B50A 1HHHB 2J5LC 1T80A 3QDGD 4UOW1 4U1IA 1JTOA 3C6LA 5F7LB 1T04A 3IAQA 4KK5D 3WLWD 1AD9B 2YZ1A 2AV7B 3ES6B 3VH8G 5HSFA 4L4TA 5MI0C 1N7ML 1AI1H 4CU6A 4K3JH 5EO0A 1GHFL 5FV2A 5L0QC 1UXSB 1HOCB 5I76B 3X3FL 1NGPH 3RY6C 4U1NA 4PJ5D 5EA0H 1M6OA 4M1GL 2BVPA 1XGQB 1B9ZA 4NKDA 1DQDL 2GFBB 4U0RC 3BZFA 43C9A 4BZ2H 1BJ8A 4DKFL 4XMKL 1DL7L 3BSZH 1JZ2A 1S7SB 4KMTL 5D2NE 1H5BB 1U92A 1VFAB 2HTKD 1NFDF 4RGNC 1K4CB 5IFJB 4Y4FC 5GS1B 5B3JF 5I66A 1KEML 5TH2B 4NZRH 2P47B 4QOKA 3TBTB 3W0WB 1HHGA 5GS0D 1JI1A 1FGNL 2NX5B 5AD0A 4HMCA 4QRPE 1UCTA 4MAYD 3LH2H 1KLGA 3TZVD 4Y5XB 4Z7VA 1MLBB 5CUSH 1J1XL 3DI2B 4QXGH 1A5FL 4F80A 3PNWA 3KYKH 2FEEI 3IDMB 1CCZA 4HCRH 3A6BH 2DQFB 2F58H 2RR3A 4PGBA 4ZG1A 4QT5B 3GBML 3BUYB 2HT4C 4PJDE 2Q86A 3ARYA 2Y1VA 2ESVB 3OXRB 4BZYA 2IPUG 5DJDA 4PD4K 1GSMA 1MFDL 4YUEH 5F9JA 1UACL 5JHDD 1EH9A 3EZJB 2OTUA 3DV6B 1NUNB 1JGVL 1QNZH 3FO1B 4WEMB 1TJGL 5T1KD 5C0RL 3MLYL 3IJYA 1TPXC 2CLZA 1P5VA 4N0FA 1ZMYA 4NCC1 4YXKL 5C71A 5LGHL 3ROLA 2QSCL 3HRZB 1GZQA 1UVQA 2YOCA 5GS0L 5LAXA 3HNTH 4XVSH 1YMME 3QJHB 3W2DL 4LRNL 3QCTL 3HHRB 1FLRL 1FYTD 1JNNL 2HVJB 2NY0D 2YD3A 4M7LL 4XI5D 5KSBA 2W38A 6FABL 4S11A 5L88H 1JPFA 1MCQA 1LO4H 4ZQKB 5BQ7B 4P5TD 1CIUA 4UBDD 5SWZE 1JRHL 3KPLA 4MA1B 4CMMB 4JKLA 2BXYA 4KHTH 12E8L 5FKPB 5GGSB 4OGAD 3FTGB 3UTSD 2YXMA 5GGUB 3WJLC 3CXDL 3M1BB 1YUHA 4NGHH 1X9QA 1AE6H 5HHQB 2X09A 4GKOA 5CIPB 1EHLH 2BNQE 5HYSG 3MRGB 3SDAA 1QSZA 5CGYD 5CSZA 4GG8A 1XFPA 3QRGH 2AJZB 1W8OA 3MRCA 3QB7C 5IJKA 3QQ3A 3UTQA 3LS5H 3RWIA 3JV6A 3G9AB 1DBBL 1JPSL 3HRPA 2NW2A 4Q6YA 2BCKA 1EJOH 4MS8A 3MRFB 1CXIA 2CDEB 2LU3A 4YFLI 2EDKA 3MV7D 1NCBH 4XVTH 4CU8A 4G80A 3EYVB 5EOTA 1CLYH 1I1AA 3QDGE 3BISA 4PLJD 5D1ZA 2BERA 5GIRA 3GMOA 5D1QB 2C3HA 3NFSH 1GGIH 2AW2A 2WSKA 3B2UC 4KHXH 4OF5A 3B9DA 2J88L 2AJ3A 2XY1A 4PJAB 5I8OL 4G43A 1ZVHA 4L3EA 1JGLH 4OLVH 4OZGB 4JZNA 3GNML 4Y2DA 1UM5L 1OQXA 5T1DH 1FO0L 2Q8AH 5DURD 1UXWA 3ZT6A 5I1GL 2IPUK 4MD4B 2Q7YA 3B9KA 2I9TB 4GMTL 3NPZB 1ONQB 3OKMB 4UQ3A 5IKCB 3CXHK 3Q3GA 3V8OA 2VC2L 1A1NB 3H42H 3RWJB 5CS7A 4QHMB 1S8DB 4MMXC 2I9LB 4Z77B 5FYKD 2OJZL 1HWGB 5A2JH 2O26U 4XAKD 1HNGA 2ITDA 3DYMA 4QYOB 3NAAL 3GDBA 2CO6B 4U6HB 3K46A 4FQXC 3SCMB 3RPIB 3MQIA 1FV1A 1F2XK 1KYOK 2W0FB 3M8OH 1AR2A 4ODXA 3SJVB 1E4WH 5KVMC 3JWDH 1C5BH 1PG7X 2OM5A 5C3LD 1KTKE 1UH3A 1HINH 1S5IL 2FATH 2YBRB 4ZAKD 4G9DA 5JHDE 4X6DE 1CZ8H 4LNRA 1FL3B 1GPOL 4PJIE 2J6EL 1U8IB 3FOLB 4ZOBA 1I7ZA 4PBVC 4UIKL 1PQZA 2XXMB 3LQAH 5TGBA 3SDCD 1JNLH 2X4NB 4F33B 2UWEA 1Q0XL 4P9HL 1W72B 3TFKC 2P5ED 2WAHA 5FYKL 3NACL 3VDBA 3NIDE 3DO7B 4LLMA 3QNZA 3D39B 3H0TB 3ARGA 5BVJB 4ONFL 3I2CH 3IXTB 4JKPL 1EUTA 4N9GA 4XC3H 1O0VA 4MXVE 5F7DA 1WBXA 5F9AC 2C7UA 1NGZA 1FYTE 4X4YA 3UBXI 1OT2A 3DBXB 4NWUH 2APXA 3DVNA 2DTML 5IVXA 4YXLH 3WIHH 2J8UA 1UKSA 3KLSA 5TDPB 4JB9L 1QRND 2V7NB 2AK4D 1IT9L 2OTWA 4L4VB 3S36X 3WJJC 3WFDH 1F00I 1A02N 5CILL 1SEQL 3CH1A 3CDYA 1T0NA 4GKNA 3BPNC 4O9HL 3RAJH 4N8CL 4NQEB 3SE4C 5I30H 4CL7A 3OBAA 5DT1H 4CNIA 2XTJE 4PLOB 3MNWA 4NZDA 4OD3H 5D9SA 1A64A 3MLUH 1YYMH 3IJHA 4WFED 3WFHA 5DJZA 3THML 4OAWA 5DEZA 2P5WB 2CUIA 4NQDE 5FHAL 5JXED 4QHUA 2J2ZA 4RFEA 1ADQL 4GBXA 2OR9L 1BWMA 1KCGC 2PXYC 2R4SH 4AEHH 4YIQB 3QDMA 4XPFL 4Y5YA 1G0XA 3MV7E 3QSKB 4MDIB 4R8WH 1EGJL 1RULH 2EYSA 3NVQA 1D5IH 4WIQA 1CFSB 3LB6C 4PB0L 3TGXA 1QSEB 4KVNL 1CE1L 3TBVB 2EH8H 1QYGL 5IB1B 1T7VA 1HSAB 1M1SA 4JHAH 5D93C 3SDYL 5JDJA 5SWSB 1TMCA 3BKMH 5E8OB 3T1WA 3LDBB 5HVHB 3IDYC 1GC1L 1J0HA 4BSJA 4NHUB 3VH8B 3BAEL 4HF5H 5T3ZD 1U41A 1R6VA 1ZHNA 1T89C 2HN7A 3O3UN 5HGBA 3TT3L 3SE9L 3SGJA 1L6ZA 3VGAC 3JV4A 3FHAA 1C1EL 3KWWB 3RQ3A 2IPKA 3NIFF 3DGGB 1FN4B 2DQGH 1U8NA 4I5BA 4YQXH 3G6DH 5FYKE 1R3KA 2EEAA 4TSAH 4IOFC 4KRNA 5GRUH 4XWOC 4XAKE 3C2AL 4P2OB 3OHXA 3RIAK 3U4AA 4FN0A 4RFOL 4PGDA 3TA3C 4HJGA 2BRQA 4J4PC 3IDIB 4OI7A 1JGUH 2W91A 3S6CA 4KRPC 1Q72H 1UWGH 2PTUA 3E1F1 4JGJA 4Z95H 2VZVA 2EXWD 1AGCA 3RZCD 1IGTB 3T0ED 2QV2A 5DFWH 3HUJB 5FGSA 3MFFB 4RQQB 3T3PF 1BFOA 3VE0B 2I07A 3ARFB 1T21B 2BNRD 5T3ZL 2VQ1A 1YPZE 2F19H 4YPJA 3VFWA 2OI9B 3WUZA 2L7UA 3N1PC 3V8CA 4XNYL 3VI4F 2H1PL 5JIKA 3CZFB 1YNLH 3DNKA 2NY2C 3FN0L 5TF1L 5I16B 3FZUD 2P5EE 1W0YT 3TNMB 5DA0B 3HC4H 2IFFL 4IHOA 5D2NB 1F58H 1ZWIB 2HT3C 1EFXA 2Z92A 1NH6A 1J88A 3EW3B 4N9OB 3IXAA 4YFDB 4V3EB 2R2EB 5TPWL 1IAOA 3WS3B 5IIEA 1AH1A 2QQNL 3U7AA 4APQC 1VACA 3K8LA 1ND0B 2BP3A 2WW8A 4HV8A 4HIHA 4RMVA 4U6XA 3DUSB 3VRLF 3MV8B 3OXSB 2FB4H 3CC5A 4LSVH 4NRXA 1VFMA 1OP5K 4JPKH 1HQ4B 1QRNE 2APWA 3FQWB 4K7PL 1J1OL 1AXTL 2AK4E 1K3ZA 3TJHD 4UV4H 3R0NA 4PTUA 5A2KH 5AYUL 4NRZA 4XAWL 4UT7L 3KYNA 2Y06L 5E70A 2VWEC 4X0KA 5K9QI 4G8FA 3CH8A 2ZCLH 4A6YB 2VDML 3OB0K 2FX7H 1QD0A 2C1OB 5FB8B 1AFVH 3IFOA 4LGRB 5MEND 3HLAB 3O3BA 4WNQB 4WFEE 1DBJH 3QPXL 5FHBH 5HYSB 1Z9MA 4KC3B 4HGWB 1I85A 3QO1B 3MLSH 4N1EA 4ZUUA 4KPHL 3QEQB 5KW9H 5AG9A 5FUCE 5E2WL 3JTCA 2XZQH 1NSNL 1K5NB 4Y1AA 5FF6B 3GBNL 4GRWH 3VFPA 3ZL4H 4E0RA 2E27H 3O6KL 3QEUB 1FZJB 1T1YB 2PR4H 1OLZA 3K8KA 1KXVC 4IMKC 3RDTA 2A73A 2NLJA 5DEFA 3QI9C 5C0CD 4Q6IC 3MODH 4K8RD 4O5LL 1DN0A 5SWZB 4JO4H 4K9EC 3U83A 4OB5H 4QXUL 3IU3A 1AHWA 1TZGH 3AU1A 3KJ4B 3GK8H 3CX5J 4O02L 4ZO9A 4YDKH 4L4JA 5IVZA 1B3JA 2GUOA 1HH9B 1NEZG 4JFYA 4OF6A 4OIIL 4YDJA 3LEYL 1G7PA 1A9BB 1VEPA 3W39B 2XACC 5GPRA 1OAYL 1OARH 3BIAX 5DUMH 5T3ZE 2X7LB 3WFEL 1QKZL 3MLRL 5INCA 2BNUA 3NOIA 4S1RH 4XT1C 5DJXB 3PL6A 2O61A 3HAEG 1QBAA 5IJVB 1Z2KA 4MXQC 1G1CA 5F88A 1EJ6A 3CPLB 2ATPA 4KMQA 3TPUB 4ELMA 5EU3B 4NFDA 1KJVB 4P3DA 1T1WA 4LVHB 1J8HB 2DWEA 4S0TD 2OK0L 4XTRD 5IB4A 4M62H 2E7LA 4K8RL 3QDGB 1KPUB 5GJTH 5D1XC 4HFWA 3MJ9L 4HIXL 1OW0C 2OQJB 4WO4C 5CD5D 5E4IA 2VUOA 1A6WH 4RAUA 5E2TL 1SVCP 5DYOA 4FABL 2DQIL 3EFDH 4AIOA 2FEEL 3T0EE 1DQTA 3QZWA 4XGZA 1FSKB 5C3TA 4F7MB 1VKXA 2EDJA 2BNRE 5KANI 5CBEB 4PJ5B 4KZDH 3EGSA 2EH7H 1RJLB 3TIDA 1MHCB 2EDTA 5JORA 5H2BB 3DV4B 4LP5A 5C09E 4ZUSA 3DURA 1BQLL 5DRZB 3CFCL 3TWCL 4F57L 2HH0L 3FO0L 3OMZA 5F9OL 3T8XA 4V2CB 4CJ1A 4Z7NF 1EK3A 1Q9WA 1U6AL 1CN4A 1WIUA 4DVBA 5IT2L 4OIBA 1NL0L 3WE6B 3GGWA 3OKDA 3V4VL 4ETQB 4U1JB 5H94A 5C0BD 3B9AA 4K23H 3B2VH 1ULVA 3FB5A 4MAYB 1IKNA 3TZVB 5HDLA 1U2HA 1XF3A 5C6TH 2EC8A 5ABDE 3VGBA 4S2SA 3UJIL 5HDQL 4ODHL 4EIZC 4MA8H 1A9EA 1TCRB 3L9RA 3M17B 3Q5YA 5J6HB 3PDOB 5JHDB 4X6DB 2VXUL 3U1SL 1T22B 1FFPA 2NY4C 4J2XA 2WLZA 3STZA 2AQ2A 3QEGL 4JZOB 1VGEL 2HWZH 5DMKA 1XGUB 3H9SD 3KXFA 4R4BB 3RHWK 3MLTB 4N5EA 1NAMA 3BH8A 3L3GB 5ACLA 2FYYA 1J05B 5J06A 3SEPA 3S3SA 5FAAA 5T1KB 5MENE 1LWRA 2O5XH 2VDRH 4NWTL 1KB9J 3CNKA 3CSBA 4XNQB 4XVUD 1U8HB 5JQHC 1ZVSA 5HPMA 5LGJB 5ISZD 2IAND 4IRZH 3VXOA 1N64L 4PTTB 5ESAA 4GG6A 2DS4A 1N3NB 4YEEA 4CVZA 1FYTB 2NY0B 1LP9E 1IAIM 3I02A 2FX8H 7FABH 5B4MD 4GQPH 4LLYA 1JHKL 3TLRA 4P5TB 4X5XB 4YAQB 3RWEB 4AL8H 4C83B 1JN6A 5CIPH 4QGTA 3HR5B 2D0HA 1QTYT 1WZLA 2BSSB 2ZNXA 3UTSB 4D0DA 1OCWL 4OCWL 1MJ8H 3O3DA 5I1DA 3NCJH 5IWLA 5FO8B 5GZNC 2QQLH 5DSCA 1T6VN 2MMXA 2E7BA 4ZUVB 3UZQA 3WO3B 3H6JA 1X5YA 4H0HB 1B4RA 3MA9H 4EDXB 1KTLB 4FTVD 5IM7B 3V0VA 1IM9D 1EERB 1FO0B 4NJAL 4MB4A 1W0WA 3LN5A 5EC2A 3QWRA 3D3VE 3VG9B 4JANA 4LCIH 5FM5M 2D0GA 2HFGH 4M7ZC 4OCRL 1MNUH 1IGIL 2D03L 4EN3A 2VYRE 2Q3AA 3AB0C 4F7TB 3GMRA 1I8IB 4MX7A 5AZEL 2A38A 1B2WL 1UWXH 2EKSA 1MREL 2RBLA 1X5GA 4L8CA 4PV8A 4NPYB 1NGXA 2WWMC 1MLCA 3L1OH 4L9LB 1F4WH 3F7QA 3WSQL 5K9KA 3O8XC 4OBSA 1HXMA 2NY3C 1HCFX 1WTGT 1IZKA 1GVIA 2F5BL 1AR1C 1D5XB 3UC0L 4CN6A 4HK3J 3O6LL 2B39A 4TULH 2AJSH 1IQWH 3ZHKA 4QRQA 3ZT5A 4CMHC 4LCUB 5DURB 5HVWA 2EDQA 2HFFB 5TDNA 5KG9B 1CFQB 5BZDA 4Y2OA 2MPAH 2Z4QA 4OQTL 3S37H 4P48A 2VLKA 1TVBA 2ZNWA 1K4DA 4KAQH 5JUEH 3OZ9H 3IDJB 2H9GA 1F3DH 1L6XA 3LD8B 1A6TB 2PUQT 5C0BE 5K9JH 3E3QE 2VQTA 2JJSC 4P23A 4YHZL 5ELIA 2AEPL 4FQQA 1KB5A 1T66D 3SDXE 3HI5H 4LLUB 2HVKB 1FG2A 5E8NB 3EOBB 3L3JB 3BKJH 3C6LD 1FVEB 4GRLA 3C8KA 3IYLW 4IIQA 2B5IB 2X4RA 4RMTA 4RMRA 4ZAKB 4DN3H 4IRSC 3U7WH 2YK1L 2WM0A 2VJXA 1YPZB 3RUGF 5T5FL 3OR6A 5HHPA 3KNBB 1ZLSH 4WVRA 1I7TA 3SDCB 2DYPA 1T5XB 4OGXL 4Z8FL 4K3EL 4PJ9C 1ZT1B 2P5EB 4DFHA 4KZEH 4FQCH 2BJML 5DDHB 1F4HA 3PDDA 4XB8A 3FT4A 4CVXA 4P5KB 1U8PB 5F6HI 5ISZE 4YZFF 4ZXBA 3HNSL 1CICB 4UV7L 5E5MA 5E8DH 5GRXG 1ED3A 4LQFL 1OAXH 2VZ3A 1KIUA 4N0CA 5JOFA 5HYFA 2X4QB 5EBWA 3FT2B 4MD5B 5HYJA 3CFKA 5F70A 2ADGA 5AZ2L 4QOKD 4UT6H 1QRNB 4S1DC 1CL7H 3CVHA 3MZGB 3DIFB 5JZ7D 4P2CG 4TTGA 1WZ1H 5BRZA 2IAMC 4WHTA 4UMGA 1ORQA 1D6VH 5KSUB 5J1AA 1J0IA 3G5VB 3DPBA 4WWKC 4KQ3H 4W4OA 1NFIB 2W07A 1GOHA 2VN4A 5D6DA 1JMXA 4GS7B 4MLSA 5D7JB 5KAQF 4AT6A 1PJ9A 4WGWB 3RWFB 5CZVL 4P2QB 1F11A 3RTQC 4QRTA 1RK1B 4Y4KC 2OSLA 3NZ8A 5C8JA 2NZIA 5DD6A 1W0VA 4G7VH 4TUKH 5JQ6L 1BIIA 1FRGL 2HT2C 4HGKC 2P7TA 1CDUA 1RFDH 3HAEB 1CXKA 4TTDC 2APTA 2G60H 2X4PB 1AC6A 1WIPA 3X17A 3LKSB 2AXGA 5BZWB 2MHAB 1H8NA 1CFNB 3X14B 5JMRA 5A2IH 5DLMH 5GGRY 2X4TA 3EOTH 3RP1A 4ZPVA 3P2TA 1U8LA 3TIEB 2VABB 1F6FB 4PR5A 2IADB 3DVGA 1A7QH 4GKZB 4MZ2A 5HGGS 1FL6B 1T7ZA 1H3WM 5IP4A 1F4AA 3X13B 1GCFA 3TBYB 3GSNH 1DJSA 1YQVL 2QL1A 3MJ7B 4HDIB 1UB5A 3MLXL 3FQRB 4EI6A 3DTXA 4XPGL 3NPSC 2ID5A 1VENA 2G2RB 2MCG1 1I9EA 5I73B 1J5OL 3ET9F 2N7BA 5IVOA 4HJ0C 4PY8I 4HUNB 3S88H 4HIJA 3D85A 1CBVH 4X6EB 3OGOE 2DF3A 2X41A 2YWYA 1X5ZA 4Z7WA 1CF8L 2BFVH 3RX5A 5BJTB 4ZD3L 1AGDA 2E9JA 3QHZL 4XNMB 3UPRB 4PB9L 4GXVL 4LSRL 3UBXG 1QEWA 2V2TA 2R69L 4PJCE 4LARL 2R29L 5HHMD 4U6YA 1GJIA 1ZSDB 1CLZL 1FFRA 3KPSA 1FZKB 4MA7H 4GRWF 1LK3H 2Q6WB 1G7QB 3RZCB 4ZDHB 3MRJB 1I1AD 1S7UB 2NQCA 4HXAH 4UTBH 3T0EB 4PGCA 2UUDH 2YRPA 1RJZA 3HTLX 5D1ZD 1R5WB 4G8IA 3P77A 2W0PA 2CR6A 2BNRB 1TZIB 2XRAL 1NLDL 5I8CA 4OD1H 1U8KA 3BVNB 4L3ED 3IRZA 3H3BC 3O4OC 4D9RD 4KQ4L 1JZ4A 1WCQA 3L6FB 2O5ZL 3RJQB 1MJJB 4M6NL 5ALBL 4OZFG 4ENEC 3VRJB 5ID1A 1KJ2A 5EIQA 3V6OE 3HG1B 3QUYA 1ES0A 2XQBL 3QDJA 2I26N 1D6EB 2DQDL 4P2RA 1KNOA 5L7XL 1OAUH 4QOKE 1VSCA 2CLVA 3QCVH 3QHTC 1NCWH 4NT6B 1E4XH 3ZSSA 2C3GA 4Q97A 4YHMH 3MRDB 2C3VB 3I6GA 4P9ML 2FBJL 1KCSL 3PWVB 3P30H 4HS6B 1IKFL 2XQYK 3O3EA 1IAKB 3CFBB 4I3SH 1JIBA 3SOBL 4OLUL 1LEIA 1PZ5B 5DA4A 3LEXA 3SE8H 2XG4A 43CAA 1A3LL 4M1CD 2QHRL 4WW2B 3ILQC 1TETH 1MOEA 4YBLC 5MENB 4NFCA 1X5HA 1WISA 1UB6B 2OTPA 3KLHC 3NBNA 2HMIC 1P84J 1ZA3B 3PHQA 1H9VA 1K8DA 5T33H 5EIIA 3C5ZB 1G7JB 4DAGH 3GUTA 5BV7H 5FOBA 1FE8L 3DSFL 3KYMB 1LP9B 1HHIA 3ARGD 3QUMA 4G9FA 4HK3N 4WCYL 4ZSOA 3WNLA 3SKMA 4NUGL 4BUHA 5I17A 1N7MH 5C0CB 4Z5RA 1RZGB 2EIBA 2BC4B 2ICEA 1JBJA 1G7HB 1G7MA 2XPGB 5KSBE 2GAZB 3X3FH 4EUPA 3RVTD 5D72L 1T83A 4M1GH 4IJ3B 3BOVA 1U8QB 4G3YL 4NKMA 1DQDH 1P7HL 2DN7A 1HDMB 2V7HA 5ENWA 4B41A 4G8GA 1E6OL 1HXYB 3AREB 4F7PA 4DKFH 5DI8B 1MVUB 1DL7H 3INUH 3BN9D 4KMTH 4BH7B 4WFGD 2CUHA 4HIEA 3QULB 5D8JL 5HJ3B 3WS6A 2ERJB 4N68A 1I9JL 4PLKD 2F5AL 4QTHB 1PYWB 1M71A 1KEMH 3DETD 3QFDB 4HKZB 1NCAL 4NN5B 1FGNH 1F6LL 4XPHL 4G8EB 3EYOB 1FFNB 1S9XA 2HFEB 5JOEA 5ITFA 1KFAL 2R4RL 2P8PB 3VFOB 1J1XH 4IRJC 2MKLC 3TNNB 4HFUH 4DOHE 1LNUA 1MRFL 3I3DA 2VTFA 4FQ1H 4ODVH 3QDMD 3IJSA 4HIIA 1WEJH 3G6JA 1RIHL 3MRPB 1FORL 3UROR 4HKJA 3CFEB 1U3YA 4LGPB 1S7QB 2HLAA 3ARPA 3BZEA 1S9YA 5EBMA 4Y5XC 2ARJB 1DQQA 5HHXL 1TJGH 4NC1E 5C0RH 5K9QG 1BJMA 4LCWB 5HGAB 4M61B 4U3HA 4YXKH 4L3EE 3T0VA 2QSCH 3FB6B 1EAPA 4D9RE 3ESVF 3ME0A 3MOBH 5IOPA 4M9OA 3BN3B 1N6UA 3QEHA 4FG6C 5DXWA 1T7YA 3W2DH 3MNZA 2QSVA 3QCTH 5IB3A 4U1LB 4OZHA 4HKBB 1JNNH 3TV3L 2PTTB 5DJCB 3HN3A 1Z0NA 5CJXA 1NJ9B 5C0BB 2DLIA 4XCNA 2D7PA 2CMRH 5JDSB 1YY9C 2XNAA 1TENA 5B8CA 4TVPD 5DD3L 3MUGA 3MMEB 2VIRA 3K4AA 2PO6A 2VLRA 3IETB 1XH3A 3MYZA 1OPGH 4PJAF 2RHEA 2JJTA 1IGFL 4KMLB 3D6GA 4NO2B 4R3SB 1U2CA 3W9EA 3T1FB 3T65B 3LV3A 2NXZD 4IBLT 5FK9A 1UZ8B 3E2HA 3H9SB 3VWJA 4MA1C 2NW3B 2ILLA 2Y36L 1I3RA 3GJFB 3SQBA 4QTIL 5E99H 1TFHA 1ZS8B 3C2SA 3MGOA 3MJ6A 3VGHA 4CJ0A 2FL5A 4F2MA 4XHJC 2H2SC 1C5DA 1Q9LB 2EDFA 4P4KC 2UWEE 4JE4B 4JFFA 5ISZB 2IALA 2IANB 2VOTA 1JCKA 5FA3B 4ONHB 1RK0A 3C8HA 4A2LA 3SE3C 1N26A 5C0EA 3MGTA 1CT8B 1QBLL 2YXFA 4XBPA 1KN2L 5EO9A 3PABA 4WENB 1S9WB 3VMNA 2J88H 4ZMAT 5I8OH 4NRYB 3KJ6L 1ZV5A 3LKPB 3GSXB 4YE4L 3DJ9A 3TBWA 4EXKA 4U1SB 5I1HL 5HI4C 1KLUB 3GNMH 5IVXE 2B4CL 2J8UE 1U8JA 5D2LA 3SBWA 3VFTA 2PW2B 3DX7B 1CFBA 1VESA 3IFNL 5I1GH 1SYVA 4PJFB 5KANG 4G59A 1BECA 1I7RB 3SO5A 2JCCA 3BT2L 4ZUTA 5D1QC 4JG1H 2R1XB 3OKNA 2QSQA 4PBWD 4WFGE 3STBA 1ZLVH 1X3DA 4FTVB 1IM9B 3JWOL 2OJZH 2A9ML 2EYTA 2YPLA 4JFQA 4JDZA 3U36B 5EPMB 5L2KD 4Y4HA 2VSCA 4NQCD 3ARBA 3NAAH 1F4XL 4OCMC 1RAMA 1N59B 3PJSB 2X2YA 5DD0L 1XGPA 1J86A 3CX5K 4V2BA 3ETBF 4OT1L 4WJ5A 4C54A 1HN1A 1TTFA 3OGCB 35C8L 3CCHA 3SGDH 2PCPB 4TNVF 3QIUA 2YPKA 4JEGB 3UYRL 1OTUD 5C2UB 4Y1AD 3QDME 5IHLB 4L3CB 1FCGA 1KCKA 1S5IH 2DM4A 1CGXA 4YGVB 4ZNEA 4XVJL 1I4FA 3UBXB 1KSRA 1OAQL 3WUWG 4O51A 5FGCE 3LPWA 3MNVA 3SCMC 2BVEA 5KVFH 2YRLA 3DO3A 4UIKH 1QLEL 1CD0A 1ZGLB 1FNGA 3QO0A 3D25A 1A6AA 2C5DC 3CIQA 2CK0H 5D7LD 3E6HB 4P9HH 4NKQB 3RNQA 2FSEB 4TUOB 3MUHL 2QADC 4NQVA 5FYKH 3T0XA 4HLZG 5GRVK 2F54D 4U1HB 4BSVB 4Z7UA 1RHHB 1X7QA 1YEDA 5IEHB 1QSFA 4P2YA 1EX0A 3RY6A 4D8PB 3O6MH 1CFTA 1K3IA 4NOFA 3LMJL 3VGDA 1BOYA 3VXNA 1Z0MA 1FJ1B 2KZ1B 4C56A 3PL6D 1PKQB 2DTMH 3CAFA 2UVFA 4PJGB 4OZFB 4X6CE 4CW1A 3TT1H 4PJCB 2HG5A 1IT9H 3L3IB 1C16A 3PP3H 4PIRF 4R97C 3RVUC 4Y4FA 5CILH 1SEQH 1OGTB 1J0ZA 3IDUA 1S78C 3BPOB 3O3AA 4K94L 5I0DA 3VFSA 1V7ML 3V52H 4O9HH 3AS0A 4N8CH 4U1IB 3C6LB 1T04B 1P7QB 2ED8A 2VLJD 4GLRH 1KIQB 4XCEB 5EZLB 3GSQA 5IMKA 5IB2B 1CWVA 3U2SA 4LSPL 5SWQA 4HKXB 4RBPH 5F1IB 5C6WH 1OVZA 4YC2B 5GRJH 5CEZH 4LKXB 4Z0XB 2OR9H 2AABH 1F90L 4XPFH 3EJJX 1EGJH 1YECL 3OG4B 3BZFB 4N5UA 2C3XA 43C9B 1I8MA 4FXKB 1EHXA 3PQYD 1CE1H 4FP8H 1N2RB 4H8WL 4YNYA 1QYGH 1WF5A 5J12B 2ZSVA 4K71B 4MA3B 3SDYH 3I3BA 3ZHDA 3CX2A 5AD0B 2DIBA 5D7SH 5TQ2L 4UT9L 2A83A 4FA8A 2A77L 1QVOB 2FDBP 4HT1L 4YXHL 3HUJF 1KB9K 3BAEH 5KSVB 3DSNA 3VD5A 1FIGL 2V2XA 3TJEH 3NFPA 2MFNA 4Q2ZB 3ARXA 1NFDA 3TT3H 1L0XA 3SE9H 4DN4H 1KPRB 2C9AA 2Q86B 3HC3H 1C1EH 1FNSL 2BSRA 5F9JB 1OWWA 1ZTXH 4WWID 3I6KB 3P4NA 1LEKA 1PEZA 1DCLA 5HVHC 2EYRA 3WJLA 1BLNA 5L2KE 2NYYC 3P4OA 2P8MA 5EFIB 2LQRA 1ACZA 3MREA 2CLZB 3REVB 4N0FB 3JXAA 4QGYA 3L95B 4WY7H 3AXLB 3ROLB 1UVQB 4FFWD 1H3GA 1VFBB 5LAXB 3LSOB 3NFNB 2GCYA 4ELKA 4Y1AE 5CP3H 5F7HA 3ZKQD 3MOQA 3EHBD 2WV3A 2NY1D 2A6DA 4P2OC 1EAJA 4LF3B 4KKNA 4QHKI 1LO0L 4Y89A 3ARUA 4QCIA 1JPFB 3BGFC 3QAZC 1XF2A 1FNAA 5JW4N 4LLDA 3T0BA 3VD3A 3L7FB 4XNYH 3KPLB 2HTLC 2H1PH 3FN0H 2A9NL 1DLHA 1G9ML 1U95B 2CH8A 2FLBT 1OHQA 5F97E 5TF1H 4DCQA 1DBML 2XG5A 3FRUB 3S5LA 4YFEA 2W9EL 3V4UH 1IAMA 2W1NA 3DECA 3PHOB 5INDA 4X8JB 2F54E 4Q9RL 1CD1A 2V2WB 4ORGB 1NAML 3MBXL 5H35B 1FZOA 3ARFC 5TPWH 4U0QB 2EIZA 4FFVC 2IEPA 2OI9C 4JJ5A 2DD8L 1I8KB 3UX9B 3MRCB 1DSFH 5J6GA 1UENA 3QQ3B 4EBQL 2QTEA 2EDBA 3P9MA 3UTQB 3I9GL 3IDNA 3QWRD 3JV6B 3UJTH 5F96L 3VDAA 4IMLA 4DOHB 3IFLL 3VXMD 1J1OH 4ELME 5BS0A 4D0BB 5I8KL 5HHMB 2CPCA 3VXSA 2OL3A 5AYUH 4XAWH 4MWFA 4PS4L 3FT3A 4UT7H 2Y06H 3GMLA 5EOTB 1I1AB 2E7LE 1MCHA 2ZWLT 3VXQA 3BKYH 3WNNA 3QUZB 4KI5D 4LBEA 4FQXA 1FLTX 5D1ZB 4XXDB 5A1AA 5MEQA 5D71L 1EO8H 5GIRB 1CIDA 4U31A 2V5TA 3GMOB 4AIZA 3FO2B 3GO1H 4LHUA 4M4PA 4ZUWA 1ZAGA 4G43B 2MQ0A 3BYTA 1AGEA 4NC0B 4L3EB 3B9VA 3PG2A 4KPHH 4MVBC 3VXPA 3PWLA 5E2WH 1NC4D 1NSNH 3GBNH 2WBJC 1N8ZA 4U1MA 1ITCA 4QY8B 4DK6A 2FGWH 4U2ZA 2HLFD 3UPAA 2A0LD 1GGTA 5HI5C 1NBZA 3RL1B 4GMSL 1KLFA 3TFKA 3DX6B 2VLKD 3PQYE 1RJYB 2ZUVA 4O5LH 4J1UB 2YUWA 3KYAA 1T1ZB 3P11L 1MHHA 2HP4A 2WP3O 4QXUH 5FV1L 3MJ8A 3GMNB 1A4JB 4KJPD 3NH7L 5ICYA 3RWDA 4L8DB 4H1LG 4P23D 2I5YL 4HUVA 4OIIH 2P8LA 3LEYH 3QZWG 1ZANL 1OAYH 4XCYA 5E2UL 1F13A 1FL5A 1M05A 1OWRM 2AK1L 4BFEA 4TSBL 1QKZH 2FD6L 3MLRH 1ZLUH 3ZDYE 4C55A 2C26A 1GZPB 2IH3A 5DVLA 4GRLD 4OM1H 3WJJA 2BOBB 1TJHL 4LNRB 2X89A 2W9LA 4JFDB 1T2XA 4FXLA 3ZDXE 3OKLA 1I7ZB 2BRRL 1PQZB 2DYPD 3SE4A 2EIDA 4JN1L 1K6QH 4PP1D 2R0WH 2UWEB 4DZBA 1HIMH 4G42B 2OK0H 4HWBA 3EYFA 2FECI 4QRSA 5TE7H 3NMEA 3O2VL 3LN9A 3HE6A 4LLMB 1YEGH 4HIXH 3ARGB 4TUJB 2YEZA 1LO5B 4FABH 2DQIH 4JY6B 4ZXBD 1JUFA 4N9GB 5F7DB 1RY7B 1IFHL 2C7UB 1NGZB 2W92A 4N0CD 1KB5L 4KKLD 5HYJD 4M02A 1QLRA 3FJTA 4LPTA 5CAYB 1NUDA 1M4KA 5DZOA 2J8UB 4X6DF 3U6RA 1CG9B 2NY7H 5M7QA 4PRHA 2QR0A 4K3JL 2VDPL 2G5BA 4KK5C 3WUWB 3MACH 5BRZD 1NGPL 3TWCH 3T2QA 1V3JA 2HH0H 1KJMB 3HZMA 4GKNB 5BVPL 1JFQH 3TCXA 1PDKA 1U6AH 4BUGA 1ZKAA 1WAAF 5E7BA 5IT2H 1NL0H 3RBSA 3BPCA 4XH2A 3IKCB 3PWPD 4YPGA 3V4VH 3NIDF 4F37F 1NGQH 4BZ2L 4NZTL 5EDXA 4LIQL 1FFOA 1T89A 4JPWL 3WFHB 1MCOL 4MXVF 4X4ZA 4RFEB 4Y8DC 2CKBA 4Z0BH 3UJIH 3VDCA 4ODHH 4ZFZA 1RJCA 2HTKC 2XA3A 3JTTB 3QDMB 3CK0H 1G9NC 3B43A 4Y5YB 2GITA 4AIXA 2BK8A 2HJFB 5GS0C 4KVCH 3U1SH 2D31B 4ODTL 1FHGA 4BQBA 1KCUL 3GEWB 4JRXA 3TA3A 5FGCB 3RVXD 3QEGH 1VGEH 4J4PA 3CVHL 3HB3D 2F58L 4PJBA 3TZVC 5TQ0L 2XT1B 2ZPKH 4QWWD 4G6AC 2GIYA 3GSNA 3QWOA 3F7PC 4NWTH 4QRRA 4KY1L 5DS8B 3GB7B 4DEPB 4ZS7L 3GI8L 4HEME 1G7IA 1QNZL 3DX8A 1OF2B 4GAFB 4U1KA 5D7KD 5F7FA 3MLWH 5E6IA 3VXRD 2XTLA 3JV4B 3FL7A 2EDLA 3QXDA 3B3IA 5AG8A 3HNTL 4XVSL 4F7CA 1SJEA 2VLKE 2YD6A 2Y6SD 2W0LA 3D85D 4X6CB 4LVEA 4OFYD 5EB9A 1KTRL 3P4LA 3WHE0 4G6JL 1T5WA 4HJGB 5L88L 1LO4L 1I1RA 4APQA 2JB6B 2NY0C 1S7RA 4LDOB 1ODAA 4HC1A 3GZKA 3GJFH 3KG5A 3VU2A 3TYFA 3KPSD 5CP7B 1AGCB 4KHTL 5DJYB 3C09B 4P5TC 4W70A 5C0GA 3UYOD 2NXZB 3MGAA 3SKOB 4UBDC 1MAJA 3BP6A 1ZHKB 4QKXB 2GJ6A 1IGML 3TO4D 2KUTA 2XWBB 1LDPL 2I07B 2VERN 4U7MA 3RPKA 2EXYD 2VQ1B 4OGAC 1E4JA 4OKDA 2Y7QB 3VFWB 3G5XB 3TVMD 1IGIH 2I60L 1II4E 3HZYB 3OB8A 4U49A 3VFVA 2JIXA 5TF0A 4KI1A 4L8SB 2D7TH 4WU7A 4HHAA 3W5NA 3WEXA 2DBLL 4GAJL 4BYHA 4LIQE 4IHOB 4CDGC 1SY6A 3HA0A 3EZ8A 4M5YH 4X4MA 3SKUD 1OTSC 1U91A 5F72S 5IHUH 1IEAB 5IW6B 3VG9C 1NCBL 4XVTL 1CDYA 4JG0H 1IAOB 3QH3A 3QUYD 3MRLA 1AXIB 1JF5A 3QDJD 5E08H 1MI5A 4XWGL 2F5BH 3LPFA 4P2RD 4HV8B 5JO5B 5HYJE 2O93L 3O6LH 4HIHB 5I75B 2W9DL 4U6XB 1QR4A 1M7DA 5FGRA 3NFSL 4IMKA 1P84K 2V6HA 5JW3L 3QQNA 3QI9A 4PLJC 4OF3A 4Q6IA 1YPZF 2VR9A 4PTUB 2AP2A 5IV2A 4NRZB 2R2CA 5BRZE 4L9LC 4F3FA 1YA5A 3OJDB 1P1ZA 4X0KB 1BBDL 3Q0HA 5K9OA 4QHLB 2IMNA 4NO5B 5L2KB 3GSVA 5GRWA 3PWPE 1G7LA 4NQCB 4UTAH 3EJYD 3RKDD 3H9YA 3IFOB 5I1EH 4YHZH 2EEDA 4PDCE 4HS3A 4HJJL 2DWDA 2AEPH 3K2MC 3S96A 1KJ2L 2D7OA 3ZHLA 4XBEL 4ZUUB 4I13B 4L29A 4UAOB 4LOUD 2IMMA 3NN8B 4MXQA 4R9HA 3PE9A 2F53A 4Y1AB 4Y8AA 5JW4R 3BYYA 3VFPB 4E0RB 1BMGA 2E6JA 3FQXB 3RWHA 3ZSTA 3MCKB 1R3IH 3LD8C 2YK1H 2NLJB 5DEFB 1ZHBA 1IARB 3MRIA 5T5FH 4J8RA 4EVNB 4GW1A 5F1KC 4RZCB 3JWDL 1C5BL 2FATL 2KL6A 3HC0A 5D1XA 3RHWF 4Z8FH 1AHWB 3JUZA 4K3EH 3MROA 5D7LB 1OW0A 4WO4A 1CZ8L 5IVZB 1RZ7H 2OMBA 5B22A 3DRQB 2F54B 4YDJB 3LQAL 2B5IC 2LTQB 4ZAKC 5GRZA 1JNLL 3F6IA 4HWZA 4ZPTA 3UJJL 3HNSH 1IC5H 2MSPA 5D7KE 3VXRE 5INCB 2LU7A 4JZJB 4JLRB 3PL6B 1EVUA 5AZ2H 3BMVA 2O61B 5C0JB 3A67H 3KPOA 2LFGA 3TYGL 4X99B 3BXNA 5M94B 1FG9C 3UTZA 4P3DB 1T1WB 4Z7WE 1A7OL 5CZKA 4NWUL 3EDDA 4M7JL 5TE6H 3PF2A 1CICC 4NZUL 4YXLL 4S0SD 1ZGLP 2R2BB 4HFWB 3K0WA 4O4YL 3KPSE 2PW1B 2XKNB 2VLJB 3V6FA 3WFDL 4H1LB 3NA9H 5EU4A 3G6AA 3KDMB 1REIA 5CZVH 5T1MA 1AKJA 3QZWB 2IPTL 1U3ZA 4JAMA 5I30L 1F3DJ 4Q74A 2VLLB 4PRDA 1G6RA 4ALAL 4ISVA 1QQDA 4H0IA 1JZ7A 4TQEH 1YN7A 4L9DA 1FRGH 4YHIB 3TIDB 3MLUL 1GC1C 1YYML 2Y72A 4ZUSB 4PJXE 1MCWW 1JNHB 1TTGA 4GS7C 5D7JC 5ICXA 2EE9A 5J4MA 3UZEA 5FECB 2SEBA 5ESQB 3T8XB 1YEKL 3PQYB 3HZKA 5MERB 2FIRT 4UB0H 3REWB 3GGWB 2CO7B 2HJKA 3OKDB 1KIPB 3OKEA 5HTSA 1RULL 2J8HA 5FUCC 5DK2B 2VDNL 3QDJE 4L1DA 4KJWD 5H94B 4P2RE 3ARRA 1NCDH 3FB5B 5HGHA 2EH8L 1IGCL 3D0VA 3R8BB 1YQVH 1LK2A 4TNWK 4NNXB 4JHAL 1YC8A 2DKUA 3MLXH 2PO6D 2VLRD 3BKML 1A9EB 4OCXL 4OLWH 5IQ9A 3BGMA 5EU7C 4XPTL 2WUCH 3UAJD 1OL0A 3HMXA 4HF5L 1FVDA 2F74A 2VLMD 3STZB 3FKUS 4EQ2A 3PWNB 1XIWA 4YDLB 2FYYB 1CF8H 1HEZA 1YYLH 4ZD3H 5JR1L 2X4UB 2DI9A 4LSRH 3UTTA 4M48L 4LARH 3G6DL 4LCYA 4R0LB 3JVGC 4TSAL 3BDYL 1CLZH 2M1KA 2Z0BA 5GRUL 4LLVA 3B5TA 1ZVSB 4XP1H 2H32A 1QPXA 3OX8A 5ESAB 1BVLA 5EH1A 5DRWB 3NCBB 1D5ZB 4J3VA 2NY1B 1Q72L 1UWGL 4YHKL 2B0SL 4ZSOE 4Z95L 4B0MM 1VFOA 2XRAH 1A14H 3JV0A 4HXBL 3LKOA 1F4YH 4LAQH 5KN5B 5GS2H 2UYLA 3FOMA 4M3KB 5IESL 4KQ4H 2EXWC 1A6ZB 3O11A 4PRIA 4D0DB 4WW2F 3DYOA 5ALBH 5I1DB 5DFTA 5IF0A 4Z7OE 4G8GE 5DSCB 5EN2B 5FYKU 1YNLL 3OKKA 3FN3A 3KAAA 4OF0A 1P7KA 2XQBH 2FH8A 4RGOL 3V0VB 4LPYA 3HC4L 2DQDH 1F58L 2YPLD 3O41B 1BFVH 1W0WB 3LN5B 5EC2B 4CGTA 1A6UL 2A6JA 3ARBD 4EOWH 1OP9A 4JANB 3FZUC 1LP9F 1DQLH 3P40A 4MNHA 3VXMB 4P9MH 1VEOA 4MYWB 4XB7A 3U4EA 2NY6D 2P24B 1WWBX 4MX7B 1JPGA 4QHNA 4LASL 1UM6H 1YDPA 2FB4L 4LSVL 1Y0LB 3SOBH 3KPRA 3FQTB 3QIUD 2Z91A 3R1GL 4OLUH 4I0PC 4EUPG 5D7IB 3U7YL 4JM2D 4LMQI 2JJSA 2IWGA 5C07D 3WD5L 4L8CB 2YUXA 3ULSB 2XICA 4KTYA 1NGXB 2QHRH 4UV4L 4JFZL 5F3HA 4W6WB 1MLCB 1V05A 4W81A 3S3PA 2H2PC 2Y4SA 5K9KB 3H7LA 1HXMB 4PRPD 3P9LA 3L3HB 2ZCLL 4UIMA 2FR4A 2WQRA 2CSPA 2EEBA 3VFNA 4IRSA 1NC4B 1CGVA 5CEYA 2CIKA 4HK0A 3DROA 4AK1A 4ODUA 1FE8H 2V5SA 1R5IA 1DBJL 5TDNB 1BBJA 5BZDB 2G75A 1XCTA 4I18C 1FNEA 4QRUA 2BVQA 1QSFD 2Q1EA 4PJ9A 3VRIB 5KW9L 4NUGH 5C08D 2Z4QB 5DUPH 2KKQA 1A7BA 4LPXA 2VLKB 2XZQL 2FECL 1FNFA 3BW9A 4D3CH 3E8UL 2H9GB 2ZG3A 2E27L 1E4XI 2WBWB 4MB3A 5D72H 3C5ZC 2PR4L 5L8KB 3KYOA 1LEGA 4G3YH 3WLBA 4O2EA 1I9IL 1RZKH 4P23B 2R2HA 3I84A 1FH5L 4NQUA 3LKRA 1KB5B 3G04B 4RGND 5BO1L 1E6OH 2XWTB 4OB5L 4Y4FD 1TZGL 3F7VA 3SKNA 3GK8L 5ALCL 4E41A 2VLRE 3BD5A 5D8JH 2BSTA 3BQUD 4K8RC 2GJZB 3T4YB 1I9JH 3QXUA 2F5AH 4JREC 4GRLB 4IIQB 2X4RB 4IJ3C 4PRAA 1A3RL 4H25B 2IAMA 1YY8B 1OARL 4XPHH 5FO9B 2KPNA 3OR6B 1E27A 5ERWB 1KFAH 4WWKA 1I7TB 3H9HB 4XPAH 2HT4D 4S1RL 3NCFB 2X05A 1TJIL 4DUXA 3AREC 3DMMA 1FNHA 4MMZC 3G5ZA 5E9DA 1MRFH 3DUHA 1R3JA 1K85A 1KG0A 4JFXB 4KKCD 5MP6H 5I19H 4EKXA 1XF4B 1NC2A 4QNPE 3RTQA 2PETA 4RWYL 1RIHH 4GRMA 1FORH 4MXWH 5CBAB 4ODWB 4JFFE 3TPKA 5BXFA 4PGEB 1XZ0A 4X6BB 5C70A 4ZXBB 1DVFB 3T77A 4YFLF 5E5MB 1UC6A 2CDGA 2EC9U 4M62L 5CKAA 4OLEA 5GJTL 5EBWB 5HYJB 3R0MA 3ZYIA 1A2YB 1A6WL 5CGMA 1A3QA 3EFDL 3DLQR 4H20H 3VG0H 3CVHB 4WI2A 4KJQD 4NDMB 4RDQG 2F15A 3ZE1E 5BRZB 1JWUA 1NKRA 1SEBA 5D2LE 2EH7L 1CDGA 2ADJA 1ZT7B 4JRYA 5C0AA 1I1CA 4FQIL 2NTFB 2JCCE 3S35L 4FFYL 3PWPB 1RIVH 4AT6B 1TDQA 3GSOA 1WIOA 2ZG2A 5IMOA 1NCUA 2Y25A 2YPLE 2DDQH 4R7DA 4HZAA 5DD3H 3E6FB 1NUGA 2AKRB 3NZ8B 4HULB 3QFJA 1Q8MA 3C60C 5DD6B 3ESUF 1YEEH 3DX9B 1JWSB 4YX2L 1BIIB 2P7TB 5AAMA 4PV9B 4K23L 1FDLH 4M8QA 3B2VL 1IGFH 4OI8A 2NPLX 1FBIL 5LBSL 3MRMB 3MXWL 1UKQA 1DLFH 4MA8L 2FH6A 1XEDA 4ZNEE 3EOAA 4PJFF 4QTIH 4ZPVB 5E2JA 1VADA 2WK2A 1JPTL 1ZHLA 3MRBB 3BESR 1U58A 4PRPE 3DVGB 5D70L 3WDIA 1ZGLM 1NCNA 4HH9A 4DGYL 5ID0B 1RD6A 4WHYH 4E5XB 3QA3A 1R24B 5KJRL 2PYFA 3CSPA 2O5XL 5E00A 4WV1B 3VXRB 1HYRC 3RWCA 3DTXB 3EYSL 3ILPA 4Z7UE 1QBLH 2YD7A 1KN2H 1QSFE 5JTWA 3A6CL 4IRZL 2X4OB 5BMFH 3KJ6H 3QWQB 1A4KB 1V3MA 4YDVA 4YE4H 5FA4A 3CJJA 4C56E 4P57A 1CXHA 2FX8L 2ICES 4Z7WB 1ZT4A 2WQ8A 2B4CH 3QXWA 3T2NH 7FABL 1TVDA 2FIKA 2CIIB 5BS0D 3MV9A 3VXSD 4RGNE 5IMLA 3BT2H 1Q9KB 5B4MC 1MCDA 2XFXA 1P2CA 4JKWA 4MCZB 5EU6A 4HBQA 3IDGA 3JWOH 2ADFL 2VQUA 2A9MH 1TZHB 2YD1A 4JPIA 3NCJL 3TO4B 3P77B 1F4XH 3OKYA 3L3DA 5DD0H 1K2DA 3MA9L 2FZ3B 3TVMB 4OT1H 5EOCH 4U1GB 1B0RA 4Z7QE 4EI5B 35C8H 3UTOA 4G6KL 4PJXB 3U0TB 1BX2B 3V6ZA 4S1QH 4BH8A 4G6MH 3MRKA 2HRLA 1MNUL 2E8ZA 4PJGF 4XVJH 1QHPA 4PJCF 5E1HB 3QUYB 2H26A 3QDJB 3TFKD 4KK6D 3GBLA 3RY5A 1AXSA 4P2RB 3GSWB 1QLEH 2OL3L 4RMQA 4CADA 5DZLA 2NY5C 4GW5A 4U4BA 3L1OL 3WXWL 2D4DA 2DQTL 2GTZA 3QDAA 5LWYH 4MSWA 3I6GB 1X5IA 2K3TA 1N5YH 5IG7B 5EZJA 4LVNB 5B3JE 4X80L 2ZCKH 3L3KA 3BWAA 2AV7A 3ES6A 2H45A 1YEJL 2ZUQC 4IOIA 4KAQL 3SKJH 4MHHI 3SGDI 2DI7A 3OZ9L 1CLCA 4F9PC 1HOCA 3BUTA 5I76A 2COQA 2MQCA 1EV2E 2E8YA 2N1KA 5FOBB 4MQSB 2GFBA 3HE6D 4DW2L 2FO1A 4IRJA 2CD0A 5GSRA 2FX9L 2AXHA 1HHIB 2BMKA 4NCDA 3HI5L 4OV6F 3BEWA 4Z5RB 3F6LA 3BKJL 1ZLWH 1RI8A 1K4CA 1T66C 2Q20A 4EUPB 3WXVH 3AM8C 1YEHH 4Z78A 3ZKXB 1QFOA 2NX5A 3BEVA 2P46B 3LB6D 2V7HB 5ENWB 1ZLSL 2B1AL 1I1YA 4PRHD 1J10A 2EDNA 1YECH 1G0DA 3AGVA 4Y5XA 3QPQC 4O2FB 4OIAA 2DM7A 1DEEB 3B8YA 2W65B 4B7LA 3IDMA 4DKAA 2GSGB 1HHKA 4HIEB 4FQCL 1AO7D 2DQFA 1NBQA 4QT5A 1RQ5A 2ESVA 3OXRA 3CFDA 4B53A 4YC2C 1MRDL 1T2JA 3D9AH 1QACA 3CLFH 3DV6A 3LZFH 5ITFB 5F6IB 2A77H 3BPLC 3BE1L 3KVQA 4X9IA 1FIGH 1TITA 4JGUA 2J3SA 3FO1A 3V6OC 1MEXL 3WKMH 5BS0E 4WW1A 4QEGA 3VXSE 1QLFA 2GKIA 3IJSB 4KU1A 1FNSH 3OF6A 4MZ3A 5I2IB 4IOFD 4GLRI 3QIWD 4HX1B 3HRZA 4XWOD 5J12C 3T04D 2F8OA 1WZ1L 1UKTA 5DR5L 3PV6A 4JRXD 2AQ1A 3B4NA 3QJHA 5GGQL 3S5LG 5JZ7C 3BZEB 1T03H 4ZOEA 1DQQB 2HVJA 1PG7L 1NKOA 4C58B 1EPFA 4QRRD 4ZQKA 3KR3H 4WTZA 1KELH 2MKWA 1H8SA 3BO8A 4R4ND 1EAPB 4CMMA 4XX1E 1FVCA 1FNLA 5E5RB 5IOPB 4UZGA 5FKPA 5GGSA 4FHBD 3MNZB 5JNYB 1CVSC 5IB3B 4TUKL 4DUWA 1OGAA 1L9MA 4Z6AT 1ZK9A 5E6ID 4H5SB 3M1BA 4OQ1A 1LO0H 2CKBL 4P4KA 2NY2D 2Q7NA 3D18A 1FCCA 2NZ9D 2AJZA 3ZYZA 2XNAB 2HT3D 3SE3A 5DUBB 5DLML 1EEQA 5B8CB 1D3CA 1GGUA 1G9MH 2A9NH 3C5JB 3EOTL 3RRQA 2MOVA 2NXYC 3MUGB 5FDYA 3HZVB 2W9EH 5F7WC 1A0QL 2PO6B 2VLRB 3CUPB 4Q9RH 1XH3B 5DF0A 1NAMH 1A7QL 4NQXB 5JOPD 5IGXH 5EC1B 3W9EB 4AENA 3ULUC 3GSNL 3LV3B 3S36L 4XX1G 4M7KH 4LP4A 1U42A 5FK9B 4PG2C 2WNGA 4EBQH 5F96H 1I3RB 2H8PA 2EO9A 5D1QA 2Y23A 3W9DB 3IFLH 3QG7L 2ZUWA 5TDOB 1LQSR 3S88L 3MGOB 4PJAA 1CBVL 4ZO6A 2FL5B 2JIXD 5DJ8A 4F2MB 2X9WA 4JY5H 3U9PL 2YD5A 4MD0B 2DQJH 1P5UA 1RZJH 3FN9A 3FAWA 2IALB 4P3WA 3OQ3B 1O7SA 2F8XC 3BH9A 5D71H 5C0EB 3MGTB 2RCSL 4MD4A 2HJLB 1QOKA 3PABB 25C8H 4MA7L 1ONQA 5IKCA 4MDJA 3OWEA 4LVOB 2ATKA 4HXAL 3I75B 4OLXH 3RWJA 2QHLA 1S8DA 4R2GD 2I9LA 4HC1L 4EDWH 2Y5TB 5HDBE 4QYOA 1U8JB 5D2LB 1LE5A 4X8XA 3VFTB 3FFDB 5L6YL 4U6HA 3QUZC 4PRHE 5FYLD 3RPIA 3RNKA 3TO2B 2JCCB 4M3JA 3OKNB 4J6RH 1QRKA 3SJVA 5F44A 1JVKA 4GMSH 5IROC 2UWEF 5HDOA 2GSIB 3QQ4A 2EYTB 4JDZB 3MBED 3ARBB 2YBRA 4ONGH 1GOFA 5FM4A 4ZYKB 4DZ8A 1FL3A 1SY6L 4ODSL 1XGPB 1U8IA 3FOLA 4PJ7B 4WJ5B 3P73B 1ZANH 3CVIH 2NY6B 4P5MB 3PWJA 4ZTPL 1OAUL 3HE7D 4F33A 2YUVA 3QCVL 1NCWL 1W2KT 1E4XL 4MXQD 1W72A 2FD6H 3OSKA 4YHML 2F53D 4JM2B 1UWXK 2J8UF 1BQHA 5C07B 4CN1A 3CDFA 1EDQA 3P30L 4X7SH 2BNQD 5JPNB 3D39A 3CDCA 4JRXE 4O51B 1INDH 2VR4A 5BVJA 4PRPB 3MNVB 5FYLL 4PJBE 2BRRH 3Q6GL 1FNGB 4Y19D 3QO0B 5D1XD 3D25B 3NABH 4P46D 5F7EL 3DBXA 4HWNA 3WFBL 5F8QC 3RNQB 4WO4D 2UZIL 4NQVB 4QRRE 3VMPA 3O2VH 5MI0B 2ZCHL 4ORZC 4XRCA 3SGKC 5L0QB 1X7QB 4JPVH 4R6UA 1QSFB 1IQDA 1EO7A 4DAGL 5C08B 1W8NA 1IFHH 3MLZL 3GMPB 3SPVB 3L5JA 5BV7L 1KB5H 2DQHH 3VXNB 2ADIB 4BZ1L 4NQEA 3PP4H 1D5MA 4PGJA 3C08L 4U0RB 5CEXB 1F97A 1LD9A 4WTWA 3WFZA 3ZMRA 1YC7A 2HG5B 2JE8A 2W59A 4RGMB 2VDPH 4Y4FB 1SYSA 2P5WA 3FQNB 2X40A 5BVPH 3BQUB 1EEYA 1T3FB 4YIQA 2J8OA 5JOPE 4UDUA 4LMQE 4MDIA 3RVTC 3BZ4A 1PLGH 2EC9T 1L9NA 3I6LE 4M5ZL 4NZTH 3GSQB 3INUL 3D69B 4LIQH 2UVEA 3RIFF 4RX4A 1AKJD 2GJ6E 1U3HB 4JPWH 2EZ0C 3LAFA 1MCOH 3TBVA 3MZTA 3B83A 5IB1A 3GSUB 3BN9C 1HSAA 1S9KC 4HUWB 2NY4D 1OAKL 5HI3D 5E8OA 3FQUA 5DRNA 3TBSB 1DDHB 2G5RA 3DETC 4X6CF 1RSFA 4ODTH 2ZUXA 4NHUA 3CLEH 1KCUH 4HFUL 4TNVK 3CVHH 4X4ME 4FQ1L 3AUVA 4K7FB 4ODVL 5TQ0H 4YNYB 1OOAA 3U0WL 1D7FA 1WEJL 3D0LA 3KWWA 5FUZH 3FB7A 1B0GB 3DGGA 1FN4A 4HUXB 4KY1H 1MI5E 3VI4E 1QZ1A 4ZS7H 3GI8H 1Q1JH 2KH2B 2UY6A 4P2OA 3DWTA 3LS4H 3NFPB 3DGCR 5F1NA 5FYLE 1QO3A 5EZOH 2MWCA 5C9KA 4YHPA 3MOBL 1A6VL 3P4NB 1LEKB 4EIGB 2EYRB 4DEPC 1BLNB 3P4OB 5B21A 5ETUB 1GIGL 3HUJA 1XIWD 4G6JH 4RQQA 2Q87A 1KXQE 3V5DB 3VE0A 1MWAA 3ARFA 1T21A 3UTTD 3B9EA 1NBVH 2CMRL 2MNUA 2OI9A 1Y6NR 2GY5A 3CZFA 4NBZB 4XNXH 5I16A 4PBXA 4Z18A 3U0PB 2F53E 3TNMA 5LGKA 5HD8C 1NUFA 1NANH 1IGMH 1ZWIA 3IDXH 4IDLA 2YPVL 1OPGL 3MR9A 1LDPH 3MXVH 3N1GC 5KTEH 2XTJD 1KTDB 4QCIB 1F3JB 2R2EA 3WS3A 2I60H 1KT2B 1T20A 1CI5A 1NBYB 4Y19E 3QIBC 4UOW0 2CJUH 4QLRA 3HMXL 5KSAD 4NQDD 3DUSA 3MV8A 3OXSA 2DBLH 5I1IH 4GAJH 1JZ5A 4PRID 4U33A 4W68A 5E99L 3S5LB 3V5KB 1HQ4A 3FQWA 2WZPD 5INDB 3SDDC 4WUUD 3BP7B 3ZTJH 3QUXD 1FZOB 1UJTA 3LIZL 5E1AB 4MVBA 4ONOA 4XWGH 4JJ5B 5HPOA 2WBJA 1BIHA 2W9DH 4L8SC 3IDNB 3EFFA 3ARDC 2C1OA 3D1MC 5FB8A 3B8SA 2B8OT 5JW3H 1LDSA 4BJLA 5C2BL 3TCLA 4FXGA 4OUUA 2AJXH 5BS0B 4YHLH 3L7EB 1TNMA 3VXSB 2A6IB 3O9WA 3GFUA 3KPMA 3NTCL 5C0IB 5ICZA 1KCVL 3QEQA 1BBDH 3VXQB 4LBEB 5FF6A 5I75C 5TFSH 5MEOB 4JG1L 1FZJA 1T1YA 1EUUA 2D7QA 1J8KA 5ADPL 4HJJH 3DRTB 5SWZA 1MCIA 1KJ2H 4DGIL 1Y6MR 4XBEH 5FCSH 1F6AA 2Q8BL 1ORSA 1KEGH 3PWLB 1SJHA 2APFA 1JK8B 4U6TA 1MSPA 1HH9A 1P4BL 1AGFA 4LLQB 3W39A 3TESA 1NBZB 1UT9A 4NN6C 2AEQH 3PHSA 3OJ2C 2P45B 4LU5L 3WYRA 2Q3ZA 1MHHB 4JCLA 3MJ8B 2F9BT 5KVGH 4L8BB 4UAOC 5DJ6B 2FJFA 3RWDB 4FFEX 4RMWA 5IJVA 1WFTA 1OTUC 2FBOJ 2HFTA 4HEPG 4QO1A 2P8LB 3TPUA 5KVFL 3TH2T 1UM4H 1FL5B 2E5EA 3UJJH 1UJ3B 2CK0L 1J8HA 4K94C 4E41D 1OT1A 2IH3B 1KPUA 1GGBH 4X9FA 3UZVB 1X5LA 3P9WB 4NZJA 1TQBB 3TYGH 2OQJA 4ZS6D 2IAMD 3O6ML 5CEZD 8CGTA 5L8LB 5EO1A 1A7OH 2LTQC 4PJ8C 5CZXC 2OXHA 3QUMH 3DMMD 4M7JH 4KTEL 4PJ5A 4NZUH 3UTTE 4QRSB 2YSSB 3EAKA 5FYJH 1R5VA 2XV6B 4LNVA 2V17H 3HE6B 1MHCA 3TT1L 4JZJC 5H2BA 2P1YA 4O4YH 4TVSa 4EUPH 3PL6C 1QP1A 3EKCA 3GJEA 5KOMC 5DRZA 2IPTH 4OJFL 3V52L 1HSBB 2HT2D 4JFOB 1NEUA 5B38G 4H8WC 4GT7A 3ZDYF 4ALAH 1QUNA 4IS6B 3PGFH 4ETQA 2NNAA 1RUML 4U1JA 3U6RB 1P9MC 3C5SA 5K59E 3WO4C 4PRHB 2VDQH 3TZVA 3KHOA 4PRIE 5GRJL 5CEZL 1YEKH 2HA1A 4CUCA 2AABL 3HZMB 4JRYD 1AO7B 4WUUE 1TCRA 3IDYB 3BPCB 2DIAA 3M17A 2Z31D 5J6HA 3S98A 4YPGB 2VKWA 3PDOA 2VDNH 5JHDA 1H0DB 1NDMA 2ITCB 4X6DA 5D96C 1T22A 2IBZX 4WU5A 3VA6A 4AYFA 4JZOA 1CR9H 5FFLA 4FP8L 1XGUA 4R4BA 1IGCH 1YMHA 3L3GA 4ZFFB 4LQ1A 5T1KA 3OAUL 3GI9H 1WAAA 3F58H 1F5WA 5D7SL 3U9UA 4OCXH 2GITB 4XNQA 4XPTH 1XGRA 3QIWB 1AJ7H 2XI9A 1U8HA 2OX5A 4PY7A 1J1PH 4JRXB 4JR9H 3TJEL 1FZMB 3G08B 2YD2A 4DN4L 1EA9C 4PJBB 3HC3L 5J13C 1FYTA 4KWUA 2E9BA 4M9PA 5F1SA 5JR1H 1ZTXL 3GSNB 3QWOB 4M48H 4QRRB 4P5TA 2E7MA 4X6FB 3BDYH 4C83A 1AQKH 1TVHB 2PYEA 5EUOE 3HR5A 4DVRL 1T6WA 1JI2A 1MFCH 4BFIA 2BSSA 3CDGA 3UTSA 3NCYP 4U1KB 2GK0B 4MHHG 2D2OA 2FJHA 5E6IB 5I1AB 1NPUA 4YHKH 4WY7L 3G5YB 4YDLC 5IB5B 5FO8A 2B0SH 4JY4B 4ZUVA 4AEIL 1S7TA 2WINB 2NY2B 4HXBH 5C86A 3EO0B 4EDXA 3RVVC 5IM7A 4FQHA 5EBGA 1AGBB 5IVNA 1IGJB 4R0LC 4LEOB 1BHGA 4GXUN 5D7IF 5IESH 4KI5F 1MH5B 4LKCA 4TSCH 3UTPE 1OB1B 1NMAL 5IBTL 5DJ2B 2WWKO 3PWUA 5JPMA 2DQCL 3EHBC 2NY1C 2JLLA 3O45B 1AD0A 1V3KA 5D5ME 5C09D 1WITA 3C9NA 4F7TA 5EU6D 2D7MA 1JFMA 1Q94B 5CWSA 4E41E 4RGOH 3F7YA 5KVEL 3K80A 3GKZA 3BP6B 3X11A 3V4UL 3C6SB 5D4QA 3BI9X 1A6UH 4NPYA 4JFEA 3WIFA 4F37K 2WMPA 4L9LA 1XF1A 4Q9BA 3U48A 5CEZE 3T0DA 2BY0A 4QRPB 2JIXB 5DD1L 1DSFL 3ISWA 2DKSA 4LASH 4WU7B 5LG1A 3UJTL 1WBYA 3S7GA 1E28B 3T09A 5E6ZA 3R1GH 3ILQD 3RFZC 3U7YH 4MLIA 4LCUA 3X3GL 2J6EA 1B0WA 3WD5H 4DQOH 4JFZH 4HPYL 4PJDB 1U91B 1IM3B 1OY3B 5KG9A 5CJOH 4PRBA 4M1DH 2ZOKA 4RRPG 3MRLB 1OTTD 1MCBA 4F58H 3S3JA 1YJDC 3BKYL 1HZHL 2OXGA 4LLAA 2LAAA 4ERSL 4R2GB 2ICWA 1EO8L 4KH2A 3N1QC 3QXAB 1A6TA 3GO1L 3UEZA 3O6FD 2X1OA 4NQTA 4KI5C 2VZSA 4Q6IB 4GOSA 3RX8A 5IV2B 1CDBA 1GOGA 4YZFE 1AQDB 5E5UB 5J3HC 2KZWA 1MRCH 1NFKA 1P1ZB 1IGYA 5K9OB 1YMMB 4JRYE 5C0AE 5E8NA 1ZLVK 3GSVB 3L3JA 3E8UH 3MBEB 4KK8C 3MRRB 4F9LA 1FVEA 1G7LB 2FGWL 4ZAKA 5JMOC 3CFJB 1I9IH 5J8OA 3VXUD 1FH5H 2DWDB 3S96B 5BV7B 4ESKA 5BO1H 1NMBL 2A0LC 3HE7B 5ALCH 1T5XA 4P59H 1KBGH 4TNWF 4BM7A 1ZT1A 5I1JL 2F53B 5HHOD 2VDLL 5DJAB 1O5DT 4IRJD 2BNQB 5F71A 1U8PA 1A3RH 4HPOH 2M26A 3MRIB 5GSVB 4J8RB 2P42B 1ADQA 4V1DA 1CICA 2NTSP 5BOZG 5GZOD 5DJ0B 3HC0B 4Y19B <